1HF8A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Clathrin
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 102
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hf8A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hf8A01
2LO6A 2QY7A 1UJJA 2L0IA 4Q96A 1UJKA 3CLJA 4Q94A 1XGWA 2MOWA 4GZDA 5LP0A 1JUQA 1HX8A 4AVXA 3ZYKA 1DVPA 1ELKA 3D9LA 5LOZA 3ZYLA 1MHQA 2DCPA 3G2WA 1INZA 4GZCA 5CMWA 2BF0X 2DIWA 3G2TA 3LDZA 1LF8A 1SZAA 4FU3A 3ZYQA 1HFAA 4JXTA 1HG5A 4HFGA 2V8SE 1EDUA 3D9OA 1SZ9A 3ZYMA 1X5BA 5CMYA 5J08A 1HG2A 3G2UA 3D9PA 1PY1A 2L0TB 4NACA 3G2SA 1EYHA 1VDYA 3D9JA 1JWFA 1JPLA 3D9KA 3D9IA 3G2VA 3D9MA 3D9NA 3ONKA 1JWGA 3RRUA 3ONLA 1HF8A 2KM4A 4FLBA 1H0AA
chains in the Genus database with same CATH superfamily
3D0TA 4GK5E 2LM9A 4KP3C 5CEAA 1YQ3A 2C5IT 4DUYT 3QKYA 1OEDA 3KEZA 4LCTA 3U3IA 2DCPA 2YKSA 4GAAA 2NOXA 4DMVA 3JXJA 3W9GA 1NZNA 2H6IA 5J90A 5L4HA 3AU4A 2BKGA 1K1BA 2KWIB 5LXTE 3GN5B 4PS7A 2E9XA 4EIWA 3RH3A 3A5XA 4P1NA 4YHJA 2VK9A 1MZCA 3JXIA 4QX7B 3P2BA 1BI8B 1KZOA 5G55A 5LMNT 4R7LA 5ARGA 3TAXA 3AE5A 4O4HE 5CA0E 5FMNA 1H7CA 2XQ3A 5T4YA 5LCWJ 5LB7B 2WXQA 1GQEA 2L6JA 2WQHA 2L3LA 3ISMC 4O60A 2FO7A 2UY1B 4CQIA 4ERRA 1TN8A 4ANUA 3C4ZA 3QB2A 3MYVA 3ZMVB 4PJMA 4TV8E 1HG2A 3CQGB 4XI9A 3C64A 2ZU6B 2KT9A 2V5DA 2X9YA 4UQZA 3ZMZB 2JMHA 2LSGA 3CX7B 4BWRA 3P4QA 5A7DB 4DIDB 4YVOA 3PE0A 5JR9B 3NAWA 1E96B 2AE9A 1LTXA 4YJ3E 4QXCB 3UUXB 2C0SA 3B7SA 1N4QA 4PJLA 3QJZA 1G73A 4HOQA 3BG0B 5LGTB 3UM2A 1LKXA 3RKGA 3ZYQA 3UFGA 4HFCA 2VASA 3AECA 4JUYA 4ZZBA 3CHOA 1LVKA 3PUAA 2M63A 3WXXA 5CMYA 3FTSA 5AQTB 5HCJA 2F8YA 3UXGA 2VTBA 5BT1A 2L0TB 3UT4A 3EU9A 3CVUA 3MEKA 3WG7E 5EK2A 1E90A 4EBAA 2PM7A 2XAJB 1IXVA 2J07A 3NRXA 4G24A 2KCKA 4MRUA 1WLXA 2A3DA 1T8BA 2WCAA 4GK0E 2KXPC 1KNPA 3HG0D 2R02A 3SOLA 3F6QA 2CRBA 1YXRA 3L16A 4B93B 2I1KA 5CJ5A 2IOLA 2JABA 3RIAA 2ETAA 4HFGA 4K5CA 4GCNA 4CDNA 4N5QA 2XHEB 3L82A 4KT6B 2IIUA 1PAQA 3EU5A 4A1SA 4ATGA 2PL2A 3TWRA 1OCRE 2XASB 3RIFA 2OVBA 2XEHA 2XZEA 4U74A 4IULA 2VYIA 5FL0A 3MA9A 2MYOA 4GTTA 2AXUA 1S0PA 4AXPA 4HB5A 4Q25A 4IHJE 4WNEA 4AM9A 3FDHA 5LBQB 3FUMA 4PK6A 3F2EA 4JI8T 3R7RA 4GYRA 4TUMA 3X2QE 2A4ZA 3SD5A 5DABA 2CLYC 3UQ7A 4LUNU 2H89A 1H2TC 4GA0A 1N4PA 4DV3T 2IW5B 5AQNB 5CRUA 3N71A 2FJBA 5LOVE 4L9IA 4HXIA 3ZNGA 4Q96A 1UJKA 2V6YA 5JDHA 4UUCA 2VL8A 2NTYA 2ONDA 2NW9A 3MV3B 3Q15A 3JAEA 4HEAA 3CX8B 4YY3T 3T9KA 3MZKB 4JLEA 2XGSA 3FHNA 5FY1A 4U0ZA 5AENA 4JI1T 1SUMB 3Q5XA 3E0ZA 1MIVA 5AQBA 4U72A 3AEEA 1UURA 2X0LB 1ZP0A 4UVCB 4CRWA 4V3IA 5LOZA 1KLXA 2WXFA 5KJLA 2F37A 5LX8A 2QYUA 4ILIA 4WNGA 5FZQA 2KBXA 4GMLA 4JC8A 4LF7T 4G63A 3N9QA 1D0ZA 3NZSA 4EV6A 5JDGA 4ANXA 2V7MA 2GROB 2ZMAA 4PAGA 2KZTB 3D9MA 2GK9A 4WWPA 4HFBA 3PEVB 3ZMTB 3DSSA 2KNDA 5D0QD 3VLEA 4L2LA 4YFSA 5CA1E 2MYSA 1ZHCA 1ZV4X 2XSBA 3HI2A 2V4HC 3LSVA 3ZYLA 4DR2T 2WQ6A 2H88A 3L54A 3R84B 1AWCB 3C72A 2AJAA 2WBLA 3GW4A 2X9XA 4DBRA 1M7KA 2EHOC 1FT2A 2KINB 3EHZA 4QXBB 4DLOA 3F31A 3QB5K 4DLQA 2I6HA 3AE4A 3DPDA 3ML8A 1YQ4A 4YDOA 4LNGA 2BS2A 2UU9T 4KYOB 4AY5A 4UF0B 3ZXSA 1BI7B 5AQLB 1IKND 3ZT6A 4AOFA 4GZCA 5AYWD 3VLFA 5FWQA 4MLPA 3U9WA 3ULEG 3AE2A 1E8WA 2IDOB 3HDXA 1OWAA 1L0VA 4TNWA 3N9NA 1HE8A 2ZGGA 5KXJA 2J4GA 5KCMA 1HNXT 4I6EA 4IE4A 5FTPA 3D9JA 3O1IA 3B57A 3OKQA 1O1RA 5FXXA 3FZLB 2LKGA 5FINA 3SQVA 3I4GA 2MOWA 2VQ2A 2J4BA 4XEIG 4NUUA 2E0IA 3CVWA 4HFEA 3FUEA 5BPPA 2HM8A 1U4QA 2J08A 2XQ0A 4I6JA 1TNUA 4AQGA 5KWDA 2OLTA 4O4IE 2ZLYA 4X8QA 5J08A 5C3JA 2FF4A 4GYSA 2EHOA 2LJLA 1TNBA 2E2AA 1U2VG 5ITZF 3RYHE 4DR1T 3N9OA 3IHYA 4ZI3D 3D9LA 4LF9T 3JADA 2A9UA 1EF1C 2J47A 3PVLA 5EDSA 5EILA 4WYVA 2XS8A 1U3DA 3AG1E 4IYPA 5HXHA 2WPVA 2PQRA 2X6FA 3M65A 2KATA 2M67A 3FB2A 3FHEA 5LA6E 2EHOB 4U07A 2DYSE 1HU3A 5IUXA 3VR8A 4G25A 2IONA 5FVKA 5AQSB 4EB6E 1N54A 2E5LT 3IHVA 4QH4A 1SHZC 2A2FX 2IC9A 2I0MA 4OVUA 5HRYA 4LF5T 4GIWA 3PUWF 4JI5T 4DRXE 5KBAA 4DX6D 2WVIA 5LP6E 5AQFB 3C3OA 1MIYA 1XMOT 3D9HA 4WWOA 3D9OA 2PG8A 2K48A 3PDYA 2E9XB 5LYJE 2IU1A 3EDTB 1ZBPA 1MMNA 2QRXA 3PZ1A 2QC9A 1MX4A 1IBMT 3NWIA 4U8HA 5HEHA 3O4ZA 3HA4A 2L9BA 3ESKA 3MZLB 2AW6A 1P5QA 3UM1A 1Y01A 2UWJG 2FO1E 1U3CA 3TJPA 5AQPB 4LERA 4J6IA 2WXLA 2BF0X 1XMQT 5CFBA 2DIWA 1IJ5A 4TWHA 2KC7A 3I0OA 3QNKA 4HOTA 2WB5A 4ZZCA 5H6RB 3SWHA 1MQSA 3Q78A 2A5EA 1H6PA 4I50E 4DPRA 3D9NA 5G05C 3FTXA 4NIQA 3TLVA 2IF4A 2P9LG 1W3BA 3N9PA 3NKZA 4WNDA 4AP2A 3Q5DA 5FQ4A 3V5UA 2CG3A 4HI8A 4J8YA 3K3NA 3ETUA 4IGUA 2PM6A 4UWGA 1A5EA 1XWMA 2XZDG 4J8FA 3QAQA 3SFXA 3AEDA 2WXGA 2XQ7A 5AQQB 2BVMA 1X79A 1LD8A 1TNYA 4LG6A 3LY8A 5LGNB 3HHMA 1JWGA 3W15B 1FPPA 1TYQG 4CXWA 2LNIA 5AQUB 3KVBA 2KLQA 4BA9A 1FJGT 4TUYE 4J8EA 4GA1A 4Q94A 2CFZA 2SPCA 2GRNB 4AVXA 4X5TA 3ZYKA 3SRZA 3DRAA 3EHMA 5ABGA 2LM2A 3SBTB 4EBAG 3MKDA 2PTFA 5JRCB 4H9NC 4GTOA 3CVRA 3OJAA 4YXDA 5LG3A 1O1TA 5H6QB 2I9CA 2NC9A 3DSVA 5B1AE 1IJ6A 3ZPOA 3CVQA 1KNRA 5CBNA 3UX4A 5HWXA 3ONKA 3L17A 1VOMA 1V9DA 1K1AA 4GYYA 5AQMB 2X38A 4WBOA 3DEOA 5G04J 1TEZA 1H6OA 1N0QA 1JCRA 4YDYA 2ETCA 5HQ8A 3L3PA 1ZKEA 5FQ7A 4BY6A 5FYMA 3AJIA 1SA5A 4GPMA 2XAQB 1MNDA 4EZ4A 4IE7A 4K0RA 2W62A 3TLTA 3K1SA 1JPLA 3I5PA 4GKJT 3S7DA 1X81A 4YLHA 2L0IA 2DI4A 2VGYA 2VWAA 3LVRE 2J9QA 4HRNA 3TGOA 4AJWA 4TV9E 2XENA 4MLKA 4OK0A 3FTYA 1TNOA 5J2UE 2KCLA 4U7IA 5EX3A 4GOUA 3ZHEB 5L3FB 4PDXA 4LF8T 4QH1A 2EHOD 1SQMA 4KZCA 3AEFA 2OV8A 3LYAA 4E6HA 3Q5EA 5T3RA 2X67A 1UK5A 4PS8A 3TWQA 3KDSE 1SA0E 3TWUA 2IHR1 2X0HA 1MMAA 2J49A 4H63V 4YJ2E 1O1SA 3FWVA 2D0TA 2BBJA 4XKCA 2CHNA 2WM9A 4L7TA 3FZHB 3PV0F 3KV4A 2GRQB 3MKQA 4A98A 3X1DA 4LFAT 3DP7A 4J7WA 1QLBA 4BTBA 4BJNA 2R03A 3O1JA 1FCHA 3ZFWA 2K3WA 3I1AA 3NRYA 2BEDA 4HTEA 4FHJA 4DR6T 2WDRA 1UN8A 2X3MA 2QY7A 3EHNA 3ML9A 4AIUA 3PZ4A 3CLJA 3RGLA 2EIJE 5LBMA 1DCQA 5J0ZA 3DPYA 5JDLA 5CECB 2QGSA 2X9HA 4HWHA 4OAUC 4LFBT 1VCTA 2WZIA 4BESA 3IF8B 2JIWA 4CYMD 3IBPA 3AEAA 3WAJA 3LDQB 2WS3A 3NVOA 2FUPA 3TKLB 3JUIA 4JEHA 4FLBA 2CG2A 2VL0A 2DVWA 4U7YA 4CGWA 4QWNB 1YKHB 1OXJA 3RYFE 5LJMA 5JQGE 2V7IA 2HH7A 1H6KA 2IEJA 4Z90A 1J1JA 2XQ8A 3KAEA 4GZ5A 4K5BA 4TZ4C 3PUKA 5JDNA 2F0YA 4D10C 1N32T 2BS3A 3Q75A 4AQYT 4KHZF 3ZCIA 2V6XA 1YKEB 3G06A 5G04C 1MX2A 2B1EA 3ASHA 4G1TA 2HYZA 1V54E 1Y6IA 2LO6A 1MYOA 1HO8A 1QNFA 4N5CA 3A7MA 4N39A 3C4WA 3FUDA 4IDZA 4JI6T 2YOEA 4KBMB 3AG2E 5HXEA 3CSTA 3VTXA 2NR4A 3SBSA 4ATZD 4JI7T 2IO3C 4H7XA 5BXOA 2QYWA 1BLXB 3UIOC 1WG0A 2R17C 2LSJA 2UXBT 3DSTA 3PEUB 2XSAA 3ZC1A 3RYCE 4YSXA 2ACXA 4GPKA 1UGOA 4H9QC 1NFIE 2A72A 2AXVA 1NENA 4FJOA 1UX4A 3Q47B 4A97A 3RSEG 2PFVA 2H6FA 3CR3A 3AA0B 2JRKA 1IYGA 2WXNA 4U2YA 2JJ9A 5LP0A 2J62A 3AE6A 2L9QA 3P50A 1N11A 2R5SA 3PNTB 2PZIA 2QA7A 3ZGQA 4ZI7E 3OTOT 4V1Av 3RU0A 3KV6A 1CUNA 4GYOA 2AXZA 3V2OA 4JI3T 3DXKG 4GTSA 3RO3A 3KSLA 4GZ6A 3AS4A 2JMKA 2P9BA 2UXNB 3ZN1B 5A1LA 4I4TE 3TWWA 4QH5A 3AS5A 3ASNE 4FHKA 1XNQT 1E8YA 1T7SA 4IE6A 2CHWA 4ZI3C 2UY1A 5BMVE 1UN9A 2YHCA 2CEAA 1OWLA 3C98A 3QK0A 3FZFB 3KFWX 5L3DB 4HWFA 2W63A 1BPOA 4GZ3A 4K03A 3NZUA 2ZM6T 1DCEA 2GRMA 5BW8C 3TL5A 3Q4AB 4ABNA 5FXWA 1WM5A 4GU5A 2LOPA 2KWHA 1N4SA 2VKOA 4TN7B 2PJQA 1N95A 4YTPA 3V31A 4B89A 3K3QC 2HN2A 4XI0A 2FBWA 5FY7A 4WWNA 3U66A 1D1CA 4DVDA 4EQFA 3E30A 1D1AA 1IHBA 3FULA 1D1BA 5DQWA 3FU5A 1OEDC 3UQ3A 1B7TA 4YDEA 4F6RD 3ZRHA 1FMVA 5CBOA 3ASOE 2B76A 1X5BA 3FU0A 4U33A 3AB3B 1NI1A 3G2UA 4UI9K 4H9SE 5FT9A 4AEZC 3CIAA 4F8HA 3HVEB 3IKOB 2JQKA 3C3QA 1SA4A 3JQ0A 3KD7A 1Y64B 3O4XE 2HN1A 3ESLA 3EIJA 1IZNB 4PNIA 2DNXA 3PTRB 2Q9QB 3EUHA 5CCLA 2CFUA 3AS8A 5ENPD 3IBEA 3AEGA 3O1HA 3ZIMA 5BNWA 5AQKB 2W00A 3ZLIA 4AY6A 3RC3A 5DIZA 4EEDA 3QNUA 4DI4A 4UVAB 4DV7T 2HPJA 3AEBA 4IE0A 4ADZA 2UXXB 2EIME 4N2SA 1D0XA 4CEMA 1EZ3A 2P9KG 5JDMA 2XGOA 4OYSA 4JEUB 4IN3B 2L6BA 5FQ6A 2HHHT 2R2LA 5LCYA 2XTLA 5ANLA 3O9XA 3B7UX 1D8DA 5HYAA 3QK6A 3ZMSB 2WSSV 1XGWA 3BEEA 4NURA 2CXLA 1NA0A 5AN8A 4BSXA 1S64A 3ZU7B 3B13A 3LKUA 5CCMA 4JW1A 3Q7AA 3UUXA 3AVSA 3GN5A 1TJFA 4JA9A 3FUKA 3UI2A 3N5LA 2YDQA 4URKA 4JD2G 3ZUVB 3CKCA 3OBVE 4IDPA 5C8YE 3MACA 5AQOB 4PJNA 2P9UG 3L08A 5FZSA 1YCSB 3RRUA 2ZIRA 4LMLA 3SGHA 3FFLA 1OCZE 3ETVA 4B8AA 3I4RB 4GZDA 5LGUB 2BDEA 4UI9C 3PUSA 3TLWA 2KCVA 4UV9B 4XX5A 4A55A 4YHHT 3QWPA 2LSUA 5LHIB 3JAFA 3PJAJ 2H3RA 4O8SA 4X62T 1EDUA 2J1DG 2B0OE 5A23A 1ELWA 2BTDA 3ZN0B 3HL6A 4X20E 3V5SA 1EYHA 4TXPA 3QB5A 3QDNA 5AQRB 2BG9A 4CT4A 1L5JA 4HGAA 2H6GA 3EHRA 2XHEA 4WUYA 1HS6A 3LK2B 4WW0A 1I6ZA 4AQFC 5ENTD 3SFYA 3UM3A 4RG9A 4HFIA 2ES0A 1Z5SC 4N3CA 3ZSSA 2LSKA 2WXOA 4Z8XA 3LVQE 4JEUA 4LFCT 3D9PA 4BSZB 2DWKA 5HEUA 1KPSB 5L2LA 1DNPA 2W0GA 1JCQA 3RHWA 3OXGA 4ASKA 4ZI2C 2X51A 4KHPT 1H19A 3LJCA 5E76A 5JDQA 4UIGA 4KVOA 1JNZA 3FZKB 4FP7A 4H63H 2X9WA 1I94T 2ACZA 2LE8A 4F3VA 1HTJF 1LF8A 3LCAA 1SE7A 3R6NA 2WMNA 5HS0A 4CZZB 2VQFT 5L3CB 4GTPA 4ISTA 4AKRB 2IC6A 4ISSA 2ZM8A 2YDRA 3PNLB 3LK42 1KT1A 3NB2A 4FJYA 3P4PA 2V8SV 4WNKA 3CVNA 2ZM2A 4L1BA 2P9IG 4BFRA 4KBQA 2EQXA 2FULA 3J7Yq 3CSFA 2IJGX 3VKGA 1N36T 5CHEE 1FMWA 4DO0A 1ELKA 3EVYA 1HX1B 2BG9E 1YD8G 4EZLA 2GRLA 2XGMA 4CZ2D 2OCCE 3KEAA 5FXZA 4CN6A 4AQFA 1HNWT 2RP4A 