4JD2G

Crystal structure of bos taurus arp2/3 complex binding with mus musculus gmf
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
139
Chain Sequence
ARFRKVDVGEYDENKFVDEEGDGGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regulation of Arp2/3 complex by GMF.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 38
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 4jd2G00
1U2VG 3DXMG 3ULEG 2P9NG 2P9LG 2P9IG 3RSEG 1K8KG 2P9SG 2P9KG 4XEIG 4JD2G 3UKUG 2P9PG 2P9UG 1TYQG 3DWLG 3UKRG 3DXKG
chains in the Genus database with same CATH superfamily
4I9EA 3LYAA 3O4ZA 3FUMA 2FBNA 2NC9A 2P9IG 2RKKA 1OCOE 4GA2A 3PZ2A 4E6HA 4YVQC 2BUGA 1NA3A 4TV3A 1O5MA 4GZ5A 2PM6A 3CV0A 2J9QA 4U8HA 3AS4A 5FT9A 3AJIA 3Q73A 3JXJA 5AJLA 4GMJA 3ZEFA 3L54A 2P9UG 4UI9K 1EYHA 3ZYKA 2VYIA 2X3MA 3UMVA 3UTMA 1JPLA 4GMLA 5T4YA 4J8SA 4DX2A 1HF8A 1OUVA 3UT4A 4V3IA 5DBKA 3DEOA 1DCQA 1MZCA 1BD8A 2AXVA 4J8EA 4CDMA 1UJKA 2ZISA 2PNNA 3DSTA 4WNGA 2VGYA 3Q4AB 2GW1A 3ENEA 3UPVA 1X81A 3NOCD 3LJNA 4AEZC 3C3QA 3D9PA 1K8KG 2HO1A 3CVPA 4KVMA 2GRNB 1OCRE 1V54E 5A7DB 4HRLA 2OEVA 3PVLA 4XIFA 2BEDA 4AY5A 4K03A 1TJFA 2VJ8A 3RJVA 3O48A 1TN6A 4X8QA 2IJGX 2BF0X 4LUNU 4I1OB 2VGXB 3FUFA 2ZGDA 1KLXA 3G2UA 5EYPF 2DBAA 3AU4A 3V2OA 4U95D 3ONLA 2KCLA 2IU1A 3VLEA 5D66A 4GTRA 5CHEE 2NXPA 1NZNA 4FU3A 2DCPA 3DSVA 1FPPA 1A17A 4EZJA 3X2QE 3D9IA 4XI0A 3UT8A 3ABKE 4HQDA 4TUMA 4L7TA 1DVPA 1HG5A 2WQ7A 1OXJA 1FVFA 2WM9A 4GU5A 3CKCA 4GTSA 1LD8A 4JXTA 1TNYA 2L0IA 3IEGA 2AJAA 4YDOA 4AVXA 2RFMA 5B1AE 5ANLA 2WQ6A 5KWDA 3FH8A 4F7AA 2XENA 2X6HA 3G2SA 4WWOA 2MHKA 4MLPA 2WXHA 1OCCE 3FU5A 4BTAA 2JABA 3ASDA 2IOSA 1X5BA 4ANXA 3C3OA 2R03A 3LS8A 5H7PA 3SNXA 3ZN3A 1BI7B 5LCWC 4NIKA 4BFRA 4L2YA 2AWIA 2WB2A 2YINA 2WXGA 2IO2C 2XEVA 3EIQC 3UKRG 4N3AA 2AVPA 2QC9A 2YHCA 3ZU7B 3ONKA 4HXIA 4HLEA 3QK0A 4DI4A 3GW4A 4XI9A 3NZUA 5HS0A 1TNBA 5G04C 5KJLA 2XEEA 5A23A 1HXIA 3FTYA 3SFZA 3UI2A 4BT8A 4FA6A 3ZYLA 1WDYA 1KT1A 2PQNA 3QDNA 4N3BA 3T8KA 3FEXA 1TNZA 1HO8A 3ULYA 2WVIA 4UQZA 3E30A 2PZIA 1SA4A 1IHGA 3OTNA 3FY4A 3D9KA 3ABLE 4IYPA 2LSUA 4HS2A 3FUNA 4K5BA 5CCLA 3UIPC 3ESLA 4DX7D 2P9LG 3PS6A 4I6EA 1YYHA 1MJ0A 3RRUA 4F3VA 2EQXA 4I1MA 1MX2A 5ENQD 4FULA 1U3CA 4JA7A 3ZUVB 4DLQA 4GCOA 3KSLA 3UXGA 1N4QA 5KJNA 1SW6A 2DZOA 4JL0A 4J8YA 4ABNA 1KZOA 4K5AB 1E90A 4GA1A 3DXKG 2KCVA 4GTVA 1WG0A 4W9RA 4AM9A 1A5EA 3CHOA 3ZRHA 3ZHEA 3E4BA 4OAVB 3AG1E 3DPDA 3ZXPA 3CSTA 3WXXA 4O1PA 4NRHB 2H6GA 3ZVVA 4KYOB 3TG5A 4BX8A 3ASHA 4CT4A 4QQIA 4AV7A 3MCXA 2I9CA 3L22A 4CEMA 3L08A 4GTQA 3RSEG 4UQYA 4TXRA 3MKRA 3PDNA 5M72A 5KNHD 3EU5A 3Q5MA 3TWWA 4ANWA 1OWNA 1OT8A 3L13A 4RVBA 5KJKA 2WXOA 3MJWA 2J07A 2V4LA 5KBAA 4JB8P 3IHYA 3MEKA 3NOGD 4GA0A 2C0MA 1KT0A 4ME2A 1FVHA 3TWSA 3JQ0A 3Q7AA 2R5SA 4I17A 3V31A 4ATGA 3FTSA 3OXFA 2X38A 3L6AA 3D9JA 3VLDA 3NAWA 1QYMA 4ANVA 4MRUA 1Z3XA 1S70B 2FO7A 5BNWA 2H6FA 1TR4A 2A5UA 3FEYA 4GPMA 4I9CA 4HOQA 3U4TA 3BU8A 1E8XA 