4JD2G

Crystal structure of bos taurus arp2/3 complex binding with mus musculus gmf
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
139
Chain Sequence
ARFRKVDVGEYDENKFVDEEGDGGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Structural basis for regulation of Arp2/3 complex by GMF.
pubmed doi rcsb
total genus 38
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 4jd2G00
3DWLG 3UKRG 2P9NG 3DXMG 4XEIG 3UKUG 2P9PG 2P9SG 3RSEG 3ULEG 3DXKG 2P9UG 4JD2G 1U2VG 2P9KG 1TYQG 2P9IG 2P9LG 1K8KG
chains in the Genus database with same CATH superfamily
2ZGDA 4FADA 2BEDA 3BG0B 3I4GA 4I43A 3DSXA 5LCWC 4G1TA 2J9QA 1N11A 2FF4A 4CEMA 3LS8A 2LUHA 1Q2ZA 3ASOE 1W3BA 4ATGA 2A5EA 1IXVA 3L54A 4ANXA 1TN6A 3ZU7B 3MKRA 2WXFA 2GRRB 2VTBA 5FQ7A 2Y4UA 4A1GA 1UJKA 5T4YA 3EIJA 3KD7A 4H7XA 4DX6D 1N52A 2AXVA 3QNKA 4AP2A 1ELKA 2WXKA 3APDA 3MA5A 1MX4A 2XRYA 4EECA 3C3QA 1YA0A 1D8EA 3KAEA 4GYWA 5FINA 3OXGA 2Y69E 5G04J 3U9WA 4CCAA 2NSZA 4EQFA 1LTXA 1FVFA 5AARA 5BT1A 2LAHA 1TR4A 4K5AB 5C1DA 1TYQG 4APFA 4GYOA 2KZTA 2R5SA 4W9RA 2P58C 3S2AA 1EPUA 2XRZA 4FLHA 3HG0D 3Q7AA 3UUXA 1S64A 4HOTA 2B6CA 4YDEA 2I9CA 3UM0A 5A6CA 3KS2A 3CR3A 4TXQA 4ZFHA 5HRYA 3FU5A 3G2WA 2AW6A 5LP0A 4HI8A 1EDUA 1OCZE 2PZIA 1MQSA 3ZFWA 5E76A 1BI8B 3HXCA 4HVBA 2X6HA 4U7EB 3FUNA 5KWDA 5ENNA 4YNDA 2RFAA 1MX2A 4WNEA 3ENEA 3T9KA 3CVYA 1E8WA 1S63A 2BTDA 4IRUA 4PDXA 4Q69A 5JJ7A 4FP7A 4G2VA 5ENPD 1A17A 2BKKB 5EX3A 5AQ7A 1TNUA 3CSFA 2CHXA 1DNPA 1BI7B 3FUHA 3UT7A 5JA4D 3FDHA 5ENOD 2ONDA 3Q9NC 1H0AA 1DCEA 3L6AA 3RIBA 4MS6A 4GTVA 1D8DA 3CQGB 4F3VA 3CVPA 2LSUA 4KVOA 3GYZA 3RSEG 3EUVA 3ULEG 3CIAA 3FH7A 2P9IG 3R9AB 4IN3B 3AG2E 5EN5D 3CGHA 5B1BE 5B3SE 3SI5A 2I1KA 1DCQA 3PE4A 4C9BB 2KXPC 4RG6A 3JUIA 3QDNA 1Y8MA 3FEYA 1SA4A 5J90A 4LNUD 4PS8A 2WXLA 2NC9A 1B89A 4APOA 3U66A 3LXUX 3EHQA 4C48B 3CLJA 1HZ4A 1H6KA 4UQXA 3ZEFA 2ILRA 4G24A 4JL0A 5ENSD 5KJNA 3NZUA 2V5QC 4PS7A 3SD5A 2WQ6A 4UWHA 4BEPA 3PNLB 5LOZA 1HO8A 4FHJA 5D2MC 4DK5A 2FULA 5HQ8A 4DX2A 4MKTA 5G05C 3TWVA 2V5FA 1O1SA 3FEXA 1HXIA 2R03A 1HX8A 1H19A 3L9TA 2M63A 3JYSA 1NA0A 5C2YA 3L13A 1OY3D 2KCVA 3NAWA 5FQ8A 5AQBA 2X6KA 2X38A 4ANWA 3EU5A 4GPMA 5FJYA 3D9OA 3PE3A 3CKCA 4HOQA 3FUMA 5ARGA 4N5CA 4AY6A 5G55A 2A4ZA 2OVFA 2ZISA 3UXGA 5CMWA 1ZBPA 4Q96A 2DYSE 1IKND 1OUVA 3OXLA 4L2YA 1OWOA 3L08A 2DZOA 3CSTA 3V31A 3PEVB 4U8HA 3S7BA 2GROB 2I2OA 4AM9A 1H6PA 2IO3C 4LERA 2XQ0A 2LO6A 4L1BA 2QY7A 3T8KA 3QAQA 1L5JA 4FLBA 4GA1A 3V30A 4A3TA 3NB2A 5CRUA 5DIZA 2XEEA 1ZB1A 4BSXA 1N95A 3MKQB 2L6JA 4U0SA 4GTPA 1QZ2A 3EDTB 3TXMA 3B7BA 1EF1C 5A23A 3SQVA 4GZ5A 2QC9A 1HG2A 2C0MA 5CEAA 4XI9A 3FUJA 5KJLA 4N5QA 4FA6A 3ZGQA 3LVRE 5BV1A 3KEAA 3NOCD 1OT8A 4HRLA 2ZXWE 1RW2A 1HG5A 4WWPA 4O6FA 2J09A 1NFIE 3ZKJA 3UM1A 3Q15A 4F53A 4DRXE 3MX3A 1E8ZA 4G11A 4RQIA 1N4RA 5G04C 4DX5D 2IY0C 1E96B 4JA9A 1OCCE 4PH4B 3DXKG 4UI9J 2L0IA 3LPZA 2Y1LE 3FP3A 3GZSA 2XZDG 3FHEA 2WXRA 2VJ8A 4Y6CA 5KCMA 