2P9PG

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
143
structure length
128
Chain Sequence
ARFRKVDVDEYDENKFVDGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 39
structure length 128
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9pG00
3DXKG 2P9SG 1K8KG 2P9LG 4JD2G 3UKUG 3UKRG 2P9NG 2P9KG 3DXMG 1TYQG 2P9UG 4XEIG 3RSEG 3DWLG 1U2VG 3ULEG 2P9IG 2P9PG
chains in the Genus database with same CATH superfamily
4RG6A 4G11A 4EZKA 4HRNA 2PL2A 3KEAA 4PH4B 3O4ZA 4HB5A 4RVBA 5T4YA 5EDSA 2WQHA 3DXMG 2ETBA 4TUUA 4FULA 3ABLE 2OCCE 3ABKE 4RLYA 4EZJA 3DSVA 3SO8A 2L0TB 4HBDA 2X6FA 5FQ7A 4JB8P 4ABNA 3RRNB 4G24A 1BU9A 2XRYA 3SZ7A 4GMLA 1TNUA 1IHGA 1UJJA 1U3DA 3UMVA 4NURA 5KNGA 3FHEA 2CG3A 4O1OA 3CVNA 1NFIE 2VJ8A 3LY9A 2V4HC 2P9SG 1SW6A 2KCKA 1YCSB 3R9MA 1H6OA 1Z6TA 4UQZA 4O6FA 3Q78A 4N3BA 4KYOB 2Y69E 1FVFA 1FCHA 1HF8A 3SFYA 2XRZA 1E8YA 3B95A 2I9CA 4GYYA 2EILE 2DCPA 2OOEA 1RW2A 2ZISA 1E8XA 2J9QA 3ZYKA 4M3OA 3B7TA 1QYMA 3VTXA 1N11A 4U96D 2VGYA 3BQOA 1AP7A 3OAWA 5CMYA 3IHVA 3LYAA 3W9GA 1LD8A 3CQGB 2L6BA 2AXZA 2IOSA 3I4RB 4J6IA 5CBNA 4JA9A 3SI5A 3FTUA 3CVQA 4P29A 1FPPA 3ASHA 5FWQA 2FULA 5D2MC 3ZYMA 3T8MA 4L2YA 4J7WA 3CEQA 1KPSB 3ZEFA 2C0MA 4B0ZA 2LAIA 2WXKA 4L2LA 3JCKC 2QYJA 3GZSA 2BUGA 4B8AA 4CDRA 4KVOA 2KZTA 3ULQA 3ZU7B 2XPIA 3AG1E 1WM5A 4AM9A 1X5BA 2JABA 1GW6A 4DX1A 3E30A 4EECA 1N4SA 3FTVA 1WG0A 2J4DA 4G23A 4KBQA 4WAFA 2B0OE 1ELRA 5B1BE 5A6CA 3G2UA 4FJZA 2IOLA 1INZA 2VSNA 5JMND 4RG9A 2VGXB 4CDNA 3JQ0A 1OCOE 4G1TA 3ZRHA 2DYRE 4MLPA 4BSZB 3TAXA 5ENSD 5ENOD 4C48B 2VTBA 4UI9C 4UWLA 3FUMA 3ENEA 3AG3E 1UJKA 3EHRA 4DLQA 3QWWA 4I1MA 4CYMD 3FUNA 3Q5MA 3V30A 2J07A 2FBNA 3LDZA 3OTNA 3CGHA 3FU6A 3P1UA 3MEKA 3D3MA 3NZSA 3VLDA 2CFZA 5AQ9A 4K5CA 3NQPA 2WXMA 4C9BB 4FA6A 3S7FA 5EYPF 2QC9A 4PDXA 1DC2A 1O5MA 1JCRA 4GB9A 2WXNA 4G2VA 1HE8A 4JVSA 4WWOA 3QWVA 4D10C 3NZUA 4DX2A 1TN8A 1MZCA 3CKBA 1ELWA 3Q7FA 2YINA 3CHQA 5BUZA 2XEHA 5M72A 2NC9A 3FUKA 3APCA 2MHKA 4JEUA 1SZAA 5KJKA 1ZB1A 3UM1A 4FHKA 4JW1A 3CVYA 3U4TA 3T8KA 1H19A 3UM0A 5BXOA 3BU8A 3DRAA 3ASGA 3CVVA 4XE0A 5EYLA 3Q75A 2FO1E 3L08A 3PNLB 2BEDA 1KZPA 3LY8A 4QFVA 4J0UA 3ONKA 4G25A 4KVMA 2WM9A 4U0SA 3CLJA 4UWFA 2R03A 4WNDA 3IXEA 3WXXA 4LUNU 3MCXA 3FUEA 3T5XA 3HVEB 4URKA 1UOHA 5AQ7A 2KM4A 3QAQA 4ANWA 3OXFA 4F1SA 2KXPC 2WQ7A 3PREA 4GA1A 2VSXE 3FUIA 1IHBA 1TJCA 3FTXA 5CECB 4XI0A 2Y4TA 4UWKA 4APFA 3S7BA 3WG7E 2UWJG 3EJNA 4O60A 3Q49B 3IBEA 5KWDA 2R05A 3FY4A 4GTTA 5ARGA 2RD0A 4H7YA 2H6GA 2EQXA 4XX5A 4GZCA 2Y4UA 3E34A 5J90A 2ZGGA 3Q4AB 4KMOA 4GPMA 4GTQA 2ZU6B 3AU5A 1DNPA 1BPOA 3LKUA 3MGBA 3UXGA 5FIOA 4U07A 2OVBA 3V2XA 3JUIA 4C0MA 5AIJA 4UUCA 5AQBA 2ZXWE 2H6HA 3D9IA 5EILA 3KSQA 3EIQC 5E76A 2RKKA 1ELKA 2P9LG 3UT4A 3CIAA 5AJLA 3ZUVB 3TXNA 4AEZC 4EBAG 2LSVA 4YNDA 2WQ6A 3Q15A 4O1PA 1K3ZD 3URZA 2IF4A 2AXVA 4IULA 3TWVA 1TNZA 4I9EA 1D8DA 4XKCA 4GTSA 5EKQD 4HOTA 3PEUB 3FFLA 4Y6CA 4WNFA 