4JD2G

Crystal structure of bos taurus arp2/3 complex binding with mus musculus gmf
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
143
structure length
139
Chain Sequence
ARFRKVDVGEYDENKFVDEEGDGGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for regulation of Arp2/3 complex by GMF.
pubmed doi rcsb
molecule tags Structural protein
molecule keywords Actin-related protein 3
total genus 38
structure length 139
sequence length 143
ec nomenclature
pdb deposition date 2013-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 4jd2G00
2P9UG 4JD2G 4XEIG 3UKRG 2P9KG 2P9PG 1U2VG 2P9LG 3DWLG 3DXKG 1TYQG 3UKUG 2P9SG 2P9NG 2P9IG 1K8KG 3RSEG 3ULEG 3DXMG
chains in the Genus database with same CATH superfamily
2IOLA 4FJYA 3JUIA 2PM6A 1IHGA 2KCLA 4JHKA 4KZCA 1N4QA 4ANXA 4L2LA 5AQAA 2PQRA 1K1AA 4F1SA 5AARA 3FTWA 4A3VA 2RG8A 1N4RA 2WXIA 2WXOA 3Q73A 4CZ2D 1QZ2A 2XENA 1IYGA 2ILRA 1U3CA 1H6KA 4GTOA 1QYMA 3FWVA 3ZYLA 2L9BA 3BEEA 3UPVA 3CK8A 4KVMA 4FLHA 4FHKA 2MHKA 4JVSA 4JEUA 4LRZA 1KZOA 2ETCA 3GYZA 3UIOC 5AYWD 3RKVA 3R9MA 1DVPA 5KNGA 3NOGD 2B6CA 4FLBA 3JQ1A 2A5EA 3UM2A 3DWLG 3D3MA 4JXTA 4HXIA 5CMYA 3Q47B 3TXNA 5JJ7A 5G2NA 3MKQA 5KCMA 5CMWA 3C3QA 5LFAA 1PC2A 5BPPA 2B0OE 3K9IA 4U8YD 2LAHA 2J8SD 3V79K 3DEPA 3JCKC 4XZ4A 4MLPA 3T5XA 1NP7A 2X6IA 3W9FA 2V5QC 1S0PA 5BV0A 5C2YA 4GZ6A 1TNOA 1G3NB 4B93B 4GZCA 5ENOD 4XI9A 4GB9A 4GTTA 2HM8A 4H7YA 3QDNA 3TG4A 3KEAA 2ETAA 4EECA 4KZ0A 3UT8A 3EIQC 4EBAA 2UY1B 4IYPA 4WAFA 4E85A 2LNIA 3LJ3A 4ZFHA 3NZSA 4F53A 2BKGA 3ZKJA 3I4GA 4HOTA 1BPOA 4B8CB 3RIBA 1SA4A 2OV8A 3I3NA 5ENSD 3CVWA 3DSVA 3V30A 5AJLA 4WNDA 4G23A 3LXUX 4XEIG 4I2WA 1MHQA 2X3MA 4I6GA 4BETA 3EHNA 3UKUG 2E2EA 3FU0A 4LERA 3EJNA 3FTSA 4YVQC 3SI5A 2P9UG 1XGWA 5KJNA 2I1JA 3HHMA 3TL5A 3DSWA 1E96B 2BF0X 5EN5D 3GZ2A 4EZLA 1MJ0A 3ZW3A 3E4BA 3SGHA 5AJDA 2J07A 4A3TA 1NI1A 4U0UA 4B8AA 3O4ZA 4RQIA 3I4RB 3UTMA 1JCSA 3G2VA 3T5VA 4ATGA 4QFVA 2XCCA 5LP0A 3C98A 3CLJA 3HVEB 1H6OA 2C0MA 2CFUA 2WXJA 1ELWA 3LEWA 3OXFA 3QK0A 3PVLA 4LSZE 2L0IA 2J49A 1K3ZD 2UY1A 1E8XA 3LY8A 4J8DA 3PS6A 5FJYA 3FU3A 4PS7A 4BX8A 4LCTA 4U07A 1EPUA 4JA9A 4B0ZA 4WNGA 2XRZA 3EHQA 3R7QA 1VDYA 1H2TC 3I5PA 5FTPA 5D66A 4KVOA 1E8ZA 2ZU6B 3PDNA 5CBNA 3OAWA 3AS5A 5G05J 4JZYA 4O60A 4FP7A 2J4BA 3ZU7B 1E7VA 2WXLA 4EHMA 2WMNA 4GMRA 5ITZF 3CVYA 5EX0A 2GRMA 2OVBA 2FO7A 1TYQG 4LEUA 1WM5A 3CHMA 3DSSA 2OEWA 2WQ7A 4ACKA 1QBQA 3L82A 4JEHA 2ZISA 4V3IA 2R02A 3CVUA 2BEDA 4XI0A 3WG7E 4Q96A 2CG2A 2R03A 1HZ4A 2VSYA 1E90A 1TJFA 2XPZA 4OAVB 1KT1A 4I6EA 2GRQB 4AY6A 3ZXPA 3FUDA 4H7XA 2KCKA 2LAIA 3V2OA 5IY5E 4JL0A 1N11A 4ILIA 2KZTB 3UQ3A 2X6JA 3PUKA 3RJVA 3EUVA 5AAOA 4HLEA 3CEQA 4Q69A 1SW6A 2LSUA 2PQNA 2CG3A 3EHRA 5ANRA 3DPYA 3NBNB 3PH0C 3PZ4A 4KT6B 3OXGA 3QKYA 2FO1E 3SFXA 1BLXB 4BFRA 4HOUA 2KM4A 4N3BA 4EBAG 4J0UA 1WAO1 1JWFA 3FDHA 4BESA 3HIZA 1Z3XA 1IQRA 4FADA 3D9MA 4F7AA 3UM1A 3QB2A 4UQZA 2X38A 1N54A 4KXKB 4LUNU 5JHAA 2F8XK 2YHCA 