1OY3D

Crystal structure of an ikbbeta/nf-kb p65 homodimer complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
255
structure length
220
Chain Sequence
VFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDADEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAPEPEDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Transcription factor p65
publication title X-ray crystal structure of an IkappaBbeta x NF-kappaB p65 homodimer complex.
pubmed doi rcsb
source organism Mus musculus
total genus 69
structure length 220
sequence length 255
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1oy3D00
2XENA 5D66A 3NOCD 1OT8A 1MX6A 2RFMA 4G8KA 1NFIE 4HNAD 3ZUVB 2Y0BG 2BKGA 5EYPF 3TWSA 3TWUA 1MJ0A 3F6QA 3TWQA 5AN8A 4F6RD 2DZOA 3T8KA 3Q9NC 1IKND 5JMND 5CEDB 4RLYA 2AJAA 5KBAA 2NYJA 3SO8A 3IXEA 1AWCB 3JXJA 4DX7D 1WG0A 2JABA 1AP7A 1BLXB 1IXVA 1MX2A 3V79K 4HRNA 3NOGD 4HBDA 3V2OA 3UXGA 1MYOA 5EN5D 3UI2A 3V31A 5EIDA 4BEPA 4DRXE 2V4HC 1BI8B 5JA4D 2L6BA 2BKKB 4J8YA 2FO1E 2VGEA 1K3ZD 3DEPA 2V5QC 3NBNB 2J8SD 1YMPA 4DUIA 1S70B 5BXOA 4HI8A 2XZDG 1DCQA 4GMRA 3HG0D 4O1OA 1BU9A 4CZ2D 5ENSD 5CBOA 4K5CA 4DX5D 1IHBA 5CBNA 4BERA 3J5PA 4HI9A 3T9KA 4HRMB 3TWVA 5FIOA 4C48B 3EU9A 5ITZF 4CYMD 2ETBA 4TUMA 5HS0A 5ENOD 2MYOA 2B0OE 2KBXA 2P2CP 5BXUA 5ENRD 4ZFHA 3TWRA 4GPMA 2XEEA 3C5RA 4YDYA 4YDWA 5AQAA 1SVXA 4HRLA 4K5BA 4U8YD 3JXIA 3AAAC 2F8YA 5ENTD 5HKPA 1TR4A 3V30A 4JB8P 4K5AB 5AAOA 5ENPD 4LG6A 5ENQD 2Y1LE 4DX6D 4N5QA 2XEHA 1BD8A 3ZU7B 4QQIA 2F37A 4ZHBA 2RFAA 1WDYA 3B7BA 5EYLA 1D9SA 1N0RA 4LNUD 4ATZD 5KNGA 4LSZE 5EILA 3W9FA 3TWXA 2A5EA 4NIKA 1UOHA 5AQ7A 3V2XA 4O60A 4OAVB 1N0QA 1BI7B 1QYMA 3ZNGA 3B95A 4B93B 1SW6A 3UTMA 3D9HA 4HB5A 1A5EA 4BESA 4F1PA 2ETCA 2QYJA 3KEAA 2ZGGA 5KWDA 4HLLA 2KXPC 2ETAA 3Q9UC 4BETA 4Z68A 4QFVA 4G8LA 5FINA 5CEAA 5CECB 1K1BA 3AJIA 3LJNA 4J7WA 3TWTA 3DEOA 1YCSB 2QC9A 3ZKJA 1K1AA 4U8VD 1MX4A 3EHRA 5AQBA 4U96D 4UUCA 1N11A 3HRAA 4BSZB 5AQ9A 4A63B 1YYHA 5AARA 4HQDA 4O1PA 4U95D 3J5QB 5HRYA 2DVWA 1OY3D 5KNHD 1DC2A 2HE0A 3W9GA 5CERB 3TWWA 2F8XK 4OAUC 2XZTG 4DX1A 4DX2A 3JUEA 2DZNA 2DWZA 5EIBE 1G3NB 3EHQA 2ZGDA 2PNNA
chains in the Genus database with same CATH superfamily
1HF8A 3NOCD 5KJLA 1NP7A 4BX9A 3ZPJA 2AWIA 5EYPF 5KBAA 3FY4A 5LP0A 4WNEA 3B7RL 2NYJA 4N3BA 4LNBA 2R03A 3UPVA 2P9UG 4HOTA 2XCBA 3CVYA 4JL0A 4I9EA 3ML8A 3CHRA 3C3QA 5FZSA 3IHVA 3UUXA 1UW4B 5FT9A 3FU0A 1H6PA 4TXPA 2WQHA 2F0YA 1Z6TA 4U8YD 2J09A 5E76A 1B89A 3FUMA 3V30A 3LY7A 3Q4AB 1KT0A 1TNBA 3QARA 2HYZA 2BF0X 1NL4A 3FU3A 3HXEA 2A5EA 1E8YA 1ELRA 3KSLA 3Q49B 4F1PA 4HLLA 3HXDA 5G05J 5BPPA 4CEMA 3LJNA 4TV3A 4MS6A 3S7DA 2WXOA 3FUNA 4XI0A 3HRAA 3CKBA 1Q2ZA 3ASOE 4Y6WA 3ZIMA 4ANVA 3T5VA 5KNHD 3G2UA 3Q7FA 3T8MA 2CHWA 4OAUC 2A4ZA 5EIBE 5FTPA 3FH8A 4GB9A 1YA0A 1MJ0A 4RVBA 3PUJA 4JHJA 3JYSA 4LCTA 3SF4A 2RG8A 5CMYA 2XEVA 4J8YA 2WQ7A 3QOUA 5BXOA 4IYPA 1DCQA 2VSOE 1HZ4A 2WXHA 3ZVVA 5DIZA 4FHKA 3FUJA 3AG4E 3PZ4A 5LX8A 1SVXA 1PY1A 3R7QA 3GW4A 4A3VA 2EIJE 3RIBA 2XEHA 1L5JA 2NXPA 2OEWA 4F3VA 4LEUA 2F37A 4U04A 2P9IG 5FQ6A 3B7SA 3MYVA 3D9NA 4AXHA 4HB5A 4HOSA 3TXMA 2ETCA 2VGXB 3Q9UC 2VGXA 1K1BA 4J7WA 4LRZA 1YCSB 2FF4A 3HXCA 3DSTA 2LAIA 3UKUG 2XHEA 2VQ2A 5ARGA 2GRLA 3VLEA 3BG1B 4UWFA 3SI5A 2ZGDA 2PNNA 3SFYA 5T3RA 2I1KA 1OT8A 3LKUA 4G8KA 3I3NA 3MJWA 2AJAA 3ENEA 3SO8A 1WG0A 5D2MC 1MX2A 2R17C 2CG3A 4BEPA 3OAWA 1DNPA 3ASHA 3DEPA 3D3MA 1YMPA 3HG0D 1HU3A 3LEWA 2XCCA 5T4YA 4ILIA 2KBXA 5ENRD 2XEEA 4M7CA 3CHSA 3RJVA 1UG3A 3OXGA 2GGFA 3FTWA 4N5QA 1S64A 2BTDA 2GRQB 2C0LA 4ZHBA 1RW2A 1WDYA 3AS5A 3UM3A 4ATZD 5KNGA 4K0RA 4YDOA 3QWVA 3ZNGA 3CQGB 3L08A 4JEUA 4B0ZA 3AG1E 3KEAA 3AG3E 3ABKE 2IEJA 5B1AE 4UWHA 4GMLA 5FINA 4PS8A 5D0QD 4U96D 3O4ZA 3GZSA 4RQIA 3FH5A 4K03A 5G05C 2XPZA 4JXTA 2HE0A 5CERB 2XPYA 4JA9A 3RRMB 2GRMA 4KYOB 4HNAD 3ZUVB 