4JD2G

Crystal structure of bos taurus arp2/3 complex binding with mus musculus gmf
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
139
Chain Sequence
ARFRKVDVGEYDENKFVDEEGDGGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural basis for regulation of Arp2/3 complex by GMF.
pubmed doi rcsb
molecule tags Structural protein
total genus 38
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 4jd2G00
3ULEG 1K8KG 3DXMG 2P9NG 2P9UG 1TYQG 3UKRG 2P9IG 2P9KG 2P9LG 1U2VG 4JD2G 2P9PG 3DWLG 3RSEG 2P9SG 4XEIG 3UKUG 3DXKG
chains in the Genus database with same CATH superfamily
5D0OD 2XRYA 4CT0A 1PC2A 4BX8A 2V8SE 4RLYA 5EIDA 4KVOA 4JD2G 2DYRE 2KZTB 3UT4A 4PUCA 3CK8A 2XPZA 4G23A 3D9IA 2XEHA 4ILHB 3TXNA 2FBNA 1K8KG 3UKRG 3AG3E 1JPLA 5BNWA 3CGHA 4OYSA 3MKQA 5AQBA 4EZJA 1HU3A 3Q9NC 4GCOA 5KJMA 1TEZA 3S7JA 2XRZA 1OWNA 2L9BA 3CQCB 2M63A 4BSZB 1N52A 5ANLA 4LNGA 2P9NG 2WQ7A 4HLLA 1IXVA 1QZ2A 4V3IA 2XS1A 5C2YA 1OWOA 3D9JA 5ENRD 2L0TB 3D9KA 3E37A 1XGWA 2VJ8A 3SO8A 2KCKA 3QWPA 5FIOA 2XZTG 2F8XK 2YHEA 4EPZA 5FZSA 4JZYA 3D9MA 3ULQA 3BG0B 1JWGA 3D9HA 1MX2A 4AV7A 4WNEA 4CT4A 3QWVA 3RAUA 4F1PA 2UWJG 3ZYMA 3UM1A 4A55A 4JC8A 2X6FA 3AAAC 4RSYA 2LNIA 2J49A 4EZLA 2NYJA 4KZCA 5KJNA 4GTSA 4NQ0A 5CBNA 4I6JA 3L17A 4HB5A 4U8HA 1N4PA 2I6HA 4JHRA 4JW1A 1JCRA 3C3OA 5J08A 4OVUA 3MKRA 4TUMA 3AG4E 1KPSB 4BETA 5CBOA 3KSLA 5E76A 2RFAA 2HM8A 4IN3B 3HXEA 1KZPA 3IBEA 3Q79A 4BSXA 3V31A 3KEAA 2WXLA 5M72A 4HOSA 4ILIA 3Q47B 3E34A 5FQ8A 3VTYA 4JEHA 4I1OB 3C98A 2VYIA 3V2XA 4EQFA 3ABKE 4Z68A 5ITZF 3HXFA 3KAEA 3CKBA 5G05C 4HRMB 5AJDA 2B0OE 3LCAA 3R9MA 3ABLE 4XI9A 2EQXA 1H2VC 3OXGA 3WXXA 4AP2A 1TN8A 4U96D 5LP0A 3MJWA 3SGHA 3TXMA 4IYPA 3FUNA 3ISMC 5AENA 3ZU7B 3N71A 4AM9A 5BUZA 4N3BA 5ENPD 2KZTA 3JCKC 5BPPA 4I17A 5EDSA 3C3RA 1MYOA 3UM0A 3RO3A 1HXIA 1JWFA 3EHNA 5CRUA 2H6IA 2QYUA 2YNQA 1BD8A 3EIQC 4U0SA 1OCOE 1RZ4A 4O6FA 1H2TC 3PNLB 4HVBA 1MX4A 1W3BA 4G8KA 5EX3A 3WG7E 2AXZA 3C3QA 3ML8A 4HORA 3ASDA 2EINE 1EYHA 2LSVA 3TGOA 3SZ7A 3FUKA 5CMWA 1N0QA 1XNFA 3SQVA 4R7LA 3PZDA 2HE0A 3RU0A 3BU8A 3ZHEB 3FU3A 2RG8A 4GU5A 4HXIA 3QWWA 3AG2E 2J07A 1MQSA 2PNNA 4G24A 5ENTD 2CG3A 1ELRA 1E7UA 3PUJA 5HRYA 3SI5A 4DX2A 4XIFA 1WY6A 2L6JA 3TJPA 4AIFA 3CVUA 2RKKA 1TN7A 1QNFA 3G2SA 4WUYA 2DWZA 2Y0BG 4UUCA 2XPYA 5FQ7A 5A6CA 5G04C 3HG0D 5BT1A 4LCTA 2IEJA 5BV1A 5DIZA 3ONLA 2GGFA 1WG0A 3TG5A 5LCWJ 5AIJA 5JHBA 2AWIA 3LDZA 2Q7FA 3EU9A 2P9SG 3QARA 4L1BA 2P9IG 4M3OA 2R5SA 4O60A 2MHKA 4U95D 2DIWA 4ANUA 4GPKA 2ZGDA 5EX0A 1Z6TA 1H6OA 1D8DA 3HRAA 5CCLA 3EDTB 2VQ2A 1BI8B 5CCMA 4BTBA 4JHKA 3SFZA 4DLOA 3CHRA 1AWCB 3FDHA 3IEGA 3C5RA 2XCCA 2Y4UA 3HHMA 4XE0A 3LYAA 2CG2A 5BV0A 3FTVA 5FJYA 2I1JA 4FU3A 3GZ1A 2QZAA 4K5AB 2HR2A 1H19A 2ETAA 2X6IA 2AJAA 3FUJA 3U66A 4DI3A 3ESLA 3T8MA 5KNGA 3IXEA 2KM4A 5JHAA 4BX9A 4YDYA 5ENNA 4E6HA 5FZRA 1NA0A 4ZFHA 1OY3D 3SNXA 1A5EA 1NL4A 4GMLA 2MRIA 4U63A 3AG1E 2WXGA 4EBAA 1MZCA 2CFUA 3JXIA 