2OV9A 3Q9UC 3S7BA 4EPZA 4A63B 4ACKA 2V5QC 4RG6A 4UQYA 3JYSA 2RFAA 3B7BA 4XKBA 3QOUA 3EDUA 1RZ4A 2R05A 2XCCA 5B1BE 4MALA 2LT3A 3S4UA 3S7FA 2NSZA 3RRWA 5FIOA 4NRHB 3FUHA 4U3CA 2YEVC 2VGXA 3CEQA 3ONLC 1W9RA 1QBQA 2L8KA 3NOGD 2JLBA 3CVPA 4Y6WA 3KS2A 1A17A 3ZEFA 2IMLA 4B8CB 3JC6D 1SW6A 1Y8MA 4XZCA 2EIKE 4G26A 1QZ2A 3RQWA 3E22E 3RK6A 4P09A 2XM1A 3ASGA 4J8SA 1TN7A 2RPAA 2UUAT 4PFOA 3CHRA 4JA7A 4OYJA 3AE9A 3HXEA 3K8PC 2N1GA 3LXUX 4O1PA 4ZFHA 1OEDB 4FULA 3ZC0A 4IL4A 2WZHA 4UWKA 4FLHA 4A1GA 3SS1A 2V5FA 1YYHA 4UF0A 3CVXA 2DCFA 4U95D 1WY6A 3ZXPA 1MJ0A 2IFUA 3AE8A 4H9PC 3PJAA 3G2VA 4CGVA 3RYIE 1ZU2A 5AQ7A 5ENRD 3ONXA 3ZT5A 3DSUA 4AIFA 3Q5WA 3PURA 3UU5A 3PZ3A 2ZGDA 3PUJA 4U0UA 2LXMA 2NWBA 3GWHA 4YNDA 3KV5A 4W9RA 4DNDA 1Z8UA 1BR4A 1EPUA 5DBKA 4TWDA 3C5RA 3RRNB 3UPVA 2JPFA 2XQ5A 2LSYA 4HLEA 3N2OA 4GTRA 2VVNA 2LOSA 1TNZA 2P9NG 3APDA 2Q7FA 4J2CA 3CQXC 3S2AA 3BQKA 2GW1A 4U0SA 3MKRA 1IQUA 4E7SA 2HR2A 1Z3XA 1BD8A 2FEZA 3Q49B 3PZ2A 4X64T 1S35A 2R6GF 2E2EA 1S70B 1YW0A 2VSNA 4HFVA 3AE3A 5AQHB 3LK3B 3E34A 1OCCE 4OVVA 5EK3A 4I9CA 1IQRA 3FUIA 4CI1B 2VGEA 4F1SA 4CI3B 4PK5A 4FADA 5HCMA 4HKAA 3Q9NC 3R9MA 2K9AA 3FUJA 4B3ST 4DR7T 2FJEA 2XQ4A 1SVXA 3UUMA 4DV4T 3UTMA 2KZTA 2LSIA 5L4EA 3BQOA 5AQVB 3ABKE 4G2VA 4O6FA 5LG4A 4I1MA 3DXMG 5LMUT 4TV3A 2B6CA 4CXXA 5AQJB 2RG8A 3HKDE 3T8OA 2X6KA 4HBDA 5FNVE 3FXEB 5KJMA 5AAOA 4UWLA 2XUEA 3JC6C 5BXUA 4AISA 1WYCA 3P4SA 5EX0A 5H7PA 2WB2A 3UU4A 2VSXE 4DX5D 2X6HA 4XE0A 3BUAA 2CHZA 5F3JA 2DWZA 5BV0A 4IIJE 2W61A 5ARFA 1O5MA 5KJNA 3QC1A 2YHEA 1IAPA 5JH7E 4I1AA 1FEWA 2YQ8A 2NTXA 2VSYA 4U2ZA 2MAWA 2LEHA 3SFZA 4C0EA 4F7AA 3NBXX 4HQDA 1NP7A 2AWIA 4U8YD 4AV7A 4DJAA 5AFUL 2PNNA 1XNRT 3UFEA 2JQHA 3TWTA 2XJ7A 4HS2A 4GA2A 3ZJ1A 3H3AA 4EOZB 4F6RC 1E8XA 4CDRA 3IEGA 2BKKB 3RRMB 3PE4A 2X66A 2WDQA 4JBWF 3BK9A 1OT8A 4Z91A 3UKRG 3D3MA 1LD7A 1UUSA 4TNVA 3N9MA 3V79K 3CMLA 3CGHA 1W0AA 3WAKA 2VVSA 3LJ3A 4CCAA 4UXNB 5C2TA 5JR9A 5D66A 4GKKT 1VDYA 4KUMB 2OA5A 3NZPA 2DL1A 1H2UA 2MOZA 3OYXA 2W2UA 4X1YE 5KMGP 3EUVA 2C2LA 3PE3A 3PUYF 3T1HT 1N9AA 3PZDA 4DR5T 3P4WA 4EGWA 4DBQA 1ELRA 1M62A 4EYUA 2IY0C 5ANRA 2MTQA 2LHNA 1W0BA 3QARA 3TG5A 1HR0T 4ANVA 1UG3A 1NL4A 4ZHQE 3RIUA 3TLUA 1XDPA 3PDNA 1WR6A 4HN9A 3BQIA 4KZ0A 5CB4E 2KMFA 1VRBA 3P4RA 1UW4B 4FA6A 3U64A 4CDMA 2BG9B 3LFMA 3UTKA 3CHMA 3SF4A 3SHFA 1DVPA 4GMJA 3O48A 2V26A 3RI5A 4G2AA 3UUBA 4TXQA 4IDNA 2XPIA 3UT8A 2NYJA 3MX3A 2K24A 3QC9A 2XY8B 4B6XA 4L9PA 2Y3AA 1HNZT 3I3NA 3SFEA 2XCBA 3FP3A 3FTVA 1OWPA 2H7OA 3K9IA 4DX2A 5T8IA 3Q2MA 4NXNT 1FT1A 3AAIA 4AKIA 2XPZA 2AXDS 4UV8B 1HX8A 4DV0T 4U7EB 4OX9T 4KX6A 3HXBA 4X66T 2WXIA 4ANWA 3QUJA 5AQGB 1OCOE 1E7PA 2CE7A 2XQ6A 3ANWB 3VRAA 1N4RA 5J1GA 2CMRA 1S63A 1WFDA 3HIZA 4RVBA 2CCQA 2V8SE 3ASDA 5KNHD 3UULA 4LMJA 2Y48B 3U3WA 1YA0A 4DX1A 5AQ9A 5D2MC 4BETA 3CK6A 4BT8A 4AKLA 3ZSTA 4HFHA 4DX7D 4L5GA 5L3BB 2CHXA 5FJYA 3LJNA 3VRBA 4BAYB 2BKPA 3CK9A 2MHKA 5EK4A 2CPTA 3SZ7A 3DWLG 1E2AA 4OFZA 4Q69A 3PU8A 3I0QA 3QWWA 5JA4D 3CQCB 4FU3A 3VKHA 1E1HB 3ANWA 5KNGA 2YN6A 2J8SD 3AU5A 4K0UA 5AIJA 4ZI2D 4ME2A 3C4XA 3BG1B 3GYZA 3E37A 2X0YA 2LRLA 2ODUA 4EHMA 4GTMA 2MRIA 1OEDE 4PK4A 3AAEB 1DU2A 3OXLA 4ZHBA 1JCSA 4QKNA 1Z3YA 2WU5A 3E33A 5GONE 2E8IA 1JUQA 2DZNA 5LCWC 4FI5A 4CN4A 4O2BE 1QYMA 3E32A 3GZ1A 3IHRA 4ILBA 3ZEFB 1E7UA 5FQ8A 2XPYA 5JRCA 5FVLA 4B3TT 5HWYA 1KFYA 4DR3T 4U96D 3CVYA 3SFDA 4A5XA 5JJ7A 3HKEE 2VTBB 1N94A 3B7TA 2NXPA 1J5ET 3TWSA 1H0AA 3ULQA 2P2CP 2CM0A 4JHRA 2IAKA 4GB9A 2HO1A 2XPKA 5F8PA 4QFVA 3ZKJA 4IL9A 2YK0A 4EEBA 4MBGA 4RQIA 5ENOD 5B3SE 5IYZE 2XZTG 1HG5A 3OYZA 2GRRB 3L13A 5L3GB 4JHKA 4JXTA 5KDMC 3TG4A 4HORA 3FUFA 4JPSA 5G2NA 4YTNA 2XQAA 1GW6A 3FEXA 5ABFB 3RO2A 2XQ9A 3AG3E 1TJCA 1J5WA 1HF8A 2VJ8A 3CK8A 3RIBA 3MCXA 1BU9A 4ILCA 4J0UA 2LLYA 3NBNB 4HOSA 3N2GE 2ETBA 2GRPB 4DV5T 4DMWA 3M3ZB 1HZ4A 3OAWA 1K8KG 3G2TA 3UM0A 4IE5A 1KZPA 2UUBT 2OEWA 1V55E 2P58C 1UOHA 4I43A 4PFPA 4EZKA 1KF6A 1TR4A 4N3BA 2E9XC 3VHLA 4PS3A 4GYWA 5TAOA 1WRDA 2ZM0A 4DI3A 5LHHB 3OXFA 3TXMA 3FZMB 1NA3A 5EKQD 2UXCT 2CBIA 2YU1A 4UVBB 3P1UA 5ABHA 4BX8A 1D0YA 1DC2A 3AVRA 4G8KA 1FVHA 3UT5E 4MBQA 5FL1A 4HWCA 4JYAT 2I2OA 3OPCA 2WWUA 3PUXF 4H9RC 3EI0A 4I1OB 1PY1A 1ZB1A 2XAHB 4DUZT 2HE0A 2BG9C 3HVEA 2XEVA 3ONLA 2BBHA 2YU2A 4WZXA 4B0ZA 2CWYA 2YNQA 2WXKA 4C90A 3RJVA 2X6IA 3UU3A 3MA5A 4F1PA 2OVFA 4CI2B 3RF1A 1T72A 4O2AE 4LNUD 1D9SA 3AA1B 4P0BA 4Y6CA 2V0PA 2IUBA 5AQIB 3JCKC 3I9WA 2WWVA 1WYBA 4IREA 3SNXA 2V7LA 3T8KA 3UQ4A 4CXYA 4A3VA 1R8IA 2N2NA 1LVFA 3PRZA 3ZT7A 1BR0A 1G3NB 5BV1A 4HE8A 4JEHB 4NUVA 2DZOA 4BEPA 3L8RA 1AJ3A 2XRZA 5BR8T 3APFA 2ODVA 2CXFA 3BU8A 3P7IA 3T5VA 3Q73A 3CHPA 3ZVVA 2XM2A 4YTMA 3CVVA 3R9AB 3ABME 5IHYA 1MMDA 3DJBA 1S94A 3CX6B 3VR9A 3ENEA 4ZEYA 3ZMUB 2G0UA 2YINA 4XAXB 3L39A 3HXDA 1FVFA 4UQXA 1HXIA 4UR9A 3RIUC 3DTOA 2QFCA 4DR4T 1INZA 4H9OC 4C0MA 2FBNA 2VGXB 2IO2C 3OTNA 3KBUA 3J5PA 3GMIA 1E7VA 4U8VD 2I1JA 2DHRA 4BT9A 2OOEA 3ZN3A 1RW2A 5F5WA 3PUQA 4M3OA 5C2YA 3Q9DA 3Q79A 3T5XA 3EIQC 4UI9J 4C48B 4BX9A 2H7VC 5CRVA 4Z68A 3KSQA 1NAFA 2LHRA 2C5JA 2WDVA 3CKBA 1SZ9A 2V1DB 3CVLA 5HXCA 1JNRA 2HPLA 4ZXLA 3MGBA 4DK5A 4GTQA 3UINC 5DJQC 3D9IA 4BTAA 1OWMA 1FIOA 2W4XA 3E08A 3TLSA 3PUGA 3WI3A 4A56A 3ABLE 1N34T 3AA7B 1XZYA 4KMOA 3UT7A 3FUNA 2JQ9A 3LBXA 3LY7A 3TWVA 2XEEA 4RSYA 2FJAA 4ACLA 5HEJA 4ZS2A 2EINE 2QYJA 2VQET 4OAVB 4ANJA 1N33T 3AG4E 4TXRA 3ULYA 3ZYMA 3PUZF 3SI5A 2Z6EA 1Z0PA 3RKVA 3G2SA 4O4JE 4CN1A 4UWFA 1IBLT 2KXPB 2JEKA 5HI7A 5ABEA 3MJXA 3AE7A 1PC2A 4I9EA 4H7YA 4L0RA 4FJZA 3ABVA 3B7RL 3LY9A 5JVDE 4OYKA 4XIFA 4NQ0A 5ADXL 4LF6T 2RKKA 3JCFA 2V4LA 5IY5E 4MS6A 4HFDA 1Q2ZA 2H6HA 4N3AA 4N2QA 3CWZB 3ZCJA 2OEVA 4DV2T 3MXZA 3H37A 3SO8A 4O1OA 1KNZA 2QZAA 2JQQA 3Q5MA 5D0OD 3MJWA 2ILRA 2CLYB 5FXVA 4B3RT 3RX6A 2KM4A 3KINB 3RAUA 4HWDA 5CERB 2BS4A 3QOFA 3FTWA 3C51A 4ILUA 2P9PG 2Q9QC 1HH8A 3NZQA 1OY3D 2WY2A 4IDQA 2Y0BG 3OVUA 4I6GA 3LPZA 2NW8A 3FH5A 2D9DA 3RKOA 3VU7H 4AXHA 3FU6A 3EAMA 3TWXA 5J2TE 3KV9A 4LSZE 2LRKA 3RC8A 4FC8A 4GCOA 3T1YT 3EABA 4J8DA 2M6IA 4YT0A 5HXSA 2BUGA 3I9YA 3APCA 4JHJA 4EZJA 1QSDA 5FP3A 4TX5A 4IRUA 1XDOA 3AA6B 4L2YA 2Y1LE 4KI0F 4DV6T 1U5PA 4ILHB 3GZSA 3RPUA 3GZ2A 5EN5D 4PW8A 3RRCA 3V2XA 4AI6A 2KSRA 4DUIA 3IV0A 2Y6XA 1JWFA 4IT4A 4APOA 3FEYA 2W67A 4MKTA 1MIWA 3UUNA 2WMOA 5L3EB 5JMND 4CT0A 3ZKRA 5CEDB 5HEGA 4O4LE 4OHFA 4X1IE 5M4YA 4HOUA 3N9LA 3ZHEA 5EYPF 2MPKA 5CMWA 5ENSD 2WP9A 3PH0C 2DBAA 1OUVA 5CGMA 4F53A 4GTVA 5JREA 4NXMT 1YMPA 2LXLA 2K5BB 2D2SA 4GMRA 4PH4B 2MBGA 2QVAA 3G2WA 5LJNA 4UELA 3ZPJA 2V7KA 2CHOA 1UJJA 3PREA 5E0OA 4EAHA 5ABFA 4N78D 4E85A 5ENNA 4LF4T 4JI4T 2C0LA 5M72A 2VKHA 4QXHB 4JB8P 3HXFA 1MHQA 3L09A 2IQCA 4JZYA 3MKQB 1HFAA 2KZ7B 4U63A 2D5UA 1OWOA 1NWMX 2X68A 3T8MA 3KVAA 5KJKA 4NACA 2V7JA 4E7ZA 1N0RA 2A5UA 4C91A 3KBTA 5LNKA 4YSZA 3FTZA 1ZOYA 5HEOA 1WR0A 4MHCA 2I59A 5EIDA 3EHQA 2W66A 1G8XA 5FY0A 3ZW3A 4HVBA 3HKCE 2CWOA 4LMKA 3L22A 2Q9QD 2VB6A 3FU3A 2F8XK 3AXJB 4DV1T 5EIBE 4WBNE 1X9BA 5KX5E 2AVPA 4G11A 3J9X1 2LKHA 2FJDA 3MV2B 2WAUA 2X6JA 3H3MA 3ASFA 3L6AA 5EYLA 1TN6A 2UUCT 1OWNA 5LFAA 2WXPA 1LRZA 2ZXWE 3ZJ2A 2Y69E 3VLDA 3LBXB 4NIKA 2XAGB 3AE1A 3C3RA 5HKPA 4PUCA 1MX6A 3S7JA 2CBJA 3AXJA 3LG7A 4YSYA 2XQYA 5AJLA 3FH7A 5EZYE 4YDWA 1CHUA 4HRMB 1O3XA 4LEUA 1H2VC 4A3TA 3RLFF 3CV0A 2LSVA 2RA1A 4HNAD 5A6CA 4C9BB 2WQ7A 1W09A 1IHGA 3FH8A 3PU3A 5AARA 1QQEA 4G23A 5FZRA 3UU6A 3CIRA 2GGFA 2VURA 4ILGA 3R7QA 2RFMA 2RD0A 4WNFA 4JL0A 1OXZA 4TUUA 4B3MT 1WAO1 4TWFA 4BERA 2E9XD 5JR9C 2XS1A 4M7CA 4APFA 3NF1A 4AKGA 3F57A 5JJ6A 2VSOE 3PS6A 5IWAT 3DSWA 4X1KE 4KXKB 2BVLA 1K3ZD 1US7B 3E4BA 2EILE 3CPZA 3HYMB 3JQ1A 3U4TA 1B89A 4B94A 3B95A 1HCIA 3AAAC 1UCUA 2DLRA 4HI9A 3MK7C 1VCSA 2NW7A 4P29A 2Y8DA 3FY4A 3CHQA 3L9TA 4KMCA 3JUEA 4EYYR 4ZOLE 1KK7A 4YVQC 2WU2A 1SZAA 2P9SG 4QX8B 3DEPA 2LUHA 5LHGB 2XRYA 1Z6TA 4KVMA 5C1DA 5JTGA 3ONJA 2J4DA 3FTUA 1WCRA 2PBIA 3K3OA 3NOCD 3W9FA 3HRAA 2BKOA 4U04A 2YDSA 1E8ZA 3TXNA 4PJJA 1ZEEA 2PQNA 3V30A 4RLYA 4XZ4A 5AJDA 1IBKT 3J5QB 4BJMA 2IOSA 3U78A 2V6YB 3BQLA 3EDVA 2CXDA 1UX5A 3GA8A 3QWVA 2CA5A 3PUVF 4COFA 2DWGA 5FKYA 3HXCA 4ZS3A 2DYRE 3B5MA 4L23A 3IEEA 1MNEA 4U31A 3CHSA 3SY2A 4I43B 4LRZA 3LEWA 4MFRA 2J09A 3NQPA 2NP9A 1T98A 5JHAA 5JDFA 3IA3A 3VTYA 3UMVA 4ILAA 3P8CD 1D8EA 5L47A 5HAXA 2WXJA 4JVSA 4M1PA 1KT0A 1AP7A 3UIPC 3IXEA 2Y4UA 2BKNA 3UKUG 5BUZA 4JI2T 3UU8A 5DQVA 3URZA 4XBFB 3C50A 5ETWA 4G8LA 3DBSA 2M6BA 2WXHA 5G05J 4HWIB 4QHOA 3AAAB 2C5KT 2LAIA 5JHBA 3N2KE 3CK7A 3EJNA 4JI0T 1N52A 3RQUA 2ZISA 2R59A 4I2WA 3LDZA 4I55E 5JJTA 4TRQA 4QQIA 3FBLA 4EECA 1WDYA 1BR2A 3LS8A 3A8YC 2C0MA 4JV5T 1KEYA 4P0AA 4NPPA 4I2ZA 3D9KA 3HR0A 4LNBA 1NEKA 3C98B 5ENQD 2Y4TA 4HRLA 2D0UA 4AKHA 4UEMA 4IDOA 2LAHA 4I17A 2WXMA 4X65T 3HKBE 3DSXA 2V5CA 4WAFA 2XAFB 2Q9QA 2WXRA 3Q7FA 2VKDA 4EZHA 1QUUA 3FXDB 4EXTA 1BR1A 3CKDA 5E75A 2BZBA 2WQYA 5AQAA 1MMGA 2UXDT 2E5VA 2N9DA 2FI7A 3FBZA 1HS7A 4K5AB 5HXRA 4K0KT 4I0UA 2F4VT 1XNFA 2VKJA 4UWHA 4HLLA
chains in the Genus database with same CATH topology