5B3SE 3F6QA 2AXUA 3C3OA 1IKND 4NRHB 1UJJA 2CHXA 1AP7A 1MYOA 3DXKG 1BI8B 1E8XA 2WMOA 3FUHA 2J07A 5FJYA 3SNXA 2RD0A 4KXKB 4K5CA 5CBNA 3GZ1A 3SFZA 2V4LA 1MQSA 2IONA 5FIOA 3L13A 3VLFA 3SGHA 3FUKA 3LVQE 3L6AA 2YHCA 3FUFA 2MOWA 2P9SG 1K8KG 4DI3A 3L82A 4LG6A 5ENQD 4DX6D 1OWMA 4APFA 4IRUA 2RFAA 4J8EA 2KC7A 3CHPA 2PQRA 3D9HA 5LOZA 4C0EA 5LFAA 2ZGGA 3ZYQA 3MKQB 1TJFA 3MKQA 2V5FA 4WUYA 3TJPA 1E8WA 3UT7A 5AQBA 1JCRA 3LY8A 2WM9A 1JPLA 4RG9A 4FULA 1JUQA 4ABNA 3MA5A 3L16A 3UT4A 1G3NB 3EHQA 1FVFA 5BNWA 5AJDA 2ONDA 4UQZA 3QAQA 3NAWA 4DK5A 2YINA 3ONLA 4URKA 2E2EA 5EN5D 3ZYMA 2PM7A 1OWPA 1BPOA 2V5QC 2P9KG 4C0MA 3PZ3A 4HI8A 3U9WA 3D9PA 4L9PA 2LUHA 2UWJG 2YQ8A 4UI9J 3ASGA 3J5PA 4FLHA 2ILRA 3D9OA 4UWGA 4YDWA 2IY0C 4HFGA 3NF1A 5ENTD 3ASNE 1FVHA 3UQ3A 4GZ5A 5G55A 5KCMA 3I5PA 4AEZC 4LNUD 3UIOC 1Z3YA 1LF8A 4M3OA 3JUIA 3ZEFA 4GPKA 1OXJA 4EZKA 1QYMA 4CGWA 2OCCE 3EHMA 4L23A 1H2VC 2XRYA 4NURA 3AJIA 3JQ0A 5JHBA 4U0UA 4WWOA 3IBEA 4CDNA 1HG5A 4O1PA 2DVWA 4YDEA 4JEHA 2WVIA 2IQCA 4FLBA 3RO3A 4J8FA 2XENA 4GA0A 4I2WA 1W3BA 4I6JA 2RFMA 1Y8MA 5A7DB 3PUKA 3T8KA 2UY1B 3UINC 1IXVA 4UWLA 1IHGA 3CEQA 5EIDA 2V4HC 3ISMC 4NACA 1S0PA 5FQ8A 2WXNA 2J8SD 2NSZA 1ZU2A 4EBAG 4BERA 5A23A 4E6HA 3ZGQA 5ENNA 3JQ1A 2QY7A 4GCNA 4CYMD 4BY6A 3PDNA 2IOLA 4YDYA 1SQMA 4Q96A 3CSTA 1TN6A 2VSYA 3ZW3A 5C1DA 3IKOB 4F1SA 1IQRA 3PE4A 2FI7A 2DCPA 4L2YA 2FEZA 1LTXA 3CHMA 3HXBA 3KAEA 3QJZA 3UMVA 4N2QA 2OOEA 2WXFA 5D0OD 3HXFA 5JJ7A 1INZA 3OXFA 3EHNA 2ETAA 4XZ4A 4Z68A 4GTPA 1HX8A 4BT9A 5A6CA 4WWNA 3N71A 3PEVB 1N9AA 4L1BA 2ZU6B 3FEXA 1H6OA 2KM4A 3Q47B 3RAUA 5HRYA 3UX4A 2F8XK 1U2VG 3CVNA 4DX2A 1UN9A 3U64A 4AP2A 3AS4A 3TWQA 5AN8A 3Q9NC 2X6HA 5BV1A 3PZ2A 3CVUA 2P9LG 3V2OA 3UXGA 2YHEA 4EZJA 2KCVA 3BU8A 2VTBB 3VTYA 2VTBA 1WY6A 4FJYA 3SBTB 2YNQA 4I1AA 5ITZF 2XS1A 2ETBA 1OWOA 4DLQA 3WXXA 3ULEG 4YNDA 3G2SA 4EZLA 2WMNA 4CDRA 3IV0A 4UI9C 2X3MA 3ZHEB 3ZHEA 5AJLA 4DI4A 4JA7A 1N4QA 2R02A 5EILA 4CT4A 4U63A 1QZ2A 2Y3AA 3ASFA 3MX3A 4I17A 3FTXA 1FCHA 1D8EA 4G8LA 1Z3XA 3QKYA 1O1SA 4O6FA 4BTAA 2RKKA 5AQ9A 3CHOA 3DRAA 3APFA 3SQVA 4WNGA 3LPZA 3J5QB 4DX1A 3JUEA 3FU5A 3TL5A 1OUVA 2DWZA 3O48A 4I6EA 4ANWA 5DBKA 4EECA 1HFAA 2BKGA 3TWSA 2PM6A 2DZOA 1SA4A 3CGHA 2AXZA 4HBDA 1E90A 3VTXA 3S7BA 3CR3A 5ARFA 4A1GA 2WXMA 4JD2G 1XGWA 5ENSD 4Q94A 4DX5D 2BEDA 1HXIA 1TYQG 3BQOA 1JWGA 2R05A 4D10C 3FTZA 1DVPA 3HIZA 5HKPA 5BUZA 4JB8P 4J8DA 5AAOA 4H7YA 3RO2A 3IHYA 1N0RA 5IY5E 3W9FA 3FEYA 1JWFA 1N4RA 4ILHB 1FT1A 1H6KA 2Q7FA 2XS8A 1EDUA 5CRUA 3T5XA 1E7UA 2DIWA 1O5MA 4FJZA 3DEOA 4APOA 4C9BB 4Q69A 3U4TA 2P9NG 4UUCA 4AY5A 4XX5A 2WXIA 2E0IA 2LSUA 1QQEA 1OY3D 4CCAA 2XZTG 2ZIRA 4GTTA 2H6FA 3CVPA 3LJ3A 4PDXA 4N3AA 1NFIE 1N95A 5AYWD 3EUVA 4F6RD 2HM8A 3PS6A 1ELKA 3FTVA 4FA6A 2X6FA 4DX7D 4G2VA 2XRZA 2V8SE 3TXNA 1H2UA 2M63A 5E75A 3C72A 4JW1A 4KZCA 4HI9A 4L7TA 3MV3B 4KT6B 3CK9A 3RSEG 1OWNA 2P2CP 1LD8A 4HRLA 3GYZA 2I1JA 3BUAA 5CMWA 3LS8A 3AU5A 3CK8A 3UM2A 3GZ2A 4PS7A 4XI9A 1V54E 4FP7A 3LYAA 4XIFA 2AVPA 4H7XA 3SBSA 2ZISA 1N52A 1MHQA 5KJKA 2CFUA 3I4RB 4GTQA 2KXPC 4AIFA 4UQYA 3CLJA 3FU6A 2EIME 3UT8A 3EU5A 3Q78A 4HOUA 2X6JA 4ACLA 3SFXA 1EYHA 1UJKA 4TRQA 1U3DA 4CGVA 2IO2C 1E96B 2DZNA 3D9KA 1TNZA 5BV0A 2IU1A 1WAO1 4PUCA 4CT0A 2WXQA 3MKRA 3PEUB 3IXEA 4TUUA 3QB2A 4JC8A 3DPDA 3RK6A 3SZ7A 2WXLA 4R7LA 4N39A 2I9CA 3SD5A 3FUIA 4GZDA 1OCCE 5JJ6A 5CRVA 4GMRA 4G11A 3MCXA 4GCOA 4ANUA 2PL2A 4YVQC 3T9KA 4WAFA 2AW6A 3TWVA 3ABME 2WXGA 4KVMA 3Q15A 3PNTB 1KLXA 3PVLA 3B13A 4J0UA 1GW6A 4ME2A 3JXIA 4N2SA 4FHJA 1E8ZA 4HVBA 4GZ6A 1QNFA 4I1MA 3QNKA 2Y1LE 2X6KA 4CDMA 1JCSA 4UI9K 3TWXA 4NIKA 3V2XA 1N0QA 3HHMA 4TXQA 1KPSB 4ACKA 4GTOA 1TN8A 4AJWA 3EDTB 4JHRA 1ZB1A 5BW8C 3QK0A 3PZDA 4GA2A 4B8CB 5J08A 3MV2B 1MZCA 4FU3A 3ESKA 2J4DA 2H6HA 3DSSA 3UKRG 4A63B 1YYHA 2WXKA 3HVEB 4PS3A 4AV7A 3HVEA 4LNGA 3PZ1A 3W9GA 2KCKA 2XQ0A 