1QQEA 3KS2A 3L08A 1OWLA 4YDWA 4U0ZA 3E32A 3DEOA 4DJAA 1Q2ZA 1G3NB 3LEWA 4CGWA 4GZCA 3Q73A 3ZHEA 3FTUA 5EN5D 3HIZA 1KLXA 2CFZA 3NBNB 4GYYA 4CCAA 3J5QB 4XZ4A 4WWOA 4DRXE 2VTBB 3APCA 1E8WA 2WVIA 3ABME 2AW6A 4GZDA 3IHVA 3ESKA 4HLEA 2X6JA 4OAVB 5E75A 2EILE 2R59A 4D10C 3SHFA 3VLEA 3C72A 1SZAA 2GW1A 4JHJA 4BY6A 1N54A 4NIKA 2VSNA 3L54A 4HQDA 2GRNB 2WXRA 3MCXA 3IV0A 2J08A 4O1PA 2GRRB 2IY0C 3E33A 3E4BA 3BQOA 4J8SA 3FHEA 4FA6A 3PS6A 4RG9A 3PEUB 4UQYA 4WWPA 2MOWA 1TNBA 2CHXA 2KBXA 2WXNA 4EBAG 3JQ1A 1N0RA 4FHJA 4B0ZA 2WXIA 2DVWA 3AU5A 2P9LG 3BUAA 1ELKA 2PL2A 3PE4A 4K5CA 3G2UA 2GRLA 4KXKB 3U3WA 1D9SA 4N5CA 1HFAA 3FU6A 1TR4A 2KCVA 2FO1E 1Z5SC 3UM2A 1E7VA 3U9WA 3DXKG 3EUVA 2AXVA 3DSSA 1SZ9A 4G26A 1U3CA 2H6HA 1FVHA 2IF4A 4MS6A 3P1UA 4ABNA 2XHEA 1FCHA 4DK5A 4GMJA 5AQ9A 5FQ4A 3ZIMA 2WM9A 1DNPA 4Q69A 2F0YA 3CVNA 3FP3A 3B7TA 4HFGA 4FLBA 3RSEG 4FC8A 3MV2B 1O1RA 1PY1A 4TXPA 1YA0A 4GTPA 1H0AA 1UN8A 4UQZA 2V5QC 2WPVA 1OWMA 3NOCD 3ZGQA 2H6FA 2ETBA 3PUKA 4GA2A 2X6HA 2C2LA 3OXFA 3PNTB 3PDNA 4U0UA 3NOGD 4GCNA 4DX5D 5ARFA 2QC9A 3EHMA 2I9CA 2IQCA 2R03A 2A4ZA 4CDNA 3CHSA 3S7DA 2VGEA 5HQ8A 4APFA 2VTBA 4K0RA 2DYSE 3FUEA 3T5VA 2EIME 2ONDA 4PDXA 4N2SA 3V2OA 3TWUA 2J4BA 4UWLA 5CEDB 2VGXB 3CV0A 4GMRA 5JJTA 4HS2A 4IULA 3QOUA 4AY5A 4F53A 4B89A 3DSUA 3LY7A 5JJ7A 3P2BA 3SD5A 2J09A 3RIBA 3QAQA 4LNBA 4U7EB 2FEZA 3TWXA 1HX8A 2LXMA 4GYOA 4DLQA 2P9PG 2JEKA 3TWTA 2Y69E 1OCRE 1U3DA 1X5BA 3L22A 3CSTA 1P5QA 3QKYA 2FO7A 3KD7A 5LX8A 1YMPA 1B89A 5KCMA 5EYPF 3FWVA 4DX1A 5G05J 3CIAA 3LXUX 4AVXA 3T9KA 2WXOA 3PZ3A 5T3RA 4Q94A 3J5PA 2GROB 3Q7FA 3SBTB 2VSOE 1TNUA 3G2WA 1YCSB 1A17A 4G2VA 2XGSA 2X38A 5CRVA 1E90A 3ZPJA 4AXHA 4HBDA 2IJGX 1GW6A 1MJ0A 3RRUA 3U64A 3O4ZA 1S0PA 3CVPA 4HI8A 2BF0X 3PE3A 2I2OA 3ASOE 4WNFA 4A1GA 4PS3A 4W9RA 2RFMA 3LPZA 4DX7D 4U04A 4AOFA 3DXMG 5FZQA 4G11A 5CECB 4EHMA 1INZA 2UY1A 2Y1LE 3I5PA 2P58C 4N3AA 1H6KA 3AS8A 3PREA 3Q49B 3CVXA 4N5QA 3L16A 2X6KA 2F37A 2OVFA 1TYQG 1WM5A 2GRMA 5D66A 2MYOA 3ENEA 1K3ZD 3L82A 3GYZA 5KJLA 1EPUA 1IQUA 3DPYA 5KJKA 2YQ8A 2C0MA 2XEVA 3ASHA 2NXPA 1HE8A 4OAUC 3UTMA 2IU1A 2A5UA 4LUNU 2VGXA 1NI1A 4C48B 3Q4AB 5JA4D 2QY7A 4J8EA 2ZGGA 4I6EA 4MKTA 5KWDA 5FT9A 2V4HC 1AP7A 4BTAA 4YVQC 3APFA 3ML9A 3JQ0A 4C0MA 2IONA 2GRPB 1OUVA 5JMND 5FWQA 2VSXE 4UI9J 1X81A 2WXKA 3U4TA 3TWRA 3ULYA 1HZ4A 3UUXA 5LCWC 4GPMA 1OCCE 2RD0A 4E85A 3L13A 3AJIA 2H6GA 3G2TA 1NZNA 4KZ0A 3UMVA 1KZOA 4JA7A 3IHYA 4JPSA 1ELWA 3ONKA 2XGOA 2WXMA 3FU5A 3Q5MA 3D9NA 4U8YD 3UXGA 2DCPA 2LAIA 3L6AA 4B8AA 2FI7A 3MV3B 2C0LA 4L2LA 2YHCA 4I6GA 4FHKA 3Q9UC 3R9AB 5AAOA 1IYGA 2LSUA 2P2CP 4ATZD 4J6IA 3CQGB 1BI7B 4XI0A 3SFXA 3NF1A 4UWHA 4L23A 5H7PA 3FUIA 4CDRA 3O48A 4ANVA 4JVSA 4GA1A 3FH5A 3FUFA 5HI7A 3CHMA 1FVFA 3HYMB 3CVQA 5DBKA 5FTPA 3T5XA 2E2EA 4Y6WA 3CLJA 5D0QD 5ENSD 1D8EA 2ZISA 3ZFWA 3G2VA 5HS0A 4BFRA 2KATA 4J8FA 4CEMA 4GTQA 4UWGA 3CK9A 3ASFA 3PH0C 4GTRA 4ACLA 3DSVA 3GZSA 4KVMA 3APDA 