3D0TA 4GK5E 2LM9A 4KP3C 2C5IT 3QKYA 3KEZA 4LCTA 3U3IA 2DCPA 4GAAA 2NOXA 4DMVA 1NZNA 5J90A 3AU4A 2KWIB 5LXTE 3GN5B 4PS7A 2E9XA 4EIWA 3RH3A 3A5XA 4YHJA 2VK9A 4QX7B 3P2BA 5G55A 4R7LA 5ARGA 3TAXA 4O4HE 5CA0E 5FMNA 1H7CA 5LCWJ 5T4YA 2WXQA 2L6JA 2WQHA 2L3LA 2FO7A 2UY1B 4CQIA 4ERRA 4ANUA 3C4ZA 3QB2A 3MYVA 3ZMVB 4PJMA 4TV8E 1HG2A 3CQGB 4XI9A 3C64A 2ZU6B 2KT9A 2X9YA 4UQZA 3ZMZB 2JMHA 2LSGA 3CX7B 4BWRA 5A7DB 4YVOA 3PE0A 5JR9B 1E96B 4YJ3E 4QXCB 3UUXB 2C0SA 3B7SA 4PJLA 3QJZA 1G73A 4HOQA 3BG0B 5LGTB 1LKXA 3ZYQA 2VASA 4JUYA 3CHOA 1LVKA 3PUAA 2M63A 3WXXA 5CMYA 3FTSA 2VTBA 5BT1A 2L0TB 3UT4A 3CVUA 3MEKA 5EK2A 1E90A 4EBAA 2PM7A 2XAJB 2J07A 4G24A 3NRXA 2KCKA 4MRUA 1WLXA 2A3DA 4GK0E 3SOLA 3L16A 2I1KA 2IOLA 4CDNA 4HFGA 4GCNA 2XHEB 4KT6B 1PAQA 4A1SA 4ATGA 2PL2A 2XASB 2OVBA 4U74A 4IULA 2VYIA 3MA9A 2AXUA 1S0PA 4AXPA 4IHJE 4WNEA 4AM9A 3FDHA 5LBQB 3FUMA 4PK6A 3F2EA 3R7RA 4GYRA 2A4ZA 3SD5A 5DABA 2CLYC 4LUNU 1H2TC 4GA0A 2IW5B 3N71A 5LOVE 4L9IA 4HXIA 4Q96A 1UJKA 5JDHA 2VL8A 2NTYA 2ONDA 2NW9A 3MV3B 3Q15A 4HEAA 3CX8B 3MZKB 4JLEA 2XGSA 3FHNA 5FY1A 4U0ZA 5AENA 3Q5XA 3E0ZA 1MIVA 4U72A 2X0LB 4UVCB 4CRWA 4V3IA 5LOZA 1KLXA 2WXFA 5KJLA 5LX8A 4ILIA 4WNGA 5FZQA 4GMLA 4JC8A 4G63A 3N9QA 1D0ZA 3NZSA 5JDGA 4ANXA 2V7MA 2ZMAA 4PAGA 2KZTB 3D9MA 2GK9A 4WWPA 3PEVB 3ZMTB 5D0QD 2KNDA 3VLEA 4L2LA 4YFSA 5CA1E 2MYSA 1ZHCA 1ZV4X 3HI2A 3ZYLA 2WQ6A 3L54A 3R84B 2WBLA 3GW4A 2X9XA 4DBRA 2EHOC 2KINB 4QXBB 4DLOA 3F31A 4DLQA 2I6HA 3DPDA 3ML8A 4AY5A 4KYOB 4UF0B 3ZXSA 4AOFA 4GZCA 5AYWD 3VLFA 5FWQA 4MLPA 3U9WA 1E8WA 3HDXA 1OWAA 3N9NA 1HE8A 5KCMA 4I6EA 4IE4A 5FTPA 3D9JA 3O1IA 3B57A 3OKQA 5FXXA 3I4GA 2MOWA 2VQ2A 2J4BA 4NUUA 2E0IA 3CVWA 3FUEA 5BPPA 2HM8A 1U4QA 2J08A 2XQ0A 4I6JA 4AQGA 4O4IE 2ZLYA 5J08A 2FF4A 4GYSA 2EHOA 2LJLA 3RYHE 3N9OA 3IHYA 4ZI3D 3D9LA 1EF1C 3PVLA 5EDSA 1U3DA 4IYPA 5HXHA 2WPVA 2PQRA 2X6FA 3M65A 2KATA 2M67A 3FB2A 3FHEA 5LA6E 2EHOB 4U07A 1HU3A 4G25A 2IONA 4EB6E 1N54A 3IHVA 1SHZC 2A2FX 2IC9A 4OVUA 4GIWA 2WVIA 5LP6E 1MIYA 4WWOA 3D9OA 2PG8A 2K48A 3PDYA 2E9XB 5LYJE 2IU1A 3EDTB 1ZBPA 1MMNA 4U8HA 3O4ZA 3HA4A 3MZLB 2L9BA 3ESKA 2AW6A 1P5QA 2UWJG 1U3CA 3TJPA 4LERA 4J6IA 2WXLA 2BF0X 2KC7A 2DIWA 1IJ5A 3I0OA 3QNKA 4HOTA 5H6RB 3SWHA 1MQSA 4I50E 4DPRA 3D9NA 5G05C 3FTXA 2IF4A 1W3BA 3N9PA 4WNDA 4AP2A 5FQ4A 3V5UA 2CG3A 4UWGA 3K3NA 3ETUA 4IGUA 2PM6A 4J8FA 3QAQA 2WXGA 2BVMA 1X79A 3LY8A 5LGNB 3HHMA 1JWGA 3W15B 4CXWA 2LNIA 3KVBA 2KLQA 4BA9A 4TUYE 4J8EA 4GA1A 4Q94A 2CFZA 2SPCA 4AVXA 3ZYKA 3SRZA 3EHMA 3SBTB 4EBAG 3MKDA 5JRCB 4H9NC 3CVRA 3OJAA 5H6QB 2I9CA 2NC9A 1IJ6A 3ZPOA 3CVQA 3UX4A 5HWXA 3ONKA 3L17A 1VOMA 1V9DA 4GYYA 2X38A 4WBOA 5G04J 1TEZA 5HQ8A 3L3PA 1ZKEA 5FQ7A 4BY6A 5FYMA 2XAQB 1MNDA 4EZ4A 4IE7A 4K0RA 2W62A 1JPLA 3I5PA 3S7DA 4YLHA 2L0IA 2DI4A 2VGYA 2VWAA 3LVRE 2J9QA 3TGOA 4AJWA 4TV9E 4MLKA 4OK0A 3FTYA 5J2UE 2KCLA 5EX3A 4GOUA 3ZHEB 5L3FB 4PDXA 2EHOD 1SQMA 4KZCA 2OV8A 3LYAA 4E6HA 5T3RA 2X67A 4PS8A 3KDSE 1SA0E 1MMAA 2J49A 4H63V 4YJ2E 3FWVA 2D0TA 4XKCA 2WM9A 4L7TA 3KV4A 3MKQA 3DP7A 4BTBA 4BJNA 3O1JA 1FCHA 3ZFWA 3NRYA 3I1AA 4HTEA 4FHJA 1UN8A 2X3MA 2QY7A 3EHNA 3ML9A 3CLJA 5LBMA 5JDLA 2QGSA 2X9HA 3IF8B 3IBPA 3WAJA 3TKLB 3JUIA 4JEHA 4FLBA 2CG2A 4CGWA 4QWNB 1YKHB 3RYFE 5LJMA 5JQGE 2V7IA 2HH7A 1H6KA 3KAEA 4GZ5A 4TZ4C 3PUKA 5JDNA 4D10C 3ZCIA 1YKEB 5G04C 2B1EA 3ASHA 4G1TA 2HYZA 1Y6IA 2LO6A 1HO8A 1QNFA 4N5CA 4N39A 3C4WA 3FUDA 4IDZA 4KBMB 3VTXA 5HXEA 3CSTA 3SBSA 4H7XA 2R17C 2LSJA 3PEUB 3ZC1A 3RYCE 2ACXA 4GPKA 4H9QC 2AXVA 2A72A 4FJOA 1UX4A 3Q47B 2PFVA 3CR3A 3AA0B 2JRKA 1IYGA 2WXNA 2JJ9A 5LP0A 2L9QA 3PNTB 2R5SA 2PZIA 2QA7A 3ZGQA 4ZI7E 4V1Av 3RU0A 3KV6A 1CUNA 4GYOA 2AXZA 3RO3A 4GZ6A 3AS4A 2JMKA 2P9BA 2UXNB 3ZN1B 5A1LA 4I4TE 3AS5A 4FHKA 1E8YA 2CHWA 4IE6A 4ZI3C 2UY1A 5BMVE 1UN9A 2YHCA 2CEAA 1OWLA 3C98A 3QK0A 3KFWX 5L3DB 2W63A 1BPOA 4GZ3A 4K03A 3NZUA 2GRMA 5BW8C 4ABNA 3TL5A 3Q4AB 5FXWA 1WM5A 4GU5A 2LOPA 2KWHA 2VKOA 4TN7B 2PJQA 4B89A 3K3QC 4XI0A 5FY7A 4WWNA 3U66A 1D1CA 4DVDA 4EQFA 1D1AA 3FULA 1D1BA 5DQWA 3FU5A 3UQ3A 1B7TA 3ZRHA 1FMVA 1X5BA 3FU0A 4B94A 3AB3B 3G2UA 4UI9K 5FT9A 4H9SE 4AEZC 3CIAA 3HVEB 3IKOB 3JQ0A 3KD7A 1Y64B 3O4XE 3ESLA 3EIJA 1IZNB 4PNIA 2DNXA 3PTRB 2Q9QB 3EUHA 5CCLA 2CFUA 3AS8A 3IBEA 3O1HA 5BNWA 3ZIMA 2W00A 3ZLIA 4AY6A 3RC3A 5DIZA 4DI4A 4UVAB 2HPJA 4IE0A 4ADZA 2UXXB 4N2SA 1D0XA 4CEMA 1EZ3A 5JDMA 2XGOA 4OYSA 4JEUB 4IN3B 5FQ6A 5LCYA 2XTLA 5ANLA 3O9XA 3B7UX 5HYAA 3QK6A 3ZMSB 3BEEA 2WSSV 1XGWA 4NURA 2CXLA 1NA0A 4BSXA 3B13A 3LKUA 5CCMA 4JW1A 3UUXA 3AVSA 3GN5A 1TJFA 4JA9A 3FUKA 3N5LA 4URKA 3CKCA 3OBVE 5C8YE 3MACA 5FZSA 4PJNA 3L08A 3RRUA 3SGHA 3FFLA 3ETVA 4B8AA 3I4RB 4GZDA 5LGUB 2BDEA 4UI9C 3PUSA 2KCVA 4UV9B 4XX5A 4A55A 3QWPA 2LSUA 5LHIB 2H3RA 4O8SA 1EDUA 2J1DG 5A23A 1ELWA 2BTDA 3ZN0B 3HL6A 4X20E 3V5SA 1EYHA 3QDNA 4CT4A 1L5JA 4HGAA 2XHEA 4WUYA 1HS6A 3LK2B 4WW0A 4AQFC 4RG9A 2ES0A 4N3CA 2LSKA 2WXOA 4Z8XA 3LVQE 4JEUA 3D9PA 2DWKA 5L2LA 1DNPA 2W0GA 3OXGA 4ASKA 4ZI2C 2X51A 1H19A 3LJCA 5E76A 5JDQA 4UIGA 4KVOA 4FP7A 4H63H 2X9WA 2LE8A 4F3VA 1HTJF 1LF8A 3LCAA 3R6NA 2WMNA 4CZZB 5L3CB 4ISTA 4AKRB 2IC6A 4ISSA 2ZM8A 3PNLB 3LK42 1KT1A 4FJYA 4WNKA 3CVNA 2ZM2A 4L1BA 4BFRA 4KBQA 2EQXA 2FULA 3J7Yq 3CSFA 2IJGX 3VKGA 5CHEE 1FMWA 4DO0A 1ELKA 3EVYA 1YD8G 4EZLA 2GRLA 2XGMA 5FXZA 4AQFA 2RP4A 3S7BA 4EPZA 4ACKA 4RG6A 4UQYA 3JYSA 4XKBA 3QOUA 3EDUA 2XCCA 4MALA 2LT3A 3S4UA 3S7FA 2NSZA 3RRWA 4NRHB 3FUHA 2YEVC 2VGXA 3CEQA 2L8KA 2JLBA 3CVPA 4Y6WA 3KS2A 1A17A 3ZEFA 4B8CB 3JC6D 1Y8MA 4XZCA 4G26A 1QZ2A 3E22E 3RK6A 4P09A 3ASGA 4J8SA 4PFOA 3CHRA 4JA7A 4OYJA 3K8PC 2N1GA 3LXUX 4FULA 3ZC0A 4UWKA 4FLHA 4A1GA 3SS1A 2V5FA 4UF0A 3CVXA 2DCFA 1WY6A 2IFUA 4H9PC 3G2VA 4CGVA 3RYIE 1ZU2A 3ONXA 4AIFA 3Q5WA 3PURA 3PUJA 4U0UA 2NWBA 3GWHA 4YNDA 3KV5A 4W9RA 4DNDA 1EPUA 1BR4A 5DBKA 3RRNB 3UPVA 2JPFA 2LSYA 4HLEA 3N2OA 2LOSA 3APDA 2Q7FA 4J2CA 3CQXC 3S2AA 3BQKA 2GW1A 4U0SA 3MKRA 1IQUA 4E7SA 2HR2A 1Z3XA 2FEZA 3Q49B 1S35A 2E2EA 1YW0A 2VSNA 4HFVA 3LK3B 4OVVA 5EK3A 4I9CA 1IQRA 3FUIA 4CI1B 4F1SA 4CI3B 4PK5A 4FADA 4HKAA 2K9AA 3FUJA 3UUMA 2KZTA 2LSIA 4G2VA 4O6FA 5LG4A 4I1MA 4TV3A 4CXXA 2RG8A 3HKDE 3T8OA 2X6KA 5FNVE 3FXEB 5KJMA 4UWLA 2XUEA 3JC6C 1WYCA 5EX0A 2WB2A 2VSXE 2X6HA 4XE0A 2CHZA 5F3JA 5BV0A 4IIJE 2W61A 5ARFA 5KJNA 3QC1A 2YHEA 1IAPA 5JH7E 4I1AA 1FEWA 2YQ8A 2NTXA 2VSYA 2LEHA 3SFZA 4C0EA 4F7AA 3NBXX 1NP7A 2AWIA 4AV7A 4DJAA 5AFUL 3UFEA 4HS2A 4GA2A 3ZJ1A 3H3AA 4EOZB 4F6RC 1E8XA 4CDRA 3IEGA 3RRMB 3PE4A 2X66A 3BK9A 3D3MA 3N9MA 3CMLA 3CGHA 3WAKA 3LJ3A 4CCAA 4UXNB 5JR9A 1VDYA 4KUMB 2OA5A 3NZPA 1H2UA 2MOZA 3OYXA 4X1YE 5KMGP 2C2LA 3PE3A 3PZDA 4DBQA 1ELRA 4EYUA 5ANRA 2MTQA 2LHNA 3TG5A 3QARA 4ANVA 1UG3A 4ZHQE 3PDNA 1WR6A 4HN9A 3BQIA 4KZ0A 5CB4E 2KMFA 1VRBA 1UW4B 4FA6A 3U64A 4CDMA 3LFMA 3UTKA 3CHMA 3SF4A 3SHFA 1DVPA 4GMJA 3O48A 2V26A 4G2AA 2XPIA 3UT8A 3MX3A 2K24A 3QC9A 4B6XA 2Y3AA 3I3NA 2XCBA 3FP3A 3FTVA 1OWPA 2H7OA 3K9IA 5T8IA 3Q2MA 3AAIA 4AKIA 2XPZA 4UV8B 1HX8A 2WXIA 4ANWA 3QUJA 2CE7A 3ANWB 5J1GA 2CMRA 3HIZA 4RVBA 2CCQA 2V8SE 3ASDA 3UULA 2Y48B 3U3WA 1YA0A 4BT8A 4AKLA 4L5GA 5L3BB 2CHXA 5FJYA 4BAYB 3CK9A 2MHKA 5EK4A 3SZ7A 4Q69A 4OFZA 3PU8A 3I0QA 3QWWA 3CQCB 4FU3A 3VKHA 1E1HB 3ANWA 3AU5A 4K0UA 5AIJA 4ZI2D 4ME2A 3C4XA 3BG1B 3GYZA 2ODUA 2MRIA 4PK4A 3AAEB 3OXLA 4QKNA 1Z3YA 5GONE 2E8IA 1JUQA 5LCWC 4FI5A 4O2BE 3GZ1A 3IHRA 3ZEFB 1E7UA 5FQ8A 2XPYA 5JRCA 5HWYA 3CVYA 5JJ7A 3HKEE 2VTBB 3B7TA 2NXPA 1H0AA 3ULQA 2CM0A 4JHRA 2IAKA 4GB9A 2HO1A 5F8PA 4QFVA 2YK0A 5IYZE 4JXTA 3L13A 1HG5A 3OYZA 3TG4A 5L3GB 4JHKA 5KDMC 4HORA 3FUFA 4JPSA 5G2NA 1GW6A 3FEXA 3RO2A 1TJCA 1HF8A 2VJ8A 3CK8A 3RIBA 3MCXA 4J0UA 4HOSA 3N2GE 4DMWA 1HZ4A 3OAWA 3G2TA 4IE5A 2P58C 4I43A 4PFPA 4EZKA 4N3BA 2E9XC 3VHLA 4PS3A 4GYWA 5TAOA 1WRDA 2ZM0A 4DI3A 5LHHB 3OXFA 3TXMA 1NA3A 5EKQD 2YU1A 4UVBB 3P1UA 4BX8A 1D0YA 3AVRA 1FVHA 3UT5E 4MBQA 2I2OA 2WWUA 4H9RC 4I1OB 1PY1A 2XAHB 3HVEA 2XEVA 3ONLA 2YU2A 4B0ZA 2CWYA 2YNQA 2WXKA 4C90A 3RJVA 2X6IA 3MA5A 2OVFA 4CI2B 4O2AE 3AA1B 4P0BA 4Y6CA 2V0PA 3JCKC 3I9WA 1WYBA 3SNXA 2V7LA 4CXYA 4A3VA 2N2NA 1LVFA 3PRZA 1BR0A 5BV1A 4HE8A 4JEHB 4NUVA 1AJ3A 2XRZA 3APFA 2ODVA 2CXFA 3P7IA 3T5VA 3CHPA 3ZVVA 3CVVA 3R9AB 5IHYA 1MMDA 3DJBA 1S94A 3CX6B 3ENEA 3ZMUB 2G0UA 2YINA 4XAXB 1FVFA 4UQXA 1HXIA 3DTOA 2QFCA 1INZA 4H9OC 4C0MA 2FBNA 2VGXB 3OTNA 3KBUA 3GMIA 1E7VA 2I1JA 2DHRA 4BT9A 2OOEA 3ZN3A 3PUQA 4M3OA 5C2YA 3Q9DA 3T5XA 3EIQC 4UI9J 4BX9A 2H7VC 1NAFA 2LHRA 2C5JA 3CKBA 1SZ9A 2V1DB 3CVLA 5HXCA 2HPLA 3MGBA 4DK5A 5DJQC 3D9IA 4BTAA 1OWMA 1FIOA 3E08A 3PUGA 3WI3A 4A56A 3AA7B 4KMOA 3UT7A 3FUNA 3LBXA 3LY7A 4RSYA 4ACLA 4ZS2A 4ANJA 3ZYMA 3SI5A 2Z6EA 1Z0PA 3RKVA 3G2SA 4O4JE 4UWFA 2KXPB 2JEKA 5HI7A 3MJXA 1PC2A 4I9EA 4H7YA 4L0RA 4FJZA 3B7RL 3LY9A 5JVDE 4OYKA 4XIFA 4NQ0A 5ADXL 2V4LA 4MS6A 4N3AA 4N2QA 3CWZB 3ZCJA 3MXZA 3H37A 1KNZA 3Q5MA 2JQQA 5D0OD 3MJWA 2ILRA 2CLYB 5FXVA 3RX6A 2KM4A 3KINB 3FTWA 3C51A 4ILUA 2Q9QC 1HH8A 3NZQA 4I6GA 3LPZA 2NW8A 3FH5A 3RKOA 3VU7H 4AXHA 3FU6A 5J2TE 3KV9A 3RC8A 4FC8A 