1HF8A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Clathrin
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
total genus 102
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hf8A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hf8A01
3LDZA 2DIWA 1JWGA 3D9OA 3RRUA 1SZAA 3D9JA 3ZYKA 4FU3A 1HG5A 5LP0A 4GZCA 1HFAA 1HX8A 1H0AA 1DVPA 1PY1A 3ZYQA 5LOZA 3D9MA 3D9KA 2V8SE 2KM4A 2L0IA 3G2WA 3D9PA 1UJJA 1JWFA 1X5BA 1VDYA 2BF0X 2LO6A 3CLJA 4FLBA 4GZDA 4NACA 4Q94A 2L0TB 3ONKA 4AVXA 1XGWA 3D9NA 1EDUA 5CMWA 1JPLA 3G2SA 4HFGA 5J08A 3ZYLA 3D9IA 1MHQA 1HG2A 1JUQA 4JXTA 3G2TA 1EYHA 1UJKA 4Q96A 1LF8A 1INZA 3D9LA 1SZ9A 1HF8A 2MOWA 3ONLA 2DCPA 3G2VA 3G2UA 2QY7A 5CMYA 1ELKA 3ZYMA
chains in the Genus database with same CATH superfamily
3U3WA 2VGXB 2OCCE 2WY2A 1FPPA 3D9JA 4Q25A 4IE6A 3LJ3A 2W67A 4JV5T 2WU5A 1SQMA 3FUKA 2LSVA 2C0LA 5CBOA 4IDNA 4BT9A 4BX9A 2OOEA 4U7IA 5IUXA 3CVRA 4LNGA 3RAUA 4KMCA 3UUXA 3HL6A 2JIWA 4D10C 3DRAA 4BSXA 5ENQD 3MZKB 3ONLC 3SFDA 3CX7B 3CHRA 5AFUL 2E9XD 3CVPA 4Z68A 4N78D 3EHRA 1BR0A 2GRMA 2MPKA 2IDOB 4LFBT 1XWMA 2P9SG 2I1JA 4WW0A 1QQEA 4EOZB 2WWVA 4DMWA 3AS4A 3FFLA 3FH5A 3LEWA 3UQ7A 4J6IA 2X6JA 2B1EA 2L0TB 3DSUA 3FTZA 3PUKA 4A55A 4GTSA 4XKBA 5J2TE 1IZNB 3RI5A 1IKND 5KJKA 4O4LE 4G23A 1ZOYA 3AEBA 2WBLA 5E0OA 2EINE 2YDRA 4UVAB 5ETWA 1ZP0A 4ZI2D 4UR9A 4UELA 1IHBA 3JUEA 1OCRE 2J47A 2KINB 4JI8T 4GTRA 5A7DB 4ILGA 4HS2A 3V31A 2GRQB 4RQIA 2FF4A 2N1GA 5JVDE 1J1JA 3B57A 5ARFA 3UULA 3RSEG 4LF4T 1A17A 4A3TA 3IEGA 3L39A 4FHKA 4MKTA 2H7VC 2WXHA 1W3BA 3EVYA 5ABFB 5ABGA 2HN2A 2L9BA 4JI3T 1Y64B 2JQQA 2QZAA 3QWVA 3OXLA 4OYKA 2KSRA 1NENA 4CT4A 3GW4A 3KD7A 3KEAA 3CHOA 2J9QA 3ONLA 4CGWA 2J4BA 3BQOA 3QOUA 3LCAA 5LCYA 2V1DB 2J62A 3TXNA 4EXTA 4O2BE 3PVLA 5DIZA 1FEWA 1HNXT 3UTKA 5EKQD 3C4ZA 1ZV4X 1UURA 4EYUA 3ASGA 2OV8A 3OKQA 3FU3A 3UPVA 3CK6A 3AEFA 4LFCT 4DR5T 3CVVA 3LK2B 3ZN0B 2XQ6A 1WAO1 4GYYA 3MV2B 2L6JA 4U95D 5HRYA 3RX6A 4GYWA 4ILUA 4U74A 3UQ3A 3BQKA 1IHGA 4P29A 3K9IA 3AAAB 3NVOA 3HI2A 2XQYA 5DABA 4MLKA 2R02A 3URZA 4HLLA 4I1OB 1JCRA 4YNDA 3FZLB 2J08A 5AQGB 1N4RA 2VGXA 3JADA 4U2ZA 3PEVB 2Y8DA 2XPIA 3ENEA 3G2TA 2WXKA 3T8KA 4DBRA 3M65A 2C5IT 3HR0A 2IY0C 4DLOA 5HAXA 5JRCB 1M62A 2L9QA 3FUIA 4IE0A 2IF4A 4AQFC 3UINC 5CRVA 3PZ3A 4U7YA 2WXLA 3BG1B 4MALA 4TX5A 1B89A 4G2VA 3D9KA 4GYOA 5FZSA 2MAWA 4U31A 3CLJA 3FHEA 3ZKJA 4H9RC 3S7DA 3TG4A 2HPJA 4IGUA 1MX4A 1G73A 3ONXA 2V0PA 2XQ0A 4JEUA 5JHBA 3RO2A 5LGTB 2KLQA 5ANRA 4CDRA 1AP7A 2IU1A 2PZIA 1UX4A 1HG5A 4IDQA 2Y4UA 3CK7A 4I17A 4UQXA 4Y6CA 5BW8C 4ZI3C 3Q5WA 4DBQA 1BD8A 1V9DA 4MBQA 3CEQA 3BQLA 5FQ7A 4DV6T 4ISSA 2C5KT 5LA6E 1E2AA 2XZEA 3OJAA 3HVEA 4U7EB 2X0LB 4GIWA 1YKHB 3PUXF 3QNUA 5L2LA 2R17C 4GB9A 4L2LA 4HKAA 3FU5A 2CLYC 5FNVE 5CA1E 4TRQA 4PNIA 2VQFT 2YU1A 5ABFA 3AE3A 3FY4A 1IJ6A 1UX5A 4HFDA 3KV5A 3PJAA 1I6ZA 5HCMA 3J7Yq 4P1NA 3ZEFB 4ISTA 3MA5A 3QAQA 4LUNU 4L2YA 2W0GA 4I0UA 1HNZT 4GYSA 2IMLA 4BY6A 2LKGA 2LT3A 2J1DG 2IOSA 2VSNA 5KNGA 4XI0A 1MX6A 4HB5A 2XJ7A 3FWVA 1E8WA 3JQ0A 4QHOA 2Q9QB 3K3QC 2VKOA 3O1IA 1N94A 3RIUC 2FEZA 2V6XA 3PNTB 5HXRA 5ENOD 3FUHA 4FADA 4DR2T 1IYGA 3MACA 4HEAA 5L3GB 2VQ2A 3U78A 4LERA 1IBKT 3AEDA 3LJCA 2BS2A 2DL1A 2E8IA 3T8OA 1LVKA 1H6OA 1Q2ZA 3AE5A 3S4UA 3T8MA 5DJQC 2MRIA 3VU7H 2AVPA 2P9UG 3L9TA 2DWGA 2FJAA 2QRXA 4G8LA 2B6CA 4AM9A 2WXQA 3DSTA 3ABKE 1KT0A 1OUVA 4EZLA 3CKDA 3ZIMA 2WB2A 5FQ6A 2OLTA 5LYJE 3DSWA 4PDXA 1G3NB 3C5RA 2RPAA 4TNWA 2WCAA 3ETVA 3Q49B 3G2SA 4CN6A 3UQ4A 1WY6A 2Z6EA 1FIOA 3TWXA 3UT7A 4ZS2A 4H7XA 5BPPA 4BESA 1QLBA 3D9HA 2RFMA 3V30A 5J90A 4AQGA 4DJAA 3ZYMA 4C91A 4M7CA 4FC8A 3J9X1 4IDPA 3IHVA 3QWPA 2X6HA 3PDNA 3VR9A 2P9KG 5BV0A 4XEIG 1H6PA 4IE5A 2DYSE 3LPZA 3GA8A 3RIUA 3AECA 1XDPA 4DMVA 3AE4A 4CDNA 2AXZA 2CM0A 3HG0D 1D1BA 2K5BB 4H9NC 3UU8A 1T8BA 4YXDA 2KCKA 3L13A 2YDSA 4AY5A 2FJBA 4K0UA 4IIJE 1QNFA 4O4JE 4CI1B 1ZBPA 1MX2A 5L47A 2B0OE 3ZNGA 3X2QE 5FYMA 2QGSA 1YKEB 2V6YB 4A1GA 4TNVA 1KFYA 3JCFA 3T5XA 3RRUA 2ZMAA 1WR0A 3JQ1A 2IC6A 4I43A 4WWNA 4IT4A 4I6GA 3OXGA 3TLUA 3LYAA 2J4DA 3NB2A 1SHZC 4OVUA 4U96D 5LOZA 4X5TA 4DUIA 4I50E 4N3CA 3CHMA 4ME2A 5KJLA 3ZN3A 4HLEA 3RIAA 3ZXSA 4U04A 2VVNA 3OYXA 2CHZA 4URKA 4WNGA 3GYZA 3NBNB 2V5FA 5JA4D 1WLXA 3UT4A 4PK5A 1LRZA 2JRKA 3SS1A 1JWGA 2QVAA 1S64A 4HFIA 2BG9E 1SA4A 1OEDE 5E75A 1O1TA 3VTYA 5CRUA 4O60A 5AJLA 1VCSA 2RG8A 3CSFA 1KPSB 5ITZF 3R6NA 4A5XA 4EZJA 2MOZA 2Q9QA 4A63B 2DZNA 2PBIA 4EBAG 3TWWA 2HR2A 2FUPA 2XTLA 4N39A 3HHMA 1FVFA 1HZ4A 3LY9A 2V4LA 3TLVA 4OAVB 3Q7FA 3IKOB 1WYCA 3O48A 4CYMD 1X79A 4BERA 4YY3T 5BXOA 5FQ8A 1D1CA 2KWHA 4A56A 4QH4A 3DTOA 3PURA 1VDYA 1E96B 2WZIA 2EHOB 3UIOC 4DX5D 2ETCA 3AE2A 3KSLA 2Y0BG 4G25A 3PZ4A 3U4TA 3WAKA 3PUGA 3RRMB 3RIFA 3OAWA 1HF8A 3GZ1A 1AWCB 2D0TA 5JDMA 4ILAA 4PJLA 2CHNA 5AARA 1OWMA 4HI8A 3PZ1A 3FTVA 4DUZT 2FBWA 3H3MA 2V8SE 4HWDA 3E33A 2ODUA 3UT8A 2E9XB 3E30A 3AEGA 3N5LA 3UFEA 5D66A 2R2LA 3ZMTB 4JL0A 1Z0PA 3FUJA 4GZ5A 4U33A 3APFA 4NURA 3ETUA 4Z90A 3ASHA 3HYMB 4XZ4A 4GAAA 3FUDA 4LFAT 4FULA 4KBMB 1NFIE 3MV3B 4C0EA 5AQIB 3O1JA 3CIRA 4K03A 3RJVA 3JYSA 3BG0B 3C98B 4H63V 3N9MA 2OVFA 5KCMA 2RKKA 2WQHA 5FXWA 3UT5E 4JW1A 2E5LT 2VSOE 4WNFA 2R05A 2CXDA 3Q9DA 1JUQA 3QARA 2LAIA 2V5QC 2RP4A 1KLXA 4J8YA 4CXYA 3B7UX 2LEHA 3N2KE 1W0AA 2I2OA 4NUVA 2JQHA 1YW0A 4E6HA 5T8IA 3B95A 4RG6A 3OTOT 3UM2A 4DI3A 3UU4A 1MMGA 3ZGQA 1X5BA 4C90A 4YDYA 4YTMA 3FUNA 4F3VA 2PTFA 2LLYA 4M3OA 2E9XC 2IAKA 3GMIA 3UUXB 3AE6A 2XCBA 4HOSA 4GMJA 1N54A 3AXJB 1OWAA 3AJIA 4PUCA 4XX5A 3FTYA 3FHNA 3LVQE 2X9HA 1PC2A 3DSXA 3IV0A 3HKBE 2IOLA 2IO2C 3CGHA 3PZ2A 2PNNA 2X9YA 4AKGA 4YTNA 2OV9A 5FTPA 4G1TA 4DV1T 2XAJB 2QYUA 5JHAA 4ZS3A 2XY8B 4HRMB 1OY3D 3NWIA 4ATGA 3WI3A 4DRXE 3UXGA 5IHYA 3F2EA 4LMJA 4ZI2C 2X38A 1N0QA 2WQYA 3LK3B 4U72A 1QSDA 2V7MA 2EHOA 4OFZA 5FVKA 4DK5A 3G06A 3NZUA 2ZM0A 1TEZA 2LSUA 2V8SV 3Q5EA 3C51A 3LJNA 2XAFB 4F1PA 2WDRA 3I3NA 1E1HB 4GK0E 4WZXA 4YTPA 3PNLB 2NWBA 3H37A 4EZ4A 2A2FX 4BJMA 4QXCB 3CQGB 3L54A 4L7TA 1VRBA 3K8PC 3OVUA 4NPPA 2KXPC 1YA0A 3C3OA 1ZKEA 1W09A 2BS3A 2E9XA 3HDXA 4NIKA 5KXJA 3RYCE 4X64T 2UXCT 2KZ7B 1NI1A 3AS5A 3LKUA 4FA6A 3G2WA 2HM8A 2AXDS 3ZW3A 1WCRA 2CG3A 2NTYA 5HYAA 3HXCA 3T1HT 3Q75A 3PH0C 4OK0A 3BQIA 2ZU6B 3U3IA 4B3ST 4F7AA 3AVSA 4ILCA 4TWFA 1WM5A 3AB3B 2XM2A 2IC9A 1SZ9A 4IL9A 2F8YA 1UK5A 3ONJA 1IQUA 2QY7A 2MTQA 4PW8A 4B3TT 3N9NA 1U2VG 5C3JA 3U9WA 4UI9J 2ODVA 3KINB 3KDSE 1L5JA 4GZDA 2VASA 3AEAA 2YKSA 4EYYR 2XQ5A 3MKDA 3Q78A 5CECB 2UUCT 5CERB 2UY1A 3CWZB 4X1YE 1T98A 5HEHA 4B94A 2VB6A 4I9CA 1MQSA 4KYOB 4YVOA 4V1Av 2ZGDA 1S70B 1CHUA 2WXOA 3CVUA 3QWWA 2V26A 2IO3C 5BXUA 2BUGA 4DX6D 3AXJA 1WR6A 2V5DA 3I0QA 1E7UA 3GZ2A 1UCUA 2NTXA 2Y4TA 3F31A 2RA1A 2YK0A 4DUYT 4DNDA 2ZM2A 3AE9A 3CHQA 3JAFA 2AXUA 3FTUA 2VKDA 3ANWB 1W0BA 4DO0A 3EJNA 5LNKA 3A7MA 4JEUB 2V7IA 3LDQB 5L4HA 2BG9C 3I4RB 4O1OA 3TLWA 4WUYA 1TYQG 1LVFA 1N52A 2CG2A 3KVBA 5A1LA 1TJFA 5C2TA 2BZBA 4KI0F 4WBNE 4F6RD 3R7RA 3RK6A 3ZSSA 3ULQA 4O4HE 4E7SA 1J5WA 3L3PA 4K5CA 3D3MA 5CMYA 4GCNA 2CHWA 3CQXC 3HVEB 3FZFB 3TXMA 4HRNA 4CN1A 5JDQA 3N2OA 4CXXA 4AKRB 2IW5B 2VTBA 2BF0X 3VTXA 3VHLA 4DV5T 1RZ4A 2IFUA 4CI2B 3VRAA 2WXJA 3UU3A 4JYAT 4XIFA 5EZYE 1HR0T 4JI0T 2J4GA 3IHYA 3VKHA 4OHFA 3TLSA 3KAEA 4JHKA 4X62T 3AG3E 1INZA 5FKYA 1DNPA 3ZMSB 4N5CA 4TXPA 4GOUA 2HE0A 5EK2A 2CXLA 4CZ2D 2R5SA 4G63A 3CSTA 3P4QA 3SFEA 1ELWA 2SPCA 2WMOA 3P4PA 4DR6T 4RVBA 2KCVA 4L9PA 5AYWD 4ACLA 3I5PA 4IULA 4YSZA 2BG9A 3TLTA 1MZCA 3BK9A 4FLBA 5FXZA 4OAUC 4J0UA 1NEKA 2X6IA 2C0SA 4KBQA 2XS8A 3LXUX 2F37A 4K5BA 5L3FB 4RSYA 3OBVE 1KNZA 1Z3XA 4QFVA 4I1MA 3Q7AA 4HWFA 3FTXA 5FL1A 5M72A 5H7PA 4GTPA 2YEVC 2JMHA 4PK6A 1HU3A 4V3IA 2CFZA 3O9XA 1EZ3A 3KVAA 4LF6T 4ZHBA 4GZ6A 3APDA 2MYOA 4UVBB 3TL5A 3I4GA 4B8CB 4TV9E 2CLYB 2OA5A 4UIGA 5HEOA 3MA9A 5IYZE 1MIVA 4YT0A 4UV8B 2VSXE 3MX3A 3C64A 1BR4A 3B7SA 5L4EA 2M6BA 4UQYA 3ZT6A 3AA7B 3D9LA 2CXFA 1D8DA 1MJ0A 4JEHA 4ZZCA 2NYJA 3JAEA 3UM3A 2HYZA 3UUBA 5HCJA 2GK9A 4IYPA 2DWKA 1NWMX 2F4VT 2ZLYA 2WQ7A 2XQ8A 3P2BA 2NW7A 3ZXPA 2UXXB 2KWIB 1MMNA 2X9WA 3S7JA 2D2SA 4BWRA 4UI9C 4OX9T 2D0UA 4L5GA 2XUEA 1Z3YA 1D0XA 4BTBA 3ANWA 4PFOA 3CV0A 3DSVA 4HE8A 2OEVA 5FMNA 5JJTA 4DVDA 4GPKA 4HVBA 2RD0A 2E2AA 1Z8UA 5D0QD 3WG7E 2XPZA 3JXIA 1LTXA 2ETBA 4U0SA 3ABME 3FEYA 2UU9T 1O1SA 5FZRA 3D9NA 4GKKT 3E08A 3N71A 2CA5A 4LNBA 4I43B 3EUHA 4JXTA 3UUMA 3IA3A 3C50A 3X1DA 1TR4A 3HXBA 5FXXA 4F53A 2P2CP 3VLEA 2WXMA 3HKEE 4H9SE 4IL4A 5JJ6A 3I9WA 5JQGE 1OCCE 5ENTD 1FJGT 3QK0A 4AQFA 4KHZF 3MXZA 4PS7A 3CVLA 3PUYF 3ZPOA 2WMNA 1NA0A 3QNKA 5J1GA 1EDUA 3Q2MA 2WXRA 1RW2A 1D8EA 4I6EA 4F8HA 4EAHA 3I0OA 4O8SA 4G8KA 3PDYA 2ACXA 1XZYA 2BEDA 2CRBA 4ILIA 2XZDG 2LHNA 3K3NA 3FU0A 4DLQA 5ENRD 5ENPD 4KUMB 3LVRE 5FQ4A 2I6HA 4HWHA 3QB5A 1EF1C 3TAXA 5EK3A 2HHHT 4WNKA 3PUSA 3TKLB 4HGAA 1NP7A 3RC3A 1SW6A 3AEEA 5FXVA 3R7QA 2GW1A 3RKGA 3E32A 3HKCE 1SA5A 1K8KG 5EIBE 3Q15A 4N3BA 5LJNA 1H2TC 4FU3A 1JCQA 3VLFA 2PQRA 4OYSA 4QX8B 1O5MA 2LNIA 3R84B 2EIME 4C0MA 3E22E 3FH7A 3V5SA 1H6KA 4J8SA 4RG9A 