3UIPC 5CHEE 4RVBA 3CK7A 1V55E 4HRLA 4UWFA 2FF4A 3B13A 2AVPA 3D9PA 2P9UG 2P9KG 1N4SA 1Y6IA 5CMYA 1LF8A 3HVEB 3BG1B 1ZU2A 2J9QA 4QFVA 2LXLA 3FFLA 3FTYA 4FLHA 2KC7A 4J8YA 4LERA 3UKUG 4F6RD 1TJFA 3JXJA 4LEUA 3ZXSA 5B3SE 4WNGA 3R7QA 4ANXA 3FTWA 4BEPA 3UIOC 3B95A 2QYJA 1NP7A 1UJKA 4A63B 2ZXWE 5T4YA 4U07A 4AEZC 1TNOA 5B1BE 4O1OA 3PRZA 3ULEG 4UQXA 3ZUVB 3Q7AA 3QDNA 3FH7A 4F1SA 1H2UA 3FTZA 2XENA 4B94A 3RRNB 5FINA 4URKA 2AXUA 4BWRA 1DCQA 4GZ3A 3GZ2A 4WNDA 5KBAA 4U8VD 4DUIA 3B7RL 3FEYA 1OXJA 1N94A 4G25A 1N95A 4ACKA 4GAAA 3TWVA 3DRAA 2PZIA 3SFYA 3V30A 3B7UX 4F3VA 2KXPC 4C0EA 4EZKA 4I9CA 2B6CA 5ENQD 4L2YA 1QBQA 2WQ6A 3ZEFA 4YVOA 1UG3A 4A3VA 1TN6A 1SA5A 4GTTA 4TXQA 4AJWA 3UX4A 1H6PA 3I4GA 4XKCA 4UWKA 4YDEA 2WXHA 4I2ZA 3KSQA 3TWQA 3W9FA 3ZYQA 3EU5A 3IKOB 4JEUA 5C1DA 2WXFA 1SVXA 5AQ7A 4ANWA 2V5FA 2UY1B 1WDYA 2YINA 3NZSA 3TWSA 5EKQD 4L7TA 1TNZA 3D3MA 2BKGA 3CHQA 3CKCA 2A5EA 3EIJA 3UQ3A 1SA4A 3D9OA 2WMNA 3BEEA 4CZ2D 3DSWA 1MX6A 4LG6A 3NZUA 3JUEA 3CVLA 2BUGA 3SBSA 3DPDA 3OXLA 3LJNA 4XEIG 2OEVA 4J8DA 1BLXB 3B7SA 3AU4A 3MGBA 1LD7A 1VDYA 4B93B 4HOQA 2PQNA 4FJZA 1E8XA 1N4RA 1UN9A 1OWPA 4CRWA 3PZ4A 3HVEA 5J90A 1ZBPA 4L9PA 3R7RA 3RKVA 4KBQA 1Z3XA 3ZYLA 3PVLA 3VTXA 3MYVA 2Y3AA 2WQHA 3EHQA 3S7FA 2X3MA 2Y4TA 2ZIRA 4BT8A 3W9GA 1BPOA 2KCLA 1HF8A 4EECA 1UOHA 4I9EA 3FUMA 3NQPA 1SW6A 2JABA 4TUUA 1O1TA 3CHPA 3FY4A 2WXPA 3FEXA 3NAWA 1HH8A 1KT0A 3ZYKA 3OAWA 4X8QA 3OTNA 2GRQB 4TXRA 3LVQE 2J8SD 1E8YA 4BERA 4GTVA 3MX3A 4Y6CA 4A1SA 4LNUD 4DX6D 1K1BA 2PM6A 3CSFA 4K03A 4JL0A 5EILA 1N11A 2CHZA 3UM3A 3ZW3A 4GA0A 3I3NA 4GYWA 1FT2A 4MBGA 1LD8A 1MHQA 3FUHA 1IKND 2XPIA 4A3TA 2V0PA 3VLFA 3QC1A 4N2QA 4K5BA 1DVPA 4PS7A 3ZNGA 4I1AA 3CR3A 1V54E 2R2LA 5B1AE 3DBSA 2OCCE 4GTMA 3VLDA 4BT9A 3FTXA 2FULA 4G1TA 4CGVA 2VSYA 4C9BB 4HRNA 3DSTA 2R17C 3JUIA 4LSZE 4IRUA 3E30A 3ZRHA 4TV3A 4N39A 1TJCA 3NB2A 4MRUA 2R02A 4AY6A 3PEVB 3T8KA 2BKKB 3FTSA 5ENOD 4YDOA 2JLBA 2XGMA 2DBAA 1N9AA 2E0IA 4J0UA 3S7BA 3UPVA 3RRMB 3QJZA 1HG2A 2WMOA 3FU0A 1S63A 1JCSA 4N3CA 2PQRA 1NFIE 3PZ1A 2XS8A 3AS4A 4G8LA 5CEAA 1EDUA 4ATGA 5G55A 4NRHB 4LRZA 4JB8P 3B7BA 1BU9A 1DC2A 3RO2A 3AS5A 3QNKA 3MEKA 3HXDA 1JUQA 5AARA 2XEEA 3ZKJA 2HYZA 2OEWA 4WAFA 4KYOB 3FULA 5KNHD 3JYSA 3EJNA 1OCZE 3S2AA 5BW8C 1N4QA 3RJVA 5EIBE 4FADA 5G04J 2XCBA 2IOLA 3Q15A 1TNYA 4PH4B 4ILGA 3DWLG 2OVBA 1O1SA 2R05A 5AYWD 3MA5A 4JA9A 4UI9C 4GZ5A 5CERB 3ZXPA 1HS6A 1S64A 3KEZA 1JCQA 3QB2A 2WXQA 2DZOA 4KMOA 4I2WA 3TAXA 1KT1A 5LOZA 4APOA 4OVVA 1PAQA 2ETCA 3DSXA 2XQ0A 5T8IA 3TL5A 3CVYA 2HO1A 1ZB1A 3UINC 2ZU6B 4B8CB 3D9LA 3HXBA 2IFUA 4FP7A 5FQ6A 2BEDA 2V4LA 4J7WA 1IQRA 1NA3A 2IO2C 3Q78A 4ZHBA 2F8YA 5A7DB 1FT1A 2J4DA 4PS8A 4HOUA 4I1MA 4DPRA 1UJJA 1IHBA 2L6BA 1UW4B 4HI9A 4CYMD 4HNAD 1IHGA 3ZVVA 2EIKE 3L9TA 2NSZA 5BXUA 2I1KA 5AJLA 3K9IA 3MZLB 3ASNE 2LAHA 5D2MC 4H7XA 2EIJE 3LKUA 4H7YA 4I43A 3CHOA 3EHRA 3QK0A 3V79K 4HOTA 3MKQB 2VGYA 2LUHA 3I4RB 4RQIA 3CVWA 3ASGA 