4GCOA 4J8DA 5HXSA 4JHJA 2BUGA 3APCA 3I9YA 4EZJA 1QSDA 5FP3A 4TX5A 4IRUA 3AA6B 4L2YA 1U5PA 4ILHB 3GZSA 3RPUA 3GZ2A 4PW8A 3RRCA 4AI6A 3IV0A 2Y6XA 1JWFA 4APOA 3FEYA 4MKTA 1MIWA 3UUNA 2WMOA 5L3EB 4CT0A 4O4LE 4OHFA 4X1IE 5M4YA 4HOUA 3N9LA 3ZHEA 5CMWA 3PH0C 2DBAA 1OUVA 4F53A 5JREA 2K5BB 2D2SA 4PH4B 2MBGA 3G2WA 5LJNA 4UELA 3ZPJA 2V7KA 1UJJA 3PREA 5E0OA 4EAHA 4N78D 4E85A 5ENNA 2C0LA 5M72A 2VKHA 4QXHB 1MHQA 3L09A 2IQCA 4JZYA 3MKQB 1HFAA 2KZ7B 4U63A 2D5UA 1OWOA 1NWMX 2X68A 3T8MA 3KVAA 5KJKA 4NACA 2V7JA 4E7ZA 2A5UA 4C91A 3KBTA 5LNKA 3FTZA 4MHCA 2I59A 1G8XA 5FY0A 3ZW3A 4HVBA 3HKCE 2CWOA 3L22A 2Q9QD 2VB6A 3FU3A 4WBNE 5KX5E 2AVPA 4G11A 3J9X1 3MV2B 2WAUA 2X6JA 3ASFA 3L6AA 1OWNA 5LFAA 2WXPA 1LRZA 3ZJ2A 3VLDA 3LBXB 2XAGB 4PUCA 3S7JA 3LG7A 2XQYA 5AJLA 3FH7A 5EZYE 1O3XA 4LEUA 1H2VC 4A3TA 3CV0A 2LSVA 2RA1A 5A6CA 4C9BB 2WQ7A 1IHGA 3FH8A 3PU3A 1QQEA 4G23A 5FZRA 2GGFA 4ILGA 3R7QA 2RD0A 4WNFA 4JL0A 1OXZA 4TUUA 1WAO1 2E9XD 5JR9C 4APFA 3NF1A 4AKGA 3F57A 5JJ6A 2VSOE 3PS6A 4X1KE 4KXKB 2BVLA 1US7B 3E4BA 3CPZA 3HYMB 3JQ1A 3U4TA 1B89A 1HCIA 1UCUA 2DLRA 3MK7C 2NW7A 4P29A 2Y8DA 3FY4A 3CHQA 4KMCA 4EYYR 4ZOLE 1KK7A 4YVQC 1SZAA 4QX8B 5LHGB 2XRYA 1Z6TA 4KVMA 5C1DA 2J4DA 3FTUA 2PBIA 3K3OA 4U04A 1E8ZA 3TXNA 4PJJA 1ZEEA 2PQNA 4XZ4A 5AJDA 4BJMA 2IOSA 3U78A 3BQLA 3EDVA 2CXDA 1UX5A 3GA8A 3QWVA 2CA5A 2DWGA 4ZS3A 4L23A 3IEEA 1MNEA 3CHSA 4I43B 4LRZA 3LEWA 4MFRA 2J09A 3NQPA 2NP9A 1T98A 5JHAA 5JDFA 3VTYA 3UMVA 3P8CD 4JVSA 5HAXA 2WXJA 4M1PA 1KT0A 2Y4UA 5BUZA 5DQVA 3URZA 4XBFB 3C50A 5ETWA 3DBSA 2WXHA 5G05J 4QHOA 3AAAB 2C5KT 2LAIA 5JHBA 3N2KE 3CK7A 3EJNA 1N52A 2R59A 4I2WA 3LDZA 4I55E 5JJTA 4TRQA 3FBLA 4EECA 1BR2A 3LS8A 2C0MA 4P0AA 4I2ZA 3D9KA 3HR0A 3C98B 2Y4TA 2D0UA 4AKHA 4UEMA 2LAHA 4I17A 2WXMA 3HKBE 4WAFA 2XAFB 2Q9QA 2WXRA 2VKDA 4EZHA 1QUUA 3FXDB 4EXTA 1BR1A 3CKDA 5E75A 2BZBA 1MMGA 2N9DA 2FI7A 3FBZA 1HS7A 5HXRA 1XNFA 2VKJA 4UWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LO6 A;  2QY7 A;  1UJJ A;  2L0I A;  4Q96 A;  1UJK A;  3CLJ A;  4Q94 A;  1XGW A;  2MOW A;  4GZD A;  5LP0 A;  1JUQ A;  1HX8 A;  4AVX A;  3ZYK A;  1DVP A;  1ELK A;  3D9L A;  5LOZ A;  3ZYL A;  1MHQ A;  2DCP A;  3G2W A;  1INZ A;  4GZC A;  5CMW A;  2BF0 X;  2DIW A;  3G2T A;  3LDZ A;  1LF8 A;  1SZA A;  4FU3 A;  3ZYQ A;  1HFA A;  4JXT A;  1HG5 A;  4HFG A;  2V8S E;  1EDU A;  3D9O A;  1SZ9 A;  3ZYM A;  1X5B A;  5CMY A;  5J08 A;  1HG2 A;  3G2U A;  3D9P A;  1PY1 A;  2L0T B;  4NAC A;  3G2S A;  1EYH A;  1VDY A;  3D9J A;  1JWF A;  1JPL A;  3D9K A;  3D9I A;  3G2V A;  3D9M A;  3D9N A;  3ONK A;  1JWG A;  3RRU A;  3ONL A;  1HF8 A;  2KM4 A;  4FLB A;  1H0A A; 
#chains in the Genus database with same CATH topology
 3D0T A;  4GK5 E;  2LM9 A;  4KP3 C;  5CEA A;  1YQ3 A;  2C5I T;  4DUY T;  3QKY A;  1OED A;  3KEZ A;  4LCT A;  3U3I A;  2DCP A;  2YKS A;  4GAA A;  2NOX A;  4DMV A;  3JXJ A;  3W9G A;  1NZN A;  2H6I A;  5J90 A;  5L4H A;  3AU4 A;  2BKG A;  1K1B A;  2KWI B;  5LXT E;  3GN5 B;  4PS7 A;  2E9X A;  4EIW A;  3RH3 A;  3A5X A;  4P1N A;  4YHJ A;  2VK9 A;  1MZC A;  3JXI A;  4QX7 B;  3P2B A;  1BI8 B;  1KZO A;  5G55 A;  5LMN T;  4R7L A;  5ARG A;  3TAX A;  3AE5 A;  4O4H E;  5CA0 E;  5FMN A;  1H7C A;  2XQ3 A;  5T4Y A;  5LCW J;  5LB7 B;  2WXQ A;  1GQE A;  2L6J A;  2WQH A;  2L3L A;  3ISM C;  4O60 A;  2FO7 A;  2UY1 B;  4CQI A;  4ERR A;  1TN8 A;  4ANU A;  3C4Z A;  3QB2 A;  3MYV A;  3ZMV B;  4PJM A;  4TV8 E;  1HG2 A;  3CQG B;  4XI9 A;  3C64 A;  2ZU6 B;  2KT9 A;  2V5D A;  2X9Y A;  4UQZ A;  3ZMZ B;  2JMH A;  2LSG A;  3CX7 B;  4BWR A;  3P4Q A;  5A7D B;  4DID B;  4YVO A;  3PE0 A;  5JR9 B;  3NAW A;  1E96 B;  2AE9 A;  1LTX A;  4YJ3 E;  4QXC B;  3UUX B;  2C0S A;  3B7S A;  1N4Q A;  4PJL A;  3QJZ A;  1G73 A;  4HOQ A;  3BG0 B;  5LGT B;  3UM2 A;  1LKX A;  3RKG A;  3ZYQ A;  3UFG A;  4HFC A;  2VAS A;  3AEC A;  4JUY A;  4ZZB A;  3CHO A;  1LVK A;  3PUA A;  2M63 A;  3WXX A;  5CMY A;  3FTS A;  5AQT B;  5HCJ A;  2F8Y A;  3UXG A;  2VTB A;  5BT1 A;  2L0T B;  3UT4 A;  3EU9 A;  3CVU A;  3MEK A;  3WG7 E;  5EK2 A;  1E90 A;  4EBA A;  2PM7 A;  2XAJ B;  1IXV A;  2J07 A;  3NRX A;  4G24 A;  2KCK A;  4MRU A;  1WLX A;  2A3D A;  1T8B A;  2WCA A;  4GK0 E;  2KXP C;  1KNP A;  3HG0 D;  2R02 A;  3SOL A;  3F6Q A;  2CRB A;  1YXR A;  3L16 A;  4B93 B;  2I1K A;  5CJ5 A;  2IOL A;  2JAB A;  3RIA A;  2ETA A;  4HFG A;  4K5C A;  4GCN A;  4CDN A;  4N5Q A;  2XHE B;  3L82 A;  4KT6 B;  2IIU A;  1PAQ A;  3EU5 A;  4A1S A;  4ATG A;  2PL2 A;  3TWR A;  1OCR E;  2XAS B;  3RIF A;  2OVB A;  2XEH A;  2XZE A;  4U74 A;  4IUL A;  2VYI A;  5FL0 A;  3MA9 A;  2MYO A;  4GTT A;  2AXU A;  1S0P A;  4AXP A;  4HB5 A;  4Q25 A;  4IHJ E;  4WNE A;  4AM9 A;  3FDH A;  5LBQ B;  3FUM A;  4PK6 A;  3F2E A;  4JI8 T;  3R7R A;  4GYR A;  4TUM A;  3X2Q E;  2A4Z A;  3SD5 A;  5DAB A;  2CLY C;  3UQ7 A;  4LUN U;  2H89 A;  1H2T C;  4GA0 A;  1N4P A;  4DV3 T;  2IW5 B;  5AQN B;  5CRU A;  3N71 A;  2FJB A;  5LOV E;  4L9I A;  4HXI A;  3ZNG A;  4Q96 A;  1UJK A;  2V6Y A;  5JDH A;  4UUC A;  2VL8 A;  2NTY A;  2OND A;  2NW9 A;  3MV3 B;  3Q15 A;  3JAE A;  4HEA A;  3CX8 B;  4YY3 T;  3T9K A;  3MZK B;  4JLE A;  2XGS A;  3FHN A;  5FY1 A;  4U0Z A;  5AEN A;  4JI1 T;  1SUM B;  3Q5X A;  3E0Z A;  1MIV A;  5AQB A;  4U72 A;  3AEE A;  1UUR A;  2X0L B;  1ZP0 A;  4UVC B;  4CRW A;  4V3I A;  5LOZ A;  1KLX A;  2WXF A;  5KJL A;  2F37 A;  5LX8 A;  2QYU A;  4ILI A;  4WNG A;  5FZQ A;  2KBX A;  4GML A;  4JC8 A;  4LF7 T;  4G63 A;  3N9Q A;  1D0Z A;  3NZS A;  4EV6 A;  5JDG A;  4ANX A;  2V7M A;  2GRO B;  2ZMA A;  4PAG A;  2KZT B;  3D9M A;  2GK9 A;  4WWP A;  4HFB A;  3PEV B;  3ZMT B;  3DSS A;  2KND A;  5D0Q D;  3VLE A;  4L2L A;  4YFS A;  5CA1 E;  2MYS A;  1ZHC A;  1ZV4 X;  2XSB A;  3HI2 A;  2V4H C;  3LSV A;  3ZYL A;  4DR2 T;  2WQ6 A;  2H88 A;  3L54 A;  3R84 B;  1AWC B;  3C72 A;  2AJA A;  2WBL A;  3GW4 A;  2X9X A;  4DBR A;  1M7K A;  2EHO C;  1FT2 A;  2KIN B;  3EHZ A;  4QXB B;  4DLO A;  3F31 A;  3QB5 K;  4DLQ A;  2I6H A;  3AE4 A;  3DPD A;  3ML8 A;  1YQ4 A;  4YDO A;  4LNG A;  2BS2 A;  2UU9 T;  4KYO B;  4AY5 A;  4UF0 B;  3ZXS A;  1BI7 B;  5AQL B;  1IKN D;  3ZT6 A;  4AOF A;  4GZC A;  5AYW D;  3VLF A;  5FWQ A;  4MLP A;  3U9W A;  3ULE G;  3AE2 A;  1E8W A;  2IDO B;  3HDX A;  1OWA A;  1L0V A;  4TNW A;  3N9N A;  1HE8 A;  2ZGG A;  5KXJ A;  2J4G A;  5KCM A;  1HNX T;  4I6E A;  4IE4 A;  5FTP A;  3D9J A;  3O1I A;  3B57 A;  3OKQ A;  1O1R A;  5FXX A;  3FZL B;  2LKG A;  5FIN A;  3SQV A;  3I4G A;  2MOW A;  2VQ2 A;  2J4B A;  4XEI G;  4NUU A;  2E0I A;  3CVW A;  4HFE A;  3FUE A;  5BPP A;  2HM8 A;  1U4Q A;  2J08 A;  2XQ0 A;  4I6J A;  1TNU A;  4AQG A;  5KWD A;  2OLT A;  4O4I E;  2ZLY A;  4X8Q A;  5J08 A;  5C3J A;  2FF4 A;  4GYS A;  2EHO A;  2LJL A;  1TNB A;  2E2A A;  1U2V G;  5ITZ F;  3RYH E;  4DR1 T;  3N9O A;  3IHY A;  4ZI3 D;  3D9L A;  4LF9 T;  3JAD A;  2A9U A;  1EF1 C;  2J47 A;  3PVL A;  5EDS A;  5EIL A;  4WYV A;  2XS8 A;  1U3D A;  3AG1 E;  4IYP A;  5HXH A;  2WPV A;  2PQR A;  2X6F A;  3M65 A;  2KAT A;  2M67 A;  3FB2 A;  3FHE A;  5LA6 E;  2EHO B;  4U07 A;  2DYS E;  1HU3 A;  5IUX A;  3VR8 A;  4G25 A;  2ION A;  5FVK A;  5AQS B;  4EB6 E;  1N54 A;  2E5L T;  3IHV A;  4QH4 A;  1SHZ C;  2A2F X;  2IC9 A;  2I0M A;  4OVU A;  5HRY A;  4LF5 T;  4GIW A;  3PUW F;  4JI5 T;  4DRX E;  5KBA A;  4DX6 D;  2WVI A;  5LP6 E;  5AQF B;  3C3O A;  1MIY A;  1XMO T;  3D9H A;  4WWO A;  3D9O A;  2PG8 A;  2K48 A;  3PDY A;  2E9X B;  5LYJ E;  2IU1 A;  3EDT B;  1ZBP A;  1MMN A;  2QRX A;  3PZ1 A;  2QC9 A;  1MX4 A;  1IBM T;  3NWI A;  4U8H A;  5HEH A;  3O4Z A;  3HA4 A;  2L9B A;  3ESK A;  3MZL B;  2AW6 A;  1P5Q A;  3UM1 A;  1Y01 A;  2UWJ G;  2FO1 E;  1U3C A;  3TJP A;  5AQP B;  4LER A;  4J6I A;  2WXL A;  2BF0 X;  1XMQ T;  5CFB A;  2DIW A;  1IJ5 A;  4TWH A;  2KC7 A;  3I0O A;  3QNK A;  4HOT A;  2WB5 A;  4ZZC A;  5H6R B;  3SWH A;  1MQS A;  3Q78 A;  2A5E A;  1H6P A;  4I50 E;  4DPR A;  3D9N A;  5G05 C;  3FTX A;  4NIQ A;  3TLV A;  2IF4 A;  2P9L G;  1W3B A;  3N9P A;  3NKZ A;  4WND A;  4AP2 A;  3Q5D A;  5FQ4 A;  3V5U A;  2CG3 A;  4HI8 A;  4J8Y A;  3K3N A;  3ETU A;  4IGU A;  2PM6 A;  4UWG A;  1A5E A;  1XWM A;  2XZD G;  4J8F A;  3QAQ A;  3SFX A;  3AED A;  2WXG A;  2XQ7 A;  5AQQ B;  2BVM A;  1X79 A;  1LD8 A;  1TNY A;  4LG6 A;  3LY8 A;  5LGN B;  3HHM A;  1JWG A;  3W15 B;  1FPP A;  1TYQ G;  4CXW A;  2LNI A;  5AQU B;  3KVB A;  2KLQ A;  4BA9 A;  1FJG T;  4TUY E;  4J8E A;  4GA1 A;  4Q94 A;  2CFZ A;  2SPC A;  2GRN B;  4AVX A;  4X5T A;  3ZYK A;  3SRZ A;  3DRA A;  3EHM A;  5ABG A;  2LM2 A;  3SBT B;  4EBA G;  3MKD A;  2PTF A;  5JRC B;  4H9N C;  4GTO A;  3CVR A;  3OJA A;  4YXD A;  5LG3 A;  1O1T A;  5H6Q B;  2I9C A;  2NC9 A;  3DSV A;  5B1A E;  1IJ6 A;  3ZPO A;  3CVQ A;  1KNR A;  5CBN A;  3UX4 A;  5HWX A;  3ONK A;  3L17 A;  1VOM A;  1V9D A;  1K1A A;  4GYY A;  5AQM B;  2X38 A;  4WBO A;  3DEO A;  5G04 