4JD2G

Crystal structure of bos taurus arp2/3 complex binding with mus musculus gmf
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
139
Chain Sequence
b'ARFRKVDVGEYDENKFVDEEGDGGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural basis for regulation of Arp2/3 complex by GMF.
pubmed doi rcsb
molecule tags Structural protein
total genus 38
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 4jd2G00
3ULEG 4XEIG 2P9NG 1U2VG 2P9UG 2P9KG 3DWLG 2P9PG 3DXKG 3UKUG 3UKRG 3RSEG 1K8KG 3DXMG 2P9SG 2P9IG 4JD2G 2P9LG 1TYQG
chains in the Genus database with same CATH superfamily
3I5PA 4I1AA 1Z3YA 5E75A 2KCKA 4JC8A 4UQZA 1D8DA 2DBAA 1UN8A 3FHEA 3NOCD 3FU0A 2R5SA 3UMVA 2RD0A 3FUNA 4U8HA 2P9LG 3VLFA 2VGYA 1BU9A 2J4BA 3L17A 4JB8P 3RKVA 2L0IA 4KVOA 2IQCA 4DX6D 3E30A 1EYHA 3OXGA 4UWGA 3RRUA 3ESLA 3TAXA 5M72A 3MCXA 4GCOA 1NL4A 3UI2A 3LY8A 5ENTD 4QQIA 5H7PA 4U0SA 1LD8A 3FUKA 4U95D 3HRAA 3ZYQA 2X3MA 3DSWA 2YNQA 4XKCA 2ZXWE 4TUUA 5JJTA 4HNAD 3TG5A 3NF1A 3V2OA 5CERB 3PNLB 2FBNA 1OCOE 4BSZB 2WXNA 4DX1A 4L23A 3UPVA 5ENSD 4PDXA 2I2OA 3UINC 4AIFA 4AJWA 2IONA 4APOA 3JXJA 5T4YA 5EN5D 3V30A 4CDRA 5DIZA 4WNEA 1X81A 5HRYA 2E2EA 5AENA 1MZCA 4FADA 3P2BA 4ATZD 2H6FA 4W9RA 1OY3D 2YHEA 2NXPA 4ME2A 2PQNA 2V8SE 3ZFWA 2RKKA 3TWSA 4GYWA 4KZ0A 3E33A 5A7DB 4GA1A 3KS2A 2OVFA 5ITZF 3O4ZA 5EYLA 3TWXA 4HVBA 3FWVA 5CRUA 2P2CP 3JQ0A 4WNFA 3CSFA 4NIKA 4A55A 3L82A 3SGHA 3Q4AB 4H7XA 4Y6WA 3JYSA 2XPYA 3W9FA 2QYJA 2XGMA 4I43A 3PEVB 1S0PA 4Q94A 2FEZA 3UT4A 3MA5A 1BD8A 3NAWA 2XEVA 3AS8A 2CG3A 1E8ZA 1DCEA 5J08A 2L6JA 4U8VD 3UT7A 4ANXA 3QWWA 2A5EA 4KZCA 5KNGA 2YINA 4U04A 4BY6A 4L7TA 2C0LA 4AOFA 4XEIG 3SBTB 1TN8A 5G04C 1D9SA 3CK9A 2WXKA 5D0OD 3DSTA 4UWLA 2UY1A 3LXUX 2IU1A 2LXLA 2HM8A 3Q75A 1NP7A 5EILA 3TXNA 3HXBA 2BEDA 3JXIA 3L54A 4F1PA 3FUDA 5KCMA 1P5QA 2PM6A 3AJIA 5FT9A 4K03A 4A3TA 4X8QA 5BNWA 1E8YA 2Y1LE 4K5AB 1HFAA 1ZU2A 3CKBA 4AV7A 1EPUA 5HI7A 4J8YA 1S70B 4GZ3A 2PL2A 3JUEA 3B95A 3L13A 4HOSA 1Z3XA 2WXMA 2X6IA 4UQYA 4KXKB 3UM2A 4BTAA 3C72A 4BESA 4LCTA 4BT9A 3T5VA 2C2LA 4L2LA 4P29A 1D8EA 3CEQA 4GA0A 5A6CA 4RSYA 4LUNU 3MV3B 3T5XA 4JHKA 1UW4B 3FU3A 3MX3A 5AQAA 4BERA 3MZLB 4RG9A 2DZNA 2V4HC 2P9SG 3ASOE 4KT6B 5LCWC 4OAUC 4IULA 2WMNA 5ANRA 3CHOA 1H6KA 5CBOA 3EUVA 4G8KA 2IY0C 5EDSA 1FT1A 2I9CA 5T3RA 3TWRA 1KT0A 1FVHA 3BG1B 2B0OE 4EZKA 2R05A 5C1DA 2XENA 1TNUA 4AVXA 2VSNA 5EIDA 1XNFA 2IO3C 1OUVA 4N3BA 3J5PA 4AY6A 3G2UA 3FEYA 4C0MA 3DXKG 4ILGA 5ENNA 3DEOA 4YDWA 3FUIA 4AEZC 1JUQA 3APCA 2MYOA 1TYQG 2KZTB 4HLEA 3ML8A 1NZNA 3L16A 4TXPA 2FO7A 4GTTA 5G04J 2PQRA 4BEPA 3CVNA 3UX4A 4QFVA 5CCLA 4E85A 1H2VC 3D9KA 4YVOA 2Y4UA 3ZXSA 5BXUA 5LFAA 4BFRA 3APDA 3GYZA 4EHMA 4F3VA 4ACLA 2R03A 4PUCA 3LS8A 2L9BA 1WAO1 2XCCA 4FLBA 3R9AB 2OOEA 1NA0A 3VTYA 2CFUA 4CZ2D 4CGWA 4URKA 3FY4A 2LO6A 4F53A 5LOZA 5FZQA 3BUAA 2EINE 4HBDA 3G2TA 4HRMB 2VTBB 1GW6A 4G25A 2VYIA 3QKYA 4N5QA 4PS7A 4BX8A 3D3MA 5CMYA 