4CYMD

Complex of human varp-ankrd1 with rab32-gppcp
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
167
structure length
167
Chain Sequence
SVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPLHLACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVYYDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKETPLKCALNSKILSVMEAYH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Varp is Recruited on to Endosomes by Direct Interaction with Retromer, Where Together They Function in Export to the Cell Surface.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords RAS-RELATED PROTEIN RAB-32
total genus 55
structure length 167
sequence length 167
chains with identical sequence E, F
ec nomenclature
pdb deposition date 2014-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4cymD00
2B0OE 1QYMA 3UXGA 5CECB 3J5PA 3KEAA 3TWRA 1YCSB 3TWVA 4HRNA 3V2OA 5ENPD 4ZFHA 5AQ9A 4CYMD 4DRXE 4YDYA 5CERB 4HI8A 3ZU7B 1NFIE 4HLLA 4O1OA 3F6QA 1D9SA 4U96D 4CZ2D 3TWUA 3EHRA 3DEPA 4ZHBA 4QQIA 1MX2A 4HB5A 4LSZE 4BETA 2BKKB 2BKGA 4J8YA 1S70B 5AN8A 1A5EA 3Q9NC 4O60A 4U8YD 5AQBA 3D9HA 5JMND 1OY3D 1WDYA 3J5QB 5JA4D 3B7BA 4HI9A 3TWQA 4DX6D 2V5QC 4U8VD 2QYJA 1N0QA 1MX4A 4G8KA 2ZGGA 4GPMA 2JABA 4RLYA 5HS0A 1SVXA 4BSZB 4BESA 4N5QA 4HBDA 1TR4A 4DX2A 5CEAA 1OT8A 1AWCB 1UOHA 3IXEA 4G8LA 3V2XA 4J7WA 3W9GA 5D66A 5HKPA 2Y0BG 1BD8A 2XZDG 3HRAA 2DZOA 4OAVB 1K1BA 2DVWA 5EILA 5ENQD 3ZKJA 5EIDA 1AP7A 4HNAD 3TWXA 4ATZD 4C48B 3UI2A 3B95A 5KNHD 5BXUA 1IKND 3T8KA 4B93B 2XEEA 1BI7B 2VGEA 2ETBA 3LJNA 1BU9A 2FO1E 5ITZF 4HRLA 4LNUD 2P2CP 4HQDA 4TUMA 2XZTG 1DC2A 1N0RA 4HRMB 4UUCA 4K5BA 2F37A 4LG6A 3TWSA 4Z68A 2KXPC 5ENTD 5AARA 4GMRA 4DUIA 5AQAA 4A63B 5CEDB 2DWZA 2XEHA 1N11A 5AAOA 5FINA 3C5RA 1IXVA 1MJ0A 1YYHA 1K3ZD 2PNNA 4K5AB 1DCQA 1YMPA 2RFMA 4DX1A 5ENSD 4BEPA 5HRYA 2F8YA 4OAUC 2J8SD 4F1PA 1MX6A 2MYOA 2NYJA 4QFVA 2ETAA 3TWTA 5CBOA 5EIBE 4F6RD 4K5CA 5EYLA 3T9KA 3V30A 2A5EA 5EN5D 3ZUVB 4JB8P 5CBNA 3NOGD 5ENRD 2RFAA 3UTMA 3Q9UC 1MYOA 3TWWA 4DX5D 2QC9A 2V4HC 3NOCD 5FIOA 5EYPF 2F8XK 2ZGDA 2KBXA 3AJIA 4U95D 2XENA 3V31A 3EU9A 2Y1LE 1BLXB 4O1PA 4YDWA 5ENOD 3SO8A 4DX7D 5KBAA 1G3NB 2L6BA 3EHQA 3JXIA 4BERA 4NIKA 1IHBA 1SW6A 3V79K 1K1AA 2AJAA 3DEOA 5KNGA 3AAAC 3JXJA 5AQ7A 2HE0A 2DZNA 3NBNB 3JUEA 5KWDA 2ETCA 3HG0D 1WG0A 1BI8B 3ZNGA 3W9FA 5BXOA
chains in the Genus database with same CATH superfamily
5A7DB 3ASNE 3Q49B 4AVXA 1YCSB 3TL5A 3LCAA 4ZFHA 4CYMD 4DRXE 4FU3A 3JQ1A 1N54A 4BETA 1X5BA 3FP3A 3D9HA 3NB2A 2AW6A 4MLPA 2HYZA 4G8LA 4A3TA 3ZKJA 4KVMA 1AP7A 5B1BE 3D9PA 2VSNA 2PM7A 2KM4A 3RSEG 4LCTA 3VTXA 4CDMA 2R03A 4FLBA 2ZU6B 1DC2A 2EINE 5ENTD 2FI7A 2ZIRA 4KXKB 4GZ5A 4GTQA 2NYJA 5CMWA 3SFYA 4JB8P 4U63A 3ZW3A 4HVBA 3UTMA 3ZYKA 3ZFWA 3DSTA 4AM9A 3EU5A 3S7BA 2DCPA 4URKA 5FZQA 3BG1B 2J07A 2NSZA 1VDYA 1G3NB 4BERA 5C2YA 5ANLA 3SFXA 1TN7A 1K1AA 3PUKA 2IO3C 4B94A 3W9FA 1SA4A 3UIOC 4JEUA 2OOEA 4I2WA 3FY4A 2EIME 3FUFA 2YQ8A 3DXMG 2HM8A 3CHSA 3MJWA 4WWOA 5FTPA 5FQ6A 5JMND 4I1AA 3TWQA 1HO8A 5HS0A 1HX8A 4GTOA 3G2TA 2WVIA 2XGMA 5BW8C 3ABLE 5BNWA 3UIPC 2J09A 2WXGA 2WQHA 2DZOA 1O5MA 3FUMA 3DSVA 1XNFA 3MV2B 2QFCA 3L08A 3DPDA 2KCLA 1IQUA 2OEWA 4ATGA 3HXBA 1NL4A 1WM5A 1ZBPA 1LTXA 3UT8A 3RIBA 3EIJA 4DLQA 4N2SA 4GZ6A 1E90A 1E8YA 4A1GA 2EIJE 1TEZA 1FVFA 3VLDA 2A5UA 5KJLA 4R7LA 4PUCA 3RJVA 3ZXPA 3MCXA 5ENRD 2GGFA 3MKQB 5LP0A 5DIZA 2WXKA 4C0EA 4DX5D 2QC9A 2AXUA 2Y69E 4WUYA 5BT1A 3L22A 2DYSE 5ENOD 2A4ZA 2L6BA 4JL0A 2L0TB 3CVWA 1NP7A 4LNBA 3S7FA 3D9JA 3KS2A 4L2LA 1SZ9A 3JQ0A 3SF4A 2LSVA 3BQOA 3VLFA 4GTMA 2L6JA 5AN8A 2LAHA 4J0UA 1HFAA 1TJFA 5JA4D 4DJAA 5G05C 5JJTA 4U7EB 1IQRA 3LY7A 4I9EA 4OVUA 3NAWA 4HFGA 2I2OA 2KCVA 1E96B 2GW1A 3E32A 3MA5A 2R02A 2KXPC 2CFZA 1N52A 4CDNA 3LJ3A 1U3CA 2GRLA 2RKKA 3ASOE 4JD2G 4K5AB 3B7RL 1MX6A 4CRWA 3CSTA 1KPSB 5EX0A 4KYOB 3PZ4A 