2KZTB 2BKNA 3EHMA 3FH8A 3PREA 3ULEG 4UVCB 3L6AA 5F5WA 2J09A 2VSYA 3D9OA 4KT6B 1LKXA 5ANLA 4BETA 2W4XA 4WAFA 3P1UA 1TNYA 2NSZA 5AQSB 3M3ZB 5CB4E 3BUAA 2NW8A 3CVYA 4LMLA 2VGEA 1N4SA 1XNFA 3TWRA 4EB6E 2WSSV 4JI7T 2LSJA 3SRZA 1UJKA 1KT1A 1Y6IA 2XGMA 1TNZA 3B7RL 4YJ3E 1BI8B 1FMVA 2A4ZA 3SQVA 4BAYB 5FINA 3V2OA 2IIUA 1H2VC 2RFAA 3SGHA 4ZXLA 3ESLA 2YU2A 2H6IA 3ZYQA 2YDQA 2XAQB 3B5MA 1U4QA 3CKCA 3SFYA 2F8XK 4B3MT 2K24A 1QBQA 4EZKA 3HKDE 2BVLA 2M67A 3N9LA 4AJWA 1N33T 2KCLA 4WNEA 4BEPA 2DYRE 4TUMA 3L08A 4FP7A 1X9BA 2L8KA 3T9KA 3RRCA 1A5EA 1HS6A 3CVXA 4NRHB 2XS1A 1US7B 5LCWJ 2DHRA 2VKJA 1FVHA 5KWDA 4AOFA 1ZEEA 5LB7B 3UIPC 3E4BA 2PJQA 1WYBA 4Y6WA 5AJDA 2H89A 2MBGA 1IAPA 4QH1A 3TWUA 2EILE 4EBAA 1HE8A 3RQUA 3FP3A 5HWXA 5H6QB 1XGWA 4NIQA 4H9QC 4HFGA 4DV0T 5EIDA 3DXMG 5HEUA 4HFHA 4JUYA 3ZCJA 3EUVA 4I6JA 1HX1B 3CK8A 3ZT7A 1N4PA 4LNUD 1M7KA 1GQEA 3IHRA 2CMRA 4GTTA 4DV4T 5LP0A 3CQCB 2YINA 3MJWA 5ADXL 3TWSA 2J49A 5HI7A 4DR3T 3PUAA 4TV8E 5JR9B 2P58C 3JC6D 5LFAA 4G2AA 4EECA 1BLXB 5CJ5A 4FJYA 3TWQA 4ILBA 2Y69E 5FL0A 2P9PG 4YDEA 2DCPA 4JI4T 5D0OD 1TNBA 3RGLA 3PUVF 2VGYA 3PS6A 4XAXB 5J2UE 1N32T 2KZTA 4WNDA 3I9YA 3UM0A 1X81A 2AJAA 4HXIA 5HQ8A 2LSIA 3UUNA 4YDOA 4Z8XA 4Q94A 2CCQA 4LG6A 3PEUB 4JZYA 2ZISA 3HIZA 4PK4A 4ASKA 2VL0A 5AQHB 4JA9A 2X66A 1E8YA 2NOXA 3AU5A 4HQDA 2LSGA 1YQ3A 3RYFE 1TNOA 4UI9K 3SI5A 3CHSA 2H7OA 2W66A 2ZIRA 3PV0F 4BTAA 4AKHA 1MNEA 4AIFA 3NRXA 3CVNA 1PY1A 2BKKB 3LY7A 1GW6A 3AAIA 2XEVA 4JBWF 3QC9A 4JLEA 5IY5E 4KZCA 5LX8A 4I2ZA 3KV9A 3QB5K 4I2WA 4WWPA 2AXVA 2CWOA 2UXBT 2W00A 4ZZBA 4G24A 2YHEA 2WXPA 4B89A 4PJMA 5JR9C 1TNUA 4PJNA 5AQOB 2NP9A 4G26A 2UY1B 4U0UA 4KVOA 4YFSA 5AQRB 2CE7A 3V2XA 4HFCA 4JHRA 1VOMA 3MCXA 2BTDA 3R9AB 3OPCA 3P8CD 2KXPB 1E8XA 1W9RA 2Q9QD 4X20E 1EPUA 3V79K 5JREA 3MGBA 2IQCA 2KMFA 4B6XA 4CRWA 4ZFHA 4IRUA 3C72A 4LF7T 1HTJF 4JI2T 3CK9A 4LEUA 4UWHA 3ML9A 1XDOA 1XMQT 1TN7A 2LRKA 5A6CA 2HO1A 2JMKA 3CVWA 1E7PA 4UF0B 3FXDB 1OWNA 3LG7A 5FVLA 4F6RC 4HWCA 1P5QA 4KMOA 3NRYA 4W9RA 5HXHA 2A5EA 5AQKB 2V4HC 3EDTB 3ZMVB 3NAWA 1UG3A 5AIJA 3FUFA 1T72A 3ZSTA 1Z6TA 4I9EA 2YOEA 4GMLA 5EYLA 2Y6XA 3WAJA 4DX2A 5CA0E 4JB8P 4PAGA 5JR9A 4ZI7E 3N2GE 3Q9NC 4NXNT 2V7LA 2PQNA 5TAOA 1BI7B 4J8DA 1OCOE 5CEAA 5LCWC 1SUMB 2L0IA 1DU2A 3N9QA 1OT8A 4DI4A 3SOLA 5CCLA 1UW4B 2IHR1 1XNQT 4I4TE 2CWYA 4EIWA 5CFBA 4ACKA 1MMAA 5J08A 4GMRA 4MFRA 2DI4A 2L3LA 5HXEA 2P9NG 4CT0A 4Q96A 3LBXA 4HTEA 2XQ3A 3ZJ2A 2VTBB 4X66T 4DV3T 3PU3A 3PUWF 4YDWA 4CGVA 2MHKA 3EHNA 2HH7A 1E8ZA 1N11A 4QXBB 1T7SA 1D0YA 1MNDA 5J0ZA 1MYOA 3KEZA 4GZ3A 3IBEA 3SHFA 1JWFA 2C0MA 4JI1T 4YHHT 5FJYA 2Q7FA 4LMKA 1QYMA 3Q79A 3EABA 5T4YA 5GONE 4GA1A 3UM1A 3SF4A 3FZMB 1S35A 1J5ET 1VCTA 3P7IA 2BG9B 1FT1A 1OXZA 5CBNA 1OEDB 2ILRA 2JLBA 2DLRA 2DIWA 4JPSA 4O6FA 2X3MA 4DV7T 2LJLA 4M1PA 1IXVA 2PL2A 2XM1A 2NXPA 5D2MC 4OYJA 5AN8A 1WRDA 3MJXA 2HN1A 2CPTA 1V55E 3AE7A 2B76A 2WP9A 2VVSA 1D0ZA 3IF8B 4U8VD 4EEDA 4QX7B 5B1AE 3PJAJ 5AQBA 2XQAA 3IEEA 3RU0A 1SE7A 5AQTB 2JEKA 3ZMUB 4BJNA 4MBGA 1YYHA 2LUHA 1OXJA 3ZU7B 5LGNB 3N9PA 3ZYKA 3AA6B 5JDFA 1ZU2A 3AS8A 2BKOA 1UOHA 3KS2A 4JEHB 1E7VA 4BFRA 1YMPA 1ZB1A 4UV9B 5JDHA 3FDHA 4EHMA 2A3DA 2LM2A 4ABNA 4X1KE 5JH7E 4B8AA 4UWGA 3P4SA 3SZ7A 5CMWA 2G0UA 3CPZA 4N5QA 2LAHA 4HRLA 3RYHE 5ARGA 4U8YD 3NQPA 4FHJA 4UF0A 3UKRG 2YN6A 4LSZE 2EHOD 1D9SA 2PFVA 2X67A 4L0RA 3DPDA 4EV6A 4ZOLE 4ADZA 3J5PA 3W9FA 3TG5A 2XSBA 3KFWX 4EEBA 2DWZA 2YNQA 2EIKE 4TN7B 1OEDC 5EN5D 3A8YC 3APCA 3EDVA 1AJ3A 3L8RA 4HOUA 1NZNA 3PE4A 2VL8A 4HBDA 4IDZA 1KZPA 1NA3A 3GZSA 4PS3A 3AAEB 2K3WA 4J2CA 2VJ8A 4JA7A 2ZGGA 5AAOA 3SFXA 2WXGA 3LDZA 3RC8A 3HA4A 2W63A 3AA0B 2JJ9A 3EI0A 2XEEA 1YXRA 4L9IA 3HXFA 5AQLB 2D9DA 3FTSA 3HXDA 3PU8A 5KJMA 3ONKA 3Q5MA 2WDQA 4X1IE 4F1SA 2XHEA 5JJ7A 4U0ZA 4ERRA 3D0TA 1BU9A 3FB2A 1D1AA 3EHQA 4K0RA 3RRNB 4LF5T 4IREA 3PE0A 5ABHA 2DBAA 3FUEA 3O1HA 3L09A 4GA2A 2WU2A 3DJBA 5AQPB 3B13A 3ZT5A 2VK9A 4NUUA 2LOPA 2J8SD 3ZCIA 1OEDA 4YSYA 1N0RA 2F0YA 4YLHA 5C8YE 4U8HA 4P0AA 5EX3A 5EYPF 3FU6A 1OCZE 3MEKA 3Q5DA 4DR7T 2NR4A 3BU8A 3NOCD 4GTMA 5HS0A 5EILA 1N9AA 3Q47B 4GYRA 4PH4B 2I1KA 1WFDA 3QDNA 3SO8A 3KBTA 2E0IA 4ZEYA 4ATZD 2XEHA 2W61A 1O3XA 2V5CA 1I94T 2WZHA 5CEDB 4BX8A 3LFMA 4AKIA 4AVXA 4U63A 2ACZA 2Y1LE 3PZDA 1MHQA 4C9BB 2FJEA 1SA0E 3H3AA 3QC1A 5KX5E 1HCIA 3Q4AB 1S94A 1HO8A 1OWOA 4CZZB 3DPYA 5L3BB 4TWHA 1U3CA 1N34T 5L3EB 5BT1A 5LHHB 1K1BA 5LGUB 3PE3A 1S0PA 2PM7A 4COFA 2XRZA 1YCSB 3PUJA 2M63A 2JQ9A 1NL4A 1N36T 3RIBA 3W9GA 4BT8A 5A23A 2BVMA 4APOA 3ESKA 5HWYA 1UJJA 2ONDA 3CMLA 3C4XA 1PAQA 5AQAA 3QUJA 3RPUA 3TJPA 5C2YA 4PJJA 4HI9A 2I9CA 5FY1A 3LS8A 3DSSA 2FJDA 1CUNA 1KF6A 4IHJE 4HOTA 2CEAA 2M6IA 3S7BA 2GRRB 1FCHA 2X6KA 3U66A 3EDUA 2KC7A 4KXKB 1H7CA 5JTGA 4UEMA 2X0HA 4KZ0A 2H3RA 1QUUA 3P50A 4FLHA 1BPOA 1N4QA 2FO7A 4XBFB 4R7LA 3R9MA 5AQQB 2GGFA 4IN3B 4AY6A 3RKVA 2R03A 2LXMA 2W62A 1LD7A 3EU9A 4HWIB 3PRZA 4J8FA 3RYIE 4U2YA 3ABLE 4H9PC 1FT2A 4N2QA 5B3SE 3RH3A 4C48B 2E2EA 5G04J 1WG0A 3ASNE 2AE9A 1UN8A 2XSAA 3RLFF 5AQJB 5H6RB 3L17A 4DR4T 2ZXWE 4H7YA 3NKZA 3P4WA 1MMDA 1UN9A 5LG3A 3IBPA 2A5UA 2FULA 2XGSA 2XAGB 4HN9A 2A9UA 3ZC1A 3AAAC 3KSQA 4X65T 4QWNB 5LJMA 2WWUA 4HOQA 2KNDA 2C5JA 2ETAA 4LF8T 3EIJA 3SY2A 5G2NA 1JNRA 4IE4A 4GK5E 3UU6A 5HXSA 4HFBA 3ASFA 4FJZA 3FZKB 4PS8A 3AVRA 2QC9A 3ZN1B 4XZCA 4EQFA 3ZFWA 3DEPA 2P9IG 5BNWA 1IBMT 3JC6C 4HNAD 1H19A 2UWJG 4DPRA 2Y48B 3CX6B 1MIWA 3NZPA 1SVXA 3ASOE 3GN5B 4WYVA 5AQMB 3ULYA 2UXNB 2N2NA 3MYVA 3KV4A 4NXMT 5L3DB 3N9OA 3HXEA 4GU5A 4LCTA 2YHCA 2WXFA 5EX0A 1OWPA 3ZJ1A 4N3AA 2XASB 3QKYA 2GRNB 3NF1A 4O1PA 5LG4A 2UXDT 5HEGA 2PG8A 5AQNB 4K0KT 2WM9A 3K3OA 2DCFA 3AG4E 4Z91A 3DBSA 2HPLA 4GPMA 1DCQA 3KBUA 2KT9A 4AP2A 3MK7C 3HRAA 3G2VA 1IJ5A 4MLPA 4CDMA 4LRZA 3CIAA 4CN4A 2WXIA 4L23A 1SZAA 3BEEA 3JXJA 2IUBA 3PUQA 2LM9A 5FP3A 2OEWA 4X8QA 3Q5XA 4MHCA 3AG2E 3SWHA 3FTWA 1MIYA 5JRCA 2E5VA 2VWAA 1DC2A 3SBSA 1NAFA 3DEOA 2LSKA 4YSXA 2R6GF 3ISMC 2WB5A 1FMWA 2BKPA 2DNXA 5FY7A 4KX6A 4H63H 3E0ZA 2BBHA 1L0VA 3RF1A 2ZM6T 1H2UA 3LSVA 3UTMA 4WWOA 5FIOA 4ANXA 5G05J 2H6GA 3FBLA 2IONA 2QYWA 4A98A 2Q9QC 4ILHB 4JVSA 5ENSD 4P09A 3JCKC 3ZHEB 1LD8A 1KEYA 2L6BA 4QQIA 4GCOA 4TUUA 4J8EA 1R8IA 2GROB 5BR8T 3RQWA 4P0BA 5CHEE 3T5VA 4O4IE 2FO1E 4HFVA 3DP7A 4O2AE 3OYZA 1OWLA 5LBMA 2J07A 2X0YA 3PUZF 3EU5A 4ZI3D 1HNWT 3S7FA 2LRLA 3W15B 2QYJA 2ZM8A 5HEJA 2VURA 3ZYLA 2DVWA 5BUZA 2XRYA 5B1BE 1XNRT 4PFPA 2X9XA 2WVIA 4TXQA 5FT9A 3UFGA 4UWLA 2WS3A 1O1RA 3DWLG 3SD5A 3ZEFA 3O4ZA 4GTOA 5LHGB 2OVBA 2LHRA 2NW9A 3NZSA 2BKGA 2CHOA 2FBNA 4E85A 3S2AA 1B7TA 3CX8B 5G55A 3EHZA 3AA1B 5JDGA 4TUYE 3GN5A 5AQFB 4JI6T 3ASDA 2VQET 3AE1A 4DV2T 3B7BA 5FY0A 4RLYA 4UWFA 2P9LG 2LO6A 2KATA 5JDNA 1TN6A 1BR2A 3NZQA 1N95A 5G04C 2GRLA 3CVQA 3FZHB 3L82A 1LF8A 4ANUA 2P9BA 2MOWA 4GTQA 2V7KA 3G2UA 5EDSA 2IEJA 3CR3A 2JPFA 4GTVA 2VYIA 4FI5A 3A5XA 3SBTB 3U64A 3B7TA 1DVPA 4XI9A 5E76A 3LBXB 2H6HA 4CXWA 5AQ9A 3DXKG 4AISA 2K9AA 2KM4A 4N2SA 3NOGD 3C3QA 4U07A 1HXIA 4AKLA 4I55E 2EIJE 4OVVA 3UKUG 2CFUA 2NC9A 2IJGX 2LSYA 1Y01A 3ML8A 3E34A 2AW6A 3SFZA 5KBAA 4UQZA 4AQYT 4GA0A 2I59A 4H9OC 2N9DA 2PM6A 2XZTG 3AG1E 2X6FA 4GZCA 1HX8A 4AIUA 1HS7A 3F57A 3Q73A 3L16A 4B93B 1UUSA 3QB2A 1UGOA 2GRPB 1E90A 4L1BA 3ZC0A 1S63A 3D9PA 3MKQB 4UXNB 2CHXA 4QKNA 4XE0A 4QXHB 4BA9A 4MRUA 4YHJA 1KK7A 4ANVA 2I0MA 3K1SA 5HKPA 5KNHD 2H6FA 5IWAT 3VLDA 4DX7D 2BDEA 3RHWA 1JCSA 1K3ZD 4HORA 4KP3C 2LOSA 5LMUT 1QZ2A 2X68A 2XCCA 3ABVA 3F6QA 3WXXA 3FUMA 3ZHEA 5HXCA 2R59A 5LHIB 4JC8A 4I1AA 4G11A 2V6YA 4MS6A 3Q9UC 1ELRA 5LOVE 4AEZC 2QA7A 3TWTA 2XPKA 3J5QB 4YVQC 5AQUB 4CEMA 3AU4A 5T3RA 4K5AB 5KMGP 1TJCA 2EHOC 1KNRA 5BV1A 2XQ4A 1ELKA 4ANWA 3MZLB 4IE7A 1H0AA 3CHPA 3I1AA 4AV7A 2C2LA 2X51A 1Y8MA 3QJZA 4NACA 4AI6A 3RRWA 2UUBT 4DR1T 3UX4A 4CCAA 3RO3A 3ZVVA 5JDLA 1HH8A 5G05C 4AXPA 5DQWA 4WBOA 2LXLA 3FXEB 2QFCA 4TWDA 2EQXA 2MYSA 3ZKRA 5ENNA 4A3VA 4EZHA 4FJOA 5KJNA 4AXHA 1KNPA 4DIDB 5L3CB 3VRBA 2VKHA 4Q69A 2WAUA 2XENA 1ZHCA 5F3JA 5JMND 3AE8A 5M4YA 4A97A 2XPYA 1WDYA 4TXRA 4KHPT 2XQ7A 3LK42 3MKRA 1HG2A 4EPZA 4QH5A 3FEXA 3OTNA 4TV3A 2WXNA 4BSZB 3V5UA 3SNXA 4CI3B 1K1AA 3ZPJA 2AWIA 3UU5A 4IDOA 5ABEA 4A1SA 5CCMA 2K48A 3UI2A 2BS4A 4TZ4C 4XKCA 5EK4A 2XHEB 4LF9T 5AQVB 4J7WA 4DX1A 3E37A 4ZHQE 1KZOA 2WQ6A 4ANJA 5LP6E 2UUAT 4B3RT 2Y3AA 1XMOT 2CBJA 3FULA 5DBKA 3EIQC 2XGOA 3LY8A 3OXFA 5LMNT 2A72A 1DCEA 2V7JA 1U3DA 5KDMC 3MKQA 1YD8G 5LXTE 4GKJT 1HFAA 2D5UA 3L22A 3ZUVB 3D9MA 2YQ8A 3PTRB 1YQ4A 5BMVE 1BR1A 3TWVA 4NQ0A 4JHJA 1IQRA 3GWHA 3QOFA 3VR8A 4UWKA 4CQIA 4YJ2E 2WPVA 4B0ZA 3NBXX 2LKHA 3ZMZB 5LBQB 3P4RA 2KBXA 3C98A 3C4WA 2CBIA 2DZOA 3EAMA 1V54E 3ZRHA 1U5PA 5CGMA 2ES0A 3QK6A 3UMVA 5FZQA 2XQ9A 3O4XE 5FWQA 3CKBA 3C3RA 4JD2G 2W2UA 4U3CA 4EGWA 5C1DA 4APFA 2LE8A 2H88A 1G8XA 3FBZA 1IBLT 3ZLIA 4HFEA 2JABA 2BBJA 2FI7A 1JPLA 4JI5T 1TN8A 3VKGA 3KV6A 3D9IA 5AQ7A 5AENA 1Z5SC 2JQKA 1EYHA 3IXEA 1JNZA 5DQVA 2WDVA 5F8PA 4E7ZA 3TGOA 3RKOA 3T1YT 3JUIA 4KVMA 2XAHB 4UUCA
chains in the Genus database with same CATH topology