3NF1A 3DEPA 4G26A 4TXPA 3FP3A 4BSZB 2QZAA 1VDYA 1TN8A 5A6CA 4CGWA 2EIME 4U04A 1Z6TA 3KSQA 3CVVA 4OYSA 4N2SA 4Y6CA 3K9IA 3T5VA 3QWVA 2QFCA 3MV2B 3BG0B 5FQ8A 4U07A 3RK6A 3C5RA 5CRUA 4CZ2D 4HB5A 1ELRA 4DPRA 1E96B 2XRZA 1IQRA 2VQ2A 3DSSA 5KJMA 5JJ6A 4BTBA 3FUHA 1EF1C 2L6BA 1H19A 4TXQA 3P2BA 3HYMB 2J4BA 3L82A 4KVOA 4OVUA 3HVEB 3AU5A 4CDNA 2NYJA 4HVBA 4DK5A 3W9FA 4LG6A 4PUCA 4FJZA 4UQXA 4GPKA 5JA4D 4G1TA 3UM0A 5KCMA 2IEJA 3FUDA 4OVVA 3VTYA 3MX3A 4CYMD 3B7BA 3CQCB 2BKGA 5JJTA 3N71A 1SQMA 2XHEA 1MX4A 3PZDA 4A3TA 1UN8A 4YDYA 3Q9NC 4BEPA 3CHMA 2B0OE 5JHBA 1Z3YA 4B94A 5EILA 4C48B 2J4DA 3GZSA 4L9PA 3I4RB 2ILRA 3CHSA 4H7XA 2KC7A 3F6QA 4QFVA 2WXJA 4U96D 4U0UA 1H0AA 3LVRE 3NB2A 1N11A 3SF4A 1H2TC 3JUEA 3CVNA 2WMNA 3R7QA 3HXBA 1IXVA 3CLJA 4XX5A 3Q78A 2XCCA 2P2CP 5LOZA 3LJ3A 5HI7A 1N94A 5HQ8A 3PNTB 3ULQA 3CK9A 1P5QA 3LCAA 5CMWA 2CFZA 3CVLA 3ZHEB 2R02A 3CQGB 4D10C 1S64A 2OV8A 5BUZA 5G05C 3QB2A 4UWLA 4CCAA 4ACLA 3JQ1A 1EPUA 3APFA 3DSXA 4WNDA 3RIBA 1BPOA 4ZFHA 3J5PA 3C3RA 3FTVA 4P29A 5ARFA 4GZ6A 4IULA 3TXNA 2IO3C 4RQIA 2L6JA 2MRIA 2XGSA 2Y4TA 1RZ4A 1SA5A 2XGMA 4K5CA 1HZ4A 4A1SA 4GZCA 4FHJA 2EIJE 4ACKA 3OAWA 4RG9A 3DSWA 2LAHA 3DWLG 2KCKA 2GRLA 4FP7A 3T9KA 3RKVA 1IHBA 2R05A 3QARA 1H2UA 4NACA 3APCA 1QQEA 5C2YA 4Q94A 3EJNA 3FULA 3JCKC 1GW6A 2ETCA 2DYSE 3HXCA 3UQ3A 3PEUB 3HXEA 3SY2A 5AJDA 3Q49B 3TWRA 3SHFA 4UI9C 3QWWA 4MBGA 4G11A 2IONA 3MKQB 2FEZA 1E7VA 4BT9A 4AJWA 3B13A 4JA9A 2WXIA 3LVQE 2CHZA 2LNIA 2LUHA 2MOWA 3JXIA 5AAOA 2P9PG 5ENPD 1INZA 3V79K 4B93B 3TL5A 2BTDA 4N39A 5ENTD 4L23A 3HG0D 1UW4B 1TNOA 2UY1B 1V55E 1TNUA 3EHRA 2GRQB 3GYZA 3BQOA 3ASGA 4HI8A 4ZHBA 5FWQA 5B3SE 4FHKA 3RO2A 3NBNB 3FU6A 3SFXA 4A63B 2EILE 5BPPA 3KAEA 2HYZA 4GYYA 4Z68A 4PH4B 1W3BA 4WWPA 3HRAA 4JC8A 3QWPA 3S7BA 3PE4A 1JCQA 2F8XK 4B89A 5EX0A 3L17A 2A4ZA 2VSYA 3ZKJA 4JEUA 2VTBA 5FQ6A 3EHNA 5G55A 2WXLA 1MHQA 3AS8A 3PE3A 1HG2A 4BERA 3FHEA 3E37A 1JCRA 3D9NA 1N4RA 4JEHA 1JWGA 4BETA 2C0LA 4GZ3A 3B95A 3J5QB 3CVXA 3E33A 4RSYA 2FO1E 2KBXA 1N4SA 3UT7A 1E8ZA 4TUUA 2EINE 3FUIA 3T8MA 4EBAA 5CBOA 3G2TA 3B7SA 4YDEA 3PEVB 3SQVA 3ZNGA 4J8FA 4BESA 2C2LA 1DNPA 4GMRA 4U0SA 2EIKE 1UG3A 4XZ4A 4HOUA 1TEZA 1NFIE 3PH0C 4URKA 4GYWA 1Y8MA 3PZ3A 1JCSA 5ITZF 3CHRA 3UKUG 1PAQA 3NQPA 2WMOA 3EDTB 3NZSA 5EIBE 3Q75A 4HNAD 4U63A 1N95A 4LNUD 3RAUA 2IFUA 5CMYA 1D9SA 3D9MA 3SI5A 1ZU2A 2ETAA 4J0UA 2F8YA 4JHRA 5BV0A 4I6GA 3QC1A 3FUJA 2F37A 4I6JA 4UWFA 4N5QA 4PDXA 2QYUA 3UM2A 1IYGA 1O1RA 4PS7A 2ONDA 4IRUA 3I3NA 2V4HC 1PY1A 4Q69A 4CDRA 2E0IA 3EHMA 1N52A 2FI7A 4I2WA 2GROB 2HM8A 4GZDA 5EDSA 2IF4A 1OCZE 3SBSA 2P9NG 5AIJA 2FF4A 4YDWA 3D9OA 4B0ZA 2ETBA 4YVOA 4JZYA 3VTXA 3U3WA 2XQ0A 3IV0A 3QKYA 4DX1A 3HXDA 1HX8A 2GRPB 3Q47B 4Y6WA 5CRVA 3ZPJA 1TN7A 3GZ2A 2L9BA 4O1OA 4AXHA 4NURA 4LEUA 3T5XA 2J8SD 3U9WA 2Y69E 3IKOB 1DC2A 3QNKA 2X6KA 3FH7A 5D0QD 1XNFA 1ELWA 3ASNE 1OWMA 1YCSB 5AQBA 1N4PA 4WUYA 3CVUA 1YMPA 3HXFA 4F1PA 4AIFA 