2P9PG

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
143
structure length
128
Chain Sequence
ARFRKVDVDEYDENKFVDGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 39
structure length 128
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9pG00
2P9UG 2P9KG 3UKUG 3DXKG 3UKRG 3DXMG 1TYQG 3DWLG 2P9PG 1U2VG 3ULEG 4JD2G 2P9NG 3RSEG 1K8KG 2P9LG 4XEIG 2P9SG 2P9IG
chains in the Genus database with same CATH superfamily
1E7VA 3R9MA 4C9BB 3FUDA 3FEXA 5CERB 4A3TA 1G3NB 4JHRA 2YHEA 1HG2A 4EBAG 1Y8MA 4UI9C 3QK0A 1TN7A 5JJ7A 3GZ1A 4F1PA 3EDTB 3SF4A 3ZYLA 4U0ZA 4K5AB 1MX6A 1MZCA 2OCCE 2MYOA 1UG3A 5D0QD 4BESA 2CHXA 1TN8A 4GMLA 3D9LA 4KBQA 2IQCA 4N5CA 3T8MA 4X8QA 2WXFA 3MCXA 3KSQA 2J07A 4M7CA 2E0IA 2NSZA 1N95A 4WAFA 2AXVA 3EHRA 4R7LA 1LD7A 4KZ0A 2X6IA 4GTVA 3TWRA 3SFXA 3HHMA 3ZN3A 3QNKA 5A6CA 2NXPA 1TNZA 4FADA 3V2OA 2GROB 4YDYA 1EDUA 3D9PA 2LUHA 4O60A 3R7RA 2XGMA 3W9GA 4UWGA 3E33A 2H6HA 2AXZA 2Y4UA 3DXMG 1DCQA 1H0AA 3CQCB 5B3SE 4G8LA 3CGHA 3LVRE 4L7TA 3I4RB 3ASHA 3ZFWA 4CEMA 4IYPA 3FH8A 5D2MC 2XZTG 4U07A 4WNGA 4HRLA 3CSFA 5KJLA 3MV2B 2WXGA 1KT0A 4DUIA 2LO6A 1OWLA 5DBKA 1U3DA 4W9RA 4V3IA 3UM3A 2DVWA 2C2LA 3IHYA 4ACKA 4OYSA 5T8IA 2BTDA 3MX3A 2XENA 1TNUA 1N4SA 4UWKA 3T5VA 1N4RA 3CSTA 2I1KA 3PZ2A 2RG8A 3LVQE 4D10C 1NA3A 3UXGA 3ZIMA 4FU3A 3G2WA 5EX3A 4A63B 5AENA 1ELWA 3DSWA 2GRPB 4F53A 4NIKA 4U0UA 2WXHA 4KVMA 2JABA 2VGXA 3CEQA 4GZDA 1AWCB 2C0MA 3FTWA 4J8YA 3T8KA 5FIOA 1Z3XA 4Q69A 5BXUA 1N52A 3FTYA 4MRUA 2XPYA 5KCMA 4GMRA 4LUNU 3ZW3A 4RG9A 3VLDA 4FHKA 1N9AA 1NL4A 2HR2A 3FULA 2BKKB 3FH7A 3FTVA 2ETCA 4FLHA 4N3CA 4AY5A 3CHSA 3UM1A 4RLYA 5AIJA 3E32A 2IOSA 4F7AA 2EIME 3UI2A 2R05A 4RG6A 3Q78A 4EBAA 2F37A 4G24A 3DPYA 4DK5A 1OUVA 4AJWA 4Z68A 4YDOA 3ZRHA 4HI8A 2P9KG 4BY6A 3ZKJA 3APCA 4JPSA 3ZU7B 1UOHA 5EIBE 4L23A 3JUIA 4HOSA 1UN9A 2X6HA 1IHGA 2EIKE 3DWLG 4K0RA 2HE0A 1JCQA 4EECA 5B1AE 4JA9A 3FTSA 5CRVA 3PDNA 1UW4B 4GPKA 1WG0A 5AAOA 3S7DA 3TJPA 3LY8A 3ASFA 1K1AA 3GW4A 4ILIA 3QWPA 3EHMA 1HFAA 5G04J 2OEVA 3EIJA 2PM6A 2XCCA 2VYIA 3V2XA 3CK9A 3FUHA 3QOUA 2WMNA 4B93B 1OCCE 4Q94A 1NP7A 4G8KA 5EKQD 1WAO1 1RW2A 3JQ0A 3AG1E 3HG0D 3WXXA 3SO8A 4B8AA 1NFIE 4BTBA 4L2YA 2WXLA 3BG1B 4FC8A 4JL0A 5CBOA 4J8FA 3LPZA 2A5EA 3RAUA 3RK6A 4F1SA 1K1BA 5HRYA 3FUJA 4I17A 4G2VA 3SNXA 3ML8A 3LY7A 4PH4B 2KCVA 3PNLB 4WUYA 2R2LA 3QARA 5BUZA 3SZ7A 1AP7A 5HKPA 2VGEA 4BFRA 2GRRB 3ISMC 1IXVA 4JW1A 4PS3A 3D9HA 3HVEB 3PUKA 3X2QE 3KD7A 4C0MA 4CRWA 4N2SA 4U04A 2DIWA 1S64A 3I4GA 5CCLA 4M3OA 3UKRG 1N54A 2PZIA 2ZGGA 2WVIA 3SD5A 3WG7E 1K3ZD 1QYMA 1Q2ZA 3IHVA 4K03A 3CKBA 4EZJA 1OWNA 1W3BA 2QY7A 3L22A 3QAQA 2DBAA 1UJKA 2VSNA 4L2LA 3UIOC 2ZU6B 3MKQB 3PRZA 2IOLA 3MZLB 2Y1LE 3L13A 4GTTA 4PDXA 3Q73A 3CQGB 4GZ6A 3RRNB 3LJNA 1SA5A 3KEZA 1SQMA 1NI1A 2VSYA 4APOA 4HNAD 3CR3A 4HI9A 3PZ4A 4YDEA 3BU8A 3CVWA 3D9KA 5CRUA 4GA1A 3EUVA 2IY0C 3QC1A 3E30A 2VSXE 4HVBA 3GZSA 4DLQA 3PUJA 