5FJYA 3DRAA 3AG4E 3Q49B 4JHRA 4LNBA 2F8XK 3MYVA 3FU6A 4GTOA 4K0RA 2ETCA 3CK8A 4GZCA 2PM7A 3HIZA 3UIOC 3R9MA 3B7SA 3ZW3A 1HE8A 5LCWJ 2P9NG 3DSUA 2H6IA 4MBGA 3CVQA 3BG0B 4RG6A 4I9EA 4U0UA 4I2WA 2KCLA 3ESKA 5CRVA 3AG1E 3HDXA 4Q69A 3B7RL 5KJMA 2WXHA 1N54A 2L0TB 3LY7A 1JCQA 3BU8A 4PS8A 4GTPA 2AXUA 5LP0A 1OCRE 2C0MA 2F8YA 3NQPA 3CVLA 1YYHA 3ZU7B 2HYZA 2ILRA 4J6IA 4GMLA 1HG2A 4ACKA 4UI9C 2X6KA 1RW2A 1FT2A 3EDTB 5LX8A 1UOHA 2XHEA 2ZISA 4HOTA 4O60A 3V2XA 3AU5A 5BXOA 4HQDA 4DX2A 3DPYA 4I1OB 4A63B 2DZOA 4NACA 2GW1A 3NZUA 1N95A 3E37A 4J8FA 5CEDB 2YHCA 4UWKA 2GRQB 5KWDA 3LJNA 4BT8A 3CHSA 3ZUVB 3FUMA 3UQ3A 3SBSA 2BTDA 4ABNA 3ZXPA 4JEHA 3EHRA 4N5CA 3Q73A 3S7FA 4J0UA 2FF4A 1H2UA 2XPIA 3PE3A 5AARA 1SA4A 1IYGA 3IHVA 4LSZE 4EBAG 3EHNA 4EZJA 3R7QA 3ZEFA 2KZTA 4L1BA 3ZYKA 2J09A 5FTPA 4F6RD 1QQEA 3ABKE 1EDUA 3RJVA 1JWFA 3TWQA 3SY2A 4HOUA 1HO8A 3HHMA 5JMND 2NYJA 2GGFA 2DCPA 2L6BA 4CDNA 4I6JA 1HF8A 4GTRA 1EF1C 5BPPA 4BWRA 2WQHA 2EIJE 4ZHBA 1VDYA 2GRMA 3DEPA 2WXLA 1S64A 3GW4A 4KBQA 5B3SE 3MEKA 1SA5A 3B7TA 2Y0BG 1NFIE 4DUIA 2XPZA 2AWIA 3D9MA 3IXEA 3PZ2A 3C5RA 4Y6CA 1N9AA 3K9IA 3ZPJA 2EIME 2VTBA 3AS5A 4RQIA 3UM0A 2IEJA 2JEKA 2NC9A 2UWJG 3Q79A 1Z5SC 4N3AA 2KBXA 2Y69E 1Y8MA 3FULA 4K5BA 3LVRE 3NB2A 3U9WA 2XZDG 3Q5MA 4A1SA 3KEAA 2VGEA 2IFUA 1N4QA 2X6JA 4UI9J 2V5QC 3S7BA 3EJNA 1TN7A 5G55A 2BUGA 3BEEA 2GRLA 1OWOA 2I6HA 4M3OA 1OT8A 1FVFA 3LEWA 4HB5A 3CQGB 3QOUA 4FA6A 1AP7A 4GTVA 5AYWD 1DNPA 3MKRA 3ONLA 3B13A 4NQ0A 1MX2A 3B7BA 3QARA 4Q96A 1IKND 3SI5A 4LRZA 5FWQA 3D9OA 1SQMA 4B93B 4N2QA 3U64A 1Y6IA 3CHRA 4MLPA 1N52A 2CG2A 2ETBA 2XGOA 2J07A 1ELRA 3TWTA 3FFLA 3FTYA 3PDNA 4N3CA 4JA9A 3HVEB 1TNYA 2J9QA 3AU4A 3FH7A 3Q7FA 4YDYA 4ATGA 5CECB 3PZ3A 4LERA 2WXFA 1U3CA 2VSXE 3PVLA 4PS3A 2JLBA 3KD7A 2PNNA 3PH0C 1O1TA 4JZYA 3CV0A 3OXLA 2IJGX 2XCBA 3UXGA 3Q9UC 3ULQA 2X6FA 2WXJA 3TGOA 2HO1A 2ZGGA 1O1SA 2XGSA 5FQ7A 4OAVB 3TWWA 3UM3A 3EIQC 5CCMA 1Q2ZA 3CHMA 4OYSA 2RFAA 4XKBA 4TUMA 2XRZA 1TN6A 3Q15A 2A4ZA 1K8KG 2XEHA 4ANVA 2J4DA 1MQSA 3FDHA 4J8DA 2B6CA 3Q47B 1OWNA 4G24A 3ULEG 5G2NA 2IF4A 1DCQA 3ONKA 3UUXA 3I4GA 2YQ8A 3Q7AA 1E8WA 4GZDA 1V54E 5ENQD 5ARFA 4HRLA 2A5UA 5AJLA 1H0AA 4U0ZA 2KATA 3VLDA 2LUHA 4B94A 1W3BA 2E0IA 3ASNE 4ANUA 3FH5A 1TNBA 3ML9A 3ASFA 4CYMD 2Y3AA 3G2SA 3FTSA 4GZ6A 3RK6A 3U66A 5ENPD 3JCKC 4I9CA 5EKQD 3LKUA 3S2AA 3G2VA 4ANWA 2F0YA 1KT1A 4JHJA 3HXFA 4AP2A 2V0PA 2OEVA 3ZYLA 4IYPA 4DI3A 3ZNGA 2Y4TA 4LG6A 2XZTG 1BPOA 2P9IG 3RO3A 2WQ6A 1NA3A 5BV1A 3SFYA 3ZHEB 3ASHA 4TXRA 2MRIA 3E32A 1TJCA 5BT1A 1K3ZD 1WM5A 2R02A 3RIBA 5IY5E 3RRNB 4DK5A 1O1RA 2X6HA 3KSLA 3CGHA 1KPSB 1HH8A 3VTXA 3UIPC 3SHFA 2H6HA 1WY6A 1XGWA 4F7AA 3RSEG 1TNZA 3LYAA 3EIJA 4GTSA 4G23A 1UN9A 2HE0A 3SO8A 5CEAA 3EHMA 2LSVA 4K5CA 4UI9K 2AW6A 3RO2A 3LDZA 1E96B 2RFMA 5T8IA 5ENOD 2KXPC 1OWPA 5JJ7A 2I1JA 1QBQA 2CFZA 3D9IA 3SD5A 3SNXA 3C98A 4DRXE 5CMWA 2DWZA 1K1BA 1UG3A 3HVEA 3TXMA 4RLYA 5EX3A 4EQFA 3QDNA 3I4RB 