J;  1TEZ A;  1H6O A;  1N0Q A;  1JCR A;  4YDY A;  2ETC A;  5HQ8 A;  3L3P A;  1ZKE A;  5FQ7 A;  4BY6 A;  5FYM A;  3AJI A;  1SA5 A;  4GPM A;  2XAQ B;  1MND A;  4EZ4 A;  4IE7 A;  4K0R A;  2W62 A;  3TLT A;  3K1S A;  1JPL A;  3I5P A;  4GKJ T;  3S7D A;  1X81 A;  4YLH A;  2L0I A;  2DI4 A;  2VGY A;  2VWA A;  3LVR E;  2J9Q A;  4HRN A;  3TGO A;  4AJW A;  4TV9 E;  2XEN A;  4MLK A;  4OK0 A;  3FTY A;  1TNO A;  5J2U E;  2KCL A;  4U7I A;  5EX3 A;  4GOU A;  3ZHE B;  5L3F B;  4PDX A;  4LF8 T;  4QH1 A;  2EHO D;  1SQM A;  4KZC A;  3AEF A;  2OV8 A;  3LYA A;  4E6H A;  3Q5E A;  5T3R A;  2X67 A;  1UK5 A;  4PS8 A;  3TWQ A;  3KDS E;  1SA0 E;  3TWU A;  2IHR 1;  2X0H A;  1MMA A;  2J49 A;  4H63 V;  4YJ2 E;  1O1S A;  3FWV A;  2D0T A;  2BBJ A;  4XKC A;  2CHN A;  2WM9 A;  4L7T A;  3FZH B;  3PV0 F;  3KV4 A;  2GRQ B;  3MKQ A;  4A98 A;  3X1D A;  4LFA T;  3DP7 A;  4J7W A;  1QLB A;  4BTB A;  4BJN A;  2R03 A;  3O1J A;  1FCH A;  3ZFW A;  2K3W A;  3I1A A;  3NRY A;  2BED A;  4HTE A;  4FHJ A;  4DR6 T;  2WDR A;  1UN8 A;  2X3M A;  2QY7 A;  3EHN A;  3ML9 A;  4AIU A;  3PZ4 A;  3CLJ A;  3RGL A;  2EIJ E;  5LBM A;  1DCQ A;  5J0Z A;  3DPY A;  5JDL A;  5CEC B;  2QGS A;  2X9H A;  4HWH A;  4OAU C;  4LFB T;  1VCT A;  2WZI A;  4BES A;  3IF8 B;  2JIW A;  4CYM D;  3IBP A;  3AEA A;  3WAJ A;  3LDQ B;  2WS3 A;  3NVO A;  2FUP A;  3TKL B;  3JUI A;  4JEH A;  4FLB A;  2CG2 A;  2VL0 A;  2DVW A;  4U7Y A;  4CGW A;  4QWN B;  1YKH B;  1OXJ A;  3RYF E;  5LJM A;  5JQG E;  2V7I A;  2HH7 A;  1H6K A;  2IEJ A;  4Z90 A;  1J1J A;  2XQ8 A;  3KAE A;  4GZ5 A;  4K5B A;  4TZ4 C;  3PUK A;  5JDN A;  2F0Y A;  4D10 C;  1N32 T;  2BS3 A;  3Q75 A;  4AQY T;  4KHZ F;  3ZCI A;  2V6X A;  1YKE B;  3G06 A;  5G04 C;  1MX2 A;  2B1E A;  3ASH A;  4G1T A;  2HYZ A;  1V54 E;  1Y6I A;  2LO6 A;  1MYO A;  1HO8 A;  1QNF A;  4N5C A;  3A7M A;  4N39 A;  3C4W A;  3FUD A;  4IDZ A;  4JI6 T;  2YOE A;  4KBM B;  3AG2 E;  5HXE A;  3CST A;  3VTX A;  2NR4 A;  3SBS A;  4ATZ D;  4JI7 T;  2IO3 C;  4H7X A;  5BXO A;  2QYW A;  1BLX B;  3UIO C;  1WG0 A;  2R17 C;  2LSJ A;  2UXB T;  3DST A;  3PEU B;  2XSA A;  3ZC1 A;  3RYC E;  4YSX A;  2ACX A;  4GPK A;  1UGO A;  4H9Q C;  1NFI E;  2A72 A;  2AXV A;  1NEN A;  4FJO A;  1UX4 A;  3Q47 B;  4A97 A;  3RSE G;  2PFV A;  2H6F A;  3CR3 A;  3AA0 B;  2JRK A;  1IYG A;  2WXN A;  4U2Y A;  2JJ9 A;  5LP0 A;  2J62 A;  3AE6 A;  2L9Q A;  3P50 A;  1N11 A;  2R5S A;  3PNT B;  2PZI A;  2QA7 A;  3ZGQ A;  4ZI7 E;  3OTO T;  4V1A v;  3RU0 A;  3KV6 A;  1CUN A;  4GYO A;  2AXZ A;  3V2O A;  4JI3 T;  3DXK G;  4GTS A;  3RO3 A;  3KSL A;  4GZ6 A;  3AS4 A;  2JMK A;  2P9B A;  2UXN B;  3ZN1 B;  5A1L A;  4I4T E;  3TWW A;  4QH5 A;  3AS5 A;  3ASN E;  4FHK A;  1XNQ T;  1E8Y A;  1T7S A;  4IE6 A;  2CHW A;  4ZI3 C;  2UY1 A;  5BMV E;  1UN9 A;  2YHC A;  2CEA A;  1OWL A;  3C98 A;  3QK0 A;  3FZF B;  3KFW X;  5L3D B;  4HWF A;  2W63 A;  1BPO A;  4GZ3 A;  4K03 A;  3NZU A;  2ZM6 T;  1DCE A;  2GRM A;  5BW8 C;  3TL5 A;  3Q4A B;  4ABN A;  5FXW A;  1WM5 A;  4GU5 A;  2LOP A;  2KWH A;  1N4S A;  2VKO A;  4TN7 B;  2PJQ A;  1N95 A;  4YTP A;  3V31 A;  4B89 A;  3K3Q C;  2HN2 A;  4XI0 A;  2FBW A;  5FY7 A;  4WWN A;  3U66 A;  1D1C A;  4DVD A;  4EQF A;  3E30 A;  1D1A A;  1IHB A;  3FUL A;  1D1B A;  5DQW A;  3FU5 A;  1OED C;  3UQ3 A;  1B7T A;  4YDE A;  4F6R D;  3ZRH A;  1FMV A;  5CBO A;  3ASO E;  2B76 A;  1X5B A;  3FU0 A;  4U33 A;  3AB3 B;  1NI1 A;  3G2U A;  4UI9 K;  4H9S E;  5FT9 A;  4AEZ C;  3CIA A;  4F8H A;  3HVE B;  3IKO B;  2JQK A;  3C3Q A;  1SA4 A;  3JQ0 A;  3KD7 A;  1Y64 B;  3O4X E;  2HN1 A;  3ESL A;  3EIJ A;  1IZN B;  4PNI A;  2DNX A;  3PTR B;  2Q9Q B;  3EUH A;  5CCL A;  2CFU A;  3AS8 A;  5ENP D;  3IBE A;  3AEG A;  3O1H A;  3ZIM A;  5BNW A;  5AQK B;  2W00 A;  3ZLI A;  4AY6 A;  3RC3 A;  5DIZ A;  4EED A;  3QNU A;  4DI4 A;  4UVA B;  4DV7 T;  2HPJ A;  3AEB A;  4IE0 A;  4ADZ A;  2UXX B;  2EIM E;  4N2S A;  1D0X A;  4CEM A;  1EZ3 A;  2P9K G;  5JDM A;  2XGO A;  4OYS A;  4JEU B;  4IN3 B;  2L6B A;  5FQ6 A;  2HHH T;  2R2L A;  5LCY A;  2XTL A;  5ANL A;  3O9X A;  3B7U X;  1D8D A;  5HYA A;  3QK6 A;  3ZMS B;  2WSS V;  1XGW A;  3BEE A;  4NUR A;  2CXL A;  1NA0 A;  5AN8 A;  4BSX A;  1S64 A;  3ZU7 B;  3B13 A;  3LKU A;  5CCM A;  4JW1 A;  3Q7A A;  3UUX A;  3AVS A;  3GN5 A;  1TJF A;  4JA9 A;  3FUK A;  3UI2 A;  3N5L A;  2YDQ A;  4URK A;  4JD2 G;  3ZUV B;  3CKC A;  3OBV E;  4IDP A;  5C8Y E;  3MAC A;  5AQO B;  4PJN A;  2P9U G;  3L08 A;  5FZS A;  1YCS B;  3RRU A;  2ZIR A;  4LML A;  3SGH A;  3FFL A;  1OCZ E;  3ETV A;  4B8A A;  3I4R B;  4GZD A;  5LGU B;  2BDE A;  4UI9 C;  3PUS A;  3TLW A;  2KCV A;  4UV9 B;  4XX5 A;  4A55 A;  4YHH T;  3QWP A;  2LSU A;  5LHI B;  3JAF A;  3PJA J;  2H3R A;  4O8S A;  4X62 T;  1EDU A;  2J1D G;  2B0O E;  5A23 A;  1ELW A;  2BTD A;  3ZN0 B;  3HL6 A;  4X20 E;  3V5S A;  1EYH A;  4TXP A;  3QB5 A;  3QDN A;  5AQR B;  2BG9 A;  4CT4 A;  1L5J A;  4HGA A;  2H6G A;  3EHR A;  2XHE A;  4WUY A;  1HS6 A;  3LK2 B;  4WW0 A;  1I6Z A;  4AQF C;  5ENT D;  3SFY A;  3UM3 A;  4RG9 A;  4HFI A;  2ES0 A;  1Z5S C;  4N3C A;  3ZSS A;  2LSK A;  2WXO A;  4Z8X A;  3LVQ E;  4JEU A;  4LFC T;  3D9P A;  4BSZ B;  2DWK A;  5HEU A;  1KPS B;  5L2L A;  1DNP A;  2W0G A;  1JCQ A;  3RHW A;  3OXG A;  4ASK A;  4ZI2 C;  2X51 A;  4KHP T;  1H19 A;  3LJC A;  5E76 A;  5JDQ A;  4UIG A;  4KVO A;  1JNZ A;  3FZK B;  4FP7 A;  4H63 H;  2X9W A;  1I94 T;  2ACZ A;  2LE8 A;  4F3V A;  1HTJ F;  1LF8 A;  3LCA A;  1SE7 A;  3R6N A;  2WMN A;  5HS0 A;  4CZZ B;  2VQF T;  5L3C B;  4GTP A;  4IST A;  4AKR B;  2IC6 A;  4ISS A;  2ZM8 A;  2YDR A;  3PNL B;  3LK4 2;  1KT1 A;  3NB2 A;  4FJY A;  3P4P A;  2V8S V;  4WNK A;  3CVN A;  2ZM2 A;  4L1B A;  2P9I G;  4BFR A;  4KBQ A;  2EQX A;  2FUL A;  3J7Y q;  3CSF A;  2IJG X;  3VKG A;  1N36 T;  5CHE E;  1FMW A;  4DO0 A;  1ELK A;  3EVY A;  1HX1 B;  2BG9 E;  1YD8 G;  4EZL A;  2GRL A;  2XGM A;  4CZ2 D;  2OCC E;  3KEA A;  5FXZ A;  4CN6 A;  4AQF A;  1HNW T;  2RP4 A;  2OV9 A;  3Q9U C;  3S7B A;  4EPZ A;  4A63 B;  4ACK A;  2V5Q C;  4RG6 A;  4UQY A;  3JYS A;  2RFA A;  3B7B A;  4XKB A;  3QOU A;  3EDU A;  1RZ4 A;  2R05 A;  2XCC A;  5B1B E;  4MAL A;  2LT3 A;  3S4U A;  3S7F A;  2NSZ A;  3RRW A;  5FIO A;  4NRH B;  3FUH A;  4U3C A;  2YEV C;  2VGX A;  3CEQ A;  3ONL C;  1W9R A;  1QBQ A;  2L8K A;  3NOG D;  2JLB A;  3CVP A;  4Y6W A;  3KS2 A;  1A17 A;  3ZEF A;  2IML A;  4B8C B;  3JC6 D;  1SW6 A;  1Y8M A;  4XZC A;  2EIK E;  4G26 A;  1QZ2 A;  3RQW A;  3E22 E;  3RK6 A;  4P09 A;  2XM1 A;  3ASG A;  4J8S A;  1TN7 A;  2RPA A;  2UUA T;  4PFO A;  3CHR A;  4JA7 A;  4OYJ A;  3AE9 A;  3HXE A;  3K8P C;  2N1G A;  3LXU X;  4O1P A;  4ZFH A;  1OED B;  4FUL A;  3ZC0 A;  4IL4 A;  2WZH A;  4UWK A;  4FLH A;  4A1G A;  3SS1 A;  2V5F A;  1YYH A;  4UF0 A;  3CVX A;  2DCF A;  4U95 D;  1WY6 A;  3ZXP A;  1MJ0 A;  2IFU A;  3AE8 A;  4H9P C;  3PJA A;  3G2V A;  4CGV A;  3RYI E;  1ZU2 A;  5AQ7 A;  5ENR D;  3ONX A;  3ZT5 A;  3DSU A;  4AIF A;  3Q5W A;  3PUR A;  3UU5 A;  3PZ3 A;  2ZGD A;  3PUJ A;  4U0U A;  2LXM A;  2NWB A;  3GWH A;  4YND A;  3KV5 A;  4W9R A;  4DND A;  1Z8U A;  1BR4 A;  1EPU A;  5DBK A;  4TWD A;  3C5R A;  3RRN B;  3UPV A;  2JPF A;  2XQ5 A;  2LSY A;  4HLE A;  3N2O A;  4GTR A;  2VVN A;  2LOS A;  1TNZ A;  2P9N G;  3APD A;  2Q7F A;  4J2C A;  3CQX C;  3S2A A;  3BQK A;  2GW1 A;  4U0S A;  3MKR A;  1IQU A;  4E7S A;  2HR2 A;  1Z3X A;  1BD8 A;  2FEZ A;  3Q49 B;  3PZ2 A;  4X64 T;  1S35 A;  2R6G F;  2E2E A;  1S70 B;  1YW0 A;  2VSN A;  4HFV A;  3AE3 A;  5AQH B;  3LK3 B;  3E34 A;  1OCC E;  4OVV A;  5EK3 A;  4I9C A;  1IQR A;  3FUI A;  4CI1 B;  2VGE A;  4F1S A;  4CI3 B;  4PK5 A;  4FAD A;  5HCM A;  4HKA A;  3Q9N C;  3R9M A;  2K9A A;  3FUJ A;  4B3S T;  4DR7 T;  2FJE A;  2XQ4 A;  1SVX A;  3UUM A;  4DV4 T;  3UTM A;  2KZT A;  2LSI A;  5L4E A;  3BQO A;  5AQV B;  3ABK E;  4G2V A;  4O6F A;  5LG4 A;  4I1M A;  3DXM G;  5LMU T;  4TV3 A;  2B6C A;  4CXX A;  5AQJ B;  2RG8 A;  3HKD E;  3T8O A;  2X6K A;  4HBD A;  5FNV E;  3FXE B;  5KJM A;  5AAO A;  4UWL A;  2XUE A;  3JC6 C;  5BXU A;  4AIS A;  1WYC A;  3P4S A;  5EX0 A;  5H7P A;  2WB2 A;  3UU4 A;  2VSX E;  4DX5 D;  2X6H A;  4XE0 A;  3BUA A;  2CHZ A;  5F3J A;  2DWZ A;  5BV0 A;  4IIJ E;  2W61 A;  5ARF A;  1O5M A;  5KJN A;  3QC1 A;  2YHE A;  1IAP A;  5JH7 E;  4I1A A;  1FEW A;  2YQ8 A;  2NTX A;  2VSY A;  4U2Z A;  2MAW A;  2LEH A;  3SFZ A;  4C0E A;  4F7A A;  3NBX X;  4HQD A;  1NP7 A;  2AWI A;  4U8Y D;  4AV7 A;  4DJA A;  5AFU L;  2PNN A;  1XNR T;  3UFE A;  2JQH A;  3TWT A;  2XJ7 A;  4HS2 A;  4GA2 A;  3ZJ1 A;  3H3A A;  4EOZ B;  4F6R C;  1E8X A;  4CDR A;  3IEG A;  2BKK B;  3RRM B;  3PE4 A;  2X66 A;  2WDQ A;  4JBW F;  3BK9 A;  1OT8 A;  4Z91 A;  3UKR G;  3D3M A;  1LD7 A;  1UUS A;  4TNV A;  3N9M A;  3V79 K;  3CML A;  3CGH A;  1W0A A;  3WAK A;  2VVS A;  3LJ3 A;  4CCA A;  4UXN B;  5C2T A;  