4IRUA 5FQ4A 1S70B 2ETBA 3C5RA 3L17A 5J08A 4ATGA 4LSZE 4LNBA 5LX8A 2DYRE 3PS6A 3QJZA 4U7EB 4A1GA 3E34A 4P29A 5J90A 2YHCA 4I9EA 1OWOA 3QWVA 4CT0A 4YDWA 5AJLA 2BEDA 3CK7A 2ZGDA 2WXOA 4IULA 5AQ7A 2WXNA 3KSLA 4GZ3A 4B8CB 1FVHA 3MGBA 4G23A 4GAAA 1IQUA 3B95A 2Q7FA 2LAIA 3QWWA 4XE0A 5BT1A 2FO7A 3LYAA 1O1SA 1U2VG 2HYZA 2I9CA 4GPMA 4TXQA 3TWUA 3G2SA 3NAWA 3IEGA 3DBSA 4L1BA 5FQ8A 3QKYA 3SHFA 3IXEA 4G26A 4FA6A 4XX5A 4B0ZA 3OXGA 5EYLA 4BERA 1Z5SC 2NC9A 5CHEE 1IYGA 3MYVA 3EU9A 5T3RA 4GMJA 4WNDA 4ANVA 4UQXA 5HI7A 3S7FA 3ZVVA 4LCTA 3ZXSA 3PE4A 5FQ7A 3ZUVB 4OVUA 3RSEG 3TWSA 1K8KG 4RQIA 4G11A 3LXUX 5ENNA 3FTZA 3TWQA 5EYPF 3JQ1A 3UKUG 4ZHBA 4HLEA 2WXIA 1YA0A 1H6KA 3ASNE 5T4YA 5G05J 1E7UA 4GA0A 2KC7A 3CVLA 3ABLE 4BETA 3PVLA 2WMOA 4KXKB 2XS1A 4DPRA 2ZXWE 4GZCA 3D9JA 2ZISA 3F6QA 2UY1A 4URKA 3B13A 2X6JA 2VTBB 1MX2A 1XNFA 3FEYA 4KYOB 3R7QA 5BNWA 5CEAA 2C0LA 4XKCA 2XCBA 5IY5E 4TUMA 5AQAA 2GRNB 4H7XA 3PEUB 2WXPA 1HE8A 2I2OA 2F0YA 4JC8A 4NRHB 3C72A 4UQZA 3FU0A 1OT8A 3DEOA 1U3CA 3QDNA 4I43A 3RO3A 1KT1A 2JEKA 2KZTA 4N39A 3P2BA 2XS8A 2J09A 1X5BA 2L0TB 2V8SE 5BPPA 2WXKA 3CHOA 3LEWA 4WWNA 2ETAA 2L0IA 2P9IG 3FUMA 4WWOA 3ENEA 3HXEA 3ML9A 3HXDA 4EPZA 4ANXA 1WM5A 4LRZA 2FULA 3I3NA 4IN3B 5ENPD 3AG4E 3FWVA 4TXPA 4AV7A 3RKVA 4KZCA 3JYSA 4U63A 1LTXA 5KBAA 5ARGA 3PEVB 1E8XA 5AQ9A 1FVFA 1JWFA 2J8SD 1H2UA 4AXHA 4DX7D 1TEZA 1E96B 5FTPA 2EINE 3UUXA 4UI9K 2LXMA 4O6FA 3RO2A 3FUNA 3LKUA 3LJ3A 2GRQB 3Q79A 2KBXA 1QNFA 2XGSA 1LD8A 2J08A 4TXRA 5FQ6A 5KJMA 1ZB1A 4O1OA 1H2TC 4RSYA 5LCWC 3UIPC 2LXLA 2WM9A 4UQYA 5EDSA 3JCKC 3UT4A 4G1TA 2R02A 1MYOA 2CFZA 4B89A 4ILGA 2V4HC 2Y0BG 4HXIA 4MS6A 3TWTA 1DVPA 3B7TA 4AM9A 2IO2C 4I6GA 5JMND 3NQPA 2R03A 2EQXA 4JZYA 3B7BA 5JHBA 3K9IA 4GYYA 3OTNA 2NYJA 4QQIA 1Z3YA 5HQ8A 2IONA 4TV3A 1PC2A 2YINA 3V31A 4FULA 4HOQA 2WXRA 4JHJA 4BX8A 4WWPA 5E76A 1SVXA 3UMVA 3UM0A 1TYQG 3MA5A 4CCAA 1TN6A 2R17C 5ENTD 4JB8P 3B7UX 2QYJA 2VGXB 2Y4TA 3W9FA 4HORA 4GTOA 1TR4A 1PY1A 3TGOA 2UWJG 5AARA 3CVUA 4UI9J 5KNGA 5C2YA 5LFAA 4Y6WA 2Y69E 4J8SA 4ACLA 3G2VA 4ME2A 5LOZA 3ZPJA 5LP0A 3GZ2A 1JUQA 4I6EA 5C1DA 3ONKA 4HOTA 3I5PA 1O1RA 2AVPA 3TG5A 2MHKA 3JUEA 2L6JA 1HZ4A 4JD2G 5E75A 2L6BA 4O1PA 4I2WA 2LSUA 4GTPA 3FUIA 2OVBA 1BI8B 4MBGA 4UWHA 3URZA 3IBEA 2GRLA 3NOGD 5EX0A 4DX6D 2X3MA 3CVXA 3FU5A 4J0UA 2XEHA 5CMWA 2PNNA 3HRAA 3UT7A 4DX5D 3T9KA 5BV1A 3DSVA 3TXNA 3CHPA 3D9IA 3ULQA 3JXJA 1ELKA 2AWIA 3PZDA 2PM7A 2XEEA 2M63A 5CMYA 5JJ6A 1EYHA 3RU0A 2I6HA 4I1AA 4C48B 4JEUA 3OXLA 2AJAA 2EILE 1HU3A 4GCNA 1OWMA 4B94A 5AQBA 1YMPA 3AU5A 2A4ZA 2WXMA 3IKOB 1ZU2A 4HBDA 1H6PA 3ZHEA 1O1TA 3AS4A 3U3WA 1E8WA 1TNBA 5H7PA 1OCOE 4GU5A 3S7JA 1EF1C 4J7WA 1KPSB 2DWZA 2P58C 1KZOA 3FUKA 4MLPA 5ENQD 1HXIA 3D3MA 4Y6CA 2CHWA 3DSUA 1E8ZA 1FT1A 4XZ4A 3SFZA 4U0SA 4ABNA 3ZEFA 5CEDB 3UT8A 1IKND 3UPVA 3SBTB 2KXPC 3L54A 2P9NG 3TXMA 3KEAA 3PH0C 3AS8A 5M72A 3TWXA 3Q9UC 4BT9A 5ENRD 1A5EA 1UJJA 