2P9PG

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
143
structure length
128
Chain Sequence
ARFRKVDVDEYDENKFVDGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 39
structure length 128
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9pG00
3DXMG 1U2VG 3DXKG 4XEIG 2P9NG 2P9KG 3DWLG 3UKRG 3ULEG 2P9SG 1TYQG 1K8KG 4JD2G 2P9UG 2P9PG 3RSEG 3UKUG 2P9IG 2P9LG
chains in the Genus database with same CATH superfamily
1HE8A 5EKQD 3PZ2A 3HRAA 4DX1A 3OXGA 3JQ1A 3LEWA 5CRVA 4ME2A 4NACA 4JZYA 3I4GA 4GZ5A 2X6KA 3CVPA 3N71A 2DBAA 4J0UA 3UTMA 2E0IA 3U64A 4UWFA 4ANXA 4DJAA 1MHQA 3RSEG 3UKUG 2VGXB 2LAHA 4I6EA 2A4ZA 2WXOA 2ZXWE 3SO8A 2XGMA 1FCHA 4DLQA 3E34A 4XZ4A 3DSXA 4TV3A 2PNNA 4F1SA 2X3MA 2WXRA 1KT0A 3UIOC 3U4TA 1MQSA 3AS8A 4KBQA 2I6HA 4J8YA 1UG3A 3PNTB 5KJKA 1QNFA 2AVPA 4GZ6A 3CVUA 1KZOA 5J90A 1JWGA 4GA1A 4Q96A 3QARA 2KC7A 2KBXA 4EPZA 1L5JA 4V3IA 3P1UA 3B13A 3S7BA 3G2WA 1E96B 5EN5D 4BWRA 2A5EA 4U0ZA 3NBNB 2VGXA 4FC8A 4DX7D 4G11A 2WMNA 1V54E 3T5XA 4G1TA 3Q4AB 1WDYA 4APFA 4I1OB 1GW6A 1N4PA 3DRAA 3ZYMA 5LX8A 5LCWJ 4I43A 3D9MA 1UJJA 2MRIA 3NQPA 2VQ2A 5E76A 2PZIA 4A55A 4HOQA 4HQDA 4CEMA 4FHJA 2XEEA 2HE0A 1OCCE 2X38A 3CSFA 3SBSA 4ATGA 2XS8A 2DYRE 3FTZA 3DSTA 5JHBA 1S0PA 4AJWA 2IY0C 1NFIE 4EZKA 1FT1A 1NA0A 2IOSA 1BI7B 1K3ZD 3TWUA 4HOSA 3FH7A 1N4SA 1OXJA 2ILRA 4OAVB 4I9EA 4RVBA 4GTVA 2V5FA 3FFLA 4BY6A 4GZDA 1HG2A 3PRZA 2I9CA 4HRLA 4DUIA 4AVXA 5C1DA 4GYYA 3B7SA 1U3DA 4I1AA 3ULQA 4U95D 2I1KA 4U8VD 1OWPA 4I17A 5BT1A 3G2VA 4GU5A 2OCCE 2GGFA 3V31A 3NOCD 2RFMA 1X81A 3IV0A 3AS5A 2ZGDA 3SF4A 3PH0C 4FULA 5ENQD 1KPSB 4CRWA 2L9BA 4RLYA 4KT6B 3ZGQA 4JPSA 4BEPA 2RKKA 3J5PA 2PM6A 3SBTB 3S7JA 3ZVVA 2HYZA 4G24A 4PDXA 2P9UG 4WWPA 3CLJA 5ARGA 2LXMA 3EHRA 5G04C 4BTBA 1Y8MA 3UIPC 1E8WA 2L0TB 4FP7A 3ZRHA 3BUAA 3DEPA 3RJVA 2BKKB 2BEDA 1RZ4A 2RD0A 4HORA 4DI4A 3CKCA 3SD5A 3RRUA 3MYVA 3DSSA 3CQGB 1SZAA 3IXEA 3MKQB 5AQAA 3HHMA 3JQ0A 5BV0A 3CGHA 4XI0A 3LCAA 4LG6A 4UUCA 3CR3A 4J8FA 2AWIA 2YHCA 4JEUA 1FVFA 5CCMA 3KS2A 5G05C 3SFXA 4TXRA 2J9QA 3FU6A 1UW4B 1KT1A 2J4BA 2F0YA 3L54A 3FUEA 3KD7A 2XHEA 4J8SA 3E32A 3ASHA 1JCQA 4QQIA 3E37A 5ITZF 5FQ6A 4XE0A 2IEJA 3RU0A 3SFZA 2IO2C 3APCA 1SQMA 1TNUA 4WNEA 5FWQA 3JXIA 3ZHEB 1UJKA 2PQNA 4I2ZA 3ZEFA 1MX4A 3EHQA 1DC2A 3QWVA 3FULA 4KYOB 4ZHBA 4GZCA 4CGVA 3RAUA 1XGWA 1BPOA 2JLBA 4JA9A 3HG0D 1H2UA 3RO2A 5EIBE 3FTWA 2GRLA 2DZOA 4G25A 4HBDA 5KJLA 3PVLA 2J08A 4N2SA 1NL4A 4B0ZA 4CYMD 3HXBA 4B8CB 5JJ6A 4U0UA 4UQYA 3UUXA 3BG0B 3Q78A 1S70B 3C3QA 2IJGX 5LCWC 3ZHEA 3Q47B 3V2OA 4U0SA 2WXMA 3PDNA 3Q5MA 2F37A 4FA6A 3TGOA 2KZTB 3LS8A 3NOGD 2YQ8A 1HF8A 3LY8A 4LRZA 3Q79A 3WG7E 1JCRA 2OEWA 1O5MA 3LXUX 3OTNA 3SFYA 1S64A 4PH4B 4HOUA 4N3BA 4K5AB 3TWXA 2P9PG 3D9LA 2RG8A 3D9HA 2F8YA 1QZ2A 4A3TA 2XGOA 5KNHD 2XRYA 1BI8B 4FU3A 3B95A 2Y1LE 2AXVA 4L7TA 5BXOA 3L22A 3CK7A 3B7UX 4CT0A 5KJMA 4GTMA 3NZUA 3PZ1A 5FT9A 1ELKA 1N54A 1TR4A 