5AJLA 4FULA 3PS6A 3FY4A 3SZ7A 1NZNA 3NQPA 3FUDA 2XEHA 4HS2A 3B7SA 3JXIA 4ME2A 3E4BA 2RFMA 3ZHEA 3Q7FA 3RKVA 3R7QA 2VTBB 4G26A 2B0OE 5BNWA 3TWQA 3KSQA 1OCRE 4J8DA 3T5VA 2R17C 2WXQA 3ASGA 3ASFA 4LG6A 2WXMA 4GTRA 3RK6A 2WVIA 4BWRA 5CCLA 4UWGA 4KZCA 4FHKA 2IFUA 3ZIMA 2WMOA 4O60A 3PZ3A 4H7YA 2CHZA 3DSVA 3APFA 4I6EA 3LY9A 1UN9A 4BETA 2ZU6B 4GMLA 3FU3A 3PVLA 1LD7A 5CECB 4CYMD 4V3IA 1N4SA 3PUKA 4U96D 1IHBA 2KM4A 2X6JA 3OAWA 4U0UA 3CVNA 2J07A 3FH5A 2XPZA 1PAQA 2KCLA 2ZGGA 4TUMA 2VSXE 1QNFA 3HYMB 3ZYMA 1E7UA 3JXJA 3J5QB 1E7VA 2XPIA 1N9AA 2LXLA 1OWLA 4O1OA 1MJ0A 2AJAA 3GZ1A 3FTYA 3DWLG 3CVXA 3J5PA 4HLLA 2ETCA 3I5PA 3IKOB 5AQ9A 4E85A 4HQDA 4JC8A 5EYPF 2WQHA 2C2LA 1PY1A 3HVEA 2L6BA 2DBAA 3PREA 4RG9A 4DPRA 5FT9A 3TJPA 3QWWA 2IU1A 1SVXA 2XS1A 1SZ9A 4ILIA 4X8QA 3I4RB 2P9SG 4GTSA 3DSTA 3F6QA 3B7TA 3DEPA 1K1AA 4CGVA 2IEJA 4A1SA 2WMNA 1QYMA 1WDYA 5G2NA 3KEZA 2C0LA 5JJ6A 3AU5A 5M72A 1VDYA 5CMYA 5CRVA 3ZUVB 4B93B 4GMJA 3SFZA 3E33A 1TNZA 2LXMA 3UT4A 1N94A 3IXEA 4EPZA 4ZHBA 4LCTA 4U0ZA 2DWZA 2XCBA 1DC2A 2FI7A 3T8MA 1NL4A 3E32A 4J7WA 4Y6WA 3D9IA 4OVVA 4G8KA 1UJJA 4ILGA 4TXPA 4URKA 3C98A 2Y4TA 3TG5A 1IQUA 1NA3A 4BT8A 3CKBA 3HXEA 3HXBA 2R05A 3D9JA 2IO2C 3DPYA 4CDMA 2Y0BG 4GZ3A 3NF1A 1FT1A 4YDWA 3TXNA 4RLYA 2EIKE 5AENA 3VLFA 4HFGA 4BSZB 2OVBA 3DRAA 4KXKB 3HIZA 1SW6A 4F6RD 3FWVA 4J0UA 4IYPA 3LCAA 4B8AA 2V8SE 4GA2A 3V2OA 5ENRD 2WQ7A 2XGMA 4HRNA 3ZYKA 2FO7A 5CHEE 3B7RL 4GZDA 4XIFA 3V79K 4TV3A 1DVPA 3UPVA 4BTBA 4D10C 5FZRA 4JHKA 3C72A 4U8VD 4HXIA 1HS6A 4OYSA 1U3CA 4WNGA 4GU5A 3VTYA 1TEZA 1X5BA 2F8XK 3D9LA 5KJKA 4XKBA 4JB8P 4ACLA 1TNBA 3E37A 3D9HA 3ULYA 2CG3A 3ABLE 4XE0A 3ASNE 4WUYA 4ANUA 3SFYA 3Q75A 5KNHD 3C3OA 4L9PA 3UIPC 3CVUA 1O5MA 3C5RA 1U2VG 3G2TA 3FU0A 4UI9C 2HR2A 1LD8A 3LVQE 3UKRG 3AS8A 5EDSA 1Z3YA 5LFAA 3EHMA 2WB2A 5CBOA 2X6IA 4XI0A 2WXNA 3U64A 3ZPJA 3DSUA 4GTOA 3IV0A 4IULA 2IF4A 2L0TB 4NRHB 4TRQA 3CVWA 2QFCA 4UWFA 5J08A 2MYOA 4DUIA 4K5CA 1GW6A 3RJVA 4GA0A 2YHCA 3E34A 2P9NG 2VQ2A 4KVMA 4PS3A 5AYWD 2QYUA 3MGBA 1N4PA 3TWUA 2HYZA 5JHBA 3CVQA 5EIBE 3QOUA 2MHKA 4U07A 4CGWA 5A7DB 3U4TA 1JCSA 1H2UA 2UWJG 3CK8A 2XZTG 1O1RA 3EHRA 1S70B 1U3DA 4HOUA 3UQ3A 3ZVVA 4GCNA 3DBSA 4EZKA 4C0EA 3FU6A 1X81A 5FIOA 4DI4A 3LKUA 4PUCA 4GCOA 1BPOA 3DXMG 3EU9A 5EX0A 3L82A 2DVWA 1HH8A 3D3MA 3LY7A 3R9MA 5AJDA 3URZA 4GZCA 4NURA 2FO1E 3VLDA 1JCRA 1IQRA 2I1JA 5FQ6A 3LJ3A 5D66A 3PZ2A 3HXFA 1SZAA 3FUKA 4LRZA 4OAVB 3O48A 4KZ0A 5FQ4A 4DJAA 1HE8A 3BU8A 1N4QA 4CDNA 3NBNB 5AAOA 1KLXA 4I1OB 3WXXA 3RO3A 4K03A 5ITZF 1JWFA 2YHEA 1FCHA 5D0QD 3ASDA 3MEKA 4JZYA 3RRMB 3QB2A 2WXJA 5FZQA 3ZNGA 3SBTB 4JPSA 1O1TA 1OWMA 4U04A 3LYAA 4DLOA 3AG4E 4GTTA 1JWGA 1H2VC 4ATZD 2BUGA 4HLEA 4NACA 3IEGA 4MBGA 4GZ6A 2KBXA 2J8SD 3DSSA 4YVQC 3TWRA 3P1UA 1K8KG 4CZ2D 1V54E 5JHAA 2EIME 2GRPB 1V55E 3SO8A 3TWXA 1JUQA 3CVVA 2GGFA 2E0IA 2E2EA 5BW8C 2AXZA 2RG8A 2BF0X 4F1SA 2F0YA 4N39A 2UY1A 5ANLA 4F7AA 1PC2A 1SQMA 