3LY9A 3ULEG 1MYOA 2JABA 3FY4A 2Y3AA 4FU3A 4U0SA 3ZEFA 3MCXA 1HF8A 3EU5A 2R05A 3ENEA 3JXIA 4MBGA 4TXPA 5EILA 2JLBA 1W3BA 3FU6A 3BG0B 4B89A 5CERB 5E76A 1V55E 2X6HA 4C9BB 4U0ZA 4EPZA 3TWQA 4A55A 4HRLA 1UN8A 3NOCD 3S7FA 2Y1LE 4WNFA 5JHBA 3R7RA 2DZNA 4JHRA 3FUKA 3MYVA 3PRZA 1NFIE 3NAWA 1XNFA 4F1PA 4O1PA 1HO8A 4U96D 3ZRHA 3QWPA 2Y4UA 3VLFA 1IQUA 4L23A 5CCMA 3UX4A 3CR3A 5T8IA 3TXMA 1EF1C 4CGVA 1TN6A 3F6QA 3JXJA 4N3AA 1YMPA 2A4ZA 3QARA 2V4HC 3CHQA 2HR2A 1JCRA 4Z68A 3LPZA 1OY3D 1TN8A 2MYOA 3B7TA 5BW8C 4HI9A 2RD0A 3FU5A 4FJZA 2HE0A 5FZSA 4BWRA 3AS4A 3Q7FA 1OCCE 4YDWA 2QC9A 4XX5A 2IJGX 1ZU2A 1H2VC 3PZ2A 5KJMA 3U3WA 4EQFA 2WXMA 1SQMA 4DI3A 1OCZE 1FT2A 1DCEA 3ULYA 5B1BE 3SD5A 2P9PG 2WXRA 3OXLA 5C1DA 3L6AA 2DYSE 1HX8A 3Q15A 1OWNA 1UJKA 3ML9A 5AQ9A 5JJ6A 4F6RD 4N5QA 3E33A 3ABME 4CYMD 3AG3E 2QFCA 2ZIRA 4NURA 3B7BA 5KNHD 3AU4A 4WWOA 3MV2B 2XEHA 1B89A 1RZ4A 2KC7A 3LKUA 4BSZB 4XKBA 4ACLA 2OCCE 2V8SE 3ZNGA 2QYJA 1TNYA 4JPSA 2AXVA 2LO6A 4QQIA 4YDEA 2LSVA 4CGWA 4DI4A 3P1UA 4U8VD 1BU9A 5ARFA 3DSUA 1KZPA 2QYUA 1IKND 4AY5A 4N2QA 4CDNA 2P2CP 4GA1A 3AAAC 3L22A 5ENRD 3ASHA 3SNXA 4Q94A 5B3SE 3BU8A 2GGFA 4I1OB 2WM9A 4HRNA 1FPPA 3HXBA 3CVQA 2KCVA 2WB2A 3ZFWA 2WXHA 1NL4A 5G04J 4AV7A 1OWMA 1H6PA 3KD7A 4XKCA 2VSXE 2R17C 4WWPA 2X6FA 5CEDB 4URKA 2XGSA 4A63B 3L17A 3DXMG 1UN9A 5KWDA 1S70B 4APOA 1U3DA 3HXCA 2VSOE 2DBAA 1SA5A 4IULA 1WDYA 3PNLB 3HXEA 1N0QA 4KMOA 4U7EB 3CQGB 1N4PA 3HXFA 4A1GA 1GW6A 5AQBA 2R2LA 5G05C 3SF4A 4C0EA 2Q7FA 4GCNA 4GAAA 4HB5A 4U04A 4BTBA 4AM9A 5J90A 1Z5SC 1NA3A 4FA6A 3VLDA 1O5MA 5BXUA 2AJAA 3SHFA 4W9RA 3B7UX 3U9WA 3DSXA 1FT1A 4LNBA 1PAQA 4GZ3A 2A5UA 4L1BA 2LXLA 5AIJA 4UI9C 3Q9NC 3CSTA 3APFA 2EILE 3Q5MA 1YA0A 4DX6D 3FFLA 1U2VG 1SZ9A 5LX8A 3TAXA 4DX2A 4MS6A 4RVBA 4EZJA 5KJLA 3FUEA 3QAQA 4HRMB 2XGOA 3MKRA 5CEAA 3TWWA 2I9CA 3G2SA 2GRNB 4YVOA 2XHEA 1HH8A 2H6HA 3FH7A 5EYPF 3V31A 2Y0BG 3CSFA 2M63A 4BT8A 1HE8A 4K5CA 3ZYKA 3U4TA 2VGXB 3KAEA 3CVNA 1D8EA 3TWXA 1MX4A 3PUJA 2PL2A 4CEMA 3HVEA 1K1BA 3FUNA 3AG2E 3G2TA 3LS8A 2DYRE 2V0PA 2VQ2A 1SVXA 1KPSB 3UT4A 3APCA 4BT9A 4JB8P 4K0RA 5H7PA 2BTDA 1OUVA 5BUZA 4IN3B 3UINC 3ZHEA 2AXUA 4A1SA 4N3CA 2OEVA 5EYLA 3IHYA 4GTVA 3NF1A 4RSYA 3CVXA 1OCOE 4XIFA 4G8KA 3V2XA 2X6KA 3ZVVA 4HOSA 4ME2A 4JW1A 3FUFA 3E32A 3QWVA 4UQYA 1MX2A 3PNTB 5ANLA 3U66A 4BEPA 3EHMA 3HYMB 5EIDA 5FWQA 4FHJA 4KBQA 1OCRE 2XCBA 4DJAA 3E37A 2WXNA 1BI8B 2FBNA 1DCQA 3E30A 2JEKA 3DBSA 1D8DA 3CHRA 1OWPA 1Y8MA 2CFZA 1N4SA 5FINA 1HG5A 2DZOA 3DRAA 4U8HA 2EIJE 5KJKA 3U64A 5CBOA 2F0YA 1TNBA 1OWLA 3AG4E 3MEKA 3S7DA 4D10C 3AS8A 5ENQD 4AXHA 3Q78A 2XEEA 5B1AE 4BERA 3C3RA 3DSTA 3LY7A 4GU5A 4JA7A 3DEOA 3C72A 2XS1A 4GA0A 4Y6CA 3IBEA 3ZHEB 3ASGA 4YDYA 4HFGA 3S7JA 4YNDA 3D9JA 3MJWA 5HQ8A 2YHEA 4E6HA 1WY6A 1N94A 2J09A 3DPDA 4UQXA 2KXPC 1LD7A 3FUJA 2VSNA 4GTPA 2ZGDA 3RU0A 1Z6TA 3VTXA 4G1TA 3GW4A 4NRHB 3QWWA 4RG6A 2GRRB 3T9KA 3ESKA 3IV0A 4L9PA 3ML8A 1LTXA 1MZCA 1X5BA 3MGBA 5T3RA 