3JXJA 5FQ4A 3LVQE 4BTBA 5LX8A 3TG4A 4CGVA 1HO8A 1W3BA 3RU0A 3OXGA 2J8SD 1TNOA 3D9KA 3PNTB 3DPDA 1OY3D 5CRVA 3PH0C 3DPYA 2E0IA 3PUKA 4AY5A 1FT1A 2CHXA 3SD5A 5G2NA 3PEVB 4JHKA 2DVWA 5EX0A 4ANUA 4DI3A 5HI7A 4J8EA 3APDA 4Q69A 1QQEA 3ZYQA 4KZCA 2RFAA 3ZVVA 5H7PA 3IV0A 3CK8A 1HH8A 3HXEA 3IHYA 3HXBA 2QZAA 4DRXE 2XPZA 4U63A 4EPZA 2MOWA 4AXHA 5LCWC 3D9OA 2FEZA 2DZOA 2HM8A 2Y0BG 3EHMA 4JA7A 4LCTA 3QOUA 4HLLA 1FVHA 4B94A 1ZBPA 5CBOA 3ZW3A 3L22A 4XKBA 2KBXA 3ISMC 2P9IG 1BLXB 1ZU2A 4L7TA 3ZKJA 3FWVA 5KJLA 3C3QA 4AP2A 2HYZA 3Q79A 2DIWA 4NIKA 2WXQA 2P2CP 1UW4B 2DWZA 3VLEA 3G2WA 2ETCA 4ZHBA 1TN7A 3HXCA 4GA2A 1HZ4A 4UI9K 1N54A 2LXMA 4TXPA 5T8IA 3AG4E 3HVEA 4EZLA 3TWUA 2JLBA 5BW8C 1DCQA 1IXVA 4JHRA 5HKPA 3GZ1A 3RRUA 4HVBA 3UPVA 1KZOA 3TWRA 4LSZE 5G04C 2A5UA 2FO7A 3CK9A 3FUFA 3FEYA 3C72A 3PZ2A 3FTZA 1V54E 5DIZA 1MX2A 3TWTA 3EU5A 4WNGA 1RZ4A 4B93B 5JJ6A 3PZ4A 3APFA 1H2UA 3RO3A 4AV7A 1VDYA 5B1AE 4I2WA 5AENA 2XEVA 3D9JA 2Q7FA 1H6KA 1HS6A 3SF4A 4GTOA 2MRIA 2J4BA 3Q73A 3W9FA 3CKCA 4AIFA 5FJYA 2RFMA 2V8SE 1QNFA 2WMNA 4I2ZA 3HDXA 3B13A 5EIDA 4E85A 3ZXPA 4N5QA 3TWQA 3QC1A 2ZIRA 4PS8A 3FULA 1WY6A 4JL0A 3CSFA 2X6IA 3PE4A 3CV0A 2NSZA 3EHQA 5G55A 3CSTA 3L16A 1B89A 3FH8A 3ASOE 3I5PA 4GZDA 4GZ6A 3DSSA 4I6GA 3UT8A 3LY7A 4EBAA 4U95D 4DUIA 1TEZA 1TNBA 4RSYA 4U0ZA 3PZDA 1AWCB 5KBAA 3ZFWA 4A55A 3CK7A 1EF1C 3D9PA 2P9NG 3QARA 3IEGA 1NL4A 2OEVA 4H7XA 3NB2A 2XCCA 4AVXA 4TRQA 2HR2A 1H2VC 5CRUA 3V31A 1S63A 4JD2G 3PE3A 2Y1LE 5ENRD 1YYHA 3ESKA 4APOA 4MS6A 4GTVA 3L6AA 3KEZA 4I17A 4BESA 4B8CB 4LNBA 4IYPA 3T5VA 4LRZA 1DVPA 4JEHA 4BERA 4ZFHA 3AS8A 2GRPB 1MJ0A 4L9PA 2IJGX 2A5EA 2VGEA 4GU5A 5G05C 1A5EA 5JA4D 4GTPA 1OCCE 1OCRE 1XNFA 3QJZA 4MBGA 3B7RL 2EIKE 3SGHA 2WXGA 2QFCA 4I1AA 4BT8A 2MYOA 3RK6A 3B7SA 4HQDA 2EIME 2WMOA 2OVFA 1N9AA 5J08A 5AARA 1MX4A 2PM7A 3MV3B 2XGOA 4J8YA 4FJYA 2EINE 4GAAA 2P9PG 3LVRE 4K5AB 4KT6B 3G2VA 5D66A 3U3WA 1K1BA 2DBAA 5AYWD 2BTDA 3UM2A 2VSYA 3NF1A 2XEEA 1BD8A 3UIOC 3DSXA 3NOCD 3UX4A 3TGOA 4XZ4A 2EIJE 4HOSA 5FQ8A 3FU0A 4AJWA 5LFAA 4L23A 3GZ2A 1HX8A 3U66A 2C0LA 1OT8A 3RO2A 3DEOA 4ACLA 1N95A 4I9CA 3NOGD 5KJMA 4DX5D 2ONDA 3LEWA 3JYSA 3UQ3A 3QDNA 5EN5D 1S70B 4I6JA 3SBTB 1L5JA 3MA5A 3LPZA 3S7JA 3UKRG 1N52A 4KZ0A 3TL5A 4DK5A 1JWFA 2PQNA 3SFXA 1OWOA 4YVOA 2AXUA 3I4GA 4PS7A 2LSUA 3MJWA 4TV3A 4Q94A 4ILHB 4LNUD 2CG2A 2WXRA 1O1RA 1EPUA 5AN8A 3FU3A 3ZGQA 4TXQA 1N0RA 1XGWA 3HXDA 5BNWA 3CVXA 5BV1A 1LD7A 4UWGA 1D8EA 4YVQC 3J5PA 3D9NA 5BXUA 5CERB 2AJAA 5CCLA 3JUEA 3T9KA 5KNHD 4WWPA 1D9SA 4E6HA 3L9TA 3P2BA 4ACKA 3UUXA 1EYHA 2I1KA 3L13A 5CCMA 3L82A 4J8DA 1H6PA 4CT4A 2I1JA 3AAAC 4JPSA 4DX7D 5HRYA 3KD7A 3QNKA 2X6KA 1N4PA 3D9HA 2Y3AA 3QK0A 2KCVA 5ARFA 3N71A 2VYIA 3E37A 4GCNA 3PZ1A 1QBQA 3CVUA 4YDYA 2IU1A 1X81A 3DEPA 3V2OA 4HRLA 1LTXA 4XEIG 3AG2E 3SQVA 2GRLA 3BEEA 3EDTB 3CHMA 3HG0D 3K9IA 2XENA 5BPPA 3ZNGA 3QKYA 1OWNA 2KATA 2AVPA 2L6JA 3MKQB 4W9RA 