3ABME 3DSWA 4HI9A 2V4HC 3AJIA 1YMPA 2PM6A 2VSYA 3ZW3A 1K1BA 3HDXA 5AN8A 3ZN3A 2EILE 2VGXA 3HHMA 3UIOC 1NP7A 4BESA 1LF8A 1MX6A 1IHGA 4N3AA 1HU3A 5JMND 2XEVA 5T8IA 3FFLA 3KSLA 3LJNA 3L17A 4LSZE 2OOEA 5D0OD 3NOGD 1MHQA 4JEHA 1Y6IA 2P2CP 2YINA 3RRUA 3HRAA 4U95D 2OV8A 2IQCA 3CEQA 4UI9K 4N2SA 3ZXSA 1Z6TA 1HF8A 3QWVA 2FEZA 1MZCA 2LNIA 2KZTB 2VSNA 3QKYA 4TXRA 1D9SA 1FPPA 4AV7A 3PEUB 3TWTA 4CRWA 1TJFA 3S7DA 3CHQA 4I1MA 4XX5A 4UWLA 4FJYA 4AY5A 1TNYA 3OTNA 4FC8A 5EKQD 3MYVA 4N3BA 1E8YA 5HS0A 4L2LA 1BLXB 1N0QA 1JCQA 4UUCA 3OXFA 3Q79A 4J8YA 2IONA 3ZYLA 3ULQA 3ML9A 1KT1A 4BTAA 3ESLA 3TG4A 2I6HA 3B13A 2AWIA 4KBQA 5CCMA 5E75A 2NYJA 4DX1A 4ANVA 3D9NA 3TL5A 3T5XA 4QQIA 2CFUA 5IY5E 4LUNU 2HO1A 1ZU2A 3FTZA 2OEVA 4I2WA 1ELWA 4G25A 2J49A 2WXGA 2F8YA 2V4LA 4Q94A 1H2TC 2V0PA 4BERA 4U63A 1UW4B 2WM9A 2H6GA 3B95A 2WXHA 3ZXPA 1KZPA 2H6IA 3CVLA 1P5QA 1QQEA 3JQ0A 3L16A 3UM2A 1AP7A 2ETBA 4I9CA 3LDZA 3JUEA 5AQAA 2OEWA 5CEDB 5HI7A 4AEZC 3BUAA 2VGYA 3FTVA 2KCKA 3BG1B 4HBDA 4EBAA 3PH0C 3FULA 2CG2A 4UQYA 2PQRA 1KPSB 4FJZA 3UMVA 3ZYQA 3IBEA 5FZSA 3SGHA 2QYJA 3AS5A 3SBSA 4N2QA 3E30A 3QARA 4I9EA 4HNAD 3SNXA 4UQZA 2J4BA 3Q47B 4J8FA 3ZRHA 1NI1A 3D9MA 4UWKA 1RZ4A 2AVPA 1KT0A 2DCPA 1UOHA 3VLEA 4M3OA 4KT6B 5CBNA 2FBNA 2PNNA 4HB5A 4HOSA 4XEIG 3UX4A 1E90A 3FTXA 3FH8A 4NQ0A 4WNFA 4GPKA 1FVHA 1HFAA 4B94A 4U8YD 4N3CA 1YYHA 4KMOA 5B1AE 5EYLA 1FT2A 3RU0A 3QK0A 3BEEA 4I1AA 4E6HA 1TNOA 3FUFA 1Z5SC 5ENQD 2H6FA 3N71A 4B8CB 4WNDA 4BT9A 2GW1A 3EIQC 4J8SA 3W9GA 3Q78A 3ONKA 4AOFA 4A3VA 2EINE 2J4DA 2H6HA 2RKKA 3G2SA 3ML8A 1OWPA 3WG7E 2ETAA 3W9FA 3FUEA 3MJWA 2JLBA 2VGEA 5ENTD 3BQOA 4LEUA 4MLPA 3Q9UC 4K5BA 3PDNA 3AG1E 2IOLA 3GW4A 4ABNA 2NXPA 3TGOA 4GTMA 2R2LA 2WXPA 1SA5A 3SHFA 2WXOA 1XGWA 4RVBA 4A55A 3LEWA 2GRMA 4J8EA 1A5EA 4DI3A 3D9PA 2QZAA 3QWPA 2IJGX 1S0PA 3FTWA 3L22A 5LCWJ 4G8LA 4EZJA 4EZLA 3MV3B 4JVSA 4L23A 4B0ZA 5BXOA 4HORA 1MYOA 3QJZA 2X3MA 2LAIA 3LY8A 3SFXA 3S7JA 2VYIA 3APCA 2VSOE 3TWWA 4CT4A 4WAFA 3CQCB 1ELRA 2GRLA 3IHVA 4P29A 5HKPA 3TAXA 4C0MA 4BY6A 5FWQA 5EILA 2F37A 5AIJA 2CFZA 5ANRA 3HXDA 3VTXA 2DYRE 4R7LA 2GRNB 4JXTA 1G3NB 3DEOA 2XCCA 5BUZA 5EIDA 3Q5MA 3CHSA 2UY1B 3Q49B 2GRQB 3JCKC 3ESKA 5BPPA 4J6IA 2WPVA 2LSVA 4AJWA 2A5UA 4EBAG 3MZLB 1E8XA 2Y3AA 5CERB 4YVOA 2EQXA 4JA7A 2VGXB 3UKUG 2OCCE 3CHPA 5BXUA 3U3WA 3RRNB 4JD2G 3TWSA 4Z68A 4BFRA 3ZHEB 4DLQA 2DZNA 2R02A 3PZ4A 4JHRA 3X2QE 3ABKE 4GAAA 3UTMA 4GYYA 3Q73A 4ILHB 4OAUC 2XGOA 3GZ2A 3S7FA 3V2XA 4YDOA 2PL2A 4FU3A 5ARFA 4NIKA 3P2BA 2P9UG 1WAO1 3QC1A 2P9LG 2PQNA 3AAAC 1WM5A 3CHMA 5KJMA 3O4ZA 2JEKA 1IYGA 2CHWA 3PNTB 2KATA 3AU4A 2DIWA 1UN8A 2RD0A 2KC7A 3CK9A 2YQ8A 4XKCA 2X6FA 2P9KG 3DPDA 4XZ4A 5LX8A 4GMRA 4DX7D 4CDRA 4A63B 3IHYA 2P9PG 3AG3E 3PZ1A 4HRMB 1N54A 3G2VA 5FTPA 5KNGA 1YCSB 3CHOA 3UI2A 2J08A 2XHEA 4JHJA 3CK7A 3MV2B 1BD8A 3NZSA 3CHRA 4G23A 3JQ1A 1TJCA 4ACKA 2XGSA 2EIJE 2HM8A 3B7UX 4MRUA 4OVUA 1K3ZD 1AWCB 1TN7A 4EHMA 