3U3WA 2VGXB 3D9JA 4IE6A 3LJ3A 1SQMA 3FUKA 2LSVA 2C0LA 4BT9A 4BX9A 2OOEA 3CVRA 3UUXA 4KMCA 3HL6A 4D10C 4BSXA 3MZKB 3CX7B 3CHRA 5AFUL 2E9XD 3CVPA 4N78D 1BR0A 2GRMA 2I1JA 4WW0A 1QQEA 4EOZB 4DMWA 3AS4A 3FFLA 3FH5A 3LEWA 4J6IA 2X6JA 2B1EA 2L0TB 3FTZA 3PUKA 4A55A 4XKBA 5J2TE 1IZNB 5KJKA 4O4LE 4G23A 2WBLA 5E0OA 4UVAB 5ETWA 4ZI2D 4UELA 2KINB 5A7DB 4ILGA 4HS2A 2FF4A 2N1GA 5JVDE 3B57A 5ARFA 3UULA 1A17A 4A3TA 3IEGA 4FHKA 4MKTA 2H7VC 2WXHA 1W3BA 3EVYA 2L9BA 1Y64B 2JQQA 3QWVA 3OXLA 4OYKA 4CT4A 3GW4A 3KD7A 3CHOA 2J9QA 3ONLA 4CGWA 2J4BA 3QOUA 3LCAA 5LCYA 2V1DB 3TXNA 4EXTA 4O2BE 3PVLA 5DIZA 1FEWA 3UTKA 5EKQD 3C4ZA 1ZV4X 4EYUA 3ASGA 2OV8A 3OKQA 3FU3A 3UPVA 3CVVA 3LK2B 3ZN0B 1WAO1 4GYYA 3MV2B 2L6JA 3RX6A 4GYWA 4ILUA 4U74A 3UQ3A 3BQKA 1IHGA 4P29A 3K9IA 3AAAB 3HI2A 2XQYA 5DABA 4MLKA 3URZA 4I1OB 4YNDA 2J08A 2VGXA 3PEVB 2Y8DA 2XPIA 3ENEA 3G2TA 2WXKA 4DBRA 3M65A 2C5IT 3HR0A 4DLOA 5HAXA 5JRCB 2L9QA 3FUIA 4IE0A 2IF4A 4AQFC 2WXLA 3BG1B 4MALA 4TX5A 1B89A 4G2VA 3D9KA 4GYOA 5FZSA 3CLJA 3FHEA 4H9RC 3S7DA 3TG4A 2HPJA 4IGUA 4JEUA 1G73A 3ONXA 2V0PA 2XQ0A 5JHBA 3RO2A 5LGTB 2KLQA 5ANRA 4CDRA 2IU1A 2PZIA 1UX4A 1HG5A 2Y4UA 3CK7A 4I17A 4UQXA 4Y6CA 5BW8C 4ZI3C 3Q5WA 4DBQA 1V9DA 4MBQA 3CEQA 3BQLA 5FQ7A 4ISSA 2C5KT 5LA6E 3OJAA 3HVEA 2X0LB 4GIWA 1YKHB 5L2LA 4GB9A 4L2LA 2R17C 4HKAA 3FU5A 2CLYC 5FNVE 5CA1E 4TRQA 4PNIA 2YU1A 3FY4A 1IJ6A 1UX5A 3KV5A 3J7Yq 3ZEFB 4ISTA 3MA5A 3QAQA 4LUNU 4L2YA 2W0GA 4GYSA 4BY6A 2LT3A 2J1DG 2IOSA 2VSNA 4XI0A 3FWVA 3JQ0A 1E8WA 4QHOA 2Q9QB 3K3QC 2VKOA 3O1IA 2FEZA 3PNTB 5HXRA 3FUHA 4FADA 1IYGA 3MACA 4HEAA 5L3GB 2VQ2A 3U78A 4LERA 3LJCA 2E8IA 3T8OA 1LVKA 3S4UA 3T8MA 5DJQC 2MRIA 3VU7H 2AVPA 2DWGA 4AM9A 2WXQA 1KT0A 1OUVA 4EZLA 3CKDA 3ZIMA 2WB2A 5FQ6A 5LYJE 4PDXA 3Q49B 3ETVA 3G2SA 1WY6A 3UT7A 2Z6EA 1FIOA 4ZS2A 4H7XA 5BPPA 5J90A 4AQGA 4DJAA 3ZYMA 4C91A 4FC8A 3J9X1 3IHVA 3QWPA 2X6HA 3PDNA 5BV0A 4IE5A 3LPZA 3GA8A 4DMVA 4CDNA 2AXZA 2CM0A 1D1BA 2K5BB 4H9NC 2KCKA 3L13A 4AY5A 4K0UA 4IIJE 1QNFA 4O4JE 4CI1B 1ZBPA 5FYMA 2QGSA 1YKEB 4A1GA 3T5XA 3RRUA 2ZMAA 3JQ1A 2IC6A 4I43A 4WWNA 4I6GA 3OXGA 3LYAA 5LOZA 2J4DA 4OVUA 1SHZC 4I50E 4N3CA 3CHMA 4ME2A 5KJLA 3ZN3A 4HLEA 3ZXSA 4U04A 3OYXA 2CHZA 4URKA 4WNGA 3GYZA 2V5FA 1WLXA 3UT4A 4PK5A 1LRZA 2JRKA 3SS1A 1JWGA 5E75A 3VTYA 5AJLA 2RG8A 3CSFA 3R6NA 4EZJA 2MOZA 2Q9QA 2PBIA 4EBAG 2HR2A 4N39A 2XTLA 3HHMA 1FVFA 1HZ4A 3LY9A 2V4LA 3IKOB 1WYCA 3O48A 1X79A 5FQ8A 1D1CA 2KWHA 4A56A 3DTOA 3PURA 1VDYA 1E96B 2EHOB 4G25A 3U4TA 3WAKA 3PUGA 3RRMB 3OAWA 1HF8A 3GZ1A 2D0TA 5JDMA 4PJLA 1OWMA 3FTVA 2V8SE 2ODUA 3UT8A 2E9XB 3N5LA 3UFEA 3ZMTB 4JL0A 1Z0PA 3FUJA 4GZ5A 3APFA 4NURA 3ETUA 3ASHA 3HYMB 4XZ4A 4GAAA 3FUDA 4FULA 4KBMB 3MV3B 4C0EA 3O1JA 4K03A 3RJVA 3JYSA 3BG0B 3C98B 4H63V 3N9MA 2OVFA 5KCMA 2WQHA 5FXWA 3UT5E 4JW1A 2VSOE 4WNFA 2CXDA 3Q9DA 1JUQA 3QARA 2LAIA 2RP4A 1KLXA 4CXYA 3B7UX 2LEHA 3N2KE 2I2OA 4NUVA 1YW0A 4E6HA 5T8IA 4RG6A 4DI3A 1MMGA 3ZGQA 1X5BA 4C90A 3FUNA 4F3VA 4M3OA 2E9XC 2IAKA 3GMIA 3UUXB 2XCBA 4HOSA 4GMJA 1N54A 1OWAA 4PUCA 4XX5A 3FTYA 3FHNA 3LVQE 2X9HA 1PC2A 3IV0A 3HKBE 2IOLA 3CGHA 2X9YA 4AKGA 5FTPA 4G1TA 2XAJB 5JHAA 4ZS3A 4ATGA 3WI3A 5IHYA 3F2EA 4ZI2C 2X38A 3LK3B 4U72A 1QSDA 2V7MA 2EHOA 4OFZA 4DK5A 3NZUA 2ZM0A 1TEZA 2LSUA 3C51A 2XAFB 3I3NA 1E1HB 4GK0E 3PNLB 2NWBA 3H37A 4EZ4A 2A2FX 4BJMA 4QXCB 3CQGB 3L54A 4L7TA 1VRBA 3K8PC 1YA0A 1ZKEA 2E9XA 3HDXA 3RYCE 2KZ7B 3AS5A 3LKUA 4FA6A 3G2WA 2HM8A 3ZW3A 2CG3A 2NTYA 5HYAA 3PH0C 4OK0A 3BQIA 2ZU6B 3U3IA 4F7AA 3AVSA 1WM5A 3AB3B 2IC9A 1SZ9A 1IQUA 2QY7A 2MTQA 4PW8A 3N9NA 3U9WA 4UI9J 2ODVA 3KINB 3KDSE 1L5JA 4GZDA 2VASA 4EYYR 3MKDA 2UY1A 3CWZB 4X1YE 1T98A 4B94A 2VB6A 4I9CA 1MQSA 4KYOB 4YVOA 4V1Av 2WXOA 3CVUA 3QWWA 2V26A 2BUGA 1WR6A 3I0QA 1E7UA 3GZ2A 1UCUA 2NTXA 2Y4TA 3F31A 2RA1A 2YK0A 4DNDA 2ZM2A 3CHQA 2AXUA 3FTUA 2VKDA 3ANWB 4DO0A 3EJNA 5LNKA 4JEUB 2V7IA 3I4RB 4WUYA 1LVFA 1N52A 2CG2A 3KVBA 5A1LA 1TJFA 2BZBA 4WBNE 3R7RA 3RK6A 3ULQA 4O4HE 4E7SA 3L3PA 3D3MA 5CMYA 4GCNA 2CHWA 3CQXC 3HVEB 3TXMA 5JDQA 3N2OA 4CXXA 4AKRB 2IW5B 2VTBA 2BF0X 3VTXA 3VHLA 2IFUA 2WXJA 4CI2B 4XIFA 5EZYE 3IHYA 3VKHA 4OHFA 3KAEA 4JHKA 1INZA 1DNPA 3ZMSB 4N5CA 4GOUA 5EK2A 2CXLA 2R5SA 4G63A 3CSTA 1ELWA 2SPCA 2WMOA 4RVBA 5AYWD 4ACLA 2KCVA 3I5PA 4IULA 3BK9A 4FLBA 5FXZA 4J0UA 2X6IA 2C0SA 4KBQA 3LXUX 5L3FB 4RSYA 3OBVE 1KNZA 1Z3XA 4QFVA 4I1MA 3FTXA 5M72A 2YEVC 2JMHA 4PK6A 1HU3A 4V3IA 2CFZA 3O9XA 1EZ3A 3KVAA 4GZ6A 3APDA 4UVBB 3TL5A 3I4GA 4B8CB 4TV9E 2CLYB 2OA5A 4UIGA 3MA9A 5IYZE 1MIVA 4UV8B 2VSXE 3MX3A 3C64A 1BR4A 3B7SA 4UQYA 3AA7B 3D9LA 2CXFA 4JEHA 2HYZA 2GK9A 4IYPA 2DWKA 1NWMX 2ZLYA 2WQ7A 3P2BA 2NW7A 2UXXB 2KWIB 1MMNA 2X9WA 3S7JA 2D2SA 4BWRA 4UI9C 2D0UA 4L5GA 2XUEA 1Z3YA 1D0XA 4BTBA 3ANWA 4PFOA 3CV0A 4HE8A 5FMNA 5JJTA 4DVDA 4GPKA 4HVBA 2RD0A 5D0QD 2XPZA 4U0SA 3FEYA 5FZRA 3D9NA 3E08A 3N71A 2CA5A 4I43B 3EUHA 4JXTA 3UUMA 3C50A 5FXXA 4F53A 3VLEA 2WXMA 3HKEE 4H9SE 5JJ6A 3I9WA 5JQGE 3QK0A 4AQFA 3MXZA 4PS7A 3CVLA 3ZPOA 2WMNA 1NA0A 3QNKA 5J1GA 1EDUA 3Q2MA 2WXRA 4I6EA 4EAHA 3I0OA 4O8SA 3PDYA 2ACXA 4ILIA 2LHNA 3K3NA 3FU0A 4DLQA 4KUMB 3LVRE 5FQ4A 2I6HA 1EF1C 3TAXA 5EK3A 4WNKA 3PUSA 3TKLB 4HGAA 1NP7A 3RC3A 5FXVA 3R7QA 2GW1A 3HKCE 3Q15A 4N3BA 5LJNA 1H2TC 4FU3A 3VLFA 2PQRA 4OYSA 4QX8B 2LNIA 3R84B 4C0MA 3E22E 3FH7A 3V5SA 1H6KA 4J8SA 4RG9A 2KZTB 3EHMA 3FH8A 3PREA 4UVCB 3L6AA 2J09A 2VSYA 3D9OA 4KT6B 1LKXA 5ANLA 4WAFA 3P1UA 2NSZA 5CB4E 2NW8A 3CVYA 1XNFA 4EB6E 2WSSV 2LSJA 3SRZA 1UJKA 1KT1A 1Y6IA 2XGMA 3B7RL 4YJ3E 1FMVA 2A4ZA 4BAYB 1H2VC 3SGHA 3ESLA 2YU2A 3ZYQA 2XAQB 1U4QA 3CKCA 2K24A 4EZKA 3HKDE 2BVLA 2M67A 3N9LA 4AJWA 2KCLA 4WNEA 3L08A 4FP7A 2L8KA 3RRCA 1HS6A 3CVXA 4NRHB 1US7B 5LCWJ 2DHRA 2VKJA 1FVHA 4AOFA 1ZEEA 3E4BA 2PJQA 1WYBA 4Y6WA 5AJDA 2MBGA 1IAPA 4EBAA 1HE8A 3FP3A 5HWXA 5H6QB 1XGWA 4H9QC 4HFGA 4JUYA 3ZCJA 4I6JA 3CK8A 3IHRA 2CMRA 5LP0A 3CQCB 2YINA 3MJWA 5ADXL 2J49A 5HI7A 3PUAA 4TV8E 5JR9B 2P58C 3JC6D 5LFAA 4G2AA 4EECA 4FJYA 2DCPA 5D0OD 2VGYA 3PS6A 4XAXB 5J2UE 2KZTA 4WNDA 3I9YA 5HQ8A 4HXIA 2LSIA 3UUNA 4Z8XA 4Q94A 2CCQA 3PEUB 4JZYA 3HIZA 4PK4A 4ASKA 4JA9A 2X66A 1E8YA 2NOXA 3AU5A 2LSGA 3RYFE 3SI5A 4UI9K 3CHSA 2H7OA 4BTAA 4AKHA 1MNEA 4AIFA 3NRXA 3CVNA 1PY1A 3LY7A 1GW6A 3AAIA 2XEVA 3QC9A 4JLEA 4KZCA 5LX8A 4I2ZA 3KV9A 4I2WA 4WWPA 2AXVA 2CWOA 4G24A 2W00A 2YHEA 2WXPA 4B89A 4PJMA 5JR9C 4PJNA 2NP9A 4G26A 2UY1B 4U0UA 4KVOA 4YFSA 2CE7A 4JHRA 1VOMA 3MCXA 2BTDA 3R9AB 3P8CD 2KXPB 1E8XA 2Q9QD 4X20E 1EPUA 5JREA 3MGBA 2IQCA 2KMFA 4B6XA 4CRWA 4IRUA 1HTJF 3CK9A 4LEUA 4UWHA 3ML9A 5A6CA 2HO1A 2JMKA 3CVWA 4UF0B 3FXDB 1OWNA 3LG7A 4F6RC 1P5QA 4KMOA 3NRYA 4W9RA 5HXHA 3EDTB 3ZMVB 1UG3A 5AIJA 3FUFA 4I9EA 1Z6TA 4GMLA 2Y6XA 3WAJA 5CA0E 4PAGA 5JR9A 4ZI7E 3N2GE 2V7LA 2PQNA 5TAOA 4J8DA 5LCWC 2L0IA 3N9QA 4DI4A 3SOLA 5CCLA 1UW4B 4I4TE 2CWYA 4EIWA 4ACKA 5J08A 1MMAA 4MFRA 2DI4A 2L3LA 5HXEA 4CT0A 4Q96A 3LBXA 4HTEA 3ZJ2A 2VTBB 3PU3A 4CGVA 2MHKA 3EHNA 2HH7A 1E8ZA 4QXBB 1D0YA 1MNDA 3KEZA 4GZ3A 3IBEA 3SHFA 1JWFA 2C0MA 5FJYA 2Q7FA 5T4YA 5GONE 4GA1A 3SF4A 1S35A 3P7IA 1OXZA 2ILRA 2JLBA 2DLRA 2DIWA 4JPSA 4O6FA 2X3MA 2LJLA 4M1PA 2PL2A 2NXPA 4OYJA 1WRDA 3MJXA 3IF8B 1D0ZA 4QX7B 3IEEA 3RU0A 2JEKA 3ZMUB 4BJNA 5LGNB 3N9PA 3ZYKA 3AA6B 5JDFA 1ZU2A 3AS8A 3KS2A 4JEHB 1E7VA 4BFRA 3FDHA 4UV9B 5JDHA 2A3DA 4ABNA 4X1KE 5JH7E 4B8AA 4UWGA 3SZ7A 5CMWA 2G0UA 3CPZA 2LAHA 3RYHE 5ARGA 3NQPA 4FHJA 4UF0A 2EHOD 2PFVA 2X67A 4L0RA 3DPDA 4ZOLE 4ADZA 3TG5A 3KFWX 2YNQA 4TN7B 3APCA 3EDVA 1AJ3A 4HOUA 1NZNA 3PE4A 2VL8A 4PS3A 4IDZA 1NA3A 3GZSA 3AAEB 4J2CA 2VJ8A 4JA7A 2WXGA 3LDZA 3RC8A 3HA4A 2W63A 3AA0B 2JJ9A 4L9IA 3FTSA 3PU8A 5KJMA 3ONKA 3Q5MA 4X1IE 4F1SA 2XHEA 5JJ7A 4U0ZA 4ERRA 3D0TA 3FB2A 1D1AA 4K0RA 3RRNB 3PE0A 2DBAA 3FUEA 3O1HA 3L09A 4GA2A 3DJBA 3B13A 2VK9A 4NUUA 2LOPA 3ZCIA 4U8HA 4YLHA 5C8YE 4P0AA 5EX3A 3FU6A 3MEKA 3Q47B 4GYRA 4PH4B 2I1KA 3QDNA 3KBTA 2E0IA 2W61A 1O3XA 4BX8A 3LFMA 4AKIA 4AVXA 4U63A 3PZDA 1MHQA 4C9BB 1SA0E 3H3AA 3QC1A 5KX5E 1HCIA 3Q4AB 1S94A 1HO8A 1OWOA 4CZZB 5L3BB 1U3CA 5L3EB 5BT1A 5LHHB 5LGUB 3PE3A 1S0PA 2PM7A 2XRZA 3PUJA 2M63A 4BT8A 3RIBA 5A23A 2BVMA 4APOA 3ESKA 5HWYA 1UJJA 2ONDA 3CMLA 3C4XA 1PAQA 3QUJA 3RPUA 3TJPA 5C2YA 4PJJA 2I9CA 5FY1A 3LS8A 4IHJE 1CUNA 4HOTA 2CEAA 3S7BA 1FCHA 2X6KA 3U66A 3EDUA 2KC7A 4KXKB 1H7CA 4UEMA 4KZ0A 2H3RA 1QUUA 4FLHA 1BPOA 2FO7A 4XBFB 4R7LA 2GGFA 4IN3B 4AY6A 3RKVA 2W62A 3PRZA 4J8FA 3RYIE 4H9PC 4N2QA 3RH3A 2E2EA 5G04J 1UN8A 5H6RB 3L17A 4H7YA 1MMDA 1UN9A 3IBPA 2A5UA 2FULA 2XGSA 2XAGB 4HN9A 3ZC1A 4QWNB 5LJMA 2WWUA 4HOQA 2KNDA 2C5JA 3EIJA 5G2NA 4IE4A 4GK5E 5HXSA 3ASFA 4FJZA 4PS8A 3AVRA 3ZN1B 4XZCA 4EQFA 3ZFWA 5BNWA 3JC6C 1H19A 2UWJG 4DPRA 2Y48B 3CX6B 1MIWA 3NZPA 3GN5B 2UXNB 2N2NA 3MYVA 3KV4A 5L3DB 3N9OA 4GU5A 4LCTA 2YHCA 2WXFA 5EX0A 1OWPA 3ZJ1A 4N3AA 2XASB 3QKYA 3NF1A 5LG4A 2PG8A 2WM9A 3K3OA 2DCFA 3DBSA 2HPLA 3KBUA 2KT9A 4AP2A 3MK7C 3G2VA 1IJ5A 4MLPA 4CDMA 4LRZA 3CIAA 2WXIA 4L23A 1SZAA 3BEEA 3PUQA 2LM9A 5FP3A 3Q5XA 4MHCA 3SWHA 3FTWA 