4C9BB 3ULYA 3R7RA 3CK7A 4G8LA 2WXGA 4V3IA 3PZ4A 3APFA 3E4BA 4OVUA 3CVPA 2MOWA 1MX4A 1G3NB 5FZRA 4GCNA 4GA2A 3AG3E 1BI8B 3PRZA 3U3WA 3FTXA 4BX9A 5FZSA 2LXMA 3S7DA 2KM4A 3HG0D 5AQBA 4FHKA 3D9PA 3ZGQA 2HR2A 3CKCA 4J8SA 4ZFHA 4FJYA 2MHKA 1N0RA 3T9KA 1H19A 4B89A 3SFXA 5B1AE 3ZN3A 4OVVA 5FQ6A 3IEGA 1QNFA 2OV8A 1NI1A 1TNOA 1QYMA 3GZ2A 5HS0A 4ILIA 4B8AA 5HKPA 1JPLA 1JCSA 4WAFA 3PS6A 4MS6A 2ONDA 2XS1A 1A5EA 2VGXB 4IRUA 4BSXA 4UWHA 4EZLA 4JEUA 4DLOA 1OCCE 2P9KG 3AG2E 4FP7A 1ELKA 3UT8A 3UTMA 4I1MA 4GYOA 3OTNA 4U63A 1BI7B 2WXPA 3KSQA 3CVXA 4HRNA 1E7VA 2BKKB 3FUJA 3SF4A 3L22A 1V55E 2GRPB 5FINA 2XEEA 2ZU6B 3IV0A 5FQ4A 3W9GA 3NZSA 1N11A 3IKOB 5EIBE 1WG0A 1LD7A 3E34A 5EX0A 3ZYMA 4F1SA 4YVQC 3ZHEA 4NURA 4FC8A 3WG7E 1N4PA 4DJAA 1HG5A 1K1AA 3FUEA 4AM9A 4GPMA 1E7UA 3FTZA 4CGVA 3DSXA 1HS6A 5EYPF 3L08A 3UKRG 3GZSA 3VLEA 4FHJA 4BETA 3D9JA 2QY7A 3MV2B 1YA0A 3PNTB 3V79K 2FI7A 2WMOA 2FULA 2DIWA 3KEZA 1INZA 4I6EA 3CIAA 2XQ0A 3X2QE 4XI9A 4A3VA 5KJLA 2WXOA 3G2WA 4DX5D 3J5QB 4JD2G 4H7YA 3LY9A 4C0EA 4WUYA 2EQXA 5FIOA 3DWLG 1DVPA 5AQ7A 3DXMG 1KLXA 4U7EB 3T8MA 2J8SD 1SVXA 5KNHD 4JVSA 5AJDA 3RAUA 5D0QD 3GZ1A 1PAQA 3ABME 2WPVA 5JHAA 3MKQB 1L5JA 3FTUA 4CDMA 5G05C 2BF0X 1H2TC 3N71A 4UQXA 3NOGD 3O48A 2GRNB 2F37A 3C3OA 4A1GA 4GYYA 1N0QA 1OWLA 4UUCA 3FH8A 4B8CB 4NRHB 4YDEA 1N4RA 4BTBA 1UJKA 5KBAA 4XI0A 3KAEA 2R17C 4YNDA 4WWNA 4FLHA 4WNGA 2DYRE 1KZPA 5C2YA 4KMOA 1QZ2A 2VGXA 4E6HA 3IBEA 4HI8A 4MKTA 3ISMC 1ZB1A 5BUZA 3C3RA 3LPZA 2CHXA 4CEMA 2WM9A 4PH4B 3NBNB 4LNGA 3I3NA 3P1UA 5HQ8A 4TV3A 3SFZA 4TXQA 4WWOA 3T8KA 1ZBPA 1IHGA 4ILHB 5KJKA 1E90A 4CT4A 2J08A 4CRWA 3L6AA 3ASDA 2KC7A 3SQVA 2KCVA 3QAQA 1N94A 1PY1A 2V4LA 4R7LA 4B0ZA 3TWUA 4HLLA 3EU9A 2CHZA 1LF8A 4AXHA 3V31A 3ZKJA 3TJPA 2IO2C 5JA4D 4C48B 4RVBA 3CHPA 5AAOA 3ASGA 2M63A 3C3QA 1SW6A 4JL0A 2I1KA 1DC2A 3DSVA 3ABLE 3PE4A 3LCAA 3PZ1A 4WNDA 2WXIA 1OWMA 3FU5A 3PUKA 1U2VG 4N39A 3FP3A 3QWPA 3HXEA 2QYUA 2QFCA 3U4TA 3HXCA 3Q78A 4KYOB 2ZGDA 3UKUG 1JWGA 4LEUA 3FTWA 5ENRD 2Q7FA 4U8YD 2V5FA 1O5MA 3PREA 3CR3A 4EECA 2WB2A 3CQCB 5CBNA 3AAAC 5D66A 4G2VA 4GTMA 1IQUA 4GPKA 4EPZA 2OVBA 1KZOA 4N2SA 5ARGA 5G05J 5AQ9A 3TL5A 3LJ3A 4XE0A 1IXVA 3ZVVA 2GRRB 4M7CA 4KVMA 3EHQA 2WVIA 4Z68A 5DBKA 3RRMB 1JCRA 1E8XA 4EBAA 3EU5A 3F6QA 4WWPA 2VSOE 1UJJA 4HS2A 2QC9A 3CSTA 1H6OA 5CHEE 3AS4A 4GZ5A 3MJWA 4JW1A 2LAHA 1A17A 4XIFA 4G11A 5AN8A 3D9LA 2PZIA 4CT0A 2XRYA 2RG8A 3PUJA 2P9UG 1LTXA 2JABA 3MKQA 3OXFA 1B89A 3FTVA 3TWVA 3ENEA 2EILE 4FJZA 4I6GA 2CHWA 4U07A 3S7JA 2ETAA 1OXJA 2OEWA 4DX7D 2VSYA 4O6FA 4I2ZA 4D10C 3DPDA 5BV0A 3DBSA 1MX6A 1TJFA 1WDYA 3FEXA 5AIJA 5J90A 1SZAA 2AJAA 1HXIA 3D9NA 3QNKA 2R2LA 1IHBA 1HX8A 4DI4A 2VJ8A 4LNUD 3Q9NC 3RU0A 2IOLA 2WXRA 3MGBA 3CVVA 2P9PG 4J7WA 5JJ6A 4GMRA 3JUIA 4FULA 1PC2A 4FU3A 4DLQA 1AWCB 1OCZE 1MYOA 1X5BA 1SZ9A 4TRQA 3CVUA 3LVQE 4GTQA 4J8EA 1IQRA 1HU3A 2ZIRA 4MRUA 4UWFA 3JQ1A 2WQ7A 4GU5A 2DYSE 5E76A 1TEZA 3ZRHA 