2P9PG

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
143
structure length
128
Chain Sequence
b'ARFRKVDVDEYDENKFVDGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSSSAVLLQWHEKALAAGGVGSIVRVLTARKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 39
structure length 128
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9pG00
3DXMG 2P9LG 3ULEG 1TYQG 2P9IG 2P9KG 2P9NG 3RSEG 1K8KG 2P9UG 1U2VG 4JD2G 2P9PG 3DXKG 4XEIG 3UKRG 3DWLG 3UKUG 2P9SG
chains in the Genus database with same CATH superfamily
1WAO1 2EILE 3FFLA 2DBAA 4APFA 3CHSA 3ONLA 2ZGGA 4U63A 4GA2A 4I1MA 4KZCA 2GRLA 3LPZA 1NZNA 4C48B 3GZSA 3RIBA 4J8FA 3IEGA 2XEEA 5JJ7A 2YNQA 2HYZA 4KVOA 1EDUA 4CDRA 4BFRA 2XPIA 2H6FA 1JUQA 3HXFA 4GTRA 5AIJA 2WXJA 4BEPA 3PZ2A 3CV0A 4F6RD 2XRYA 1DNPA 4XZ4A 3PNLB 4FLBA 4BX9A 1H2TC 2OCCE 1BLXB 2R17C 4K5BA 3E30A 5G04J 3FEYA 4GCNA 3T8KA 3PS6A 3DSVA 5FTPA 4CRWA 4HI9A 2FULA 4CDMA 4ACLA 2J09A 1H19A 3UUXA 3AS4A 3D9OA 4KBQA 2YINA 3LXUX 3CKBA 3ISMC 2R5SA 4K03A 1N0QA 2P9NG 3TG4A 2P9UG 3LYAA 2GRNB 4I1AA 4AVXA 5EIDA 4U0SA 3VTXA 5BXOA 3OXFA 5T3RA 3TWUA 3BEEA 3FTUA 1V54E 3CK9A 2BTDA 3SFXA 3FP3A 4DLQA 5C2YA 3MEKA 3BUAA 3B7TA 3T9KA 3VTYA 2UY1A 5CEAA 3JUEA 4BT9A 2OEVA 1EPUA 4KYOB 3B7RL 1HH8A 4NRHB 3CR3A 1K8KG 4A1GA 2F8XK 4EZJA 3IKOB 4IRUA 4WWOA 5BPPA 3QNKA 2CG3A 5HKPA 5LCWJ 2CFUA 3UKUG 2DIWA 3TL5A 5FZSA 2KC7A 1MX4A 4FULA 1HG5A 3L08A 2J4BA 2PM6A 3O48A 1E8ZA 1Z5SC 1E96B 3T5XA 1UG3A 4C9BB 2WXKA 3S7JA 2XQ0A 1IHGA 2F37A 1BI8B 2WVIA 5ENTD 4C0EA 3CSTA 2QC9A 2WM9A 3D9JA 2R02A 5FQ6A 4JHRA 3DSWA 5AN8A 4IYPA 4HOQA 1L5JA 2KBXA 1IKND 1FCHA 4EBAG 1SA5A 1NL4A 2RG8A 3WG7E 2BEDA 1ELWA 4BSXA 1MX2A 1BI7B 1UJKA 1PC2A 2DYSE 5ENSD 3ASDA 1SA4A 4JVSA 3SZ7A 1O1SA 4ILGA 1E8XA 5AARA 5FQ8A 1H2VC 3R9AB 3Q9NC 4G8LA 4TXQA 4ABNA 2VGYA 4Q94A 1N9AA 4F53A 4U8HA 3FHEA 4DX6D 2VTBA 3EHNA 3UXGA 1ZU2A 3JUIA 3ABME 5FIOA 5CRUA 2WPVA 4P29A 4UUCA 3CSFA 1TNYA 4U0ZA 3PEUB 3JYSA 3Q4AB 5KJMA 4BWRA 4I9EA 4X8QA 1IYGA 3D9LA 1N94A 5C1DA 4A1SA 5CBNA 5IY5E 4RG9A 1ZB1A 4F1SA 3FH8A 3LJ3A 3EDTB 4AP2A 3ONKA 4ILIA 2LAHA 4N3CA 4XIFA 3HHMA 3BQOA 3QARA 1KT1A 2AXZA 1K1AA 4WNGA 4NIKA 3E37A 4AIFA 3SI5A 4N39A 5A6CA 5CERB 1VDYA 1ELKA 5CRVA 3TG5A 3FUKA 1MYOA 3IXEA 3FU0A 4DPRA 3F6QA 3I5PA 4FHJA 2XGOA 3Q75A 5AJDA 2XHEA 1OCZE 3UT7A 4BETA 3G2UA 5JJ6A 5FWQA 4HXIA 4N5CA 5D2MC 4Z68A 2IOSA 3W9GA 4DUIA 1Z3XA 1NA3A 3EU9A 4J8EA 3UINC 4B8CB 2ILRA 4EECA 3TJPA 4JXTA 4TUUA 4UWKA 5EIBE 3D9NA 1OWMA 2CFZA 1INZA 1N4PA 4IN3B 3MGBA 4I2WA 1RW2A 3UM2A 3DSUA 1TNUA 1YMPA 2FEZA 3J5PA 4UQYA 3S7DA 2P9PG 4DRXE 2JABA 2GRPB 1LTXA 3SBSA 4DJAA 2WXRA 5CECB 4JEUA 3DSXA 3D9HA 3ULQA 4I43A 2VSNA 2XZDG 4AXHA 2DCPA 5G2NA 3UQ3A 4NURA 4OVVA 3ZN3A 3UT4A 3RJVA 2X38A 3JQ1A 5ITZF 5BUZA 3LVQE 3AG1E 2VTBB 2WXMA 4PS7A 3DEPA 3CK8A 4G23A 1OCOE 2X3MA 1K3ZD 3UTMA 1KPSB 3LY7A 4HOTA 4HS2A 3CVYA 4CZ2D 3E4BA 3AG2E 4CDNA 3ZVVA 4XKCA 3UM3A 3HXBA 5B1AE 4HORA 