2AXUA 4BX8A 3I3NA 4O1PA 4I2ZA 2YNQA 3HVEB 3UINC 4WWNA 4AXHA 2PM7A 2HE0A 2XS8A 3G2UA 4WWOA 2XENA 1INZA 5T3RA 4KYOB 2Q7FA 5BV0A 5KBAA 3SY2A 3CV0A 4LNGA 1Z3XA 3EHNA 3ISMC 3PRZA 5G05J 4AVXA 4BX9A 3RO2A 3UT8A 2MOWA 3UM3A 2R59A 4I6JA 1UG3A 2MRIA 5JJTA 3R7RA 4JW1A 4B89A 3MKQA 1OXJA 3PUJA 1WG0A 1WY6A 4CT0A 2WXIA 3D9KA 2ZIRA 4TUUA 4F1PA 1EYHA 2IOSA 3FUIA 2BKGA 4I17A 3FTUA 4GB9A 3EJNA 4LNBA 1BU9A 4RSYA 3ONLA 4GTQA 1TN8A 4AIFA 1OCOE 3MCXA 2XPYA 3RAUA 1KZOA 1QBQA 4K0RA 2JABA 3C3RA 4M7CA 1OWNA 4QFVA 3PZDA 3AS4A 4JEUA 1JPLA 1XNFA 3K9IA 5H7PA 1H6OA 4YDYA 3FTSA 5DBKA 1N0RA 4L7TA 4I6GA 3SF4A 2L9BA 3Q4AB 3ASHA
chains in the Genus database with same CATH topology
3DWLG 3UKRG 2P9NG 3DXMG 4XEIG 3UKUG 2P9PG 2P9SG 3RSEG 3ULEG 3DXKG 2P9UG 4JD2G 1U2VG 2P9KG 1TYQG 2P9IG 2P9LG 1K8KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWL G;  3UKR G;  2P9N G;  3DXM G;  4XEI G;  3UKU G;  2P9P G;  2P9S G;  3RSE G;  3ULE G;  3DXK G;  2P9U G;  4JD2 G;  1U2V G;  2P9K G;  1TYQ G;  2P9I G;  2P9L G;  1K8K G; 
#chains in the Genus database with same CATH topology
 2ZGD A;  4FAD A;  2BED A;  3BG0 B;  3I4G A;  4I43 A;  3DSX A;  5LCW C;  4G1T A;  2J9Q A;  1N11 A;  2FF4 A;  4CEM A;  3LS8 A;  2LUH A;  1Q2Z A;  3ASO E;  1W3B A;  4ATG A;  2A5E A;  1IXV A;  3L54 A;  4ANX A;  1TN6 A;  3ZU7 B;  3MKR A;  2WXF A;  2GRR B;  2VTB A;  5FQ7 A;  2Y4U A;  4A1G A;  1UJK A;  5T4Y A;  3EIJ A;  3KD7 A;  4H7X A;  4DX6 D;  1N52 A;  2AXV A;  3QNK A;  4AP2 A;  1ELK A;  2WXK A;  3APD A;  3MA5 A;  1MX4 A;  2XRY A;  4EEC A;  3C3Q A;  1YA0 A;  1D8E A;  3KAE A;  4GYW A;  5FIN A;  3OXG A;  2Y69 E;  5G04 J;  3U9W A;  4CCA A;  2NSZ A;  4EQF A;  1LTX A;  1FVF A;  5AAR A;  5BT1 A;  2LAH A;  1TR4 A;  4K5A B;  5C1D A;  1TYQ G;  4APF A;  4GYO A;  2KZT A;  2R5S A;  4W9R A;  2P58 C;  3S2A A;  1EPU A;  2XRZ A;  4FLH A;  3HG0 D;  3Q7A A;  3UUX A;  1S64 A;  4HOT A;  2B6C A;  4YDE A;  2I9C A;  3UM0 A;  5A6C A;  3KS2 A;  3CR3 A;  4TXQ A;  4ZFH A;  5HRY A;  3FU5 A;  3G2W A;  2AW6 A;  5LP0 A;  4HI8 A;  1EDU A;  1OCZ E;  2PZI A;  1MQS A;  3ZFW A;  5E76 A;  1BI8 B;  3HXC A;  4HVB A;  2X6H A;  4U7E B;  3FUN A;  5KWD A;  5ENN A;  4YND A;  2RFA A;  1MX2 A;  4WNE A;  3ENE A;  3T9K A;  3CVY A;  1E8W A;  1S63 A;  2BTD A;  4IRU A;  4PDX A;  4Q69 A;  5JJ7 A;  4FP7 A;  4G2V A;  5ENP D;  1A17 A;  2BKK B;  5EX3 A;  5AQ7 A;  1TNU A;  3CSF A;  2CHX A;  1DNP A;  1BI7 B;  3FUH A;  3UT7 A;  5JA4 D;  3FDH A;  5ENO D;  2OND A;  3Q9N C;  1H0A A;  1DCE A;  3L6A A;  3RIB A;  4MS6 A;  4GTV A;  1D8D A;  3CQG B;  4F3V A;  3CVP A;  2LSU A;  4KVO A;  3GYZ A;  3RSE G;  3EUV A;  3ULE G;  3CIA A;  3FH7 A;  2P9I G;  3R9A B;  4IN3 B;  3AG2 E;  5EN5 D;  3CGH A;  5B1B E;  5B3S E;  3SI5 A;  2I1K A;  1DCQ A;  3PE4 A;  4C9B B;  2KXP C;  4RG6 A;  3JUI A;  3QDN A;  1Y8M A;  3FEY A;  1SA4 A;  5J90 A;  4LNU D;  4PS8 A;  2WXL A;  2NC9 A;  1B89 