2JLBA 1DCEA 4OVVA 5C2YA 4JVSA 3E37A 2PZIA 4U0ZA 5CEDB 3G2WA 1AWCB 3NOGD 4I9CA 4WNDA 4GTSA 3CVQA 2L6JA 2EILE 4L2LA 2P9PG 2PQNA 3DPYA 3DBSA 3QDNA 2VJ8A 4FADA 3FFLA 4GZ3A 4O1OA 3L22A 4A1SA 2J08A 2LSVA 3URZA 3E32A 3P1UA 4HRMB 2XPIA 3IEGA 4LUNU 5HS0A 4ZFHA 1HH8A 3C5RA 3ZRHA 4K5BA 2F8YA 4W9RA 2R5SA 3ML9A 4GA1A 3ZU7B 4QQIA 3PRZA 2I6HA 3LVRE 4BFRA 2GRRB 3RRUA 2A5UA 5AQ7A 2L0IA 1SW6A 3UTMA 4OVUA 5FQ7A 4BETA 2XGSA 3VLDA 4I2ZA 3TWTA 3ZKJA 3QWPA 3ULYA 5HI7A 4GYYA 1WM5A 4HQDA 3FTUA 4EBAA 1N4PA 1H19A 4G24A 4RSYA 3TWWA 3FHEA 4XKBA 4CZ2D 3ABLE 3CV0A 3R9MA 5FWQA 3FULA 2R59A 2DYSE 3D9MA 2Y0BG 3OTNA 2IO3C 3ONKA 3ZXPA 2QZAA 3E30A 3LDZA 3UI2A 2X6IA 2BKKB 1K3ZD 3RRNB 3R7RA 4DUIA 5LCWJ 2XZDG 4GZCA 2CHZA 1NA0A 1HO8A 5M72A 4PH4B 3FUDA 3CSFA 2XGMA 4TUMA 1FT2A 4GPMA 5AQAA 3HYMB 1TR4A 3I4GA 3PNLB 3BEEA 3ZFWA 4G26A 4F7AA 3RKVA 3B7BA 1H2TC 4XE0A 3UM0A 3CVLA 3U3WA 4RG6A 4NQ0A 3AG2E 3C98A 1O1RA 3Q7AA 5CCLA 3EHRA 2WXJA 1X5BA 3DWLG 3MEKA 1TEZA 1X81A 3ASDA 2Y69E 3UM1A 2J9QA 1U3CA 2KATA 4MKTA 3SY2A 3NZSA 2H6IA 4KZ0A 4JPSA 3FWVA 3ZN3A 4DLOA 3ZYKA 3NZUA 4GU5A 5ANRA 3TWUA 4KBQA 1XNFA 5JMND 4RLYA 3D9JA 4BX8A 2NC9A 3SHFA 3B7UX 1PC2A 1NZNA 1BLXB 3LXUX 4TXRA 4HRNA 3ULQA 4HXIA 3MGBA 3CVXA 3KEZA 4A55A 4U0SA 2FO1E 3Q75A 4CRWA 3APCA 5B1BE 1OCZE 4I6GA 4JZYA 5AIJA 3L9TA 3HDXA 4U8HA 1NI1A 1TNYA 2MYOA 4MBGA 5FZQA 1UN8A 3AAAC 4GTVA 3ESLA 5EKQD 4K5AB 5H7PA 3R9AB 4BWRA 5KJNA 1E7VA 5ANLA 4LSZE 1HE8A 2HO1A 4EPZA 1UOHA 3KSQA 4O60A 2XGOA 1N4SA 3S7FA 1BI7B 2JEKA 1A5EA 3Q79A 3WG7E 1IQUA 3NQPA 2IFUA 4GMJA 5KWDA 3MZLB 1SA5A 2EINE 2QC9A 5KJMA 1K1AA 1VDYA 1MX4A 4J8SA 3QWWA 4GYOA 4U95D 3DSXA 2GRNB 2LXMA 4B89A 2WXRA 4Y6CA 3PREA 4UQXA 3G2VA 5D66A 1ZBPA 2EQXA 1MX6A 5T8IA 1A17A 3S2AA 2JABA 4G25A 3V31A 1H0AA 1EF1C 2FBNA 4WWPA 5EX0A 4DRXE 2MHKA 1JCQA 4V3IA 5G2NA 1IYGA 5FQ4A 3K9IA 1BU9A 3KD7A 3QC1A 4KVOA 4GYWA 4HORA 3E34A 4J6IA 4MLPA 2B0OE 3TWRA 1RZ4A 1PAQA 5LCWC 4XEIG 2I2OA 3DSUA 3ZXSA 4X8QA 2CFZA 4AY6A 5JJTA 5EYLA 3CVWA 1OCOE 3FP3A 1SZ9A 5CCMA 2L0TB 4JHKA 1TNUA 4BT8A 4I1OB 2HR2A 2C2LA 3KS2A 3EIJA 5G04J 4GTRA 2WB2A 2V0PA 3PE3A 3BG0B 3Q73A 5CEAA 5CECB 2VYIA 1EPUA 4BTBA 4MRUA 3TGOA 4AM9A 3U66A 2ZXWE 2IOSA 4UWKA 4U07A 4DPRA 5AENA 3LCAA 2QYUA 4B8AA 4GTMA 1DC2A 1V55E 3G2TA 2P58C 3AU4A 4G1TA 4E85A 2GRPB 2VSNA 4A3TA 2OEVA 5HQ8A 4YVOA 3JXJA 3E33A 1O1TA 5JA4D 3AS8A 4LERA 4B94A 1S70B 5CBOA 3CQCB 1IHBA 1LD7A 3FTYA 3E4BA 4U7EB 3FTSA 4P29A 3D9LA 4IULA 4N3CA 2GROB 1HS6A 3S7JA 4DJAA 2OVFA 5EX3A 2C0MA 3TG5A 3P2BA 2LAHA 3CK7A 5ENPD 5JHAA 3CIAA 3NB2A 3PH0C 1D9SA 1ELWA 1HG2A 5BT1A 4OAVB 2VSXE 3ZYLA 2FULA 3B95A 4I43A 4HOQA 4HLEA 1NA3A 2VGYA 4BESA 4HS2A 5CHEE 4N5CA 1SZAA 2GW1A 2H6GA 5J90A 4BSXA 3X2QE 4EHMA 2FO7A 3OXLA 4GAAA 1N11A 3L17A 4BSZB 4WNFA 2OV8A 1OCRE 3B7TA 5FZRA 3DSWA 2X38A 3DSVA 2OVBA 2KCLA 2WXPA 1OWLA 2WPVA 2KZTB 2KZTA 3DXMG 2BUGA 4FC8A 3FH7A 4ANXA 2IF4A 4F53A 3EJNA 1D8DA 4OYSA 1S63A 1FPPA 2Y4TA 3TG4A 1KZPA 2LXLA 1N94A 1Y6IA 3V79K 4G23A 2J49A 3FUEA 2L6BA 2AXVA 3EIQC 3RU0A 2VGEA 3NBNB 4AVXA 3CKCA 2IJGX 3UIPC 4XKCA 3LY9A 2B6CA 2MRIA 1KT1A 1TJCA 3L54A 4C48B 3EU9A 1TNOA 2EIKE 5ENOD 5BXUA 3D9IA 1KZOA 1QBQA 2DBAA 2Y4UA 2J4BA 1BD8A 3JCKC 3Q5MA 3APDA 1P5QA 3FDHA 3TAXA 2R2LA 4IN3B 2LNIA 4B93B 2QYJA 4ATGA 4ILGA 4EQFA 1TN7A 3C3RA 5EDSA 4AOFA 4QFVA 4KMOA 4U8VD 2LO6A 1Z5SC 2UY1A 2CG2A 5G04C 5AARA 2DYRE 2QFCA 3CHQA 1N54A 3CVVA 2L9BA 2WQ6A
chains in the Genus database with same CATH topology