2E0IA 1D8DA 3ZKJA 4U8VD 4KT6B 3ZYLA 3U4TA 4Q69A 3NF1A 2LNIA 2LSUA 3QWPA 3CVLA 1H6KA 4GTQA 3FUMA 2WXGA 5D0QD 2HO1A 3UIPC 5DBKA 1MX6A 2XCBA 3LS8A 5AQAA 1TJFA 4DI4A 5BV0A 2P9KG 3NBNB 4N2QA 4B89A 3CHQA 4DLOA 3W9FA 1U2VG 1X81A 3FU5A 3CVPA 4HVBA 2EIME 4WWPA 1OT8A 3CHOA 5ANLA 2HE0A 1H0AA 4A55A 2P9IG 3S7BA 3C5RA 1DC2A 2ETCA 3L54A 1IQRA 5D0OD 3QB2A 2B0OE 1FVFA 3V30A 5DIZA 3Q9UC 1TEZA 3PZDA 3JXJA 3TWRA 3N71A 4U07A 4MRUA 3C98A 3Q7FA 5A23A 3FU6A 3TWXA 2VYIA 4LG6A 4H7XA 2UWJG 4E6HA 1P5QA 1X5BA 4G24A 4KXKB 4XKBA 3PZ1A 3QAQA 4HLLA 5ANRA 5BXUA 4F7AA 5HRYA 4YDEA 5G05J 4CGVA 5T8IA 3DBSA 3S2AA 3B7BA 4E85A 3HXDA 2X6JA 1KZPA 3PUKA 2ZXWE 2XGSA 4PS8A 4EZLA 3CHPA 1LD8A 4YDYA 2IO2C 2ETAA 3QDNA 3VLEA 3ASHA 3TWVA 5ENPD 1IXVA 5FJYA 1JCRA 2IO3C 4ME2A 4GZ6A 1O1TA 1N4SA 1UOHA 5JMND 3CIAA 3QJZA 2KM4A 1A5EA 3V2OA 3L13A 2YHEA 3T8MA 2KXPC 3QWVA 3RRNB 2AXUA 3PVLA 2AW6A 1LD7A 4L7TA 3K9IA 3CVVA 4I6JA 4PUCA 2DWZA 1WM5A 2KCLA 4ATGA 4F1PA 2LO6A 4GZDA 3UI2A 4ACKA 4GTVA 4BTAA 3HIZA 1OWLA 4XI0A 3FDHA 3PH0C 3TWSA 3UMVA 3X2QE 5HQ8A 1GW6A 4G26A 4I1OB 2AWIA 1Y6IA 3B7UX 3FTSA 3S7FA 3Q78A 4JHKA 2XS1A 4LNUD 3FTYA 4HLEA 4R7LA 1H2UA 3Q73A 2BKKB 4FA6A 1JPLA 1HF8A 1S0PA 5AAOA 4JZYA 4U04A 2L9BA 3MKQA 3HVEA 2IEJA 3HXEA 4JB8P 3FU3A 4GB9A 2A4ZA 3ZHEA 5LP0A 1S70B 2IFUA 1N52A 5EN5D 1SQMA 1DCQA 4J8DA 2AVPA 3O4ZA 3PZ3A 1EYHA 2GRQB 1KT0A 3FUHA 2VSOE 3TWWA 4CCAA 3UIOC 2IONA 1TYQG 1WDYA 4WUYA 4O1PA 5FQ7A 2X6IA 4I9CA 3L16A 4L9PA 3SD5A 5CMWA 3V2XA 4WWNA 4RSYA 2Y3AA 5LFAA 3EUVA 3CVUA 2J9QA 2I1KA 3ZUVB 3L22A 3ZPJA 4F3VA 2WB2A 3CVXA 1TNOA 2QYUA 3PZ4A 4A63B 3Q7AA 1IQUA 1NI1A 2WXNA 3ZRHA 5ENRD 3ESLA 5ENOD 3QWWA 5HS0A 1QYMA 1HX8A 2PNNA 3KS2A 2VJ8A 4AY6A 5EKQD 3D9IA 5J90A 2CG2A 2MHKA 5JJTA 4L2LA 4JL0A 5KNGA 1TJCA 1WG0A 3FEXA 1E8WA 3IBEA 1XGWA 2GRMA 3ZGQA 3DSSA 2EIJE 4M3OA 3NZUA 2P58C 3LVRE 4J8SA 4UI9C 1HU3A 3LCAA 1OCRE 3C72A 2IU1A 5H7PA 3L82A 4TXRA 3VLFA 3EJNA 4QFVA 3KSQA 4HB5A 1SVXA 2WXPA 2LAIA 2UY1B 4OYSA 3SQVA 2GRRB 1SW6A 1BD8A 4CT0A 2OV8A 2YQ8A 3PNTB 1SZAA 4BT8A 3G2WA 4D10C 4MS6A 3EU5A 3HG0D 4J7WA 4ANXA 5ARFA 1N54A 4FP7A 4DX2A 3HVEB 4L23A 2RFAA 4GZ3A 2WXFA 5BNWA 2CHZA 2HR2A 1G3NB 3UKRG 3UM1A 3ZHEB 4YVQC 3PRZA 4GMLA 3Q15A 1YYHA 1JWFA 1HXIA 1E8YA 1W3BA 4G8KA 1ELRA 4DI3A 3ASNE 3ABKE 1AWCB 3JCKC 4RG6A 4Y6CA 4EBAA 2EINE 5KNHD 5JHBA 1JWGA 5BT1A 1PY1A 3KAEA 2NXPA 4J6IA 1U3CA 3PDNA 2PZIA 4WAFA 1O1RA 1H6OA 3MV3B 3SO8A 1JCQA 4RVBA 3U3WA 5ARGA 2WMNA 3TWTA 2DYRE 2VGXA 3G2TA 5BW8C 3ZNGA 5KCMA 4FC8A 4OVUA 1DCEA 1HG2A 1Z6TA 2BF0X 3B13A 3ESKA 2R2LA 5AQ9A 4XI9A 3OTNA 2XPYA 4XE0A 4ANWA 2J08A 3HRAA 1A17A 2FI7A 3PREA 2XCCA 1UW4B 3FH7A 2ZU6B 4FJZA 4UWLA 3D3MA 3SNXA 5G04C 4ANVA 2OOEA 3BU8A 3SY2A 4HRLA 2P9LG 3AS5A 1N95A 3FULA 4O60A 1H6PA 1KZOA 3I3NA 1TN8A 3MA5A 3R7RA 1TN7A 1TNZA 4UI9J 4U96D 4GZCA 3CEQA 1NA0A 1KLXA 3UPVA 2LXMA 4CYMD 2WXIA 4MLPA 1HFAA 5AJLA 3SHFA 3U9WA 4GPMA 3P2BA 5B1BE 1QQEA 3D9PA 1K1BA 