1O1SA 4GYYA 4MKTA 1HFAA 2DIWA 5BNWA 3FUHA 2KBXA 4FULA 3ZPJA 3LVRE 2VYIA 3ZGQA 1ELKA 1TNUA 4UI9J 3C3OA 4J8EA 4CT0A 3IKOB 5JA4D 3BUAA 5FQ7A 4TXQA 4BX9A 5A23A 2VTBA 3L16A 4J8SA 4BTAA 3D9PA 3BG1B 1IHBA 3TWRA 3ASFA 3SFZA 3CVLA 2L6JA 3IHVA 4ILGA 5JJTA 5M72A 3DXKG 2EINE 4J6IA 3RRUA 3WXXA 1D9SA 1P5QA 3CK7A 4PDXA 3APDA 2I6HA 4OVUA 3EIJA 2CHZA 4X8QA 3Q49B 4G25A 4ANVA 4KYOB 1X81A 2VJ8A 3D9IA 3B95A 2XPYA 2IU1A 3QC1A 2C0LA 1EDUA 1N9AA 3UM0A 3FTYA 4GPKA 2GRLA 4G8LA 1JUQA 3ZN3A 4DX7D 4GTMA 3ABLE 2WVIA 4RLYA 1E7UA 5A6CA 5T4YA 4DK5A 1N0RA 1N95A 3Q7AA 5HI7A 3SZ7A 4JD2G 2IF4A 2ZXWE 5FT9A 1ZBPA 3JQ0A 2P58C 3SY2A 4ANUA 1HU3A 2P9IG 3ZIMA 2XEVA 5BXOA 4PS3A 4UWFA 2R59A 3FULA 3KSQA 3PEVB 3EU9A 2L6BA 2EIKE 3SFYA 2XS8A 2XZDG 5AN8A 5G55A 4HORA 2OVFA 3G2UA 3IXEA 3PE3A 3ULQA 4ATZD 3AJIA 5EIBE 4MRUA 4L7TA 4GTSA 3CKCA 2MRIA 5HRYA 5FZQA 3D9KA 2IQCA 4I17A 5J08A 3VLEA 3MZLB 3TWUA 3B7RL 4GMJA 2LXMA 4GZDA 1O1RA 5FZRA 3E34A 1PY1A 4TUUA 2QZAA 3J5QB 1L5JA 2IY0C 4J8FA 3ASNE 2ZGGA 1ZB1A 2OOEA 2WXQA 3KSLA 1E8WA 2H6FA 3CQCB 3CHPA 4O6FA 3IEGA 2CHWA 4N5CA 3ZUVB 5EDSA 3ONLA 3ASDA 2WMOA 5ARGA 5ENNA 4G26A 3HXDA 4PUCA 3AG1E 3FH5A 4J8YA 5ENPD 4UI9K 3RO2A 1ELRA 2J08A 4NQ0A 3FTVA 4GZ5A 3TGOA 4GPMA 5CECB 3RO3A 3NQPA 4M3OA 3HDXA 1HXIA 1TEZA 4ILHB 4AP2A 4N39A 3LYAA 4HNAD 4DUIA 4DX5D 2PZIA 3ABKE 4AVXA 2YINA 5A7DB 5EX3A 1OXJA 1UJJA 4GA2A 4G24A 2R5SA 3D9HA 2P9LG 3LVQE 3R9AB 1WG0A 3FEYA 3MV3B 3SQVA 1LF8A 2HO1A 4UWLA 3RAUA 3T8MA 2P9KG 4UWHA 1JPLA 4GMLA 5D0QD 3JUEA 4I6JA 1BI7B 3W9GA 2RFMA 1NA0A 5DIZA 4R7LA 2WXGA 2AWIA 2Y69E 4HOQA 4HI8A 2FF4A 3EDTB 3HRAA 1K8KG 4YDOA 3B7SA 4NACA 1JCQA 2CHXA 5LCWJ 4LG6A 3L54A 3UMVA 4LNUD 2XQ0A 4NIKA 4LNGA 3FHEA 4EZKA 1UOHA 2WXPA 2GW1A 1HS6A 4HVBA 2F37A 4DX1A 3QNKA 1A5EA 4WWNA 3PZDA 5G04C 4GYWA 4GYOA 3RSEG 3AU5A 3L13A 1EYHA 1QQEA 1KLXA 2V4LA 3UUXA 3JYSA 5FQ8A 2AW6A 2ETBA 3TJPA 5CHEE 2EIME 2BUGA 3FTUA 2YNQA 2AXZA 1Q2ZA 2P9SG 3UM3A 2IFUA 3MKQB 2GRPB 3FTZA 3ZXSA 4ANWA 4O1OA 4GCOA 2FEZA 1H19A 5DBKA 2NYJA 2I2OA 1QNFA 4K5BA 4TV3A 4CDRA 4ZHBA 3KEZA 3ESLA 2L0TB 2RKKA 3FUMA 4DLQA 4HBDA 2VGYA 1S63A 3ISMC 2V5FA 1RW2A 3TWVA 1LD8A 3P2BA 2DCPA 4TUMA 2MOWA 2IOSA 5KBAA 4FC8A 3L08A 5CCLA 5D2MC 4RG9A 4HQDA 2H6GA 3PREA 1INZA 3UXGA 4OVVA 3ASOE 2F8YA 3ZYMA 3LDZA 2J9QA 1TN7A 2PNNA 1IXVA 3G2WA 2FI7A 4F3VA 2EQXA 4N2SA 3FH8A 3RRMB 1FVHA 5LOZA 4TRQA 4G11A 4M7CA 3CKBA 1SZAA 4HS2A 1YYHA 2NXPA 3QOUA 4CRWA 4I1AA 3N71A 2NC9A 4AJWA 2WQHA 5HKPA 4CDMA 3CVVA 3O48A 2QY7A 4L2YA 3FP3A 5CRUA 2WXFA 1A17A 2GROB 3J5PA 3Q9UC 4P29A 3S7BA 2UWJG 3ZYQA 1UG3A 3D9OA 3KS2A 4HLLA 1KT0A 4CT4A 3CV0A 5FQ6A 3B13A 3NB2A 4OYSA 4Y6WA 1H0AA 4U63A 3CGHA 4G2VA 2XZTG 3LJNA 4TXRA 3RRNB 2LUHA 4JC8A 4XE0A 3MA5A 3TWTA 2VGXA 5ENTD 2Y4TA 1H2UA 5HS0A 2KZTA 3PE4A 3BQOA 1FVFA 4WUYA 1NZNA 4U95D 2RFAA 1TJCA 3QJZA 3UKRG 1TNZA 4AOFA 2HYZA 1Z3YA 3L9TA 2C2LA 3GZSA 1UW4B 3UIPC 1AP7A 3PZ1A 3FTXA 3CHOA 4UUCA 2DWZA 4DPRA 2IONA 4WNEA 5E75A 4K5AB 