4P29A 4TRQA 3T9KA 4F7AA 3QK0A 1N4RA 2IOSA 1XGWA 3VLEA 3AJIA 3CSFA 3CVYA 4BTAA 4L7TA 3EHQA 1IHBA 3TJPA 2KCKA 2RG8A 3AAAC 2IO2C 2VSYA 3PH0C 5BUZA 4BX9A 3SI5A 5CECB 1BPOA 4EQFA 3S7DA 2NXPA 1E7UA 5JHAA 4HLEA 5AJLA 4IRUA 1ELRA 2WXQA 3ZYMA 1D8EA 3JUIA 3ZPJA 2X6JA 3QKYA 4XIFA 1A5EA 3Q9NC 5AQBA 3B7BA 2CHWA 3DPYA 4GMLA 4RLYA 1SVXA 2VJ8A 4AJWA 4BESA 1AWCB 4DX2A 3E4BA 4U04A 4Q69A 1BD8A 3PEUB 1ZU2A 4N2QA 4UQZA 3TWXA 2FO7A 2QYUA 3PS6A 1Z6TA 3IEGA 2RD0A 4EECA 3PVLA 3LY9A 4LRZA 3D3MA 3X2QE 3C98A 4F1PA 4ACKA 5KJNA 2X6IA 1OWPA 4BWRA 2P9KG 2GRPB 4K5CA 1WAO1 2I9CA 4HXIA 4TXRA 3URZA 3R7RA 1MYOA 3G2WA 2IQCA 5FIOA 4LNGA 4DPRA 2GRNB 3SY2A 4CCAA 2H6GA 4I6GA 3HXFA 3R7QA 2C0MA 2IF4A 4NACA 3UUXA 5IY5E 3MYVA 4JEHA 4JZYA 4YDEA 3KSQA 4OYSA 2VGXB 2DBAA 1TN6A 3ZHEB 4GZCA 4ANUA 4GZ3A 4EZKA 2YINA 3T5XA 3FUHA 4CT0A 2XGOA 2R05A 4NRHB 4JHKA 3U66A 4J8SA 3G2SA 4CDRA 1S63A 3IXEA 2XRZA 4OAVB 2GRRB 3FTYA 4B8CB 3FUKA 3T8KA 2WMOA 1P5QA 2AVPA 2R5SA 3R9AB 2M63A 5CRUA 4LG6A 2WXHA 3UMVA 2WXOA 2LUHA 2F0YA 5FWQA 1DCQA 4IULA 2J9QA 1NA0A 2ETAA 3D9KA 1JUQA 3OTNA 4AP2A 5FQ4A 1B89A 3G2UA 1DCEA 4J6IA 1H2VC 1LD8A 3KD7A 4TV3A 4EZJA 2ZGDA 1KLXA 3CVUA 3ABME 4G2VA 4WNFA 2QY7A 4NURA 3IHYA 2ONDA 3IBEA 2P58C 4GTSA 3OXLA 3HXEA 2Q7FA 3FU6A 3DBSA 3DSXA 1HS6A 2JLBA 3WG7E 3K9IA 2L9BA 4HI8A 3MX3A 3HVEB 4HORA 4AEZC 3MV3B 4W9RA 5LCWC 5G05J 4ANXA 1HH8A 3E34A 4GTRA 5LOZA 3FTSA 3PRZA 1O1RA 4N5CA 1UOHA 2YHEA 5HKPA 4EPZA 2X6HA 2XZDG 3AU5A 3EHMA 5EKQD 3ZHEA 1K1BA 3D9LA 2UY1A 3ABKE 2VGEA 4PS3A 1BU9A 5D0QD 2P2CP 3AS8A 1QNFA 5ARFA 3PDNA 5CEDB 5J90A 2DWZA 3ZRHA 5FINA 5G2NA 4BT8A 1YYHA 4J8DA 2I1JA 4BEPA 1FVHA 3Q15A 3QOUA 1OCZE 3V30A 4GMJA 3LY8A 4FJZA 2RFAA 2HO1A 3SBSA 4E85A 5T4YA 3DSSA 3PREA 2KBXA 1HU3A 2XS8A 1LD7A 1EDUA 2KZTA 4GTVA 5D0OD 4XEIG 1HXIA 5JHBA 1SW6A 2HE0A 2BUGA 2OV8A 3CVVA 1RW2A 3B13A 3T8MA 2PQRA 3IV0A 5CCMA 4UWKA 1JPLA 4U96D 3TXMA 3TWUA 5EX3A 4Q96A 4UWGA 5J08A 4UQYA 2XHEA 2BKGA 1S70B 2P9PG 2XPIA 3LKUA 1JWGA 4U8YD 4RG9A 3FTVA 4MS6A 1WDYA 3ISMC 2VYIA 5CMYA 1O1TA 3Q73A 4IYPA 4HBDA 3V2XA 4I6EA 3C3OA 3FU5A 2XEEA 3PZ2A 4O6FA 5C1DA 3GZ1A 3FH7A 3EDTB 3E33A 3LXUX 4FHKA 1N11A 2OEVA 4GZDA 2PNNA 4AV7A 3AU4A 5HRYA 2X38A 3ASDA 3RK6A 3GZSA 3QAQA 4U8HA 4AY6A 4GAAA 4TUUA 2C2LA 3KAEA 1SQMA 3UT4A 1WY6A 2ZXWE 4N3AA 1Y6IA 4BX8A 4ILHB 4K0RA 3CQGB 1BLXB 2EQXA 3LVRE 3ZYLA 2J4DA 3HVEA 3ZNGA 1TJCA 3CVXA 2V4LA 4OVVA 3FUNA 3J5PA 2R59A 1SA5A 1TNYA 4WWNA 3ZU7B 4O1OA 1N4PA 1NA3A 3UX4A 4U0UA 3MKRA 4HOUA 3ULEG 1UJJA 4J8EA 4HOTA 3D9IA 2EILE 2XGSA 2V5QC 4KT6B 2QYJA 1OWOA 3FUJA 4N5QA 4J7WA 3RRUA 4PS8A 3HRAA 3LS8A 3AG2E 1N9AA 5KNHD 1PAQA 4ILGA 3JCKC 1OWLA 5FQ7A 3TWSA 4GA0A 4Z68A 2P9NG 2V8SE 2FF4A 1TNBA 1YA0A 2IY0C 5ARGA 1Z5SC 4DX6D 1YMPA 2RFMA 1Q2ZA 3HXCA 4QFVA 4B89A 3CVLA 1A17A 4Y6WA 2WXNA 3ENEA 3RAUA 2Y4TA 3TG4A 3FUDA 1OUVA 3OXGA 3Q4AB 4APFA 3NOCD 3EUVA 5DBKA 4F1SA 3L54A 3ONLA 3SO8A 3JXIA 3O4ZA 2DYRE 3SD5A 3PNLB 2HR2A 2X6KA 3LVQE 3ESLA 3I3NA 3FH8A 4I9CA 4MKTA 4HRNA 3SNXA 2VQ2A 4G1TA 2AXVA 4APOA 3SGHA 1GW6A 5G04C 4CZ2D 5H7PA 2R17C 2CHZA 3RU0A 4J8YA 2WXRA 1DVPA 4A3VA 3AS4A 2L0IA 1IHGA 4UI9K 3JYSA 4GYOA 4G11A 3ML9A 5ANRA 4A55A 1RZ4A 4FHJA 3CKCA 2E0IA 2VTBB 1TNUA 1DNPA 4GCNA 3C3RA 5G55A 4TUMA 1D8DA 3EJNA 3I4GA 5AARA 4DUIA 4MRUA 3CHPA 3CLJA 4DI4A 1K3ZD 1UN9A 3U4TA 4UQXA 4U0ZA 3TWTA 5LCWJ 5EIBE 2LXLA 2CFUA 5BV0A 3FHEA 5FQ8A 3AG4E 4RQIA 3Q7FA 4KBQA 3PEVB 4V3IA 2XENA 5ENNA 4O1PA 4ME2A 3QWVA 1PC2A 1KZOA 1HF8A 3FU3A 2LXMA 3HIZA 1WG0A 1OWNA 2Y3AA 3HDXA 4KMOA 1HG5A 4YVQC 2MRIA 3KEAA 4LUNU 3TWVA 3V2OA 2VGYA 4IN3B 5KCMA 3RKVA 2OVFA 1NFIE 1TN8A 1D9SA 5T8IA 1EYHA 3DEPA 4ZHBA 4D10C 1MX2A 4HB5A 1EF1C 3ZVVA 4B0ZA 2WPVA 3G2VA 4UI9J 4GTPA 3CR3A 3FU0A 4I2ZA 4G24A 2FEZA 3FTWA 3CVNA 3D9OA 3PE3A 1OT8A 4EZLA 3UM2A 4MBGA 3L16A 2J49A 2IONA 2DVWA 4GTTA 5ENQD 5LFAA 3HYMB 1LF8A 3CK8A 3LEWA 1IKND 1BI7B 