2UY1B 4YDYA 3FTVA 3DSUA 1IQUA 3DWLG 1YA0A 1SW6A 5ENTD 5AQ7A 3EIJA 5ANLA 1IQRA 5AARA 4DX5D 2JEKA 1HH8A 4JHKA 2NYJA 5G2NA 3FU0A 2AW6A 4OAUC 4GCNA 4H7XA 5AQBA 3BQOA 2P9KG 2IONA 1NI1A 1IKND 2QZAA 3CEQA 2WXQA 4MBGA 1IXVA 2XEVA 1NZNA 3ZN3A 4BSZB 2XPYA 3U3WA 2XGSA 3Q73A 2KATA 1Q2ZA 5EIDA 5AYWD 1ZU2A 3ZYKA 2FULA 1HO8A 1Z3YA 2VSXE 4ANWA 5ARFA 2UY1A 3DBSA 3EU9A 3Q9UC 4O1OA 1K1BA 1E7VA 4N5CA 3EDTB 1MX2A 2WPVA 5G05J 5A7DB 4C48B 2WXFA 4LCTA 2WXPA 4F53A 1FPPA 1ELRA 1A5EA 3FY4A 4IRUA 3VLEA 4EECA 2GRQB 5T4YA 4H7YA 3ZKJA 3IEGA 4J8EA 5EYPF 4BSXA 4NURA 4GYWA 4HNAD 2EIME 4A3VA 2Y4UA 4DLOA 3ULEG 4MS6A 1JWFA 3DSWA 3AG1E 4GTOA 1HXIA 1WM5A 3ESLA 2LO6A 5FQ8A 3ZFWA 5E75A 1TN6A 4ILHB 3LVQE 4R7LA 1OT8A 1XNFA 1E7UA 1EPUA 5DBKA 3LPZA 3HXDA 2X6JA 3VTYA 3HDXA 2WXLA 3AG3E 3P2BA 2QY7A 3CIAA 3UPVA 3FEYA 5FINA 3CV0A 5KCMA 2EIJE 4HB5A 2BF0X 3QWPA 3PE3A 3EUVA 3ZXSA 4GMJA 3ML9A 3UT7A 1Z3XA 2AXZA 3HVEA 4YVOA 4U04A 5A23A 4AEZC 3GW4A 4I2WA 5T3RA 1BD8A 4PS3A 2YNQA 3O4ZA 2XZTG 2Y0BG 3CHPA 1OWMA 1H2VC 3PZ4A 4MRUA 3QC1A 3LY9A 5J08A 1IHGA 2X6IA 4AY6A 4J8DA 3FTXA 2V5QC 3E30A 3V2XA 4BX8A 2ETBA 4Q94A 1K1AA 2R2LA 4EBAG 3VLFA 3LKUA 2NXPA 1NP7A 1TNBA 1ZB1A 3QOUA 2ONDA 4B8AA 2OEVA 3G2SA 3QWWA 4JD2G 3UM1A 2IOLA 4AP2A 1NA3A 4PS7A 4L2YA 2J49A 2NSZA 4ZFHA 5FQ7A 1N94A 4KZCA 2R05A 5FQ4A 1OY3D 2DVWA 5HQ8A 3QAQA 1WG0A 5M72A 4JXTA 4E6HA 3E4BA 3PREA 3VTXA 5LP0A 3ASFA 4MLPA 1H19A 1ZBPA 4HI9A 1H6PA 4TUMA 2X6FA 3CHMA 5AQ9A 5D0QD 1JCSA 5ENOD 4L2LA 4EZLA 3ZU7B 3MX3A 1B89A 3ULYA 4N39A 2E2EA 3PNLB 2WXNA 4N3AA 3FUHA 4CCAA 4CGWA 3O48A 4JL0A 3RIBA 2CFUA 3TJPA 4C0EA 4XI9A 3FUJA 5B1AE 4KXKB 3AG2E 3X2QE 2OOEA 4JVSA 3MCXA 4UWLA 4DX2A 4P29A 4LNUD 2P58C 2M63A 4TRQA 2WQ7A 2UWJG 2DCPA 3UT4A 1LD8A 3ENEA 2L6BA 3KSQA 3ZPJA 1IYGA 4Z68A 5CCLA 4RQIA 3FH5A 3NAWA 3SQVA 4N2QA 2C0MA 4L1BA 4ILGA 3FUKA 1D8EA 3VLDA 3ZXPA 2CHWA 4O60A 4ILIA 3IBEA 4A63B 3CHRA 4EQFA 2R03A 4GPMA 4CT4A 1FVHA 3V79K 3FU3A 1MYOA 1TEZA 2GRPB 1H6KA 3LDZA 2XEHA 5ANRA 3S7DA 4APOA 4UWHA 4L23A 5FZQA 2WMOA 3ASOE 5HKPA 4O1PA 3I5PA 3J5QB 2VSYA 4G8KA 1OCOE 1D8DA 3UXGA 2BKGA 3MJWA 4F6RD 2EQXA 4WAFA 4HRNA 5T8IA 4NIKA 2J8SD 1VDYA 3FUIA 4GB9A 5EX0A 3IHVA 3CQCB 4XEIG 3B7TA 2P9NG 2XCBA 4IYPA 4U8YD 1Z6TA 5DIZA 4W9RA 4GMLA 3B7RL 3FTUA 1HU3A 2WB2A 3UINC 2ETAA 4YNDA 4AOFA 5BW8C 3FTYA 5CRUA 3JYSA 3PUJA 3DPDA 4BX9A 1OWOA 3TXMA 2MYOA 4ANUA 1N11A 3CHQA 2XZDG 1DVPA 4G23A 3TG4A 3ASDA 4AV7A 2GW1A 4I6GA 3Q75A 3L08A 2B6CA 2Y3AA 1JPLA 2PL2A 3TWQA 1E8YA 3AJIA 4Q69A 2OV8A 4LERA 2AJAA 2LNIA 3MZLB 1JUQA 2DIWA 3ONLA 4JW1A 4LSZE 4FLBA 1RW2A 4BT9A 4HLEA 3ASGA 2A5UA 3IHYA 4UI9C 3APDA 1V55E 1BU9A 1H6OA 2DZNA 4ACLA 4A1GA 3QDNA 4TUUA 5B1BE 3ABKE 4U7EB 4G8LA 3QKYA 4BT8A 2CG2A 3AG4E 5CBNA 5ENPD 1WY6A 5BV1A 4C9BB 4B89A 1G3NB 3QJZA 4O6FA 2FEZA 4BETA 2I2OA 4E85A 4XKCA 2V0PA 4DRXE 2VSNA 3E33A 3AAAC 3FUNA 3OXFA 5FJYA 5KBAA 1K8KG 3HIZA 3UI2A 3PS6A 5JMND 5AIJA 4WUYA 