5FQ4A 5EKQD 4DRXE 1FCHA 3TWSA 1DC2A 2KATA 3HG0D 4C48B 3TG5A 4DLOA 5CRVA 5D0OD 1BD8A 3NZUA 1JWGA 2P9NG 1N52A 2PM7A 3D9LA 4PH4B 4APFA 3S2AA 5FIOA 3Q75A 3GZ1A 3CK9A 4K03A 1O1TA 2XPIA 3FUIA 3OTNA 3ONKA 4I2ZA 4C0MA 4IRUA 1AWCB 1DNPA 2VTBB 4GTRA 2XGMA 1HG2A 2I1KA 1MQSA 1S64A 2NSZA 5LCWC 4UWGA 3Q4AB 3PZ3A 4I9EA 3URZA 5BV1A 2WXKA 2WQ6A 2AVPA 4BSXA 3Q79A 3RK6A 2ONDA 1OT8A 4JHJA 4BY6A 3D9NA 2XRYA 3PEUB 4GTQA 4UWKA 3SBSA 3FEXA 2YQ8A 2VGEA 4PS8A 4B94A 4AIFA 2IO2C 2FULA 3C5RA 5AQ7A 1Y6IA 4OAUC 4CCAA 3CIAA 3UI2A 5BT1A 1YCSB 4I43A 3X2QE 3CHSA 2IO3C 3LCAA 2E0IA 1OWOA 3SBTB 3T8KA 2IEJA 2DVWA 2BKKB 2J4DA 4I1MA 1E8YA 4J7WA 5AENA 3VTYA 3UT7A 2H6IA 3MX3A 4ABNA 1TR4A 3SO8A 3CVPA 1MX6A 4I9CA 2WPVA 5JMND 1V54E 4AEZC
chains in the Genus database with same CATH topology
2P9UG 4JD2G 4XEIG 3UKRG 2P9KG 2P9PG 1U2VG 2P9LG 3DWLG 3DXKG 1TYQG 3UKUG 2P9SG 2P9NG 2P9IG 1K8KG 3RSEG 3ULEG 3DXMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9U G;  4JD2 G;  4XEI G;  3UKR G;  2P9K G;  2P9P G;  1U2V G;  2P9L G;  3DWL G;  3DXK G;  1TYQ G;  3UKU G;  2P9S G;  2P9N G;  2P9I G;  1K8K G;  3RSE G;  3ULE G;  3DXM G; 
#chains in the Genus database with same CATH topology
 2IOL A;  4FJY A;  3JUI A;  2PM6 A;  1IHG A;  2KCL A;  4JHK A;  4KZC A;  1N4Q A;  4ANX A;  4L2L A;  5AQA A;  2PQR A;  1K1A A;  4F1S A;  5AAR A;  3FTW A;  4A3V A;  2RG8 A;  1N4R A;  2WXI A;  2WXO A;  3Q73 A;  4CZ2 D;  1QZ2 A;  2XEN A;  1IYG A;  2ILR A;  1U3C A;  1H6K A;  4GTO A;  1QYM A;  3FWV A;  3ZYL A;  2L9B A;  3BEE A;  3UPV A;  3CK8 A;  4KVM A;  4FLH A;  4FHK A;  2MHK A;  4JVS A;  4JEU A;  4LRZ A;  1KZO A;  2ETC A;  3GYZ A;  3UIO C;  5AYW D;  3RKV A;  3R9M A;  1DVP A;  5KNG A;  3NOG D;  2B6C A;  4FLB A;  3JQ1 A;  2A5E A;  3UM2 A;  3DWL G;  3D3M A;  4JXT A;  4HXI A;  5CMY A;  3Q47 B;  3TXN A;  5JJ7 A;  5G2N A;  3MKQ A;  5KCM A;  5CMW A;  3C3Q A;  5LFA A;  1PC2 A;  5BPP A;  2B0O E;  3K9I A;  4U8Y D;  2LAH A;  2J8S D;  3V79 K;  3DEP A;  3JCK C;  4XZ4 A;  4MLP A;  3T5X A;  1NP7 A;  2X6I A;  3W9F A;  2V5Q C;  1S0P A;  5BV0 A;  5C2Y A;  4GZ6 A;  1TNO A;  1G3N B;  4B93 B;  4GZC A;  5ENO D;  4XI9 A;  4GB9 A;  4GTT A;  2HM8 A;  4H7Y A;  3QDN A;  3TG4 A;  3KEA A;  2ETA A;  4EEC A;  4KZ0 A;  3UT8 A;  3EIQ C;  4EBA A;  2UY1 B;  4IYP A;  4WAF A;  4E85 A;  2LNI A;  3LJ3 A;  4ZFH A;  3NZS A;  4F53 A;  2BKG A;  3ZKJ A;  3I4G A;  4HOT A;  1BPO A;  4B8C B;  3RIB A;  1SA4 A;  2OV8 A;  3I3N A;  5ENS D;  3CVW A;  3DSV A;  3V30 A;  5AJL A;  4WND A;  4G23 A;  3LXU X;  4XEI G;  4I2W A;  1MHQ A;  2X3M A;  4I6G A;  4BET A;  3EHN A;  3UKU G;  2E2E A;  3FU0 A;  4LER A;  3EJN A;  3FTS A;  4YVQ C;  3SI5 A;  2P9U G;  1XGW A;  5KJN A;  2I1J A;  3HHM A;  3TL5 A;  3DSW A;  1E96 B;  2BF0 X;  5EN5 D;  3GZ2 A;  4EZL A;  1MJ0 A;  3ZW3 A;  3E4B A;  3SGH A;  5AJD A;  2J07 A;  4A3T A;  1NI1 A;  4U0U A;  4B8A A;  3O4Z A;  4RQI A;  3I4R B;  3UTM A;  1JCS