2P9UG 3UINC 3MYVA 5BV0A 2RG8A 5FTPA 2WXFA 1SZ9A 2JEKA 4UQXA 4UWHA 3E4BA 3ZPJA 3CVWA 2C2LA 4N39A 3MX3A 5KCMA 3FTSA 3Q7AA 2IFUA 4NACA 3CVPA 3MV2B 4FADA 1H0AA 1YA0A 4ILIA 4BEPA 4TUMA 4HORA 1PAQA 3PRZA 1MHQA 4UI9J 3ESLA 3FTWA 3UTMA 4BWRA 5CEDB 3FDHA 3RJVA 1LF8A 4R7LA 2XHEA 3UI2A 1UG3A 2YQ8A 3SFZA 3Q9NC 3HHMA 4A3VA 2CFUA 3LCAA 4GYOA 3CHSA 3DSWA 4YDOA 3U64A 2X3MA 3DWLG 1JUQA 3U9WA 3JQ1A 3RIBA 4MRUA 2PQRA 5ENNA 2F37A 1H2TC 3SHFA 2GRQB 3UM3A 1S0PA 4GTRA 2R5SA 4JHJA 4YDEA 3EUVA 4LEUA 2X6JA 1V55E 4BFRA 1S64A 1E8WA 5JJ7A 3R9AB 2DZNA 4FLBA 3R7RA 3PDNA 4FU3A 1K1AA 2LNIA 5ANRA 3ML8A 3KSLA 3OXLA 3TWXA 3ZHEB 1JPLA 5FZQA 1JCSA 5FQ6A 2WXIA 4F3VA 3FH7A 4F6RD 4MKTA 2ETAA 3KS2A 3B7BA 3LJ3A 1BI8B 2XZDG 3LS8A 3J5QB 3L17A 2YHCA 3PS6A 4OVVA 2I2OA 2VSOE 3NBNB 1NZNA 2YHEA 4IN3B 3SNXA 1HFAA 1OWPA 5ENTD 3QWPA 4NQ0A 1O1TA 2F8XK 3HRAA 4DI4A 1N0QA 1TNYA 4ILGA 3B7UX 2WPVA 1G3NB 3ZXSA 3ASNE 4Z68A 4DX6D 2XS1A 1A17A 2CHWA 4FP7A 3MKRA 5A7DB 1E90A 2NYJA 4OAVB 4U8YD 4DPRA 4U8HA 2WXJA 4CEMA 3FP3A 3TXMA 4N2SA 4UQYA 4ME2A 4HRMB 3PUJA 2V5QC 3ZN3A 2NXPA 2P58C 3EHNA 1NI1A 5AJDA 2PNNA 3G2SA 5HQ8A 4FLHA 4ATGA 3FUDA 3CHPA 5HS0A 1E96B 5BT1A 3ASDA 1WAO1 2XGSA 2IO3C 4HFGA 2LO6A 4M7CA 2GRNB 4ANVA 2AWIA 5EIBE 3FTYA 3NAWA 3RSEG 1IKND 2ZGDA 3MKQA 5CEAA 3PVLA 5ANLA 2X6HA 1PC2A 1Z3XA 5ITZF 3TG5A 4JC8A 4GZ5A 4F1PA 2OV8A 4I43A 1E7VA 1SA4A 5B3SE 4GCOA 1HU3A 3HXFA 2J49A 2WXOA 4HOQA 3GYZA 3CQCB 4A1GA 3V79K 4N2QA 3O48A 3BG1B 3ABME 1YMPA 4BTAA 3SBSA 1HG5A 3C3RA 5FZSA 1O1SA 2IO2C 4JZYA 3FEXA 3FUHA 2L9BA 4I6EA 2WVIA 2UY1B 1KT1A 4ATZD 1SVXA 2B6CA 2GRMA 2V0PA 1UN8A 5FZRA 1P5QA 4CDMA 3CVLA 3FH5A 3FU5A 3UKUG 4EHMA 2XQ0A 4G8KA 4FC8A 2GGFA 3ONLA 3EU9A 2HE0A 3LJNA 1DCEA 2J08A 1OWMA 2XCBA 1IQRA 2YNQA 3D9MA 2DYSE 3MZLB 4GZ3A 2VQ2A 1MQSA 2BKKB 4XIFA 5C1DA 1NP7A 5T3RA 4BY6A 5JHAA 5LP0A 1U2VG 3ZHEA 1HXIA 2AW6A 4F53A 2XGMA 4HI8A 4C0EA 1NA0A 2XZTG 2OEWA 3TWWA 4BX9A 3DSUA 5LCWJ 2HO1A 3AJIA 5JJTA 2X38A 3IKOB 2M63A 3F6QA 4K0RA 4OVUA 2R02A 4GMRA 4K03A 2LXLA 3DSTA 3VLFA 1U3CA 2A4ZA 4U7EB 4BT9A 4GPKA 1KLXA 2J09A 1OCZE 4OAUC 2R2LA 3C5RA 1Z5SC 2BKGA 4I1OB 3D9LA 4WNEA 1BI7B 2GROB 4BSXA 2IEJA 4GYWA 3ZYLA 3KAEA 2WXPA 3TWSA 4J8SA 4G26A 3G2TA 3HYMB 4U04A 2QY7A 4K5BA 5AAOA 4A3TA 4F7AA 4L1BA 5CHEE 3FUJA 4WUYA 4JXTA 5ENQD 3ULYA 3HIZA 4FHJA 3TJPA 4HXIA 4J8FA 4GA0A 1KT0A 3AS4A 3JXIA 2V4LA 5G04J 1TYQG 3GW4A 3E33A 2PM6A 1PY1A 3C3OA 1JCQA 4ANXA 4GMJA 3DBSA 4BETA 4V3IA 3PZ3A 4N3CA 1MYOA 4BX8A 3CHOA 3AS5A 4YDWA 2FI7A 4U8VD 4Y6WA 4HI9A 2LAHA 4DJAA 4PUCA 2KC7A 3CHRA 2I6HA 4TXRA 3ASFA 4CZ2D 4X8QA 4AOFA 2CHZA 3X2QE 5JHBA 1N4QA 1QZ2A 4LG6A 3ML9A 2F8YA 1SQMA 3ZIMA 5D0QD 1OUVA 3UIPC 1E7UA 4CCAA 5EX3A 1EDUA 3Q9UC 2QYUA 1Y8MA 1TJFA 1OXJA 2LUHA 2R17C 2R59A 1UN9A 3I3NA 3Q47B 4Q96A 3C98A 1N4RA 1Q2ZA 3BG0B 4IRUA 2IQCA 1TR4A 5CMWA 2H6IA 4N3AA 5FT9A 4GTMA 2VGXA 4HNAD 2UY1A 4DLOA 3E32A 3L54A 3DXKG 4A1SA 1K8KG 3BUAA 3R7QA 