1FT2A 1KLXA 1U2VG 1DNPA 3CHSA 3KSLA 4AY5A 3IKOB 4HRMB 1O1RA 4N5QA 4BTAA 2R17C 3LJ3A 3L16A 5HRYA 3TWTA 1HFAA 1TN7A 2H6HA 1O1TA 2J09A 5KNGA 2IQCA 4NRHB 4LNGA 2VSOE 2KM4A 4XKBA 3LJNA 3GZSA 1N9AA 2GROB 2XPZA 3CVYA 3Q15A 4HLLA 2NC9A 4EBAA 4I9CA 4EZJA 3CK9A 4WNFA 2HR2A 2XPIA 3ESKA 4HVBA 5FTPA 2EILE 2P9SG 3TWVA 3Q9NC 3KEZA 5ENNA 3AS4A 4FJZA 4AM9A 4G26A 3NF1A 1OCZE 4XX5A 4BFRA 5EYLA 3CVQA 4D10C 2ZISA 4YVQC 3ML8A 4DI3A 3EU5A 4TXPA 1OCRE 1HS6A 3V30A 3CVXA 3L17A 4F3VA 1N52A 3CVNA 3MKRA 3HVEB 3OAWA 3D9JA 3DEOA 4K03A 3R9MA 3MA5A 5EX3A 2P2CP 2WVIA 5IY5E 2BUGA 2LXLA 3DXKG 4M7CA 4QFVA 4U96D 4AIFA 3FUMA 4K5CA 3PE4A 2CG3A 5AENA 2LAIA 3Q7FA 4GA2A 1SVXA 2IU1A 2GRRB 3ZYQA 1OWLA 3JUEA 3TL5A 4GTSA 2LSUA 5D66A 2VGYA 3D9OA 4NQ0A 4X8QA 2CHXA 5D2MC 1MJ0A 4YDEA 3F6QA 1A17A 2R5SA 2XRZA 2FI7A 5C2YA 2XS1A 3L82A 3I3NA 2WXHA 3CKBA 4FLHA 3EJNA 1WAO1 2H6FA 3W9GA 3FH8A 4Y6WA 1DCQA 3JXJA 2QFCA 3QB2A 2VTBB 3TWRA 2L0IA 3I4RB 5JHAA 2ZGGA 1HX8A 5CMYA 2AXUA 2H6GA 1PC2A 3EIQC 4JEHA 4JA7A 3TWSA 4MKTA 2FO7A 3BG1B 2R02A 4GPKA 4U07A 2LUHA 1BLXB 3GYZA 4GMRA 4F1PA 5FZSA 3RK6A 3ZNGA 3HXFA 4U8HA 4UI9J 3D9PA 3BEEA 2DYSE 4HI8A 3LYAA 1Z5SC 2C2LA 4DX6D 4DPRA 2WXKA 3S7FA 1O1SA 1EDUA 3T5VA 3RRMB 4C0MA 2HM8A 5CBOA 3UT8A 3C3OA 3PEUB 2V8SE 4LEUA 2P9IG 3L13A 4HOTA 3FDHA 2VTBA 3TG5A 4GTRA 5KWDA 2CFZA 3R7QA 3MEKA 1QYMA 3FP3A 3ABLE 4WNDA 3G2TA 3SNXA 1AP7A 2KXPC 1SA4A 4J6IA 2WM9A 4UWGA 1TJCA 5ENSD 2IFUA 4GTQA 4ACKA 4AXHA 3LY7A 1TNOA 3HXCA 4I6JA 5HI7A 1TJFA 3UKRG 4UQZA 5BUZA 5KJNA 1MX6A 5LFAA 5ENRD 2FO1E 1SA5A 3PZ3A 1OWNA 3CSTA 3ASNE 4TXQA 1N4QA 4F7AA 5BNWA 3S2AA 2PQRA 1HG5A 3D3MA 3SI5A 2VJ8A 1DCEA 4K0RA 5JA4D 1YMPA 5FIOA 1UN9A 4B94A 3JUIA 2ZIRA 3C72A 3ZUVB 3LVRE 2V4HC 3RKVA 3FU5A 3GZ1A 3NB2A 1HZ4A 4KVOA 3DXMG 4IN3B 4FADA 3HXEA 3T8MA 3WXXA 4KZ0A 2KCKA 1QQEA 3URZA 4KMOA 4ATZD 2XENA 3ZIMA 2GRNB 2XCCA 3C98A 1QBQA 3TXNA 2J4DA 3KAEA 4UWKA 5LOZA 3T8KA 4CDMA 2XQ0A 4ABNA 1MZCA 3CVVA 1UOHA 4RG6A 1H0AA 4XIFA 4LUNU 3FWVA 5EILA 4FHKA 2MOWA 3UMVA 1PY1A 1LF8A 2F8XK 3U9WA 1D9SA 3D9IA 1N4RA 2ETCA 3L6AA 3RO3A 2HO1A 3TAXA 2YHEA 4FJYA 5AJLA 3QK0A 2KCVA 2CHZA 1W3BA 4OYSA 1TN8A 1P5QA 5A6CA 2WQ6A 2FF4A 1EF1C 2OVBA 5CECB 2IF4A 3CK8A 1N0RA 4GA0A 4EHMA 3GZ2A 3DPYA 4CZ2D 2JABA 2WQHA 3ONKA 4BESA 2PM7A 4DK5A 3UX4A 3FUFA 3C3RA 5G55A 3BU8A 4URKA 5AAOA 5AN8A 5EDSA 1TNYA 4WWOA 3SHFA 3CHOA 4HS2A 2FBNA 1E8XA 4BERA 3Q49B 5CERB 1UN8A 5B3SE 1PAQA 5CMWA 3AU4A 2KCLA 3MKQA 2QC9A 5HS0A 2P9LG 4GYOA 4L9PA 2X6HA 2OVFA 4OVVA 4RG9A 4GZ3A 4PS8A 4GCOA 2Y4TA 3KEAA 3UQ3A 5BXUA 1E90A 3FUDA 2GRMA 4JHRA 1ELWA 4ANVA 3APFA 3W9FA 1SZ9A 1AWCB 1EYHA 1YCSB 2WXIA 4J7WA 4WWNA 5CEAA 4UI9K 3CVWA 1IHBA 4HXIA 3PUKA 5JJ7A 3QNKA 1TYQG 4OVUA 5JJTA 4GTPA 3UM2A 2B0OE 4LNBA 4PUCA 2EINE 3OXLA 3MV2B 3U66A 4YDWA 3D9KA 3AU5A 4CDNA 3JCKC 3MV3B 5AJDA 3ZW3A 3T9KA 1N95A 4HFGA 4K5BA 3HYMB 3ZYLA 2VGEA 3L9TA 3G2UA 4WNGA 2Y69E 2H6IA 3PEVB 4YDOA 1Y6IA 