1MIYA 5JRCA 2VWAA 3SBSA 1NAFA 2LSKA 1FMWA 2DNXA 5FY7A 4H63H 3E0ZA 1H2UA 4WWOA 4ANXA 5G05J 3FBLA 2IONA 2Q9QC 4ILHB 4JVSA 4P09A 3JCKC 3ZHEB 4GCOA 4TUUA 4J8EA 4P0BA 5CHEE 3T5VA 4O4IE 4HFVA 3DP7A 4O2AE 3OYZA 1OWLA 5LBMA 2J07A 4ZI3D 3S7FA 3W15B 2ZM8A 3ZYLA 5BUZA 2XRYA 4PFPA 2X9XA 2WVIA 5FT9A 4UWLA 3ZEFA 3SD5A 3O4ZA 5LHGB 2OVBA 2LHRA 2NW9A 3NZSA 2FBNA 4E85A 3S2AA 1B7TA 3CX8B 5G55A 3AA1B 5JDGA 4TUYE 3GN5A 3ASDA 5FY0A 4UWFA 2LO6A 2KATA 5JDNA 1BR2A 3NZQA 5G04C 2GRLA 3CVQA 1LF8A 4ANUA 2P9BA 2MOWA 2V7KA 3G2UA 5EDSA 3CR3A 2JPFA 2VYIA 4FI5A 3A5XA 3SBTB 3U64A 3B7TA 1DVPA 4XI9A 5E76A 3LBXB 4CXWA 2K9AA 2KM4A 4N2SA 4U07A 1HXIA 4AKLA 4I55E 4OVVA 2CFUA 2NC9A 2IJGX 2LSYA 3ML8A 2AW6A 3SFZA 4UQZA 4GA0A 2I59A 4H9OC 2N9DA 2PM6A 2X6FA 4GZCA 1HX8A 1HS7A 3F57A 3L16A 3QB2A 4L1BA 1E90A 3ZC0A 3D9PA 3MKQB 4UXNB 2CHXA 4QKNA 4XE0A 4QXHB 4BA9A 4MRUA 4YHJA 1KK7A 4ANVA 3VLDA 2BDEA 4HORA 4KP3C 2LOSA 1QZ2A 2X68A 2XCCA 3WXXA 3FUMA 3ZHEA 5HXCA 2R59A 5LHIB 4JC8A 4I1AA 4G11A 4MS6A 1ELRA 5LOVE 4AEZC 2QA7A 4YVQC 4CEMA 3AU4A 5T3RA 5KMGP 1TJCA 2EHOC 5BV1A 1ELKA 4ANWA 3MZLB 4IE7A 1H0AA 3CHPA 3I1AA 4AV7A 2C2LA 2X51A 1Y8MA 3QJZA 4NACA 4AI6A 3RRWA 3UX4A 4CCAA 3RO3A 3ZVVA 5JDLA 1HH8A 5G05C 4AXPA 5DQWA 4WBOA 3FXEB 2QFCA 2EQXA 2MYSA 5ENNA 4A3VA 4EZHA 4FJOA 5KJNA 4AXHA 5L3CB 2VKHA 4Q69A 2WAUA 1ZHCA 5F3JA 5M4YA 2XPYA 3LK42 3MKRA 1HG2A 4EPZA 3FEXA 3OTNA 4TV3A 2WXNA 3V5UA 3SNXA 4CI3B 3ZPJA 2AWIA 4A1SA 5CCMA 2K48A 4TZ4C 4XKCA 5EK4A 2XHEB 4ZHQE 2WQ6A 4ANJA 5LP6E 2Y3AA 3FULA 5DBKA 3EIQC 2XGOA 3LY8A 3OXFA 2A72A 2V7JA 1U3DA 5KDMC 3MKQA 1YD8G 5LXTE 1HFAA 2D5UA 3L22A 3D9MA 2YQ8A 3PTRB 5BMVE 1BR1A 4NQ0A 4JHJA 1IQRA 3GWHA 4UWKA 4CQIA 4YJ2E 2WPVA 4B0ZA 3NBXX 3ZMZB 5LBQB 3C98A 3C4WA 3ZRHA 1U5PA 2ES0A 3QK6A 3UMVA 5FZQA 3O4XE 5FWQA 3CKBA 5C1DA 4APFA 2LE8A 3FBZA 1G8XA 3ZLIA 2FI7A 1JPLA 3VKGA 3KV6A 3D9IA 5AENA 1EYHA 5DQVA 4E7ZA 5F8PA 3TGOA 3RKOA 3JUIA 4KVMA 2XAHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDZ A;  2DIW A;  1JWG A;  3D9O A;  3RRU A;  1SZA A;  3D9J A;  3ZYK A;  4FU3 A;  1HG5 A;  5LP0 A;  4GZC A;  1HFA A;  1HX8 A;  1H0A A;  1DVP A;  1PY1 A;  3ZYQ A;  5LOZ A;  3D9M A;  3D9K A;  2V8S E;  2KM4 A;  2L0I A;  3G2W A;  3D9P A;  1UJJ A;  1JWF A;  1X5B A;  1VDY A;  2BF0 X;  2LO6 A;  3CLJ A;  4FLB A;  4GZD A;  4NAC A;  4Q94 A;  2L0T B;  3ONK A;  4AVX A;  1XGW A;  3D9N A;  1EDU A;  5CMW A;  1JPL A;  3G2S A;  4HFG A;  5J08 A;  3ZYL A;  3D9I A;  1MHQ A;  1HG2 A;  1JUQ A;  4JXT A;  3G2T A;  1EYH A;  1UJK A;  4Q96 A;  1LF8 A;  1INZ A;  3D9L A;  1SZ9 A;  1HF8 A;  2MOW A;  3ONL A;  2DCP A;  3G2V A;  3G2U A;  2QY7 A;  5CMY A;  1ELK A;  3ZYM A; 
#chains in the Genus database with same CATH topology
 3U3W A;  2VGX B;  2OCC E;  2WY2 A;  1FPP A;  3D9J A;  4Q25 A;  4IE6 A;  3LJ3 A;  2W67 A;  4JV5 T;  2WU5 A;  1SQM A;  3FUK A;  2LSV A;  2C0L A;  5CBO A;  4IDN A;  4BT9 A;  4BX9 A;  2OOE A;  4U7I A;  5IUX A;  3CVR A;  4LNG A;  3RAU A;  4KMC A;  3UUX A;  3HL6 A;  2JIW A;  4D10 C;  3DRA A;  4BSX A;  5ENQ D;  3MZK B;  3ONL C;  3SFD A;  3CX7 B;  3CHR A;  5AFU L;  2E9X D;  3CVP A;  4Z68 A;  4N78 D;  3EHR A;  1BR0 A;  2GRM A;  2MPK A;  2IDO B;  4LFB T;  1XWM A;  2P9S G;  2I1J A;  4WW0 A;  1QQE A;  4EOZ B;  2WWV A;  4DMW A;  3AS4 A;  3FFL A;  3FH5 A;  3LEW A;  3UQ7 A;  4J6I A;  2X6J A;  2B1E A;  2L0T B;  3DSU A;  3FTZ A;  3PUK A;  4A55 A;  4GTS A;  4XKB A;  5J2T E;  1IZN B;  3RI5 A;  1IKN D;  5KJK A;  4O4L E;  4G23 A;  1ZOY A;  3AEB A;  2WBL A;  5E0O A;  2EIN E;  2YDR A;  4UVA B;  5ETW A;  1ZP0 A;  4ZI2 D;  4UR9 A;  4UEL A;  1IHB A;  3JUE A;  1OCR E;  2J47 A;  2KIN B;  4JI8 T;  4GTR A;  5A7D B;  4ILG A;  4HS2 A;  3V31 A;  2GRQ B;  4RQI A;  2FF4 A;  2N1G A;  5JVD E;  1J1J A;  3B57 A;  5ARF A;  3UUL A;  3RSE G;  4LF4 T;  1A17 A;  4A3T A;  3IEG A;  3L39 A;  4FHK A;  4MKT A;  2H7V C;  2WXH A;  1W3B A;  3EVY A;  5ABF B;  5ABG A;  2HN2 A;  2L9B A;  4JI3 T;  1Y64 B;  2JQQ A;  2QZA A;  3QWV A;  3OXL A;  4OYK A;  2KSR A;  1NEN A;  4CT4 A;  3GW4 A;  3KD7 A;  3KEA A;  3CHO A;  2J9Q A;  3ONL A;  4CGW A;  2J4B A;  3BQO A;  3QOU A;  3LCA A;  5LCY A;  2V1D B;  2J62 A;  3TXN A;  4EXT A;  4O2B E;  3PVL A;  5DIZ A;  1FEW A;  1HNX T;  3UTK A;  5EKQ D;  3C4Z A;  1ZV4 X;  1UUR A;  4EYU A;  3ASG A;  2OV8 A;  3OKQ A;  3FU3 A;  3UPV A;  3CK6 A;  3AEF A;  4LFC T;  4DR5 T;  3CVV A;  3LK2 B;  3ZN0 B;  2XQ6 A;  1WAO 1;  4GYY A;  3MV2 B;  2L6J A;  4U95 D;  5HRY A;  3RX6 A;  4GYW A;  4ILU A;  4U74 A;  3UQ3 A;  3BQK A;  1IHG A;  4P29 A;  3K9I A;  3AAA B;  3NVO A;  3HI2 A;  2XQY A;  5DAB A;  4MLK A;  2R02 A;  3URZ A;  4HLL A;  4I1O B;  1JCR A;  4YND A;  3FZL B;  2J08 A;  5AQG B;  1N4R A;  2VGX A;  3JAD A;  4U2Z A;  3PEV B;  2Y8D A;  2XPI A;  3ENE A;  3G2T A;  2WXK A;  3T8K A;  4DBR A;  3M65 A;  2C5I T;  3HR0 A;  2IY0 C;  4DLO A;  5HAX A;  5JRC B;  1M62 A;  2L9Q A;  3FUI A;  4IE0 A;  2IF4 A;  4AQF C;  3UIN C;  5CRV A;  3PZ3 A;  4U7Y A;  2WXL A;  3BG1 B;  4MAL A;  4TX5 A;  1B89 A;  4G2V A;  3D9K A;  4GYO A;  5FZS A;  2MAW A;  4U31 A;  3CLJ A;  3FHE A;  3ZKJ A;  4H9R C;  3S7D A;  3TG4 A;  2HPJ A;  4IGU A;  1MX4 A;  1G73 A;  3ONX A;  2V0P A;  2XQ0 A;  4JEU A;  5JHB A;  3RO2 A;  5LGT B;  2KLQ A;  5ANR A;  4CDR A;  1AP7 A;  2IU1 A;  2PZI A;  1UX4 A;  1HG5 A;  4IDQ A;  2Y4U A;  3CK7 A;  4I17 A;  4UQX A;  4Y6C A;  5BW8 C;  4ZI3 C;  3Q5W A;  4DBQ A;  1BD8 A;  1V9D A;  4MBQ A;  3CEQ A;  3BQL A;  5FQ7 A;  4DV6 T;  4ISS A;  2C5K T;  5LA6 E;  1E2A A;  2XZE A;  3OJA A;  3HVE A;  4U7E B;  2X0L B;  4GIW A;  1YKH B;  3PUX F;  3QNU A;  5L2L A;  2R17 C;  4GB9 A;  4L2L A;  4HKA A;  3FU5 A;  2CLY C;  5FNV E;  5CA1 E;  4TRQ A;  4PNI A;  2VQF T;  2YU1 A;  5ABF A;  3AE3 A;  3FY4 A;  1IJ6 A;  1UX5 A;  4HFD A;  3KV5 A;  3PJA A;  1I6Z A;  5HCM A;  3J7Y q;  4P1N A;  3ZEF B;  4IST A;  3MA5 A;  3QAQ A;  4LUN U;  4L2Y A;  2W0G A;  4I0U A;  1HNZ T;  4GYS A;  2IML A;  4BY6 A;  2LKG A;  2LT3 A;  2J1D G;  2IOS A;  2VSN A;  5KNG A;  4XI0 A;  1MX6 A;  4HB5 A;  2XJ7 A;  3FWV A;  1E8W A;  3JQ0 A;  4QHO A;  2Q9Q B;  3K3Q C;  2VKO A;  3O1I A;  1N94 A;  3RIU C;  2FEZ A;  2V6X A;  3PNT B;  5HXR A;  5ENO D;  3FUH A;  4FAD A;  4DR2 T;  1IYG A;  3MAC A;  4HEA A;  5L3G B;  2VQ2 A;  3U78 A;  4LER A;  1IBK T;  3AED A;  3LJC A;  2BS2 A;  2DL1 A;  2E8I A;  3T8O A;  1LVK A;  1H6O A;  1Q2Z A;  3AE5 A;  3S4U A;  3T8M A;  5DJQ C;  2MRI A;  3VU7 H;  2AVP A;  2P9U G;  3L9T A;  2DWG A;  2FJA A;  2QRX A;  4G8L A;  2B6C A;  4AM9 A;  2WXQ A;  3DST A;  3ABK E;  1KT0 A;  1OUV A;  4EZL A;  3CKD A;  3ZIM A;  2WB2 A;  5FQ6 A;  2OLT A;  5LYJ E;  3DSW A;  4PDX A;  1G3N B;  3C5R A;  2RPA A;  4TNW A;  2WCA A;  3ETV A;  3Q49 B;  3G2S A;  4CN6 A;  3UQ4 A;  1WY6 A;  2Z6E A;  1FIO A;  3TWX A;  3UT7 A;  4ZS2 A;  4H7X A;  5BPP A;  4BES A;  1QLB A;  3D9H A;  2RFM A;  3V30 A;  5J90 A;  4AQG A;  4DJA A;  3ZYM A;  4C91 A;  4M7C A;  4FC8 A;  3J9X 1;  4IDP A;  3IHV A;  3QWP A;  2X6H A;  3PDN A;  3VR9 A;  2P9K G;  5BV0 A;  4XEI G;  1H6P A;  4IE5 A;  2DYS E;  3LPZ A;  3GA8 A;  3RIU A;  3AEC A;  1XDP A;  4DMV A;  3AE4 A;  4CDN A;  2AXZ A;  2CM0 A;  3HG0 D;  1D1B A;  2K5B B;  4H9N C;  3UU8 A;  1T8B A;  4YXD A;  2KCK A;  3L13 A;  2YDS A;  4AY5 A;  2FJB A;  4K0U A;  4IIJ E;  1QNF A;  4O4J E;  4CI1 B;  1ZBP A;  1MX2 A;  5L47 A;  2B0O E;  3ZNG A;  3X2Q E;  5FYM A;  2QGS A;  1YKE B;  2V6Y B;  4A1G A;  4TNV A;  1KFY A;  3JCF A;  3T5X A;  3RRU A;  2ZMA A;  1WR0 A;  3JQ1 A;  2IC6 A;  4I43 A;  4WWN A;  4IT4 A;  4I6G A;  3OXG A;  3TLU A;  3LYA A;  2J4D A;  3NB2 A;  1SHZ C;  4OVU A;  4U96 D;  5LOZ A;  4X5T A;  4DUI A;  4I50 E;  4N3C A;  3CHM A;  4ME2 A;  5KJL A;  3ZN3 A;  4HLE A;  3RIA A;  3ZXS A;  4U04 A;  2VVN A;  3OYX A;  2CHZ A;  4URK A;  4WNG A;  3GYZ A;  3NBN B;  2V5F A;  5JA4 D;  1WLX A;  3UT4 A;  4PK5 A;  1LRZ A;  2JRK A;  3SS1 A;  1JWG A;  2QVA A;  1S64 A;  4HFI A;  2BG9 E;  1SA4 A;  1OED E;  5E75 A;  1O1T A;  3VTY A;  5CRU A;  4O60 A;  5AJL A;  1VCS A;  2RG8 A;  3CSF A;  1KPS B;  5ITZ F;  3R6N A;  4A5X A;  4EZJ A;  2MOZ A;  2Q9Q A;  4A63 B;  2DZN A;  2PBI A;  4EBA G;  3TWW A;  2HR2 A;  2FUP A;  2XTL A;  4N39 A;  3HHM A;  1FVF A;  1HZ4 A;  3LY9 A;  2V4L A;  3TLV A;  4OAV B;  3Q7F A;  3IKO B;  1WYC A;  3O48 A;  4CYM D;  1X79 A;  4BER A;  4YY3 T;  5BXO A;  5FQ8 A;  1D1C A;  2KWH A;  4A56 A;  4QH4 A;  3DTO A;  3PUR A;  1VDY A;  1E96 B;  2WZI A;  2EHO B;  3UIO C;  4DX5 D;  2ETC A;  3AE2 A;  3KSL A;  2Y0B G;  4G25 A;  3PZ4 A;  3U4T A;  3WAK A;  3PUG A;  3RRM B;  3RIF A;  3OAW A;  1HF8 A;  3GZ1 A;  1AWC B;  2D0T A;  5JDM A;  4ILA A;  4PJL A;  2CHN A;  5AAR A;  1OWM A;  4HI8 A;  3PZ1 A;  3FTV A;  4DUZ T;  2FBW A;  3H3M A;  2V8S E;  4HWD A;  3E33 A;  2ODU A;  3UT8 A;  2E9X B;  3E30 A;  3AEG A;  3N5L A;  3UFE A;  5D66 A;  2R2L A;  3ZMT B;  4JL0 A;  1Z0P A;  3FUJ A;  4GZ5 A;  4U33 A;  3APF