2XENA 5D66A 3NOCD 1OT8A 1MX6A 2RFMA 4G8KA 1NFIE 4HNAD 3ZUVB 2Y0BG 2BKGA 5EYPF 3TWSA 3TWUA 1MJ0A 3F6QA 3TWQA 5AN8A 4F6RD 2DZOA 3T8KA 3Q9NC 1IKND 5JMND 5CEDB 4RLYA 2AJAA 5KBAA 2NYJA 3SO8A 3IXEA 1AWCB 3JXJA 4DX7D 1WG0A 2JABA 1AP7A 1BLXB 1IXVA 1MX2A 3V79K 4HRNA 3NOGD 4HBDA 3V2OA 3UXGA 1MYOA 5EN5D 3UI2A 3V31A 5EIDA 4BEPA 4DRXE 2V4HC 1BI8B 5JA4D 2L6BA 2BKKB 4J8YA 2FO1E 2VGEA 1K3ZD 3DEPA 2V5QC 3NBNB 2J8SD 1YMPA 4DUIA 1S70B 5BXOA 4HI8A 2XZDG 1DCQA 4GMRA 3HG0D 4O1OA 1BU9A 4CZ2D 5ENSD 5CBOA 4K5CA 4DX5D 1IHBA 5CBNA 4BERA 3J5PA 4HI9A 3T9KA 4HRMB 3TWVA 5FIOA 4C48B 3EU9A 5ITZF 4CYMD 2ETBA 4TUMA 5HS0A 5ENOD 2MYOA 2B0OE 2KBXA 2P2CP 5BXUA 5ENRD 4ZFHA 3TWRA 4GPMA 2XEEA 3C5RA 4YDYA 4YDWA 5AQAA 1SVXA 4HRLA 4K5BA 4U8YD 3JXIA 3AAAC 2F8YA 5ENTD 5HKPA 1TR4A 3V30A 4JB8P 4K5AB 5AAOA 5ENPD 4LG6A 5ENQD 2Y1LE 4DX6D 4N5QA 2XEHA 1BD8A 3ZU7B 4QQIA 2F37A 4ZHBA 2RFAA 1WDYA 3B7BA 5EYLA 1D9SA 1N0RA 4LNUD 4ATZD 5KNGA 4LSZE 5EILA 3W9FA 3TWXA 2A5EA 4NIKA 1UOHA 5AQ7A 3V2XA 4O60A 4OAVB 1N0QA 1BI7B 1QYMA 3ZNGA 3B95A 4B93B 1SW6A 3UTMA 3D9HA 4HB5A 1A5EA 4BESA 4F1PA 2ETCA 2QYJA 3KEAA 2ZGGA 5KWDA 4HLLA 2KXPC 2ETAA 3Q9UC 4BETA 4Z68A 4QFVA 4G8LA 5FINA 5CEAA 5CECB 1K1BA 3AJIA 3LJNA 4J7WA 3TWTA 3DEOA 1YCSB 2QC9A 3ZKJA 1K1AA 4U8VD 1MX4A 3EHRA 5AQBA 4U96D 4UUCA 1N11A 3HRAA 4BSZB 5AQ9A 4A63B 1YYHA 5AARA 4HQDA 4O1PA 4U95D 3J5QB 5HRYA 2DVWA 1OY3D 5KNHD 1DC2A 2HE0A 3W9GA 5CERB 3TWWA 2F8XK 4OAUC 2XZTG 4DX1A 4DX2A 3JUEA 2DZNA 2DWZA 5EIBE 1G3NB 3EHQA 2ZGDA 2PNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEN A;  5D66 A;  3NOC D;  1OT8 A;  1MX6 A;  2RFM A;  4G8K A;  1NFI E;  4HNA D;  3ZUV B;  2Y0B G;  2BKG A;  5EYP F;  3TWS A;  3TWU A;  1MJ0 A;  3F6Q A;  3TWQ A;  5AN8 A;  4F6R D;  2DZO A;  3T8K A;  3Q9N C;  1IKN D;  5JMN D;  5CED B;  4RLY A;  2AJA A;  5KBA A;  2NYJ A;  3SO8 A;  3IXE A;  1AWC B;  3JXJ A;  4DX7 D;  1WG0 A;  2JAB A;  1AP7 A;  1BLX B;  1IXV A;  1MX2 A;  3V79 K;  4HRN A;  3NOG D;  4HBD A;  3V2O A;  3UXG A;  1MYO A;  5EN5 D;  3UI2 A;  3V31 A;  5EID A;  4BEP A;  4DRX E;  2V4H C;  1BI8 B;  5JA4 D;  2L6B A;  2BKK B;  4J8Y A;  2FO1 E;  2VGE A;  1K3Z D;  3DEP A;  2V5Q C;  3NBN B;  2J8S D;  1YMP A;  4DUI A;  1S70 B;  5BXO A;  4HI8 A;  2XZD G;  1DCQ A;  4GMR A;  3HG0 D;  4O1O A;  1BU9 A;  4CZ2 D;  5ENS D;  5CBO A;  4K5C A;  4DX5 D;  1IHB A;  5CBN A;  4BER A;  3J5P A;  4HI9 A;  3T9K A;  4HRM B;  3TWV A;  5FIO A;  4C48 B;  3EU9 A;  5ITZ F;  4CYM D;  2ETB A;  4TUM A;  5HS0 A;  5ENO D;  2MYO A;  2B0O E;  2KBX A;  2P2C P;  5BXU A;  5ENR D;  4ZFH A;  3TWR A;  4GPM A;  2XEE A;  3C5R A;  4YDY A;  4YDW A;  5AQA A;  1SVX A;  4HRL A;  4K5B A;  4U8Y D;  3JXI A;  3AAA C;  2F8Y A;  5ENT D;  5HKP A;  1TR4 A;  3V30 A;  4JB8 P;  4K5A B;  5AAO A;  5ENP D;  4LG6 A;  5ENQ D;  2Y1L E;  4DX6 D;  4N5Q A;  2XEH A;  1BD8 A;  3ZU7 B;  4QQI A;  2F37 A;  4ZHB A;  2RFA A;  1WDY A;  3B7B A;  5EYL A;  1D9S A;  1N0R A;  4LNU D;  4ATZ D;  5KNG A;  4LSZ E;  5EIL A;  3W9F A;  3TWX A;  2A5E A;  4NIK A;  1UOH A;  5AQ7 A;  3V2X A;  4O60 A;  4OAV B;  1N0Q A;  1BI7 B;  1QYM A;  3ZNG A;  3B95 A;  4B93 B;  1SW6 A;  3UTM A;  3D9H A;  4HB5 A;  1A5E A;  4BES A;  4F1P A;  2ETC A;  2QYJ A;  3KEA A;  2ZGG A;  5KWD A;  4HLL A;  2KXP C;  2ETA A;  3Q9U C;  4BET A;  4Z68 A;  4QFV A;  4G8L A;  5FIN A;  5CEA A;  5CEC B;  1K1B A;  3AJI A;  3LJN A;  4J7W A;  3TWT A;  3DEO A;  1YCS B;  2QC9 A;  3ZKJ A;  1K1A A;  4U8V D;  1MX4 A;  3EHR A;  5AQB A;  4U96 D;  4UUC A;  1N11 A;  3HRA A;  4BSZ B;  5AQ9 A;  4A63 B;  1YYH A;  5AAR A;  4HQD A;  4O1P A;  4U95 D;  3J5Q B;  5HRY A;  2DVW A;  1OY3 D;  5KNH D;  1DC2 A;  2HE0 A;  3W9G A;  5CER B;  3TWW A;  2F8X K;  4OAU C;  2XZT G;  4DX1 A;  4DX2 A;  3JUE A;  2DZN A;  2DWZ A;  5EIB E;  1G3N B;  3EHQ A;  2ZGD A;  2PNN A; 
#chains in the Genus database with same CATH topology