2PL2A 3ZYQA 3RU0A 3RRMB 4E85A 4HFGA 3FTWA 3P1UA 4FADA 4JW1A 5T8IA 5DIZA 3SGHA 2KXPC 3SD5A 4HLLA 2WXKA 3G2VA 3FU0A 3FUEA 4LSZE 5ENRD 3FTXA 1N0QA 4OAUC 1OWPA 4WAFA 3APDA 1SZ9A 4ILGA 4BWRA 2M63A 1NA0A 5EIDA 3UM3A 5J90A 4Q96A 1KPSB 2XZDG 3S7FA 1E8YA 3FTUA 4HBDA 4B8AA 5AYWD 4G25A 4UUCA 5FINA 2HR2A 2E2EA 3Q15A 3S7DA 1WAO1 5FZSA 4U8YD 2JEKA 2DWZA 2WXNA 3G2WA 3OXLA 3FFLA 5BT1A 3AS5A 1HS6A 2YNQA 5CEDB 2RD0A 3E34A 3I5PA 1HH8A 1PC2A 1N9AA 4EHMA 3B7RL 3SFYA 2OVFA 1QZ2A 2WXMA 1U2VG 2LSVA 1OWLA 3CVQA 4EBAG 4G8KA 5BV1A 5G04J 3LPZA 4ANUA 3AG4E 4GCNA 2GRMA 5ENNA 2XGOA 3R9MA 4HOTA 1KZPA 2VSNA 2F0YA 2XCBA 2Y3AA 2ZGGA 4I2ZA 2P9KG 4L1BA 5FQ4A 2B6CA 3JYSA 4JVSA 3LKUA 5BW8C 4C0MA 4I43A 2Y4UA 2Q7FA 4ILHB 5ENSD 1JUQA 4DLOA 5E76A 1WM5A 3FTZA 3SBTB 4MKTA 3IXEA 2WQHA 1HE8A 3DRAA 5KNGA 5J08A 1FCHA 2AXUA 1U3DA 3IBEA 1ZBPA 1RW2A 4G8LA 3TWVA 3QOUA 2X6FA 2WXFA 2V8SE 2V5FA 4DX5D 2KZTB 3ASFA 4CT0A 3SO8A 3C72A 2X6JA 1DCEA 2FULA 2ZU6B 3S7JA 4WNFA 4RG6A 2VTBB 3BEEA 2DIWA 2R2LA 2CFUA 2WXQA 2XPZA 2WXRA 3DSUA 1S63A 5LX8A 2Y0BG 3W9GA 4N2QA 5AQAA 1QNFA 1QBQA 2R17C 2LO6A 5BXUA 2UY1A 4O6FA 3MYVA 4JHJA 5T3RA 4F53A 4APFA 1H6OA 2LXLA 1D8DA 2AXZA 2H6HA 3DBSA 3ASOE 5AARA 1JWFA 4U7EB 2CG3A 3UUXA 2WXPA 5LFAA 1Q2ZA 1HU3A 4C9BB 2KM4A 2LXMA 4JHKA 3UIOC 1Z5SC 3CK8A 1TYQG 2QY7A 3HDXA 4GTMA 3CSFA 3Q79A 3ZFWA 4ATZD 1OY3D 4XE0A 4MS6A 5FIOA 3Q7FA 1O1TA 1S0PA 1H2VC 4LNBA 2LAIA 2NSZA 1SZAA 2I1KA 4UWHA 1WY6A 3L9TA 5ARGA 4EPZA 2ZXWE 5EKQD 3B7UX 1N54A 1BU9A 3MKQA 2VSOE 1FT1A 2J08A 1IQUA 2CHXA 3FH5A 1AP7A 1LD7A 5ANRA 2DZNA 5FZQA 3EU9A 3AG2E 2DVWA 3TJPA 4FJYA 4G23A 1IKND 3HIZA 3EIJA 3BG1B 3RRNB 1E8WA 5FQ7A 3CIAA 4EQFA 3FUKA 5HKPA 3RO3A 1AWCB 3ESKA 4GTOA 1B89A 3ZIMA 2UWJG 1HFAA 3WG7E 3LY9A 3R9AB 4B8CB 4K0RA 5B1BE 4CRWA 4HI9A 2YQ8A 4HRNA 1LF8A 3DPYA 3OXGA 4WNEA 3UX4A 4A55A 3PUKA 2CG2A 4N5CA 4AOFA 4GB9A 2RG8A 2XS8A 1LTXA 4CGVA 4H7YA 4J7WA 3ULEG 4APOA 2QYJA 2KATA 2L0TB 2KZTA 3I4GA 3V2XA 4C0EA 2OCCE 3TWTA 1H6KA 3LY7A 3PREA 2P9SG 2R59A 4EZKA 2VGXA 1MX6A 5D2MC 2XS1A 3CVWA 2IQCA 4HOSA 2I6HA 3CEQA 1BI8B 3MZLB 3CK7A 4M7CA 1H6PA 4HRMB 2XPYA 3LEWA 1K1BA 2J09A 1YA0A 3LXUX 3SZ7A 5HRYA 5CECB 3ZYMA 2YHEA 1BLXB 4XKCA 2CHWA 1MQSA 4XEIG 2RFAA 3QAQA 4DJAA 3TWXA 5FJYA 5IY5E 3PRZA 3MV3B 2X6IA 3C98A 3BUAA 3HHMA 2OEWA 4GTPA 1UJJA 5FTPA 1ELKA 4AY6A 3EHQA 4AP2A 2BKKB 4BY6A 3FU3A 1K1AA 1G3NB 2I1JA 5AN8A 5FZRA 4DUIA 3Q9UC 2PQRA 2HE0A 1L5JA 2J49A 3IHVA 5CBNA 5G2NA 3CHPA 3LDZA 4M3OA 3CVYA 5JHAA 3E32A 5JMND 3HVEA 3ML9A 2GRRB 2ZIRA 1MYOA 5G05J 3ML8A 4F1SA 4ILIA 3DXMG 2XZTG 4JD2G 1NP7A 2A5EA 2JLBA 4LRZA 1OWOA 2AW6A 1NI1A 4N3CA 3L16A 2IY0C 3PNLB 3TXMA 4KZCA 2WPVA 2XPIA 5BXOA 3D9HA 5AENA 4UWGA 3D3MA 3ZGQA 3U66A 1EDUA 4NQ0A 4G2VA 1TJCA 3ISMC 2Y1LE 5LP0A 2IOLA 4RLYA 1O1SA 4HORA 2GGFA 5CERB 4DRXE 3LY8A 3FWVA 4GTTA 5D0OD 2PM7A 1UN9A 2OOEA 3ZXSA 4FC8A 4YNDA 4U8VD 3TWUA 4DX6D 2DYRE 2VGEA 5E75A 2MYOA 4KT6B 2I2OA 2OVBA 1SVXA 