2VGEA 2WXLA 2Y4TA 1V55E 4JHJA 2ONDA 2PQRA 4LNGA 3APCA 4H7YA 3RRUA 3DPYA 2R05A 3MZLB 3MJWA 1OXJA 4U95D 3NQPA 1HS6A 4HQDA 2KZTA 2Y69E 3MYVA 3APFA 4LNBA 4B8AA 3CGHA 4ZFHA 4N3AA 2IF4A 3RAUA 4HRNA 3ML9A 4XEIG 1E7VA 1NFIE 4PS3A 3CHRA 3BG0B 3KD7A 2WXHA 4GPKA 4KMOA 2A5UA 3JXIA 5LCWC 2J07A 2XEHA 3HXCA 3QOUA 3BG1B 2I6HA 3U64A 4MKTA 3Q49B 4TUMA 2LUHA 3DWLG 1QBQA 2QY7A 1S63A 3RRMB 1JCSA 1RZ4A 1MQSA 3LY8A 4GU5A 3AG3E 4A3TA 5FINA 3SGHA 4JPSA 4N3BA 3URZA 2WXOA 3MX3A 2IOLA 4G2VA 3Q47B 2RFMA 4WNDA 3RO3A 1UN9A 3FY4A 2KATA 2PQNA 2C2LA 4UI9K 1D9SA 3HDXA 3TWQA 2V4LA 3FUIA 3ZFWA 1N4RA 4GAAA 4URKA 2I9CA 1SZ9A 3NAWA 4LRZA 3L6AA 2F0YA 4IULA 4NQ0A 4JA9A 2P9SG 5LOZA 1TN6A 2A5EA 4GTPA 2WQ7A 4J8YA 4I6EA 4UWFA 4AY5A 3FTZA 2DZOA 3EIJA 4HBDA 3FUDA 3TGOA 2OVFA 3G2VA 2AJAA 3Q79A 3R9MA 4N5QA 4UWGA 4HFGA 3AU4A 3APDA 5J08A 3DPDA 1Z3YA 5AYWD 2OEWA 5AQ7A 2GW1A 4AV7A 4CT4A 4GTTA 4GYWA 3GW4A 4WNFA 4GZ5A 2WMOA 3CHMA 3P1UA 2FF4A 3GZ1A 2R59A 3ASFA 2Y1LE 4GYYA 1TNBA 2IQCA 3NB2A 4O1OA 2KZTB 1Q2ZA 1TR4A 4FHKA 3DEOA 3MV2B 4UQXA 1B89A 2Y4UA 4G11A 4JD2G 3AAAC 3EHRA 1PAQA 2QFCA 3TXMA 4B94A 4I2ZA 3SF4A 5A7DB 4ZHBA 2ZISA 2BKGA 2F8YA 1MZCA 3L17A 2EIKE 1YCSB 2V5FA 4WNEA 1O5MA 5KJKA 3ZU7B 4AEZC 3ASOE 2L0IA 5AQBA 3TAXA 3E33A 4G1TA 4OAUC 1FPPA 4ANUA 3Q5MA 3OXGA 3B95A 4YDOA 2QYJA 3ML8A 3AS8A 2B6CA 3B7SA 2L0TB 2H6GA 1FT1A 4J0UA 3C3RA 4U0UA 2XS8A 4AOFA 3IV0A 4ILHB 3U66A 5AENA 2LSVA 2WQHA 4TV3A 2MRIA 3UT8A 2HM8A 2V8SE 4UWHA 3WXXA 4FADA 5HI7A 1E90A 3ABLE 4Q96A 3PE4A 3D9MA 4TXPA 2H6IA 1OCCE 3JQ0A 2V0PA 2KCVA 3EHQA 5D66A 5E76A 2KCKA 3UX4A 2Y0BG 3I4RB 2PM7A 1BU9A 5FT9A 4BERA 2H6HA 2OVBA 4O6FA 2C0LA 4A3VA 4GA1A 3CVNA 4GTMA 2MYOA 4BY6A 4HI8A 4JC8A 4JW1A 4U7EB 1Y8MA 4LEUA 3KEZA 4V3IA 5JA4D 4APOA 4FJYA 5EYLA 3ZEFA 2I1JA 5JHAA 2XGMA 2CHWA 2Q7FA 3D9KA 5KWDA 3FUEA 4L1BA 4NACA 1ZBPA 5KJLA 2BUGA 2AXVA 4LUNU 2FO7A 4MBGA 4RQIA 3QK0A 1YA0A 3L9TA 2X6KA 4BTBA 3LKUA 3J5QB 1OY3D 4DX1A 3MCXA 3I4GA 4ATZD 3CLJA 1MHQA 2VSXE 2V4HC 1S64A 3UM0A 4PH4B 5LX8A 3CVQA 5B3SE 1OUVA 4EQFA 4CEMA 5CEDB 2NYJA 2JLBA 2FO1E 3DSTA 3FTWA 4UQZA 3KSLA 3RU0A 5FZRA 2XZTG 2J49A 3MKQB 3G2SA 4TRQA 3RKVA 3R7QA 4GTOA 5T4YA 5EYPF 2E2EA 3DRAA 4G25A 3AU5A 2ZGDA 5FQ4A 4HOUA 2ZIRA 3SBTB 3ULEG 2WQ6A 3ZYQA 2MOWA 4N2SA 2DZNA 4JEHA 4GA0A 1HE8A 3FTVA 3FTXA 3ZYMA 4HOSA 1UJJA 3SFYA 1OWPA 3ZW3A 1N4QA 4L2YA 1FT2A 3EHMA 2QZAA 4EZKA 5E75A 2RD0A 3CKCA 2V5QC 3C3QA 2IY0C 2ETBA 1NP7A 4GCOA 1N0RA 5M72A 3GYZA 2VSYA 2NSZA 3DXMG 3RO2A 3ENEA 4JA7A 3EIQC 3RK6A 3QC1A 4B93B 4GMJA 5EX3A 4OAVB 1DVPA 2J4DA 1OWOA 4CGWA 3OAWA 2NC9A 3AJIA 2I2OA 4EHMA 3AG4E 3OXLA 4GTSA 3LJNA 5ENQD 2L6BA 4BSZB 4B0ZA 2L6JA 4KVMA 4DX7D 2X6HA 3FUNA 1OWNA 2XPZA 5G05C 3QKYA 4I6GA 2EQXA 3FUJA 2CHXA 3DXKG 3TXNA 2LXLA 3FWVA 4LERA 2PL2A 3E32A 2XEVA 1BPOA 3ZIMA 4FU3A 3LDZA 3CQGB 4YNDA 3LY9A 3ZXPA 5CHEE 3ZYKA 3LEWA 5CBOA 2IJGX 4DX5D 4M7CA 4QQIA 4LSZE 2RKKA 4BX8A 5ENNA 2X6FA 2DVWA 5KBAA 