3CLJA 1Z6TA 4APFA 5KJNA 3L9TA 4G1TA 5FQ8A 5B1BE 4GMJA 5D2MC 2AXVA 1RZ4A 3PEUB 2IOSA 4O1PA 4JXTA 3UM1A 5JHBA 3URZA 1TR4A 3CVYA 3B7UX 3CVWA 2XS8A 3HYMB 4U96D 4L2YA 3D9HA 3FUFA 1YCSB 3TG4A 2R59A 4JA7A 3BQOA 3QC1A 4I17A 4G26A 3WXXA 2WXQA 3DSSA 3OAWA 3FUHA 2NSZA 1MJ0A 2DVWA 4JPSA 3ZIMA 4IN3B 1MHQA 2J49A 4HXIA 1FCHA 2P58C 2VQ2A 4AY5A 2OCCE 4GB9A 2EIKE 1H6PA 2AVPA 3QB2A 2GROB 1U3DA 4HI9A 4YDOA 2X38A 2LNIA 3QJZA 3PZDA 1ELWA 1BLXB 3IHYA 5BW8C 3QK0A 4L9PA 1N4SA 5ANLA 1S63A 2UY1B 4O1OA 1HZ4A 2AXZA 4GAAA 2LAIA 2BKGA 4XX5A 3SZ7A 4HFGA 2QZAA 2LSUA 5A23A 4XZ4A 1YMPA 4HORA 3HXDA 1FPPA 4CCAA 3CHQA 4HOQA 2H6GA 3QWVA 2FO1E 4DPRA
chains in the Genus database with same CATH topology
3ULEG 4XEIG 2P9NG 1U2VG 2P9UG 2P9KG 3DWLG 2P9PG 3DXKG 3UKUG 3UKRG 3RSEG 1K8KG 3DXMG 2P9SG 2P9IG 4JD2G 2P9LG 1TYQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULE G;  4XEI G;  2P9N G;  1U2V G;  2P9U G;  2P9K G;  3DWL G;  2P9P G;  3DXK G;  3UKU G;  3UKR G;  3RSE G;  1K8K G;  3DXM G;  2P9S G;  2P9I G;  4JD2 G;  2P9L G;  1TYQ G; 
#chains in the Genus database with same CATH topology
 3I5P A;  4I1A A;  1Z3Y A;  5E75 A;  2KCK A;  4JC8 A;  4UQZ A;  1D8D A;  2DBA A;  1UN8 A;  3FHE A;  3NOC D;  3FU0 A;  2R5S A;  3UMV A;  2RD0 A;  3FUN A;  4U8H A;  2P9L G;  3VLF A;  2VGY A;  1BU9 A;  2J4B A;  3L17 A;  4JB8 P;  3RKV A;  2L0I A;  4KVO A;  2IQC A;  4DX6 D;  3E30 A;  1EYH A;  3OXG A;  4UWG A;  3RRU A;  3ESL A;  3TAX A;  5M72 A;  3MCX A;  4GCO A;  1NL4 A;  3UI2 A;  3LY8 A;  5ENT D;  4QQI A;  5H7P A;  4U0S A;  1LD8 A;  3FUK A;  4U95 D;  3HRA A;  3ZYQ A;  2X3M A;  3DSW A;  2YNQ A;  4XKC A;  2ZXW E;  4TUU A;  5JJT A;  4HNA D;  3TG5 A;  3NF1 A;  3V2O A;  5CER B;  3PNL B;  2FBN A;  1OCO E;  4BSZ B;  2WXN A;  4DX1 A;  4L23 A;  3UPV A;  5ENS D;  4PDX A;  2I2O A;  3UIN C;  4AIF A;  4AJW A;  2ION A;  4APO A;  3JXJ A;  5T4Y A;  5EN5 D;  3V30 A;  4CDR A;  5DIZ A;  4WNE A;  1X81 A;  5HRY A;  2E2E A;  5AEN A;  1MZC A;  4FAD A;  3P2B A;  4ATZ D;  2H6F A;  4W9R A;  1OY3 D;  2YHE A;  2NXP A;  4ME2 A;  2PQN A;  2V8S E;  3ZFW A;  2RKK A;  3TWS A;  4GYW A;  4KZ0 A;  3E33 A;  5A7D B;  4GA1 A;  3KS2 A;  2OVF A;  5ITZ F;  3O4Z A;  5EYL A;  3TWX A;  4HVB A;  3FWV A;  5CRU A;  2P2C P;  3JQ0 A;  4WNF A;  3CSF A;  4NIK A;  4A55 A;  3L82 A;  3SGH A;  3Q4A B;  4H7X A;  4Y6W A;  3JYS A;  2XPY A;  3W9F A;  2QYJ A;  2XGM A;  4I43 A;  3PEV B;  1S0P A;  4Q94 A;  2FEZ A;  3UT4 A;  3MA5 A;  1BD8 A;  3NAW A;  2XEV A;  3AS8 A;  2CG3 A;  1E8Z A;  1DCE A;  5J08 A;  2L6J A;  4U8V D;  3UT7 A;  4ANX A;  3QWW A;  2A5E A;  4KZC A;  5KNG A;  2YIN A;  4U04 A;  4BY6 A;  4L7T A;  2C0L A;  4AOF A;  4XEI G;  3SBT B;  1TN8 A;  5G04 C;  1D9S A;  3CK9 A;  2WXK A;  5D0O D;  3DST A;  4UWL A;  2UY1 A;  3LXU X;  2IU1 A;  2LXL A;  2HM8 A;  3Q75 A;  1NP7 A;  5EIL A;  3TXN A;  3HXB A;  2BED A;  3JXI A;  3L54 A;  4F1P A;  3FUD A;  