3B7TA 5EYLA 4J8DA 3ABME 3V30A 3KEAA 3U64A 3TWQA 3URZA 3JUIA 4U0ZA 3TAXA 2XEHA 4A1GA 1UOHA 4FLHA 2P58C 3PZ1A 1ZB1A 5JJ7A 4PS8A 4WWNA 4DI3A 3EUVA 3S2AA 3TG4A 3UM1A 5CCMA 4J6IA 4KXKB 1D8EA 4IN3B 2V5QC 4UI9J 3KS2A 3QJZA 4XKBA 3R7RA 4A3VA 4KMOA 4UWKA 2XRYA 4L2LA 1FT2A 4PS3A 1K3ZD 3TGOA 3PUJA 3ZW3A 1E7UA 3MA5A 5ENOD 4GYOA 3D9LA 2V0PA 2H6IA 4LERA 4LNGA 5C1DA 3GZ1A 4TRQA 4I1AA 3CR3A 3KEZA 3CHQA 2VSXE 4EZLA 4BSXA 5AQ9A 3CGHA 4KBQA 5CEAA 3PZ4A 5EN5D 4R7LA 4FLBA 3AG3E 4BX9A 1NL4A 5LCWJ 5EX3A 3FDHA 3CKBA 3MGBA 1N0RA 4F6RD 1Y6IA 4O60A 3VLFA 1XGWA 5AQ7A 4JPSA 3KD7A 3AAAC 4G24A 4KZ0A 4GAAA 3UINC 4EECA 4LCTA
chains in the Genus database with same CATH topology
1U2VG 3DXMG 3ULEG 2P9NG 2P9LG 2P9IG 3RSEG 1K8KG 2P9SG 2P9KG 4XEIG 4JD2G 3UKUG 2P9PG 2P9UG 1TYQG 3DWLG 3UKRG 3DXKG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U2V G;  3DXM G;  3ULE G;  2P9N G;  2P9L G;  2P9I G;  3RSE G;  1K8K G;  2P9S G;  2P9K G;  4XEI G;  4JD2 G;  3UKU G;  2P9P G;  2P9U G;  1TYQ G;  3DWL G;  3UKR G;  3DXK G; 
#chains in the Genus database with same CATH topology
 4I9E A;  3LYA A;  3O4Z A;  3FUM A;  2FBN A;  2NC9 A;  2P9I G;  2RKK A;  1OCO E;  4GA2 A;  3PZ2 A;  4E6H A;  4YVQ C;  2BUG A;  1NA3 A;  4TV3 A;  1O5M A;  4GZ5 A;  2PM6 A;  3CV0 A;  2J9Q A;  4U8H A;  3AS4 A;  5FT9 A;  3AJI A;  3Q73 A;  3JXJ A;  5AJL A;  4GMJ A;  3ZEF A;  3L54 A;  2P9U G;  4UI9 K;  1EYH A;  3ZYK A;  2VYI A;  2X3M A;  3UMV A;  3UTM A;  1JPL A;  4GML A;  5T4Y A;  4J8S A;  4DX2 A;  1HF8 A;  1OUV A;  3UT4 A;  4V3I A;  5DBK A;  3DEO A;  1DCQ A;  1MZC A;  1BD8 A;  2AXV A;  4J8E A;  4CDM A;  1UJK A;  2ZIS A;  2PNN A;  3DST A;  4WNG A;  2VGY A;  3Q4A B;  2GW1 A;  3ENE A;  3UPV A;  1X81 A;  3NOC D;  3LJN A;  4AEZ C;  3C3Q A;  3D9P A;  1K8K G;  2HO1 A;  3CVP A;  4KVM A;  2GRN B;  1OCR E;  1V54 E;  5A7D B;  4HRL A;  2OEV A;  3PVL A;  4XIF A;  2BED A;  4AY5 A;  4K03 A;  1TJF A;  2VJ8 A;  3RJV A;  3O48 A;  1TN6 A;  4X8Q A;  2IJG X;  2BF0 X;  4LUN U;  4I1O B;  2VGX B;  3FUF A;  2ZGD A;  1KLX A;  3G2U A;  5EYP F;  2DBA A;  3AU4 A;  3V2O A;  4U95 D;  3ONL A;  2KCL A;  2IU1 A;  3VLE A;  5D66 A;  4GTR A;  5CHE E;  2NXP A;  1NZN A;  4FU3 A;  2DCP A;  3DSV A;  1FPP A;  1A17 A;  4EZJ A;  3X2Q E;  3D9I A;  4XI0 A;  3UT8 A;  3ABK E;  4HQD A;  4TUM A;  4L7T A;  1DVP A;  1HG5 A;  2WQ7 A;  1OXJ A;  1FVF A;  2WM9 A;  4GU5 A;  3CKC A;  4GTS A;  1LD8 A;  4JXT A;  1TNY A;  2L0I A;  3IEG A;  2AJA A;  4YDO A;  4AVX A;  2RFM A;  5B1A E;  5ANL A;  2WQ6 A;  5KWD A;  3FH8 A;  4F7A A;  2XEN A;  2X6H A;  3G2S A;  4WWO A;  2MHK A;  4MLP A;  2WXH A;  1OCC E;  3FU5 A;  4BTA A;  2JAB A;  3ASD A;  2IOS A;  1X5B A;  4ANX A;  3C3O A;  2R03 A;  3LS8 A;  5H7P A;  3SNX A;  3ZN3 A;  1BI7 B;  5LCW C;  4NIK A;  4BFR A;  4L2Y A;  2AWI A;  2WB2 A;  2YIN A;  2WXG A;  2IO2 C;  2XEV A;  3EIQ C;  3UKR G;  4N3A A;  2AVP A;  2QC9 A;  2YHC