5JR9 A;  5D66 A;  4GKK T;  1VDY A;  4KUM B;  2OA5 A;  3NZP A;  2DL1 A;  1H2U A;  2MOZ A;  3OYX A;  2W2U A;  4X1Y E;  5KMG P;  3EUV A;  2C2L A;  3PE3 A;  3PUY F;  3T1H T;  1N9A A;  3PZD A;  4DR5 T;  3P4W A;  4EGW A;  4DBQ A;  1ELR A;  1M62 A;  4EYU A;  2IY0 C;  5ANR A;  2MTQ A;  2LHN A;  1W0B A;  3QAR A;  3TG5 A;  1HR0 T;  4ANV A;  1UG3 A;  1NL4 A;  4ZHQ E;  3RIU A;  3TLU A;  1XDP A;  3PDN A;  1WR6 A;  4HN9 A;  3BQI A;  4KZ0 A;  5CB4 E;  2KMF A;  1VRB A;  3P4R A;  1UW4 B;  4FA6 A;  3U64 A;  4CDM A;  2BG9 B;  3LFM A;  3UTK A;  3CHM A;  3SF4 A;  3SHF A;  1DVP A;  4GMJ A;  3O48 A;  2V26 A;  3RI5 A;  4G2A A;  3UUB A;  4TXQ A;  4IDN A;  2XPI A;  3UT8 A;  2NYJ A;  3MX3 A;  2K24 A;  3QC9 A;  2XY8 B;  4B6X A;  4L9P A;  2Y3A A;  1HNZ T;  3I3N A;  3SFE A;  2XCB A;  3FP3 A;  3FTV A;  1OWP A;  2H7O A;  3K9I A;  4DX2 A;  5T8I A;  3Q2M A;  4NXN T;  1FT1 A;  3AAI A;  4AKI A;  2XPZ A;  2AXD S;  4UV8 B;  1HX8 A;  4DV0 T;  4U7E B;  4OX9 T;  4KX6 A;  3HXB A;  4X66 T;  2WXI A;  4ANW A;  3QUJ A;  5AQG B;  1OCO E;  1E7P A;  2CE7 A;  2XQ6 A;  3ANW B;  3VRA A;  1N4R A;  5J1G A;  2CMR A;  1S63 A;  1WFD A;  3HIZ A;  4RVB A;  2CCQ A;  2V8S E;  3ASD A;  5KNH D;  3UUL A;  4LMJ A;  2Y48 B;  3U3W A;  1YA0 A;  4DX1 A;  5AQ9 A;  5D2M C;  4BET A;  3CK6 A;  4BT8 A;  4AKL A;  3ZST A;  4HFH A;  4DX7 D;  4L5G A;  5L3B B;  2CHX A;  5FJY A;  3LJN A;  3VRB A;  4BAY B;  2BKP A;  3CK9 A;  2MHK A;  5EK4 A;  2CPT A;  3SZ7 A;  3DWL G;  1E2A A;  4OFZ A;  4Q69 A;  3PU8 A;  3I0Q A;  3QWW A;  5JA4 D;  3CQC B;  4FU3 A;  3VKH A;  1E1H B;  3ANW A;  5KNG A;  2YN6 A;  2J8S D;  3AU5 A;  4K0U A;  5AIJ A;  4ZI2 D;  4ME2 A;  3C4X A;  3BG1 B;  3GYZ A;  3E37 A;  2X0Y A;  2LRL A;  2ODU A;  4EHM A;  4GTM A;  2MRI A;  1OED E;  4PK4 A;  3AAE B;  1DU2 A;  3OXL A;  4ZHB A;  1JCS A;  4QKN A;  1Z3Y A;  2WU5 A;  3E33 A;  5GON E;  2E8I A;  1JUQ A;  2DZN A;  5LCW C;  4FI5 A;  4CN4 A;  4O2B E;  1QYM A;  3E32 A;  3GZ1 A;  3IHR A;  4ILB A;  3ZEF B;  1E7U A;  5FQ8 A;  2XPY A;  5JRC A;  5FVL A;  4B3T T;  5HWY A;  1KFY A;  4DR3 T;  4U96 D;  3CVY A;  3SFD A;  4A5X A;  5JJ7 A;  3HKE E;  2VTB B;  1N94 A;  3B7T A;  2NXP A;  1J5E T;  3TWS A;  1H0A A;  3ULQ A;  2P2C P;  2CM0 A;  4JHR A;  2IAK A;  4GB9 A;  2HO1 A;  2XPK A;  5F8P A;  4QFV A;  3ZKJ A;  4IL9 A;  2YK0 A;  4EEB A;  4MBG A;  4RQI A;  5ENO D;  5B3S E;  5IYZ E;  2XZT G;  1HG5 A;  3OYZ A;  2GRR B;  3L13 A;  5L3G B;  4JHK A;  4JXT A;  5KDM C;  3TG4 A;  4HOR A;  3FUF A;  4JPS A;  5G2N A;  4YTN A;  2XQA A;  1GW6 A;  3FEX A;  5ABF B;  3RO2 A;  2XQ9 A;  3AG3 E;  1TJC A;  1J5W A;  1HF8 A;  2VJ8 A;  3CK8 A;  3RIB A;  3MCX A;  1BU9 A;  4ILC A;  4J0U A;  2LLY A;  3NBN B;  4HOS A;  3N2G E;  2ETB A;  2GRP B;  4DV5 T;  4DMW A;  3M3Z B;  1HZ4 A;  3OAW A;  1K8K G;  3G2T A;  3UM0 A;  4IE5 A;  1KZP A;  2UUB T;  2OEW A;  1V55 E;  2P58 C;  1UOH A;  4I43 A;  4PFP A;  4EZK A;  1KF6 A;  1TR4 A;  4N3B A;  2E9X C;  3VHL A;  4PS3 A;  4GYW A;  5TAO A;  1WRD A;  2ZM0 A;  4DI3 A;  5LHH B;  3OXF A;  3TXM A;  3FZM B;  1NA3 A;  5EKQ D;  2UXC T;  2CBI A;  2YU1 A;  4UVB B;  3P1U A;  5ABH A;  4BX8 A;  1D0Y A;  1DC2 A;  3AVR A;  4G8K A;  1FVH A;  3UT5 E;  4MBQ A;  5FL1 A;  4HWC A;  4JYA T;  2I2O A;  3OPC A;  2WWU A;  3PUX F;  4H9R C;  3EI0 A;  4I1O B;  1PY1 A;  1ZB1 A;  2XAH B;  4DUZ T;  2HE0 A;  2BG9 C;  3HVE A;  2XEV A;  3ONL A;  2BBH A;  2YU2 A;  4WZX A;  4B0Z A;  2CWY A;  2YNQ A;  2WXK A;  4C90 A;  3RJV A;  2X6I A;  3UU3 A;  3MA5 A;  4F1P A;  2OVF A;  4CI2 B;  3RF1 A;  1T72 A;  4O2A E;  4LNU D;  1D9S A;  3AA1 B;  4P0B A;  4Y6C A;  2V0P A;  2IUB A;  5AQI B;  3JCK C;  3I9W A;  2WWV A;  1WYB A;  4IRE A;  3SNX A;  2V7L A;  3T8K A;  3UQ4 A;  4CXY A;  4A3V A;  1R8I A;  2N2N A;  1LVF A;  3PRZ A;  3ZT7 A;  1BR0 A;  1G3N B;  5BV1 A;  4HE8 A;  4JEH B;  4NUV A;  2DZO A;  4BEP A;  3L8R A;  1AJ3 A;  2XRZ A;  5BR8 T;  3APF A;  2ODV A;  2CXF A;  3BU8 A;  3P7I A;  3T5V A;  3Q73 A;  3CHP A;  3ZVV A;  2XM2 A;  4YTM A;  3CVV A;  3R9A B;  3ABM E;  5IHY A;  1MMD A;  3DJB A;  1S94 A;  3CX6 B;  3VR9 A;  3ENE A;  4ZEY A;  3ZMU B;  2G0U A;  2YIN A;  4XAX B;  3L39 A;  3HXD A;  1FVF A;  4UQX A;  1HXI A;  4UR9 A;  3RIU C;  3DTO A;  2QFC A;  4DR4 T;  1INZ A;  4H9O C;  4C0M A;  2FBN A;  2VGX B;  2IO2 C;  3OTN A;  3KBU A;  3J5P A;  3GMI A;  1E7V A;  4U8V D;  2I1J A;  2DHR A;  4BT9 A;  2OOE A;  3ZN3 A;  1RW2 A;  5F5W A;  3PUQ A;  4M3O A;  5C2Y A;  3Q9D A;  3Q79 A;  3T5X A;  3EIQ C;  4UI9 J;  4C48 B;  4BX9 A;  2H7V C;  5CRV A;  4Z68 A;  3KSQ A;  1NAF A;  2LHR A;  2C5J A;  2WDV A;  3CKB A;  1SZ9 A;  2V1D B;  3CVL A;  5HXC A;  1JNR A;  2HPL A;  4ZXL A;  3MGB A;  4DK5 A;  4GTQ A;  3UIN C;  5DJQ C;  3D9I A;  4BTA A;  1OWM A;  1FIO A;  2W4X A;  3E08 A;  3TLS A;  3PUG A;  3WI3 A;  4A56 A;  3ABL E;  1N34 T;  3AA7 B;  1XZY A;  4KMO A;  3UT7 A;  3FUN A;  2JQ9 A;  3LBX A;  3LY7 A;  3TWV A;  2XEE A;  4RSY A;  2FJA A;  4ACL A;  5HEJ A;  4ZS2 A;  2EIN E;  2QYJ A;  2VQE T;  4OAV B;  4ANJ A;  1N33 T;  3AG4 E;  4TXR A;  3ULY A;  3ZYM A;  3PUZ F;  3SI5 A;  2Z6E A;  1Z0P A;  3RKV A;  3G2S A;  4O4J E;  4CN1 A;  4UWF A;  1IBL T;  2KXP B;  2JEK A;  5HI7 A;  5ABE A;  3MJX A;  3AE7 A;  1PC2 A;  4I9E A;  4H7Y A;  4L0R A;  4FJZ A;  3ABV A;  3B7R L;  3LY9 A;  5JVD E;  4OYK A;  4XIF A;  4NQ0 A;  5ADX L;  4LF6 T;  2RKK A;  3JCF A;  2V4L A;  5IY5 E;  4MS6 A;  4HFD A;  1Q2Z A;  2H6H A;  4N3A A;  4N2Q A;  3CWZ B;  3ZCJ A;  2OEV A;  4DV2 T;  3MXZ A;  3H37 A;  3SO8 A;  4O1O A;  1KNZ A;  2QZA A;  2JQQ A;  3Q5M A;  5D0O D;  3MJW A;  2ILR A;  2CLY B;  5FXV A;  4B3R T;  3RX6 A;  2KM4 A;  3KIN B;  3RAU A;  4HWD A;  5CER B;  2BS4 A;  3QOF A;  3FTW A;  3C51 A;  4ILU A;  2P9P G;  2Q9Q C;  1HH8 A;  3NZQ A;  1OY3 D;  2WY2 A;  4IDQ A;  2Y0B G;  3OVU A;  4I6G A;  3LPZ A;  2NW8 A;  3FH5 A;  2D9D A;  3RKO A;  3VU7 H;  4AXH A;  3FU6 A;  3EAM A;  3TWX A;  5J2T E;  3KV9 A;  4LSZ E;  2LRK A;  3RC8 A;  4FC8 A;  4GCO A;  3T1Y T;  3EAB A;  4J8D A;  2M6I A;  4YT0 A;  5HXS A;  2BUG A;  3I9Y A;  3APC A;  4JHJ A;  4EZJ A;  1QSD A;  5FP3 A;  4TX5 A;  4IRU A;  1XDO A;  3AA6 B;  4L2Y A;  2Y1L E;  4KI0 F;  4DV6 T;  1U5P A;  4ILH B;  3GZS A;  3RPU A;  3GZ2 A;  5EN5 D;  4PW8 A;  3RRC A;  3V2X A;  4AI6 A;  2KSR A;  4DUI A;  3IV0 A;  2Y6X A;  1JWF A;  4IT4 A;  4APO A;  3FEY A;  2W67 A;  4MKT A;  1MIW A;  3UUN A;  2WMO A;  5L3E B;  5JMN D;  4CT0 A;  3ZKR A;  5CED B;  5HEG A;  4O4L E;  4OHF A;  4X1I E;  5M4Y A;  4HOU A;  3N9L A;  3ZHE A;  5EYP F;  2MPK A;  5CMW A;  5ENS D;  2WP9 A;  3PH0 C;  2DBA A;  1OUV A;  5CGM A;  4F53 A;  4GTV A;  5JRE A;  4NXM T;  1YMP A;  2LXL A;  2K5B B;  2D2S A;  4GMR A;  4PH4 B;  2MBG A;  2QVA A;  3G2W A;  5LJN A;  4UEL A;  3ZPJ A;  2V7K A;  2CHO A;  1UJJ A;  3PRE A;  5E0O A;  4EAH A;  5ABF A;  4N78 D;  4E85 A;  5ENN A;  4LF4 T;  4JI4 T;  2C0L A;  5M72 A;  2VKH A;  4QXH B;  4JB8 P;  3HXF A;  1MHQ A;  3L09 A;  2IQC A;  4JZY A;  3MKQ B;  1HFA A;  2KZ7 B;  4U63 A;  2D5U A;  1OWO A;  1NWM X;  2X68 A;  3T8M A;  3KVA A;  5KJK A;  4NAC A;  2V7J A;  4E7Z A;  1N0R A;  2A5U A;  4C91 A;  3KBT A;  5LNK A;  4YSZ A;  3FTZ A;  1ZOY A;  5HEO A;  1WR0 A;  4MHC A;  2I59 A;  5EID A;  3EHQ A;  2W66 A;  1G8X A;  5FY0 A;  3ZW3 A;  4HVB A;  3HKC E;  2CWO A;  4LMK A;  3L22 A;  2Q9Q D;  2VB6 A;  3FU3 A;  2F8X K;  3AXJ B;  4DV1 T;  5EIB E;  4WBN E;  1X9B A;  5KX5 E;  2AVP A;  4G11 A;  3J9X 1;  2LKH A;  2FJD A;  3MV2 B;  2WAU A;  2X6J A;  3H3M A;  3ASF A;  3L6A A;  5EYL A;  1TN6 A;  2UUC T;  1OWN A;  5LFA A;  2WXP A;  1LRZ A;  2ZXW E;  3ZJ2 A;  2Y69 E;  3VLD A;  3LBX B;  4NIK A;  2XAG B;  3AE1 A;  3C3R A;  5HKP A;  4PUC A;  1MX6 A;  3S7J A;  2CBJ A;  3AXJ A;  3LG7 A;  4YSY A;  2XQY A;  5AJL A;  3FH7 A;  5EZY E;  4YDW A;  1CHU A;  4HRM B;  1O3X A;  4LEU A;  1H2V C;  4A3T A;  3RLF F;  3CV0 A;  2LSV A;  2RA1 A;  4HNA D;  5A6C A;  4C9B B;  2WQ7 A;  1W09 A;  1IHG A;  3FH8 A;  3PU3 A;  5AAR A;  1QQE A;  4G23 A;  5FZR A;  3UU6 A;  3CIR A;  2GGF A;  2VUR A;  4ILG A;  3R7Q A;  2RFM A;  2RD0 A;  4WNF A;  4JL0 A;  1OXZ A;  4TUU A;  4B3M T;  1WAO 1;  4TWF A;  4BER A;  2E9X D;  5JR9 C;  2XS1 A;  4M7C A;  4APF A;  3NF1 A;  4AKG A;  3F57 A;  5JJ6 A;  2VSO E;  3PS6 A;  5IWA T;  3DSW A;  4X1K E;  4KXK B;  2BVL A;  1K3Z D;  1US7 B;  3E4B A;  2EIL E;  3CPZ A;  3HYM B;  3JQ1 A;  3U4T A;  1B89 A;  4B94 A;  3B95 A;  1HCI A;  3AAA C;  1UCU A;  2DLR A;  4HI9 A;  3MK7 C;  1VCS A;  2NW7 A;  4P29 A;  2Y8D A;  3FY4 A;  3CHQ A;  3L9T A;  4KMC A;  3JUE A;  4EYY R;  4ZOL E;  1KK7 A;  4YVQ C;  2WU2 A;  1SZA A;  2P9S G;  4QX8 B;  3DEP A;  2LUH A;  5LHG B;  2XRY A;  1Z6T A;  4KVM A;  5C1D A;  5JTG A;  3ONJ A;  2J4D A;  3FTU A;  1WCR A;  2PBI A;  3K3O A;  3NOC D;  3W9F A;  3HRA A;  2BKO A;  4U04 A;  2YDS A;  1E8Z A;  3TXN A;  4PJJ A;  1ZEE A;  2PQN A;  3V30 A;  4RLY