1PY1A 5A23A 4JPSA 4HRMB 4A1SA 5KJKA 3TGOA 4ANWA 1MHQA 4DX1A 4WNDA 2P9SG 4YNDA 2IEJA 3SQVA 2ILRA 3APDA 2A5EA 3GZ2A 4XI0A 5EN5D 3ZUVB 5CBNA 3NOGD 5B1AE 3SFZA 3UM3A 3PUJA 3QNKA 2FBNA 2LNIA 1NI1A 3ZN3A 4FULA 3C72A 3FUEA 2AJAA 1KT1A 4JHRA 5BXOA 3BG0B 1E8WA 3C3QA 3L9TA 2UY1B 1OCRE 3UKUG 4AIFA 4AXHA 3TG5A 3E37A 3ESKA 5JJ7A 2X3MA 4CGWA 3D9MA 2J4BA 5FZRA 4ANVA 2KATA 3J5QB 3UT7A 3ZGQA 3LDZA 2H6HA 3ASFA 2MOWA 5AENA 5EIDA 3OAWA 4F53A 1MZCA 4XKCA 4L23A 4I17A 2XCBA 2ETBA 3SBTB 3CHRA 4HQDA 3AS5A 1ELWA 3CK9A 5AAOA 1FPPA 5CHEE 2WM9A 2LSUA 5FJYA 4BTBA 4UI9C 4OAUC 2J8SD 2WB2A 4FC8A 2NC9A 5EYLA 3T5VA 5T3RA 3GW4A 4U0SA 2P9LG 3TWWA 2V4HC 4BY6A 3AG1E 2Y1LE 4G23A 4YDWA 2X6FA 1N4SA 3FEXA 1IYGA 3V79K 4L1BA 3NBNB 3JUEA 2I6HA 4Y6CA 4YDOA 4XX5A 4GCOA 3UXGA 2CG3A 3B7SA 1H2UA 3RRNB 3FULA 5CERB 4HLLA 3UPVA 3F6QA 3OXFA 3EHRA 3PZ3A 3HHMA 5BV1A 3KEZA 1HE8A 2R2LA 4O60A 3FTUA 4I1MA 3O48A 1N0QA 1MX4A 5FT9A 1NZNA 2JABA 5HQ8A 1KT0A 2YNQA 2OVBA 2BTDA 5E75A 4HNAD 4C48B 1JCQA 3FWVA 2FO1E 4ABNA 2XZTG 3E30A 1H0AA 4C9BB 4GYYA 5JJ6A 4CGVA 2GRQB 3C5RA 1IXVA 3Q47B 2WXFA 4WWPA 4WNEA 4ACLA 3Q78A 3FEYA 3SZ7A 2PL2A 4I1OB 3BEEA 3MEKA 3CKBA 1HZ4A 2WXLA 4L2YA 1Z3YA 2IOLA 3V31A 3LYAA 4DX7D 3L82A 2LO6A 3RRMB 4AOFA 4BFRA 1UW4B 2WQ6A 2CG2A 3I4RB 1BI8B 2UWJG 2F8XK 2B0OE 1QYMA 2P9IG 3TWRA 4RVBA 5AJDA 3APFA 3DSWA 3CHOA 3Q7AA 3WXXA 2J08A 3D9NA 4NQ0A 3QWPA 4AY5A 4JHJA 3RO3A 1U3DA 5CRVA 2KZTB 3TAXA 1L5JA 4G8KA 3CIAA 2KC7A 3U3WA 2WXJA 3IHVA 3W9GA 2Y0BG 4H7XA 3FTZA 4PH4B 3I5PA 4RSYA 1OXJA 4HRLA 2XRYA 2XEVA 3Q79A 4L9PA 1JWFA 3BUAA 4XKBA 4GMRA 3NQPA 5AQAA 4HOQA 5AIJA 4I6JA 4GPKA 2XPYA 3EIQC 5AYWD 2F8YA 1K8KG 3UQ3A 2MYOA 1OCCE 3CK7A 1QQEA 3GYZA 4JA7A 3UM1A 5BPPA 3ML8A 3U64A 4EBAG 3CEQA 2OCCE 2VSOE 2WXIA 3ZEFA 1OCOE 3DEOA 4JC8A 2V5FA 3VTYA 3NZSA 2CHXA 5ENPD 4PDXA 2LAIA 3CGHA 5LX8A 1UG3A 4BT9A 1Z3XA 4QQIA 3N71A 4LSZE 1QZ2A 4GA1A 1OY3D 4FADA 3PZDA 3FTXA 2ZGGA 1ELKA 5CEAA 1X81A 3CV0A 2BF0X 3S2AA 3NF1A 4U07A 3CQCB 1QBQA 3CVQA 3PZ1A 4BSXA 2I1KA 3P1UA 3UI2A 2E2EA 4KZ0A 2XPZA 5D2MC 2VTBA 2Y4UA 2GROB 4E6HA 3APCA 4N3BA 3FH5A 1FCHA 4LNUD 2H6IA 1N0RA 3UINC 4K5BA 3QB2A 4DI3A 4K03A 4A63B 4G25A 1EPUA 1MJ0A 1N94A 4UWLA 2DIWA 3ULQA 5EDSA 3QARA 5CBOA 2XCCA 3MKQA 2V0PA 1H6OA 1FT2A 2WXMA 3MZLB 3FDHA 1Y8MA 4ILIA 4X8QA 5KBAA 3QC1A 2FULA 2GRMA 4NIKA 4M7CA 4YVOA 2P9UG 4FP7A 3DSUA 4XZ4A 2DZNA 3CHMA 1SZAA 2B6CA 5A6CA 3ZIMA 3KSLA 2PM6A 1JCSA 3L13A 3UKRG 2AXZA 3DWLG 5AQ9A 1UN8A 3ZXSA 1H2TC 2XS1A 2IFUA 1FT1A 4WAFA 4F3VA 2BKKB 1V54E 4HI9A 4UWHA 4U8VD 3LPZA 2IJGX 3AG3E 2PZIA 4DLOA 1TR4A 3NZUA 4GA2A 3L17A 2ZISA 4ATZD 4H7YA 3B95A 4B93B 5HI7A 4Q94A 3LJNA 1MQSA 3HXDA 5ITZF 3ONKA 2F37A 4FLHA 3CVPA 3B7UX 4FA6A 4TXQA 2XEHA 4LERA 3Q5MA 2MHKA 3ASHA 1JCRA 1E8ZA 3BU8A 1U2VG 2H6FA 1V55E 3ZYQA 3R9MA 3ASGA 4XE0A 4HS2A 4JW1A 2EIKE 3Q9UC 3MGBA 2C0LA 4GU5A 4CEMA 4U95D 1TNOA 4HOSA 4GYWA 4EBAA 4M3OA 3QJZA 3JXJA 2ETCA 3HG0D 4J8FA 3P2BA 2BEDA 1HG2A 3FFLA 1S0PA 4RG6A 2VSXE 1N95A 1TYQG 4UWFA 4G26A 4YDYA 5B3SE 4XI9A 1E8XA 3EHNA 5KJMA 2WQ7A 5CCLA 2JEKA 4B8AA 3B7TA 4CT4A 1OWMA 4TXPA 5E76A 2VGXA 3PNTB 4KZCA 1H19A 1N4QA 4GPMA 2PQNA 2YHCA 4BSZB 4C0MA 3UM0A 5M72A 2IU1A 5D66A 4LEUA 1KZPA 1ZB1A 5G04J 4DK5A 1H6PA 5EILA 1TNZA 5BXUA 1W3BA 3RO2A 1UJKA 3DRAA 1H6KA 4I43A 1E7VA 4EHMA 4UUCA 2WMNA 3Q75A 3CHQA 3ULYA 4JVSA 2WXPA 4N3CA 5ENSD 5FZSA 2AWIA 3SHFA 3S7JA 4F6RD 2XQ0A 4PS7A 4WNGA 4KVOA 1S64A 2QZAA 3IKOB 3QWWA 4FJYA 1O1SA 5EYPF 1INZA 3L6AA 3PE4A 4N39A 3EU9A 3U9WA 3DXKG 4JXTA 4JA9A 3FUIA 4GB9A 3TXNA 5KNGA 3QDNA 5AQ7A 5KWDA
chains in the Genus database with same CATH topology