A;  3G2V A;  3T5V A;  4ATG A;  4QFV A;  2XCC A;  5LP0 A;  3C98 A;  3CLJ A;  3HVE B;  1H6O A;  2C0M A;  2CFU A;  2WXJ A;  1ELW A;  3LEW A;  3OXF A;  3QK0 A;  3PVL A;  4LSZ E;  2L0I A;  2J49 A;  1K3Z D;  2UY1 A;  1E8X A;  3LY8 A;  4J8D A;  3PS6 A;  5FJY A;  3FU3 A;  4PS7 A;  4BX8 A;  4LCT A;  4U07 A;  1EPU A;  4JA9 A;  4B0Z A;  4WNG A;  2XRZ A;  3EHQ A;  3R7Q A;  1VDY A;  1H2T C;  3I5P A;  5FTP A;  5D66 A;  4KVO A;  1E8Z A;  2ZU6 B;  3PDN A;  5CBN A;  3OAW A;  3AS5 A;  5G05 J;  4JZY A;  4O60 A;  4FP7 A;  2J4B A;  3ZU7 B;  1E7V A;  2WXL A;  4EHM A;  2WMN A;  4GMR A;  5ITZ F;  3CVY A;  5EX0 A;  2GRM A;  2OVB A;  2FO7 A;  1TYQ G;  4LEU A;  1WM5 A;  3CHM A;  3DSS A;  2OEW A;  2WQ7 A;  4ACK A;  1QBQ A;  3L82 A;  4JEH A;  2ZIS A;  4V3I A;  2R02 A;  3CVU A;  2BED A;  4XI0 A;  3WG7 E;  4Q96 A;  2CG2 A;  2R03 A;  1HZ4 A;  2VSY A;  1E90 A;  1TJF A;  2XPZ A;  4OAV B;  1KT1 A;  4I6E A;  2GRQ B;  4AY6 A;  3ZXP A;  3FUD A;  4H7X A;  2KCK A;  2LAI A;  3V2O A;  5IY5 E;  4JL0 A;  1N11 A;  4ILI A;  2KZT B;  3UQ3 A;  2X6J A;  3PUK A;  3RJV A;  3EUV A;  5AAO A;  4HLE A;  3CEQ A;  4Q69 A;  1SW6 A;  2LSU A;  2PQN A;  2CG3 A;  3EHR A;  5ANR A;  3DPY A;  3NBN B;  3PH0 C;  3PZ4 A;  4KT6 B;  3OXG A;  3QKY A;  2FO1 E;  3SFX A;  1BLX B;  4BFR A;  4HOU A;  2KM4 A;  4N3B A;  4EBA G;  4J0U A;  1WAO 1;  1JWF A;  3FDH A;  4BES A;  3HIZ A;  1Z3X A;  1IQR A;  4FAD A;  3D9M A;  4F7A A;  3UM1 A;  3QB2 A;  4UQZ A;  2X38 A;  1N54 A;  4KXK B;  4LUN U;  5JHA A;  2F8X K;  2YHC A;  3LY9 A;  3ULE G;  1MYO A;  2JAB A;  3FY4 A;  2Y3A A;  4FU3 A;  4U0S A;  3ZEF A;  3MCX A;  1HF8 A;  3EU5 A;  2R05 A;  3ENE A;  3JXI A;  4MBG A;  4TXP A;  5EIL A;  2JLB A;  1W3B A;  3FU6 A;  3BG0 B;  4B89 A;  5CER B;  5E76 A;  1V55 E;  2X6H A;  4C9B B;  4U0Z A;  4EPZ A;  3TWQ A;  4A55 A;  4HRL A;  1UN8 A;  3NOC D;  3S7F A;  2Y1L E;  4WNF A;  5JHB A;  3R7R A;  2DZN A;  4JHR A;  3FUK A;  3MYV A;  3PRZ A;  1NFI E;  3NAW A;  1XNF A;  4F1P A;  4O1P A;  1HO8 A;  4U96 D;  3ZRH A;  3QWP A;  2Y4U A;  3VLF A;  1IQU A;  4L23 A;  5CCM A;  3UX4 A;  3CR3 A;  5T8I A;  3TXM A;  1EF1 C;  4CGV A;  1TN6 A;  3F6Q A;  3JXJ A;  4N3A A;  1YMP A;  2A4Z A;  3QAR A;  2V4H C;  3CHQ A;  2HR2 A;  1JCR A;  4Z68 A;  3LPZ A;  1OY3 D;  1TN8 A;  2MYO A;  3B7T A;  5BW8 C;  4HI9 A;  2RD0 A;  3FU5 A;  4FJZ A;  2HE0 A;  5FZS A;  4BWR A;  3AS4 A;  3Q7F A;  1OCC E;  4YDW A;  2QC9 A;  4XX5 A;  2IJG X;  1ZU2 A;  1H2V C;  3PZ2 A;  5KJM A;  3U3W A;  4EQF A;  2WXM A;  1SQM A;  4DI3 A;  1OCZ E;  1FT2 A;  1DCE A;  3ULY A;  5B1B E;  3SD5 A;  2P9P G;  2WXR A;  3OXL A;  5C1D A;  3L6A A;  2DYS E;  1HX8 A;  3Q15 A;  1OWN A;  1UJK A;  3ML9 A;  5AQ9 A;  5JJ6 A;  4F6R D;  4N5Q A;  3E33 A;  3ABM E;  4CYM D;  3AG3 E;  2QFC A;  2ZIR A;  4NUR A;  3B7B A;  5KNH D;  3AU4 A;  4WWO A;  3MV2 B;  2XEH A;  1B89 A;  1RZ4 A;  2KC7 A;  3LKU A;  4BSZ B;  4XKB A;  4ACL A;  