4GTTA 3NZSA 5H7PA 3FEXA 4M3OA 3RRNB 4RSYA 3CVLA 3ISMC 4A1SA 2RFAA 3K9IA 3B7BA 4JB8P 2VYIA 4B93B 2LSVA 4U63A 4KVMA 2ZU6B 5BPPA 2BTDA 3Q7AA 1E8ZA 2R59A 2QYUA 4N3CA 1OUVA 3MGBA 3SGHA 2DWZA 5G04J 2KZTA 1H2TC 3UM0A 1N0QA 3PZDA 3SZ7A 1INZA 1U3CA 2WXJA 4UQXA 3R9AB 3UM3A 3FHEA 4GAAA 2J07A 5CEDB 2Q7FA 3C5RA 1LTXA 4I1MA 1TNZA 3TWWA 1KZPA 1LD7A 2IO3C 4CDRA 3EHMA 2YINA 2V4LA 4JHJA 3SY2A 4JC8A 3D9NA 2MHKA 2QYJA 2C0LA 1YYHA 3DSVA 2EIKE 2L6JA 2I1JA 4Y6CA 3FTSA 4G2VA 5FZRA 2WXGA 3EHNA 5D0OD 1X5BA 5CHEE 3ABME 4IULA 3R7RA 1S63A
chains in the Genus database with same CATH topology
3DXMG 1U2VG 3DXKG 4XEIG 2P9NG 2P9KG 3DWLG 3UKRG 3ULEG 2P9SG 1TYQG 1K8KG 4JD2G 2P9UG 2P9PG 3RSEG 3UKUG 2P9IG 2P9LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXM G;  1U2V G;  3DXK G;  4XEI G;  2P9N G;  2P9K G;  3DWL G;  3UKR G;  3ULE G;  2P9S G;  1TYQ G;  1K8K G;  4JD2 G;  2P9U G;  2P9P G;  3RSE G;  3UKU G;  2P9I G;  2P9L G; 
#chains in the Genus database with same CATH topology
 1HE8 A;  5EKQ D;  3PZ2 A;  3HRA A;  4DX1 A;  3OXG A;  3JQ1 A;  3LEW A;  5CRV A;  4ME2 A;  4NAC A;  4JZY A;  3I4G A;  4GZ5 A;  2X6K A;  3CVP A;  3N71 A;  2DBA A;  4J0U A;  3UTM A;  2E0I A;  3U64 A;  4UWF A;  4ANX A;  4DJA A;  1MHQ A;  3RSE G;  3UKU G;  2VGX B;  2LAH A;  4I6E A;  2A4Z A;  2WXO A;  2ZXW E;  3SO8 A;  2XGM A;  1FCH A;  4DLQ A;  3E34 A;  4XZ4 A;  3DSX A;  4TV3 A;  2PNN A;  4F1S A;  2X3M A;  2WXR A;  1KT0 A;  3UIO C;  3U4T A;  1MQS A;  3AS8 A;  4KBQ A;  2I6H A;  4J8Y A;  1UG3 A;  3PNT B;  5KJK A;  1QNF A;  2AVP A;  4GZ6 A;  3CVU A;  1KZO A;  5J90 A;  1JWG A;  4GA1 A;  4Q96 A;  3QAR A;  2KC7 A;  2KBX A;  4EPZ A;  1L5J A;  4V3I A;  3P1U A;  3B13 A;  3S7B A;  3G2W A;  1E96 B;  5EN5 D;  4BWR A;  2A5E A;  4U0Z A;  3NBN B;  2VGX A;  4FC8 A;  4DX7 D;  4G11 A;  2WMN A;  1V54 E;  3T5X A;  4G1T A;  3Q4A B;  1WDY A;  4APF A;  4I1O B;  1GW6 A;  1N4P A;  3DRA A;  3ZYM A;  5LX8 A;  5LCW J;  4I43 A;  3D9M A;  1UJJ A;  2MRI A;  3NQP A;  2VQ2 A;  5E76 A;  2PZI A;  4A55 A;  4HOQ A;  4HQD A;  4CEM A;  4FHJ A;  2XEE A;  2HE0 A;  1OCC E;  2X38 A;  3CSF A;  3SBS A;  4ATG A;  2XS8 A;  2DYR E;  3FTZ A;  3DST A;  5JHB A;  1S0P A;  4AJW A;  2IY0 C;  1NFI E;  4EZK A;  1FT1 A;  1NA0 A;  2IOS A;  1BI7 B;  1K3Z D;  3TWU A;  4HOS A;  3FH7 A;  1N4S A;  1OXJ A;  2ILR A;  4OAV B;  4I9E A;  4RVB A;  4GTV A;  2V5F A;  3FFL A;  4BY6 A;  4GZD A;  1HG2 A;  3PRZ A;  2I9C A;  4HRL A;  4DUI A;  4AVX A;  5C1D A;  4GYY A;  3B7S A;  1U3D A;  4I1A A;  3ULQ A;  4U95 D;  2I1K A;  4U8V D;  1OWP A;  4I17 A;  5BT1 A;  3G2V A;  4GU5 A;  2OCC E;  2GGF A;  3V31 A;  3NOC D;  2RFM A;  1X81 A;  3IV0 A;  3AS5 A;  2ZGD A;  3SF4 A;  3PH0 C;  4FUL A;  5ENQ D;  1KPS B;  4CRW A;  2L9B A;  4RLY A;  4KT6 B;  3ZGQ A;  4JPS A;  4BEP A;  2RKK A;  3J5P A;  2PM6 A;  3SBT B;  3S7J A;  3ZVV A;  2HYZ A;  4G24 A;  4PDX