1QYMA 2CHWA 5EYLA 3UI2A 2ILRA 1HO8A 1HG5A 3TG4A 2OV8A 2LO6A 5LFAA 1E8ZA 3RK6A 2IO3C 3X2QE 1FPPA 3GW4A 3LVRE 3LY8A 2WB2A 2WXJA 3TWWA 4FULA 3DEPA 3FUDA 4JXTA 3UT7A 2QFCA 1Z3YA 1OT8A 1SQMA 3HXCA 5G2NA 1DCEA 1EF1C 4QQIA 1LTXA 4CDMA 3FH8A 3F6QA 5IY5E 5ARGA 4GZ6A 4XX5A 1RW2A 5JJ6A 4NACA 2NC9A 4YNDA 4WWNA 5BXOA 1YYHA 3HDXA 5AQAA 5ANRA 3PZ2A 2BTDA 4Q96A 4UI9K 4DI4A 3ZN3A 4RG6A 3UT8A 1E96B 3URZA 1WAO1 3LY9A 2DZNA 1U2VG 5AN8A 2PM7A 3CEQA 2IOSA 2OOEA 3LJ3A 4FJYA 4P29A 4F7AA 4KT6B 3CVVA 3LS8A 4XKBA 4BESA 4GTOA 4M7CA 5HKPA 3Q75A 3SF4A 1L5JA 1S70B 4ME2A 4TRQA 2XZDG 4MLPA 4NURA 3SY2A 5A23A 4GB9A 1O5MA 2L0IA 1K1AA 1Y8MA
chains in the Genus database with same CATH topology
3ULEG 1K8KG 3DXMG 2P9NG 2P9UG 1TYQG 3UKRG 2P9IG 2P9KG 2P9LG 1U2VG 4JD2G 2P9PG 3DWLG 3RSEG 2P9SG 4XEIG 3UKUG 3DXKG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULE G;  1K8K G;  3DXM G;  2P9N G;  2P9U G;  1TYQ G;  3UKR G;  2P9I G;  2P9K G;  2P9L G;  1U2V G;  4JD2 G;  2P9P G;  3DWL G;  3RSE G;  2P9S G;  4XEI G;  3UKU G;  3DXK G; 
#chains in the Genus database with same CATH topology
 5D0O D;  2XRY A;  4CT0 A;  1PC2 A;  4BX8 A;  2V8S E;  4RLY A;  5EID A;  4KVO A;  4JD2 G;  2DYR E;  2KZT B;  3UT4 A;  4PUC A;  3CK8 A;  2XPZ A;  4G23 A;  3D9I A;  2XEH A;  4ILH B;  3TXN A;  2FBN A;  1K8K G;  3UKR G;  3AG3 E;  1JPL A;  5BNW A;  3CGH A;  4OYS A;  3MKQ A;  5AQB A;  4EZJ A;  1HU3 A;  3Q9N C;  4GCO A;  5KJM A;  1TEZ A;  3S7J A;  2XRZ A;  1OWN A;  2L9B A;  3CQC B;  2M63 A;  4BSZ B;  1N52 A;  5ANL A;  4LNG A;  2P9N G;  2WQ7 A;  4HLL A;  1IXV A;  1QZ2 A;  4V3I A;  2XS1 A;  5C2Y A;  1OWO A;  3D9J A;  5ENR D;  2L0T B;  3D9K A;  3E37 A;  1XGW A;  2VJ8 A;  3SO8 A;  2KCK A;  3QWP A;  5FIO A;  2XZT G;  2F8X K;  2YHE A;  4EPZ A;  5FZS A;  4JZY A;  3D9M A;  3ULQ A;  3BG0 B;  1JWG A;  3D9H A;  1MX2 A;  4AV7 A;  4WNE A;  4CT4 A;  3QWV A;  3RAU A;  4F1P A;  2UWJ G;  3ZYM A;  3UM1 A;  4A55 A;  4JC8 A;  2X6F A;  3AAA C;  4RSY A;  2LNI A;  2J49 A;  4EZL A;  2NYJ A;  4KZC A;  5KJN A;  4GTS A;  4NQ0 A;  5CBN A;  4I6J A;  3L17 A;  4HB5 A;  4U8H A;  1N4P A;  2I6H A;  4JHR A;  4JW1 A;  1JCR A;  3C3O A;  5J08 A;  4OVU A;  3MKR A;  4TUM A;  3AG4 E;  1KPS B;  4BET A;  5CBO A;  3KSL A;  5E76 A;  2RFA A;  2HM8 A;  4IN3 B;  3HXE A;  1KZP A;  3IBE A;  3Q79 A;  4BSX A;  3V31 A;  3KEA A;  2WXL A;  5M72 A;  4HOS A;  4ILI A;  3Q47 B;  3E34 A;  5FQ8 A;  3VTY A;  4JEH A;  4I1O B;  3C98 A;  2VYI A;  3V2X A;  4EQF A;  3ABK E;  4Z68 A;  5ITZ F;  3HXF A;  3KAE A;  3CKB A;  5G05 C;  4HRM B;  5AJD A;  2B0O E;  3LCA A;  3R9M A;  3ABL E;  4XI9 A;  2EQX A;  1H2V C;  3OXG A;  3WXX A;  4AP2 A;  1TN8 A;  4U96 D;  5LP0 A;  3MJW A;  3SGH A;  3TXM A;  4IYP A;  3FUN A;  3ISM C;  5AEN A;  3ZU7 B;  3N71 A;  4AM9 A;  5BUZ A;  4N3B A;  5ENP D;  2KZT A;  3JCK C;  5BPP A;  4I17 A;  5EDS A;  3C3R A;  1MYO A;  3UM0 A;  3RO3 A;  