2B0OE 1QYMA 3UXGA 5CECB 3J5PA 3KEAA 3TWRA 1YCSB 3TWVA 4HRNA 3V2OA 5ENPD 4ZFHA 5AQ9A 4CYMD 4DRXE 4YDYA 5CERB 4HI8A 3ZU7B 1NFIE 4HLLA 4O1OA 3F6QA 1D9SA 4U96D 4CZ2D 3TWUA 3EHRA 3DEPA 4ZHBA 4QQIA 1MX2A 4HB5A 4LSZE 4BETA 2BKKB 2BKGA 4J8YA 1S70B 5AN8A 1A5EA 3Q9NC 4O60A 4U8YD 5AQBA 3D9HA 5JMND 1OY3D 1WDYA 3J5QB 5JA4D 3B7BA 4HI9A 3TWQA 4DX6D 2V5QC 4U8VD 2QYJA 1N0QA 1MX4A 4G8KA 2ZGGA 4GPMA 2JABA 4RLYA 5HS0A 1SVXA 4BSZB 4BESA 4N5QA 4HBDA 1TR4A 4DX2A 5CEAA 1OT8A 1AWCB 1UOHA 3IXEA 4G8LA 3V2XA 4J7WA 3W9GA 5D66A 5HKPA 2Y0BG 1BD8A 2XZDG 3HRAA 2DZOA 4OAVB 1K1BA 2DVWA 5EILA 5ENQD 3ZKJA 5EIDA 1AP7A 4HNAD 3TWXA 4ATZD 4C48B 3UI2A 3B95A 5KNHD 5BXUA 1IKND 3T8KA 4B93B 2XEEA 1BI7B 2VGEA 2ETBA 3LJNA 1BU9A 2FO1E 5ITZF 4HRLA 4LNUD 2P2CP 4HQDA 4TUMA 2XZTG 1DC2A 1N0RA 4HRMB 4UUCA 4K5BA 2F37A 4LG6A 3TWSA 4Z68A 2KXPC 5ENTD 5AARA 4GMRA 4DUIA 5AQAA 4A63B 5CEDB 2DWZA 2XEHA 1N11A 5AAOA 5FINA 3C5RA 1IXVA 1MJ0A 1YYHA 1K3ZD 2PNNA 4K5AB 1DCQA 1YMPA 2RFMA 4DX1A 5ENSD 4BEPA 5HRYA 2F8YA 4OAUC 2J8SD 4F1PA 1MX6A 2MYOA 2NYJA 4QFVA 2ETAA 3TWTA 5CBOA 5EIBE 4F6RD 4K5CA 5EYLA 3T9KA 3V30A 2A5EA 5EN5D 3ZUVB 4JB8P 5CBNA 3NOGD 5ENRD 2RFAA 3UTMA 3Q9UC 1MYOA 3TWWA 4DX5D 2QC9A 2V4HC 3NOCD 5FIOA 5EYPF 2F8XK 2ZGDA 2KBXA 3AJIA 4U95D 2XENA 3V31A 3EU9A 2Y1LE 1BLXB 4O1PA 4YDWA 5ENOD 3SO8A 4DX7D 5KBAA 1G3NB 2L6BA 3EHQA 3JXIA 4BERA 4NIKA 1IHBA 1SW6A 3V79K 1K1AA 2AJAA 3DEOA 5KNGA 3AAAC 3JXJA 5AQ7A 2HE0A 2DZNA 3NBNB 3JUEA 5KWDA 2ETCA 3HG0D 1WG0A 1BI8B 3ZNGA 3W9FA 5BXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B0O E;  1QYM A;  3UXG A;  5CEC B;  3J5P A;  3KEA A;  3TWR A;  1YCS B;  3TWV A;  4HRN A;  3V2O A;  5ENP D;  4ZFH A;  5AQ9 A;  4CYM D;  4DRX E;  4YDY A;  5CER B;  4HI8 A;  3ZU7 B;  1NFI E;  4HLL A;  4O1O A;  3F6Q A;  1D9S A;  4U96 D;  4CZ2 D;  3TWU A;  3EHR A;  3DEP A;  4ZHB A;  4QQI A;  1MX2 A;  4HB5 A;  4LSZ E;  4BET A;  2BKK B;  2BKG A;  4J8Y A;  1S70 B;  5AN8 A;  1A5E A;  3Q9N C;  4O60 A;  4U8Y D;  5AQB A;  3D9H A;  5JMN D;  1OY3 D;  1WDY A;  3J5Q B;  5JA4 D;  3B7B A;  4HI9 A;  3TWQ A;  4DX6 D;  2V5Q C;  4U8V D;  2QYJ A;  1N0Q A;  1MX4 A;  4G8K A;  2ZGG A;  4GPM A;  2JAB A;  4RLY A;  5HS0 A;  1SVX A;  4BSZ B;  4BES A;  4N5Q A;  4HBD A;  1TR4 A;  4DX2 A;  5CEA A;  1OT8 A;  1AWC B;  1UOH A;  3IXE A;  4G8L A;  3V2X A;  4J7W A;  3W9G A;  5D66 A;  5HKP A;  2Y0B G;  1BD8 A;  2XZD G;  3HRA A;  2DZO A;  4OAV B;  1K1B A;  2DVW A;  5EIL A;  5ENQ D;  3ZKJ A;  5EID A;  1AP7 A;  4HNA D;  3TWX A;  4ATZ D;  4C48 B;  3UI2 A;  3B95 A;  5KNH D;  5BXU A;  1IKN D;  3T8K A;  4B93 B;  2XEE A;  1BI7 B;  2VGE A;  2ETB A;  3LJN A;  1BU9 A;  2FO1 E;  5ITZ F;  4HRL A;  4LNU D;  2P2C P;  4HQD A;  4TUM A;  2XZT G;  1DC2 A;  1N0R A;  4HRM B;  4UUC A;  4K5B A;  2F37 A;  4LG6 A;  3TWS A;  4Z68 A;  2KXP C;  5ENT D;  5AAR A;  4GMR A;  4DUI A;  5AQA A;  4A63 B;  5CED B;  2DWZ A;  2XEH A;  1N11 A;  5AAO A;  5FIN A;  3C5R A;  1IXV A;  1MJ0 A;  1YYH A;  1K3Z D;  2PNN A;  4K5A B;  1DCQ A;  1YMP A;  2RFM A;  4DX1 A;  5ENS D;  4BEP A;  5HRY A;  2F8Y A;  4OAU C;  2J8S D;  4F1P A;  1MX6 A;  2MYO A;  2NYJ A;  4QFV A;  2ETA A;  3TWT A;  5CBO A;  5EIB E;  4F6R D;  4K5C A;  5EYL A;  3T9K A;  3V30 A;  2A5E A;  5EN5 D;  3ZUV B;  4JB8 P;  5CBN A;  3NOG D;  5ENR D;  2RFA A;  3UTM A;  3Q9U C;  1MYO A;  3TWW A;  4DX5 D;  2QC9 A;  2V4H C;  3NOC D;  5FIO A;  5EYP F;  2F8X K;  2ZGD A;  2KBX A;  3AJI A;  4U95 D;  2XEN A;  3V31 A;  3EU9 A;  2Y1L E;  1BLX B;  4O1P A;  4YDW A;  5ENO D;  3SO8 A;  4DX7 D;  5KBA A;  1G3N B;  2L6B A;  3EHQ A;  3JXI A;  4BER A;  4NIK A;  1IHB A;  1SW6 A;  3V79 K;  1K1A A;  2AJA A;  3DEO A;  5KNG A;  3AAA C;  3JXJ A;  5AQ7 A;  2HE0 A;  2DZN A;  3NBN B;  3JUE A;  5KWD A;  2ETC A;  3HG0 D;  1WG0 A;  1BI8 B;  3ZNG A;  3W9F A;  5BXO A; 
#chains in the Genus database with same CATH topology