2XRZA 2J8SD 2VQ2A 1HZ4A 3E34A 1N11A 3PEVB 4K0RA 4DK5A 2WXQA 4W9RA 3CVWA 2R03A 3GZ2A 4C0MA 3ASGA 1AP7A 2XENA 4YDWA 4AJWA 5BV1A 5G55A 1LF8A 4FLHA 4Y6WA 2C0MA 1D8EA 1E7UA 1QZ2A 1WY6A 4GMRA 5EDSA 4I17A 3NOGD 1FVHA 3CK7A 3MKRA 1HO8A 3CQCB 4HNAD 3HYMB 3PE3A 3ULYA 5FZQA 5CCMA 2GGFA 1U3DA 3NZSA 1IHBA 5KJNA 3RSEG 4PDXA 3FH5A 3KEAA 4EPZA 3IHVA 3T5VA 4AM9A 3ZXSA 4LCTA 3C3OA 4U8YD 4KZ0A 4XX5A 3IHYA 3VLDA 3PUJA 4HRMB 5EX0A 5CCLA 5CMYA 2M63A 3NOCD 4RLYA 1EF1C 4K5AB 3FUFA 4BESA 1MJ0A 4YVOA 2VGXB 4K5CA 3V79K 2YHCA 3V31A 1QNFA 2P2CP 4GYOA 5EILA 2GROB 1XNFA 1UN8A 2JEKA 3SFZA 2FBNA
chains in the Genus database with same CATH topology
3DXMG 2P9LG 3ULEG 1TYQG 2P9IG 2P9KG 2P9NG 3RSEG 1K8KG 2P9UG 1U2VG 4JD2G 2P9PG 3DXKG 4XEIG 3UKRG 3DWLG 3UKUG 2P9SG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXM G;  2P9L G;  3ULE G;  1TYQ G;  2P9I G;  2P9K G;  2P9N G;  3RSE G;  1K8K G;  2P9U G;  1U2V G;  4JD2 G;  2P9P G;  3DXK G;  4XEI G;  3UKR G;  3DWL G;  3UKU G;  2P9S G; 
#chains in the Genus database with same CATH topology
 1WAO 1;  2EIL E;  3FFL A;  2DBA A;  4APF A;  3CHS A;  3ONL A;  2ZGG A;  4U63 A;  4GA2 A;  4I1M A;  4KZC A;  2GRL A;  3LPZ A;  1NZN A;  4C48 B;  3GZS A;  3RIB A;  4J8F A;  3IEG A;  2XEE A;  5JJ7 A;  2YNQ A;  2HYZ A;  4KVO A;  1EDU A;  4CDR A;  4BFR A;  2XPI A;  2H6F A;  1JUQ A;  3HXF A;  4GTR A;  5AIJ A;  2WXJ A;  4BEP A;  3PZ2 A;  3CV0 A;  4F6R D;  2XRY A;  1DNP A;  4XZ4 A;  3PNL B;  4FLB A;  4BX9 A;  1H2T C;  2OCC E;  1BLX B;  2R17 C;  4K5B A;  3E30 A;  5G04 J;  3FEY A;  4GCN A;  3T8K A;  3PS6 A;  3DSV A;  5FTP A;  4CRW A;  4HI9 A;  2FUL A;  4CDM A;  4ACL A;  2J09 A;  1H19 A;  3UUX A;  3AS4 A;  3D9O A;  4KBQ A;  2YIN A;  3LXU X;  3CKB A;  3ISM C;  2R5S A;  4K03 A;  1N0Q A;  2P9N G;  3TG4 A;  2P9U G;  3LYA A;  2GRN B;  4I1A A;  4AVX A;  5EID A;  4U0S A;  3VTX A;  5BXO A;  3OXF A;  5T3R A;  3TWU A;  3BEE A;  3FTU A;  1V54 E;  3CK9 A;  2BTD A;  3SFX A;  3FP3 A;  4DLQ A;  5C2Y A;  3MEK A;  3BUA A;  3B7T A;  3T9K A;  3VTY A;  2UY1 A;  5CEA A;  3JUE A;  4BT9 A;  2OEV A;  1EPU A;  4KYO B;  3B7R L;  1HH8 A;  4NRH B;  3CR3 A;  1K8K G;  4A1G A;  2F8X K;  4EZJ A;  3IKO B;  4IRU A;  4WWO A;  5BPP A;  3QNK A;  2CG3 A;  5HKP A;  5LCW J;  2CFU A;  3UKU G;  2DIW A;  3TL5 A;  5FZS A;  2KC7 A;  1MX4 A;  4FUL A;  1HG5 A;  3L08 A;  2J4B A;  2PM6 A;  3O48 A;  1E8Z A;  1Z5S C;  1E96 B;  3T5X A;  1UG3 A;  4C9B B;  2WXK A;  3S7J A;  2XQ0 A;  1IHG A;  2F37 A;  1BI8 B;  2WVI A;  5ENT D;  4C0E A;  3CST A;  2QC9 A;  2WM9 A;  3D9J A;  2R02 A;  5FQ6 A;  4JHR A;  3DSW A;  5AN8 A;  4IYP A;  4HOQ A;  1L5J A;  2KBX A;  1IKN D;  1FCH A;  4EBA G;  1SA5 A;  1NL4 A;  2RG8 A;  3WG7 E;  2BED A;  1ELW A;  4BSX A;  1MX2 A;  1BI7 B;  1UJK A;  1PC2 A;  2DYS E;  5ENS D;  3ASD A;  1SA4 A;  4JVS A;  3SZ7 A;  1O1S A;  4ILG A;  1E8X A;  5AAR A;  5FQ8 A;  1H2V C;  