3FTUA 2AW6A 4A1SA 2ILRA 4U8YD 5CECB 2LAHA 4WNEA 3C3QA 4GTMA 4UUCA 3ZNGA 2HO1A 3VLFA 4ANWA 4BSXA 2FF4A 4GA2A 2P2CP 1IQRA 4U96D 2RKKA 3Q49B 4KVOA 3FUEA 3L9TA 2H6GA 3ESKA 5EN5D 3UX4A 4AY6A 2J4DA 3ZYQA 2XZDG 3BUAA 1QBQA 4YNDA 3EHQA 4BX9A 5CBNA 1SW6A 3ZXPA 3PREA 5KNHD 4JA7A 4XI9A 1WY6A 5KWDA 1KZPA 4YVOA 4ILHB 2PL2A 1QZ2A 4GCOA 3NZSA 4C0EA 4DLOA 4UWLA 3ULEG 2PQNA 3AS5A 4GZ5A 5B1BE 2OEWA 3DSSA 2HM8A 4XKBA 5KJNA 3DPDA 1VDYA 5EILA 3S2AA 3QB2A 3AAAC 3DSXA 4E85A 2FI7A 4PUCA 3KS2A 4J6IA 2GRMA 1HG5A 1WDYA 5CCMA 4LEUA 5ARFA 2IF4A 4CGVA 3S7BA 5ITZF 1FT2A 4I2ZA 3NOCD 2Y3AA 3L6AA 4LERA 4I1OB 3D9OA 4HQDA 5BW8C 1MJ0A 4HB5A 4KMOA 5D0OD 2OV8A 1Y6IA 4DX2A 1N11A 4I9CA 4CDRA 5G04C 4FP7A 3ABME 2AXUA 2CFUA 4GTSA 4N5QA 2LNIA 5BV0A 4PS8A 4EZKA 1BPOA 3CVQA 4N2QA 3ONLA 4FLBA 2WQ6A 2B6CA 1N94A 5ANLA 1HX8A 1DNPA 4DI4A 1P5QA 2F8XK 5FINA 2XPZA 3FUFA 5A7DB 1GW6A 2CG3A 1HF8A 4N3BA 5DIZA 3C3OA 1BI7B 4QFVA 3D9MA 3G2TA 2XGOA 3RRMB 4A3VA 4CDMA 4F3VA 1H6OA 3FU6A 1KLXA 3L82A 1MQSA 3B7RL 4A55A 5AJDA 4N3AA 2IU1A 1MX4A 2WXJA 4HFGA 2QYUA 1TJFA 2WQ7A 2XQ0A 5A23A 3ZYMA 2CHZA 3E4BA 3NZUA 4EHMA 3Q5MA 3N71A 1O5MA 2R59A 1B89A 4Q96A 3CVNA 2VQ2A 2UY1B 3ZYKA 3IV0A 3UQ3A 4ZFHA 1TNOA 3APDA 4CYMD 4G25A 1XGWA 3NF1A 1EPUA 4OAUC 2MRIA 3Q4AB 4LNUD 4AEZC 1HH8A 4GYWA 2RD0A 4JEHA 4BTAA 2WB2A 4XIFA 5ANRA 1SZAA 2DZOA 4U8HA 3PNTB 1S0PA 2QFCA 2J49A 1OWPA 3AG2E 3EJNA 3BEEA 3CHQA 5JHAA 3KAEA 4U95D 2RFAA 3B7SA 2X38A 3SFYA 2KZTB 2VGYA 2H6IA 2BF0X 1HS6A 3ASOE 1N0QA 1YCSB 1E8YA 3V30A 3NBNB 3LCAA 4AVXA 2V5QC 3ASGA 2YQ8A 5AN8A 2FO1E 1V54E 2IEJA 3LY9A 5EIDA 1PAQA 4F6RD 3Q15A 4NQ0A 1SZ9A 2XPIA 1DC2A 2KCLA 4LG6A 4MKTA 5JJTA 3R9AB 2ZIRA 2H6FA 5FJYA 3RIBA 1E90A 5G55A 3U64A 3CLJA 2YNQA 3ASDA 4HRMB 2P9LG 4CDNA 4AIFA 3MEKA 2MOWA 3PZ3A 1FPPA 3DRAA 1OCZE 3LDZA 4YVQC 4HRNA 3C98A 3UM2A 1DCEA 2V0PA 4KT6B 4FJYA 1LF8A 2OVFA 1JCRA 3BG0B 1X81A 5ENSD 1IHBA 5ENOD 4ANUA 3U66A 2XHEA 2IFUA 2EIJE 3HXFA 4OVVA 1HO8A 1Z6TA 1SA4A 3SGHA 3ULYA 1BLXB 4JVSA 3MKRA 3CVPA 2OOEA 2XRYA 2A5UA 2FBNA 2KM4A 4I1MA 2F8YA 4APFA 1TJCA 3L16A 2BUGA 2GW1A 1NZNA 3U4TA 3ZGQA 4K5BA 3CVYA 4GYOA 2KATA 2P9PG 3NB2A 5FZRA 4CGWA 3CIAA 4J8EA 3SQVA 1JPLA 3J5QB 2V4LA 2WQHA 1OY3D 3T5XA 5G2NA 2QZAA 3APFA 3CHMA 3DXKG 3FDHA 3UINC 4BSZB 4RVBA 1H2VC 3P1UA 5AYWD 1TNYA 3HVEA 4CT4A 4GTRA 2IJGX 5G05C 4FJZA 4GTQA 3TWWA 3BQOA 3HXBA 2GGFA 3ESLA 3VTYA 4K5CA 2KCKA 3AU4A 1NA0A 1D9SA 3D9NA 3CVVA 2JLBA 1D8DA 1INZA 2LSVA 1N0RA 2QC9A 3EU5A 1D8EA 3CHRA 5JA4D 2VSOE 4XEIG 4L9PA 3G2UA 4TUUA 2V5FA 2X6FA 3FP3A 4BT8A 2IO3C 3MKQA 4BWRA 3EHNA 3VTXA 3LS8A 3FHEA 3DEPA 4XI0A 3CK8A 1OXJA 3J5PA 3SI5A 4DJAA 3SBSA 3Q75A 4HOUA 3DSTA 3C3RA 4DRXE 3Q9NC 3SY2A 4NURA 3U9WA 4H7YA 3V79K 4EZLA 3CV0A 4E6HA 3PZ1A 3TG4A 3L08A 2FEZA 4WNFA 1OCRE 1N4QA 1UN8A 4AOFA 1ZBPA 3HIZA 3OXFA 4GB9A 3FTXA 1ELRA 1FCHA 3GYZA 3OAWA 2P9SG 1A17A 2P9UG 3JXIA 2VJ8A 3Q7AA 2DZNA 1H19A 3FY4A 2RFMA 2DCPA 4JXTA 