5DBKA 3RRMB 4AY6A 2PZIA 3VTYA 4WWNA 5LOZA 1HG2A 4CRWA 2H6FA 1FT2A 2F0YA 4LERA 4CGWA 3EIJA 5D0OD 4HLEA 4NRHB 5A23A 4EQFA 2KZTB 5ENPD 3AU4A 4QQIA 1JWGA 2XS8A 3LXUX 5AQAA 3RKVA 2WB2A 4KXKB 4HS2A 2BF0X 1Z3YA 3S2AA 2FF4A 1N94A 2WXHA 2P9KG 2GW1A 5IY5E 1IQUA 2XPYA 3S7DA 3UT7A 4G8LA 2ILRA 4A63B 2L0IA 1Y6IA 2V5FA 2WXLA 4HOUA 3QB2A 4PS3A 1TN6A 1OWLA 4LNGA 5G05J 3RAUA 1E8ZA 1NA3A 2IY0C 2IONA 5FINA 5C2YA 2E2EA 5E75A 1SA5A 4U0UA 4RQIA 2VTBB 3CR3A 4B89A 2GRRB 4XI9A 3SY2A 4OYSA 4CT0A 1IYGA 1MX6A 2KCLA 5KJNA 3ULEG 4N5CA 1WDYA
chains in the Genus database with same CATH topology
3DXKG 2P9SG 1K8KG 2P9LG 4JD2G 3UKUG 3UKRG 2P9NG 2P9KG 3DXMG 1TYQG 2P9UG 4XEIG 3RSEG 3DWLG 1U2VG 3ULEG 2P9IG 2P9PG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXK G;  2P9S G;  1K8K G;  2P9L G;  4JD2 G;  3UKU G;  3UKR G;  2P9N G;  2P9K G;  3DXM G;  1TYQ G;  2P9U G;  4XEI G;  3RSE G;  3DWL G;  1U2V G;  3ULE G;  2P9I G;  2P9P G; 
#chains in the Genus database with same CATH topology
 4RG6 A;  4G11 A;  4EZK A;  4HRN A;  2PL2 A;  3KEA A;  4PH4 B;  3O4Z A;  4HB5 A;  4RVB A;  5T4Y A;  5EDS A;  2WQH A;  3DXM G;  2ETB A;  4TUU A;  4FUL A;  3ABL E;  2OCC E;  3ABK E;  4RLY A;  4EZJ A;  3DSV A;  3SO8 A;  2L0T B;  4HBD A;  2X6F A;  5FQ7 A;  4JB8 P;  4ABN A;  3RRN B;  4G24 A;  1BU9 A;  2XRY A;  3SZ7 A;  4GML A;  1TNU A;  1IHG A;  1UJJ A;  1U3D A;  3UMV A;  4NUR A;  5KNG A;  3FHE A;  2CG3 A;  4O1O A;  3CVN A;  1NFI E;  2VJ8 A;  3LY9 A;  2V4H C;  2P9S G;  1SW6 A;  2KCK A;  1YCS B;  3R9M A;  1H6O A;  1Z6T A;  4UQZ A;  4O6F A;  3Q78 A;  4N3B A;  4KYO B;  2Y69 E;  1FVF A;  1FCH A;  1HF8 A;  3SFY A;  2XRZ A;  1E8Y A;  3B95 A;  2I9C A;  4GYY A;  2EIL E;  2DCP A;  2OOE A;  1RW2 A;  2ZIS A;  1E8X A;  2J9Q A;  3ZYK A;  4M3O A;  3B7T A;  1QYM A;  3VTX A;  1N11 A;  4U96 D;  2VGY A;  3BQO A;  1AP7 A;  3OAW A;  5CMY A;  3IHV A;  3LYA A;  3W9G A;  1LD8 A;  3CQG B;  2L6B A;  2AXZ A;  2IOS A;  3I4R B;  4J6I A;  5CBN A;  4JA9 A;  3SI5 A;  3FTU A;  3CVQ A;  4P29 A;  1FPP A;  3ASH A;  5FWQ A;  2FUL A;  5D2M C;  3ZYM A;  3T8M A;  4L2Y A;  4J7W A;  3CEQ A;  1KPS B;  3ZEF A;  2C0M A;  4B0Z A;  2LAI A;  2WXK A;  4L2L A;  3JCK C;  2QYJ A;  3GZS A;  2BUG A;  4B8A A;  4CDR A;  4KVO A;  2KZT A;  3ULQ A;  3ZU7 B;  2XPI A;  3AG1 E;  1WM5 A;  4AM9 A;  1X5B A;  2JAB A;  1GW6 A;  4DX1 A;  3E30 A;  4EEC A;  1N4S A;  3FTV A;  1WG0 A;  2J4D A;  4G23 A;  4KBQ A;  4WAF A;  2B0O E;  1ELR A;  5B1B E;  5A6C A;  3G2U A;  4FJZ A;  2IOL A;  1INZ A;  2VSN A;  5JMN D;  4RG9 A;  2VGX B;  4CDN A;  3JQ0 A;  1OCO E;  4G1T A;  3ZRH A;  2DYR E;  4MLP A;  4BSZ B;  3TAX A;  5ENS D;  5ENO D;  4C48 B;  2VTB A;  4UI9 C;  4UWL A;  3FUM A;  3ENE A;  3AG3 E;  1UJK A;  3EHR A;  4DLQ A;  3QWW A;  4I1M A;  4CYM D;  3FUN A;  3Q5M A;  3V30 A;  2J07 A;  2FBN A;  3LDZ A;  3OTN A;  3CGH A;  3FU6 A;  3P1U A;  3MEK A;  