A;  3ZU7 B;  3ONK A;  4HXI A;  4HLE A;  3QK0 A;  4DI4 A;  3GW4 A;  4XI9 A;  3NZU A;  5HS0 A;  1TNB A;  5G04 C;  5KJL A;  2XEE A;  5A23 A;  1HXI A;  3FTY A;  3SFZ A;  3UI2 A;  4BT8 A;  4FA6 A;  3ZYL A;  1WDY A;  1KT1 A;  2PQN A;  3QDN A;  4N3B A;  3T8K A;  3FEX A;  1TNZ A;  1HO8 A;  3ULY A;  2WVI A;  4UQZ A;  3E30 A;  2PZI A;  1SA4 A;  1IHG A;  3OTN A;  3FY4 A;  3D9K A;  3ABL E;  4IYP A;  2LSU A;  4HS2 A;  3FUN A;  4K5B A;  5CCL A;  3UIP C;  3ESL A;  4DX7 D;  2P9L G;  3PS6 A;  4I6E A;  1YYH A;  1MJ0 A;  3RRU A;  4F3V A;  2EQX A;  4I1M A;  1MX2 A;  5ENQ D;  4FUL A;  1U3C A;  4JA7 A;  3ZUV B;  4DLQ A;  4GCO A;  3KSL A;  3UXG A;  1N4Q A;  5KJN A;  1SW6 A;  2DZO A;  4JL0 A;  4J8Y A;  4ABN A;  1KZO A;  4K5A B;  1E90 A;  4GA1 A;  3DXK G;  2KCV A;  4GTV A;  1WG0 A;  4W9R A;  4AM9 A;  1A5E A;  3CHO A;  3ZRH A;  3ZHE A;  3E4B A;  4OAV B;  3AG1 E;  3DPD A;  3ZXP A;  3CST A;  3WXX A;  4O1P A;  4NRH B;  2H6G A;  3ZVV A;  4KYO B;  3TG5 A;  4BX8 A;  3ASH A;  4CT4 A;  4QQI A;  4AV7 A;  3MCX A;  2I9C A;  3L22 A;  4CEM A;  3L08 A;  4GTQ A;  3RSE G;  4UQY A;  4TXR A;  3MKR A;  3PDN A;  5M72 A;  5KNH D;  3EU5 A;  3Q5M A;  3TWW A;  4ANW A;  1OWN A;  1OT8 A;  3L13 A;  4RVB A;  5KJK A;  2WXO A;  3MJW A;  2J07 A;  2V4L A;  5KBA A;  4JB8 P;  3IHY A;  3MEK A;  3NOG D;  4GA0 A;  2C0M A;  1KT0 A;  4ME2 A;  1FVH A;  3TWS A;  3JQ0 A;  3Q7A A;  2R5S A;  4I17 A;  3V31 A;  4ATG A;  3FTS A;  3OXF A;  2X38 A;  3L6A A;  3D9J A;  3VLD A;  3NAW A;  1QYM A;  4ANV A;  4MRU A;  1Z3X A;  1S70 B;  2FO7 A;  5BNW A;  2H6F A;  1TR4 A;  2A5U A;  3FEY A;  4GPM A;  4I9C A;  4HOQ A;  3U4T A;  3BU8 A;  1E8X A;  3NF1 A;  3DEP A;  4G26 A;  4TXP A;  3FP3 A;  4BSZ B;  2QZA A;  1VDY A;  1TN8 A;  5A6C A;  4CGW A;  2EIM E;  4U04 A;  1Z6T A;  3KSQ A;  3CVV A;  4OYS A;  4N2S A;  4Y6C A;  3K9I A;  3T5V A;  3QWV A;  2QFC A;  3MV2 B;  3BG0 B;  5FQ8 A;  4U07 A;  3RK6 A;  3C5R A;  5CRU A;  4CZ2 D;  4HB5 A;  1ELR A;  4DPR A;  1E96 B;  2XRZ A;  1IQR A;  2VQ2 A;  3DSS A;  5KJM A;  5JJ6 A;  4BTB A;  3FUH A;  1EF1 C;  2L6B A;  1H19 A;  4TXQ A;  3P2B A;  3HYM B;  2J4B A;  3L82 A;  4KVO A;  4OVU A;  3HVE B;  3AU5 A;  4CDN A;  2NYJ A;  4HVB A;  4DK5 A;  3W9F A;  4LG6 A;  4PUC A;  4FJZ A;  4UQX A;  4GPK A;  5JA4 D;  4G1T A;  3UM0 A;  5KCM A;  2IEJ A;  3FUD A;  4OVV A;  3VTY A;  3MX3 A;  4CYM D;  3B7B A;  3CQC B;  2BKG A;  5JJT A;  3N71 A;  1SQM A;  2XHE A;  1MX4 A;  3PZD A;  4A3T A;  1UN8 A;  4YDY A;  3Q9N C;  4BEP A;  3CHM A;  2B0O E;  5JHB A;  1Z3Y A;  4B94 A;  5EIL A;  4C48 B;  2J4D A;  3GZS A;  4L9P A;  3I4R B;  2ILR A;  3CHS A;  4H7X A;  2KC7 A;  3F6Q A;  4QFV A;  2WXJ A;  4U96 D;  4U0U A;  1H0A A;  3LVR E;  3NB2 A;  1N11 A;  3SF4 A;  1H2T C;  3JUE A;  3CVN A;  2WMN A;  3R7Q A;  3HXB A;  1IXV A;  3CLJ A;  4XX5 A;  3Q78 A;  2XCC A;  2P2C P;  5LOZ A;  3LJ3 A;  5HI7 A;  1N94 A;  5HQ8 A;  