5BXOA 3O48A 2X6KA 4U8VD 4CZ2D 1QQEA 3Q7FA 1V55E 3AJIA 1BD8A 4JHKA 3PE3A 5D66A 3FFLA 5LCWJ 2XEVA 4DX1A 3VLEA 3AG3E 3UTMA 2E2EA 5FT9A 3ABKE 1S63A 5FZSA 4J8DA 4BEPA 3TAXA 4ATZD 3MV3B 1BU9A 3ZHEB 1N4PA 2B0OE 3RRUA 1RZ4A 1L5JA 3HYMB 2WPVA 5FWQA 1MHQA 2ONDA 3Q47B 1JWGA 4FHJA 2BKGA 3TL5A 2J4BA 3E37A 1YYHA 4EQFA 5FZQA 3HDXA 4PS7A 3RJVA 2WXQA 2I1JA 3MJWA 4TRQA 4AP2A 4UWFA 4LNGA 2L9BA 2R5SA 5KJKA 2PQRA 3HXCA 4NACA 5HS0A 3TWVA 2CG2A 2J9QA 2VTBA 3FH5A 3EIQC 4DI3A 4I6JA 2DYSE 4HLLA 3O4ZA 4OAVB 3CKCA 2XRZA 1JCSA 3FU3A 4HS2A
chains in the Genus database with same CATH topology
2P9UG 2P9KG 3UKUG 3DXKG 3UKRG 3DXMG 1TYQG 3DWLG 2P9PG 1U2VG 3ULEG 4JD2G 2P9NG 3RSEG 1K8KG 2P9LG 4XEIG 2P9SG 2P9IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9U G;  2P9K G;  3UKU G;  3DXK G;  3UKR G;  3DXM G;  1TYQ G;  3DWL G;  2P9P G;  1U2V G;  3ULE G;  4JD2 G;  2P9N G;  3RSE G;  1K8K G;  2P9L G;  4XEI G;  2P9S G;  2P9I G; 
#chains in the Genus database with same CATH topology
 1E7V A;  3R9M A;  4C9B B;  3FUD A;  3FEX A;  5CER B;  4A3T A;  1G3N B;  4JHR A;  2YHE A;  1HG2 A;  4EBA G;  1Y8M A;  4UI9 C;  3QK0 A;  1TN7 A;  5JJ7 A;  3GZ1 A;  4F1P A;  3EDT B;  3SF4 A;  3ZYL A;  4U0Z A;  4K5A B;  1MX6 A;  1MZC A;  2OCC E;  2MYO A;  1UG3 A;  5D0Q D;  4BES A;  2CHX A;  1TN8 A;  4GML A;  3D9L A;  4KBQ A;  2IQC A;  4N5C A;  3T8M A;  4X8Q A;  2WXF A;  3MCX A;  3KSQ A;  2J07 A;  4M7C A;  2E0I A;  2NSZ A;  1N95 A;  4WAF A;  2AXV A;  3EHR A;  4R7L A;  1LD7 A;  4KZ0 A;  2X6I A;  4GTV A;  3TWR A;  3SFX A;  3HHM A;  3ZN3 A;  3QNK A;  5A6C A;  2NXP A;  1TNZ A;  4FAD A;  3V2O A;  2GRO B;  4YDY A;  1EDU A;  3D9P A;  2LUH A;  4O60 A;  3R7R A;  2XGM A;  3W9G A;  4UWG A;  3E33 A;  2H6H A;  2AXZ A;  2Y4U A;  3DXM G;  1DCQ A;  1H0A A;  3CQC B;  5B3S E;  4G8L A;  3CGH A;  3LVR E;  4L7T A;  3I4R B;  3ASH A;  3ZFW A;  4CEM A;  4IYP A;  3FH8 A;  5D2M C;  2XZT G;  4U07 A;  4WNG A;  4HRL A;  3CSF A;  5KJL A;  3MV2 B;  2WXG A;  1KT0 A;  4DUI A;  2LO6 A;  1OWL A;  5DBK A;  1U3D A;  4W9R A;  4V3I A;  3UM3 A;  2DVW A;  2C2L A;  3IHY A;  4ACK A;  4OYS A;  5T8I A;  2BTD A;  3MX3 A;  2XEN A;  1TNU A;  1N4S A;  4UWK A;  3T5V A;  1N4R A;  3CST A;  2I1K A;  3PZ2 A;  2RG8 A;  3LVQ E;  4D10 C;  1NA3 A;  3UXG A;  3ZIM A;  4FU3 A;  3G2W A;  5EX3 A;  4A63 B;  5AEN A;  1ELW A;  3DSW A;  2GRP B;  4F53 A;  4NIK A;  4U0U A;  2WXH A;  4KVM A;  2JAB A;  2VGX A;  3CEQ A;  4GZD A;  1AWC B;  2C0M A;  3FTW A;  4J8Y A;  3T8K A;  5FIO A;  1Z3X A;  4Q69 A;  5BXU A;  1N52 A;  3FTY A;  4MRU A;  2XPY A;  5KCM A;  4GMR A;  4LUN U;  3ZW3 A;  4RG9 A;  3VLD A;  4FHK A;  1N9A A;  1NL4 A;  2HR2 A;  3FUL A;  2BKK B;  3FH7 A;  3FTV A;  2ETC A;  4FLH A;  4N3C A;  4AY5 A;  3CHS A;  3UM1 A;  4RLY A;  5AIJ A;  3E32 A;  2IOS A;  4F7A A;  2EIM E;  3UI2 A;  2R05 A;  4RG6 A;  3Q78 A;  4EBA A;  2F37 A;  4G24 