3D3M A;  3NZS A;  3VLD A;  2CFZ A;  5AQ9 A;  4K5C A;  3NQP A;  2WXM A;  4C9B B;  4FA6 A;  3S7F A;  5EYP F;  2QC9 A;  4PDX A;  1DC2 A;  1O5M A;  1JCR A;  4GB9 A;  2WXN A;  4G2V A;  1HE8 A;  4JVS A;  4WWO A;  3QWV A;  4D10 C;  3NZU A;  4DX2 A;  1TN8 A;  1MZC A;  3CKB A;  1ELW A;  3Q7F A;  2YIN A;  3CHQ A;  5BUZ A;  2XEH A;  5M72 A;  2NC9 A;  3FUK A;  3APC A;  2MHK A;  4JEU A;  1SZA A;  5KJK A;  1ZB1 A;  3UM1 A;  4FHK A;  4JW1 A;  3CVY A;  3U4T A;  3T8K A;  1H19 A;  3UM0 A;  5BXO A;  3BU8 A;  3DRA A;  3ASG A;  3CVV A;  4XE0 A;  5EYL A;  3Q75 A;  2FO1 E;  3L08 A;  3PNL B;  2BED A;  1KZP A;  3LY8 A;  4QFV A;  4J0U A;  3ONK A;  4G25 A;  4KVM A;  2WM9 A;  4U0S A;  3CLJ A;  4UWF A;  2R03 A;  4WND A;  3IXE A;  3WXX A;  4LUN U;  3MCX A;  3FUE A;  3T5X A;  3HVE B;  4URK A;  1UOH A;  5AQ7 A;  2KM4 A;  3QAQ A;  4ANW A;  3OXF A;  4F1S A;  2KXP C;  2WQ7 A;  3PRE A;  4GA1 A;  2VSX E;  3FUI A;  1IHB A;  1TJC A;  3FTX A;  5CEC B;  4XI0 A;  2Y4T A;  4UWK A;  4APF A;  3S7B A;  3WG7 E;  2UWJ G;  3EJN A;  4O60 A;  3Q49 B;  3IBE A;  5KWD A;  2R05 A;  3FY4 A;  4GTT A;  5ARG A;  2RD0 A;  4H7Y A;  2H6G A;  2EQX A;  4XX5 A;  4GZC A;  2Y4U A;  3E34 A;  5J90 A;  2ZGG A;  3Q4A B;  4KMO A;  4GPM A;  4GTQ A;  2ZU6 B;  3AU5 A;  1DNP A;  1BPO A;  3LKU A;  3MGB A;  3UXG A;  5FIO A;  4U07 A;  2OVB A;  3V2X A;  3JUI A;  4C0M A;  5AIJ A;  4UUC A;  5AQB A;  2ZXW E;  2H6H A;  3D9I A;  5EIL A;  3KSQ A;  3EIQ C;  5E76 A;  2RKK A;  1ELK A;  2P9L G;  3UT4 A;  3CIA A;  5AJL A;  3ZUV B;  3TXN A;  4AEZ C;  4EBA G;  2LSV A;  4YND A;  2WQ6 A;  3Q15 A;  4O1P A;  1K3Z D;  3URZ A;  2IF4 A;  2AXV A;  4IUL A;  3TWV A;  1TNZ A;  4I9E A;  1D8D A;  4XKC A;  4GTS A;  5EKQ D;  4HOT A;  3PEU B;  3FFL A;  4Y6C A;  4WNF A;  3JXJ A;  5FQ4 A;  3LVQ E;  4BTB A;  5LX8 A;  3TG4 A;  4CGV A;  1HO8 A;  1W3B A;  3RU0 A;  3OXG A;  2J8S D;  1TNO A;  3D9K A;  3PNT B;  3DPD A;  1OY3 D;  5CRV A;  3PH0 C;  3DPY A;  2E0I A;  3PUK A;  4AY5 A;  1FT1 A;  2CHX A;  3SD5 A;  5G2N A;  3PEV B;  4JHK A;  2DVW A;  5EX0 A;  4ANU A;  4DI3 A;  5HI7 A;  4J8E A;  3APD A;  4Q69 A;  1QQE A;  3ZYQ A;  4KZC A;  2RFA A;  3ZVV A;  5H7P A;  3IV0 A;  3CK8 A;  1HH8 A;  3HXE A;  3IHY A;  3HXB A;  2QZA A;  4DRX E;  2XPZ A;  4U63 A;  4EPZ A;  2MOW A;  4AXH A;  5LCW C;  3D9O A;  2FEZ A;  2DZO A;  2HM8 A;  2Y0B G;  3EHM A;  4JA7 A;  4LCT A;  3QOU A;  4HLL A;  1FVH A;  4B94 A;  1ZBP A;  5CBO A;  3ZW3 A;  3L22 A;  4XKB A;  2KBX A;  3ISM C;  2P9I G;  1BLX B;  1ZU2 A;  4L7T A;  3ZKJ A;  3FWV A;  5KJL A;  3C3Q A;  4AP2 A;  2HYZ A;  3Q79 A;  2DIW A;  4NIK A;  2WXQ A;  2P2C P;  1UW4 B;  2DWZ A;  3VLE A;  3G2W A;  2ETC A;  4ZHB A;  1TN7 A;  3HXC A;  4GA2 A;  1HZ4 A;  4UI9 K;  1N54 A;  2LXM A;  4TXP A;  5T8I A;  3AG4 E;  3HVE A;  4EZL A;  3TWU A;  2JLB A;  5BW8 C;  1DCQ A;  1IXV A;  4JHR A;  5HKP A;  3GZ1 A;  3RRU