A;  4NUR A;  3ETU A;  4Z90 A;  3ASH A;  3HYM B;  4XZ4 A;  4GAA A;  3FUD A;  4LFA T;  4FUL A;  4KBM B;  1NFI E;  3MV3 B;  4C0E A;  5AQI B;  3O1J A;  3CIR A;  4K03 A;  3RJV A;  3JYS A;  3BG0 B;  3C98 B;  4H63 V;  3N9M A;  2OVF A;  5KCM A;  2RKK A;  2WQH A;  5FXW A;  3UT5 E;  4JW1 A;  2E5L T;  2VSO E;  4WNF A;  2R05 A;  2CXD A;  3Q9D A;  1JUQ A;  3QAR A;  2LAI A;  2V5Q C;  2RP4 A;  1KLX A;  4J8Y A;  4CXY A;  3B7U X;  2LEH A;  3N2K E;  1W0A A;  2I2O A;  4NUV A;  2JQH A;  1YW0 A;  4E6H A;  5T8I A;  3B95 A;  4RG6 A;  3OTO T;  3UM2 A;  4DI3 A;  3UU4 A;  1MMG A;  3ZGQ A;  1X5B A;  4C90 A;  4YDY A;  4YTM A;  3FUN A;  4F3V A;  2PTF A;  2LLY A;  4M3O A;  2E9X C;  2IAK A;  3GMI A;  3UUX B;  3AE6 A;  2XCB A;  4HOS A;  4GMJ A;  1N54 A;  3AXJ B;  1OWA A;  3AJI A;  4PUC A;  4XX5 A;  3FTY A;  3FHN A;  3LVQ E;  2X9H A;  1PC2 A;  3DSX A;  3IV0 A;  3HKB E;  2IOL A;  2IO2 C;  3CGH A;  3PZ2 A;  2PNN A;  2X9Y A;  4AKG A;  4YTN A;  2OV9 A;  5FTP A;  4G1T A;  4DV1 T;  2XAJ B;  2QYU A;  5JHA A;  4ZS3 A;  2XY8 B;  4HRM B;  1OY3 D;  3NWI A;  4ATG A;  3WI3 A;  4DRX E;  3UXG A;  5IHY A;  3F2E A;  4LMJ A;  4ZI2 C;  2X38 A;  1N0Q A;  2WQY A;  3LK3 B;  4U72 A;  1QSD A;  2V7M A;  2EHO A;  4OFZ A;  5FVK A;  4DK5 A;  3G06 A;  3NZU A;  2ZM0 A;  1TEZ A;  2LSU A;  2V8S V;  3Q5E A;  3C51 A;  3LJN A;  2XAF B;  4F1P A;  2WDR A;  3I3N A;  1E1H B;  4GK0 E;  4WZX A;  4YTP A;  3PNL B;  2NWB A;  3H37 A;  4EZ4 A;  2A2F X;  4BJM A;  4QXC B;  3CQG B;  3L54 A;  4L7T A;  1VRB A;  3K8P C;  3OVU A;  4NPP A;  2KXP C;  1YA0 A;  3C3O A;  1ZKE A;  1W09 A;  2BS3 A;  2E9X A;  3HDX A;  4NIK A;  5KXJ A;  3RYC E;  4X64 T;  2UXC T;  2KZ7 B;  1NI1 A;  3AS5 A;  3LKU A;  4FA6 A;  3G2W A;  2HM8 A;  2AXD S;  3ZW3 A;  1WCR A;  2CG3 A;  2NTY A;  5HYA A;  3HXC A;  3T1H T;  3Q75 A;  3PH0 C;  4OK0 A;  3BQI A;  2ZU6 B;  3U3I A;  4B3S T;  4F7A A;  3AVS A;  4ILC A;  4TWF A;  1WM5 A;  3AB3 B;  2XM2 A;  2IC9 A;  1SZ9 A;  4IL9 A;  2F8Y A;  1UK5 A;  3ONJ A;  1IQU A;  2QY7 A;  2MTQ A;  4PW8 A;  4B3T T;  3N9N A;  1U2V G;  5C3J A;  3U9W A;  4UI9 J;  2ODV A;  3KIN B;  3KDS E;  1L5J A;  4GZD A;  2VAS A;  3AEA A;  2YKS A;  4EYY R;  2XQ5 A;  3MKD A;  3Q78 A;  5CEC B;  2UUC T;  5CER B;  2UY1 A;  3CWZ B;  4X1Y E;  1T98 A;  5HEH A;  4B94 A;  2VB6 A;  4I9C A;  1MQS A;  4KYO B;  4YVO A;  4V1A v;  2ZGD A;  1S70 B;  1CHU A;  2WXO A;  3CVU A;  3QWW A;  2V26 A;  2IO3 C;  5BXU A;  2BUG A;  4DX6 D;  3AXJ A;  1WR6 A;  2V5D A;  3I0Q A;  1E7U A;  3GZ2 A;  1UCU A;  2NTX A;  2Y4T A;  3F31 A;  2RA1 A;  2YK0 A;  4DUY T;  4DND A;  2ZM2 A;  3AE9 A;  3CHQ A;  3JAF A;  2AXU A;  3FTU A;  2VKD A;  3ANW B;  1W0B A;  4DO0 A;  3EJN A;  5LNK A;  3A7M A;  4JEU B;  2V7I A;  3LDQ B;  5L4H A;  2BG9 C;  3I4R B;  4O1O A;  3TLW A;  4WUY A;  1TYQ G;  1LVF A;  1N52 A;  2CG2 A;  3KVB A;  5A1L A;  1TJF A;  5C2T A;  2BZB A;  4KI0 F;  4WBN E;  4F6R D;  3R7R A;  3RK6 A;  3ZSS A;  3ULQ A;  4O4H E;  4E7S A;  1J5W A;  3L3P A;  4K5C A;  3D3M A;  5CMY A;  4GCN A;  2CHW A;  3CQX C;  3HVE B;  3FZF B;  3TXM A;  4HRN A;  4CN1 A;  5JDQ A;  3N2O A;  4CXX A;  4AKR B;  2IW5 B;  2VTB A;  2BF0 X;  3VTX A;  3VHL A;  4DV5 T;  1RZ4 A;  2IFU A;  4CI2 B;  3VRA A;  2WXJ A;  3UU3 A;  4JYA T;  4XIF A;  5EZY E;  1HR0 T;  4JI0 T;  2J4G A;  3IHY A;  3VKH A;  4OHF A;  3TLS A;  3KAE A;  4JHK A;  4X62 T;  3AG3 E;  1INZ A;  5FKY A;  1DNP A;  3ZMS B;  4N5C A;  4TXP A;  4GOU A;  2HE0 A;  5EK2 A;  2CXL A;  4CZ2 D;  2R5S A;  4G63 A;  3CST A;  3P4Q A;  3SFE A;  1ELW A;  2SPC A;  2WMO A;  3P4P A;  4DR6 T;  4RVB A;  2KCV A;  4L9P A;  5AYW D;  4ACL A;  3I5P A;  4IUL A;  4YSZ A;  2BG9 A;  3TLT A;  1MZC A;  3BK9 A;  4FLB A;  5FXZ A;  4OAU C;  4J0U A;  1NEK A;  2X6I A;  2C0S A;  4KBQ A;  2XS8 A;  3LXU X;  2F37 A;  4K5B A;  5L3F B;  4RSY A;  3OBV E;  1KNZ A;  1Z3X A;  4QFV A;  4I1M A;  3Q7A A;  4HWF A;  3FTX A;  5FL1 A;  5M72 A;  5H7P A;  4GTP A;  2YEV C;  2JMH A;  4PK6 A;  1HU3 A;  4V3I A;  2CFZ A;  3O9X A;  1EZ3 A;  3KVA A;  4LF6 T;  4ZHB A;  4GZ6 A;  3APD A;  2MYO A;  4UVB B;  3TL5 A;  3I4G A;  4B8C B;  4TV9 E;  2CLY B;  2OA5 A;  4UIG A;  5HEO A;  3MA9 A;  5IYZ E;  1MIV A;  4YT0 A;  4UV8 B;  2VSX E;  3MX3 A;  3C64 A;  1BR4 A;  3B7S A;  5L4E A;  2M6B A;  4UQY A;  3ZT6 A;  3AA7 B;  3D9L A;  2CXF A;  1D8D A;  1MJ0 A;  4JEH A;  4ZZC A;  2NYJ A;  3JAE A;  3UM3 A;  2HYZ A;  3UUB A;  5HCJ A;  2GK9 A;  4IYP A;  2DWK A;  1NWM X;  2F4V T;  2ZLY A;  2WQ7 A;  2XQ8 A;  3P2B A;  2NW7 A;  3ZXP A;  2UXX B;  2KWI B;  1MMN A;  2X9W A;  3S7J A;  2D2S A;  4BWR A;  4UI9 C;  4OX9 T;  2D0U A;  4L5G A;  2XUE A;  1Z3Y A;  1D0X A;  4BTB A;  3ANW A;  4PFO A;  3CV0 A;  3DSV A;  4HE8 A;  2OEV A;  5FMN A;  5JJT A;  4DVD A;  4GPK A;  4HVB A;  2RD0 A;  2E2A A;  1Z8U A;  5D0Q D;  3WG7 E;  2XPZ A;  3JXI A;  1LTX A;  2ETB A;  4U0S A;  3ABM E;  3FEY A;  2UU9 T;  1O1S A;  5FZR A;  3D9N A;  4GKK T;  3E08 A;  3N71 A;  2CA5 A;  4LNB A;  4I43 B;  3EUH A;  4JXT A;  3UUM A;  3IA3 A;  3C50 A;  3X1D A;  1TR4 A;  3HXB A;  5FXX A;  4F53 A;  2P2C P;  3VLE A;  2WXM A;  3HKE E;  4H9S E;  4IL4 A;  5JJ6 A;  3I9W A;  5JQG E;  1OCC E;  5ENT D;  1FJG T;  3QK0 A;  4AQF A;  4KHZ F;  3MXZ A;  4PS7 A;  3CVL A;  3PUY F;  3ZPO A;  2WMN A;  1NA0 A;  3QNK A;  5J1G A;  1EDU A;  3Q2M A;  2WXR A;  1RW2 A;  1D8E A;  4I6E A;  4F8H A;  4EAH A;  3I0O A;  4O8S A;  4G8K A;  3PDY A;  2ACX A;  1XZY A;  2BED A;  2CRB A;  4ILI A;  2XZD G;  2LHN A;  3K3N A;  3FU0 A;  4DLQ A;  5ENR D;  5ENP D;  4KUM B;  3LVR E;  5FQ4 A;  2I6H A;  4HWH A;  3QB5 A;  1EF1 C;  3TAX A;  5EK3 A;  2HHH T;  4WNK A;  3PUS A;  3TKL B;  4HGA A;  1NP7 A;  3RC3 A;  1SW6 A;  3AEE A;  5FXV A;  3R7Q A;  2GW1 A;  3RKG A;  3E32 A;  3HKC E;  1SA5 A;  1K8K G;  5EIB E;  3Q15 A;  4N3B A;  5LJN A;  1H2T C;  4FU3 A;  1JCQ A;  3VLF A;  2PQR A;  4OYS A;  4QX8 B;  1O5M A;  2LNI A;  3R84 B;  2EIM E;  4C0M A;  3E22 E;  3FH7 A;  3V5S A;  1H6K A;  4J8S A;  4RG9 A;  2KZT B;  2BKN A;  3EHM A;  3FH8 A;  3PRE A;  3ULE G;  4UVC B;  3L6A A;  5F5W A;  2J09 A;  2VSY A;  3D9O A;  4KT6 B;  1LKX A;  5ANL A;  4BET A;  2W4X A;  4WAF A;  3P1U A;  1TNY A;  2NSZ A;  5AQS B;  3M3Z B;  5CB4 E;  3BUA A;  2NW8 A;  3CVY A;  4LML A;  2VGE A;  1N4S A;  1XNF A;  3TWR A;  4EB6 E;  2WSS V;  4JI7 T;  2LSJ A;  3SRZ A;  1UJK A;  1KT1 A;  1Y6I A;  2XGM A;  1TNZ A;  3B7R L;  4YJ3 E;  1BI8 B;  1FMV A;  2A4Z A;  3SQV A;  4BAY B;  5FIN A;  3V2O A;  2IIU A;  1H2V C;  2RFA A;  3SGH A;  4ZXL A;  3ESL A;  2YU2 A;  2H6I A;  3ZYQ A;  2YDQ A;  2XAQ B;  3B5M A;  1U4Q A;  3CKC A;  3SFY A;  2F8X K;  4B3M T;  2K24 A;  1QBQ A;  4EZK A;  3HKD E;  2BVL A;  2M67 A;  3N9L A;  4AJW A;  1N33 T;  2KCL A;  4WNE A;  4BEP A;  2DYR E;  4TUM A;  3L08 A;  4FP7 A;  1X9B A;  2L8K A;  3T9K A;  3RRC A;  1A5E A;  1HS6 A;  3CVX A;  4NRH B;  2XS1 A;  1US7 B;  5LCW J;  2DHR A;  2VKJ A;  1FVH A;  5KWD A;  4AOF A;  1ZEE A;  5LB7 B;  3UIP C;  3E4B A;  2PJQ A;  1WYB A;  4Y6W A;  5AJD A;  2H89 A;  2MBG A;  1IAP A;  4QH1 A;  3TWU A;  2EIL E;  4EBA A;  1HE8 A;  3RQU A;  3FP3 A;  5HWX A;  5H6Q B;  1XGW A;  4NIQ A;  4H9Q C;  4HFG A;  4DV0 T;  5EID A;  3DXM G;  5HEU A;  4HFH A;  4JUY A;  3ZCJ A;  3EUV A;  4I6J A;  1HX1 B;  3CK8 A;  3ZT7 A;  1N4P A;  4LNU D;  1M7K A;  1GQE A;  3IHR A;  2CMR A;  4GTT A;  4DV4 T;  5LP0 A;  3CQC B;  2YIN A;  3MJW A;  5ADX L;  3TWS A;  2J49 A;  5HI7 A;  4DR3 T;  3PUA A;  4TV8 E;  5JR9 B;  2P58 C;  3JC6 D;  5LFA A;  4G2A A;  4EEC A;  1BLX B;  5CJ5 A;  4FJY A;  3TWQ A;  4ILB A;  2Y69 E;  5FL0 A;  2P9P G;  4YDE A;  2DCP A;  4JI4 T;  5D0O D;  1TNB A;  3RGL A;  3PUV F;  2VGY A;  3PS6 A;  4XAX B;  5J2U E;  1N32 T;  2KZT A;  4WND A;  3I9Y A;  3UM0 A;  1X81 A;  2AJA A;  4HXI A;  5HQ8 A;  2LSI A;  3UUN A;  4YDO A;  4Z8X A;  4Q94 A;  2CCQ A;  4LG6 A;  3PEU B;  4JZY A;  2ZIS A;  3HIZ A;  4PK4 A;  4ASK A;  2VL0 A;  5AQH B;  4JA9 A;  2X66 A;  1E8Y A;  2NOX A;  3AU5 A;  4HQD A;  2LSG A;  1YQ3 A;  3RYF E;  1TNO A;  4UI9 K;  3SI5 A;  3CHS A;  2H7O A;  2W66 A;  2ZIR A;  3PV0 F;  4BTA A;  4AKH A;  1MNE A;  4AIF A;  3NRX A;  3CVN A;  1PY1 A;  2BKK B;  3LY7 A;  1GW6 A;  3AAI A;  2XEV A;  4JBW F;  3QC9 A;  4JLE A;  5IY5 E;  4KZC A;  5LX8 A;  4I2Z A;  3KV9 A;  3QB5 K;  4I2W A;  4WWP A;  2AXV A;  2CWO A;  2UXB T;  2W00 A;  4ZZB A;  4G24 A;  2YHE A;  2WXP A;  4B89 A;  4PJM A;  5JR9 C;  1TNU A;  4PJN A;  5AQO B;  2NP9 A;  4G26 A;  2UY1 B;  4U0U A;  4KVO A;  4YFS A;  5AQR B;  2CE7 A;  3V2X A;  4HFC A;  4JHR A;  1VOM A;  3MCX A;  2BTD A;  3R9A B;  3OPC A;  3P8C D;  2KXP B;  1E8X A;  1W9R A;  2Q9Q D;  4X20 E;  1EPU A;  3V79 K;  5JRE A;  3MGB A;  2IQC A;  2KMF A;  4B6X A;  4CRW A;  4ZFH A;  4IRU A;  3C72 A;  4LF7 T;  1HTJ F;  4JI2 T;  3CK9 A;  4LEU A;  4UWH A;  3ML9 A;  1XDO A;  1XMQ T;  1TN7 A;  2LRK A;  5A6C A;  2HO1 A;  2JMK A;  3CVW A;  1E7P