A;  3DPY A;  4DK5 A;  1OUV A;  4AJW A;  4Z68 A;  4YDO A;  3ZRH A;  4HI8 A;  2P9K G;  4BY6 A;  3ZKJ A;  3APC A;  4JPS A;  3ZU7 B;  1UOH A;  5EIB E;  4L23 A;  3JUI A;  4HOS A;  1UN9 A;  2X6H A;  1IHG A;  2EIK E;  3DWL G;  4K0R A;  2HE0 A;  1JCQ A;  4EEC A;  5B1A E;  4JA9 A;  3FTS A;  5CRV A;  3PDN A;  1UW4 B;  4GPK A;  1WG0 A;  5AAO A;  3S7D A;  3TJP A;  3LY8 A;  3ASF A;  1K1A A;  3GW4 A;  4ILI A;  3QWP A;  3EHM A;  1HFA A;  5G04 J;  2OEV A;  3EIJ A;  2PM6 A;  2XCC A;  2VYI A;  3V2X A;  3CK9 A;  3FUH A;  3QOU A;  2WMN A;  4B93 B;  1OCC E;  4Q94 A;  1NP7 A;  4G8K A;  5EKQ D;  1WAO 1;  1RW2 A;  3JQ0 A;  3AG1 E;  3HG0 D;  3WXX A;  3SO8 A;  4B8A A;  1NFI E;  4BTB A;  4L2Y A;  2WXL A;  3BG1 B;  4FC8 A;  4JL0 A;  5CBO A;  4J8F A;  3LPZ A;  2A5E A;  3RAU A;  3RK6 A;  4F1S A;  1K1B A;  5HRY A;  3FUJ A;  4I17 A;  4G2V A;  3SNX A;  3ML8 A;  3LY7 A;  4PH4 B;  2KCV A;  3PNL B;  4WUY A;  2R2L A;  3QAR A;  5BUZ A;  3SZ7 A;  1AP7 A;  5HKP A;  2VGE A;  4BFR A;  2GRR B;  3ISM C;  1IXV A;  4JW1 A;  4PS3 A;  3D9H A;  3HVE B;  3PUK A;  3X2Q E;  3KD7 A;  4C0M A;  4CRW A;  4N2S A;  4U04 A;  2DIW A;  1S64 A;  3I4G A;  5CCL A;  4M3O A;  3UKR G;  1N54 A;  2PZI A;  2ZGG A;  2WVI A;  3SD5 A;  3WG7 E;  1K3Z D;  1QYM A;  1Q2Z A;  3IHV A;  4K03 A;  3CKB A;  4EZJ A;  1OWN A;  1W3B A;  2QY7 A;  3L22 A;  3QAQ A;  2DBA A;  1UJK A;  2VSN A;  4L2L A;  3UIO C;  2ZU6 B;  3MKQ B;  3PRZ A;  2IOL A;  3MZL B;  2Y1L E;  3L13 A;  4GTT A;  4PDX A;  3Q73 A;  3CQG B;  4GZ6 A;  3RRN B;  3LJN A;  1SA5 A;  3KEZ A;  1SQM A;  1NI1 A;  2VSY A;  4APO A;  4HNA D;  3CR3 A;  4HI9 A;  3PZ4 A;  4YDE A;  3BU8 A;  3CVW A;  3D9K A;  5CRU A;  4GA1 A;  3EUV A;  2IY0 C;  3QC1 A;  3E30 A;  2VSX E;  4HVB A;  3GZS A;  4DLQ A;  3PUJ A;  4IRU A;  5FQ4 A;  1S70 B;  2ETB A;  3C5R A;  3L17 A;  5J08 A;  4ATG A;  4LSZ E;  4LNB A;  5LX8 A;  2DYR E;  3PS6 A;  3QJZ A;  4U7E B;  4A1G A;  3E34 A;  4P29 A;  5J90 A;  2YHC A;  4I9E A;  1OWO A;  3QWV A;  4CT0 A;  4YDW A;  5AJL A;  2BED A;  3CK7 A;  2ZGD A;  2WXO A;  4IUL A;  5AQ7 A;  2WXN A;  3KSL A;  4GZ3 A;  4B8C B;  1FVH A;  3MGB A;  4G23 A;  4GAA A;  1IQU A;  3B95 A;  2Q7F A;  2LAI A;  3QWW A;  4XE0 A;  5BT1 A;  2FO7 A;  3LYA A;  1O1S A;  1U2V G;  2HYZ A;  2I9C A;  4GPM A;  4TXQ A;  3TWU A;  3G2S A;  3NAW A;  3IEG A;  3DBS A;  4L1B A;  5FQ8 A;  3QKY A;  3SHF A;  3IXE A;  4G26 A;  4FA6 A;  4XX5 A;  4B0Z A;  3OXG A;  5EYL A;  4BER A;  1Z5S C;  2NC9 A;  5CHE E;  1IYG A;  3MYV A;  3EU9 A;  5T3R A;  4GMJ A;  4WND A;  4ANV A;  4UQX A;  5HI7 A;  3S7F A;  3ZVV A;  4LCT A;  3ZXS A;  3PE4 A;  5FQ7 A;  3ZUV B;  4OVU A;  3RSE G;  3TWS A;  1K8K G;  4RQI A;  4G11 A;  3LXU X;  5ENN A;  3FTZ A;  3TWQ A;  5EYP F;  3JQ1 A;  3UKU G;  4ZHB A;  4HLE A;  2WXI A;  1YA0 A;  1H6K A;  3ASN E;  5T4Y A;  5G05 J;  1E7U A;  4GA0 A;  2KC7 A;  3CVL A;  3ABL E;  