A;  4HVB A;  3UPV A;  1KZO A;  3TWR A;  4LSZ E;  5G04 C;  2A5U A;  2FO7 A;  3CK9 A;  3FUF A;  3FEY A;  3C72 A;  3PZ2 A;  3FTZ A;  1V54 E;  5DIZ A;  1MX2 A;  3TWT A;  3EU5 A;  4WNG A;  1RZ4 A;  4B93 B;  5JJ6 A;  3PZ4 A;  3APF A;  1H2U A;  3RO3 A;  4AV7 A;  1VDY A;  5B1A E;  4I2W A;  5AEN A;  2XEV A;  3D9J A;  2Q7F A;  1H6K A;  1HS6 A;  3SF4 A;  4GTO A;  2MRI A;  2J4B A;  3Q73 A;  3W9F A;  3CKC A;  4AIF A;  5FJY A;  2RFM A;  2V8S E;  1QNF A;  2WMN A;  4I2Z A;  3HDX A;  3B13 A;  5EID A;  4E85 A;  3ZXP A;  4N5Q A;  3TWQ A;  3QC1 A;  2ZIR A;  4PS8 A;  3FUL A;  1WY6 A;  4JL0 A;  3CSF A;  2X6I A;  3PE4 A;  3CV0 A;  2NSZ A;  3EHQ A;  5G55 A;  3CST A;  3L16 A;  1B89 A;  3FH8 A;  3ASO E;  3I5P A;  4GZD A;  4GZ6 A;  3DSS A;  4I6G A;  3UT8 A;  3LY7 A;  4EBA A;  4U95 D;  4DUI A;  1TEZ A;  1TNB A;  4RSY A;  4U0Z A;  3PZD A;  1AWC B;  5KBA A;  3ZFW A;  4A55 A;  3CK7 A;  1EF1 C;  3D9P A;  2P9N G;  3QAR A;  3IEG A;  1NL4 A;  2OEV A;  4H7X A;  3NB2 A;  2XCC A;  4AVX A;  4TRQ A;  2HR2 A;  1H2V C;  5CRU A;  3V31 A;  1S63 A;  4JD2 G;  3PE3 A;  2Y1L E;  5ENR D;  1YYH A;  3ESK A;  4APO A;  4MS6 A;  4GTV A;  3L6A A;  3KEZ A;  4I17 A;  4BES A;  4B8C B;  4LNB A;  4IYP A;  3T5V A;  4LRZ A;  1DVP A;  4JEH A;  4BER A;  4ZFH A;  3AS8 A;  2GRP B;  1MJ0 A;  4L9P A;  2IJG X;  2A5E A;  2VGE A;  4GU5 A;  5G05 C;  1A5E A;  5JA4 D;  4GTP A;  1OCC E;  1OCR E;  1XNF A;  3QJZ A;  4MBG A;  3B7R L;  2EIK E;  3SGH A;  2WXG A;  2QFC A;  4I1A A;  4BT8 A;  2MYO A;  3RK6 A;  3B7S A;  4HQD A;  2EIM E;  2WMO A;  2OVF A;  1N9A A;  5J08 A;  5AAR A;  1MX4 A;  2PM7 A;  3MV3 B;  2XGO A;  4J8Y A;  4FJY A;  2EIN E;  4GAA A;  2P9P G;  3LVR E;  4K5A B;  4KT6 B;  3G2V A;  5D66 A;  3U3W A;  1K1B A;  2DBA A;  5AYW D;  2BTD A;  3UM2 A;  2VSY A;  3NF1 A;  2XEE A;  1BD8 A;  3UIO C;  3DSX A;  3NOC D;  3UX4 A;  3TGO A;  4XZ4 A;  2EIJ E;  4HOS A;  5FQ8 A;  3FU0 A;  4AJW A;  5LFA A;  4L23 A;  3GZ2 A;  1HX8 A;  3U66 A;  2C0L A;  1OT8 A;  3RO2 A;  3DEO A;  4ACL A;  1N95 A;  4I9C A;  3NOG D;  5KJM A;  4DX5 D;  2OND A;  3LEW A;  3JYS A;  3UQ3 A;  3QDN A;  5EN5 D;  1S70 B;  4I6J A;  3SBT B;  1L5J A;  3MA5 A;  3LPZ A;  3S7J A;  3UKR G;  1N52 A;  4KZ0 A;  3TL5 A;  4DK5 A;  1JWF A;  2PQN A;  3SFX A;  1OWO A;  4YVO A;  2AXU A;  3I4G A;  4PS7 A;  2LSU A;  3MJW A;  4TV3 A;  4Q94 A;  4ILH B;  4LNU D;  2CG2 A;  2WXR A;  1O1R A;  1EPU A;  5AN8 A;  3FU3 A;  3ZGQ A;  4TXQ A;  1N0R A;  1XGW A;  3HXD A;  5BNW A;  3CVX A;  5BV1 A;  1LD7 A;  4UWG A;  1D8E A;  4YVQ C;  3J5P A;  3D9N A;  5BXU A;  5CER B;  2AJA A;  5CCL A;  3JUE A;  3T9K A;  5KNH D;  4WWP A;  1D9S A;  4E6H A;  3L9T A;  3P2B A;  4ACK A;  3UUX A;  1EYH A;  2I1K A;  3L13 A;  5CCM A;  3L82 A;  4J8D A;  1H6P A;  4CT4 A;  2I1J A;  3AAA C;  4JPS A;  4DX7 D;  5HRY A;  3KD7 A;  3QNK A;  2X6K A;  1N4P A;  3D9H A;  2Y3A A;  3QK0 A;  