2OCC E;  2V8S E;  3ZNG A;  2QYJ A;  1TNY A;  4JPS A;  2AXV A;  2LO6 A;  4QQI A;  4YDE A;  2LSV A;  4CGW A;  4DI4 A;  3P1U A;  4U8V D;  1BU9 A;  5ARF A;  3DSU A;  1KZP A;  2QYU A;  1IKN D;  4AY5 A;  4N2Q A;  4CDN A;  2P2C P;  4GA1 A;  3AAA C;  3L22 A;  5ENR D;  3ASH A;  3SNX A;  4Q94 A;  5B3S E;  3BU8 A;  2GGF A;  4I1O B;  2WM9 A;  4HRN A;  1FPP A;  3HXB A;  3CVQ A;  2KCV A;  2WB2 A;  3ZFW A;  2WXH A;  1NL4 A;  5G04 J;  4AV7 A;  1OWM A;  1H6P A;  3KD7 A;  4XKC A;  2VSX E;  2R17 C;  4WWP A;  2X6F A;  5CED B;  4URK A;  2XGS A;  4A63 B;  3L17 A;  3DXM G;  1UN9 A;  5KWD A;  1S70 B;  4APO A;  1U3D A;  3HXC A;  2VSO E;  2DBA A;  1SA5 A;  4IUL A;  1WDY A;  3PNL B;  3HXE A;  1N0Q A;  4KMO A;  4U7E B;  3CQG B;  1N4P A;  3HXF A;  4A1G A;  1GW6 A;  5AQB A;  2R2L A;  5G05 C;  3SF4 A;  4C0E A;  2Q7F A;  4GCN A;  4GAA A;  4HB5 A;  4U04 A;  4BTB A;  4AM9 A;  5J90 A;  1Z5S C;  1NA3 A;  4FA6 A;  3VLD A;  1O5M A;  5BXU A;  2AJA A;  3SHF A;  4W9R A;  3B7U X;  3U9W A;  3DSX A;  1FT1 A;  4LNB A;  1PAQ A;  4GZ3 A;  2A5U A;  4L1B A;  2LXL A;  5AIJ A;  4UI9 C;  3Q9N C;  3CST A;  3APF A;  2EIL E;  3Q5M A;  1YA0 A;  4DX6 D;  3FFL A;  1U2V G;  1SZ9 A;  5LX8 A;  3TAX A;  4DX2 A;  4MS6 A;  4RVB A;  4EZJ A;  5KJL A;  3FUE A;  3QAQ A;  4HRM B;  2XGO A;  3MKR A;  5CEA A;  3TWW A;  2I9C A;  3G2S A;  2GRN B;  4YVO A;  2XHE A;  1HH8 A;  2H6H A;  3FH7 A;  5EYP F;  3V31 A;  2Y0B G;  3CSF A;  2M63 A;  4BT8 A;  1HE8 A;  4K5C A;  3ZYK A;  3U4T A;  2VGX B;  3KAE A;  3CVN A;  1D8E A;  3TWX A;  1MX4 A;  3PUJ A;  2PL2 A;  4CEM A;  3HVE A;  1K1B A;  3FUN A;  3AG2 E;  3G2T A;  3LS8 A;  2DYR E;  2V0P A;  2VQ2 A;  1SVX A;  1KPS B;  3UT4 A;  3APC A;  4BT9 A;  4JB8 P;  4K0R A;  5H7P A;  2BTD A;  1OUV A;  5BUZ A;  4IN3 B;  3UIN C;  3ZHE A;  2AXU A;  4A1S A;  4N3C A;  2OEV A;  5EYL A;  3IHY A;  4GTV A;  3NF1 A;  4RSY A;  3CVX A;  1OCO E;  4XIF A;  4G8K A;  3V2X A;  2X6K A;  3ZVV A;  4HOS A;  4ME2 A;  4JW1 A;  3FUF A;  3E32 A;  3QWV A;  4UQY A;  1MX2 A;  3PNT B;  5ANL A;  3U66 A;  4BEP A;  3EHM A;  3HYM B;  5EID A;  5FWQ A;  4FHJ A;  4KBQ A;  1OCR E;  2XCB A;  4DJA A;  3E37 A;  2WXN A;  1BI8 B;  2FBN A;  1DCQ A;  3E30 A;  2JEK A;  3DBS A;  1D8D A;  3CHR A;  1OWP A;  1Y8M A;  2CFZ A;  1N4S A;  5FIN A;  1HG5 A;  2DZO A;  3DRA A;  4U8H A;  2EIJ E;  5KJK A;  3U64 A;  5CBO A;  2F0Y A;  1TNB A;  1OWL A;  3AG4 E;  3MEK A;  3S7D A;  4D10 C;  3AS8 A;  5ENQ D;  4AXH A;  3Q78 A;  2XEE A;  5B1A E;  4BER A;  3C3R A;  3DST A;  3LY7 A;  4GU5 A;  4JA7 A;  3DEO A;  3C72 A;  2XS1 A;  4GA0 A;  4Y6C A;  3IBE A;  3ZHE B;  3ASG A;  4YDY A;  4HFG A;  3S7J A;  4YND A;  3D9J A;  3MJW A;  5HQ8 A;  2YHE A;  4E6H A;  1WY6 A;  1N94 A;  2J09 A;  3DPD A;  4UQX A;  2KXP C;  1LD7 A;  3FUJ A;  2VSN A;  4GTP A;  2ZGD A;  3RU0 A;  1Z6T A;  3VTX A;  4G1T A;  3GW4 A;  4NRH B;  3QWW A;  4RG6 A;  2GRR B;  3T9K A;  3ESK A;  3IV0 