 5A7D B;  3ASN E;  3Q49 B;  4AVX A;  1YCS B;  3TL5 A;  3LCA A;  4ZFH A;  4CYM D;  4DRX E;  4FU3 A;  3JQ1 A;  1N54 A;  4BET A;  1X5B A;  3FP3 A;  3D9H A;  3NB2 A;  2AW6 A;  4MLP A;  2HYZ A;  4G8L A;  4A3T A;  3ZKJ A;  4KVM A;  1AP7 A;  5B1B E;  3D9P A;  2VSN A;  2PM7 A;  2KM4 A;  3RSE G;  4LCT A;  3VTX A;  4CDM A;  2R03 A;  4FLB A;  2ZU6 B;  1DC2 A;  2EIN E;  5ENT D;  2FI7 A;  2ZIR A;  4KXK B;  4GZ5 A;  4GTQ A;  2NYJ A;  5CMW A;  3SFY A;  4JB8 P;  4U63 A;  3ZW3 A;  4HVB A;  3UTM A;  3ZYK A;  3ZFW A;  3DST A;  4AM9 A;  3EU5 A;  3S7B A;  2DCP A;  4URK A;  5FZQ A;  3BG1 B;  2J07 A;  2NSZ A;  1VDY A;  1G3N B;  4BER A;  5C2Y A;  5ANL A;  3SFX A;  1TN7 A;  1K1A A;  3PUK A;  2IO3 C;  4B94 A;  3W9F A;  1SA4 A;  3UIO C;  4JEU A;  2OOE A;  4I2W A;  3FY4 A;  2EIM E;  3FUF A;  2YQ8 A;  3DXM G;  2HM8 A;  3CHS A;  3MJW A;  4WWO A;  5FTP A;  5FQ6 A;  5JMN D;  4I1A A;  3TWQ A;  1HO8 A;  5HS0 A;  1HX8 A;  4GTO A;  3G2T A;  2WVI A;  2XGM A;  5BW8 C;  3ABL E;  5BNW A;  3UIP C;  2J09 A;  2WXG A;  2WQH A;  2DZO A;  1O5M A;  3FUM A;  3DSV A;  1XNF A;  3MV2 B;  2QFC A;  3L08 A;  3DPD A;  2KCL A;  1IQU A;  2OEW A;  4ATG A;  3HXB A;  1NL4 A;  1WM5 A;  1ZBP A;  1LTX A;  3UT8 A;  3RIB A;  3EIJ A;  4DLQ A;  4N2S A;  4GZ6 A;  1E90 A;  1E8Y A;  4A1G A;  2EIJ E;  1TEZ A;  1FVF A;  3VLD A;  2A5U A;  5KJL A;  4R7L A;  4PUC A;  3RJV A;  3ZXP A;  3MCX A;  5ENR D;  2GGF A;  3MKQ B;  5LP0 A;  5DIZ A;  2WXK A;  4C0E A;  4DX5 D;  2QC9 A;  2AXU A;  2Y69 E;  4WUY A;  5BT1 A;  3L22 A;  2DYS E;  5ENO D;  2A4Z A;  2L6B A;  4JL0 A;  2L0T B;  3CVW A;  1NP7 A;  4LNB A;  3S7F A;  3D9J A;  3KS2 A;  4L2L A;  1SZ9 A;  3JQ0 A;  3SF4 A;  2LSV A;  3BQO A;  3VLF A;  4GTM A;  2L6J A;  5AN8 A;  2LAH A;  4J0U A;  1HFA A;  1TJF A;  5JA4 D;  4DJA A;  5G05 C;  5JJT A;  4U7E B;  1IQR A;  3LY7 A;  4I9E A;  4OVU A;  3NAW A;  4HFG A;  2I2O A;  2KCV A;  1E96 B;  2GW1 A;  3E32 A;  3MA5 A;  2R02 A;  2KXP C;  2CFZ A;  1N52 A;  4CDN A;  3LJ3 A;  1U3C A;  2GRL A;  2RKK A;  3ASO E;  4JD2 G;  4K5A B;  3B7R L;  1MX6 A;  4CRW A;  3CST A;  1KPS B;  5EX0 A;  4KYO B;  3PZ4 A;  4P29 A;  4TRQ A;  3T9K A;  4F7A A;  3QK0 A;  1N4R A;  2IOS A;  1XGW A;  3VLE A;  3AJI A;  3CSF A;  3CVY A;  4BTA A;  4L7T A;  3EHQ A;  1IHB A;  3TJP A;  2KCK A;  2RG8 A;  3AAA C;  2IO2 C;  2VSY A;  3PH0 C;  5BUZ A;  4BX9 A;  3SI5 A;  5CEC B;  1BPO A;  4EQF A;  3S7D A;  2NXP A;  1E7U A;  5JHA A;  4HLE A;  5AJL A;  4IRU A;  1ELR A;  2WXQ A;  3ZYM A;  1D8E A;  3JUI A;  3ZPJ A;  2X6J A;  3QKY A;  4XIF A;  1A5E A;  3Q9N C;  5AQB A;  3B7B A;  2CHW A;  3DPY A;  4GML A;  4RLY A;  1SVX A;  2VJ8 A;  4AJW A;  4BES A;  1AWC B;  4DX2 A;  3E4B A;  4U04 A;  4Q69 A;  1BD8 A;  3PEU B;  1ZU2 A;  4N2Q A;  4UQZ A;  3TWX A;  2FO7 A;  2QYU A;  3PS6 A;  1Z6T A;  3IEG A;  2RD0 A;  4EEC A;  3PVL A;  3LY9 A;  4LRZ A;  3D3M A;  3X2Q E;  3C98 A;  4F1P A;  4ACK A;  5KJN A;  2X6I A;  1OWP A;  4BWR A;  2P9K G;  2GRP B;  4K5C A;  1WAO 1;  2I9C A;  4HXI A;  4TXR A;  3URZ A;  3R7R A;  1MYO A;  3G2W A;  2IQC A;  5FIO A;  4LNG A;  4DPR A;  2GRN B;  3SY2 A;  4CCA A;  2H6G A;  4I6G A;  3HXF A;  3R7Q A;  2C0M A;  2IF4 A;  4NAC A;  3UUX A;  5IY5 E;  3MYV A;  4JEH A;  4JZY A;  4YDE A;  3KSQ A;  4OYS A;  2VGX B;  2DBA A;  1TN6 A;  3ZHE B;  4GZC A;  4ANU A;  4GZ3 A;  4EZK A;  2YIN A;  3T5X A;  3FUH A;  4CT0 A;  2XGO A;  2R05 A;  4NRH B;  4JHK A;  3U66 A;  4J8S A;  3G2S A;  4CDR A;  1S63 A;  3IXE A;  2XRZ A;  4OAV B;  2GRR B;  3FTY A;  4B8C B;  3FUK A;  3T8K A;  2WMO A;  1P5Q A;  2AVP A;  2R5S A;  3R9A B;  2M63 A;  5CRU A;  4LG6 A;  2WXH A;  3UMV A;  2WXO A;  2LUH A;  2F0Y A;  5FWQ A;  1DCQ A;  4IUL A;  2J9Q A;  1NA0 A;  2ETA A;  3D9K A;  1JUQ A;  3OTN A;  4AP2 A;  5FQ4 A;  1B89 A;  3G2U A;  1DCE A;  4J6I A;  1H2V C;  1LD8 A;  3KD7 A;  4TV3 A;  4EZJ A;  2ZGD A;  1KLX A;  3CVU A;  3ABM E;  4G2V A;  4WNF A;  2QY7 A;  4NUR A;  3IHY A;  2OND A;  3IBE A;  2P58 C;  4GTS A;  3OXL A;  3HXE A;  2Q7F A;  3FU6 A;  3DBS A;  3DSX A;  