A;  4APO A;  3U66 A;  3LXU X;  3EHQ A;  4C48 B;  3CLJ A;  1HZ4 A;  1H6K A;  4UQX A;  3ZEF A;  2ILR A;  4G24 A;  4JL0 A;  5ENS D;  5KJN A;  3NZU A;  2V5Q C;  4PS7 A;  3SD5 A;  2WQ6 A;  4UWH A;  4BEP A;  3PNL B;  5LOZ A;  1HO8 A;  4FHJ A;  5D2M C;  4DK5 A;  2FUL A;  5HQ8 A;  4DX2 A;  4MKT A;  5G05 C;  3TWV A;  2V5F A;  1O1S A;  3FEX A;  1HXI A;  2R03 A;  1HX8 A;  1H19 A;  3L9T A;  2M63 A;  3JYS A;  1NA0 A;  5C2Y A;  3L13 A;  1OY3 D;  2KCV A;  3NAW A;  5FQ8 A;  5AQB A;  2X6K A;  2X38 A;  4ANW A;  3EU5 A;  4GPM A;  5FJY A;  3D9O A;  3PE3 A;  3CKC A;  4HOQ A;  3FUM A;  5ARG A;  4N5C A;  4AY6 A;  5G55 A;  2A4Z A;  2OVF A;  2ZIS A;  3UXG A;  5CMW A;  1ZBP A;  4Q96 A;  2DYS E;  1IKN D;  1OUV A;  3OXL A;  4L2Y A;  1OWO A;  3L08 A;  2DZO A;  3CST A;  3V31 A;  3PEV B;  4U8H A;  3S7B A;  2GRO B;  2I2O A;  4AM9 A;  1H6P A;  2IO3 C;  4LER A;  2XQ0 A;  2LO6 A;  4L1B A;  2QY7 A;  3T8K A;  3QAQ A;  1L5J A;  4FLB A;  4GA1 A;  3V30 A;  4A3T A;  3NB2 A;  5CRU A;  5DIZ A;  2XEE A;  1ZB1 A;  4BSX A;  1N95 A;  3MKQ B;  2L6J A;  4U0S A;  4GTP A;  1QZ2 A;  3EDT B;  3TXM A;  3B7B A;  1EF1 C;  5A23 A;  3SQV A;  4GZ5 A;  2QC9 A;  1HG2 A;  2C0M A;  5CEA A;  4XI9 A;  3FUJ A;  5KJL A;  4N5Q A;  4FA6 A;  3ZGQ A;  3LVR E;  5BV1 A;  3KEA A;  3NOC D;  1OT8 A;  4HRL A;  2ZXW E;  1RW2 A;  1HG5 A;  4WWP A;  4O6F A;  2J09 A;  1NFI E;  3ZKJ A;  3UM1 A;  3Q15 A;  4F53 A;  4DRX E;  3MX3 A;  1E8Z A;  4G11 A;  4RQI A;  1N4R A;  5G04 C;  4DX5 D;  2IY0 C;  1E96 B;  4JA9 A;  1OCC E;  4PH4 B;  3DXK G;  4UI9 J;  2L0I A;  3LPZ A;  2Y1L E;  3FP3 A;  3GZS A;  2XZD G;  3FHE A;  2WXR A;  2VJ8 A;  4Y6C A;  5KCM A;  5AJL A;  4FUL A;  3PS6 A;  3FY4 A;  3SZ7 A;  1NZN A;  3NQP A;  3FUD A;  2XEH A;  4HS2 A;  3B7S A;  3JXI A;  4ME2 A;  3E4B A;  2RFM A;  3ZHE A;  3Q7F A;  3RKV A;  3R7Q A;  2VTB B;  4G26 A;  2B0O E;  5BNW A;  3TWQ A;  3KSQ A;  1OCR E;  4J8D A;  3T5V A;  2R17 C;  2WXQ A;  3ASG A;  3ASF A;  4LG6 A;  2WXM A;  4GTR A;  3RK6 A;  2WVI A;  4BWR A;  5CCL A;  4UWG A;  4KZC A;  4FHK A;  2IFU A;  3ZIM A;  2WMO A;  4O60 A;  3PZ3 A;  4H7Y A;  2CHZ A;  3DSV A;  3APF A;  4I6E A;  3LY9 A;  1UN9 A;  4BET A;  2ZU6 B;  4GML A;  3FU3 A;  3PVL A;  1LD7 A;  5CEC B;  4CYM D;  4V3I A;  1N4S A;  3PUK A;  4U96 D;  1IHB A;  2KM4 A;  2X6J A;  3OAW A;  4U0U A;  3CVN A;  2J07 A;  3FH5 A;  2XPZ A;  1PAQ A;  2KCL A;  2ZGG A;  4TUM A;  2VSX E;  1QNF A;  3HYM B;  3ZYM A;  1E7U A;  3JXJ A;  3J5Q B;  1E7V A;  2XPI A;  1N9A A;  2LXL A;  1OWL A;  4O1O A;  1MJ0 A;  2AJA A;  3GZ1 A;  3FTY A;  3DWL G;  3CVX A;  3J5P A;  4HLL A;  2ETC A;  3I5P A;  3IKO B;  5AQ9 A;  4E85 A;  4HQD A;  4JC8 A;  5EYP F;  2WQH A;  2C2L A;  1PY1 A;  3HVE A;  2L6B A;  2DBA A;  3PRE A;  4RG9 A;  4DPR A;  5FT9 A;  3TJP A;  3QWW A;  2IU1 A;  1SVX A;  2XS1 A;  1SZ9 A;  4ILI A;  4X8Q A;  3I4R B;  2P9S G;  4GTS A;  3DST A;  3F6Q A;  