 1HF8 A;  3NOC D;  5KJL A;  1NP7 A;  4BX9 A;  3ZPJ A;  2AWI A;  5EYP F;  5KBA A;  3FY4 A;  5LP0 A;  4WNE A;  3B7R L;  2NYJ A;  4N3B A;  4LNB A;  2R03 A;  3UPV A;  2P9U G;  4HOT A;  2XCB A;  3CVY A;  4JL0 A;  4I9E A;  3ML8 A;  3CHR A;  3C3Q A;  5FZS A;  3IHV A;  3UUX A;  1UW4 B;  5FT9 A;  3FU0 A;  1H6P A;  4TXP A;  2WQH A;  2F0Y A;  1Z6T A;  4U8Y D;  2J09 A;  5E76 A;  1B89 A;  3FUM A;  3V30 A;  3LY7 A;  3Q4A B;  1KT0 A;  1TNB A;  3QAR A;  2HYZ A;  2BF0 X;  1NL4 A;  3FU3 A;  3HXE A;  2A5E A;  1E8Y A;  1ELR A;  3KSL A;  3Q49 B;  4F1P A;  4HLL A;  3HXD A;  5G05 J;  5BPP A;  4CEM A;  3LJN A;  4TV3 A;  4MS6 A;  3S7D A;  2WXO A;  3FUN A;  4XI0 A;  3HRA A;  3CKB A;  1Q2Z A;  3ASO E;  4Y6W A;  3ZIM A;  4ANV A;  3T5V A;  5KNH D;  3G2U A;  3Q7F A;  3T8M A;  2CHW A;  4OAU C;  2A4Z A;  5EIB E;  5FTP A;  3FH8 A;  4GB9 A;  1YA0 A;  1MJ0 A;  4RVB A;  3PUJ A;  4JHJ A;  3JYS A;  4LCT A;  3SF4 A;  2RG8 A;  5CMY A;  2XEV A;  4J8Y A;  2WQ7 A;  3QOU A;  5BXO A;  4IYP A;  1DCQ A;  2VSO E;  1HZ4 A;  2WXH A;  3ZVV A;  5DIZ A;  4FHK A;  3FUJ A;  3AG4 E;  3PZ4 A;  5LX8 A;  1SVX A;  1PY1 A;  3R7Q A;  3GW4 A;  4A3V A;  2EIJ E;  3RIB A;  2XEH A;  1L5J A;  2NXP A;  2OEW A;  4F3V A;  4LEU A;  2F37 A;  4U04 A;  2P9I G;  5FQ6 A;  3B7S A;  3MYV A;  3D9N A;  4AXH A;  4HB5 A;  4HOS A;  3TXM A;  2ETC A;  2VGX B;  3Q9U C;  2VGX A;  1K1B A;  4J7W A;  4LRZ A;  1YCS B;  2FF4 A;  3HXC A;  3DST A;  2LAI A;  3UKU G;  2XHE A;  2VQ2 A;  5ARG A;  2GRL A;  3VLE A;  3BG1 B;  4UWF A;  3SI5 A;  2ZGD A;  2PNN A;  3SFY A;  5T3R A;  2I1K A;  1OT8 A;  3LKU A;  4G8K A;  3I3N A;  3MJW A;  2AJA A;  3ENE A;  3SO8 A;  1WG0 A;  5D2M C;  1MX2 A;  2R17 C;  2CG3 A;  4BEP A;  3OAW A;  1DNP A;  3ASH A;  3DEP A;  3D3M A;  1YMP A;  3HG0 D;  1HU3 A;  3LEW A;  2XCC A;  5T4Y A;  4ILI A;  2KBX A;  5ENR D;  2XEE A;  4M7C A;  3CHS A;  3RJV A;  1UG3 A;  3OXG A;  2GGF A;  3FTW A;  4N5Q A;  1S64 A;  2BTD A;  2GRQ B;  2C0L A;  4ZHB A;  1RW2 A;  1WDY A;  3AS5 A;  3UM3 A;  4ATZ D;  5KNG A;  4K0R A;  4YDO A;  3QWV A;  3ZNG A;  3CQG B;  3L08 A;  4JEU A;  4B0Z A;  3AG1 E;  3KEA A;  3AG3 E;  3ABK E;  2IEJ A;  5B1A E;  4UWH A;  4GML A;  5FIN A;  4PS8 A;  5D0Q D;  4U96 D;  3O4Z A;  3GZS A;  4RQI A;  3FH5 A;  4K03 A;  5G05 C;  2XPZ A;  4JXT A;  2HE0 A;  5CER B;  2XPY A;  4JA9 A;  3RRM B;  2GRM A;  4KYO B;  4HNA D;  3ZUV B;  5B3S E;  3F6Q A;  2AXU A;  3C3O A;  1IKN D;  4NRH B;  1UJJ A;  2CHX A;  1AP7 A;  1MYO A;  3DXK G;  1BI8 B;  1E8X A;  2WMO A;  3FUH A;  2J07 A;  5FJY A;  3SNX A;  2RD0 A;  4KXK B;  4K5C A;  5CBN A;  3GZ1 A;  3SFZ A;  2V4L A;  1MQS A;  2ION A;  5FIO A;  3L13 A;  3VLF A;  3SGH A;  3FUK A;  3LVQ E;  3L6A A;  2YHC A;  3FUF A;  2MOW A;  2P9S G;  1K8K G;  4DI3 A;  3L82 A;  4LG6 A;  5ENQ D;  4DX6 D;  1OWM A;  4APF A;  4IRU A;  2RFA A;  4J8E A;  2KC7 A;  3CHP A;  2PQR A;  3D9H A;  5LOZ A;  4C0E A;  5LFA A;  2ZGG A;  3ZYQ A;  3MKQ B;  1TJF A;  3MKQ A;  2V5F A;  4WUY A;  3TJP A;  1E8W A;  3UT7 A;  5AQB A;  1JCR A;  3LY8 A;  2WM9 A;  1JPL A;  4RG9 A;  4FUL A;  1JUQ A;  4ABN A;  3MA5 A;  3L16 A;  3UT4 A;  1G3N B;  3EHQ A;  1FVF A;  5BNW A;  5AJD A;  2OND A;  4UQZ A;  3QAQ A;  3NAW A;  4DK5 A;  2YIN A;  3ONL A;  4URK A;  2E2E A;  5EN5 D;  3ZYM A;  2PM7 A;  1OWP A;  1BPO A;  2V5Q C;  2P9K G;  4C0M A;  3PZ3 A;  4HI8 A;  3U9W A;  3D9P A;  4L9P A;  2LUH A;  2UWJ G;  2YQ8 A;  4UI9 J;  3ASG A;  3J5P A;  4FLH A;  2ILR A;  3D9O A;  4UWG A;  4YDW A;  2IY0 C;  4HFG A;  3NF1 A;  5ENT D;  3ASN E;  1FVH A;  3UQ3 A;  4GZ5 A;  5G55 A;  5KCM A;  3I5P A;  4AEZ C;  4LNU D;  3UIO C;  1Z3Y A;  1LF8 A;  4M3O A;  3JUI A;  3ZEF A;  4GPK A;  1OXJ A;  4EZK A;  1QYM A;  4CGW A;  2OCC E;  3EHM A;  4L23 A;  1H2V C;  2XRY A;  4NUR A;  3AJI A;  3JQ0 A;  5JHB A;  4U0U A;  4WWO A;  3IBE A;  4CDN A;  1HG5 A;  4O1P A;  2DVW A;  4YDE A;  4JEH A;  2WVI A;  2IQC A;  4FLB A;  3RO3 A;  4J8F A;  2XEN A;  4GA0 A;  4I2W A;  1W3B A;  4I6J A;  2RFM A;  1Y8M A;  5A7D B;  3PUK A;  3T8K A;  2UY1 B;  3UIN C;  1IXV A;  4UWL A;  1IHG A;  3CEQ A;  5EID A;  2V4H C;  3ISM