A;  4UF0 B;  3FXD B;  1OWN A;  3LG7 A;  5FVL A;  4F6R C;  4HWC A;  1P5Q A;  4KMO A;  3NRY A;  4W9R A;  5HXH A;  2A5E A;  5AQK B;  2V4H C;  3EDT B;  3ZMV B;  3NAW A;  1UG3 A;  5AIJ A;  3FUF A;  1T72 A;  3ZST A;  1Z6T A;  4I9E A;  2YOE A;  4GML A;  5EYL A;  2Y6X A;  3WAJ A;  4DX2 A;  5CA0 E;  4JB8 P;  4PAG A;  5JR9 A;  4ZI7 E;  3N2G E;  3Q9N C;  4NXN T;  2V7L A;  2PQN A;  5TAO A;  1BI7 B;  4J8D A;  1OCO E;  5CEA A;  5LCW C;  1SUM B;  2L0I A;  1DU2 A;  3N9Q A;  1OT8 A;  4DI4 A;  3SOL A;  5CCL A;  1UW4 B;  2IHR 1;  1XNQ T;  4I4T E;  2CWY A;  4EIW A;  5CFB A;  4ACK A;  1MMA A;  5J08 A;  4GMR A;  4MFR A;  2DI4 A;  2L3L A;  5HXE A;  2P9N G;  4CT0 A;  4Q96 A;  3LBX A;  4HTE A;  2XQ3 A;  3ZJ2 A;  2VTB B;  4X66 T;  4DV3 T;  3PU3 A;  3PUW F;  4YDW A;  4CGV A;  2MHK A;  3EHN A;  2HH7 A;  1E8Z A;  1N11 A;  4QXB B;  1T7S A;  1D0Y A;  1MND A;  5J0Z A;  1MYO A;  3KEZ A;  4GZ3 A;  3IBE A;  3SHF A;  1JWF A;  2C0M A;  4JI1 T;  4YHH T;  5FJY A;  2Q7F A;  4LMK A;  1QYM A;  3Q79 A;  3EAB A;  5T4Y A;  5GON E;  4GA1 A;  3UM1 A;  3SF4 A;  3FZM B;  1S35 A;  1J5E T;  1VCT A;  3P7I A;  2BG9 B;  1FT1 A;  1OXZ A;  5CBN A;  1OED B;  2ILR A;  2JLB A;  2DLR A;  2DIW A;  4JPS A;  4O6F A;  2X3M A;  4DV7 T;  2LJL A;  4M1P A;  1IXV A;  2PL2 A;  2XM1 A;  2NXP A;  5D2M C;  4OYJ A;  5AN8 A;  1WRD A;  3MJX A;  2HN1 A;  2CPT A;  1V55 E;  3AE7 A;  2B76 A;  2WP9 A;  2VVS A;  1D0Z A;  3IF8 B;  4U8V D;  4EED A;  4QX7 B;  5B1A E;  3PJA J;  5AQB A;  2XQA A;  3IEE A;  3RU0 A;  1SE7 A;  5AQT B;  2JEK A;  3ZMU B;  4BJN A;  4MBG A;  1YYH A;  2LUH A;  1OXJ A;  3ZU7 B;  5LGN B;  3N9P A;  3ZYK A;  3AA6 B;  5JDF A;  1ZU2 A;  3AS8 A;  2BKO A;  1UOH A;  3KS2 A;  4JEH B;  1E7V A;  4BFR A;  1YMP A;  1ZB1 A;  4UV9 B;  5JDH A;  3FDH A;  4EHM A;  2A3D A;  2LM2 A;  4ABN A;  4X1K E;  5JH7 E;  4B8A A;  4UWG A;  3P4S A;  3SZ7 A;  5CMW A;  2G0U A;  3CPZ A;  4N5Q A;  2LAH A;  4HRL A;  3RYH E;  5ARG A;  4U8Y D;  3NQP A;  4FHJ A;  4UF0 A;  3UKR G;  2YN6 A;  4LSZ E;  2EHO D;  1D9S A;  2PFV A;  2X67 A;  4L0R A;  3DPD A;  4EV6 A;  4ZOL E;  4ADZ A;  3J5P A;  3W9F A;  3TG5 A;  2XSB A;  3KFW X;  4EEB A;  2DWZ A;  2YNQ A;  2EIK E;  4TN7 B;  1OED C;  5EN5 D;  3A8Y C;  3APC A;  3EDV A;  1AJ3 A;  3L8R A;  4HOU A;  1NZN A;  3PE4 A;  2VL8 A;  4HBD A;  4IDZ A;  1KZP A;  1NA3 A;  3GZS A;  4PS3 A;  3AAE B;  2K3W A;  4J2C A;  2VJ8 A;  4JA7 A;  2ZGG A;  5AAO A;  3SFX A;  2WXG A;  3LDZ A;  3RC8 A;  3HA4 A;  2W63 A;  3AA0 B;  2JJ9 A;  3EI0 A;  2XEE A;  1YXR A;  4L9I A;  3HXF A;  5AQL B;  2D9D A;  3FTS A;  3HXD A;  3PU8 A;  5KJM A;  3ONK A;  3Q5M A;  2WDQ A;  4X1I E;  4F1S A;  2XHE A;  5JJ7 A;  4U0Z A;  4ERR A;  3D0T A;  1BU9 A;  3FB2 A;  1D1A A;  3EHQ A;  4K0R A;  3RRN B;  4LF5 T;  4IRE A;  3PE0 A;  5ABH A;  2DBA A;  3FUE A;  3O1H A;  3L09 A;  4GA2 A;  2WU2 A;  3DJB A;  5AQP B;  3B13 A;  3ZT5 A;  2VK9 A;  4NUU A;  2LOP A;  2J8S D;  3ZCI A;  1OED A;  4YSY A;  1N0R A;  2F0Y A;  4YLH A;  5C8Y E;  4U8H A;  4P0A A;  5EX3 A;  5EYP F;  3FU6 A;  1OCZ E;  3MEK A;  3Q5D A;  4DR7 T;  2NR4 A;  3BU8 A;  3NOC D;  4GTM A;  5HS0 A;  5EIL A;  1N9A A;  3Q47 B;  4GYR A;  4PH4 B;  2I1K A;  1WFD A;  3QDN A;  3SO8 A;  3KBT A;  2E0I A;  4ZEY A;  4ATZ D;  2XEH A;  2W61 A;  1O3X A;  2V5C A;  1I94 T;  2WZH A;  5CED B;  4BX8 A;  3LFM A;  4AKI A;  4AVX A;  4U63 A;  2ACZ A;  2Y1L E;  3PZD A;  1MHQ A;  4C9B B;  2FJE A;  1SA0 E;  3H3A A;  3QC1 A;  5KX5 E;  1HCI A;  3Q4A B;  1S94 A;  1HO8 A;  1OWO A;  4CZZ B;  3DPY A;  5L3B B;  4TWH A;  1U3C A;  1N34 T;  5L3E B;  5BT1 A;  5LHH B;  1K1B A;  5LGU B;  3PE3 A;  1S0P A;  2PM7 A;  4COF A;  2XRZ A;  1YCS B;  3PUJ A;  2M63 A;  2JQ9 A;  1NL4 A;  1N36 T;  3RIB A;  3W9G A;  4BT8 A;  5A23 A;  2BVM A;  4APO A;  3ESK A;  5HWY A;  1UJJ A;  2OND A;  3CML A;  3C4X A;  1PAQ A;  5AQA A;  3QUJ A;  3RPU A;  3TJP A;  5C2Y A;  4PJJ A;  4HI9 A;  2I9C A;  5FY1 A;  3LS8 A;  3DSS A;  2FJD A;  1CUN A;  1KF6 A;  4IHJ E;  4HOT A;  2CEA A;  2M6I A;  3S7B A;  2GRR B;  1FCH A;  2X6K A;  3U66 A;  3EDU A;  2KC7 A;  4KXK B;  1H7C A;  5JTG A;  4UEM A;  2X0H A;  4KZ0 A;  2H3R A;  1QUU A;  3P50 A;  4FLH A;  1BPO A;  1N4Q A;  2FO7 A;  4XBF B;  4R7L A;  3R9M A;  5AQQ B;  2GGF A;  4IN3 B;  4AY6 A;  3RKV A;  2R03 A;  2LXM A;  2W62 A;  1LD7 A;  3EU9 A;  4HWI B;  3PRZ A;  4J8F A;  3RYI E;  4U2Y A;  3ABL E;  4H9P C;  1FT2 A;  4N2Q A;  5B3S E;  3RH3 A;  4C48 B;  2E2E A;  5G04 J;  1WG0 A;  3ASN E;  2AE9 A;  1UN8 A;  2XSA A;  3RLF F;  5AQJ B;  5H6R B;  3L17 A;  4DR4 T;  2ZXW E;  4H7Y A;  3NKZ A;  3P4W A;  1MMD A;  1UN9 A;  5LG3 A;  3IBP A;  2A5U A;  2FUL A;  2XGS A;  2XAG B;  4HN9 A;  2A9U A;  3ZC1 A;  3AAA C;  3KSQ A;  4X65 T;  4QWN B;  5LJM A;  2WWU A;  4HOQ A;  2KND A;  2C5J A;  2ETA A;  4LF8 T;  3EIJ A;  3SY2 A;  5G2N A;  1JNR A;  4IE4 A;  4GK5 E;  3UU6 A;  5HXS A;  4HFB A;  3ASF A;  4FJZ A;  3FZK B;  4PS8 A;  3AVR A;  2QC9 A;  3ZN1 B;  4XZC A;  4EQF A;  3ZFW A;  3DEP A;  2P9I G;  5BNW A;  1IBM T;  3JC6 C;  4HNA D;  1H19 A;  2UWJ G;  4DPR A;  2Y48 B;  3CX6 B;  1MIW A;  3NZP A;  1SVX A;  3ASO E;  3GN5 B;  4WYV A;  5AQM B;  3ULY A;  2UXN B;  2N2N A;  3MYV A;  3KV4 A;  4NXM T;  5L3D B;  3N9O A;  3HXE A;  4GU5 A;  4LCT A;  2YHC A;  2WXF A;  5EX0 A;  1OWP A;  3ZJ1 A;  4N3A A;  2XAS B;  3QKY A;  2GRN B;  3NF1 A;  4O1P A;  5LG4 A;  2UXD T;  5HEG A;  2PG8 A;  5AQN B;  4K0K T;  2WM9 A;  3K3O A;  2DCF A;  3AG4 E;  4Z91 A;  3DBS A;  2HPL A;  4GPM A;  1DCQ A;  3KBU A;  2KT9 A;  4AP2 A;  3MK7 C;  3HRA A;  3G2V A;  1IJ5 A;  4MLP A;  4CDM A;  4LRZ A;  3CIA A;  4CN4 A;  2WXI A;  4L23 A;  1SZA A;  3BEE A;  3JXJ A;  2IUB A;  3PUQ A;  2LM9 A;  5FP3 A;  2OEW A;  4X8Q A;  3Q5X A;  4MHC A;  3AG2 E;  3SWH A;  3FTW A;  1MIY A;  5JRC A;  2E5V A;  2VWA A;  1DC2 A;  3SBS A;  1NAF A;  3DEO A;  2LSK A;  4YSX A;  2R6G F;  3ISM C;  2WB5 A;  1FMW A;  2BKP A;  2DNX A;  5FY7 A;  4KX6 A;  4H63 H;  3E0Z A;  2BBH A;  1L0V A;  3RF1 A;  2ZM6 T;  1H2U A;  3LSV A;  3UTM A;  4WWO A;  5FIO A;  4ANX A;  5G05 J;  2H6G A;  3FBL A;  2ION A;  2QYW A;  4A98 A;  2Q9Q C;  4ILH B;  4JVS A;  5ENS D;  4P09 A;  3JCK C;  3ZHE B;  1LD8 A;  1KEY A;  2L6B A;  4QQI A;  4GCO A;  4TUU A;  4J8E A;  1R8I A;  2GRO B;  5BR8 T;  3RQW A;  4P0B A;  5CHE E;  3T5V A;  4O4I E;  2FO1 E;  4HFV A;  3DP7 A;  4O2A E;  3OYZ A;  1OWL A;  5LBM A;  2J07 A;  2X0Y A;  3PUZ F;  3EU5 A;  4ZI3 D;  1HNW T;  3S7F A;  2LRL A;  3W15 B;  2QYJ A;  2ZM8 A;  5HEJ A;  2VUR A;  3ZYL A;  2DVW A;  5BUZ A;  2XRY A;  5B1B E;  1XNR T;  4PFP A;  2X9X A;  2WVI A;  4TXQ A;  5FT9 A;  3UFG A;  4UWL A;  2WS3 A;  1O1R A;  3DWL G;  3SD5 A;  3ZEF A;  3O4Z A;  4GTO A;  5LHG B;  2OVB A;  2LHR A;  2NW9 A;  3NZS A;  2BKG A;  2CHO A;  2FBN A;  4E85 A;  3S2A A;  1B7T A;  3CX8 B;  5G55 A;  3EHZ A;  3AA1 B;  5JDG A;  4TUY E;  3GN5 A;  5AQF B;  4JI6 T;  3ASD A;  2VQE T;  3AE1 A;  4DV2 T;  3B7B A;  5FY0 A;  4RLY A;  4UWF A;  2P9L G;  2LO6 A;  2KAT A;  5JDN A;  1TN6 A;  1BR2 A;  3NZQ A;  1N95 A;  5G04 C;  2GRL A;  3CVQ A;  3FZH B;  3L82 A;  1LF8 A;  4ANU A;  2P9B A;  2MOW A;  4GTQ A;  2V7K A;  3G2U A;  5EDS A;  2IEJ A;  3CR3 A;  2JPF A;  4GTV A;  2VYI A;  4FI5 A;  3A5X A;  3SBT B;  3U64 A;  3B7T A;  1DVP A;  4XI9 A;  5E76 A;  3LBX B;  2H6H A;  4CXW A;  5AQ9 A;  3DXK G;  4AIS A;  2K9A A;  2KM4 A;  4N2S A;  3NOG D;  3C3Q A;  4U07 A;  1HXI A;  4AKL A;  4I55 E;  2EIJ E;  4OVV A;  3UKU G;  2CFU A;  2NC9 A;  2IJG X;  2LSY A;  1Y01 A;  3ML8 A;  3E34 A;  2AW6 A;  3SFZ A;  5KBA A;  4UQZ A;  4AQY T;  4GA0 A;  2I59 A;  4H9O C;  2N9D A;  2PM6 A;  2XZT G;  3AG1 E;  2X6F A;  4GZC A;  1HX8 A;  4AIU A;  1HS7 A;  3F57 A;  3Q73 A;  3L16 A;  4B93 B;  1UUS A;  3QB2 A;  1UGO A;  2GRP B;  1E90 A;  4L1B A;  3ZC0 A;  1S63 A;  3D9P A;  3MKQ B;  4UXN B;  2CHX A;  4QKN A;  4XE0 A;  4QXH B;  4BA9 A;  4MRU A;  4YHJ A;  1KK7 A;  4ANV A;  2I0M A;  3K1S A;  5HKP A;  5KNH D;  2H6F A;  5IWA T;  3VLD A;  4DX7 D;  2BDE A;  3RHW A;  1JCS A;  1K3Z D;  4HOR A;  4KP3 C;  2LOS A;  5LMU T;  1QZ2 A;  2X68 A;  2XCC A;  3ABV A;  3F6Q A;  3WXX A;  3FUM A;  3ZHE A;  5HXC A;  2R59 A;  5LHI B;  4JC8 A;  4I1A A;  4G11 A;  2V6Y A;  4MS6 A;  3Q9U C;  1ELR A;  5LOV E;  4AEZ C;  2QA7 A;  3TWT A;  2XPK A;  3J5Q B;  4YVQ C;  5AQU B;  4CEM A;  3AU4 A;  5T3R A;  4K5A B;  5KMG P;  1TJC A;  2EHO C;  1KNR A;  5BV1 A;  2XQ4 A;  1ELK A;  4ANW A;  3MZL B;  4IE7 A;  1H0A A;  3CHP A;  3I1A A;  4AV7 A;  2C2L A;  2X51 A;  1Y8M A;  3QJZ A;  4NAC A;  4AI6 A;  3RRW A;  2UUB T;  4DR1 T;  3UX4 A;  4CCA A;  3RO3 A;  3ZVV A;  5JDL A;  1HH8 A;  5G05 C;  4AXP A;  5DQW A;  4WBO A;  2LXL A;  3FXE B;  2QFC A;  4TWD A;  2EQX A;  2MYS A;  3ZKR A;  5ENN A;  4A3V A;  4EZH A;  4FJO A;  5KJN A;  4AXH A;  1KNP A;  4DID B;  5L3C B;  3VRB A;  2VKH A;  4Q69 A;  2WAU A;  2XEN A;  1ZHC A;  5F3J A;  