A;  4XZ4 A;  5AJD A;  1IBK T;  3J5Q B;  4BJM A;  2IOS A;  3U78 A;  2V6Y B;  3BQL A;  3EDV A;  2CXD A;  1UX5 A;  3GA8 A;  3QWV A;  2CA5 A;  3PUV F;  4COF A;  2DWG A;  5FKY A;  3HXC A;  4ZS3 A;  2DYR E;  3B5M A;  4L23 A;  3IEE A;  1MNE A;  4U31 A;  3CHS A;  3SY2 A;  4I43 B;  4LRZ A;  3LEW A;  4MFR A;  2J09 A;  3NQP A;  2NP9 A;  1T98 A;  5JHA A;  5JDF A;  3IA3 A;  3VTY A;  3UMV A;  4ILA A;  3P8C D;  1D8E A;  5L47 A;  5HAX A;  2WXJ A;  4JVS A;  4M1P A;  1KT0 A;  1AP7 A;  3UIP C;  3IXE A;  2Y4U A;  2BKN A;  3UKU G;  5BUZ A;  4JI2 T;  3UU8 A;  5DQV A;  3URZ A;  4XBF B;  3C50 A;  5ETW A;  4G8L A;  3DBS A;  2M6B A;  2WXH A;  5G05 J;  4HWI B;  4QHO A;  3AAA B;  2C5K T;  2LAI A;  5JHB A;  3N2K E;  3CK7 A;  3EJN A;  4JI0 T;  1N52 A;  3RQU A;  2ZIS A;  2R59 A;  4I2W A;  3LDZ A;  4I55 E;  5JJT A;  4TRQ A;  4QQI A;  3FBL A;  4EEC A;  1WDY A;  1BR2 A;  3LS8 A;  3A8Y C;  2C0M A;  4JV5 T;  1KEY A;  4P0A A;  4NPP A;  4I2Z A;  3D9K A;  3HR0 A;  4LNB A;  1NEK A;  3C98 B;  5ENQ D;  2Y4T A;  4HRL A;  2D0U A;  4AKH A;  4UEM A;  4IDO A;  2LAH A;  4I17 A;  2WXM A;  4X65 T;  3HKB E;  3DSX A;  2V5C A;  4WAF A;  2XAF B;  2Q9Q A;  2WXR A;  3Q7F A;  2VKD A;  4EZH A;  1QUU A;  3FXD B;  4EXT A;  1BR1 A;  3CKD A;  5E75 A;  2BZB A;  2WQY A;  5AQA A;  1MMG A;  2UXD T;  2E5V A;  2N9D A;  2FI7 A;  3FBZ A;  1HS7 A;  4K5A B;  5HXR A;  4K0K T;  4I0U A;  2F4V T;  1XNF A;  2VKJ A;  4UWH A;  4HLL A; 
#chains in the Genus database with same CATH homology
 3D0T A;  4GK5 E;  2LM9 A;  4KP3 C;  2C5I T;  3QKY A;  3KEZ A;  4LCT A;  3U3I A;  2DCP A;  4GAA A;  2NOX A;  4DMV A;  1NZN A;  5J90 A;  3AU4 A;  2KWI B;  5LXT E;  3GN5 B;  4PS7 A;  2E9X A;  4EIW A;  3RH3 A;  3A5X A;  4YHJ A;  2VK9 A;  4QX7 B;  3P2B A;  5G55 A;  4R7L A;  5ARG A;  3TAX A;  4O4H E;  5CA0 E;  5FMN A;  1H7C A;  5LCW J;  5T4Y A;  2WXQ A;  2L6J A;  2WQH A;  2L3L A;  2FO7 A;  2UY1 B;  4CQI A;  4ERR A;  4ANU A;  3C4Z A;  3QB2 A;  3MYV A;  3ZMV B;  4PJM A;  4TV8 E;  1HG2 A;  3CQG B;  4XI9 A;  3C64 A;  2ZU6 B;  2KT9 A;  2X9Y A;  4UQZ A;  3ZMZ B;  2JMH A;  2LSG A;  3CX7 B;  4BWR A;  5A7D B;  4YVO A;  3PE0 A;  5JR9 B;  1E96 B;  4YJ3 E;  4QXC B;  3UUX B;  2C0S A;  3B7S A;  4PJL A;  3QJZ A;  1G73 A;  4HOQ A;  3BG0 B;  5LGT B;  1LKX A;  3ZYQ A;  2VAS A;  4JUY A;  3CHO A;  1LVK A;  3PUA A;  2M63 A;  3WXX A;  5CMY A;  3FTS A;  2VTB A;  5BT1 A;  2L0T B;  3UT4 A;  3CVU A;  3MEK A;  5EK2 A;  1E90 A;  4EBA A;  2PM7 A;  2XAJ B;  2J07 A;  4G24 A;  3NRX A;  2KCK A;  4MRU A;  1WLX A;  2A3D A;  4GK0 E;  3SOL A;  3L16 A;  2I1K A;  2IOL A;  4CDN A;  4HFG A;  4GCN A;  2XHE B;  4KT6 B;  1PAQ A;  4A1S A;  4ATG A;  2PL2 A;  2XAS B;  2OVB A;  4U74 A;  4IUL A;  2VYI A;  3MA9 A;  2AXU A;  1S0P A;  4AXP A;  4IHJ E;  4WNE A;  4AM9 A;  3FDH A;  5LBQ B;  3FUM A;  4PK6 A;  3F2E A;  3R7R A;  4GYR A;  2A4Z A;  3SD5 A;  5DAB A;  2CLY C;  4LUN U;  1H2T C;  4GA0 A;  2IW5 B;  3N71 A;  5LOV E;  4L9I A;  4HXI A;  4Q96 A;  1UJK A;  5JDH A;  2VL8 A;  2NTY A;  2OND A;  2NW9 A;  3MV3 B;  3Q15 A;  4HEA A;  3CX8 B;  3MZK B;  4JLE A;  2XGS A;  3FHN A;  5FY1 A;  4U0Z A;  5AEN A;  3Q5X A;  3E0Z A;  1MIV A;  4U72 A;  2X0L B;  4UVC B;  4CRW A;  4V3I A;  5LOZ A;  1KLX A;  2WXF A;  5KJL A;  5LX8 A;  4ILI A;  4WNG A;  5FZQ A;  4GML A;  4JC8 A;  4G63 A;  3N9Q A;  1D0Z A;  3NZS A;  5JDG A;  4ANX A;  2V7M A;  2ZMA A;  4PAG A;  2KZT B;  3D9M A;  2GK9 A;  4WWP A;  3PEV B;  3ZMT B;  5D0Q D;  2KND A;  3VLE A;  4L2L A;  4YFS A;  5CA1 E;  2MYS A;  1ZHC A;  1ZV4 X;  3HI2 A;  3ZYL A;  2WQ6 A;  3L54 A;  3R84 B;  2WBL A;  3GW4 A;  2X9X A;  4DBR A;  2EHO C;  2KIN B;  4QXB B;  4DLO A;  3F31 A;  4DLQ A;  2I6H A;  3DPD A;  3ML8 A;  4AY5 A;  4KYO B;  4UF0 B;  3ZXS A;  4AOF A;  4GZC A;  5AYW D;  3VLF A;  5FWQ A;  4MLP A;  3U9W A;  1E8W A;  3HDX A;  1OWA A;  3N9N A;  1HE8 A;  5KCM A;  4I6E A;  4IE4 A;  5FTP A;  3D9J A;  3O1I A;  3B57 A;  3OKQ A;  5FXX A;  3I4G A;  2MOW A;  2VQ2 A;  2J4B A;  4NUU A;  2E0I A;  3CVW A;  3FUE A;  5BPP A;  2HM8 A;  1U4Q A;  2J08 A;  2XQ0 A;  4I6J A;  4AQG A;  4O4I E;  2ZLY A;  5J08 A;  2FF4 A;  4GYS A;  2EHO A;  2LJL A;  3RYH E;  3N9O A;  3IHY A;  4ZI3 D;  3D9L A;  1EF1 C;  3PVL A;  5EDS A;  1U3D A;  4IYP A;  5HXH A;  2WPV A;  2PQR A;  2X6F A;  3M65 A;  2KAT A;  2M67 A;  3FB2 A;  3FHE A;  5LA6 E;  2EHO B;  4U07 A;  1HU3 A;  4G25 A;  2ION A;  4EB6 E;  1N54 A;  3IHV A;  1SHZ C;  2A2F X;  2IC9 A;  4OVU A;  4GIW A;  2WVI A;  5LP6 E;  1MIY A;  4WWO A;  3D9O A;  2PG8 A;  2K48 A;  3PDY A;  2E9X B;  5LYJ E;  2IU1 A;  3EDT B;  1ZBP A;  1MMN A;  4U8H A;  3O4Z A;  3HA4 A;  3MZL B;  2L9B A;  3ESK A;  2AW6 A;  1P5Q A;  2UWJ G;  1U3C A;  3TJP A;  4LER A;  4J6I A;  2WXL A;  2BF0 X;  2KC7 A;  2DIW A;  1IJ5 A;  3I0O A;  3QNK A;  4HOT A;  5H6R B;  3SWH A;  1MQS A;  4I50 E;  4DPR A;  3D9N A;  5G05 C;  3FTX A;  2IF4 A;  1W3B A;  3N9P A;  4WND A;  4AP2 A;  5FQ4 A;  3V5U A;  2CG3 A;  4UWG A;  3K3N A;  3ETU A;  4IGU A;  2PM6 A;  4J8F A;  3QAQ A;  2WXG A;  2BVM A;  1X79 A;  3LY8 A;  5LGN B;  3HHM A;  1JWG A;  3W15 B;  4CXW A;  2LNI A;  3KVB A;  2KLQ A;  4BA9 A;  4TUY E;  4J8E A;  4GA1 A;  4Q94 A;  2CFZ A;  2SPC A;  4AVX A;  3ZYK A;  3SRZ A;  3EHM A;  3SBT B;  4EBA G;  3MKD A;  5JRC B;  4H9N C;  3CVR A;  3OJA A;  5H6Q B;  2I9C A;  2NC9 A;  1IJ6 A;  3ZPO A;  3CVQ A;  3UX4 A;  5HWX A;  3ONK A;  3L17 A;  1VOM A;  1V9D A;  4GYY A;  2X38 A;  4WBO A;  5G04 J;  1TEZ A;  5HQ8 A;  3L3P A;  1ZKE A;  5FQ7 A;  4BY6 A;  5FYM A;  2XAQ B;  1MND A;  4EZ4 A;  4IE7 A;  4K0R A;  2W62 A;  1JPL A;  3I5P A;  3S7D A;  4YLH A;  2L0I A;  2DI4 A;  2VGY A;  2VWA A;  3LVR E;  2J9Q A;  3TGO A;  4AJW A;  4TV9 E;  4MLK A;  4OK0 A;  3FTY A;  5J2U E;  2KCL A;  5EX3 A;  4GOU A;  3ZHE B;  5L3F B;  4PDX A;  2EHO D;  1SQM A;  4KZC A;  2OV8 A;  3LYA A;  4E6H A;  5T3R A;  2X67 A;  4PS8 A;  3KDS E;  1SA0 E;  1MMA A;  2J49 A;  4H63 V;  4YJ2 E;  3FWV A;  2D0T A;  4XKC A;  2WM9 A;  4L7T A;  3KV4 A;  3MKQ A;  3DP7 A;  4BTB A;  4BJN A;  3O1J A;  1FCH A;  3ZFW A;  3NRY A;  3I1A A;  4HTE A;  4FHJ A;  1UN8 A;  2X3M A;  2QY7 A;  3EHN A;  3ML9 A;  3CLJ A;  5LBM A;  5JDL A;  2QGS A;  2X9H A;  3IF8 B;  3IBP A;  3WAJ A;  3TKL B;  3JUI A;  4JEH A;  4FLB A;  2CG2 A;  4CGW A;  4QWN B;  1YKH B;  3RYF E;  5LJM A;  5JQG E;  2V7I A;  2HH7 A;  1H6K A;  3KAE A;  4GZ5 A;  4TZ4 C;  3PUK A;  5JDN A;  4D10 C;  3ZCI A;  1YKE B;  5G04 C;  2B1E A;  3ASH A;  4G1T A;  2HYZ A;  1Y6I A;  2LO6 A;  1HO8 A;  1QNF A;  4N5C A;  4N39 A;  3C4W A;  3FUD A;  4IDZ A;  4KBM B;  3VTX A;  5HXE A;  3CST A;  3SBS A;  4H7X A;  2R17 C;  2LSJ A;  3PEU B;  3ZC1 A;  3RYC E;  2ACX A;  4GPK A;  4H9Q C;  2AXV A;  2A72 A;  4FJO A;  1UX4 A;  3Q47 B;  2PFV A;  3CR3 A;  3AA0 B;  2JRK A;  1IYG A;  2WXN A;  2JJ9 A;  5LP0 A;  2L9Q A;  3PNT B;  2R5S A;  2PZI A;  2QA7 A;  3ZGQ A;  4ZI7 E;  4V1A v;  3RU0 A;  3KV6 A;  1CUN A;  4GYO A;  2AXZ A;  3RO3 A;  4GZ6 A;  3AS4 A;  2JMK A;  2P9B A;  2UXN B;  3ZN1 B;  5A1L A;  4I4T E;  3AS5 A;  4FHK A;  1E8Y A;  2CHW A;  4IE6 A;  4ZI3 C;  2UY1 A;  5BMV E;  1UN9 A;  2YHC A;  2CEA A;  1OWL A;  3C98 A;  3QK0 A;  3KFW X;  5L3D B;  2W63 A;  1BPO A;  4GZ3 A;  4K03 A;  3NZU A;  2GRM A;  5BW8 C;  4ABN A;  3TL5 A;  3Q4A B;  5FXW A;  1WM5 A;  4GU5 A;  2LOP A;  2KWH A;  2VKO A;  4TN7 B;  2PJQ A;  4B89 A;  3K3Q C;  4XI0 A;  5FY7 A;  4WWN A;  3U66 A;  1D1C A;  4DVD A;  4EQF A;  1D1A A;  3FUL A;  1D1B A;  5DQW A;  3FU5 A;  3UQ3 A;  1B7T A;  3ZRH A;  1FMV A;  1X5B A;  3FU0 A;  4B94 A;  3AB3 B;  3G2U A;  4UI9 K;  5FT9 A;  4H9S E;  4AEZ C;  3CIA A;  3HVE B;  3IKO B;  3JQ0 A;  3KD7 A;  1Y64 B;  3O4X E;  3ESL A;  3EIJ A;  1IZN B;  4PNI A;  2DNX A;  3PTR B;  2Q9Q B;  3EUH A;  5CCL A;  2CFU A;  3AS8 A;  3IBE A;  3O1H A;  5BNW A;  3ZIM A;  2W00 A;  3ZLI A;  4AY6 A;  3RC3 A;  5DIZ A;  4DI4 A;  4UVA B;  2HPJ A;  4IE0 A;  4ADZ A;  2UXX B;  4N2S A;  1D0X A;  4CEM A;  1EZ3 A;  5JDM A;  2XGO A;  4OYS A;  4JEU B;  4IN3 B;  5FQ6 A;  5LCY A;  2XTL A;  5ANL A;  3O9X A;  3B7U X;  5HYA A;  3QK6 A;  3ZMS B;  3BEE A;  2WSS V;  1XGW A;  4NUR A;  2CXL A;  1NA0 A;  4BSX A;  3B13 A;  3LKU A;  5CCM A;  4JW1 A;  3UUX A;  3AVS A;  3GN5 A;  1TJF A;  4JA9 A;  3FUK A;  3N5L A;  4URK A;  3CKC A;  3OBV E;  5C8Y E;  3MAC A;  5FZS A;  4PJN A;  3L08 A;  3RRU A;  3SGH A;  3FFL A;  3ETV A;  4B8A A;  3I4R B;  4GZD A;  5LGU B;  2BDE A;  4UI9 C;  3PUS A;  2KCV A;  4UV9 B;  4XX5 A;  4A55 A;  3QWP A;  2LSU A;  5LHI B;  2H3R A;  4O8S A;  1EDU A;  2J1D G;  5A23 A;  1ELW A;  2BTD A;  3ZN0 B;  3HL6 A;  4X20 E;  3V5S A;  1EYH A;  3QDN A;  4CT4 A;  1L5J A;  4HGA A;  2XHE A;  4WUY A;  1HS6 A;  3LK2 B;  4WW0 A;  4AQF C;  4RG9 A;  2ES0 A;  4N3C A;  2LSK A;  2WXO A;  4Z8X A;  3LVQ E;  4JEU A;  3D9P A;  2DWK A;  5L2L A;  1DNP A;  2W0G A;  3OXG A;  4ASK A;  4ZI2 C;  