1HS6 A;  2JLB A;  3WG7 E;  3K9I A;  2L9B A;  4HI8 A;  3MX3 A;  3HVE B;  4HOR A;  4AEZ C;  3MV3 B;  4W9R A;  5LCW C;  5G05 J;  4ANX A;  1HH8 A;  3E34 A;  4GTR A;  5LOZ A;  3FTS A;  3PRZ A;  1O1R A;  4N5C A;  1UOH A;  2YHE A;  5HKP A;  4EPZ A;  2X6H A;  2XZD G;  3AU5 A;  3EHM A;  5EKQ D;  3ZHE A;  1K1B A;  3D9L A;  2UY1 A;  3ABK E;  2VGE A;  4PS3 A;  1BU9 A;  5D0Q D;  2P2C P;  3AS8 A;  1QNF A;  5ARF A;  3PDN A;  5CED B;  5J90 A;  2DWZ A;  3ZRH A;  5FIN A;  5G2N A;  4BT8 A;  1YYH A;  4J8D A;  2I1J A;  4BEP A;  1FVH A;  3Q15 A;  3QOU A;  1OCZ E;  3V30 A;  4GMJ A;  3LY8 A;  4FJZ A;  2RFA A;  2HO1 A;  3SBS A;  4E85 A;  5T4Y A;  3DSS A;  3PRE A;  2KBX A;  1HU3 A;  2XS8 A;  1LD7 A;  1EDU A;  2KZT A;  4GTV A;  5D0O D;  4XEI G;  1HXI A;  5JHB A;  1SW6 A;  2HE0 A;  2BUG A;  2OV8 A;  3CVV A;  1RW2 A;  3B13 A;  3T8M A;  2PQR A;  3IV0 A;  5CCM A;  4UWK A;  1JPL A;  4U96 D;  3TXM A;  3TWU A;  5EX3 A;  4Q96 A;  4UWG A;  5J08 A;  4UQY A;  2XHE A;  2BKG A;  1S70 B;  2P9P G;  2XPI A;  3LKU A;  1JWG A;  4U8Y D;  4RG9 A;  3FTV A;  4MS6 A;  1WDY A;  3ISM C;  2VYI A;  5CMY A;  1O1T A;  3Q73 A;  4IYP A;  4HBD A;  3V2X A;  4I6E A;  3C3O A;  3FU5 A;  2XEE A;  3PZ2 A;  4O6F A;  5C1D A;  3GZ1 A;  3FH7 A;  3EDT B;  3E33 A;  3LXU X;  4FHK A;  1N11 A;  2OEV A;  4GZD A;  2PNN A;  4AV7 A;  3AU4 A;  5HRY A;  2X38 A;  3ASD A;  3RK6 A;  3GZS A;  3QAQ A;  4U8H A;  4AY6 A;  4GAA A;  4TUU A;  2C2L A;  3KAE A;  1SQM A;  3UT4 A;  1WY6 A;  2ZXW E;  4N3A A;  1Y6I A;  4BX8 A;  4ILH B;  4K0R A;  3CQG B;  1BLX B;  2EQX A;  3LVR E;  3ZYL A;  2J4D A;  3HVE A;  3ZNG A;  1TJC A;  3CVX A;  2V4L A;  4OVV A;  3FUN A;  3J5P A;  2R59 A;  1SA5 A;  1TNY A;  4WWN A;  3ZU7 B;  4O1O A;  1N4P A;  1NA3 A;  3UX4 A;  4U0U A;  3MKR A;  4HOU A;  3ULE G;  1UJJ A;  4J8E A;  4HOT A;  3D9I A;  2EIL E;  2XGS A;  2V5Q C;  4KT6 B;  2QYJ A;  1OWO A;  3FUJ A;  4N5Q A;  4J7W A;  3RRU A;  4PS8 A;  3HRA A;  3LS8 A;  3AG2 E;  1N9A A;  5KNH D;  1PAQ A;  4ILG A;  3JCK C;  1OWL A;  5FQ7 A;  3TWS A;  4GA0 A;  4Z68 A;  2P9N G;  2V8S E;  2FF4 A;  1TNB A;  1YA0 A;  2IY0 C;  5ARG A;  1Z5S C;  4DX6 D;  1YMP A;  2RFM A;  1Q2Z A;  3HXC A;  4QFV A;  4B89 A;  3CVL A;  1A17 A;  4Y6W A;  2WXN A;  3ENE A;  3RAU A;  2Y4T A;  3TG4 A;  3FUD A;  1OUV A;  3OXG A;  3Q4A B;  4APF A;  3NOC D;  3EUV A;  5DBK A;  4F1S A;  3L54 A;  3ONL A;  3SO8 A;  3JXI A;  3O4Z A;  2DYR E;  3SD5 A;  3PNL B;  2HR2 A;  2X6K A;  3LVQ E;  3ESL A;  3I3N A;  3FH8 A;  4I9C A;  4MKT A;  4HRN A;  3SNX A;  2VQ2 A;  4G1T A;  2AXV A;  4APO A;  3SGH A;  1GW6 A;  5G04 C;  4CZ2 D;  5H7P A;  2R17 C;  2CHZ A;  3RU0 A;  4J8Y A;  2WXR A;  1DVP A;  4A3V A;  3AS4 A;  2L0I A;  1IHG A;  4UI9 K;  3JYS A;  4GYO A;  4G11 A;  3ML9 A;  5ANR A;  4A55 A;  1RZ4 A;  4FHJ A;  3CKC A;  2E0I A;  2VTB B;  1TNU A;  1DNP A;  4GCN A;  3C3R A;  5G55 A;  4TUM A;  1D8D A;  3EJN A;  3I4G A;  5AAR A;  4DUI A;  4MRU A;  3CHP A;  3CLJ A;  4DI4 A;  1K3Z D;  1UN9 A;  3U4T A;  4UQX A;  4U0Z A;  3TWT A;  5LCW J;  5EIB E;  2LXL A;  2CFU A;  5BV0 A;  3FHE A;  5FQ8 A;  3AG4 E;  4RQI A;  3Q7F A;  4KBQ A;  3PEV B;  4V3I A;  2XEN A;  5ENN A;  4O1P A;  4ME2 A;  3QWV A;  1PC2 A;  1KZO A;  1HF8 A;  3FU3 A;  2LXM A;  3HIZ A;  1WG0 A;  1OWN A;  2Y3A A;  3HDX A;  4KMO A;  1HG5 A;  4YVQ C;  2MRI A;  3KEA A;  4LUN U;  3TWV A;  3V2O A;  2VGY A;  4IN3 B;  5KCM A;  3RKV A;  2OVF A;  1NFI E;  1TN8 A;  1D9S A;  5T8I A;  1EYH A;  3DEP A;  4ZHB A;  4D10 C;  1MX2 A;  4HB5 A;  1EF1 C;  3ZVV A;  4B0Z A;  2WPV A;  3G2V A;  4UI9 J;  4GTP A;  3CR3 A;  3FU0 A;  4I2Z A;  4G24 A;  2FEZ A;  3FTW A;  3CVN A;  3D9O A;  3PE3 A;  1OT8 A;  4EZL A;  3UM2 A;  4MBG A;  3L16 A;  2J49 A;  2ION A;  2DVW A;  4GTT A;  5ENQ D;  5LFA A;  3HYM B;  1LF8 A;  3CK8 A;  3LEW A;  1IKN D;  