5KCM A;  1P5Q A;  2PM6 A;  3AJI A;  5FT9 A;  4K03 A;  4A3T A;  4X8Q A;  5BNW A;  1E8Y A;  2Y1L E;  4K5A B;  1HFA A;  1ZU2 A;  3CKB A;  4AV7 A;  1EPU A;  5HI7 A;  4J8Y A;  1S70 B;  4GZ3 A;  2PL2 A;  3JUE A;  3B95 A;  3L13 A;  4HOS A;  1Z3X A;  2WXM A;  2X6I A;  4UQY A;  4KXK B;  3UM2 A;  4BTA A;  3C72 A;  4BES A;  4LCT A;  4BT9 A;  3T5V A;  2C2L A;  4L2L A;  4P29 A;  1D8E A;  3CEQ A;  4GA0 A;  5A6C A;  4RSY A;  4LUN U;  3MV3 B;  3T5X A;  4JHK A;  1UW4 B;  3FU3 A;  3MX3 A;  5AQA A;  4BER A;  3MZL B;  4RG9 A;  2DZN A;  2V4H C;  2P9S G;  3ASO E;  4KT6 B;  5LCW C;  4OAU C;  4IUL A;  2WMN A;  5ANR A;  3CHO A;  1H6K A;  5CBO A;  3EUV A;  4G8K A;  2IY0 C;  5EDS A;  1FT1 A;  2I9C A;  5T3R A;  3TWR A;  1KT0 A;  1FVH A;  3BG1 B;  2B0O E;  4EZK A;  2R05 A;  5C1D A;  2XEN A;  1TNU A;  4AVX A;  2VSN A;  5EID A;  1XNF A;  2IO3 C;  1OUV A;  4N3B A;  3J5P A;  4AY6 A;  3G2U A;  3FEY A;  4C0M A;  3DXK G;  4ILG A;  5ENN A;  3DEO A;  4YDW A;  3FUI A;  4AEZ C;  1JUQ A;  3APC A;  2MYO A;  1TYQ G;  2KZT B;  4HLE A;  3ML8 A;  1NZN A;  3L16 A;  4TXP A;  2FO7 A;  4GTT A;  5G04 J;  2PQR A;  4BEP A;  3CVN A;  3UX4 A;  4QFV A;  5CCL A;  4E85 A;  1H2V C;  3D9K A;  4YVO A;  2Y4U A;  3ZXS A;  5BXU A;  5LFA A;  4BFR A;  3APD A;  3GYZ A;  4EHM A;  4F3V A;  4ACL A;  2R03 A;  4PUC A;  3LS8 A;  2L9B A;  1WAO 1;  2XCC A;  4FLB A;  3R9A B;  2OOE A;  1NA0 A;  3VTY A;  2CFU A;  4CZ2 D;  4CGW A;  4URK A;  3FY4 A;  2LO6 A;  4F53 A;  5LOZ A;  5FZQ A;  3BUA A;  2EIN E;  4HBD A;  3G2T A;  4HRM B;  2VTB B;  1GW6 A;  4G25 A;  2VYI A;  3QKY A;  4N5Q A;  4PS7 A;  4BX8 A;  3D3M A;  5CMY A;  5FJY A;  3DRA A;  3AG4 E;  3Q49 B;  4JHR A;  4LNB A;  2F8X K;  3MYV A;  3FU6 A;  4GTO A;  4K0R A;  2ETC A;  3CK8 A;  4GZC A;  2PM7 A;  3HIZ A;  3UIO C;  3R9M A;  3B7S A;  3ZW3 A;  1HE8 A;  5LCW J;  2P9N G;  3DSU A;  2H6I A;  4MBG A;  3CVQ A;  3BG0 B;  4RG6 A;  4I9E A;  4U0U A;  4I2W A;  2KCL A;  3ESK A;  5CRV A;  3AG1 E;  3HDX A;  4Q69 A;  3B7R L;  5KJM A;  2WXH A;  1N54 A;  2L0T B;  3LY7 A;  1JCQ A;  3BU8 A;  4PS8 A;  4GTP A;  2AXU A;  5LP0 A;  1OCR E;  2C0M A;  2F8Y A;  3NQP A;  3CVL A;  1YYH A;  3ZU7 B;  2HYZ A;  2ILR A;  4J6I A;  4GML A;  1HG2 A;  4ACK A;  4UI9 C;  2X6K A;  1RW2 A;  1FT2 A;  3EDT B;  5LX8 A;  1UOH A;  2XHE A;  2ZIS A;  4HOT A;  4O60 A;  3V2X A;  3AU5 A;  5BXO A;  4HQD A;  4DX2 A;  3DPY A;  4I1O B;  4A63 B;  2DZO A;  4NAC A;  2GW1 A;  3NZU A;  1N95 A;  3E37 A;  4J8F A;  5CED B;  2YHC A;  4UWK A;  2GRQ B;  5KWD A;  3LJN A;  4BT8 A;  3CHS A;  3ZUV B;  3FUM A;  3UQ3 A;  3SBS A;  2BTD A;  4ABN A;  3ZXP A;  4JEH A;  3EHR A;  4N5C A;  3Q73 A;  3S7F A;  4J0U A;  2FF4 A;  1H2U A;  2XPI A;  3PE3 A;  5AAR A;  1SA4 A;  1IYG A;  3IHV A;  4LSZ E;  4EBA G;  3EHN A;  4EZJ A;  3R7Q A;  3ZEF A;  2KZT A;  4L1B A;  3ZYK A;  2J09 A;  5FTP A;  4F6R D;  1QQE A;  3ABK E;  1EDU A;  3RJV