3PNT B;  3ULQ A;  3CK9 A;  1P5Q A;  3LCA A;  5CMW A;  2CFZ A;  3CVL A;  3ZHE B;  2R02 A;  3CQG B;  4D10 C;  1S64 A;  2OV8 A;  5BUZ A;  5G05 C;  3QB2 A;  4UWL A;  4CCA A;  4ACL A;  3JQ1 A;  1EPU A;  3APF A;  3DSX A;  4WND A;  3RIB A;  1BPO A;  4ZFH A;  3J5P A;  3C3R A;  3FTV A;  4P29 A;  5ARF A;  4GZ6 A;  4IUL A;  3TXN A;  2IO3 C;  4RQI A;  2L6J A;  2MRI A;  2XGS A;  2Y4T A;  1RZ4 A;  1SA5 A;  2XGM A;  4K5C A;  1HZ4 A;  4A1S A;  4GZC A;  4FHJ A;  2EIJ E;  4ACK A;  3OAW A;  4RG9 A;  3DSW A;  2LAH A;  3DWL G;  2KCK A;  2GRL A;  4FP7 A;  3T9K A;  3RKV A;  1IHB A;  2R05 A;  3QAR A;  1H2U A;  4NAC A;  3APC A;  1QQE A;  5C2Y A;  4Q94 A;  3EJN A;  3FUL A;  3JCK C;  1GW6 A;  2ETC A;  2DYS E;  3HXC A;  3UQ3 A;  3PEU B;  3HXE A;  3SY2 A;  5AJD A;  3Q49 B;  3TWR A;  3SHF A;  4UI9 C;  3QWW A;  4MBG A;  4G11 A;  2ION A;  3MKQ B;  2FEZ A;  1E7V A;  4BT9 A;  4AJW A;  3B13 A;  4JA9 A;  2WXI A;  3LVQ E;  2CHZ A;  2LNI A;  2LUH A;  2MOW A;  3JXI A;  5AAO A;  2P9P G;  5ENP D;  1INZ A;  3V79 K;  4B93 B;  3TL5 A;  2BTD A;  4N39 A;  5ENT D;  4L23 A;  3HG0 D;  1UW4 B;  1TNO A;  2UY1 B;  1V55 E;  1TNU A;  3EHR A;  2GRQ B;  3GYZ A;  3BQO A;  3ASG A;  4HI8 A;  4ZHB A;  5FWQ A;  5B3S E;  4FHK A;  3RO2 A;  3NBN B;  3FU6 A;  3SFX A;  4A63 B;  2EIL E;  5BPP A;  3KAE A;  2HYZ A;  4GYY A;  4Z68 A;  4PH4 B;  1W3B A;  4WWP A;  3HRA A;  4JC8 A;  3QWP A;  3S7B A;  3PE4 A;  1JCQ A;  2F8X K;  4B89 A;  5EX0 A;  3L17 A;  2A4Z A;  2VSY A;  3ZKJ A;  4JEU A;  2VTB A;  5FQ6 A;  3EHN A;  5G55 A;  2WXL A;  1MHQ A;  3AS8 A;  3PE3 A;  1HG2 A;  4BER A;  3FHE A;  3E37 A;  1JCR A;  3D9N A;  1N4R A;  4JEH A;  1JWG A;  4BET A;  2C0L A;  4GZ3 A;  3B95 A;  3J5Q B;  3CVX A;  3E33 A;  4RSY A;  2FO1 E;  2KBX A;  1N4S A;  3UT7 A;  1E8Z A;  4TUU A;  2EIN E;  3FUI A;  3T8M A;  4EBA A;  5CBO A;  3G2T A;  3B7S A;  4YDE A;  3PEV B;  3SQV A;  3ZNG A;  4J8F A;  4BES A;  2C2L A;  1DNP A;  4GMR A;  4U0S A;  2EIK E;  1UG3 A;  4XZ4 A;  4HOU A;  1TEZ A;  1NFI E;  3PH0 C;  4URK A;  4GYW A;  1Y8M A;  3PZ3 A;  1JCS A;  5ITZ F;  3CHR A;  3UKU G;  1PAQ A;  3NQP A;  2WMO A;  3EDT B;  3NZS A;  5EIB E;  3Q75 A;  4HNA D;  4U63 A;  1N95 A;  4LNU D;  3RAU A;  2IFU A;  5CMY A;  1D9S A;  3D9M A;  3SI5 A;  1ZU2 A;  2ETA A;  4J0U A;  2F8Y A;  4JHR A;  5BV0 A;  4I6G A;  3QC1 A;  3FUJ A;  2F37 A;  4I6J A;  4UWF A;  4N5Q A;  4PDX A;  2QYU A;  3UM2 A;  1IYG A;  1O1R A;  4PS7 A;  2OND A;  4IRU A;  3I3N A;  2V4H C;  1PY1 A;  4Q69 A;  4CDR A;  2E0I A;  3EHM A;  1N52 A;  2FI7 A;  4I2W A;  2GRO B;  2HM8 A;  4GZD A;  5EDS A;  2IF4 A;  1OCZ E;  3SBS A;  2P9N G;  5AIJ A;  2FF4 A;  4YDW A;  3D9O A;  4B0Z A;  2ETB A;  4YVO A;  4JZY A;  3VTX A;  3U3W A;  2XQ0 A;  3IV0 A;  3QKY A;  4DX1 A;  3HXD A;  1HX8 A;  2GRP B;  3Q47 B;  4Y6W A;  5CRV A;  3ZPJ A;  1TN7 A;  3GZ2 A;  2L9B A;  4O1O A;  4AXH A;  4NUR A;  4LEU A;  