1HXI A;  1JWF A;  3EHN A;  5CRU A;  2H6I A;  2QYU A;  2YNQ A;  1BD8 A;  3EIQ C;  4U0S A;  1OCO E;  1RZ4 A;  4O6F A;  1H2T C;  3PNL B;  4HVB A;  1MX4 A;  1W3B A;  4G8K A;  5EX3 A;  3WG7 E;  2AXZ A;  3C3Q A;  3ML8 A;  4HOR A;  3ASD A;  2EIN E;  1EYH A;  2LSV A;  3TGO A;  3SZ7 A;  3FUK A;  5CMW A;  1N0Q A;  1XNF A;  3SQV A;  4R7L A;  3PZD A;  2HE0 A;  3RU0 A;  3BU8 A;  3ZHE B;  3FU3 A;  2RG8 A;  4GU5 A;  4HXI A;  3QWW A;  3AG2 E;  2J07 A;  1MQS A;  2PNN A;  4G24 A;  5ENT D;  2CG3 A;  1ELR A;  1E7U A;  3PUJ A;  5HRY A;  3SI5 A;  4DX2 A;  4XIF A;  1WY6 A;  2L6J A;  3TJP A;  4AIF A;  3CVU A;  2RKK A;  1TN7 A;  1QNF A;  3G2S A;  4WUY A;  2DWZ A;  2Y0B G;  4UUC A;  2XPY A;  5FQ7 A;  5A6C A;  5G04 C;  3HG0 D;  5BT1 A;  4LCT A;  2IEJ A;  5BV1 A;  5DIZ A;  3ONL A;  2GGF A;  1WG0 A;  3TG5 A;  5LCW J;  5AIJ A;  5JHB A;  2AWI A;  3LDZ A;  2Q7F A;  3EU9 A;  2P9S G;  3QAR A;  4L1B A;  2P9I G;  4M3O A;  2R5S A;  4O60 A;  2MHK A;  4U95 D;  2DIW A;  4ANU A;  4GPK A;  2ZGD A;  5EX0 A;  1Z6T A;  1H6O A;  1D8D A;  3HRA A;  5CCL A;  3EDT B;  2VQ2 A;  1BI8 B;  5CCM A;  4BTB A;  4JHK A;  3SFZ A;  4DLO A;  3CHR A;  1AWC B;  3FDH A;  3IEG A;  3C5R A;  2XCC A;  2Y4U A;  3HHM A;  4XE0 A;  3LYA A;  2CG2 A;  5BV0 A;  3FTV A;  5FJY A;  2I1J A;  4FU3 A;  3GZ1 A;  2QZA A;  4K5A B;  2HR2 A;  1H19 A;  2ETA A;  2X6I A;  2AJA A;  3FUJ A;  3U66 A;  4DI3 A;  3ESL A;  3T8M A;  5KNG A;  3IXE A;  2KM4 A;  5JHA A;  4BX9 A;  4YDY A;  5ENN A;  4E6H A;  5FZR A;  1NA0 A;  4ZFH A;  1OY3 D;  3SNX A;  1A5E A;  1NL4 A;  4GML A;  2MRI A;  4U63 A;  3AG1 E;  2WXG A;  4EBA A;  1MZC A;  2CFU A;  3JXI A;  1QQE A;  3KS2 A;  3L08 A;  1OWL A;  4YDW A;  4U0Z A;  3E32 A;  3DEO A;  4DJA A;  1Q2Z A;  1G3N B;  3LEW A;  4CGW A;  4GZC A;  3Q73 A;  3ZHE A;  3FTU A;  5EN5 D;  3HIZ A;  1KLX A;  2CFZ A;  3NBN B;  4GYY A;  4CCA A;  3J5Q B;  4XZ4 A;  4WWO A;  4DRX E;  2VTB B;  3APC A;  1E8W A;  2WVI A;  3ABM E;  2AW6 A;  4GZD A;  3IHV A;  3ESK A;  4HLE A;  2X6J A;  4OAV B;  5E75 A;  2EIL E;  2R59 A;  4D10 C;  3SHF A;  3VLE A;  3C72 A;  1SZA A;  2GW1 A;  4JHJ A;  4BY6 A;  1N54 A;  4NIK A;  2VSN A;  3L54 A;  4HQD A;  2GRN B;  2WXR A;  3MCX A;  3IV0 A;  2J08 A;  4O1P A;  2GRR B;  2IY0 C;  3E33 A;  3E4B A;  3BQO A;  4J8S A;  3FHE A;  4FA6 A;  3PS6 A;  4RG9 A;  3PEU B;  4UQY A;  4WWP A;  2MOW A;  1TNB A;  2CHX A;  2KBX A;  2WXN A;  4EBA G;  3JQ1 A;  1N0R A;  4FHJ A;  4B0Z A;  2WXI A;  2DVW A;  3AU5 A;  2P9L G;  3BUA A;  1ELK A;  2PL2 A;  3PE4 A;  4K5C A;  3G2U A;  2GRL A;  4KXK B;  3U3W A;  1D9S A;  4N5C A;  1HFA A;  3FU6 A;  1TR4 A;  2KCV A;  2FO1 E;  1Z5S C;  3UM2 A;  1E7V A;  3U9W A;  3DXK G;  3EUV A;  2AXV A;  3DSS A;  1SZ9 A;  4G26 A;  1U3C A;  2H6H A;  1FVH A;  2IF4 A;  4MS6 A;  3P1U A;  4ABN A;  2XHE A;  1FCH A;  4DK5 A;  4GMJ A;  5AQ9 A;  5FQ4 A;  3ZIM A;  2WM9 A;  1DNP A;  4Q69 A;  2F0Y A;  