3R9A B;  3Q9N C;  4G8L A;  4TXQ A;  4ABN A;  2VGY A;  4Q94 A;  1N9A A;  4F53 A;  4U8H A;  3FHE A;  4DX6 D;  2VTB A;  3EHN A;  3UXG A;  1ZU2 A;  3JUI A;  3ABM E;  5FIO A;  5CRU A;  2WPV A;  4P29 A;  4UUC A;  3CSF A;  1TNY A;  4U0Z A;  3PEU B;  3JYS A;  3Q4A B;  5KJM A;  4BWR A;  4I9E A;  4X8Q A;  1IYG A;  3D9L A;  1N94 A;  5C1D A;  4A1S A;  5CBN A;  5IY5 E;  4RG9 A;  1ZB1 A;  4F1S A;  3FH8 A;  3LJ3 A;  3EDT B;  4AP2 A;  3ONK A;  4ILI A;  2LAH A;  4N3C A;  4XIF A;  3HHM A;  3BQO A;  3QAR A;  1KT1 A;  2AXZ A;  1K1A A;  4WNG A;  4NIK A;  3E37 A;  4AIF A;  3SI5 A;  4N39 A;  5A6C A;  5CER B;  1VDY A;  1ELK A;  5CRV A;  3TG5 A;  3FUK A;  1MYO A;  3IXE A;  3FU0 A;  4DPR A;  3F6Q A;  3I5P A;  4FHJ A;  2XGO A;  3Q75 A;  5AJD A;  2XHE A;  1OCZ E;  3UT7 A;  4BET A;  3G2U A;  5JJ6 A;  5FWQ A;  4HXI A;  4N5C A;  5D2M C;  4Z68 A;  2IOS A;  3W9G A;  4DUI A;  1Z3X A;  1NA3 A;  3EU9 A;  4J8E A;  3UIN C;  4B8C B;  2ILR A;  4EEC A;  3TJP A;  4JXT A;  4TUU A;  4UWK A;  5EIB E;  3D9N A;  1OWM A;  2CFZ A;  1INZ A;  1N4P A;  4IN3 B;  3MGB A;  4I2W A;  1RW2 A;  3UM2 A;  3DSU A;  1TNU A;  1YMP A;  2FEZ A;  3J5P A;  4UQY A;  3S7D A;  2P9P G;  4DRX E;  2JAB A;  2GRP B;  1LTX A;  3SBS A;  4DJA A;  2WXR A;  5CEC B;  4JEU A;  3DSX A;  3D9H A;  3ULQ A;  4I43 A;  2VSN A;  2XZD G;  4AXH A;  2DCP A;  5G2N A;  3UQ3 A;  4NUR A;  4OVV A;  3ZN3 A;  3UT4 A;  3RJV A;  2X38 A;  3JQ1 A;  5ITZ F;  5BUZ A;  3LVQ E;  3AG1 E;  2VTB B;  2WXM A;  4PS7 A;  3DEP A;  3CK8 A;  4G23 A;  1OCO E;  2X3M A;  1K3Z D;  3UTM A;  1KPS B;  3LY7 A;  4HOT A;  4HS2 A;  3CVY A;  4CZ2 D;  3E4B A;  3AG2 E;  4CDN A;  3ZVV A;  4XKC A;  3UM3 A;  3HXB A;  5B1A E;  4HOR A;  2E0I A;  1D8D A;  3ZKJ A;  4U8V D;  4KT6 B;  3ZYL A;  3U4T A;  4Q69 A;  3NF1 A;  2LNI A;  2LSU A;  3QWP A;  3CVL A;  1H6K A;  4GTQ A;  3FUM A;  2WXG A;  5D0Q D;  2HO1 A;  3UIP C;  5DBK A;  1MX6 A;  2XCB A;  3LS8 A;  5AQA A;  1TJF A;  4DI4 A;  5BV0 A;  2P9K G;  3NBN B;  4N2Q A;  4B89 A;  3CHQ A;  4DLO A;  3W9F A;  1U2V G;  1X81 A;  3FU5 A;  3CVP A;  4HVB A;  2EIM E;  4WWP A;  1OT8 A;  3CHO A;  5ANL A;  2HE0 A;  1H0A A;  4A55 A;  2P9I G;  3S7B A;  3C5R A;  1DC2 A;  2ETC A;  3L54 A;  1IQR A;  5D0O D;  3QB2 A;  2B0O E;  1FVF A;  3V30 A;  5DIZ A;  3Q9U C;  1TEZ A;  3PZD A;  3JXJ A;  3TWR A;  3N71 A;  4U07 A;  4MRU A;  3C98 A;  3Q7F A;  5A23 A;  3FU6 A;  3TWX A;  2VYI A;  4LG6 A;  4H7X A;  2UWJ G;  4E6H A;  1P5Q A;  1X5B A;  4G24 A;  4KXK B;  4XKB A;  3PZ1 A;  3QAQ A;  4HLL A;  5ANR A;  5BXU A;  4F7A A;  5HRY A;  4YDE A;  5G05 J;  4CGV A;  5T8I A;  3DBS A;  3S2A A;  3B7B A;  4E85 A;  3HXD A;  2X6J A;  1KZP A;  3PUK A;  2ZXW E;  2XGS A;  4PS8 A;  4EZL A;  3CHP A;  1LD8 A;  4YDY A;  2IO2 C;  2ETA A;  3QDN A;  3VLE A;  3ASH A;  3TWV A;  5ENP D;  1IXV A;  5FJY A;  1JCR A;  2IO3 C;  4ME2 A;  4GZ6 A;  1O1T A;  1N4S A;  1UOH A;  