1BI7 B;  1PY1 A;  5A23 A;  4JPS A;  4HRM B;  4A1S A;  5KJK A;  3TGO A;  4ANW A;  1MHQ A;  4DX1 A;  4WND A;  2P9S G;  4YND A;  2IEJ A;  3SQV A;  2ILR A;  3APD A;  2A5E A;  3GZ2 A;  4XI0 A;  5EN5 D;  3ZUV B;  5CBN A;  3NOG D;  5B1A E;  3SFZ A;  3UM3 A;  3PUJ A;  3QNK A;  2FBN A;  2LNI A;  1NI1 A;  3ZN3 A;  4FUL A;  3C72 A;  3FUE A;  2AJA A;  1KT1 A;  4JHR A;  5BXO A;  3BG0 B;  1E8W A;  3C3Q A;  3L9T A;  2UY1 B;  1OCR E;  3UKU G;  4AIF A;  4AXH A;  3TG5 A;  3E37 A;  3ESK A;  5JJ7 A;  2X3M A;  4CGW A;  3D9M A;  2J4B A;  5FZR A;  4ANV A;  2KAT A;  3J5Q B;  3UT7 A;  3ZGQ A;  3LDZ A;  2H6H A;  3ASF A;  2MOW A;  5AEN A;  5EID A;  3OAW A;  4F53 A;  1MZC A;  4XKC A;  4L23 A;  4I17 A;  2XCB A;  2ETB A;  3SBT B;  3CHR A;  4HQD A;  3AS5 A;  1ELW A;  3CK9 A;  5AAO A;  1FPP A;  5CHE E;  2WM9 A;  2LSU A;  5FJY A;  4BTB A;  4UI9 C;  4OAU C;  2J8S D;  2WB2 A;  4FC8 A;  2NC9 A;  5EYL A;  3T5V A;  5T3R A;  3GW4 A;  4U0S A;  2P9L G;  3TWW A;  2V4H C;  4BY6 A;  3AG1 E;  2Y1L E;  4G23 A;  4YDW A;  2X6F A;  1N4S A;  3FEX A;  1IYG A;  3V79 K;  4L1B A;  3NBN B;  3JUE A;  2I6H A;  4Y6C A;  4YDO A;  4XX5 A;  4GCO A;  3UXG A;  2CG3 A;  3B7S A;  1H2U A;  3RRN B;  3FUL A;  5CER B;  4HLL A;  3UPV A;  3F6Q A;  3OXF A;  3EHR A;  3PZ3 A;  3HHM A;  5BV1 A;  3KEZ A;  1HE8 A;  2R2L A;  4O60 A;  3FTU A;  4I1M A;  3O48 A;  1N0Q A;  1MX4 A;  5FT9 A;  1NZN A;  2JAB A;  5HQ8 A;  1KT0 A;  2YNQ A;  2OVB A;  2BTD A;  5E75 A;  4HNA D;  4C48 B;  1JCQ A;  3FWV A;  2FO1 E;  4ABN A;  2XZT G;  3E30 A;  1H0A A;  4C9B B;  4GYY A;  5JJ6 A;  4CGV A;  2GRQ B;  3C5R A;  1IXV A;  3Q47 B;  2WXF A;  4WWP A;  4WNE A;  4ACL A;  3Q78 A;  3FEY A;  3SZ7 A;  2PL2 A;  4I1O B;  3BEE A;  3MEK A;  3CKB A;  1HZ4 A;  2WXL A;  4L2Y A;  1Z3Y A;  2IOL A;  3V31 A;  3LYA A;  4DX7 D;  3L82 A;  2LO6 A;  3RRM B;  4AOF A;  4BFR A;  1UW4 B;  2WQ6 A;  2CG2 A;  3I4R B;  1BI8 B;  2UWJ G;  2F8X K;  2B0O E;  1QYM A;  2P9I G;  3TWR A;  4RVB A;  5AJD A;  3APF A;  3DSW A;  3CHO A;  3Q7A A;  3WXX A;  2J08 A;  3D9N A;  4NQ0 A;  3QWP A;  4AY5 A;  4JHJ A;  3RO3 A;  1U3D A;  5CRV A;  2KZT B;  3TAX A;  1L5J A;  4G8K A;  3CIA A;  2KC7 A;  3U3W A;  2WXJ A;  3IHV A;  3W9G A;  2Y0B G;  4H7X A;  3FTZ A;  4PH4 B;  3I5P A;  4RSY A;  1OXJ A;  4HRL A;  2XRY A;  2XEV A;  3Q79 A;  4L9P A;  1JWF A;  3BUA A;  4XKB A;  4GMR A;  3NQP A;  5AQA A;  4HOQ A;  5AIJ A;  4I6J A;  4GPK A;  2XPY A;  3EIQ C;  5AYW D;  2F8Y A;  1K8K G;  3UQ3 A;  2MYO A;  1OCC E;  3CK7 A;  1QQE A;  3GYZ A;  4JA7 A;  3UM1 A;  5BPP A;  3ML8 A;  3U64 A;  4EBA G;  3CEQ A;  2OCC E;  2VSO E;  2WXI A;  3ZEF A;  1OCO E;  3DEO A;  4JC8 A;  2V5F A;  3VTY A;  3NZS A;  2CHX A;  5ENP D;  4PDX A;  2LAI A;  3CGH A;  5LX8 A;  1UG3 A;  4BT9 A;  1Z3X A;  4QQI A;  3N71 A;  4LSZ E;  1QZ2 A;  4GA1 A;  1OY3 D;  4FAD A;  3PZD A;  3FTX A;  2ZGG A;  1ELK A;  5CEA A;  1X81 A;  3CV0 A;  2BF0 X;  3S2A A;  3NF1 A;  4U07 A;  3CQC B;  1QBQ A;  3CVQ A;  3PZ1 A;  4BSX A;  2I1K A;  3P1U A;  3UI2 A;  2E2E A;  4KZ0 A;  2XPZ A;  5D2M C;  2VTB A;  2Y4U A;  2GRO B;  4E6H A;  3APC A;  4N3B A;  3FH5 A;  1FCH A;  4LNU D;  2H6I A;  1N0R A;  3UIN C;  4K5B A;  3QB2 A;  4DI3 A;  4K03 A;  4A63 B;  4G25 A;  1EPU A;  1MJ0 A;  1N94 A;  4UWL A;  2DIW A;  3ULQ A;  5EDS A;  3QAR A;  5CBO A;  2XCC A;  3MKQ A;  2V0P A;  1H6O A;  1FT2 A;  2WXM A;  3MZL B;  3FDH A;  1Y8M A;  4ILI A;  4X8Q A;  5KBA A;  3QC1 A;  2FUL A;  2GRM A;  4NIK A;  4M7C A;  4YVO A;  2P9U G;  4FP7 A;  3DSU A;  4XZ4 A;  2DZN A;  3CHM A;  1SZA A;  2B6C A;  5A6C A;  3ZIM A;  3KSL A;  2PM6 A;  1JCS A;  3L13 A;  3UKR G;  2AXZ A;  3DWL G;  5AQ9 A;  1UN8 A;  3ZXS A;  1H2T C;  2XS1 A;  2IFU A;  1FT1 A;  4WAF A;  4F3V A;  2BKK B;  1V54 E;  4HI9 A;  4UWH A;  4U8V D;  3LPZ A;  2IJG X;  3AG3 E;  2PZI A;  4DLO