4BET A;  3PVL A;  2WMO A;  4KXK B;  2XS1 A;  4DPR A;  2ZXW E;  4GZC A;  3D9J A;  2ZIS A;  3F6Q A;  2UY1 A;  4URK A;  3B13 A;  2X6J A;  2VTB B;  1MX2 A;  1XNF A;  3FEY A;  4KYO B;  3R7Q A;  5BNW A;  5CEA A;  2C0L A;  4XKC A;  2XCB A;  5IY5 E;  4TUM A;  5AQA A;  2GRN B;  4H7X A;  3PEU B;  2WXP A;  1HE8 A;  2I2O A;  2F0Y A;  4JC8 A;  4NRH B;  3C72 A;  4UQZ A;  3FU0 A;  1OT8 A;  3DEO A;  1U3C A;  3QDN A;  4I43 A;  3RO3 A;  1KT1 A;  2JEK A;  2KZT A;  4N39 A;  3P2B A;  2XS8 A;  2J09 A;  1X5B A;  2L0T B;  2V8S E;  5BPP A;  2WXK A;  3CHO A;  3LEW A;  4WWN A;  2ETA A;  2L0I A;  2P9I G;  3FUM A;  4WWO A;  3ENE A;  3HXE A;  3ML9 A;  3HXD A;  4EPZ A;  4ANX A;  1WM5 A;  4LRZ A;  2FUL A;  3I3N A;  4IN3 B;  5ENP D;  3AG4 E;  3FWV A;  4TXP A;  4AV7 A;  3RKV A;  4KZC A;  3JYS A;  4U63 A;  1LTX A;  5KBA A;  5ARG A;  3PEV B;  1E8X A;  5AQ9 A;  1FVF A;  1JWF A;  2J8S D;  1H2U A;  4AXH A;  4DX7 D;  1TEZ A;  1E96 B;  5FTP A;  2EIN E;  3UUX A;  4UI9 K;  2LXM A;  4O6F A;  3RO2 A;  3FUN A;  3LKU A;  3LJ3 A;  2GRQ B;  3Q79 A;  2KBX A;  1QNF A;  2XGS A;  1LD8 A;  2J08 A;  4TXR A;  5FQ6 A;  5KJM A;  1ZB1 A;  4O1O A;  1H2T C;  4RSY A;  5LCW C;  3UIP C;  2LXL A;  2WM9 A;  4UQY A;  5EDS A;  3JCK C;  3UT4 A;  4G1T A;  2R02 A;  1MYO A;  2CFZ A;  4B89 A;  4ILG A;  2V4H C;  2Y0B G;  4HXI A;  4MS6 A;  3TWT A;  1DVP A;  3B7T A;  4AM9 A;  2IO2 C;  4I6G A;  5JMN D;  3NQP A;  2R03 A;  2EQX A;  4JZY A;  3B7B A;  5JHB A;  3K9I A;  4GYY A;  3OTN A;  2NYJ A;  4QQI A;  1Z3Y A;  5HQ8 A;  2ION A;  4TV3 A;  1PC2 A;  2YIN A;  3V31 A;  4FUL A;  4HOQ A;  2WXR A;  4JHJ A;  4BX8 A;  4WWP A;  5E76 A;  1SVX A;  3UMV A;  3UM0 A;  1TYQ G;  3MA5 A;  4CCA A;  1TN6 A;  2R17 C;  5ENT D;  4JB8 P;  3B7U X;  2QYJ A;  2VGX B;  2Y4T A;  3W9F A;  4HOR A;  4GTO A;  1TR4 A;  1PY1 A;  3TGO A;  2UWJ G;  5AAR A;  3CVU A;  4UI9 J;  5KNG A;  5C2Y A;  5LFA A;  4Y6W A;  2Y69 E;  4J8S A;  4ACL A;  3G2V A;  4ME2 A;  5LOZ A;  3ZPJ A;  5LP0 A;  3GZ2 A;  1JUQ A;  4I6E A;  5C1D A;  3ONK A;  4HOT A;  3I5P A;  1O1R A;  2AVP A;  3TG5 A;  2MHK A;  3JUE A;  2L6J A;  1HZ4 A;  4JD2 G;  5E75 A;  2L6B A;  4O1P A;  4I2W A;  2LSU A;  4GTP A;  3FUI A;  2OVB A;  1BI8 B;  4MBG A;  4UWH A;  3URZ A;  3IBE A;  2GRL A;  3NOG D;  5EX0 A;  4DX6 D;  2X3M A;  3CVX A;  3FU5 A;  4J0U A;  2XEH A;  5CMW A;  2PNN A;  3HRA A;  3UT7 A;  4DX5 D;  3T9K A;  5BV1 A;  3DSV A;  3TXN A;  3CHP A;  3D9I A;  3ULQ A;  3JXJ A;  1ELK A;  2AWI A;  3PZD A;  2PM7 A;  2XEE A;  2M63 A;  5CMY A;  5JJ6 A;  1EYH A;  3RU0 A;  2I6H A;  4I1A A;  4C48 B;  4JEU A;  3OXL A;  2AJA A;  2EIL E;  1HU3 A;  4GCN A;  1OWM A;  4B94 A;  5AQB A;  1YMP A;  3AU5 A;  2A4Z A;  2WXM A;  3IKO B;  1ZU2 A;  4HBD A;  1H6P A;  3ZHE A;  1O1T A;  3AS4 A;  3U3W A;  1E8W A;  1TNB A;  5H7P A;  1OCO E;  4GU5 A;  3S7J A;  1EF1 C;  4J7W A;  1KPS B;  2DWZ A;  2P58 