2KCV A;  5ARF A;  3N71 A;  2VYI A;  3E37 A;  4GCN A;  3PZ1 A;  1QBQ A;  3CVU A;  4YDY A;  2IU1 A;  1X81 A;  3DEP A;  3V2O A;  4HRL A;  1LTX A;  4XEI G;  3AG2 E;  3SQV A;  2GRL A;  3BEE A;  3EDT B;  3CHM A;  3HG0 D;  3K9I A;  2XEN A;  5BPP A;  3ZNG A;  3QKY A;  1OWN A;  2KAT A;  2AVP A;  2L6J A;  3MKQ B;  4W9R A;  2P9U G;  3UIN C;  3MYV A;  5BV0 A;  2RG8 A;  5FTP A;  2WXF A;  1SZ9 A;  2JEK A;  4UQX A;  4UWH A;  3E4B A;  3ZPJ A;  3CVW A;  2C2L A;  4N39 A;  3MX3 A;  5KCM A;  3FTS A;  3Q7A A;  2IFU A;  4NAC A;  3CVP A;  3MV2 B;  4FAD A;  1H0A A;  1YA0 A;  4ILI A;  4BEP A;  4TUM A;  4HOR A;  1PAQ A;  3PRZ A;  1MHQ A;  4UI9 J;  3ESL A;  3FTW A;  3UTM A;  4BWR A;  5CED B;  3FDH A;  3RJV A;  1LF8 A;  4R7L A;  2XHE A;  3UI2 A;  1UG3 A;  2YQ8 A;  3SFZ A;  3Q9N C;  3HHM A;  4A3V A;  2CFU A;  3LCA A;  4GYO A;  3CHS A;  3DSW A;  4YDO A;  3U64 A;  2X3M A;  3DWL G;  1JUQ A;  3U9W A;  3JQ1 A;  3RIB A;  4MRU A;  2PQR A;  5ENN A;  2F37 A;  1H2T C;  3SHF A;  2GRQ B;  3UM3 A;  1S0P A;  4GTR A;  2R5S A;  4JHJ A;  4YDE A;  3EUV A;  4LEU A;  2X6J A;  1V55 E;  4BFR A;  1S64 A;  1E8W A;  5JJ7 A;  3R9A B;  2DZN A;  4FLB A;  3R7R A;  3PDN A;  4FU3 A;  1K1A A;  2LNI A;  5ANR A;  3ML8 A;  3KSL A;  3OXL A;  3TWX A;  3ZHE B;  1JPL A;  5FZQ A;  1JCS A;  5FQ6 A;  2WXI A;  4F3V A;  3FH7 A;  4F6R D;  4MKT A;  2ETA A;  3KS2 A;  3B7B A;  3LJ3 A;  1BI8 B;  2XZD G;  3LS8 A;  3J5Q B;  3L17 A;  2YHC A;  3PS6 A;  4OVV A;  2I2O A;  2VSO E;  3NBN B;  1NZN A;  2YHE A;  4IN3 B;  3SNX A;  1HFA A;  1OWP A;  5ENT D;  3QWP A;  4NQ0 A;  1O1T A;  2F8X K;  3HRA A;  4DI4 A;  1N0Q A;  1TNY A;  4ILG A;  3B7U X;  2WPV A;  1G3N B;  3ZXS A;  3ASN E;  4Z68 A;  4DX6 D;  2XS1 A;  1A17 A;  2CHW A;  4FP7 A;  3MKR A;  5A7D B;  1E90 A;  2NYJ A;  4OAV B;  4U8Y D;  4DPR A;  4U8H A;  2WXJ A;  4CEM A;  3FP3 A;  3TXM A;  4N2S A;  4UQY A;  4ME2 A;  4HRM B;  3PUJ A;  2V5Q C;  3ZN3 A;  2NXP A;  2P58 C;  3EHN A;  1NI1 A;  5AJD A;  2PNN A;  3G2S A;  5HQ8 A;  4FLH A;  4ATG A;  3FUD A;  3CHP A;  5HS0 A;  1E96 B;  5BT1 A;  3ASD A;  1WAO 1;  2XGS A;  2IO3 C;  4HFG A;  2LO6 A;  4M7C A;  2GRN B;  4ANV A;  2AWI A;  5EIB E;  3FTY A;  3NAW A;  3RSE G;  1IKN D;  2ZGD A;  3MKQ A;  5CEA A;  3PVL A;  5ANL A;  2X6H A;  1PC2 A;  1Z3X A;  5ITZ F;  3TG5 A;  4JC8 A;  4GZ5 A;  4F1P A;  2OV8 A;  4I43 A;  1E7V A;  1SA4 A;  5B3S E;  4GCO A;  1HU3 A;  3HXF A;  2J49 A;  2WXO A;  4HOQ A;  3GYZ A;  3CQC B;  4A1G A;  3V79 K;  4N2Q A;  3O48 A;  3BG1 B;  3ABM E;  1YMP A;  4BTA A;  3SBS A;  1HG5 A;  3C3R A;  5FZS A;  1O1S A;  2IO2 C;  4JZY A;  3FEX A;  3FUH A;  2L9B A;  4I6E A;  2WVI A;  2UY1 B;  1KT1 A;  4ATZ D;  1SVX A;  2B6C A;  2GRM A;  2V0P A;  1UN8 A;  5FZR A;  1P5Q A;  4CDM A;  3CVL A;  3FH5 A;  3FU5 A;  3UKU G;  4EHM A;  2XQ0 A;  4G8K A;  4FC8 A;  2GGF A;  3ONL A;  3EU9 A;  2HE0 A;  3LJN A;  1DCE