C;  4NAC A;  1S0P A;  5FQ8 A;  2WXN A;  2J8S D;  2NSZ A;  1ZU2 A;  4EBA G;  4BER A;  5A23 A;  4E6H A;  3ZGQ A;  5ENN A;  3JQ1 A;  2QY7 A;  4GCN A;  4CYM D;  4BY6 A;  3PDN A;  2IOL A;  4YDY A;  1SQM A;  4Q96 A;  3CST A;  1TN6 A;  2VSY A;  3ZW3 A;  5C1D A;  3IKO B;  4F1S A;  1IQR A;  3PE4 A;  2FI7 A;  2DCP A;  4L2Y A;  2FEZ A;  1LTX A;  3CHM A;  3HXB A;  3KAE A;  3QJZ A;  3UMV A;  4N2Q A;  2OOE A;  2WXF A;  5D0O D;  3HXF A;  5JJ7 A;  1INZ A;  3OXF A;  3EHN A;  2ETA A;  4XZ4 A;  4Z68 A;  4GTP A;  1HX8 A;  4BT9 A;  5A6C A;  4WWN A;  3N71 A;  3PEV B;  1N9A A;  4L1B A;  2ZU6 B;  3FEX A;  1H6O A;  2KM4 A;  3Q47 B;  3RAU A;  5HRY A;  3UX4 A;  2F8X K;  1U2V G;  3CVN A;  4DX2 A;  1UN9 A;  3U64 A;  4AP2 A;  3AS4 A;  3TWQ A;  5AN8 A;  3Q9N C;  2X6H A;  5BV1 A;  3PZ2 A;  3CVU A;  2P9L G;  3V2O A;  3UXG A;  2YHE A;  4EZJ A;  2KCV A;  3BU8 A;  2VTB B;  3VTY A;  2VTB A;  1WY6 A;  4FJY A;  3SBT B;  2YNQ A;  4I1A A;  5ITZ F;  2XS1 A;  2ETB A;  1OWO A;  4DLQ A;  3WXX A;  3ULE G;  4YND A;  3G2S A;  4EZL A;  2WMN A;  4CDR A;  3IV0 A;  4UI9 C;  2X3M A;  3ZHE B;  3ZHE A;  5AJL A;  4DI4 A;  4JA7 A;  1N4Q A;  2R02 A;  5EIL A;  4CT4 A;  4U63 A;  1QZ2 A;  2Y3A A;  3ASF A;  3MX3 A;  4I17 A;  3FTX A;  1FCH A;  1D8E A;  4G8L A;  1Z3X A;  3QKY A;  1O1S A;  4O6F A;  4BTA A;  2RKK A;  5AQ9 A;  3CHO A;  3DRA A;  3APF A;  3SQV A;  4WNG A;  3LPZ A;  3J5Q B;  4DX1 A;  3JUE A;  3FU5 A;  3TL5 A;  1OUV A;  2DWZ A;  3O48 A;  4I6E A;  4ANW A;  5DBK A;  4EEC A;  1HFA A;  2BKG A;  3TWS A;  2PM6 A;  2DZO A;  1SA4 A;  3CGH A;  2AXZ A;  4HBD A;  1E90 A;  3VTX A;  3S7B A;  3CR3 A;  5ARF A;  4A1G A;  2WXM A;  4JD2 G;  1XGW A;  5ENS D;  4Q94 A;  4DX5 D;  2BED A;  1HXI A;  1TYQ G;  3BQO A;  1JWG A;  2R05 A;  4D10 C;  3FTZ A;  1DVP A;  3HIZ A;  5HKP A;  5BUZ A;  4JB8 P;  4J8D A;  5AAO A;  4H7Y A;  3RO2 A;  3IHY A;  1N0R A;  5IY5 E;  3W9F A;  3FEY A;  1JWF A;  1N4R A;  4ILH B;  1FT1 A;  1H6K A;  2Q7F A;  2XS8 A;  1EDU A;  5CRU A;  3T5X A;  1E7U A;  2DIW A;  1O5M A;  4FJZ A;  3DEO A;  4APO A;  4C9B B;  4Q69 A;  3U4T A;  2P9N G;  4UUC A;  4AY5 A;  4XX5 A;  2WXI A;  2E0I A;  2LSU A;  1QQE A;  1OY3 D;  4CCA A;  2XZT G;  2ZIR A;  4GTT A;  2H6F A;  3CVP A;  3LJ3 A;  4PDX A;  4N3A A;  1NFI E;  1N95 A;  5AYW D;  3EUV A;  4F6R D;  2HM8 A;  3PS6 A;  1ELK A;  3FTV A;  4FA6 A;  2X6F A;  4DX7 D;  4G2V A;  2XRZ A;  2V8S E;  3TXN A;  1H2U A;  2M63 A;  5E75 A;  3C72 A;  4JW1 A;  4KZC A;  4HI9 A;  4L7T A;  3MV3 B;  4KT6 B;  3CK9 A;  3RSE G;  1OWN A;  2P2C P;  1LD8 A;  4HRL A;  3GYZ A;  2I1J A;  3BUA A;  5CMW A;  3LS8 A;  3AU5 A;  3CK8 A;  3UM2 A;  3GZ2 A;  4PS7 A;  4XI9 A;  1V54 E;  4FP7 A;  3LYA A;  4XIF A;  2AVP A;  4H7X A;  3SBS A;  2ZIS A;  1N52 A;  1MHQ A;  5KJK A;  2CFU A;  3I4R B;  4GTQ A;  2KXP C;  4AIF A;  4UQY A;  3CLJ A;  3FU6 A;  2EIM E;  3UT8 A;  3EU5 A;  3Q78 A;  4HOU A;  2X6J A;  4ACL A;  3SFX A;  1EYH A;  1UJK A;  4TRQ A;  1U3D A;  4CGV A;  2IO2 C;  1E96 B;  2DZN A;  3D9K A;  1TNZ A;  5BV0 A;  2IU1 A;  1WAO 1;  4PUC A;  4CT0 A;  2WXQ A;  3MKR A;  3PEU B;  3IXE A;  4TUU A;  3QB2 A;  4JC8 A;  3DPD A;  3RK6 A;  3SZ7 A;  2WXL A;  4R7L A;  4N39 A;  2I9C A;  3SD5 A;  3FUI A;  4GZD A;  1OCC E;  5JJ6 A;  5CRV A;  4GMR A;  4G11 A;  3MCX A;  4GCO A;  4ANU A;  2PL2 A;  4YVQ C;  3T9K A;  4WAF A;  2AW6 A;  3TWV A;  3ABM E;  2WXG A;  4KVM A;  3Q15 A;  3PNT B;  1KLX A;  3PVL A;  3B13 A;  4J0U A;  1GW6 A;  4ME2 A;  3JXI A;  4N2S A;  4FHJ A;  1E8Z A;  4HVB A;  4GZ6 A;  1QNF A;  4I1M A;  3QNK A;  2Y1L E;  2X6K A;  4CDM A;  1JCS A;  4UI9 K;  3TWX A;  4NIK A;  3V2X A;  1N0Q A;  3HHM A;  4TXQ A;  1KPS B;  4ACK A;  4GTO A;  1TN8 A;  4AJW A;  3EDT B;  4JHR A;  1ZB1 A;  5BW8 C;  3QK0 A;  3PZD A;  4GA2 A;  4B8C B;  5J08 A;  3MV2 