3B7T A;  3DEP A;  1K1A A;  4CGV A;  2IEJ A;  4A1S A;  2WMN A;  1QYM A;  1WDY A;  5G2N A;  3KEZ A;  2C0L A;  5JJ6 A;  3AU5 A;  5M72 A;  1VDY A;  5CMY A;  5CRV A;  3ZUV B;  4B93 B;  4GMJ A;  3SFZ A;  3E33 A;  1TNZ A;  2LXM A;  3UT4 A;  1N94 A;  3IXE A;  4EPZ A;  4ZHB A;  4LCT A;  4U0Z A;  2DWZ A;  2XCB A;  1DC2 A;  2FI7 A;  3T8M A;  1NL4 A;  3E32 A;  4J7W A;  4Y6W A;  3D9I A;  4OVV A;  4G8K A;  1UJJ A;  4ILG A;  4TXP A;  4URK A;  3C98 A;  2Y4T A;  3TG5 A;  1IQU A;  1NA3 A;  4BT8 A;  3CKB A;  3HXE A;  3HXB A;  2R05 A;  3D9J A;  2IO2 C;  3DPY A;  4CDM A;  2Y0B G;  4GZ3 A;  3NF1 A;  1FT1 A;  4YDW A;  3TXN A;  4RLY A;  2EIK E;  5AEN A;  3VLF A;  4HFG A;  4BSZ B;  2OVB A;  3DRA A;  4KXK B;  3HIZ A;  1SW6 A;  4F6R D;  3FWV A;  4J0U A;  4IYP A;  3LCA A;  4B8A A;  2V8S E;  4GA2 A;  3V2O A;  5ENR D;  2WQ7 A;  2XGM A;  4HRN A;  3ZYK A;  2FO7 A;  5CHE E;  3B7R L;  4GZD A;  4XIF A;  3V79 K;  4TV3 A;  1DVP A;  3UPV A;  4BTB A;  4D10 C;  5FZR A;  4JHK A;  3C72 A;  4U8V D;  4HXI A;  1HS6 A;  4OYS A;  1U3C A;  4WNG A;  4GU5 A;  3VTY A;  1TEZ A;  1X5B A;  2F8X K;  3D9L A;  5KJK A;  4XKB A;  4JB8 P;  4ACL A;  1TNB A;  3E37 A;  3D9H A;  3ULY A;  2CG3 A;  3ABL E;  4XE0 A;  3ASN E;  4WUY A;  4ANU A;  3SFY A;  3Q75 A;  5KNH D;  3C3O A;  4L9P A;  3UIP C;  3CVU A;  1O5M A;  3C5R A;  1U2V G;  3G2T A;  3FU0 A;  4UI9 C;  2HR2 A;  1LD8 A;  3LVQ E;  3UKR G;  3AS8 A;  5EDS A;  1Z3Y A;  5LFA A;  3EHM A;  2WB2 A;  5CBO A;  2X6I A;  4XI0 A;  2WXN A;  3U64 A;  3ZPJ A;  3DSU A;  4GTO A;  3IV0 A;  4IUL A;  2IF4 A;  2L0T B;  4NRH B;  4TRQ A;  3CVW A;  2QFC A;  4UWF A;  5J08 A;  2MYO A;  4DUI A;  4K5C A;  1GW6 A;  3RJV A;  4GA0 A;  2YHC A;  3E34 A;  2P9N G;  2VQ2 A;  4KVM A;  4PS3 A;  5AYW D;  2QYU A;  3MGB A;  1N4P A;  3TWU A;  2HYZ A;  5JHB A;  3CVQ A;  5EIB E;  3QOU A;  2MHK A;  4U07 A;  4CGW A;  5A7D B;  3U4T A;  1JCS A;  1H2U A;  2UWJ G;  3CK8 A;  2XZT G;  1O1R A;  3EHR A;  1S70 B;  1U3D A;  4HOU A;  3UQ3 A;  3ZVV A;  4GCN A;  3DBS A;  4EZK A;  4C0E A;  3FU6 A;  1X81 A;  5FIO A;  4DI4 A;  3LKU A;  4PUC A;  4GCO A;  1BPO A;  3DXM G;  3EU9 A;  5EX0 A;  3L82 A;  2DVW A;  1HH8 A;  3D3M A;  3LY7 A;  3R9M A;  5AJD A;  3URZ A;  4GZC A;  4NUR A;  2FO1 E;  3VLD A;  1JCR A;  1IQR A;  2I1J A;  5FQ6 A;  3LJ3 A;  5D66 A;  3PZ2 A;  3HXF A;  1SZA A;  3FUK A;  4LRZ A;  4OAV B;  3O48 A;  4KZ0 A;  5FQ4 A;  4DJA A;  1HE8 A;  3BU8 A;  1N4Q A;  4CDN A;  3NBN B;  5AAO A;  1KLX A;  4I1O B;  3WXX A;  3RO3 A;  4K03 A;  5ITZ F;  1JWF A;  2YHE A;  1FCH A;  5D0Q D;  3ASD A;  3MEK A;  4JZY A;  3RRM B;  3QB2 A;  2WXJ A;  5FZQ A;  3ZNG A;  3SBT B;  4JPS A;  1O1T A;  1OWM A;  4U04 A;  3LYA A;  4DLO A;  3AG4 E;  4GTT A;  1JWG A;  1H2V C;  4ATZ D;  2BUG A;  4HLE A;  4NAC A;  3IEG A;  4MBG A;  4GZ6 A;  2KBX A;  2J8S D;  3DSS A;  4YVQ C;  3TWR A;  3P1U A;  1K8K G;  4CZ2 D;  1V54 E;  