A;  2J08 A;  1OWM A;  2XCB A;  1IQR A;  2YNQ A;  3D9M A;  2DYS E;  3MZL B;  4GZ3 A;  2VQ2 A;  1MQS A;  2BKK B;  4XIF A;  5C1D A;  1NP7 A;  5T3R A;  4BY6 A;  5JHA A;  5LP0 A;  1U2V G;  3ZHE A;  1HXI A;  2AW6 A;  4F53 A;  2XGM A;  4HI8 A;  4C0E A;  1NA0 A;  2XZT G;  2OEW A;  3TWW A;  4BX9 A;  3DSU A;  5LCW J;  2HO1 A;  3AJI A;  5JJT A;  2X38 A;  3IKO B;  2M63 A;  3F6Q A;  4K0R A;  4OVU A;  2R02 A;  4GMR A;  4K03 A;  2LXL A;  3DST A;  3VLF A;  1U3C A;  2A4Z A;  4U7E B;  4BT9 A;  4GPK A;  1KLX A;  2J09 A;  1OCZ E;  4OAU C;  2R2L A;  3C5R A;  1Z5S C;  2BKG A;  4I1O B;  3D9L A;  4WNE A;  1BI7 B;  2GRO B;  4BSX A;  2IEJ A;  4GYW A;  3ZYL A;  3KAE A;  2WXP A;  3TWS A;  4J8S A;  4G26 A;  3G2T A;  3HYM B;  4U04 A;  2QY7 A;  4K5B A;  5AAO A;  4A3T A;  4F7A A;  4L1B A;  5CHE E;  3FUJ A;  4WUY A;  4JXT A;  5ENQ D;  3ULY A;  3HIZ A;  4FHJ A;  3TJP A;  4HXI A;  4J8F A;  4GA0 A;  1KT0 A;  3AS4 A;  3JXI A;  2V4L A;  5G04 J;  1TYQ G;  3GW4 A;  3E33 A;  2PM6 A;  1PY1 A;  3C3O A;  1JCQ A;  4ANX A;  4GMJ A;  3DBS A;  4BET A;  4V3I A;  3PZ3 A;  4N3C A;  1MYO A;  4BX8 A;  3CHO A;  3AS5 A;  4YDW A;  2FI7 A;  4U8V D;  4Y6W A;  4HI9 A;  2LAH A;  4DJA A;  4PUC A;  2KC7 A;  3CHR A;  2I6H A;  4TXR A;  3ASF A;  4CZ2 D;  4X8Q A;  4AOF A;  2CHZ A;  3X2Q E;  5JHB A;  1N4Q A;  1QZ2 A;  4LG6 A;  3ML9 A;  2F8Y A;  1SQM A;  3ZIM A;  5D0Q D;  1OUV A;  3UIP C;  1E7U A;  4CCA A;  5EX3 A;  1EDU A;  3Q9U C;  2QYU A;  1Y8M A;  1TJF A;  1OXJ A;  2LUH A;  2R17 C;  2R59 A;  1UN9 A;  3I3N A;  3Q47 B;  4Q96 A;  3C98 A;  1N4R A;  1Q2Z A;  3BG0 B;  4IRU A;  2IQC A;  1TR4 A;  5CMW A;  2H6I A;  4N3A A;  5FT9 A;  4GTM A;  2VGX A;  4HNA D;  2UY1 A;  4DLO A;  3E32 A;  3L54 A;  3DXK G;  4A1S A;  1K8K G;  3BUA A;  3R7Q A;  5DBK A;  3RRM B;  4AY6 A;  2PZI A;  3VTY A;  4WWN A;  5LOZ A;  1HG2 A;  4CRW A;  2H6F A;  1FT2 A;  2F0Y A;  4LER A;  4CGW A;  3EIJ A;  5D0O D;  4HLE A;  4NRH B;  5A23 A;  4EQF A;  2KZT B;  5ENP D;  3AU4 A;  4QQI A;  1JWG A;  2XS8 A;  3LXU X;  5AQA A;  3RKV A;  2WB2 A;  4KXK B;  4HS2 A;  2BF0 X;  1Z3Y A;  3S2A A;  2FF4 A;  1N94 A;  2WXH A;  2P9K G;  2GW1 A;  5IY5 E;  1IQU A;  2XPY A;  3S7D A;  3UT7 A;  4G8L A;  2ILR A;  4A63 B;  2L0I A;  1Y6I A;  2V5F A;  2WXL A;  4HOU A;  3QB2 A;  4PS3 A;  1TN6 A;  1OWL A;  4LNG A;  5G05 J;  3RAU A;  1E8Z A;  1NA3 A;  2IY0 C;  2ION A;  5FIN A;  5C2Y A;  2E2E A;  5E75 A;  1SA5 A;  4U0U A;  4RQI A;  2VTB B;  3CR3 A;  4B89 A;  2GRR B;  4XI9 A;  3SY2 A;  4OYS A;  4CT0 A;  1IYG A;  1MX6 A;  2KCL A;  5KJN A;  3ULE G;  4N5C A;  1WDY A; 
#chains in the Genus database with same CATH homology
 3DXK G;  2P9S G;  1K8K G;  2P9L G;  4JD2 G;  3UKU G;  3UKR G;  2P9N G;  2P9K G;  3DXM G;  1TYQ G;  2P9U G;  4XEI G;  3RSE G;  3DWL G;  1U2V G;  3ULE G;  2P9I G;  2P9P G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...