B;  1MZC A;  4FU3 A;  3ESK A;  2J4D A;  2H6H A;  3DSS A;  3UKR G;  4A63 B;  1YYH A;  2WXK A;  3HVE B;  4PS3 A;  4AV7 A;  3HVE A;  4LNG A;  3PZ1 A;  3W9G A;  2KCK A;  2XQ0 A;  2JLB A;  1DCE A;  4OVV A;  5C2Y A;  4JVS A;  3E37 A;  2PZI A;  4U0Z A;  5CED B;  3G2W A;  1AWC B;  3NOG D;  4I9C A;  4WND A;  4GTS A;  3CVQ A;  2L6J A;  2EIL E;  4L2L A;  2P9P G;  2PQN A;  3DPY A;  3DBS A;  3QDN A;  2VJ8 A;  4FAD A;  3FFL A;  4GZ3 A;  4O1O A;  3L22 A;  4A1S A;  2J08 A;  2LSV A;  3URZ A;  3E32 A;  3P1U A;  4HRM B;  2XPI A;  3IEG A;  4LUN U;  5HS0 A;  4ZFH A;  1HH8 A;  3C5R A;  3ZRH A;  4K5B A;  2F8Y A;  4W9R A;  2R5S A;  3ML9 A;  4GA1 A;  3ZU7 B;  4QQI A;  3PRZ A;  2I6H A;  3LVR E;  4BFR A;  2GRR B;  3RRU A;  2A5U A;  5AQ7 A;  2L0I A;  1SW6 A;  3UTM A;  4OVU A;  5FQ7 A;  4BET A;  2XGS A;  3VLD A;  4I2Z A;  3TWT A;  3ZKJ A;  3QWP A;  3ULY A;  5HI7 A;  4GYY A;  1WM5 A;  4HQD A;  3FTU A;  4EBA A;  1N4P A;  1H19 A;  4G24 A;  4RSY A;  3TWW A;  3FHE A;  4XKB A;  4CZ2 D;  3ABL E;  3CV0 A;  3R9M A;  5FWQ A;  3FUL A;  2R59 A;  2DYS E;  3D9M A;  2Y0B G;  3OTN A;  2IO3 C;  3ONK A;  3ZXP A;  2QZA A;  3E30 A;  3LDZ A;  3UI2 A;  2X6I A;  2BKK B;  1K3Z D;  3RRN B;  3R7R A;  4DUI A;  5LCW J;  2XZD G;  4GZC A;  2CHZ A;  1NA0 A;  1HO8 A;  5M72 A;  4PH4 B;  3FUD A;  3CSF A;  2XGM A;  4TUM A;  1FT2 A;  4GPM A;  5AQA A;  3HYM B;  1TR4 A;  3I4G A;  3PNL B;  3BEE A;  3ZFW A;  4G26 A;  4F7A A;  3RKV A;  3B7B A;  1H2T C;  4XE0 A;  3UM0 A;  3CVL A;  3U3W A;  4RG6 A;  4NQ0 A;  3AG2 E;  3C98 A;  1O1R A;  3Q7A A;  5CCL A;  3EHR A;  2WXJ A;  1X5B A;  3DWL G;  3MEK A;  1TEZ A;  1X81 A;  3ASD A;  2Y69 E;  3UM1 A;  2J9Q A;  1U3C A;  2KAT A;  4MKT A;  3SY2 A;  3NZS A;  2H6I A;  4KZ0 A;  4JPS A;  3FWV A;  3ZN3 A;  4DLO A;  3ZYK A;  3NZU A;  4GU5 A;  5ANR A;  3TWU A;  4KBQ A;  1XNF A;  5JMN D;  4RLY A;  3D9J A;  4BX8 A;  2NC9 A;  3SHF A;  3B7U X;  1PC2 A;  1NZN A;  1BLX B;  3LXU X;  4TXR A;  4HRN A;  3ULQ A;  4HXI A;  3MGB A;  3CVX A;  3KEZ A;  4A55 A;  4U0S A;  2FO1 E;  3Q75 A;  4CRW A;  3APC A;  5B1B E;  1OCZ E;  4I6G A;  4JZY A;  5AIJ A;  3L9T A;  3HDX A;  4U8H A;  1NI1 A;  1TNY A;  2MYO A;  4MBG A;  5FZQ A;  1UN8 A;  3AAA C;  4GTV A;  3ESL A;  5EKQ D;  4K5A B;  5H7P A;  3R9A B;  4BWR A;  5KJN A;  1E7V A;  5ANL A;  4LSZ E;  1HE8 A;  2HO1 A;  4EPZ A;  1UOH A;  3KSQ A;  4O60 A;  2XGO A;  1N4S A;  3S7F A;  1BI7 B;  2JEK A;  1A5E A;  3Q79 A;  3WG7 E;  1IQU A;  3NQP A;  2IFU A;  4GMJ A;  5KWD A;  3MZL B;  1SA5 A;  2EIN E;  2QC9 A;  5KJM A;  1K1A A;  1VDY A;  1MX4 A;  4J8S A;  3QWW A;  4GYO A;  4U95 D;  3DSX A;  2GRN B;  2LXM A;  4B89 A;  2WXR A;  4Y6C A;  3PRE A;  4UQX A;  3G2V A;  5D66 A;  1ZBP A;  2EQX A;  1MX6 A;  5T8I A;  1A17 A;  3S2A A;  2JAB A;  4G25 A;  3V31 A;  1H0A A;  1EF1 C;  2FBN A;  4WWP A;  5EX0 A;  4DRX E;  2MHK A;  1JCQ A;  4V3I A;  5G2N A;  1IYG A;  5FQ4 A;  3K9I A;  1BU9 A;  3KD7 A;  3QC1 A;  4KVO A;  4GYW A;  4HOR A;  3E34 A;  4J6I A;  4MLP A;  2B0O E;  3TWR A;  1RZ4 A;  1PAQ A;  5LCW C;  4XEI G;  2I2O A;  3DSU A;  3ZXS A;  4X8Q A;  2CFZ A;  4AY6 A;  5JJT A;  5EYL A;  3CVW A;  1OCO E;  3FP3 A;  1SZ9 A;  5CCM A;  2L0T B;  4JHK A;  1TNU A;  4BT8 A;  4I1O B;  2HR2 A;  2C2L A;  3KS2 A;  3EIJ A;  5G04 J;  4GTR A;  2WB2 A;  2V0P A;  3PE3 A;  3BG0 B;  3Q73 A;  5CEA A;  5CEC B;  2VYI A;  1EPU A;  4BTB A;  4MRU A;  3TGO A;  4AM9 A;  3U66 A;  2ZXW E;  2IOS A;  4UWK A;  4U07 A;  4DPR A;  5AEN A;  3LCA A;  2QYU A;  4B8A A;  4GTM A;  1DC2 A;  1V55 E;  3G2T A;  2P58 C;  3AU4 A;  4G1T A;  4E85 A;  2GRP B;  2VSN A;  4A3T A;  2OEV A;  5HQ8 A;  4YVO A;  3JXJ A;  3E33 A;  1O1T A;  5JA4 D;  3AS8 A;  4LER A;  4B94 A;  1S70 B;  5CBO A;  3CQC B;  1IHB A;  1LD7 A;  3FTY A;  3E4B A;  4U7E B;  3FTS A;  