A;  2P9U G;  4WWP A;  3CLJ A;  5ARG A;  2LXM A;  3EHR A;  5G04 C;  4BTB A;  1Y8M A;  3UIP C;  1E8W A;  2L0T B;  4FP7 A;  3ZRH A;  3BUA A;  3DEP A;  3RJV A;  2BKK B;  2BED A;  1RZ4 A;  2RD0 A;  4HOR A;  4DI4 A;  3CKC A;  3SD5 A;  3RRU A;  3MYV A;  3DSS A;  3CQG B;  1SZA A;  3IXE A;  3MKQ B;  5AQA A;  3HHM A;  3JQ0 A;  5BV0 A;  3CGH A;  4XI0 A;  3LCA A;  4LG6 A;  4UUC A;  3CR3 A;  4J8F A;  2AWI A;  2YHC A;  4JEU A;  1FVF A;  5CCM A;  3KS2 A;  5G05 C;  3SFX A;  4TXR A;  2J9Q A;  3FU6 A;  1UW4 B;  1KT1 A;  2J4B A;  2F0Y A;  3L54 A;  3FUE A;  3KD7 A;  2XHE A;  4J8S A;  3E32 A;  3ASH A;  1JCQ A;  4QQI A;  3E37 A;  5ITZ F;  5FQ6 A;  4XE0 A;  2IEJ A;  3RU0 A;  3SFZ A;  2IO2 C;  3APC A;  1SQM A;  1TNU A;  4WNE A;  5FWQ A;  3JXI A;  3ZHE B;  1UJK A;  2PQN A;  4I2Z A;  3ZEF A;  1MX4 A;  3EHQ A;  1DC2 A;  3QWV A;  3FUL A;  4KYO B;  4ZHB A;  4GZC A;  4CGV A;  3RAU A;  1XGW A;  1BPO A;  2JLB A;  4JA9 A;  3HG0 D;  1H2U A;  3RO2 A;  5EIB E;  3FTW A;  2GRL A;  2DZO A;  4G25 A;  4HBD A;  5KJL A;  3PVL A;  2J08 A;  4N2S A;  1NL4 A;  4B0Z A;  4CYM D;  3HXB A;  4B8C B;  5JJ6 A;  4U0U A;  4UQY A;  3UUX A;  3BG0 B;  3Q78 A;  1S70 B;  3C3Q A;  2IJG X;  5LCW C;  3ZHE A;  3Q47 B;  3V2O A;  4U0S A;  2WXM A;  3PDN A;  3Q5M A;  2F37 A;  4FA6 A;  3TGO A;  2KZT B;  3LS8 A;  3NOG D;  2YQ8 A;  1HF8 A;  3LY8 A;  4LRZ A;  3Q79 A;  3WG7 E;  1JCR A;  2OEW A;  1O5M A;  3LXU X;  3OTN A;  3SFY A;  1S64 A;  4PH4 B;  4HOU A;  4N3B A;  4K5A B;  3TWX A;  2P9P G;  3D9L A;  2RG8 A;  3D9H A;  2F8Y A;  1QZ2 A;  4A3T A;  2XGO A;  5KNH D;  2XRY A;  1BI8 B;  4FU3 A;  3B95 A;  2Y1L E;  2AXV A;  4L7T A;  5BXO A;  3L22 A;  3CK7 A;  3B7U X;  4CT0 A;  5KJM A;  4GTM A;  3NZU A;  3PZ1 A;  5FT9 A;  1ELK A;  1N54 A;  1TR4 A;  2UY1 B;  4YDY A;  3FTV A;  3DSU A;  1IQU A;  3DWL G;  1YA0 A;  1SW6 A;  5ENT D;  5AQ7 A;  3EIJ A;  5ANL A;  1IQR A;  5AAR A;  4DX5 D;  2JEK A;  1HH8 A;  4JHK A;  2NYJ A;  5G2N A;  3FU0 A;  2AW6 A;  4OAU C;  4GCN A;  4H7X A;  5AQB A;  3BQO A;  2P9K G;  2ION A;  1NI1 A;  1IKN D;  2QZA A;  3CEQ A;  2WXQ A;  4MBG A;  1IXV A;  2XEV A;  1NZN A;  3ZN3 A;  4BSZ B;  2XPY A;  3U3W A;  2XGS A;  3Q73 A;  2KAT A;  1Q2Z A;  5EID A;  5AYW D;  1ZU2 A;  3ZYK A;  2FUL A;  1HO8 A;  1Z3Y A;  2VSX E;  4ANW A;  5ARF A;  2UY1 A;  3DBS A;  3EU9 A;  3Q9U C;  4O1O A;  1K1B A;  1E7V A;  4N5C A;  3EDT B;  1MX2 A;  2WPV A;  5G05 J;  5A7D B;  4C48 B;  2WXF A;  4LCT A;  2WXP A;  4F53 A;  1FPP A;  1ELR A;  1A5E A;  3FY4 A;  4IRU A;  3VLE A;  4EEC A;  2GRQ B;  5T4Y A;  4H7Y A;  3ZKJ A;  3IEG A;  4J8E A;  5EYP F;  4BSX A;  4NUR A;  4GYW A;  4HNA D;  2EIM E;  4A3V A;  2Y4U A;  4DLO A;  3ULE G;  4MS6 A;  1JWF A;  3DSW A;  3AG1 E;  4GTO A;  1HXI A;  1WM5 A;  3ESL A;  2LO6 A;  5FQ8 A;  3ZFW A;  5E75 A;  1TN6 A;  4ILH B;  3LVQ E;  4R7L A;  1OT8 A;  1XNF A;  1E7U A;  1EPU A;  