5JHA A;  2EIM E;  2GRP B;  1V55 E;  3SO8 A;  3TWX A;  1JUQ A;  3CVV A;  2GGF A;  2E0I A;  2E2E A;  5BW8 C;  2AXZ A;  2RG8 A;  2BF0 X;  4F1S A;  2F0Y A;  4N39 A;  2UY1 A;  5ANL A;  4F7A A;  1PC2 A;  1SQM A;  3ABM E;  3DSW A;  4HI9 A;  2V4H C;  3AJI A;  1YMP A;  2PM6 A;  2VSY A;  3ZW3 A;  1K1B A;  3HDX A;  5AN8 A;  3ZN3 A;  2EIL E;  2VGX A;  3HHM A;  3UIO C;  1NP7 A;  4BES A;  1LF8 A;  1MX6 A;  1IHG A;  4N3A A;  1HU3 A;  5JMN D;  2XEV A;  5T8I A;  3FFL A;  3KSL A;  3LJN A;  3L17 A;  4LSZ E;  2OOE A;  5D0O D;  3NOG D;  1MHQ A;  4JEH A;  1Y6I A;  2P2C P;  2YIN A;  3RRU A;  3HRA A;  4U95 D;  2OV8 A;  2IQC A;  3CEQ A;  4UI9 K;  4N2S A;  3ZXS A;  1Z6T A;  1HF8 A;  3QWV A;  2FEZ A;  1MZC A;  2LNI A;  2KZT B;  2VSN A;  3QKY A;  4TXR A;  1D9S A;  1FPP A;  4AV7 A;  3PEU B;  3TWT A;  4CRW A;  1TJF A;  3S7D A;  3CHQ A;  4I1M A;  4XX5 A;  4UWL A;  4FJY A;  4AY5 A;  1TNY A;  3OTN A;  4FC8 A;  5EKQ D;  3MYV A;  4N3B A;  1E8Y A;  5HS0 A;  4L2L A;  1BLX B;  1N0Q A;  1JCQ A;  4UUC A;  3OXF A;  3Q79 A;  4J8Y A;  2ION A;  3ZYL A;  3ULQ A;  3ML9 A;  1KT1 A;  4BTA A;  3ESL A;  3TG4 A;  2I6H A;  3B13 A;  2AWI A;  4KBQ A;  5CCM A;  5E75 A;  2NYJ A;  4DX1 A;  4ANV A;  3D9N A;  3TL5 A;  3T5X A;  4QQI A;  2CFU A;  5IY5 E;  4LUN U;  2HO1 A;  1ZU2 A;  3FTZ A;  2OEV A;  4I2W A;  1ELW A;  4G25 A;  2J49 A;  2WXG A;  2F8Y A;  2V4L A;  4Q94 A;  1H2T C;  2V0P A;  4BER A;  4U63 A;  1UW4 B;  2WM9 A;  2H6G A;  3B95 A;  2WXH A;  3ZXP A;  1KZP A;  2H6I A;  3CVL A;  1P5Q A;  1QQE A;  3JQ0 A;  3L16 A;  3UM2 A;  1AP7 A;  2ETB A;  4I9C A;  3LDZ A;  3JUE A;  5AQA A;  2OEW A;  5CED B;  5HI7 A;  4AEZ C;  3BUA A;  2VGY A;  3FTV A;  2KCK A;  3BG1 B;  4HBD A;  4EBA A;  3PH0 C;  3FUL A;  2CG2 A;  4UQY A;  2PQR A;  1KPS B;  4FJZ A;  3UMV A;  3ZYQ A;  3IBE A;  5FZS A;  3SGH A;  2QYJ A;  3AS5 A;  3SBS A;  4N2Q A;  3E30 A;  3QAR A;  4I9E A;  4HNA D;  3SNX A;  4UQZ A;  2J4B A;  3Q47 B;  4J8F A;  3ZRH A;  1NI1 A;  3D9M A;  4UWK A;  1RZ4 A;  2AVP A;  1KT0 A;  2DCP A;  1UOH A;  3VLE A;  4M3O A;  4KT6 B;  5CBN A;  2FBN A;  2PNN A;  4HB5 A;  4HOS A;  4XEI G;  3UX4 A;  1E90 A;  3FTX A;  3FH8 A;  4NQ0 A;  4WNF A;  4GPK A;  1FVH A;  1HFA A;  4B94 A;  4U8Y D;  4N3C A;  1YYH A;  4KMO A;  5B1A E;  5EYL A;  1FT2 A;  3RU0 A;  3QK0 A;  3BEE A;  4I1A A;  4E6H A;  1TNO A;  3FUF A;  1Z5S C;  5ENQ D;  2H6F A;  3N71 A;  4B8C B;  4WND A;  4BT9 A;  2GW1 A;  3EIQ C;  4J8S A;  3W9G A;  3Q78 A;  3ONK A;  4AOF A;  4A3V A;  2EIN E;  2J4D A;  2H6H A;  2RKK A;  3G2S A;  3ML8 A;  1OWP A;  3WG7 E;  2ETA A;  3W9F A;  3FUE A;  3MJW A;  2JLB A;  2VGE A;  5ENT D;  3BQO A;  4LEU A;  4MLP A;  3Q9U C;  4K5B A;  3PDN A;  3AG1 E;  2IOL A;  3GW4 A;  4ABN A;  2NXP A;  3TGO A;  4GTM A;  2R2L A;  2WXP A;  1SA5 A;  3SHF A;  2WXO A;  1XGW A;  4RVB A;  4A55 A;  3LEW A;  2GRM A;  4J8E A;  1A5E A;  4DI3 A;  3D9P A;  2QZA