4P29 A;  3D9L A;  4IUL A;  4N3C A;  2GRO B;  1HS6 A;  3S7J A;  4DJA A;  2OVF A;  5EX3 A;  2C0M A;  3TG5 A;  3P2B A;  2LAH A;  3CK7 A;  5ENP D;  5JHA A;  3CIA A;  3NB2 A;  3PH0 C;  1D9S A;  1ELW A;  1HG2 A;  5BT1 A;  4OAV B;  2VSX E;  3ZYL A;  2FUL A;  3B95 A;  4I43 A;  4HOQ A;  4HLE A;  1NA3 A;  2VGY A;  4BES A;  4HS2 A;  5CHE E;  4N5C A;  1SZA A;  2GW1 A;  2H6G A;  5J90 A;  4BSX A;  3X2Q E;  4EHM A;  2FO7 A;  3OXL A;  4GAA A;  1N11 A;  3L17 A;  4BSZ B;  4WNF A;  2OV8 A;  1OCR E;  3B7T A;  5FZR A;  3DSW A;  2X38 A;  3DSV A;  2OVB A;  2KCL A;  2WXP A;  1OWL A;  2WPV A;  2KZT B;  2KZT A;  3DXM G;  2BUG A;  4FC8 A;  3FH7 A;  4ANX A;  2IF4 A;  4F53 A;  3EJN A;  1D8D A;  4OYS A;  1S63 A;  1FPP A;  2Y4T A;  3TG4 A;  1KZP A;  2LXL A;  1N94 A;  1Y6I A;  3V79 K;  4G23 A;  2J49 A;  3FUE A;  2L6B A;  2AXV A;  3EIQ C;  3RU0 A;  2VGE A;  3NBN B;  4AVX A;  3CKC A;  2IJG X;  3UIP C;  4XKC A;  3LY9 A;  2B6C A;  2MRI A;  1KT1 A;  1TJC A;  3L54 A;  4C48 B;  3EU9 A;  1TNO A;  2EIK E;  5ENO D;  5BXU A;  3D9I A;  1KZO A;  1QBQ A;  2DBA A;  2Y4U A;  2J4B A;  1BD8 A;  3JCK C;  3Q5M A;  3APD A;  1P5Q A;  3FDH A;  3TAX A;  2R2L A;  4IN3 B;  2LNI A;  4B93 B;  2QYJ A;  4ATG A;  4ILG A;  4EQF A;  1TN7 A;  3C3R A;  5EDS A;  4AOF A;  4QFV A;  4KMO A;  4U8V D;  2LO6 A;  1Z5S C;  2UY1 A;  2CG2 A;  5G04 C;  5AAR A;  2DYR E;  2QFC A;  3CHQ A;  1N54 A;  3CVV A;  2L9B A;  2WQ6 A; 
#chains in the Genus database with same CATH homology
 2XEN A;  5D66 A;  3NOC D;  1OT8 A;  1MX6 A;  2RFM A;  4G8K A;  1NFI E;  4HNA D;  3ZUV B;  2Y0B G;  2BKG A;  5EYP F;  3TWS A;  3TWU A;  1MJ0 A;  3F6Q A;  3TWQ A;  5AN8 A;  4F6R D;  2DZO A;  3T8K A;  3Q9N C;  1IKN D;  5JMN D;  5CED B;  4RLY A;  2AJA A;  5KBA A;  2NYJ A;  3SO8 A;  3IXE A;  1AWC B;  3JXJ A;  4DX7 D;  1WG0 A;  2JAB A;  1AP7 A;  1BLX B;  1IXV A;  1MX2 A;  3V79 K;  4HRN A;  3NOG D;  4HBD A;  3V2O A;  3UXG A;  1MYO A;  5EN5 D;  3UI2 A;  3V31 A;  5EID A;  4BEP A;  4DRX E;  2V4H C;  1BI8 B;  5JA4 D;  2L6B A;  2BKK B;  4J8Y A;  2FO1 E;  2VGE A;  1K3Z D;  3DEP A;  2V5Q C;  3NBN B;  2J8S D;  1YMP A;  4DUI A;  1S70 B;  5BXO A;  4HI8 A;  2XZD G;  1DCQ A;  4GMR A;  3HG0 D;  4O1O A;  1BU9 A;  4CZ2 D;  5ENS D;  5CBO A;  4K5C A;  4DX5 D;  1IHB A;  5CBN A;  4BER A;  3J5P A;  4HI9 A;  3T9K A;  4HRM B;  3TWV A;  5FIO A;  4C48 B;  3EU9 A;  5ITZ F;  4CYM D;  2ETB A;  4TUM A;  5HS0 A;  5ENO D;  2MYO A;  2B0O E;  2KBX A;  2P2C P;  5BXU A;  5ENR D;  4ZFH A;  3TWR A;  4GPM A;  2XEE A;  3C5R A;  4YDY A;  4YDW A;  5AQA A;  1SVX A;  4HRL A;  4K5B A;  4U8Y D;  3JXI A;  3AAA C;  2F8Y A;  5ENT D;  5HKP A;  1TR4 A;  3V30 A;  4JB8 P;  4K5A B;  5AAO A;  5ENP D;  4LG6 A;  5ENQ D;  2Y1L E;  4DX6 D;  4N5Q A;  2XEH A;  1BD8 A;  3ZU7 B;  4QQI A;  2F37 A;  4ZHB A;  2RFA A;  1WDY A;  3B7B A;  5EYL A;  1D9S A;  1N0R A;  4LNU D;  4ATZ D;  5KNG A;  4LSZ E;  5EIL A;  3W9F A;  3TWX A;  2A5E A;  4NIK A;  1UOH A;  5AQ7 A;  3V2X A;  4O60 A;  4OAV B;  1N0Q A;  1BI7 B;  1QYM A;  3ZNG A;  3B95 A;  4B93 B;  1SW6 A;  3UTM A;  3D9H A;  4HB5 A;  1A5E A;  4BES A;  4F1P A;  2ETC A;  2QYJ A;  3KEA A;  2ZGG A;  5KWD A;  4HLL A;  2KXP C;  2ETA A;  3Q9U C;  4BET A;  4Z68 A;  4QFV A;  4G8L A;  5FIN A;  5CEA A;  5CEC B;  1K1B A;  3AJI A;  3LJN A;  4J7W A;  3TWT A;  3DEO A;  1YCS B;  2QC9 A;  3ZKJ A;  1K1A A;  4U8V D;  1MX4 A;  3EHR A;  5AQB A;  4U96 D;  4UUC A;  1N11 A;  3HRA A;  4BSZ B;  5AQ9 A;  4A63 B;  1YYH A;  5AAR A;  4HQD A;  4O1P A;  4U95 D;  3J5Q B;  5HRY A;  2DVW A;  1OY3 D;  5KNH D;  1DC2 A;  2HE0 A;  3W9G A;  5CER B;  3TWW A;  2F8X K;  4OAU C;  2XZT G;  4DX1 A;  4DX2 A;  3JUE A;  2DZN A;  2DWZ A;  5EIB E;  1G3N B;  3EHQ A;  2ZGD A;  2PNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...