5JMN D;  3CIA A;  3QJZ A;  2KM4 A;  1A5E A;  3V2O A;  3L13 A;  2YHE A;  3T8M A;  2KXP C;  3QWV A;  3RRN B;  2AXU A;  3PVL A;  2AW6 A;  1LD7 A;  4L7T A;  3K9I A;  3CVV A;  4I6J A;  4PUC A;  2DWZ A;  1WM5 A;  2KCL A;  4ATG A;  4F1P A;  2LO6 A;  4GZD A;  3UI2 A;  4ACK A;  4GTV A;  4BTA A;  3HIZ A;  1OWL A;  4XI0 A;  3FDH A;  3PH0 C;  3TWS A;  3UMV A;  3X2Q E;  5HQ8 A;  1GW6 A;  4G26 A;  4I1O B;  2AWI A;  1Y6I A;  3B7U X;  3FTS A;  3S7F A;  3Q78 A;  4JHK A;  2XS1 A;  4LNU D;  3FTY A;  4HLE A;  4R7L A;  1H2U A;  3Q73 A;  2BKK B;  4FA6 A;  1JPL A;  1HF8 A;  1S0P A;  5AAO A;  4JZY A;  4U04 A;  2L9B A;  3MKQ A;  3HVE A;  2IEJ A;  3HXE A;  4JB8 P;  3FU3 A;  4GB9 A;  2A4Z A;  3ZHE A;  5LP0 A;  1S70 B;  2IFU A;  1N52 A;  5EN5 D;  1SQM A;  1DCQ A;  4J8D A;  2AVP A;  3O4Z A;  3PZ3 A;  1EYH A;  2GRQ B;  1KT0 A;  3FUH A;  2VSO E;  3TWW A;  4CCA A;  3UIO C;  2ION A;  1TYQ G;  1WDY A;  4WUY A;  4O1P A;  5FQ7 A;  2X6I A;  4I9C A;  3L16 A;  4L9P A;  3SD5 A;  5CMW A;  3V2X A;  4WWN A;  4RSY A;  2Y3A A;  5LFA A;  3EUV A;  3CVU A;  2J9Q A;  2I1K A;  3ZUV B;  3L22 A;  3ZPJ A;  4F3V A;  2WB2 A;  3CVX A;  1TNO A;  2QYU A;  3PZ4 A;  4A63 B;  3Q7A A;  1IQU A;  1NI1 A;  2WXN A;  3ZRH A;  5ENR D;  3ESL A;  5ENO D;  3QWW A;  5HS0 A;  1QYM A;  1HX8 A;  2PNN A;  3KS2 A;  2VJ8 A;  4AY6 A;  5EKQ D;  3D9I A;  5J90 A;  2CG2 A;  2MHK A;  5JJT A;  4L2L A;  4JL0 A;  5KNG A;  1TJC A;  1WG0 A;  3FEX A;  1E8W A;  3IBE A;  1XGW A;  2GRM A;  3ZGQ A;  3DSS A;  2EIJ E;  4M3O A;  3NZU A;  2P58 C;  3LVR E;  4J8S A;  4UI9 C;  1HU3 A;  3LCA A;  1OCR E;  3C72 A;  2IU1 A;  5H7P A;  3L82 A;  4TXR A;  3VLF A;  3EJN A;  4QFV A;  3KSQ A;  4HB5 A;  1SVX A;  2WXP A;  2LAI A;  2UY1 B;  4OYS A;  3SQV A;  2GRR B;  1SW6 A;  1BD8 A;  4CT0 A;  2OV8 A;  2YQ8 A;  3PNT B;  1SZA A;  4BT8 A;  3G2W A;  4D10 C;  4MS6 A;  3EU5 A;  3HG0 D;  4J7W A;  4ANX A;  5ARF A;  1N54 A;  4FP7 A;  4DX2 A;  3HVE B;  4L23 A;  2RFA A;  4GZ3 A;  2WXF A;  5BNW A;  2CHZ A;  2HR2 A;  1G3N B;  3UKR G;  3UM1 A;  3ZHE B;  4YVQ C;  3PRZ A;  4GML A;  3Q15 A;  1YYH A;  1JWF A;  1HXI A;  1E8Y A;  1W3B A;  4G8K A;  1ELR A;  4DI3 A;  3ASN E;  3ABK E;  1AWC B;  3JCK C;  4RG6 A;  4Y6C A;  4EBA A;  2EIN E;  5KNH D;  5JHB A;  1JWG A;  5BT1 A;  1PY1 A;  3KAE A;  2NXP A;  4J6I A;  1U3C A;  3PDN A;  2PZI A;  4WAF A;  1O1R A;  1H6O A;  3MV3 B;  3SO8 A;  1JCQ A;  4RVB A;  3U3W A;  5ARG A;  2WMN A;  3TWT A;  2DYR E;  2VGX A;  3G2T A;  5BW8 C;  3ZNG A;  5KCM A;  4FC8 A;  4OVU A;  1DCE A;  1HG2 A;  1Z6T A;  2BF0 X;  3B13 A;  3ESK A;  2R2L A;  5AQ9 A;  4XI9 A;  3OTN A;  2XPY A;  4XE0 A;  4ANW A;  2J08 A;  3HRA A;  1A17 A;  2FI7 A;  3PRE A;  2XCC A;  1UW4 B;  3FH7 A;  2ZU6 B;  4FJZ A;  4UWL A;  3D3M A;  3SNX A;  5G04 C;  4ANV A;  2OOE A;  3BU8 A;  3SY2 A;  4HRL A;  2P9L G;  3AS5 A;  1N95 A;  3FUL A;  4O60 A;  1H6P A;  1KZO