A;  4L9P A;  3ML8 A;  1LTX A;  1MZC A;  1X5B A;  3MGB A;  5T3R A;  1O1S A;  4GYY A;  4MKT A;  1HFA A;  2DIW A;  5BNW A;  3FUH A;  2KBX A;  4FUL A;  3ZPJ A;  3LVR E;  2VYI A;  3ZGQ A;  1ELK A;  1TNU A;  4UI9 J;  3C3O A;  4J8E A;  4CT0 A;  3IKO B;  5JA4 D;  3BUA A;  5FQ7 A;  4TXQ A;  4BX9 A;  5A23 A;  2VTB A;  3L16 A;  4J8S A;  4BTA A;  3D9P A;  3BG1 B;  1IHB A;  3TWR A;  3ASF A;  3SFZ A;  3CVL A;  2L6J A;  3IHV A;  4ILG A;  5JJT A;  5M72 A;  3DXK G;  2EIN E;  4J6I A;  3RRU A;  3WXX A;  1D9S A;  1P5Q A;  3CK7 A;  4PDX A;  3APD A;  2I6H A;  4OVU A;  3EIJ A;  2CHZ A;  4X8Q A;  3Q49 B;  4G25 A;  4ANV A;  4KYO B;  1X81 A;  2VJ8 A;  3D9I A;  3B95 A;  2XPY A;  2IU1 A;  3QC1 A;  2C0L A;  1EDU A;  1N9A A;  3UM0 A;  3FTY A;  4GPK A;  2GRL A;  4G8L A;  1JUQ A;  3ZN3 A;  4DX7 D;  4GTM A;  3ABL E;  2WVI A;  4RLY A;  1E7U A;  5A6C A;  5T4Y A;  4DK5 A;  1N0R A;  1N95 A;  3Q7A A;  5HI7 A;  3SZ7 A;  4JD2 G;  2IF4 A;  2ZXW E;  5FT9 A;  1ZBP A;  3JQ0 A;  2P58 C;  3SY2 A;  4ANU A;  1HU3 A;  2P9I G;  3ZIM A;  2XEV A;  5BXO A;  4PS3 A;  4UWF A;  2R59 A;  3FUL A;  3KSQ A;  3PEV B;  3EU9 A;  2L6B A;  2EIK E;  3SFY A;  2XS8 A;  2XZD G;  5AN8 A;  5G55 A;  4HOR A;  2OVF A;  3G2U A;  3IXE A;  3PE3 A;  3ULQ A;  4ATZ D;  3AJI A;  5EIB E;  4MRU A;  4L7T A;  4GTS A;  3CKC A;  2MRI A;  5HRY A;  5FZQ A;  3D9K A;  2IQC A;  4I17 A;  5J08 A;  3VLE A;  3MZL B;  3TWU A;  3B7R L;  4GMJ A;  2LXM A;  4GZD A;  1O1R A;  5FZR A;  3E34 A;  1PY1 A;  4TUU A;  2QZA A;  3J5Q B;  1L5J A;  2IY0 C;  4J8F A;  3ASN E;  2ZGG A;  1ZB1 A;  2OOE A;  2WXQ A;  3KSL A;  1E8W A;  2H6F A;  3CQC B;  3CHP A;  4O6F A;  3IEG A;  2CHW A;  4N5C A;  3ZUV B;  5EDS A;  3ONL A;  3ASD A;  2WMO A;  5ARG A;  5ENN A;  4G26 A;  3HXD A;  4PUC A;  3AG1 E;  3FH5 A;  4J8Y A;  5ENP D;  4UI9 K;  3RO2 A;  1ELR A;  2J08 A;  4NQ0 A;  3FTV A;  4GZ5 A;  3TGO A;  4GPM A;  5CEC B;  3RO3 A;  3NQP A;  4M3O A;  3HDX A;  1HXI A;  1TEZ A;  4ILH B;  4AP2 A;  4N39 A;  3LYA A;  4HNA D;  4DUI A;  4DX5 D;  2PZI A;  3ABK E;  4AVX A;  2YIN A;  5A7D B;  5EX3 A;  1OXJ A;  1UJJ A;  4GA2 A;  4G24 A;  2R5S A;  3D9H A;  2P9L G;  3LVQ E;  3R9A B;  1WG0 A;  3FEY A;  3MV3 B;  3SQV A;  1LF8 A;  2HO1 A;  4UWL A;  3RAU A;  3T8M A;  2P9K G;  4UWH A;  1JPL A;  4GML A;  5D0Q D;  3JUE A;  4I6J A;  1BI7 B;  3W9G A;  2RFM A;  1NA0 A;  5DIZ A;  4R7L A;  2WXG A;  2AWI A;  2Y69 E;  4HOQ A;  4HI8 A;  2FF4 A;  3EDT B;  3HRA A;  1K8K G;  4YDO A;  3B7S A;  4NAC A;  1JCQ A;  2CHX A;  5LCW J;  4LG6 A;  3L54 A;  3UMV A;  4LNU D;  2XQ0 A;  4NIK A;  4LNG A;  3FHE A;  4EZK A;  1UOH A;  2WXP A;  2GW1 A;  1HS6 A;  4HVB A;  2F37 A;  4DX1 A;  3QNK A;  1A5E A;  4WWN A;  3PZD A;  5G04 C;  4GYW A;  4GYO A;  3RSE G;  3AU5 A;  3L13 A;  1EYH A;  1QQE A;  1KLX A;  2V4L A;  3UUX A;  3JYS A;  5FQ8 A;  2AW6 A;  2ETB A;  3TJP A;  5CHE E;  2EIM E;  2BUG A;  3FTU A;  2YNQ A;  2AXZ A;  