2X51 A;  1H19 A;  3LJC A;  5E76 A;  5JDQ A;  4UIG A;  4KVO A;  4FP7 A;  4H63 H;  2X9W A;  2LE8 A;  4F3V A;  1HTJ F;  1LF8 A;  3LCA A;  3R6N A;  2WMN A;  4CZZ B;  5L3C B;  4IST A;  4AKR B;  2IC6 A;  4ISS A;  2ZM8 A;  3PNL B;  3LK4 2;  1KT1 A;  4FJY A;  4WNK A;  3CVN A;  2ZM2 A;  4L1B A;  4BFR A;  4KBQ A;  2EQX A;  2FUL A;  3J7Y q;  3CSF A;  2IJG X;  3VKG A;  5CHE E;  1FMW A;  4DO0 A;  1ELK A;  3EVY A;  1YD8 G;  4EZL A;  2GRL A;  2XGM A;  5FXZ A;  4AQF A;  2RP4 A;  3S7B A;  4EPZ A;  4ACK A;  4RG6 A;  4UQY A;  3JYS A;  4XKB A;  3QOU A;  3EDU A;  2XCC A;  4MAL A;  2LT3 A;  3S4U A;  3S7F A;  2NSZ A;  3RRW A;  4NRH B;  3FUH A;  2YEV C;  2VGX A;  3CEQ A;  2L8K A;  2JLB A;  3CVP A;  4Y6W A;  3KS2 A;  1A17 A;  3ZEF A;  4B8C B;  3JC6 D;  1Y8M A;  4XZC A;  4G26 A;  1QZ2 A;  3E22 E;  3RK6 A;  4P09 A;  3ASG A;  4J8S A;  4PFO A;  3CHR A;  4JA7 A;  4OYJ A;  3K8P C;  2N1G A;  3LXU X;  4FUL A;  3ZC0 A;  4UWK A;  4FLH A;  4A1G A;  3SS1 A;  2V5F A;  4UF0 A;  3CVX A;  2DCF A;  1WY6 A;  2IFU A;  4H9P C;  3G2V A;  4CGV A;  3RYI E;  1ZU2 A;  3ONX A;  4AIF A;  3Q5W A;  3PUR A;  3PUJ A;  4U0U A;  2NWB A;  3GWH A;  4YND A;  3KV5 A;  4W9R A;  4DND A;  1EPU A;  1BR4 A;  5DBK A;  3RRN B;  3UPV A;  2JPF A;  2LSY A;  4HLE A;  3N2O A;  2LOS A;  3APD A;  2Q7F A;  4J2C A;  3CQX C;  3S2A A;  3BQK A;  2GW1 A;  4U0S A;  3MKR A;  1IQU A;  4E7S A;  2HR2 A;  1Z3X A;  2FEZ A;  3Q49 B;  1S35 A;  2E2E A;  1YW0 A;  2VSN A;  4HFV A;  3LK3 B;  4OVV A;  5EK3 A;  4I9C A;  1IQR A;  3FUI A;  4CI1 B;  4F1S A;  4CI3 B;  4PK5 A;  4FAD A;  4HKA A;  2K9A A;  3FUJ A;  3UUM A;  2KZT A;  2LSI A;  4G2V A;  4O6F A;  5LG4 A;  4I1M A;  4TV3 A;  4CXX A;  2RG8 A;  3HKD E;  3T8O A;  2X6K A;  5FNV E;  3FXE B;  5KJM A;  4UWL A;  2XUE A;  3JC6 C;  1WYC A;  5EX0 A;  2WB2 A;  2VSX E;  2X6H A;  4XE0 A;  2CHZ A;  5F3J A;  5BV0 A;  4IIJ E;  2W61 A;  5ARF A;  5KJN A;  3QC1 A;  2YHE A;  1IAP A;  5JH7 E;  4I1A A;  1FEW A;  2YQ8 A;  2NTX A;  2VSY A;  2LEH A;  3SFZ A;  4C0E A;  4F7A A;  3NBX X;  1NP7 A;  2AWI A;  4AV7 A;  4DJA A;  5AFU L;  3UFE A;  4HS2 A;  4GA2 A;  3ZJ1 A;  3H3A A;  4EOZ B;  4F6R C;  1E8X A;  4CDR A;  3IEG A;  3RRM B;  3PE4 A;  2X66 A;  3BK9 A;  3D3M A;  3N9M A;  3CML A;  3CGH A;  3WAK A;  3LJ3 A;  4CCA A;  4UXN B;  5JR9 A;  1VDY A;  4KUM B;  2OA5 A;  3NZP A;  1H2U A;  2MOZ A;  3OYX A;  4X1Y E;  5KMG P;  2C2L A;  3PE3 A;  3PZD A;  4DBQ A;  1ELR A;  4EYU A;  5ANR A;  2MTQ A;  2LHN A;  3TG5 A;  3QAR A;  4ANV A;  1UG3 A;  4ZHQ E;  3PDN A;  1WR6 A;  4HN9 A;  3BQI A;  4KZ0 A;  5CB4 E;  2KMF A;  1VRB A;  1UW4 B;  4FA6 A;  3U64 A;  4CDM A;  3LFM A;  3UTK A;  3CHM A;  3SF4 A;  3SHF A;  1DVP A;  4GMJ A;  3O48 A;  2V26 A;  4G2A A;  2XPI A;  3UT8 A;  3MX3 A;  2K24 A;  3QC9 A;  4B6X A;  2Y3A A;  3I3N A;  2XCB A;  3FP3 A;  3FTV A;  1OWP A;  2H7O A;  3K9I A;  5T8I A;  3Q2M A;  3AAI A;  4AKI A;  2XPZ A;  4UV8 B;  1HX8 A;  2WXI A;  4ANW A;  3QUJ A;  2CE7 A;  3ANW B;  5J1G A;  2CMR A;  3HIZ A;  4RVB A;  2CCQ A;  2V8S E;  3ASD A;  3UUL A;  2Y48 B;  3U3W A;  1YA0 A;  4BT8 A;  4AKL A;  4L5G A;  5L3B B;  2CHX A;  5FJY A;  4BAY B;  3CK9 A;  2MHK A;  5EK4 A;  3SZ7 A;  4Q69 A;  4OFZ A;  3PU8 A;  3I0Q A;  3QWW A;  3CQC B;  4FU3 A;  3VKH A;  1E1H B;  3ANW A;  3AU5 A;  4K0U A;  5AIJ A;  4ZI2 D;  4ME2 A;  3C4X A;  3BG1 B;  3GYZ A;  2ODU A;  2MRI A;  4PK4 A;  3AAE B;  3OXL A;  4QKN A;  1Z3Y A;  5GON E;  2E8I A;  1JUQ A;  5LCW C;  4FI5 A;  4O2B E;  3GZ1 A;  3IHR A;  3ZEF B;  1E7U A;  5FQ8 A;  2XPY A;  5JRC A;  5HWY A;  3CVY A;  5JJ7 A;  3HKE E;  2VTB B;  3B7T A;  2NXP A;  1H0A A;  3ULQ A;  2CM0 A;  4JHR A;  2IAK A;  4GB9 A;  2HO1 A;  5F8P A;  4QFV A;  2YK0 A;  5IYZ E;  4JXT A;  3L13 A;  1HG5 A;  3OYZ A;  3TG4 A;  5L3G B;  4JHK A;  5KDM C;  4HOR A;  3FUF A;  4JPS A;  5G2N A;  1GW6 A;  3FEX A;  3RO2 A;  1TJC A;  1HF8 A;  2VJ8 A;  3CK8 A;  3RIB A;  3MCX A;  4J0U A;  4HOS A;  3N2G E;  4DMW A;  1HZ4 A;  3OAW A;  3G2T A;  4IE5 A;  2P58 C;  4I43 A;  4PFP A;  4EZK A;  4N3B A;  2E9X C;  3VHL A;  4PS3 A;  4GYW A;  5TAO A;  1WRD A;  2ZM0 A;  4DI3 A;  5LHH B;  3OXF A;  3TXM A;  1NA3 A;  5EKQ D;  2YU1 A;  4UVB B;  3P1U A;  4BX8 A;  1D0Y A;  3AVR A;  1FVH A;  3UT5 E;  4MBQ A;  2I2O A;  2WWU A;  4H9R C;  4I1O B;  1PY1 A;  2XAH B;  3HVE A;  2XEV A;  3ONL A;  2YU2 A;  4B0Z A;  2CWY A;  2YNQ A;  2WXK A;  4C90 A;  3RJV A;  2X6I A;  3MA5 A;  2OVF A;  4CI2 B;  4O2A E;  3AA1 B;  4P0B A;  4Y6C A;  2V0P A;  3JCK C;  3I9W A;  1WYB A;  3SNX A;  2V7L A;  4CXY A;  4A3V A;  2N2N A;  1LVF A;  3PRZ A;  1BR0 A;  5BV1 A;  4HE8 A;  4JEH B;  4NUV A;  1AJ3 A;  2XRZ A;  3APF A;  2ODV A;  2CXF A;  3P7I A;  3T5V A;  3CHP A;  3ZVV A;  3CVV A;  3R9A B;  5IHY A;  1MMD A;  3DJB A;  1S94 A;  3CX6 B;  3ENE A;  3ZMU B;  2G0U A;  2YIN A;  4XAX B;  1FVF A;  4UQX A;  1HXI A;  3DTO A;  2QFC A;  1INZ A;  4H9O C;  4C0M A;  2FBN A;  2VGX B;  3OTN A;  3KBU A;  3GMI A;  1E7V A;  2I1J A;  2DHR A;  4BT9 A;  2OOE A;  3ZN3 A;  3PUQ A;  4M3O A;  5C2Y A;  3Q9D A;  3T5X A;  3EIQ C;  4UI9 J;  4BX9 A;  2H7V C;  1NAF A;  2LHR A;  2C5J A;  3CKB A;  1SZ9 A;  2V1D B;  3CVL A;  5HXC A;  2HPL A;  3MGB A;  4DK5 A;  5DJQ C;  3D9I A;  4BTA A;  1OWM A;  1FIO A;  3E08 A;  3PUG A;  3WI3 A;  4A56 A;  3AA7 B;  4KMO A;  3UT7 A;  3FUN A;  3LBX A;  3LY7 A;  4RSY A;  4ACL A;  4ZS2 A;  4ANJ A;  3ZYM A;  3SI5 A;  2Z6E A;  1Z0P A;  3RKV A;  3G2S A;  4O4J E;  4UWF A;  2KXP B;  2JEK A;  5HI7 A;  3MJX A;  1PC2 A;  4I9E A;  4H7Y A;  4L0R A;  4FJZ A;  3B7R L;  3LY9 A;  5JVD E;  4OYK A;  4XIF A;  4NQ0 A;  5ADX L;  2V4L A;  4MS6 A;  4N3A A;  4N2Q A;  3CWZ B;  3ZCJ A;  3MXZ A;  3H37 A;  1KNZ A;  3Q5M A;  2JQQ A;  5D0O D;  3MJW A;  2ILR A;  2CLY B;  5FXV A;  3RX6 A;  2KM4 A;  3KIN B;  3FTW A;  3C51 A;  4ILU A;  2Q9Q C;  1HH8 A;  3NZQ A;  4I6G A;  3LPZ A;  2NW8 A;  3FH5 A;  3RKO A;  3VU7 H;  4AXH A;  3FU6 A;  5J2T E;  3KV9 A;  3RC8 A;  4FC8 A;  4GCO A;  4J8D A;  5HXS A;  4JHJ A;  2BUG A;  3APC A;  3I9Y A;  4EZJ A;  1QSD A;  5FP3 A;  4TX5 A;  4IRU A;  3AA6 B;  4L2Y A;  1U5P A;  4ILH B;  3GZS A;  3RPU A;  3GZ2 A;  4PW8 A;  3RRC A;  4AI6 A;  3IV0 A;  2Y6X A;  1JWF A;  4APO A;  3FEY A;  4MKT A;  1MIW A;  3UUN A;  2WMO A;  5L3E B;  4CT0 A;  4O4L E;  4OHF A;  4X1I E;  5M4Y A;  4HOU A;  3N9L A;  3ZHE A;  5CMW A;  3PH0 C;  2DBA A;  1OUV A;  4F53 A;  5JRE A;  2K5B B;  2D2S A;  4PH4 B;  2MBG A;  3G2W A;  5LJN A;  4UEL A;  3ZPJ A;  2V7K A;  1UJJ A;  3PRE A;  5E0O A;  4EAH A;  4N78 D;  4E85 A;  5ENN A;  2C0L A;  5M72 A;  2VKH A;  4QXH B;  1MHQ A;  3L09 A;  2IQC A;  4JZY A;  3MKQ B;  1HFA A;  2KZ7 B;  4U63 A;  2D5U A;  1OWO A;  1NWM X;  2X68 A;  3T8M A;  3KVA A;  5KJK A;  4NAC A;  2V7J A;  4E7Z A;  2A5U A;  4C91 A;  3KBT A;  5LNK A;  3FTZ A;  4MHC A;  2I59 A;  1G8X A;  5FY0 A;  3ZW3 A;  4HVB A;  3HKC E;  2CWO A;  3L22 A;  2Q9Q D;  2VB6 A;  3FU3 A;  4WBN E;  5KX5 E;  2AVP A;  4G11 A;  3J9X 1;  3MV2 B;  2WAU A;  2X6J A;  3ASF A;  3L6A A;  1OWN A;  5LFA A;  2WXP A;  1LRZ A;  3ZJ2 A;  3VLD A;  3LBX B;  2XAG B;  4PUC A;  3S7J A;  3LG7 A;  2XQY A;  5AJL A;  3FH7 A;  5EZY E;  1O3X A;  4LEU A;  1H2V C;  4A3T A;  3CV0 A;  2LSV A;  2RA1 A;  5A6C A;  4C9B B;  2WQ7 A;  1IHG A;  3FH8 A;  3PU3 A;  1QQE A;  4G23 A;  5FZR A;  2GGF A;  4ILG A;  3R7Q A;  2RD0 A;  4WNF A;  4JL0 A;  1OXZ A;  4TUU A;  1WAO 1;  2E9X D;  5JR9 C;  4APF A;  3NF1 A;  4AKG A;  3F57 A;  5JJ6 A;  2VSO E;  3PS6 A;  4X1K E;  4KXK B;  2BVL A;  1US7 B;  3E4B A;  3CPZ A;  3HYM B;  3JQ1 A;  3U4T A;  1B89 A;  1HCI A;  1UCU A;  2DLR A;  3MK7 C;  2NW7 A;  4P29 A;  2Y8D A;  3FY4 A;  3CHQ A;  4KMC A;  4EYY R;  4ZOL E;  1KK7 A;  4YVQ C;  1SZA A;  4QX8 B;  5LHG B;  2XRY A;  1Z6T A;  4KVM A;  5C1D A;  2J4D A;  3FTU A;  2PBI A;  3K3O A;  4U04 A;  1E8Z A;  3TXN A;  4PJJ A;  1ZEE A;  2PQN A;  4XZ4 A;  5AJD A;  4BJM A;  2IOS A;  3U78 A;  3BQL A;  3EDV A;  2CXD A;  1UX5 A;  3GA8 A;  3QWV A;  2CA5 A;  2DWG A;  4ZS3 A;  4L23 A;  3IEE A;  1MNE A;  3CHS A;  4I43 B;  4LRZ A;  3LEW A;  4MFR A;  2J09 A;  3NQP A;  2NP9 A;  1T98 A;  5JHA A;  5JDF A;  3VTY A;  3UMV A;  3P8C D;  4JVS A;  5HAX A;  2WXJ A;  4M1P A;  1KT0 A;  2Y4U A;  5BUZ A;  5DQV A;  3URZ A;  4XBF B;  3C50 A;  5ETW A;  3DBS A;  2WXH A;  5G05 J;  4QHO A;  3AAA B;  2C5K T;  2LAI A;  5JHB A;  3N2K E;  3CK7 A;  3EJN A;  1N52 A;  2R59 A;  4I2W A;  3LDZ A;  4I55 E;  5JJT A;  4TRQ A;  3FBL A;  4EEC A;  1BR2 A;  3LS8 A;  2C0M A;  4P0A A;  4I2Z A;  3D9K A;  3HR0 A;  3C98 B;  2Y4T A;  2D0U A;  4AKH A;  4UEM A;  2LAH A;  4I17 A;  2WXM A;  3HKB E;  4WAF A;  2XAF B;  2Q9Q A;  2WXR A;  2VKD A;  4EZH A;  1QUU A;  3FXD B;  4EXT A;  1BR1 A;  3CKD A;  5E75 A;  2BZB A;  1MMG A;  2N9D A;  2FI7 A;  3FBZ A;  1HS7 A;  5HXR A;  1XNF A;  2VKJ A;  4UWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...