5JMN D;  3AE8 A;  5M4Y A;  4A97 A;  2XPY A;  1WDY A;  4TXR A;  4KHP T;  2XQ7 A;  3LK4 2;  3MKR A;  1HG2 A;  4EPZ A;  4QH5 A;  3FEX A;  3OTN A;  4TV3 A;  2WXN A;  4BSZ B;  3V5U A;  3SNX A;  4CI3 B;  1K1A A;  3ZPJ A;  2AWI A;  3UU5 A;  4IDO A;  5ABE A;  4A1S A;  5CCM A;  2K48 A;  3UI2 A;  2BS4 A;  4TZ4 C;  4XKC A;  5EK4 A;  2XHE B;  4LF9 T;  5AQV B;  4J7W A;  4DX1 A;  3E37 A;  4ZHQ E;  1KZO A;  2WQ6 A;  4ANJ A;  5LP6 E;  2UUA T;  4B3R T;  2Y3A A;  1XMO T;  2CBJ A;  3FUL A;  5DBK A;  3EIQ C;  2XGO A;  3LY8 A;  3OXF A;  5LMN T;  2A72 A;  1DCE A;  2V7J A;  1U3D A;  5KDM C;  3MKQ A;  1YD8 G;  5LXT E;  4GKJ T;  1HFA A;  2D5U A;  3L22 A;  3ZUV B;  3D9M A;  2YQ8 A;  3PTR B;  1YQ4 A;  5BMV E;  1BR1 A;  3TWV A;  4NQ0 A;  4JHJ A;  1IQR A;  3GWH A;  3QOF A;  3VR8 A;  4UWK A;  4CQI A;  4YJ2 E;  2WPV A;  4B0Z A;  3NBX X;  2LKH A;  3ZMZ B;  5LBQ B;  3P4R A;  2KBX A;  3C98 A;  3C4W A;  2CBI A;  2DZO A;  3EAM A;  1V54 E;  3ZRH A;  1U5P A;  5CGM A;  2ES0 A;  3QK6 A;  3UMV A;  5FZQ A;  2XQ9 A;  3O4X E;  5FWQ A;  3CKB A;  3C3R A;  4JD2 G;  2W2U A;  4U3C A;  4EGW A;  5C1D A;  4APF A;  2LE8 A;  2H88 A;  1G8X A;  3FBZ A;  1IBL T;  3ZLI A;  4HFE A;  2JAB A;  2BBJ A;  2FI7 A;  1JPL A;  4JI5 T;  1TN8 A;  3VKG A;  3KV6 A;  3D9I A;  5AQ7 A;  5AEN A;  1Z5S C;  2JQK A;  1EYH A;  3IXE A;  1JNZ A;  5DQV A;  2WDV A;  5F8P A;  4E7Z A;  3TGO A;  3RKO A;  3T1Y T;  3JUI A;  4KVM A;  2XAH B;  4UUC A; 
#chains in the Genus database with same CATH homology
 3U3W A;  2VGX B;  3D9J A;  4IE6 A;  3LJ3 A;  1SQM A;  3FUK A;  2LSV A;  2C0L A;  4BT9 A;  4BX9 A;  2OOE A;  3CVR A;  3UUX A;  4KMC A;  3HL6 A;  4D10 C;  4BSX A;  3MZK B;  3CX7 B;  3CHR A;  5AFU L;  2E9X D;  3CVP A;  4N78 D;  1BR0 A;  2GRM A;  2I1J A;  4WW0 A;  1QQE A;  4EOZ B;  4DMW A;  3AS4 A;  3FFL A;  3FH5 A;  3LEW A;  4J6I A;  2X6J A;  2B1E A;  2L0T B;  3FTZ A;  3PUK A;  4A55 A;  4XKB A;  5J2T E;  1IZN B;  5KJK A;  4O4L E;  4G23 A;  2WBL A;  5E0O A;  4UVA B;  5ETW A;  4ZI2 D;  4UEL A;  2KIN B;  5A7D B;  4ILG A;  4HS2 A;  2FF4 A;  2N1G A;  5JVD E;  3B57 A;  5ARF A;  3UUL A;  1A17 A;  4A3T A;  3IEG A;  4FHK A;  4MKT A;  2H7V C;  2WXH A;  1W3B A;  3EVY A;  2L9B A;  1Y64 B;  2JQQ A;  3QWV A;  3OXL A;  4OYK A;  4CT4 A;  3GW4 A;  3KD7 A;  3CHO A;  2J9Q A;  3ONL A;  4CGW A;  2J4B A;  3QOU A;  3LCA A;  5LCY A;  2V1D B;  3TXN A;  4EXT A;  4O2B E;  3PVL A;  5DIZ A;  1FEW A;  3UTK A;  5EKQ D;  3C4Z A;  1ZV4 X;  4EYU A;  3ASG A;  2OV8 A;  3OKQ A;  3FU3 A;  3UPV A;  3CVV A;  3LK2 B;  3ZN0 B;  1WAO 1;  4GYY A;  3MV2 B;  2L6J A;  3RX6 A;  4GYW A;  4ILU A;  4U74 A;  3UQ3 A;  3BQK A;  1IHG A;  4P29 A;  3K9I A;  3AAA B;  3HI2 A;  2XQY A;  5DAB A;  4MLK A;  3URZ A;  4I1O B;  4YND A;  2J08 A;  2VGX A;  3PEV B;  2Y8D A;  2XPI A;  3ENE A;  3G2T A;  2WXK A;  4DBR A;  3M65 A;  2C5I T;  3HR0 A;  4DLO A;  5HAX A;  5JRC B;  2L9Q A;  3FUI A;  4IE0 A;  2IF4 A;  4AQF C;  2WXL A;  3BG1 B;  4MAL A;  4TX5 A;  1B89 A;  4G2V A;  3D9K A;  4GYO A;  5FZS A;  3CLJ A;  3FHE A;  4H9R C;  3S7D A;  3TG4 A;  2HPJ A;  4IGU A;  4JEU A;  1G73 A;  3ONX A;  2V0P A;  2XQ0 A;  5JHB A;  3RO2 A;  5LGT B;  2KLQ A;  5ANR A;  4CDR A;  2IU1 A;  2PZI A;  1UX4 A;  1HG5 A;  2Y4U A;  3CK7 A;  4I17 A;  4UQX A;  4Y6C A;  5BW8 C;  4ZI3 C;  3Q5W A;  4DBQ A;  1V9D A;  4MBQ A;  3CEQ A;  3BQL A;  5FQ7 A;  4ISS A;  2C5K T;  5LA6 E;  3OJA A;  3HVE A;  2X0L B;  4GIW A;  1YKH B;  5L2L A;  4GB9 A;  4L2L A;  2R17 C;  4HKA A;  3FU5 A;  2CLY C;  5FNV E;  5CA1 E;  4TRQ A;  4PNI A;  2YU1 A;  3FY4 A;  1IJ6 A;  1UX5 A;  3KV5 A;  3J7Y q;  3ZEF B;  4IST A;  3MA5 A;  3QAQ A;  4LUN U;  4L2Y A;  2W0G A;  4GYS A;  4BY6 A;  2LT3 A;  2J1D G;  2IOS A;  2VSN A;  4XI0 A;  3FWV A;  3JQ0 A;  1E8W A;  4QHO A;  2Q9Q B;  3K3Q C;  2VKO A;  3O1I A;  2FEZ A;  3PNT B;  5HXR A;  3FUH A;  4FAD A;  1IYG A;  3MAC A;  4HEA A;  5L3G B;  2VQ2 A;  3U78 A;  4LER A;  3LJC A;  2E8I A;  3T8O A;  1LVK A;  3S4U A;  3T8M A;  5DJQ C;  2MRI A;  3VU7 H;  2AVP A;  2DWG A;  4AM9 A;  2WXQ A;  1KT0 A;  1OUV A;  4EZL A;  3CKD A;  3ZIM A;  2WB2 A;  5FQ6 A;  5LYJ E;  4PDX A;  3Q49 B;  3ETV A;  3G2S A;  1WY6 A;  3UT7 A;  2Z6E A;  1FIO A;  4ZS2 A;  4H7X A;  5BPP A;  5J90 A;  4AQG A;  4DJA A;  3ZYM A;  4C91 A;  4FC8 A;  3J9X 1;  3IHV A;  3QWP A;  2X6H A;  3PDN A;  5BV0 A;  4IE5 A;  3LPZ A;  3GA8 A;  4DMV A;  4CDN A;  2AXZ A;  2CM0 A;  1D1B A;  2K5B B;  4H9N C;  2KCK A;  3L13 A;  4AY5 A;  4K0U A;  4IIJ E;  1QNF A;  4O4J E;  4CI1 B;  1ZBP A;  5FYM A;  2QGS A;  1YKE B;  4A1G A;  3T5X A;  3RRU A;  2ZMA A;  3JQ1 A;  2IC6 A;  4I43 A;  4WWN A;  4I6G A;  3OXG A;  3LYA A;  5LOZ A;  2J4D A;  4OVU A;  1SHZ C;  4I50 E;  4N3C A;  3CHM A;  4ME2 A;  5KJL A;  3ZN3 A;  4HLE A;  3ZXS A;  4U04 A;  3OYX A;  2CHZ A;  4URK A;  4WNG A;  3GYZ A;  2V5F A;  1WLX A;  3UT4 A;  4PK5 A;  1LRZ A;  2JRK A;  3SS1 A;  1JWG A;  5E75 A;  3VTY A;  5AJL A;  2RG8 A;  3CSF A;  3R6N A;  4EZJ A;  2MOZ A;  2Q9Q A;  2PBI A;  4EBA G;  2HR2 A;  4N39 A;  2XTL A;  3HHM A;  1FVF A;  1HZ4 A;  3LY9 A;  2V4L A;  3IKO B;  1WYC A;  3O48 A;  1X79 A;  5FQ8 A;  1D1C A;  2KWH A;  4A56 A;  3DTO A;  3PUR A;  1VDY A;  1E96 B;  2EHO B;  4G25 A;  3U4T A;  3WAK A;  3PUG A;  3RRM B;  3OAW A;  1HF8 A;  3GZ1 A;  2D0T A;  5JDM A;  4PJL A;  1OWM A;  3FTV A;  2V8S E;  2ODU A;  3UT8 A;  2E9X B;  3N5L A;  3UFE A;  3ZMT B;  4JL0 A;  1Z0P A;  3FUJ A;  4GZ5 A;  3APF A;  4NUR A;  3ETU A;  3ASH A;  3HYM B;  4XZ4 A;  4GAA A;  3FUD A;  4FUL A;  4KBM B;  3MV3 B;  4C0E A;  3O1J A;  4K03 A;  3RJV A;  3JYS A;  3BG0 B;  3C98 B;  4H63 V;  3N9M A;  2OVF A;  5KCM A;  2WQH A;  5FXW A;  3UT5 E;  4JW1 A;  2VSO E;  4WNF A;  2CXD A;  3Q9D A;  1JUQ A;  3QAR A;  2LAI A;  2RP4 A;  1KLX A;  4CXY A;  3B7U X;  2LEH A;  3N2K E;  2I2O A;  4NUV A;  1YW0 A;  4E6H A;  5T8I A;  4RG6 A;  4DI3 A;  1MMG A;  3ZGQ A;  1X5B A;  4C90 A;  3FUN A;  4F3V A;  4M3O A;  2E9X C;  2IAK A;  3GMI A;  3UUX B;  2XCB A;  4HOS A;  4GMJ A;  1N54 A;  1OWA A;  4PUC A;  4XX5 A;  3FTY A;  3FHN A;  3LVQ E;  2X9H A;  1PC2 A;  3IV0 A;  3HKB E;  2IOL A;  3CGH A;  2X9Y A;  4AKG A;  5FTP A;  4G1T A;  2XAJ B;  5JHA A;  4ZS3 A;  4ATG A;  3WI3 A;  5IHY A;  3F2E A;  4ZI2 C;  2X38 A;  3LK3 B;  4U72 A;  1QSD A;  2V7M A;  2EHO A;  4OFZ A;  4DK5 A;  3NZU A;  2ZM0 A;  1TEZ A;  2LSU A;  3C51 A;  2XAF B;  3I3N A;  1E1H B;  4GK0 E;  3PNL B;  2NWB A;  3H37 A;  4EZ4 A;  2A2F X;  4BJM A;  4QXC B;  3CQG B;  3L54 A;  4L7T A;  1VRB A;  3K8P C;  1YA0 A;  1ZKE A;  2E9X A;  3HDX A;  3RYC E;  2KZ7 B;  3AS5 A;  3LKU A;  4FA6 A;  3G2W A;  2HM8 A;  3ZW3 A;  2CG3 A;  2NTY A;  5HYA A;  3PH0 C;  4OK0 A;  3BQI A;  2ZU6 B;  3U3I A;  4F7A A;  3AVS A;  1WM5 A;  3AB3 B;  2IC9 A;  1SZ9 A;  1IQU A;  2QY7 A;  2MTQ A;  4PW8 A;  3N9N A;  3U9W A;  4UI9 J;  2ODV A;  3KIN B;  3KDS E;  1L5J A;  4GZD A;  2VAS A;  4EYY R;  3MKD A;  2UY1 A;  3CWZ B;  4X1Y E;  1T98 A;  4B94 A;  2VB6 A;  4I9C A;  1MQS A;  4KYO B;  4YVO A;  4V1A v;  2WXO A;  3CVU A;  3QWW A;  2V26 A;  2BUG A;  1WR6 A;  3I0Q A;  1E7U A;  3GZ2 A;  1UCU A;  2NTX A;  2Y4T A;  3F31 A;  2RA1 A;  2YK0 A;  4DND A;  2ZM2 A;  3CHQ A;  2AXU A;  3FTU A;  2VKD A;  3ANW B;  4DO0 A;  3EJN A;  5LNK A;  4JEU B;  2V7I A;  3I4R B;  4WUY A;  1LVF A;  1N52 A;  2CG2 A;  3KVB A;  5A1L A;  1TJF A;  2BZB A;  4WBN E;  3R7R A;  3RK6 A;  3ULQ A;  4O4H E;  4E7S A;  3L3P A;  3D3M A;  5CMY A;  4GCN A;  2CHW A;  3CQX C;  3HVE B;  3TXM A;  5JDQ A;  3N2O A;  4CXX A;  4AKR B;  2IW5 B;  2VTB A;  2BF0 X;  3VTX A;  3VHL A;  2IFU A;  2WXJ A;  4CI2 B;  4XIF A;  5EZY E;  3IHY A;  3VKH A;  4OHF A;  3KAE A;  4JHK A;  1INZ A;  1DNP A;  3ZMS B;  4N5C A;  4GOU A;  5EK2 A;  2CXL A;  2R5S A;  4G63 A;  3CST A;  1ELW A;  2SPC A;  2WMO A;  4RVB A;  5AYW D;  4ACL A;  2KCV A;  3I5P A;  4IUL A;  3BK9 A;  4FLB A;  5FXZ A;  4J0U A;  2X6I A;  2C0S A;  4KBQ A;  3LXU X;  5L3F B;  4RSY A;  3OBV E;  1KNZ A;  1Z3X A;  4QFV A;  4I1M A;  3FTX A;  5M72 A;  2YEV C;  2JMH A;  4PK6 A;  1HU3 A;  4V3I A;  2CFZ A;  3O9X A;  1EZ3 A;  3KVA A;  4GZ6 A;  3APD A;  4UVB B;  3TL5 A;  3I4G A;  4B8C B;  4TV9 E;  2CLY B;  2OA5 A;  4UIG A;  3MA9 A;  5IYZ E;  1MIV A;  4UV8 B;  2VSX E;  3MX3 A;  3C64 A;  1BR4 A;  3B7S A;  4UQY A;  3AA7 B;  3D9L A;  2CXF A;  4JEH A;  2HYZ A;  2GK9 A;  4IYP A;  2DWK A;  1NWM X;  2ZLY A;  2WQ7 A;  3P2B A;  2NW7 A;  2UXX B;  2KWI B;  1MMN A;  2X9W A;  3S7J A;  2D2S A;  4BWR A;  4UI9 C;  2D0U A;  4L5G A;  2XUE A;  1Z3Y A;  1D0X A;  4BTB A;  3ANW A;  4PFO A;  3CV0 A;  4HE8 A;  5FMN A;  5JJT A;  4DVD A;  4GPK A;  4HVB A;  2RD0 A;  5D0Q D;  2XPZ A;  4U0S A;  3FEY A;  5FZR A;  3D9N A;  3E08 A;  3N71 A;  2CA5 A;  4I43 B;  3EUH A;  4JXT A;  3UUM A;  3C50 A;  5FXX A;  4F53 A;  3VLE A;  2WXM A;  3HKE E;  4H9S E;  5JJ6 A;  3I9W A;  5JQG E;  3QK0 A;  4AQF A;  3MXZ A;  