A;  1JWF A;  3TWQ A;  3SY2 A;  4HOU A;  1HO8 A;  3HHM A;  5JMN D;  2NYJ A;  2GGF A;  2DCP A;  2L6B A;  4CDN A;  4I6J A;  1HF8 A;  4GTR A;  1EF1 C;  5BPP A;  4BWR A;  2WQH A;  2EIJ E;  4ZHB A;  1VDY A;  2GRM A;  3DEP A;  2WXL A;  1S64 A;  3GW4 A;  4KBQ A;  5B3S E;  3MEK A;  1SA5 A;  3B7T A;  2Y0B G;  1NFI E;  4DUI A;  2XPZ A;  2AWI A;  3D9M A;  3IXE A;  3PZ2 A;  3C5R A;  4Y6C A;  1N9A A;  3K9I A;  3ZPJ A;  2EIM E;  2VTB A;  3AS5 A;  4RQI A;  3UM0 A;  2IEJ A;  2JEK A;  2NC9 A;  2UWJ G;  3Q79 A;  1Z5S C;  4N3A A;  2KBX A;  2Y69 E;  1Y8M A;  3FUL A;  4K5B A;  3LVR E;  3NB2 A;  3U9W A;  2XZD G;  3Q5M A;  4A1S A;  3KEA A;  2VGE A;  2IFU A;  1N4Q A;  2X6J A;  4UI9 J;  2V5Q C;  3S7B A;  3EJN A;  1TN7 A;  5G55 A;  2BUG A;  3BEE A;  2GRL A;  1OWO A;  2I6H A;  4M3O A;  1OT8 A;  1FVF A;  3LEW A;  4HB5 A;  3CQG B;  3QOU A;  4FA6 A;  1AP7 A;  4GTV A;  5AYW D;  1DNP A;  3MKR A;  3ONL A;  3B13 A;  4NQ0 A;  1MX2 A;  3B7B A;  3QAR A;  4Q96 A;  1IKN D;  3SI5 A;  4LRZ A;  5FWQ A;  3D9O A;  1SQM A;  4B93 B;  4N2Q A;  3U64 A;  1Y6I A;  3CHR A;  4MLP A;  1N52 A;  2CG2 A;  2ETB A;  2XGO A;  2J07 A;  1ELR A;  3TWT A;  3FFL A;  3FTY A;  3PDN A;  4N3C A;  4JA9 A;  3HVE B;  1TNY A;  2J9Q A;  3AU4 A;  3FH7 A;  3Q7F A;  4YDY A;  4ATG A;  5CEC B;  3PZ3 A;  4LER A;  2WXF A;  1U3C A;  2VSX E;  3PVL A;  4PS3 A;  2JLB A;  3KD7 A;  2PNN A;  3PH0 C;  1O1T A;  4JZY A;  3CV0 A;  3OXL A;  2IJG X;  2XCB A;  3UXG A;  3Q9U C;  3ULQ A;  2X6F A;  2WXJ A;  3TGO A;  2HO1 A;  2ZGG A;  1O1S A;  2XGS A;  5FQ7 A;  4OAV B;  3TWW A;  3UM3 A;  3EIQ C;  5CCM A;  1Q2Z A;  3CHM A;  4OYS A;  2RFA A;  4XKB A;  4TUM A;  2XRZ A;  1TN6 A;  3Q15 A;  2A4Z A;  1K8K G;  2XEH A;  4ANV A;  2J4D A;  1MQS A;  3FDH A;  4J8D A;  2B6C A;  3Q47 B;  1OWN A;  4G24 A;  3ULE G;  5G2N A;  2IF4 A;  1DCQ A;  3ONK A;  3UUX A;  3I4G A;  2YQ8 A;  3Q7A A;  1E8W A;  4GZD A;  1V54 E;  5ENQ D;  5ARF A;  4HRL A;  2A5U A;  5AJL A;  1H0A A;  4U0Z A;  2KAT A;  3VLD A;  2LUH A;  4B94 A;  1W3B A;  2E0I A;  3ASN E;  4ANU A;  3FH5 A;  1TNB A;  3ML9 A;  3ASF A;  4CYM D;  2Y3A A;  3G2S A;  3FTS A;  4GZ6 A;  3RK6 A;  3U66 A;  5ENP D;  3JCK C;  4I9C A;  5EKQ D;  3LKU A;  3S2A A;  3G2V A;  4ANW A;  2F0Y A;  1KT1 A;  4JHJ A;  3HXF A;  4AP2 A;  2V0P A;  2OEV A;  3ZYL A;  4IYP A;  4DI3 A;  3ZNG A;  2Y4T A;  4LG6 A;  2XZT G;  1BPO A;  2P9I G;  3RO3 A;  2WQ6 A;  1NA3 A;  5BV1 A;  3SFY A;  3ZHE B;  3ASH A;  4TXR A;  2MRI A;  3E32 A;  1TJC A;  5BT1 A;  1K3Z D;  1WM5 A;  2R02 A;  3RIB A;  5IY5 E;  3RRN B;  4DK5 A;  1O1R A;  2X6H A;  3KSL A;  3CGH A;  1KPS B;  1HH8 A;  3VTX A;  3UIP C;  3SHF A;  2H6H A;  1WY6 A;  1XGW A;  4F7A A;  3RSE G;  1TNZ A;  3LYA A;  3EIJ A;  4GTS A;  4G23 A;  1UN9 A;  2HE0 A;  3SO8 A;  5CEA A;  3EHM A;  2LSV A;  4K5C A;  4UI9 K;  2AW6 A;  3RO2 A;  3LDZ A;  1E96 B;  2RFM A;  5T8I A;  5ENO D;  2KXP C;  1OWP