5DBK A;  3LPZ A;  3HXD A;  2X6J A;  3VTY A;  3HDX A;  2WXL A;  3AG3 E;  3P2B A;  2QY7 A;  3CIA A;  3UPV A;  3FEY A;  5FIN A;  3CV0 A;  5KCM A;  2EIJ E;  4HB5 A;  2BF0 X;  3QWP A;  3PE3 A;  3EUV A;  3ZXS A;  4GMJ A;  3ML9 A;  3UT7 A;  1Z3X A;  2AXZ A;  3HVE A;  4YVO A;  4U04 A;  5A23 A;  4AEZ C;  3GW4 A;  4I2W A;  5T3R A;  1BD8 A;  4PS3 A;  2YNQ A;  3O4Z A;  2XZT G;  2Y0B G;  3CHP A;  1OWM A;  1H2V C;  3PZ4 A;  4MRU A;  3QC1 A;  3LY9 A;  5J08 A;  1IHG A;  2X6I A;  4AY6 A;  4J8D A;  3FTX A;  2V5Q C;  3E30 A;  3V2X A;  4BX8 A;  2ETB A;  4Q94 A;  1K1A A;  2R2L A;  4EBA G;  3VLF A;  3LKU A;  2NXP A;  1NP7 A;  1TNB A;  1ZB1 A;  3QOU A;  2OND A;  4B8A A;  2OEV A;  3G2S A;  3QWW A;  4JD2 G;  3UM1 A;  2IOL A;  4AP2 A;  1NA3 A;  4PS7 A;  4L2Y A;  2J49 A;  2NSZ A;  4ZFH A;  5FQ7 A;  1N94 A;  4KZC A;  2R05 A;  5FQ4 A;  1OY3 D;  2DVW A;  5HQ8 A;  3QAQ A;  1WG0 A;  5M72 A;  4JXT A;  4E6H A;  3E4B A;  3PRE A;  3VTX A;  5LP0 A;  3ASF A;  4MLP A;  1H19 A;  1ZBP A;  4HI9 A;  1H6P A;  4TUM A;  2X6F A;  3CHM A;  5AQ9 A;  5D0Q D;  1JCS A;  5ENO D;  4L2L A;  4EZL A;  3ZU7 B;  3MX3 A;  1B89 A;  3ULY A;  4N39 A;  2E2E A;  3PNL B;  2WXN A;  4N3A A;  3FUH A;  4CCA A;  4CGW A;  3O48 A;  4JL0 A;  3RIB A;  2CFU A;  3TJP A;  4C0E A;  4XI9 A;  3FUJ A;  5B1A E;  4KXK B;  3AG2 E;  3X2Q E;  2OOE A;  4JVS A;  3MCX A;  4UWL A;  4DX2 A;  4P29 A;  4LNU D;  2P58 C;  2M63 A;  4TRQ A;  2WQ7 A;  2UWJ G;  2DCP A;  3UT4 A;  1LD8 A;  3ENE A;  2L6B A;  3KSQ A;  3ZPJ A;  1IYG A;  4Z68 A;  5CCL A;  4RQI A;  3FH5 A;  3NAW A;  3SQV A;  4N2Q A;  2C0M A;  4L1B A;  4ILG A;  3FUK A;  1D8E A;  3VLD A;  3ZXP A;  2CHW A;  4O60 A;  4ILI A;  3IBE A;  4A63 B;  3CHR A;  4EQF A;  2R03 A;  4GPM A;  4CT4 A;  1FVH A;  3V79 K;  3FU3 A;  1MYO A;  1TEZ A;  2GRP B;  1H6K A;  3LDZ A;  2XEH A;  5ANR A;  3S7D A;  4APO A;  4UWH A;  4L23 A;  5FZQ A;  2WMO A;  3ASO E;  5HKP A;  4O1P A;  3I5P A;  3J5Q B;  2VSY A;  4G8K A;  1OCO E;  1D8D A;  3UXG A;  2BKG A;  3MJW A;  4F6R D;  2EQX A;  4WAF A;  4HRN A;  5T8I A;  4NIK A;  2J8S D;  1VDY A;  3FUI A;  4GB9 A;  5EX0 A;  3IHV A;  3CQC B;  4XEI G;  3B7T A;  2P9N G;  2XCB A;  4IYP A;  4U8Y D;  1Z6T A;  5DIZ A;  4W9R A;  4GML A;  3B7R L;  3FTU A;  1HU3 A;  2WB2 A;  3UIN C;  2ETA A;  4YND A;  4AOF A;  5BW8 C;  3FTY A;  5CRU A;  3JYS A;  3PUJ A;  3DPD A;  4BX9 A;  1OWO A;  3TXM A;  2MYO A;  4ANU A;  1N11 A;  3CHQ A;  2XZD G;  1DVP A;  4G23 A;  3TG4 A;  3ASD A;  4AV7 A;  2GW1 A;  4I6G A;  3Q75 A;  3L08 A;  2B6C A;  2Y3A A;  1JPL A;  2PL2 A;  3TWQ A;  1E8Y A;  3AJI A;  4Q69 A;  2OV8 A;  4LER A;  2AJA A;  2LNI A;  3MZL B;  1JUQ A;  2DIW A;  3ONL A;  4JW1 A;  4LSZ E;  4FLB A;  1RW2 A;  4BT9 A;  4HLE A;  3ASG A;  2A5U A;  3IHY A;  4UI9 C;  3APD A;  1V55 E;  1BU9 A;  1H6O A;  2DZN A;  4ACL A;  4A1G A;  3QDN A;  4TUU A;  5B1B E;  3ABK E;  4U7E