4PS7 A;  3CVL A;  3ZPO A;  2WMN A;  1NA0 A;  3QNK A;  5J1G A;  1EDU A;  3Q2M A;  2WXR A;  4I6E A;  4EAH A;  3I0O A;  4O8S A;  3PDY A;  2ACX A;  4ILI A;  2LHN A;  3K3N A;  3FU0 A;  4DLQ A;  4KUM B;  3LVR E;  5FQ4 A;  2I6H A;  1EF1 C;  3TAX A;  5EK3 A;  4WNK A;  3PUS A;  3TKL B;  4HGA A;  1NP7 A;  3RC3 A;  5FXV A;  3R7Q A;  2GW1 A;  3HKC E;  3Q15 A;  4N3B A;  5LJN A;  1H2T C;  4FU3 A;  3VLF A;  2PQR A;  4OYS A;  4QX8 B;  2LNI A;  3R84 B;  4C0M A;  3E22 E;  3FH7 A;  3V5S A;  1H6K A;  4J8S A;  4RG9 A;  2KZT B;  3EHM A;  3FH8 A;  3PRE A;  4UVC B;  3L6A A;  2J09 A;  2VSY A;  3D9O A;  4KT6 B;  1LKX A;  5ANL A;  4WAF A;  3P1U A;  2NSZ A;  5CB4 E;  2NW8 A;  3CVY A;  1XNF A;  4EB6 E;  2WSS V;  2LSJ A;  3SRZ A;  1UJK A;  1KT1 A;  1Y6I A;  2XGM A;  3B7R L;  4YJ3 E;  1FMV A;  2A4Z A;  4BAY B;  1H2V C;  3SGH A;  3ESL A;  2YU2 A;  3ZYQ A;  2XAQ B;  1U4Q A;  3CKC A;  2K24 A;  4EZK A;  3HKD E;  2BVL A;  2M67 A;  3N9L A;  4AJW A;  2KCL A;  4WNE A;  3L08 A;  4FP7 A;  2L8K A;  3RRC A;  1HS6 A;  3CVX A;  4NRH B;  1US7 B;  5LCW J;  2DHR A;  2VKJ A;  1FVH A;  4AOF A;  1ZEE A;  3E4B A;  2PJQ A;  1WYB A;  4Y6W A;  5AJD A;  2MBG A;  1IAP A;  4EBA A;  1HE8 A;  3FP3 A;  5HWX A;  5H6Q B;  1XGW A;  4H9Q C;  4HFG A;  4JUY A;  3ZCJ A;  4I6J A;  3CK8 A;  3IHR A;  2CMR A;  5LP0 A;  3CQC B;  2YIN A;  3MJW A;  5ADX L;  2J49 A;  5HI7 A;  3PUA A;  4TV8 E;  5JR9 B;  2P58 C;  3JC6 D;  5LFA A;  4G2A A;  4EEC A;  4FJY A;  2DCP A;  5D0O D;  2VGY A;  3PS6 A;  4XAX B;  5J2U E;  2KZT A;  4WND A;  3I9Y A;  5HQ8 A;  4HXI A;  2LSI A;  3UUN A;  4Z8X A;  4Q94 A;  2CCQ A;  3PEU B;  4JZY A;  3HIZ A;  4PK4 A;  4ASK A;  4JA9 A;  2X66 A;  1E8Y A;  2NOX A;  3AU5 A;  2LSG A;  3RYF E;  3SI5 A;  4UI9 K;  3CHS A;  2H7O A;  4BTA A;  4AKH A;  1MNE A;  4AIF A;  3NRX A;  3CVN A;  1PY1 A;  3LY7 A;  1GW6 A;  3AAI A;  2XEV A;  3QC9 A;  4JLE A;  4KZC A;  5LX8 A;  4I2Z A;  3KV9 A;  4I2W A;  4WWP A;  2AXV A;  2CWO A;  4G24 A;  2W00 A;  2YHE A;  2WXP A;  4B89 A;  4PJM A;  5JR9 C;  4PJN A;  2NP9 A;  4G26 A;  2UY1 B;  4U0U A;  4KVO A;  4YFS A;  2CE7 A;  4JHR A;  1VOM A;  3MCX A;  2BTD A;  3R9A B;  3P8C D;  2KXP B;  1E8X A;  2Q9Q D;  4X20 E;  1EPU A;  5JRE A;  3MGB A;  2IQC A;  2KMF A;  4B6X A;  4CRW A;  4IRU A;  1HTJ F;  3CK9 A;  4LEU A;  4UWH A;  3ML9 A;  5A6C A;  2HO1 A;  2JMK A;  3CVW A;  4UF0 B;  3FXD B;  1OWN A;  3LG7 A;  4F6R C;  1P5Q A;  4KMO A;  3NRY A;  4W9R A;  5HXH A;  3EDT B;  3ZMV B;  1UG3 A;  5AIJ A;  3FUF A;  4I9E A;  1Z6T A;  4GML A;  2Y6X A;  3WAJ A;  5CA0 E;  4PAG A;  5JR9 A;  4ZI7 E;  3N2G E;  2V7L A;  2PQN A;  5TAO A;  4J8D A;  5LCW C;  2L0I A;  3N9Q A;  4DI4 A;  3SOL A;  5CCL A;  1UW4 B;  4I4T E;  2CWY A;  4EIW A;  4ACK A;  5J08 A;  1MMA A;  4MFR A;  2DI4 A;  2L3L A;  5HXE A;  4CT0 A;  4Q96 A;  3LBX A;  4HTE A;  3ZJ2 A;  2VTB B;  3PU3 A;  4CGV A;  2MHK A;  3EHN A;  2HH7 A;  1E8Z A;  4QXB B;  1D0Y A;  1MND A;  3KEZ A;  4GZ3 A;  3IBE A;  3SHF A;  1JWF A;  2C0M A;  5FJY A;  2Q7F A;  5T4Y A;  5GON E;  4GA1 A;  3SF4 A;  1S35 A;  3P7I A;  1OXZ A;  2ILR A;  2JLB A;  2DLR A;  2DIW A;  4JPS A;  4O6F A;  2X3M A;  2LJL A;  4M1P A;  2PL2 A;  2NXP A;  4OYJ A;  1WRD A;  3MJX A;  3IF8 B;  1D0Z A;  4QX7 B;  3IEE A;  3RU0 A;  2JEK A;  3ZMU B;  4BJN A;  5LGN B;  3N9P A;  3ZYK A;  3AA6 B;  5JDF A;  1ZU2 A;  3AS8 A;  3KS2 A;  4JEH B;  1E7V A;  4BFR A;  3FDH A;  4UV9 B;  5JDH A;  2A3D A;  4ABN A;  4X1K E;  5JH7 E;  4B8A A;  4UWG A;  3SZ7 A;  5CMW A;  2G0U A;  3CPZ A;  2LAH A;  3RYH E;  5ARG A;  3NQP A;  4FHJ A;  4UF0 A;  2EHO D;  2PFV A;  2X67 A;  4L0R A;  3DPD A;  4ZOL E;  4ADZ A;  3TG5 A;  3KFW X;  2YNQ A;  4TN7 B;  3APC A;  3EDV A;  1AJ3 A;  4HOU A;  1NZN A;  3PE4 A;  2VL8 A;  4PS3 A;  4IDZ A;  1NA3 A;  3GZS A;  3AAE B;  4J2C A;  2VJ8 A;  4JA7 A;  2WXG A;  3LDZ A;  3RC8 A;  3HA4 A;  2W63 A;  3AA0 B;  2JJ9 A;  4L9I A;  3FTS A;  3PU8 A;  5KJM A;  3ONK A;  3Q5M A;  4X1I E;  4F1S A;  2XHE A;  5JJ7 A;  4U0Z A;  4ERR A;  3D0T A;  3FB2 A;  1D1A A;  4K0R A;  3RRN B;  3PE0 A;  2DBA A;  3FUE A;  3O1H A;  3L09 A;  4GA2 A;  3DJB A;  3B13 A;  2VK9 A;  4NUU A;  2LOP A;  3ZCI A;  4U8H A;  4YLH A;  5C8Y E;  4P0A A;  5EX3 A;  3FU6 A;  3MEK A;  3Q47 B;  4GYR A;  4PH4 B;  2I1K A;  3QDN A;  3KBT A;  2E0I A;  2W61 A;  1O3X A;  4BX8 A;  3LFM A;  4AKI A;  4AVX A;  4U63 A;  3PZD A;  1MHQ A;  4C9B B;  1SA0 E;  3H3A A;  3QC1 A;  5KX5 E;  1HCI A;  3Q4A B;  1S94 A;  1HO8 A;  1OWO A;  4CZZ B;  5L3B B;  1U3C A;  5L3E B;  5BT1 A;  5LHH B;  5LGU B;  3PE3 A;  1S0P A;  2PM7 A;  2XRZ A;  3PUJ A;  2M63 A;  4BT8 A;  3RIB A;  5A23 A;  2BVM A;  4APO A;  3ESK A;  5HWY A;  1UJJ A;  2OND A;  3CML A;  3C4X A;  1PAQ A;  3QUJ A;  3RPU A;  3TJP A;  5C2Y A;  4PJJ A;  2I9C A;  5FY1 A;  3LS8 A;  4IHJ E;  1CUN A;  4HOT A;  2CEA A;  3S7B A;  1FCH A;  2X6K A;  3U66 A;  3EDU A;  2KC7 A;  4KXK B;  1H7C A;  4UEM A;  4KZ0 A;  2H3R A;  1QUU A;  4FLH A;  1BPO A;  2FO7 A;  4XBF B;  4R7L A;  2GGF A;  4IN3 B;  4AY6 A;  3RKV A;  2W62 A;  3PRZ A;  4J8F A;  3RYI E;  4H9P C;  4N2Q A;  3RH3 A;  2E2E A;  5G04 J;  1UN8 A;  5H6R B;  3L17 A;  4H7Y A;  1MMD A;  1UN9 A;  3IBP A;  2A5U A;  2FUL A;  2XGS A;  2XAG B;  4HN9 A;  3ZC1 A;  4QWN B;  5LJM A;  2WWU A;  4HOQ A;  2KND A;  2C5J A;  3EIJ A;  5G2N A;  4IE4 A;  4GK5 E;  5HXS A;  3ASF A;  4FJZ A;  4PS8 A;  3AVR A;  3ZN1 B;  4XZC A;  4EQF A;  3ZFW A;  5BNW A;  3JC6 C;  1H19 A;  2UWJ G;  4DPR A;  2Y48 B;  3CX6 B;  1MIW A;  3NZP A;  3GN5 B;  2UXN B;  2N2N A;  3MYV A;  3KV4 A;  5L3D B;  3N9O A;  4GU5 A;  4LCT A;  2YHC A;  2WXF A;  5EX0 A;  1OWP A;  3ZJ1 A;  4N3A A;  2XAS B;  3QKY A;  3NF1 A;  5LG4 A;  2PG8 A;  2WM9 A;  3K3O A;  2DCF A;  3DBS A;  2HPL A;  3KBU A;  2KT9 A;  4AP2 A;  3MK7 C;  3G2V A;  1IJ5 A;  4MLP A;  4CDM A;  4LRZ A;  3CIA A;  2WXI A;  4L23 A;  1SZA A;  3BEE A;  3PUQ A;  2LM9 A;  5FP3 A;  3Q5X A;  4MHC A;  3SWH A;  3FTW A;  1MIY A;  5JRC A;  2VWA A;  3SBS A;  1NAF A;  2LSK A;  1FMW A;  2DNX A;  5FY7 A;  4H63 H;  3E0Z A;  1H2U A;  4WWO A;  4ANX A;  5G05 J;  3FBL A;  2ION A;  2Q9Q C;  4ILH B;  4JVS A;  4P09 A;  3JCK C;  3ZHE B;  4GCO A;  4TUU A;  4J8E A;  4P0B A;  5CHE E;  3T5V A;  4O4I E;  4HFV A;  3DP7 A;  4O2A E;  3OYZ A;  1OWL A;  5LBM A;  2J07 A;  4ZI3 D;  3S7F A;  3W15 B;  2ZM8 A;  3ZYL A;  5BUZ A;  2XRY A;  4PFP A;  2X9X A;  2WVI A;  5FT9 A;  4UWL A;  3ZEF A;  3SD5 A;  3O4Z A;  5LHG B;  2OVB A;  2LHR A;  2NW9 A;  3NZS A;  2FBN A;  4E85 A;  3S2A A;  1B7T A;  3CX8 B;  5G55 A;  3AA1 B;  5JDG A;  4TUY E;  3GN5 A;  3ASD A;  5FY0 A;  4UWF A;  2LO6 A;  2KAT A;  5JDN A;  1BR2 A;  3NZQ A;  5G04 C;  2GRL A;  3CVQ A;  1LF8 A;  4ANU A;  2P9B A;  2MOW A;  2V7K A;  3G2U A;  5EDS A;  3CR3 A;  2JPF A;  2VYI A;  4FI5 A;  3A5X A;  3SBT B;  3U64 A;  3B7T A;  1DVP A;  4XI9 A;  5E76 A;  3LBX B;  4CXW A;  2K9A A;  2KM4 A;  4N2S A;  4U07 A;  1HXI A;  4AKL A;  4I55 E;  4OVV A;  2CFU A;  2NC9 A;  2IJG X;  2LSY A;  3ML8 A;  2AW6 A;  3SFZ A;  4UQZ A;  4GA0 A;  2I59 A;  4H9O C;  2N9D A;  2PM6 A;  2X6F A;  4GZC A;  1HX8 A;  1HS7 A;  3F57 A;  3L16 A;  3QB2 A;  4L1B A;  1E90 A;  3ZC0 A;  3D9P A;  3MKQ B;  4UXN B;  2CHX A;  4QKN A;  4XE0 A;  4QXH B;  4BA9 A;  4MRU A;  4YHJ A;  1KK7 A;  4ANV A;  3VLD A;  2BDE A;  4HOR A;  4KP3 C;  2LOS A;  1QZ2 A;  2X68 A;  2XCC A;  3WXX A;  3FUM A;  3ZHE A;  5HXC A;  2R59 A;  5LHI B;  4JC8 A;  4I1A A;  4G11 A;  4MS6 A;  1ELR A;  5LOV E;  4AEZ C;  2QA7 A;  4YVQ C;  4CEM A;  3AU4 A;  5T3R A;  5KMG P;  1TJC A;  2EHO C;  5BV1 A;  1ELK A;  4ANW A;  3MZL B;  4IE7 A;  1H0A A;  3CHP A;  3I1A A;  4AV7 A;  2C2L A;  2X51 A;  1Y8M A;  3QJZ A;  4NAC A;  4AI6 A;  3RRW A;  3UX4 A;  4CCA A;  3RO3 A;  3ZVV A;  5JDL A;  1HH8 A;  5G05 C;  4AXP A;  5DQW A;  4WBO A;  3FXE B;  2QFC A;  2EQX A;  2MYS A;  5ENN A;  4A3V A;  4EZH A;  4FJO A;  5KJN A;  4AXH A;  5L3C B;  2VKH A;  4Q69 A;  2WAU A;  1ZHC A;  5F3J A;  5M4Y A;  2XPY A;  3LK4 2;  3MKR A;  1HG2 A;  4EPZ A;  3FEX A;  3OTN A;  4TV3 A;  2WXN A;  3V5U A;  3SNX A;  4CI3 B;  3ZPJ A;  2AWI A;  4A1S A;  5CCM A;  2K48 A;  4TZ4 C;  4XKC A;  5EK4 A;  2XHE B;  4ZHQ E;  2WQ6 A;  4ANJ A;  5LP6 E;  2Y3A A;  3FUL A;  5DBK A;  3EIQ C;  2XGO A;  3LY8 A;  3OXF A;  2A72 A;  2V7J A;  1U3D A;  5KDM C;  3MKQ A;  1YD8 G;  5LXT E;  1HFA A;  2D5U A;  3L22 A;  3D9M A;  2YQ8 A;  3PTR B;  5BMV E;  1BR1 A;  4NQ0 A;  4JHJ A;  1IQR A;  3GWH A;  4UWK A;  4CQI A;  4YJ2 E;  2WPV A;  4B0Z A;  3NBX X;  3ZMZ B;  5LBQ B;  3C98 A;  3C4W A;  3ZRH A;  1U5P A;  2ES0 A;  3QK6 A;  3UMV A;  5FZQ A;  3O4X E;  5FWQ A;  3CKB A;  5C1D A;  4APF A;  2LE8 A;  3FBZ A;  1G8X A;  3ZLI A;  2FI7 A;  1JPL A;  3VKG A;  3KV6 A;  3D9I A;  5AEN A;  1EYH A;  5DQV A;  4E7Z A;  5F8P A;  3TGO A;  3RKO A;  3JUI A;  4KVM A;  2XAH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...