A;  3I3N A;  1TN8 A;  3MA5 A;  3R7R A;  1TN7 A;  1TNZ A;  4UI9 J;  4U96 D;  4GZC A;  3CEQ A;  1NA0 A;  1KLX A;  3UPV A;  2LXM A;  4CYM D;  2WXI A;  4MLP A;  1HFA A;  5AJL A;  3SHF A;  3U9W A;  4GPM A;  3P2B A;  5B1B E;  1QQE A;  3D9P A;  1K1B A;  2VGE A;  2WXL A;  2Y4T A;  1V55 E;  4JHJ A;  2OND A;  2PQR A;  4LNG A;  3APC A;  4H7Y A;  3RRU A;  3DPY A;  2R05 A;  3MZL B;  3MJW A;  1OXJ A;  4U95 D;  3NQP A;  1HS6 A;  4HQD A;  2KZT A;  2Y69 E;  3MYV A;  3APF A;  4LNB A;  4B8A A;  3CGH A;  4ZFH A;  4N3A A;  2IF4 A;  3RAU A;  4HRN A;  3ML9 A;  4XEI G;  1E7V A;  1NFI E;  4PS3 A;  3CHR A;  3BG0 B;  3KD7 A;  2WXH A;  4GPK A;  4KMO A;  2A5U A;  3JXI A;  5LCW C;  2J07 A;  2XEH A;  3HXC A;  3QOU A;  3BG1 B;  2I6H A;  3U64 A;  4MKT A;  3Q49 B;  4TUM A;  2LUH A;  3DWL G;  1QBQ A;  2QY7 A;  1S63 A;  3RRM B;  1JCS A;  1RZ4 A;  1MQS A;  3LY8 A;  4GU5 A;  3AG3 E;  4A3T A;  5FIN A;  3SGH A;  4JPS A;  4N3B A;  3URZ A;  2WXO A;  3MX3 A;  2IOL A;  4G2V A;  3Q47 B;  2RFM A;  4WND A;  3RO3 A;  1UN9 A;  3FY4 A;  2KAT A;  2PQN A;  2C2L A;  4UI9 K;  1D9S A;  3HDX A;  3TWQ A;  2V4L A;  3FUI A;  3ZFW A;  1N4R A;  4GAA A;  4URK A;  2I9C A;  1SZ9 A;  3NAW A;  4LRZ A;  3L6A A;  2F0Y A;  4IUL A;  4NQ0 A;  4JA9 A;  2P9S G;  5LOZ A;  1TN6 A;  2A5E A;  4GTP A;  2WQ7 A;  4J8Y A;  4I6E A;  4UWF A;  4AY5 A;  3FTZ A;  2DZO A;  3EIJ A;  4HBD A;  3FUD A;  3TGO A;  2OVF A;  3G2V A;  2AJA A;  3Q79 A;  3R9M A;  4N5Q A;  4UWG A;  4HFG A;  3AU4 A;  3APD A;  5J08 A;  3DPD A;  1Z3Y A;  5AYW D;  2OEW A;  5AQ7 A;  2GW1 A;  4AV7 A;  4CT4 A;  4GTT A;  4GYW A;  3GW4 A;  4WNF A;  4GZ5 A;  2WMO A;  3CHM A;  3P1U A;  2FF4 A;  3GZ1 A;  2R59 A;  3ASF A;  2Y1L E;  4GYY A;  1TNB A;  2IQC A;  3NB2 A;  4O1O A;  2KZT B;  1Q2Z A;  1TR4 A;  4FHK A;  3DEO A;  3MV2 B;  4UQX A;  1B89 A;  2Y4U A;  4G11 A;  4JD2 G;  3AAA C;  3EHR A;  1PAQ A;  2QFC A;  3TXM A;  4B94 A;  4I2Z A;  3SF4 A;  5A7D B;  4ZHB A;  2ZIS A;  2BKG A;  2F8Y A;  1MZC A;  3L17 A;  2EIK E;  1YCS B;  2V5F A;  4WNE A;  1O5M A;  5KJK A;  3ZU7 B;  4AEZ C;  3ASO E;  2L0I A;  5AQB A;  3TAX A;  3E33 A;  4G1T A;  4OAU C;  1FPP A;  4ANU A;  3Q5M A;  3OXG A;  3B95 A;  4YDO A;  2QYJ A;  3ML8 A;  3AS8 A;  2B6C A;  3B7S A;  2L0T B;  2H6G A;  1FT1 A;  4J0U A;  3C3R A;  4U0U A;  2XS8 A;  4AOF A;  3IV0 A;  4ILH B;  3U66 A;  5AEN A;  2LSV A;  2WQH A;  4TV3 A;  2MRI A;  3UT8 A;  2HM8 A;  2V8S E;  4UWH A;  3WXX A;  4FAD A;  5HI7 A;  1E90 A;  3ABL E;  4Q96 A;  3PE4 A;  3D9M A;  4TXP A;  2H6I A;  1OCC E;  3JQ0 A;  2V0P A;  2KCV A;  3EHQ A;  5D66 A;  5E76 A;  2KCK A;  3UX4 A;  2Y0B G;  3I4R B;  2PM7 A;  1BU9 A;  5FT9 A;  4BER A;  2H6H A;  2OVB A;  4O6F A;  2C0L A;  4A3V A;  4GA1 A;  3CVN A;  4GTM A;  2MYO A;  4BY6 A;  4HI8 A;  4JC8 A;  4JW1 A;  4U7E B;  1Y8M A;  4LEU A;  3KEZ A;  4V3I A;  5JA4 D;  4APO A;  4FJY A;  5EYL A;  3ZEF A;  