C;  1KZO A;  3FUK A;  4MLP A;  5ENQ D;  1HXI A;  3D3M A;  4Y6C A;  2CHW A;  3DSU A;  1E8Z A;  1FT1 A;  4XZ4 A;  3SFZ A;  4U0S A;  4ABN A;  3ZEF A;  5CED B;  3UT8 A;  1IKN D;  3UPV A;  3SBT B;  2KXP C;  3L54 A;  2P9N G;  3TXM A;  3KEA A;  3PH0 C;  3AS8 A;  5M72 A;  3TWX A;  3Q9U C;  4BT9 A;  5ENR D;  1A5E A;  1UJJ A;  3FTU A;  2AW6 A;  4A1S A;  2ILR A;  4U8Y D;  5CEC B;  2LAH A;  4WNE A;  3C3Q A;  4GTM A;  4UUC A;  3ZNG A;  2HO1 A;  3VLF A;  4ANW A;  4BSX A;  2FF4 A;  4GA2 A;  2P2C P;  1IQR A;  4U96 D;  2RKK A;  3Q49 B;  4KVO A;  3FUE A;  3L9T A;  2H6G A;  3ESK A;  5EN5 D;  3UX4 A;  4AY6 A;  2J4D A;  3ZYQ A;  2XZD G;  3BUA A;  1QBQ A;  4YND A;  3EHQ A;  4BX9 A;  5CBN A;  1SW6 A;  3ZXP A;  3PRE A;  5KNH D;  4JA7 A;  4XI9 A;  1WY6 A;  5KWD A;  1KZP A;  4YVO A;  4ILH B;  2PL2 A;  1QZ2 A;  4GCO A;  3NZS A;  4C0E A;  4DLO A;  4UWL A;  3ULE G;  2PQN A;  3AS5 A;  4GZ5 A;  5B1B E;  2OEW A;  3DSS A;  2HM8 A;  4XKB A;  5KJN A;  3DPD A;  1VDY A;  5EIL A;  3S2A A;  3QB2 A;  3AAA C;  3DSX A;  4E85 A;  2FI7 A;  4PUC A;  3KS2 A;  4J6I A;  2GRM A;  1HG5 A;  1WDY A;  5CCM A;  4LEU A;  5ARF A;  2IF4 A;  4CGV A;  3S7B A;  5ITZ F;  1FT2 A;  4I2Z A;  3NOC D;  2Y3A A;  3L6A A;  4LER A;  4I1O B;  3D9O A;  4HQD A;  5BW8 C;  1MJ0 A;  4HB5 A;  4KMO A;  5D0O D;  2OV8 A;  1Y6I A;  4DX2 A;  1N11 A;  4I9C A;  4CDR A;  5G04 C;  4FP7 A;  3ABM E;  2AXU A;  2CFU A;  4GTS A;  4N5Q A;  2LNI A;  5BV0 A;  4PS8 A;  4EZK A;  1BPO A;  3CVQ A;  4N2Q A;  3ONL A;  4FLB A;  2WQ6 A;  2B6C A;  1N94 A;  5ANL A;  1HX8 A;  1DNP A;  4DI4 A;  1P5Q A;  2F8X K;  5FIN A;  2XPZ A;  3FUF A;  5A7D B;  1GW6 A;  2CG3 A;  1HF8 A;  4N3B A;  5DIZ A;  3C3O A;  1BI7 B;  4QFV A;  3D9M A;  3G2T A;  2XGO A;  3RRM B;  4A3V A;  4CDM A;  4F3V A;  1H6O A;  3FU6 A;  1KLX A;  3L82 A;  1MQS A;  3B7R L;  4A55 A;  5AJD A;  4N3A A;  2IU1 A;  1MX4 A;  2WXJ A;  4HFG A;  2QYU A;  1TJF A;  2WQ7 A;  2XQ0 A;  5A23 A;  3ZYM A;  2CHZ A;  3E4B A;  3NZU A;  4EHM A;  3Q5M A;  3N71 A;  1O5M A;  2R59 A;  1B89 A;  4Q96 A;  3CVN A;  2VQ2 A;  2UY1 B;  3ZYK A;  3IV0 A;  3UQ3 A;  4ZFH A;  1TNO A;  3APD A;  4CYM D;  4G25 A;  1XGW A;  3NF1 A;  1EPU A;  4OAU C;  2MRI A;  3Q4A B;  4LNU D;  4AEZ C;  1HH8 A;  4GYW A;  2RD0 A;  4JEH A;  4BTA A;  2WB2 A;  4XIF A;  5ANR A;  1SZA A;  2DZO A;  4U8H A;  3PNT B;  1S0P A;  2QFC A;  2J49 A;  1OWP A;  3AG2 E;  3EJN A;  3BEE A;  3CHQ A;  5JHA A;  3KAE A;  4U95 D;  2RFA A;  3B7S A;  2X38 A;  3SFY A;  2KZT B;  2VGY A;  2H6I A;  2BF0 X;  1HS6 A;  3ASO E;  1N0Q A;  1YCS B;  1E8Y A;  3V30 A;  3NBN B;  3LCA A;  4AVX A;  2V5Q C;  3ASG A;  2YQ8 A;  5AN8 A;  2FO1 E;  1V54 E;  2IEJ A;  3LY9 A;  5EID A;  1PAQ A;  4F6R D;  3Q15 A;  4NQ0 A;  1SZ9 A;  2XPI A;  1DC2 A;  2KCL A;  4LG6 A;  4MKT A;  5JJT A;  3R9A B;  2ZIR A;  2H6F A;  5FJY A;  3RIB A;  1E90 A;  5G55 A;  3U64 A;  