3CVN A;  3FP3 A;  3B7T A;  4HFG A;  4FLB A;  3RSE G;  4FC8 A;  3MV2 B;  1O1R A;  1PY1 A;  4TXP A;  1YA0 A;  4GTP A;  1H0A A;  1UN8 A;  4UQZ A;  2V5Q C;  2WPV A;  1OWM A;  3NOC D;  3ZGQ A;  2H6F A;  2ETB A;  3PUK A;  4GA2 A;  2X6H A;  2C2L A;  3OXF A;  3PNT B;  3PDN A;  4U0U A;  3NOG D;  4GCN A;  4DX5 D;  5ARF A;  2QC9 A;  3EHM A;  2I9C A;  2IQC A;  2R03 A;  2A4Z A;  4CDN A;  3CHS A;  3S7D A;  2VGE A;  5HQ8 A;  4APF A;  2VTB A;  4K0R A;  2DYS E;  3FUE A;  3T5V A;  2EIM E;  2OND A;  4PDX A;  4N2S A;  3V2O A;  3TWU A;  2J4B A;  4UWL A;  5CED B;  2VGX B;  3CV0 A;  4GMR A;  5JJT A;  4HS2 A;  4IUL A;  3QOU A;  4AY5 A;  4F53 A;  4B89 A;  3DSU A;  3LY7 A;  5JJ7 A;  3P2B A;  3SD5 A;  2J09 A;  3RIB A;  3QAQ A;  4LNB A;  4U7E B;  2FEZ A;  3TWX A;  1HX8 A;  2LXM A;  4GYO A;  4DLQ A;  2P9P G;  2JEK A;  3TWT A;  2Y69 E;  1OCR E;  1U3D A;  1X5B A;  3L22 A;  3CST A;  1P5Q A;  3QKY A;  2FO7 A;  3KD7 A;  5LX8 A;  1YMP A;  1B89 A;  5KCM A;  5EYP F;  3FWV A;  4DX1 A;  5G05 J;  3CIA A;  3LXU X;  4AVX A;  3T9K A;  2WXO A;  3PZ3 A;  5T3R A;  4Q94 A;  3J5P A;  2GRO B;  3Q7F A;  3SBT B;  2VSO E;  1TNU A;  3G2W A;  1YCS B;  1A17 A;  4G2V A;  2XGS A;  2X38 A;  5CRV A;  1E90 A;  3ZPJ A;  4AXH A;  4HBD A;  2IJG X;  1GW6 A;  1MJ0 A;  3RRU A;  3U64 A;  3O4Z A;  1S0P A;  3CVP A;  4HI8 A;  2BF0 X;  3PE3 A;  2I2O A;  3ASO E;  4WNF A;  4A1G A;  4PS3 A;  4W9R A;  2RFM A;  3LPZ A;  4DX7 D;  4U04 A;  4AOF A;  3DXM G;  5FZQ A;  4G11 A;  5CEC B;  4EHM A;  1INZ A;  2UY1 A;  2Y1L E;  3I5P A;  2P58 C;  4N3A A;  1H6K A;  3AS8 A;  3PRE A;  3Q49 B;  3CVX A;  4N5Q A;  3L16 A;  2X6K A;  2F37 A;  2OVF A;  1TYQ G;  1WM5 A;  2GRM A;  5D66 A;  2MYO A;  3ENE A;  1K3Z D;  3L82 A;  3GYZ A;  5KJL A;  1EPU A;  1IQU A;  3DPY A;  5KJK A;  2YQ8 A;  2C0M A;  2XEV A;  3ASH A;  2NXP A;  1HE8 A;  4OAU C;  3UTM A;  2IU1 A;  2A5U A;  4LUN U;  2VGX A;  1NI1 A;  4C48 B;  3Q4A B;  5JA4 D;  2QY7 A;  4J8E A;  2ZGG A;  4I6E A;  4MKT A;  5KWD A;  5FT9 A;  2V4H C;  1AP7 A;  4BTA A;  4YVQ C;  3APF A;  3ML9 A;  3JQ0 A;  4C0M A;  2ION A;  2GRP B;  1OUV A;  5JMN D;  5FWQ A;  2VSX E;  4UI9 J;  1X81 A;  2WXK A;  3U4T A;  3TWR A;  3ULY A;  1HZ4 A;  3UUX A;  5LCW C;  4GPM A;  1OCC E;  2RD0 A;  4E85 A;  3L13 A;  3AJI A;  2H6G A;  3G2T A;  1NZN A;  4KZ0 A;  3UMV A;  1KZO A;  4JA7 A;  3IHY A;  4JPS A;  1ELW A;  3ONK A;  2XGO A;  2WXM A;  3FU5 A;  3Q5M A;  3D9N A;  4U8Y D;  3UXG A;  2DCP A;  2LAI A;  3L6A A;  4B8A A;  2FI7 A;  3MV3 B;  2C0L A;  4L2L A;  2YHC A;  4I6G A;  4FHK A;  3Q9U C;  3R9A B;  5AAO A;  1IYG A;  2LSU A;  2P2C P;  4ATZ D;  4J6I A;  3CQG B;  1BI7 B;  4XI0 A;  3SFX A;  3NF1 A;  4UWH A;  4L23 A;  5H7P A;  3FUI A;  4CDR A;  3O48 A;  4ANV A;  4JVS A;  4GA1 A;  3FH5 A;  3FUF A;  5HI7 A;  3CHM A;  1FVF A;  3HYM B;  3CVQ A;  5DBK A;  5FTP A;  3T5X A;  2E2E A;  4Y6W A;  3CLJ A;  5D0Q D;  5ENS