1HF8A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Clathrin
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 102
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hf8A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hf8A01
5LP0A 1EDUA 1EYHA 1SZ9A 2DIWA 2KM4A 3G2TA 3ONKA 4GZCA 1XGWA 5J08A 1MHQA 2MOWA 5CMYA 1UJJA 3ZYQA 3ONLA 2LO6A 3CLJA 3LDZA 1DVPA 1LF8A 5CMWA 3D9NA 4JXTA 1JWGA 3D9LA 3D9MA 1HX8A 4Q94A 4AVXA 1HG5A 4FU3A 1PY1A 3G2UA 3D9IA 1HG2A 2QY7A 2DCPA 2L0IA 4GZDA 1HFAA 1SZAA 1X5BA 3G2WA 4NACA 1HF8A 4HFGA 1VDYA 5LOZA 1JPLA 1JWFA 3ZYKA 4FLBA 1INZA 3D9OA 3D9JA 1ELKA 2V8SE 3ZYLA 2BF0X 3RRUA 3ZYMA 3G2VA 3D9PA 3G2SA 2L0TB 1H0AA 3D9KA 4Q96A 1JUQA 1UJKA
chains in the Genus database with same CATH superfamily
4LF7T 4DR2T 1KT1A 3Q7AA 4X5TA 3O9XA 3ZJ2A 2IO3C 4EZJA 3IHRA 2IUBA 5EX3A 2IC9A 2JPFA 3ABME 3FUHA 3C3QA 1FMVA 3TLUA 2PFVA 5EN5D 5LB7B 3MXZA 4LG6A 4H9RC 5FJYA 3FY4A 1KK7A 3QB2A 4XBFB 2V7KA 5AJDA 4CZ2D 1N0QA 2W61A 1Y8MA 4GZ6A 3ZYLA 2BF0X 3C51A 2WXLA 4N3CA 3X1DA 3HVEB 2WB5A 5HS0A 3JC6C 4I43B 3ZT5A 2CBIA 5JHBA 5AQFB 4K5CA 2GGFA 2NW9A 3HKBE 5AQUB 2QVAA 4BAYB 5ANLA 5G04C 3RKVA 4AKIA 4G63A 1D8DA 4RVBA 3PV0F 2B0OE 4NIKA 2EHOA 1DCQA 4UR9A 4N5CA 4A56A 4BJNA 4U95D 2ODUA 3R9AB 3L13A 4IDNA 4NPPA 2OEWA 3QOUA 3ZPOA 2DWZA 3CPZA 5LMNT 4U8VD 1SA5A 1QYMA 3SGHA 3EUVA 2P9PG 4LF4T 3NZUA 2XS1A 4AIUA 1SZ9A 4HRMB 1NI1A 3FU5A 2J62A 5HWYA 5HAXA 4GPMA 4J0UA 1OWMA 4ILHB 2E0IA 2BKGA 3TG5A 4TRQA 2WXKA 2YK0A 3DTOA 2QYWA 2KXPC 4HQDA 5ARGA 2F4VT 5LFAA 4QWNB 3Q47B 5F3JA 2C5IT 1E8YA 3FEYA 3ETUA 4IN3B 2GRRB 4RG6A 3ZPJA 4ME2A 4N39A 1SW6A 2CHZA 2A2FX 5ETWA 3EHQA 3Q75A 4JA9A 1WYBA 4DR6T 3AG3E 3ZNGA 2CLYB 2NTYA 1BI7B 2C0MA 2D0UA 2W62A 2ETAA 2CLYC 2LSUA 3ZN0B 1Q2ZA 1G8XA 3ABKE 4DBQA 4HWCA 3MX3A 3RHWA 4X1KE 5FY1A 3APCA 4I1OB 3PU8A 4HFDA 2OVFA 5AFUL 3ZT7A 2LM2A 2IONA 2A5EA 2KT9A 4FJYA 4GTSA 2QYJA 3UKUG 3PE3A 2UU9T 5HRYA 2ZM0A 3FTXA 5JDMA 3D9OA 4YFSA 5BV0A 2ZLYA 2H6GA 5ENQD 3CKDA 2CG3A 4G2VA 1IHBA 2X6JA 3BQKA 3AE5A 