1Q2Z A;  2P9S G;  3UM3 A;  2IFU A;  3MKQ B;  2GRP B;  3FTZ A;  3ZXS A;  4ANW A;  4O1O A;  4GCO A;  2FEZ A;  1H19 A;  5DBK A;  2NYJ A;  2I2O A;  1QNF A;  4K5B A;  4TV3 A;  4CDR A;  4ZHB A;  3KEZ A;  3ESL A;  2L0T B;  2RKK A;  3FUM A;  4DLQ A;  4HBD A;  2VGY A;  1S63 A;  3ISM C;  2V5F A;  1RW2 A;  3TWV A;  1LD8 A;  3P2B A;  2DCP A;  4TUM A;  2MOW A;  2IOS A;  5KBA A;  4FC8 A;  3L08 A;  5CCL A;  5D2M C;  4RG9 A;  4HQD A;  2H6G A;  3PRE A;  1INZ A;  3UXG A;  4OVV A;  3ASO E;  2F8Y A;  3ZYM A;  3LDZ A;  2J9Q A;  1TN7 A;  2PNN A;  1IXV A;  3G2W A;  2FI7 A;  4F3V A;  2EQX A;  4N2S A;  3FH8 A;  3RRM B;  1FVH A;  5LOZ A;  4TRQ A;  4G11 A;  4M7C A;  3CKB A;  1SZA A;  4HS2 A;  1YYH A;  2NXP A;  3QOU A;  4CRW A;  4I1A A;  3N71 A;  2NC9 A;  4AJW A;  2WQH A;  5HKP A;  4CDM A;  3CVV A;  3O48 A;  2QY7 A;  4L2Y A;  3FP3 A;  5CRU A;  2WXF A;  1A17 A;  2GRO B;  3J5P A;  3Q9U C;  4P29 A;  3S7B A;  2UWJ G;  3ZYQ A;  1UG3 A;  3D9O A;  3KS2 A;  4HLL A;  1KT0 A;  4CT4 A;  3CV0 A;  5FQ6 A;  3B13 A;  3NB2 A;  4OYS A;  4Y6W A;  1H0A A;  4U63 A;  3CGH A;  4G2V A;  2XZT G;  3LJN A;  4TXR A;  3RRN B;  2LUH A;  4JC8 A;  4XE0 A;  3MA5 A;  3TWT A;  2VGX A;  5ENT D;  2Y4T A;  1H2U A;  5HS0 A;  2KZT A;  3PE4 A;  3BQO A;  1FVF A;  4WUY A;  1NZN A;  4U95 D;  2RFA A;  1TJC A;  3QJZ A;  3UKR G;  1TNZ A;  4AOF A;  2HYZ A;  1Z3Y A;  3L9T A;  2C2L A;  3GZS A;  1UW4 B;  3UIP C;  1AP7 A;  3PZ1 A;  3FTX A;  3CHO A;  4UUC A;  2DWZ A;  4DPR A;  2ION A;  4WNE A;  5E75 A;  4K5A B;  5FQ4 A;  5EKQ D;  4DRX E;  1FCH A;  3TWS A;  1DC2 A;  2KAT A;  3HG0 D;  4C48 B;  3TG5 A;  4DLO A;  5CRV A;  5D0O D;  1BD8 A;  3NZU A;  1JWG A;  2P9N G;  1N52 A;  2PM7 A;  3D9L A;  4PH4 B;  4APF A;  3S2A A;  5FIO A;  3Q75 A;  3GZ1 A;  3CK9 A;  4K03 A;  1O1T A;  2XPI A;  3FUI A;  3OTN A;  3ONK A;  4I2Z A;  4C0M A;  4IRU A;  1AWC B;  1DNP A;  2VTB B;  4GTR A;  2XGM A;  1HG2 A;  2I1K A;  1MQS A;  1S64 A;  2NSZ A;  5LCW C;  4UWG A;  3Q4A B;  3PZ3 A;  4I9E A;  3URZ A;  5BV1 A;  2WXK A;  2WQ6 A;  2AVP A;  4BSX A;  3Q79 A;  3RK6 A;  2OND A;  1OT8 A;  4JHJ A;  4BY6 A;  3D9N A;  2XRY A;  3PEU B;  4GTQ A;  4UWK A;  3SBS A;  3FEX A;  2YQ8 A;  2VGE A;  4PS8 A;  4B94 A;  4AIF A;  2IO2 C;  2FUL A;  3C5R A;  5AQ7 A;  1Y6I A;  4OAU C;  4CCA A;  3CIA A;  3UI2 A;  5BT1 A;  1YCS B;  4I43 A;  3X2Q E;  3CHS A;  2IO3 C;  3LCA A;  2E0I A;  1OWO A;  3SBT B;  3T8K A;  2IEJ A;  2DVW A;  2BKK B;  2J4D A;  4I1M A;  1E8Y A;  4J7W A;  5AEN A;  3VTY A;  3UT7 A;  2H6I A;  3MX3 A;  4ABN A;  1TR4 A;  3SO8 A;  3CVP A;  1MX6 A;  4I9C A;  2WPV A;  5JMN D;  1V54 E;  4AEZ C; 
#chains in the Genus database with same CATH homology
 2P9U G;  4JD2 G;  4XEI G;  3UKR G;  2P9K G;  2P9P G;  1U2V G;  2P9L G;  3DWL G;  3DXK G;  1TYQ G;  3UKU G;  2P9S G;  2P9N G;  2P9I G;  1K8K G;  3RSE G;  3ULE G;  3DXM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...