3CLJ A;  2YNQ A;  3ASD A;  4HRM B;  2P9L G;  4CDN A;  4AIF A;  3MEK A;  2MOW A;  3PZ3 A;  1FPP A;  3DRA A;  1OCZ E;  3LDZ A;  4YVQ C;  4HRN A;  3C98 A;  3UM2 A;  1DCE A;  2V0P A;  4KT6 B;  4FJY A;  1LF8 A;  2OVF A;  1JCR A;  3BG0 B;  1X81 A;  5ENS D;  1IHB A;  5ENO D;  4ANU A;  3U66 A;  2XHE A;  2IFU A;  2EIJ E;  3HXF A;  4OVV A;  1HO8 A;  1Z6T A;  1SA4 A;  3SGH A;  3ULY A;  1BLX B;  4JVS A;  3MKR A;  3CVP A;  2OOE A;  2XRY A;  2A5U A;  2FBN A;  2KM4 A;  4I1M A;  2F8Y A;  4APF A;  1TJC A;  3L16 A;  2BUG A;  2GW1 A;  1NZN A;  3U4T A;  3ZGQ A;  4K5B A;  3CVY A;  4GYO A;  2KAT A;  2P9P G;  3NB2 A;  5FZR A;  4CGW A;  3CIA A;  4J8E A;  3SQV A;  1JPL A;  3J5Q B;  2V4L A;  2WQH A;  1OY3 D;  3T5X A;  5G2N A;  2QZA A;  3APF A;  3CHM A;  3DXK G;  3FDH A;  3UIN C;  4BSZ B;  4RVB A;  1H2V C;  3P1U A;  5AYW D;  1TNY A;  3HVE A;  4CT4 A;  4GTR A;  2IJG X;  5G05 C;  4FJZ A;  4GTQ A;  3TWW A;  3BQO A;  3HXB A;  2GGF A;  3ESL A;  3VTY A;  4K5C A;  2KCK A;  3AU4 A;  1NA0 A;  1D9S A;  3D9N A;  3CVV A;  2JLB A;  1D8D A;  1INZ A;  2LSV A;  1N0R A;  2QC9 A;  3EU5 A;  1D8E A;  3CHR A;  5JA4 D;  2VSO E;  4XEI G;  4L9P A;  3G2U A;  4TUU A;  2V5F A;  2X6F A;  3FP3 A;  4BT8 A;  2IO3 C;  3MKQ A;  4BWR A;  3EHN A;  3VTX A;  3LS8 A;  3FHE A;  3DEP A;  4XI0 A;  3CK8 A;  1OXJ A;  3J5P A;  3SI5 A;  4DJA A;  3SBS A;  3Q75 A;  4HOU A;  3DST A;  3C3R A;  4DRX E;  3Q9N C;  3SY2 A;  4NUR A;  3U9W A;  4H7Y A;  3V79 K;  4EZL A;  3CV0 A;  4E6H A;  3PZ1 A;  3TG4 A;  3L08 A;  2FEZ A;  4WNF A;  1OCR E;  1N4Q A;  1UN8 A;  4AOF A;  1ZBP A;  3HIZ A;  3OXF A;  4GB9 A;  3FTX A;  1ELR A;  1FCH A;  3GYZ A;  3OAW A;  2P9S G;  1A17 A;  2P9U G;  3JXI A;  2VJ8 A;  3Q7A A;  2DZN A;  1H19 A;  3FY4 A;  2RFM A;  2DCP A;  4JXT A;  5BXO A;  3O48 A;  2X6K A;  4U8V D;  4CZ2 D;  1QQE A;  3Q7F A;  1V55 E;  3AJI A;  1BD8 A;  4JHK A;  3PE3 A;  5D66 A;  3FFL A;  5LCW J;  2XEV A;  4DX1 A;  3VLE A;  3AG3 E;  3UTM A;  2E2E A;  5FT9 A;  3ABK E;  1S63 A;  5FZS A;  4J8D A;  4BEP A;  3TAX A;  4ATZ D;  3MV3 B;  1BU9 A;  3ZHE B;  1N4P A;  2B0O E;  3RRU A;  1RZ4 A;  1L5J A;  3HYM B;  2WPV A;  5FWQ A;  1MHQ A;  2OND A;  3Q47 B;  1JWG A;  4FHJ A;  2BKG A;  3TL5 A;  2J4B A;  3E37 A;  1YYH A;  4EQF A;  5FZQ A;  3HDX A;  4PS7 A;  3RJV A;  2WXQ A;  2I1J A;  3MJW A;  4TRQ A;  4AP2 A;  4UWF A;  4LNG A;  2L9B A;  2R5S A;  5KJK A;  2PQR A;  3HXC A;  4NAC A;  5HS0 A;  3TWV A;  2CG2 A;  2J9Q A;  2VTB A;  3FH5 A;  3EIQ C;  4DI3 A;  4I6J A;  2DYS E;  4HLL A;  3O4Z A;  4OAV B;  3CKC A;  2XRZ A;  1JCS A;  3FU3 A;  4HS2 A; 
#chains in the Genus database with same CATH homology
 2P9U G;  2P9K G;  3UKU G;  3DXK G;  3UKR G;  3DXM G;  1TYQ G;  3DWL G;  2P9P G;  1U2V G;  3ULE G;  4JD2 G;  2P9N G;  3RSE G;  1K8K G;  2P9L G;  4XEI G;  2P9S G;  2P9I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...