A;  5JJ7 A;  2I1J A;  1QBQ A;  2CFZ A;  3D9I A;  3SD5 A;  3SNX A;  3C98 A;  4DRX E;  5CMW A;  2DWZ A;  1K1B A;  1UG3 A;  3HVE A;  3TXM A;  4RLY A;  5EX3 A;  4EQF A;  3QDN A;  3I4R B;  4C9B B;  3ULY A;  3R7R A;  3CK7 A;  4G8L A;  2WXG A;  4V3I A;  3PZ4 A;  3APF A;  3E4B A;  4OVU A;  3CVP A;  2MOW A;  1MX4 A;  1G3N B;  5FZR A;  4GCN A;  4GA2 A;  3AG3 E;  1BI8 B;  3PRZ A;  3U3W A;  3FTX A;  4BX9 A;  5FZS A;  2LXM A;  3S7D A;  2KM4 A;  3HG0 D;  5AQB A;  4FHK A;  3D9P A;  3ZGQ A;  2HR2 A;  3CKC A;  4J8S A;  4ZFH A;  4FJY A;  2MHK A;  1N0R A;  3T9K A;  1H19 A;  4B89 A;  3SFX A;  5B1A E;  3ZN3 A;  4OVV A;  5FQ6 A;  3IEG A;  1QNF A;  2OV8 A;  1NI1 A;  1TNO A;  1QYM A;  3GZ2 A;  5HS0 A;  4ILI A;  4B8A A;  5HKP A;  1JPL A;  1JCS A;  4WAF A;  3PS6 A;  4MS6 A;  2OND A;  2XS1 A;  1A5E A;  2VGX B;  4IRU A;  4BSX A;  4UWH A;  4EZL A;  4JEU A;  4DLO A;  1OCC E;  2P9K G;  3AG2 E;  4FP7 A;  1ELK A;  3UT8 A;  3UTM A;  4I1M A;  4GYO A;  3OTN A;  4U63 A;  1BI7 B;  2WXP A;  3KSQ A;  3CVX A;  4HRN A;  1E7V A;  2BKK B;  3FUJ A;  3SF4 A;  3L22 A;  1V55 E;  2GRP B;  5FIN A;  2XEE A;  2ZU6 B;  3IV0 A;  5FQ4 A;  3W9G A;  3NZS A;  1N11 A;  3IKO B;  5EIB E;  1WG0 A;  1LD7 A;  3E34 A;  5EX0 A;  3ZYM A;  4F1S A;  4YVQ C;  3ZHE A;  4NUR A;  4FC8 A;  3WG7 E;  1N4P A;  4DJA A;  1HG5 A;  1K1A A;  3FUE A;  4AM9 A;  4GPM A;  1E7U A;  3FTZ A;  4CGV A;  3DSX A;  1HS6 A;  5EYP F;  3L08 A;  3UKR G;  3GZS A;  3VLE A;  4FHJ A;  4BET A;  3D9J A;  2QY7 A;  3MV2 B;  1YA0 A;  3PNT B;  3V79 K;  2FI7 A;  2WMO A;  2FUL A;  2DIW A;  3KEZ A;  1INZ A;  4I6E A;  3CIA A;  2XQ0 A;  3X2Q E;  4XI9 A;  4A3V A;  5KJL A;  2WXO A;  3G2W A;  4DX5 D;  3J5Q B;  4JD2 G;  4H7Y A;  3LY9 A;  4C0E A;  4WUY A;  2EQX A;  5FIO A;  3DWL G;  1DVP A;  5AQ7 A;  3DXM G;  1KLX A;  4U7E B;  3T8M A;  2J8S D;  1SVX A;  5KNH D;  4JVS A;  5AJD A;  3RAU A;  5D0Q D;  3GZ1 A;  1PAQ A;  3ABM E;  2WPV A;  5JHA A;  3MKQ B;  1L5J A;  3FTU A;  4CDM A;  5G05 C;  2BF0 X;  1H2T C;  3N71 A;  4UQX A;  3NOG D;  3O48 A;  2GRN B;  2F37 A;  3C3O A;  4A1G A;  4GYY A;  1N0Q A;  1OWL A;  4UUC A;  3FH8 A;  4B8C B;  4NRH B;  4YDE A;  1N4R A;  4BTB A;  1UJK A;  5KBA A;  4XI0 A;  3KAE A;  2R17 C;  4YND A;  4WWN A;  4FLH A;  4WNG A;  2DYR E;  1KZP A;  5C2Y A;  4KMO A;  1QZ2 A;  2VGX A;  4E6H A;  3IBE A;  4HI8 A;  4MKT A;  3ISM C;  1ZB1 A;  5BUZ A;  3C3R A;  3LPZ A;  2CHX A;  4CEM A;  2WM9 A;  4PH4 B;  3NBN B;  4LNG A;  3I3N A;  3P1U A;  5HQ8 A;  4TV3 A;  3SFZ A;  4TXQ A;  4WWO A;  3T8K A;  1ZBP A;  1IHG A;  4ILH B;  5KJK A;  1E90 A;  4CT4 A;  2J08 A;  4CRW A;  3L6A A;  3ASD A;  2KC7 A;  3SQV A;  2KCV A;  3QAQ A;  1N94 A;  1PY1 A;  2V4L A;  4R7L A;  4B0Z A;  3TWU A;  4HLL A;  3EU9 A;  2CHZ A;  1LF8 A;  4AXH A;  3V31 A;  3ZKJ A;  3TJP A;  2IO2 C;  5JA4 D;  4C48 B;  4RVB A;  3CHP A;  5AAO A;  3ASG A;  2M63 A;  3C3Q A;  1SW6 A;  