D;  1D8E A;  2ZIS A;  3ZFW A;  3G2V A;  5HS0 A;  4BFR A;  2KAT A;  4J8F A;  4CEM A;  4GTQ A;  4UWG A;  3CK9 A;  3ASF A;  3PH0 C;  4GTR A;  4ACL A;  3DSV A;  3GZS A;  4KVM A;  3APD A;  3UIP C;  5CHE E;  4RVB A;  3CK7 A;  1V55 E;  4HRL A;  4UWF A;  2FF4 A;  3B13 A;  2AVP A;  3D9P A;  2P9U G;  2P9K G;  1N4S A;  1Y6I A;  5CMY A;  1LF8 A;  3HVE B;  3BG1 B;  1ZU2 A;  2J9Q A;  4QFV A;  2LXL A;  3FFL A;  3FTY A;  4FLH A;  2KC7 A;  4J8Y A;  4LER A;  3UKU G;  4F6R D;  1TJF A;  3JXJ A;  4LEU A;  3ZXS A;  5B3S E;  4WNG A;  3R7Q A;  4ANX A;  3FTW A;  4BEP A;  3UIO C;  3B95 A;  2QYJ A;  1NP7 A;  1UJK A;  4A63 B;  2ZXW E;  5T4Y A;  4U07 A;  4AEZ C;  1TNO A;  5B1B E;  4O1O A;  3PRZ A;  3ULE G;  4UQX A;  3ZUV B;  3Q7A A;  3QDN A;  3FH7 A;  4F1S A;  1H2U A;  3FTZ A;  2XEN A;  4B94 A;  3RRN B;  5FIN A;  4URK A;  2AXU A;  4BWR A;  1DCQ A;  4GZ3 A;  3GZ2 A;  4WND A;  5KBA A;  4U8V D;  4DUI A;  3B7R L;  3FEY A;  1OXJ A;  1N94 A;  4G25 A;  1N95 A;  4ACK A;  4GAA A;  3TWV A;  3DRA A;  2PZI A;  3SFY A;  3V30 A;  3B7U X;  4F3V A;  2KXP C;  4C0E A;  4EZK A;  4I9C A;  2B6C A;  5ENQ D;  4L2Y A;  1QBQ A;  2WQ6 A;  3ZEF A;  4YVO A;  1UG3 A;  4A3V A;  1TN6 A;  1SA5 A;  4GTT A;  4TXQ A;  4AJW A;  3UX4 A;  1H6P A;  3I4G A;  4XKC A;  4UWK A;  4YDE A;  2WXH A;  4I2Z A;  3KSQ A;  3TWQ A;  3W9F A;  3ZYQ A;  3EU5 A;  3IKO B;  4JEU A;  5C1D A;  2WXF A;  1SVX A;  5AQ7 A;  4ANW A;  2V5F A;  2UY1 B;  1WDY A;  2YIN A;  3NZS A;  3TWS A;  5EKQ D;  4L7T A;  1TNZ A;  3D3M A;  2BKG A;  3CHQ A;  3CKC A;  2A5E A;  3EIJ A;  3UQ3 A;  1SA4 A;  3D9O A;  2WMN A;  3BEE A;  4CZ2 D;  3DSW A;  1MX6 A;  4LG6 A;  3NZU A;  3JUE A;  3CVL A;  2BUG A;  3SBS A;  3DPD A;  3OXL A;  3LJN A;  4XEI G;  2OEV A;  4J8D A;  1BLX B;  3B7S A;  3AU4 A;  3MGB A;  1LD7 A;  1VDY A;  4B93 B;  4HOQ A;  2PQN A;  4FJZ A;  1E8X A;  1N4R A;  1UN9 A;  1OWP A;  4CRW A;  3PZ4 A;  3HVE A;  5J90 A;  1ZBP A;  4L9P A;  3R7R A;  3RKV A;  4KBQ A;  1Z3X A;  3ZYL A;  3PVL A;  3VTX A;  3MYV A;  2Y3A A;  2WQH A;  3EHQ A;  3S7F A;  2X3M A;  2Y4T A;  2ZIR A;  4BT8 A;  3W9G A;  1BPO A;  2KCL A;  1HF8 A;  4EEC A;  1UOH A;  4I9E A;  3FUM A;  3NQP A;  1SW6 A;  2JAB A;  4TUU A;  1O1T A;  3CHP A;  3FY4 A;  2WXP A;  3FEX A;  3NAW A;  1HH8 A;  1KT0 A;  3ZYK A;  3OAW A;  4X8Q A;  3OTN A;  2GRQ B;  4TXR A;  3LVQ E;  2J8S D;  1E8Y A;  4BER A;  4GTV A;  3MX3 A;  4Y6C A;  4A1S A;  4LNU D;  4DX6 D;  1K1B A;  2PM6 A;  3CSF A;  4K03 A;  4JL0 A;  5EIL A;  1N11 A;  2CHZ A;  3UM3 A;  3ZW3 A;  4GA0 A;  3I3N A;  4GYW A;  1FT2 A;  4MBG A;  1LD8 A;  1MHQ A;  3FUH A;  1IKN D;  2XPI A;  4A3T A;  2V0P A;  3VLF A;  3QC1 A;  4N2Q A;  4K5B A;  1DVP A;  4PS7 A;  3ZNG A;  4I1A A;  3CR3 A;  1V54 E;  2R2L A;  5B1A E;  3DBS A;  2OCC E;  4GTM A;  3VLD A;  4BT9 A;  3FTX A;  2FUL A;  4G1T A;  4CGV A;  2VSY A;  4C9B B;  4HRN A;  3DST A;  2R17 C;  3JUI A;  4LSZ E;  4IRU A;  3E30 A;  3ZRH A;  4TV3 A;  4N39 A;  1TJC A;  3NB2 A;  4MRU A;  2R02 A;  4AY6 A;  3PEV B;  3T8K A;  2BKK B;  3FTS A;  5ENO D;  4YDO A;  2JLB A;  2XGM A;  2DBA A;  1N9A A;  2E0I A;  4J0U A;  3S7B A;  3UPV A;  3RRM B;  3QJZ A;  1HG2 A;  2WMO A;  3FU0 A;  1S63 A;  1JCS A;  4N3C A;  2PQR A;  1NFI E;  3PZ1 A;  2XS8 A;  3AS4 A;  4G8L A;  5CEA A;  1EDU A;  4ATG A;  5G55 A;  4NRH B;  4LRZ A;  4JB8 P;  3B7B A;  1BU9 A;  1DC2 A;  3RO2 A;  3AS5 A;  3QNK A;  3MEK A;  3HXD A;  1JUQ A;  5AAR A;  2XEE A;  3ZKJ A;  2HYZ A;  2OEW A;  4WAF A;  4KYO B;  3FUL A;  5KNH D;  3JYS A;  3EJN A;  1OCZ E;  3S2A A;  5BW8 C;  1N4Q A;  3RJV A;  5EIB E;  4FAD A;  5G04 J;  2XCB A;  2IOL A;  3Q15 A;  1TNY A;  4PH4 B;  4ILG A;  3DWL G;  2OVB A;  1O1S A;  2R05 A;  5AYW D;  3MA5 A;  4JA9 A;  4UI9 C;  4GZ5 A;  5CER B;  3ZXP A;  1HS6 A;  1S64 A;  3KEZ A;  1JCQ A;  3QB2 A;  2WXQ A;  2DZO A;  4KMO A;  4I2W A;  3TAX A;  1KT1 A;  5LOZ A;  4APO A;  4OVV A;  1PAQ A;  2ETC A;  3DSX A;  2XQ0 A;  5T8I A;  3TL5 A;  3CVY A;  2HO1 A;  1ZB1 A;  3UIN C;  2ZU6 B;  4B8C B;  3D9L A;  3HXB A;  2IFU A;  4FP7 A;  5FQ6 A;  2BED A;  2V4L A;  4J7W A;  1IQR A;  1NA3 A;  2IO2 C;  3Q78 A;  4ZHB A;  2F8Y A;  5A7D B;  1FT1 A;  2J4D A;  4PS8 A;  4HOU A;  4I1M A;  4DPR A;  1UJJ A;  1IHB A;  2L6B A;  1UW4 B;  4HI9 A;  4CYM D;  4HNA D;  1IHG A;  3ZVV A;  2EIK E;  3L9T A;  2NSZ A;  5BXU A;  2I1K A;  5AJL A;  3K9I A;  3MZL B;  3ASN E;  2LAH A;  5D2M C;  4H7X A;  2EIJ E;  3LKU A;  4H7Y A;  4I43 A;  3CHO A;  3EHR A;  3QK0 A;  3V79 K;  4HOT A;  3MKQ B;  2VGY A;  2LUH A;  3I4R B;  4RQI A;  3CVW A;  3ASG A;  1QYM A;  2CHW A;  5EYL A;  3UI2 A;  2ILR A;  1HO8 A;  1HG5 A;  3TG4 A;  2OV8 A;  2LO6 A;  5LFA A;  1E8Z A;  3RK6 A;  2IO3 C;  3X2Q E;  1FPP A;  3GW4 A;  3LVR E;  3LY8 A;  2WB2 A;  2WXJ A;  3TWW A;  4FUL A;  3DEP A;  3FUD A;  4JXT A;  3UT7 A;  2QFC A;  1Z3Y A;  1OT8 A;  1SQM A;  3HXC A;  5G2N A;  1DCE A;  1EF1 C;  4QQI A;  1LTX A;  4CDM A;  3FH8 A;  3F6Q A;  5IY5 E;  5ARG A;  4GZ6 A;  4XX5 A;  1RW2 A;  5JJ6 A;  4NAC A;  2NC9 A;  4YND A;  4WWN A;  5BXO A;  1YYH A;  3HDX A;  5AQA A;  5ANR A;  3PZ2 A;  2BTD A;  4Q96 A;  4UI9 K;  4DI4 A;  3ZN3 A;  4RG6 A;  3UT8 A;  1E96 B;  3URZ A;  1WAO 1;  3LY9 A;  2DZN A;  1U2V G;  5AN8 A;  2PM7 A;  3CEQ A;  2IOS A;  2OOE A;  3LJ3 A;  4FJY A;  4P29 A;  4F7A A;  4KT6 B;  3CVV A;  3LS8 A;  4XKB A;  4BES A;  4GTO A;  4M7C A;  5HKP A;  3Q75 A;  3SF4 A;  1L5J A;  1S70 B;  4ME2 A;  4TRQ A;  2XZD G;  4MLP A;  4NUR A;  3SY2 A;  5A23 A;  4GB9 A;  1O5M A;  2L0I A;  1K1A A;  1Y8M A; 
#chains in the Genus database with same CATH homology
 3ULE G;  1K8K G;  3DXM G;  2P9N G;  2P9U G;  1TYQ G;  3UKR G;  2P9I G;  2P9K G;  2P9L G;  1U2V G;  4JD2 G;  2P9P G;  3DWL G;  3RSE G;  2P9S G;  4XEI G;  3UKU G;  3DXK G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...