3T5X A;  2J8S D;  3U9W A;  2Y69 E;  3IKO B;  1DC2 A;  3QNK A;  2X6K A;  3FH7 A;  5D0Q D;  1XNF A;  1ELW A;  3ASN E;  1OWM A;  1YCS B;  5AQB A;  1N4P A;  4WUY A;  3CVU A;  1YMP A;  3HXF A;  4F1P A;  4AIF A;  2PL2 A;  3ZYQ A;  3RU0 A;  3RRM B;  4E85 A;  4HFG A;  3FTW A;  3P1U A;  4FAD A;  4JW1 A;  5T8I A;  5DIZ A;  3SGH A;  2KXP C;  3SD5 A;  4HLL A;  2WXK A;  3G2V A;  3FU0 A;  3FUE A;  4LSZ E;  5ENR D;  3FTX A;  1N0Q A;  4OAU C;  1OWP A;  4WAF A;  3APD A;  1SZ9 A;  4ILG A;  4BWR A;  2M63 A;  1NA0 A;  5EID A;  3UM3 A;  5J90 A;  4Q96 A;  1KPS B;  2XZD G;  3S7F A;  1E8Y A;  3FTU A;  4HBD A;  4B8A A;  5AYW D;  4G25 A;  4UUC A;  5FIN A;  2HR2 A;  2E2E A;  3Q15 A;  3S7D A;  1WAO 1;  5FZS A;  4U8Y D;  2JEK A;  2DWZ A;  2WXN A;  3G2W A;  3OXL A;  3FFL A;  5BT1 A;  3AS5 A;  1HS6 A;  2YNQ A;  5CED B;  2RD0 A;  3E34 A;  3I5P A;  1HH8 A;  1PC2 A;  1N9A A;  4EHM A;  3B7R L;  3SFY A;  2OVF A;  1QZ2 A;  2WXM A;  1U2V G;  2LSV A;  1OWL A;  3CVQ A;  4EBA G;  4G8K A;  5BV1 A;  5G04 J;  3LPZ A;  4ANU A;  3AG4 E;  4GCN A;  2GRM A;  5ENN A;  2XGO A;  3R9M A;  4HOT A;  1KZP A;  2VSN A;  2F0Y A;  2XCB A;  2Y3A A;  2ZGG A;  4I2Z A;  2P9K G;  4L1B A;  5FQ4 A;  2B6C A;  3JYS A;  4JVS A;  3LKU A;  5BW8 C;  4C0M A;  4I43 A;  2Y4U A;  2Q7F A;  4ILH B;  5ENS D;  1JUQ A;  4DLO A;  5E76 A;  1WM5 A;  3FTZ A;  3SBT B;  4MKT A;  3IXE A;  2WQH A;  1HE8 A;  3DRA A;  5KNG A;  5J08 A;  1FCH A;  2AXU A;  1U3D A;  3IBE A;  1ZBP A;  1RW2 A;  4G8L A;  3TWV A;  3QOU A;  2X6F A;  2WXF A;  2V8S E;  2V5F A;  4DX5 D;  2KZT B;  3ASF A;  4CT0 A;  3SO8 A;  3C72 A;  2X6J A;  1DCE A;  2FUL A;  2ZU6 B;  3S7J A;  4WNF A;  4RG6 A;  2VTB B;  3BEE A;  2DIW A;  2R2L A;  2CFU A;  2WXQ A;  2XPZ A;  2WXR A;  3DSU A;  1S63 A;  5LX8 A;  2Y0B G;  3W9G A;  4N2Q A;  5AQA A;  1QNF A;  1QBQ A;  2R17 C;  2LO6 A;  5BXU A;  2UY1 A;  4O6F A;  3MYV A;  4JHJ A;  5T3R A;  4F53 A;  4APF A;  1H6O A;  2LXL A;  1D8D A;  2AXZ A;  2H6H A;  3DBS A;  3ASO E;  5AAR A;  1JWF A;  4U7E B;  2CG3 A;  3UUX A;  2WXP A;  5LFA A;  1Q2Z A;  1HU3 A;  4C9B B;  2KM4 A;  2LXM A;  4JHK A;  3UIO C;  1Z5S C;  3CK8 A;  1TYQ G;  2QY7 A;  3HDX A;  4GTM A;  3CSF A;  3Q79 A;  3ZFW A;  4ATZ D;  1OY3 D;  4XE0 A;  4MS6 A;  5FIO A;  3Q7F A;  1O1T A;  1S0P A;  1H2V C;  4LNB A;  2LAI A;  2NSZ A;  1SZA A;  2I1K A;  4UWH A;  1WY6 A;  3L9T A;  5ARG A;  4EPZ A;  2ZXW E;  5EKQ D;  3B7U X;  1N54 A;  1BU9 A;  3MKQ A;  2VSO E;  1FT1 A;  2J08 A;  1IQU A;  2CHX A;  3FH5 A;  1AP7 A;  1LD7 A;  5ANR A;  2DZN A;  5FZQ A;  3EU9 A;  3AG2 E;  2DVW A;  3TJP A;  4FJY A;  4G23 A;  1IKN D;  3HIZ A;  3EIJ A;  3BG1 B;  3RRN B;  1E8W A;  5FQ7 A;  3CIA A;  4EQF A;  3FUK A;  5HKP A;  3RO3 A;  1AWC B;  3ESK A;  4GTO A;  1B89 A;  3ZIM A;  2UWJ G;  1HFA A;  3WG7 E;  3LY9 A;  3R9A B;  4B8C B;  4K0R A;  5B1B E;  4CRW A;  4HI9 A;  2YQ8 A;  4HRN A;  1LF8 A;  3DPY