A;  1TR4 A;  3NZU A;  4GA2 A;  3L17 A;  2ZIS A;  4ATZ D;  4H7Y A;  3B95 A;  4B93 B;  5HI7 A;  4Q94 A;  3LJN A;  1MQS A;  3HXD A;  5ITZ F;  3ONK A;  2F37 A;  4FLH A;  3CVP A;  3B7U X;  4FA6 A;  4TXQ A;  2XEH A;  4LER A;  3Q5M A;  2MHK A;  3ASH A;  1JCR A;  1E8Z A;  3BU8 A;  1U2V G;  2H6F A;  1V55 E;  3ZYQ A;  3R9M A;  3ASG A;  4XE0 A;  4HS2 A;  4JW1 A;  2EIK E;  3Q9U C;  3MGB A;  2C0L A;  4GU5 A;  4CEM A;  4U95 D;  1TNO A;  4HOS A;  4GYW A;  4EBA A;  4M3O A;  3QJZ A;  3JXJ A;  2ETC A;  3HG0 D;  4J8F A;  3P2B A;  2BED A;  1HG2 A;  3FFL A;  1S0P A;  4RG6 A;  2VSX E;  1N95 A;  1TYQ G;  4UWF A;  4G26 A;  4YDY A;  5B3S E;  4XI9 A;  1E8X A;  3EHN A;  5KJM A;  2WQ7 A;  5CCL A;  2JEK A;  4B8A A;  3B7T A;  4CT4 A;  1OWM A;  4TXP A;  5E76 A;  2VGX A;  3PNT B;  4KZC A;  1H19 A;  1N4Q A;  4GPM A;  2PQN A;  2YHC A;  4BSZ B;  4C0M A;  3UM0 A;  5M72 A;  2IU1 A;  5D66 A;  4LEU A;  1KZP A;  1ZB1 A;  5G04 J;  4DK5 A;  1H6P A;  5EIL A;  1TNZ A;  5BXU A;  1W3B A;  3RO2 A;  1UJK A;  3DRA A;  1H6K A;  4I43 A;  1E7V A;  4EHM A;  4UUC A;  2WMN A;  3Q75 A;  3CHQ A;  3ULY A;  4JVS A;  2WXP A;  4N3C A;  5ENS D;  5FZS A;  2AWI A;  3SHF A;  3S7J A;  4F6R D;  2XQ0 A;  4PS7 A;  4WNG A;  4KVO A;  1S64 A;  2QZA A;  3IKO B;  3QWW A;  4FJY A;  1O1S A;  5EYP F;  1INZ A;  3L6A A;  3PE4 A;  4N39 A;  3EU9 A;  3U9W A;  3DXK G;  4JXT A;  4JA9 A;  3FUI A;  4GB9 A;  3TXN A;  5KNG A;  3QDN A;  5AQ7 A;  5KWD A; 
#chains in the Genus database with same CATH homology
 2B0O E;  1QYM A;  3UXG A;  5CEC B;  3J5P A;  3KEA A;  3TWR A;  1YCS B;  3TWV A;  4HRN A;  3V2O A;  5ENP D;  4ZFH A;  5AQ9 A;  4CYM D;  4DRX E;  4YDY A;  5CER B;  4HI8 A;  3ZU7 B;  1NFI E;  4HLL A;  4O1O A;  3F6Q A;  1D9S A;  4U96 D;  4CZ2 D;  3TWU A;  3EHR A;  3DEP A;  4ZHB A;  4QQI A;  1MX2 A;  4HB5 A;  4LSZ E;  4BET A;  2BKK B;  2BKG A;  4J8Y A;  1S70 B;  5AN8 A;  1A5E A;  3Q9N C;  4O60 A;  4U8Y D;  5AQB A;  3D9H A;  5JMN D;  1OY3 D;  1WDY A;  3J5Q B;  5JA4 D;  3B7B A;  4HI9 A;  3TWQ A;  4DX6 D;  2V5Q C;  4U8V D;  2QYJ A;  1N0Q A;  1MX4 A;  4G8K A;  2ZGG A;  4GPM A;  2JAB A;  4RLY A;  5HS0 A;  1SVX A;  4BSZ B;  4BES A;  4N5Q A;  4HBD A;  1TR4 A;  4DX2 A;  5CEA A;  1OT8 A;  1AWC B;  1UOH A;  3IXE A;  4G8L A;  3V2X A;  4J7W A;  3W9G A;  5D66 A;  5HKP A;  2Y0B G;  1BD8 A;  2XZD G;  3HRA A;  2DZO A;  4OAV B;  1K1B A;  2DVW A;  5EIL A;  5ENQ D;  3ZKJ A;  5EID A;  1AP7 A;  4HNA D;  3TWX A;  4ATZ D;  4C48 B;  3UI2 A;  3B95 A;  5KNH D;  5BXU A;  1IKN D;  3T8K A;  4B93 B;  2XEE A;  1BI7 B;  2VGE A;  2ETB A;  3LJN A;  1BU9 A;  2FO1 E;  5ITZ F;  4HRL A;  4LNU D;  2P2C P;  4HQD A;  4TUM A;  2XZT G;  1DC2 A;  1N0R A;  4HRM B;  4UUC A;  4K5B A;  2F37 A;  4LG6 A;  3TWS A;  4Z68 A;  2KXP C;  5ENT D;  5AAR A;  4GMR A;  4DUI A;  5AQA A;  4A63 B;  5CED B;  2DWZ A;  2XEH A;  1N11 A;  5AAO A;  5FIN A;  3C5R A;  1IXV A;  1MJ0 A;  1YYH A;  1K3Z D;  2PNN A;  4K5A B;  1DCQ A;  1YMP A;  2RFM A;  4DX1 A;  5ENS D;  4BEP A;  5HRY A;  2F8Y A;  4OAU C;  2J8S D;  4F1P A;  1MX6 A;  2MYO A;  2NYJ A;  4QFV A;  2ETA A;  3TWT A;  5CBO A;  5EIB E;  4F6R D;  4K5C A;  5EYL A;  3T9K A;  3V30 A;  2A5E A;  5EN5 D;  3ZUV B;  4JB8 P;  5CBN A;  3NOG D;  5ENR D;  2RFA A;  3UTM A;  3Q9U C;  1MYO A;  3TWW A;  4DX5 D;  2QC9 A;  2V4H C;  3NOC D;  5FIO A;  5EYP F;  2F8X K;  2ZGD A;  2KBX A;  3AJI A;  4U95 D;  2XEN A;  3V31 A;  3EU9 A;  2Y1L E;  1BLX B;  4O1P A;  4YDW A;  5ENO D;  3SO8 A;  4DX7 D;  5KBA A;  1G3N B;  2L6B A;  3EHQ A;  3JXI A;  4BER A;  4NIK A;  1IHB A;  1SW6 A;  3V79 K;  1K1A A;  2AJA A;  3DEO A;  5KNG A;  3AAA C;  3JXJ A;  5AQ7 A;  2HE0 A;  2DZN A;  3NBN B;  3JUE A;  5KWD A;  2ETC A;  3HG0 D;  1WG0 A;  1BI8 B;  3ZNG A;  3W9F A;  5BXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...