A;  3QWP A;  2IJG X;  1S0P A;  3FTW A;  3L22 A;  5LCW J;  4G8L A;  4EZJ A;  4EZL A;  3MV3 B;  4JVS A;  4L23 A;  4B0Z A;  5BXO A;  4HOR A;  1MYO A;  3QJZ A;  2X3M A;  2LAI A;  3LY8 A;  3SFX A;  3S7J A;  2VYI A;  3APC A;  2VSO E;  3TWW A;  4CT4 A;  4WAF A;  3CQC B;  1ELR A;  2GRL A;  3IHV A;  4P29 A;  5HKP A;  3TAX A;  4C0M A;  4BY6 A;  5FWQ A;  5EIL A;  2F37 A;  5AIJ A;  2CFZ A;  5ANR A;  3HXD A;  3VTX A;  2DYR E;  4R7L A;  2GRN B;  4JXT A;  1G3N B;  3DEO A;  2XCC A;  5BUZ A;  5EID A;  3Q5M A;  3CHS A;  2UY1 B;  3Q49 B;  2GRQ B;  3JCK C;  3ESK A;  5BPP A;  4J6I A;  2WPV A;  2LSV A;  4AJW A;  2A5U A;  4EBA G;  3MZL B;  1E8X A;  2Y3A A;  5CER B;  4YVO A;  2EQX A;  4JA7 A;  2VGX B;  3UKU G;  2OCC E;  3CHP A;  5BXU A;  3U3W A;  3RRN B;  4JD2 G;  3TWS A;  4Z68 A;  4BFR A;  3ZHE B;  4DLQ A;  2DZN A;  2R02 A;  3PZ4 A;  4JHR A;  3X2Q E;  3ABK E;  4GAA A;  3UTM A;  4GYY A;  3Q73 A;  4ILH B;  4OAU C;  2XGO A;  3GZ2 A;  3S7F A;  3V2X A;  4YDO A;  2PL2 A;  4FU3 A;  5ARF A;  4NIK A;  3P2B A;  2P9U G;  1WAO 1;  3QC1 A;  2P9L G;  2PQN A;  3AAA C;  1WM5 A;  3CHM A;  5KJM A;  3O4Z A;  2JEK A;  1IYG A;  2CHW A;  3PNT B;  2KAT A;  3AU4 A;  2DIW A;  1UN8 A;  2RD0 A;  2KC7 A;  3CK9 A;  2YQ8 A;  4XKC A;  2X6F A;  2P9K G;  3DPD A;  4XZ4 A;  5LX8 A;  4GMR A;  4DX7 D;  4CDR A;  4A63 B;  3IHY A;  2P9P G;  3AG3 E;  3PZ1 A;  4HRM B;  1N54 A;  3G2V A;  5FTP A;  5KNG A;  1YCS B;  3CHO A;  3UI2 A;  2J08 A;  2XHE A;  4JHJ A;  3CK7 A;  3MV2 B;  1BD8 A;  3NZS A;  3CHR A;  4G23 A;  3JQ1 A;  1TJC A;  4ACK A;  2XGS A;  2EIJ E;  2HM8 A;  3B7U X;  4MRU A;  4OVU A;  1K3Z D;  1AWC B;  1TN7 A;  4EHM A;  2AXU A;  4BX8 A;  3I3N A;  4O1P A;  4I2Z A;  2YNQ A;  3HVE B;  3UIN C;  4WWN A;  4AXH A;  2PM7 A;  2HE0 A;  2XS8 A;  3G2U A;  4WWO A;  2XEN A;  1INZ A;  5T3R A;  4KYO B;  2Q7F A;  5BV0 A;  5KBA A;  3SY2 A;  3CV0 A;  4LNG A;  1Z3X A;  3EHN A;  3ISM C;  3PRZ A;  5G05 J;  4AVX A;  4BX9 A;  3RO2 A;  3UT8 A;  2MOW A;  3UM3 A;  2R59 A;  4I6J A;  1UG3 A;  2MRI A;  5JJT A;  3R7R A;  4JW1 A;  4B89 A;  3MKQ A;  1OXJ A;  3PUJ A;  1WG0 A;  1WY6 A;  4CT0 A;  2WXI A;  3D9K A;  2ZIR A;  4TUU A;  4F1P A;  1EYH A;  2IOS A;  3FUI A;  2BKG A;  4I17 A;  3FTU A;  4GB9 A;  3EJN A;  4LNB A;  1BU9 A;  4RSY A;  3ONL A;  4GTQ A;  1TN8 A;  4AIF A;  1OCO E;  3MCX A;  2XPY A;  3RAU A;  1KZO A;  1QBQ A;  4K0R A;  2JAB A;  3C3R A;  4M7C A;  1OWN A;  4QFV A;  3PZD A;  3AS4 A;  4JEU A;  1JPL A;  1XNF A;  3K9I A;  5H7P A;  1H6O A;  4YDY A;  3FTS A;  5DBK A;  1N0R A;  4L7T A;  4I6G A;  3SF4 A;  2L9B A;  3Q4A B;  3ASH A; 
#chains in the Genus database with same CATH homology
 3DWL G;  3UKR G;  2P9N G;  3DXM G;  4XEI G;  3UKU G;  2P9P G;  2P9S G;  3RSE G;  3ULE G;  3DXK G;  2P9U G;  4JD2 G;  1U2V G;  2P9K G;  1TYQ G;  2P9I G;  2P9L G;  1K8K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...