2I1J A;  5JHA A;  2XGM A;  2CHW A;  2Q7F A;  3D9K A;  5KWD A;  3FUE A;  4L1B A;  4NAC A;  1ZBP A;  5KJL A;  2BUG A;  2AXV A;  4LUN U;  2FO7 A;  4MBG A;  4RQI A;  3QK0 A;  1YA0 A;  3L9T A;  2X6K A;  4BTB A;  3LKU A;  3J5Q B;  1OY3 D;  4DX1 A;  3MCX A;  3I4G A;  4ATZ D;  3CLJ A;  1MHQ A;  2VSX E;  2V4H C;  1S64 A;  3UM0 A;  4PH4 B;  5LX8 A;  3CVQ A;  5B3S E;  1OUV A;  4EQF A;  4CEM A;  5CED B;  2NYJ A;  2JLB A;  2FO1 E;  3DST A;  3FTW A;  4UQZ A;  3KSL A;  3RU0 A;  5FZR A;  2XZT G;  2J49 A;  3MKQ B;  3G2S A;  4TRQ A;  3RKV A;  3R7Q A;  4GTO A;  5T4Y A;  5EYP F;  2E2E A;  3DRA A;  4G25 A;  3AU5 A;  2ZGD A;  5FQ4 A;  4HOU A;  2ZIR A;  3SBT B;  3ULE G;  2WQ6 A;  3ZYQ A;  2MOW A;  4N2S A;  2DZN A;  4JEH A;  4GA0 A;  1HE8 A;  3FTV A;  3FTX A;  3ZYM A;  4HOS A;  1UJJ A;  3SFY A;  1OWP A;  3ZW3 A;  1N4Q A;  4L2Y A;  1FT2 A;  3EHM A;  2QZA A;  4EZK A;  5E75 A;  2RD0 A;  3CKC A;  2V5Q C;  3C3Q A;  2IY0 C;  2ETB A;  1NP7 A;  4GCO A;  1N0R A;  5M72 A;  3GYZ A;  2VSY A;  2NSZ A;  3DXM G;  3RO2 A;  3ENE A;  4JA7 A;  3EIQ C;  3RK6 A;  3QC1 A;  4B93 B;  4GMJ A;  5EX3 A;  4OAV B;  1DVP A;  2J4D A;  1OWO A;  4CGW A;  3OAW A;  2NC9 A;  3AJI A;  2I2O A;  4EHM A;  3AG4 E;  3OXL A;  4GTS A;  3LJN A;  5ENQ D;  2L6B A;  4BSZ B;  4B0Z A;  2L6J A;  4KVM A;  4DX7 D;  2X6H A;  3FUN A;  1OWN A;  2XPZ A;  5G05 C;  3QKY A;  4I6G A;  2EQX A;  3FUJ A;  2CHX A;  3DXK G;  3TXN A;  2LXL A;  3FWV A;  4LER A;  2PL2 A;  3E32 A;  2XEV A;  1BPO A;  3ZIM A;  4FU3 A;  3LDZ A;  3CQG B;  4YND A;  3LY9 A;  3ZXP A;  5CHE E;  3ZYK A;  3LEW A;  5CBO A;  2IJG X;  4DX5 D;  4M7C A;  4QQI A;  4LSZ E;  2RKK A;  4BX8 A;  5ENN A;  2X6F A;  2DVW A;  5KBA A;  2XRZ A;  2J8S D;  2VQ2 A;  1HZ4 A;  3E34 A;  1N11 A;  3PEV B;  4K0R A;  4DK5 A;  2WXQ A;  4W9R A;  3CVW A;  2R03 A;  3GZ2 A;  4C0M A;  3ASG A;  1AP7 A;  2XEN A;  4YDW A;  4AJW A;  5BV1 A;  5G55 A;  1LF8 A;  4FLH A;  4Y6W A;  2C0M A;  1D8E A;  1E7U A;  1QZ2 A;  1WY6 A;  4GMR A;  5EDS A;  4I17 A;  3NOG D;  1FVH A;  3CK7 A;  3MKR A;  1HO8 A;  3CQC B;  4HNA D;  3HYM B;  3PE3 A;  3ULY A;  5FZQ A;  5CCM A;  2GGF A;  1U3D A;  3NZS A;  1IHB A;  5KJN A;  3RSE G;  4PDX A;  3FH5 A;  3KEA A;  4EPZ A;  3IHV A;  3T5V A;  4AM9 A;  3ZXS A;  4LCT A;  3C3O A;  4U8Y D;  4KZ0 A;  4XX5 A;  3IHY A;  3VLD A;  3PUJ A;  4HRM B;  5EX0 A;  5CCL A;  5CMY A;  2M63 A;  3NOC D;  4RLY A;  1EF1 C;  4K5A B;  3FUF A;  4BES A;  1MJ0 A;  4YVO A;  2VGX B;  4K5C A;  3V79 K;  2YHC A;  3V31 A;  1QNF A;  2P2C P;  4GYO A;  5EIL A;  2GRO B;  1XNF A;  1UN8 A;  2JEK A;  3SFZ A;  2FBN A; 
#chains in the Genus database with same CATH homology
 3DXM G;  2P9L G;  3ULE G;  1TYQ G;  2P9I G;  2P9K G;  2P9N G;  3RSE G;  1K8K G;  2P9U G;  1U2V G;  4JD2 G;  2P9P G;  3DXK G;  4XEI G;  3UKR G;  3DWL G;  3UKU G;  2P9S G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...