4JL0 A;  2I1K A;  1DC2 A;  3DSV A;  3ABL E;  3PE4 A;  3LCA A;  3PZ1 A;  4WND A;  2WXI A;  1OWM A;  3FU5 A;  3PUK A;  1U2V G;  4N39 A;  3FP3 A;  3QWP A;  3HXE A;  2QYU A;  2QFC A;  3U4T A;  3HXC A;  3Q78 A;  4KYO B;  2ZGD A;  3UKU G;  1JWG A;  4LEU A;  3FTW A;  5ENR D;  2Q7F A;  4U8Y D;  2V5F A;  1O5M A;  3PRE A;  3CR3 A;  4EEC A;  2WB2 A;  3CQC B;  5CBN A;  3AAA C;  5D66 A;  4G2V A;  4GTM A;  1IQU A;  4GPK A;  4EPZ A;  2OVB A;  1KZO A;  4N2S A;  5ARG A;  5G05 J;  5AQ9 A;  3TL5 A;  3LJ3 A;  4XE0 A;  1IXV A;  3ZVV A;  2GRR B;  4M7C A;  4KVM A;  3EHQ A;  2WVI A;  4Z68 A;  5DBK A;  3RRM B;  1JCR A;  1E8X A;  4EBA A;  3EU5 A;  3F6Q A;  4WWP A;  2VSO E;  1UJJ A;  4HS2 A;  2QC9 A;  3CST A;  1H6O A;  5CHE E;  3AS4 A;  4GZ5 A;  3MJW A;  4JW1 A;  2LAH A;  1A17 A;  4XIF A;  4G11 A;  5AN8 A;  3D9L A;  2PZI A;  4CT0 A;  2XRY A;  2RG8 A;  3PUJ A;  2P9U G;  1LTX A;  2JAB A;  3MKQ A;  3OXF A;  1B89 A;  3FTV A;  3TWV A;  3ENE A;  2EIL E;  4FJZ A;  4I6G A;  2CHW A;  4U07 A;  3S7J A;  2ETA A;  1OXJ A;  2OEW A;  4DX7 D;  2VSY A;  4O6F A;  4I2Z A;  4D10 C;  3DPD A;  5BV0 A;  3DBS A;  1MX6 A;  1TJF A;  1WDY A;  3FEX A;  5AIJ A;  5J90 A;  1SZA A;  2AJA A;  1HXI A;  3D9N A;  3QNK A;  2R2L A;  1IHB A;  1HX8 A;  4DI4 A;  2VJ8 A;  4LNU D;  3Q9N C;  3RU0 A;  2IOL A;  2WXR A;  3MGB A;  3CVV A;  2P9P G;  4J7W A;  5JJ6 A;  4GMR A;  3JUI A;  4FUL A;  1PC2 A;  4FU3 A;  4DLQ A;  1AWC B;  1OCZ E;  1MYO A;  1X5B A;  1SZ9 A;  4TRQ A;  3CVU A;  3LVQ E;  4GTQ A;  4J8E A;  1IQR A;  1HU3 A;  2ZIR A;  4MRU A;  4UWF A;  3JQ1 A;  2WQ7 A;  4GU5 A;  2DYS E;  5E76 A;  1TEZ A;  3ZRH A;  3CLJ A;  1Z6T A;  4APF A;  5KJN A;  3L9T A;  4G1T A;  5FQ8 A;  5B1B E;  4GMJ A;  5D2M C;  2AXV A;  1RZ4 A;  3PEU B;  2IOS A;  4O1P A;  4JXT A;  3UM1 A;  5JHB A;  3URZ A;  1TR4 A;  3CVY A;  3B7U X;  3CVW A;  2XS8 A;  3HYM B;  4U96 D;  4L2Y A;  3D9H A;  3FUF A;  1YCS B;  3TG4 A;  2R59 A;  4JA7 A;  3BQO A;  3QC1 A;  4I17 A;  4G26 A;  3WXX A;  2WXQ A;  3DSS A;  3OAW A;  3FUH A;  2NSZ A;  1MJ0 A;  2DVW A;  4JPS A;  3ZIM A;  4IN3 B;  1MHQ A;  2J49 A;  4HXI A;  1FCH A;  2P58 C;  2VQ2 A;  4AY5 A;  2OCC E;  4GB9 A;  2EIK E;  1H6P A;  2AVP A;  3QB2 A;  2GRO B;  1U3D A;  4HI9 A;  4YDO A;  2X38 A;  2LNI A;  3QJZ A;  3PZD A;  1ELW A;  1BLX B;  3IHY A;  5BW8 C;  3QK0 A;  4L9P A;  1N4S A;  5ANL A;  1S63 A;  2UY1 B;  4O1O A;  1HZ4 A;  2AXZ A;  4GAA A;  2LAI A;  2BKG A;  4XX5 A;  3SZ7 A;  4HFG A;  2QZA A;  2LSU A;  5A23 A;  4XZ4 A;  1YMP A;  4HOR A;  3HXD A;  1FPP A;  4CCA A;  3CHQ A;  4HOQ A;  2H6G A;  3QWV A;  2FO1 E;  4DPR A; 
#chains in the Genus database with same CATH homology
 3ULE G;  4XEI G;  2P9N G;  1U2V G;  2P9U G;  2P9K G;  3DWL G;  2P9P G;  3DXK G;  3UKU G;  3UKR G;  3RSE G;  1K8K G;  3DXM G;  2P9S G;  2P9I G;  4JD2 G;  2P9L G;  1TYQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...