A;  3OXG A;  4WNE A;  3UX4 A;  4A55 A;  3PUK A;  2CG2 A;  4N5C A;  4AOF A;  4GB9 A;  2RG8 A;  2XS8 A;  1LTX A;  4CGV A;  4H7Y A;  4J7W A;  3ULE G;  4APO A;  2QYJ A;  2KAT A;  2L0T B;  2KZT A;  3I4G A;  3V2X A;  4C0E A;  2OCC E;  3TWT A;  1H6K A;  3LY7 A;  3PRE A;  2P9S G;  2R59 A;  4EZK A;  2VGX A;  1MX6 A;  5D2M C;  2XS1 A;  3CVW A;  2IQC A;  4HOS A;  2I6H A;  3CEQ A;  1BI8 B;  3MZL B;  3CK7 A;  4M7C A;  1H6P A;  4HRM B;  2XPY A;  3LEW A;  1K1B A;  2J09 A;  1YA0 A;  3LXU X;  3SZ7 A;  5HRY A;  5CEC B;  3ZYM A;  2YHE A;  1BLX B;  4XKC A;  2CHW A;  1MQS A;  4XEI G;  2RFA A;  3QAQ A;  4DJA A;  3TWX A;  5FJY A;  5IY5 E;  3PRZ A;  3MV3 B;  2X6I A;  3C98 A;  3BUA A;  3HHM A;  2OEW A;  4GTP A;  1UJJ A;  5FTP A;  1ELK A;  4AY6 A;  3EHQ A;  4AP2 A;  2BKK B;  4BY6 A;  3FU3 A;  1K1A A;  1G3N B;  2I1J A;  5AN8 A;  5FZR A;  4DUI A;  3Q9U C;  2PQR A;  2HE0 A;  1L5J A;  2J49 A;  3IHV A;  5CBN A;  5G2N A;  3CHP A;  3LDZ A;  4M3O A;  3CVY A;  5JHA A;  3E32 A;  5JMN D;  3HVE A;  3ML9 A;  2GRR B;  2ZIR A;  1MYO A;  5G05 J;  3ML8 A;  4F1S A;  4ILI A;  3DXM G;  2XZT G;  4JD2 G;  1NP7 A;  2A5E A;  2JLB A;  4LRZ A;  1OWO A;  2AW6 A;  1NI1 A;  4N3C A;  3L16 A;  2IY0 C;  3PNL B;  3TXM A;  4KZC A;  2WPV A;  2XPI A;  5BXO A;  3D9H A;  5AEN A;  4UWG A;  3D3M A;  3ZGQ A;  3U66 A;  1EDU A;  4NQ0 A;  4G2V A;  1TJC A;  3ISM C;  2Y1L E;  5LP0 A;  2IOL A;  4RLY A;  1O1S A;  4HOR A;  2GGF A;  5CER B;  4DRX E;  3LY8 A;  3FWV A;  4GTT A;  5D0O D;  2PM7 A;  1UN9 A;  2OOE A;  3ZXS A;  4FC8 A;  4YND A;  4U8V D;  3TWU A;  4DX6 D;  2DYR E;  2VGE A;  5E75 A;  2MYO A;  4KT6 B;  2I2O A;  2OVB A;  1SVX A;  3B7T A;  5EYL A;  4J8D A;  3ABM E;  3V30 A;  3KEA A;  3U64 A;  3TWQ A;  3URZ A;  3JUI A;  4U0Z A;  3TAX A;  2XEH A;  4A1G A;  1UOH A;  4FLH A;  2P58 C;  3PZ1 A;  1ZB1 A;  5JJ7 A;  4PS8 A;  4WWN A;  4DI3 A;  3EUV A;  3S2A A;  3TG4 A;  3UM1 A;  5CCM A;  4J6I A;  4KXK B;  1D8E A;  4IN3 B;  2V5Q C;  4UI9 J;  3KS2 A;  3QJZ A;  4XKB A;  3R7R A;  4A3V A;  4KMO A;  4UWK A;  2XRY A;  4L2L A;  1FT2 A;  4PS3 A;  1K3Z D;  3TGO A;  3PUJ A;  3ZW3 A;  1E7U A;  3MA5 A;  5ENO D;  4GYO A;  3D9L A;  2V0P A;  2H6I A;  4LER A;  4LNG A;  5C1D A;  3GZ1 A;  4TRQ A;  4I1A A;  3CR3 A;  3KEZ A;  3CHQ A;  2VSX E;  4EZL A;  4BSX A;  5AQ9 A;  3CGH A;  4KBQ A;  5CEA A;  3PZ4 A;  5EN5 D;  4R7L A;  4FLB A;  3AG3 E;  4BX9 A;  1NL4 A;  5LCW J;  5EX3 A;  3FDH A;  3CKB A;  3MGB A;  1N0R A;  4F6R D;  1Y6I A;  4O60 A;  3VLF A;  1XGW A;  5AQ7 A;  4JPS A;  3KD7 A;  3AAA C;  4G24 A;  4KZ0 A;  4GAA A;  3UIN C;  4EEC A;  4LCT A; 
#chains in the Genus database with same CATH homology
 1U2V G;  3DXM G;  3ULE G;  2P9N G;  2P9L G;  2P9I G;  3RSE G;  1K8K G;  2P9S G;  2P9K G;  4XEI G;  4JD2 G;  3UKU G;  2P9P G;  2P9U G;  1TYQ G;  3DWL G;  3UKR G;  3DXK G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...