B;  4G8L A;  3QKY A;  4BT8 A;  2CG2 A;  3AG4 E;  5CBN A;  5ENP D;  1WY6 A;  5BV1 A;  4C9B B;  4B89 A;  1G3N B;  3QJZ A;  4O6F A;  2FEZ A;  4BET A;  2I2O A;  4E85 A;  4XKC A;  2V0P A;  4DRX E;  2VSN A;  3E33 A;  3AAA C;  3FUN A;  3OXF A;  5FJY A;  5KBA A;  1K8K G;  3HIZ A;  3UI2 A;  3PS6 A;  5JMN D;  5AIJ A;  4WUY A;  1FT2 A;  1KLX A;  1U2V G;  1DNP A;  3CHS A;  3KSL A;  4AY5 A;  3IKO B;  4HRM B;  1O1R A;  4N5Q A;  4BTA A;  2R17 C;  3LJ3 A;  3L16 A;  5HRY A;  3TWT A;  1HFA A;  1TN7 A;  2H6H A;  1O1T A;  2J09 A;  5KNG A;  2IQC A;  4NRH B;  4LNG A;  2VSO E;  2KM4 A;  4XKB A;  3LJN A;  3GZS A;  1N9A A;  2GRO B;  2XPZ A;  3CVY A;  3Q15 A;  4HLL A;  2NC9 A;  4EBA A;  4I9C A;  4EZJ A;  3CK9 A;  4WNF A;  2HR2 A;  2XPI A;  3ESK A;  4HVB A;  5FTP A;  2EIL E;  2P9S G;  3TWV A;  3Q9N C;  3KEZ A;  5ENN A;  3AS4 A;  4FJZ A;  4AM9 A;  4G26 A;  3NF1 A;  1OCZ E;  4XX5 A;  4BFR A;  5EYL A;  3CVQ A;  4D10 C;  2ZIS A;  4YVQ C;  3ML8 A;  4DI3 A;  3EU5 A;  4TXP A;  1OCR E;  1HS6 A;  3V30 A;  3CVX A;  3L17 A;  4F3V A;  1N52 A;  3CVN A;  3MKR A;  3HVE B;  3OAW A;  3D9J A;  3DEO A;  4K03 A;  3R9M A;  3MA5 A;  5EX3 A;  2P2C P;  2WVI A;  5IY5 E;  2BUG A;  2LXL A;  3DXK G;  4M7C A;  4QFV A;  4U96 D;  4AIF A;  3FUM A;  4K5C A;  3PE4 A;  2CG3 A;  5AEN A;  2LAI A;  3Q7F A;  4GA2 A;  1SVX A;  2IU1 A;  2GRR B;  3ZYQ A;  1OWL A;  3JUE A;  3TL5 A;  4GTS A;  2LSU A;  5D66 A;  2VGY A;  3D9O A;  4NQ0 A;  4X8Q A;  2CHX A;  5D2M C;  1MJ0 A;  4YDE A;  3F6Q A;  1A17 A;  2R5S A;  2XRZ A;  2FI7 A;  5C2Y A;  2XS1 A;  3L82 A;  3I3N A;  2WXH A;  3CKB A;  4FLH A;  3EJN A;  1WAO 1;  2H6F A;  3W9G A;  3FH8 A;  4Y6W A;  1DCQ A;  3JXJ A;  2QFC A;  3QB2 A;  2VTB B;  3TWR A;  2L0I A;  3I4R B;  5JHA A;  2ZGG A;  1HX8 A;  5CMY A;  2AXU A;  2H6G A;  1PC2 A;  3EIQ C;  4JEH A;  4JA7 A;  3TWS A;  4MKT A;  2FO7 A;  3BG1 B;  2R02 A;  4GPK A;  4U07 A;  2LUH A;  1BLX B;  3GYZ A;  4GMR A;  4F1P A;  5FZS A;  3RK6 A;  3ZNG A;  3HXF A;  4U8H A;  4UI9 J;  3D9P A;  3BEE A;  2DYS E;  4HI8 A;  3LYA A;  1Z5S C;  2C2L A;  4DX6 D;  4DPR A;  2WXK A;  3S7F A;  1O1S A;  1EDU A;  3T5V A;  3RRM B;  4C0M A;  2HM8 A;  5CBO A;  3UT8 A;  3C3O A;  3PEU B;  2V8S E;  4LEU A;  2P9I G;  3L13 A;  4HOT A;  3FDH A;  2VTB A;  3TG5 A;  4GTR A;  5KWD A;  2CFZ A;  3R7Q A;  3MEK A;  1QYM A;  3FP3 A;  3ABL E;  4WND A;  3G2T A;  3SNX A;  1AP7 A;  2KXP C;  1SA4 A;  4J6I A;  2WM9 A;  4UWG A;  1TJC A;  5ENS D;  2IFU A;  4GTQ A;  4ACK A;  4AXH A;  3LY7 A;  1TNO A;  3HXC A;  4I6J A;  5HI7 A;  1TJF A;  3UKR G;  4UQZ A;  5BUZ A;  5KJN A;  1MX6 A;  5LFA A;  5ENR D;  2FO1 E;  1SA5 A;  3PZ3 A;  1OWN A;  3CST A;  3ASN E;  4TXQ A;  1N4Q A;  4F7A A;  5BNW A;  3S2A A;  2PQR A;  1HG5 A;  3D3M A;  3SI5 A;  2VJ8 A;  1DCE A;  4K0R A;  5JA4 D;  1YMP A;  5FIO A;  1UN9 A;  4B94 A;  3JUI A;  2ZIR A;  3C72 A;  3ZUV B;  3LVR E;  2V4H C;  3RKV A;  3FU5 A;  3GZ1 A;  3NB2 A;  1HZ4 A;  4KVO A;  3DXM G;  4IN3 B;  4FAD A;  3HXE A;  3T8M A;  3WXX A;  4KZ0 A;  2KCK A;  1QQE A;  3URZ A;  4KMO A;  4ATZ D;  2XEN A;  3ZIM A;  2GRN B;  2XCC A;  3C98 A;  1QBQ A;  3TXN A;  2J4D A;  3KAE A;  4UWK A;  5LOZ A;  3T8K A;  4CDM A;  2XQ0 A;  4ABN A;  1MZC A;  3CVV A;  1UOH A;  4RG6 A;  1H0A A;  4XIF A;  4LUN U;  3FWV A;  5EIL A;  4FHK A;  2MOW A;  3UMV A;  1PY1 A;  1LF8 A;  2F8X K;  3U9W A;  1D9S A;  3D9I A;  1N4R A;  2ETC A;  3L6A A;  3RO3 A;  2HO1 A;  3TAX A;  2YHE A;  4FJY A;  5AJL A;  3QK0 A;  2KCV A;  2CHZ A;  1W3B A;  4OYS A;  1TN8 A;  1P5Q A;  5A6C A;  2WQ6 A;  2FF4 A;  1EF1 C;  2OVB A;  5CEC B;  2IF4 A;  3CK8 A;  1N0R A;  4GA0 A;  4EHM A;  3GZ2 A;  3DPY A;  4CZ2 D;  2JAB A;  2WQH A;  3ONK A;  4BES A;  2PM7 A;  4DK5 A;  3UX4 A;  3FUF A;  3C3R A;  5G55 A;  3BU8 A;  4URK A;  5AAO A;  5AN8 A;  5EDS A;  1TNY A;  4WWO A;  3SHF A;  3CHO A;  4HS2 A;  2FBN A;  1E8X A;  4BER A;  3Q49 B;  5CER B;  1UN8 A;  5B3S E;  1PAQ A;  5CMW A;  3AU4 A;  2KCL A;  3MKQ A;  2QC9 A;  5HS0 A;  2P9L G;  4GYO A;  4L9P A;  2X6H A;  2OVF A;  4OVV A;  4RG9 A;  4GZ3 A;  4PS8 A;  4GCO A;  2Y4T A;  3KEA A;  3UQ3 A;  5BXU A;  1E90 A;  3FUD A;  2GRM A;  4JHR A;  1ELW A;  4ANV A;  3APF A;  3W9F A;  1SZ9 A;  1AWC B;  1EYH A;  1YCS B;  2WXI A;  4J7W A;  4WWN A;  5CEA A;  4UI9 K;  3CVW A;  1IHB A;  4HXI A;  3PUK A;  5JJ7 A;  3QNK A;  1TYQ G;  4OVU A;  5JJT A;  4GTP A;  3UM2 A;  2B0O E;  4LNB A;  4PUC A;  2EIN E;  3OXL A;  3MV2 B;  3U66 A;  4YDW A;  3D9K A;  3AU5 A;  4CDN A;  3JCK C;  3MV3 B;  5AJD A;  3ZW3 A;  3T9K A;  1N95 A;  4HFG A;  4K5B A;  3HYM B;  3ZYL A;  2VGE A;  3L9T A;  3G2U A;  4WNG A;  2Y69 E;  2H6I A;  3PEV B;  4YDO A;  1Y6I A;  4GTT A;  3NZS A;  5H7P A;  3FEX A;  4M3O A;  3RRN B;  4RSY A;  3CVL A;  3ISM C;  4A1S A;  2RFA A;  3K9I A;  3B7B A;  4JB8 P;  2VYI A;  4B93 B;  2LSV A;  4U63 A;  4KVM A;  2ZU6 B;  5BPP A;  2BTD A;  3Q7A A;  1E8Z A;  2R59 A;  2QYU A;  4N3C A;  1OUV A;  3MGB A;  3SGH A;  2DWZ A;  5G04 J;  2KZT A;  1H2T C;  3UM0 A;  1N0Q A;  3PZD A;  3SZ7 A;  1INZ A;  1U3C A;  2WXJ A;  4UQX A;  3R9A B;  3UM3 A;  3FHE A;  4GAA A;  2J07 A;  5CED B;  2Q7F A;  3C5R A;  1LTX A;  4I1M A;  1TNZ A;  3TWW A;  1KZP A;  1LD7 A;  2IO3 C;  4CDR A;  3EHM A;  2YIN A;  2V4L A;  4JHJ A;  3SY2 A;  4JC8 A;  3D9N A;  2MHK A;  2QYJ A;  2C0L A;  1YYH A;  3DSV A;  2EIK E;  2L6J A;  2I1J A;  4Y6C A;  3FTS A;  4G2V A;  5FZR A;  2WXG A;  3EHN A;  5D0O D;  1X5B A;  5CHE E;  3ABM E;  4IUL A;  3R7R A;  1S63 A; 
#chains in the Genus database with same CATH homology
 3DXM G;  1U2V G;  3DXK G;  4XEI G;  2P9N G;  2P9K G;  3DWL G;  3UKR G;  3ULE G;  2P9S G;  1TYQ G;  1K8K G;  4JD2 G;  2P9U G;  2P9P G;  3RSE G;  3UKU G;  2P9I G;  2P9L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...