3UU6A 1TN7A 3RQUA 3EIJA 3L17A 3QAQA 3SFXA 3ASOE 3P2BA 4OVUA 2FJBA 3TKLB 3D9MA 4GYSA 1OWNA 1H2VC 3S7FA 3MACA 4WYVA 2OCCE 4V1Av 4ZHQE 3RIUA 2IY0C 3AG2E 1HF8A 3B7RL 3ZMZB 3IXEA 2IIUA 3ZYKA 1Y6IA 4ZS2A 2UXBT 3LBXA 5C8YE 2YHEA 4FI5A 4U0SA 4C91A 4UF0A 4X1YE 3PNLB 4OHFA 4QHOA 3P4RA 4ANWA 1UJKA 2VASA 2L9BA 2DIWA 4HLLA 5AQVB 1S70B 4XKBA 1KF6A 3CVUA 5FL0A 3PUGA 1W3BA 3UI2A 3UU8A 2IW5B 2LXLA 3IV0A 3APDA 3AU5A 4LF6T 1VCSA 2FJEA 3MV2B 5FP3A 2XPIA 3Q5MA 4YJ3E 2P58C 3CX8B 3PURA 2VSYA 4F6RC 5LHGB 2GROB 4KP3C 2XAJB 4X65T 4PJLA 2LAHA 4EECA 3IBEA 1XNRT 4JV5T 3AAAC 2NW7A 2HYZA 3KSQA 3RC3A 5L3EB 4UEMA 5JDHA 3E22E 4B3MT 4GTMA 2AXZA 1FEWA 4L9PA 1HR0T 4TXRA 2YDRA 1LRZA 4BWRA 3O1JA 1T8BA 3GWHA 2I2OA 5FWQA 4Z91A 2WVIA 2QYUA 1EF1C 1WFDA 4DLOA 3SBSA 1W0BA 2PM7A 2WXFA 1MNDA 1B89A 3I9WA 3FBZA 2YNQA 4ILUA 1US7B 3FTVA 1UJJA 4ABNA 1BLXB 2DL1A 3R6NA 4ATGA 3AEEA 3ULYA 2IMLA 3RRWA 2EIKE 3UM2A 2XM1A 3LEWA 4HRNA 4DV2T 3PEUB 3A7MA 3P1UA 1HTJF 4UF0B 5JJ7A 2MPKA 4LNUD 1CUNA 1NEKA 2XPKA 3AXJB 2LE8A 2IFUA 4L1BA 3APFA 4I4TE 3L39A 1Z6TA 1Y64B 2X0YA 1IJ6A 1YKEB 3LSVA 5HEUA 2UWJG 1XZYA 3FULA 1WCRA 3FUNA 4UV9B 4L0RA 3N2OA 3VRBA 2V7JA 3E0ZA 1JNZA 4EAHA 4RQIA 4JPSA 4HWFA 1JCRA 2GRMA 4IYPA 3QWVA 3UU5A 4I17A 1EPUA 3SF4A 3TG4A 3MA9A 1U3DA 3CSTA 1P5QA 4IULA 3LJ3A 1D0XA 3BQIA 4CN4A 3UKRG 1HZ4A 4DRXE 5BV1A 3QDNA 4CI1B 3B57A 5HXHA 1BI8B 3UTKA 4GIWA 2YN6A 4HKAA 5H6RB 4NXNT 3I0QA 4KVMA 4JUYA 3RO3A 5LHIB 1E7UA 2YHCA 3FTZA 4UQXA 2LAIA 3ZT6A 2BKKB 3CHSA 3ONJA 2PZIA 5EIBE 2R03A 2BKOA 4KI0F 4ACLA 5D0OD 3V5UA 2B1EA 2CFZA 3WXXA 4GPKA 4UVBB 2Q9QC 2Q9QD 3U4TA 4U7YA 5M4YA 5L3DB 4ISSA 4JI4T 5HEGA 3L9TA 3VHLA 4KBMB 4DR7T 2L6BA 1OEDE 5CCMA 3NF1A 1OWPA 4H9QC 3UT4A 1UUSA 2DZOA 3TWRA 2J4DA 5CEAA 1FJGT 4GMRA 3EI0A 3KBTA 4PAGA 3V5SA 5ABHA 3EHNA 4H7XA 3LYAA 4IRUA 5HKPA 3CVYA 1AP7A 5G55A 3JXIA 4XI9A 4YHHT 5L4EA 2XQ4A 4MHCA 3Q9UC 2KLQA 5ENNA 4X1IE 3MV3B 5AQRB 4TX5A 4DNDA 4OYJA 2CRBA 4IHJE 5DBKA 2CG2A 3VR8A 2P9NG 3O1HA 4AQGA 5A1LA 2Q7FA 2MBGA 5ANRA 3PUXF 4U07A 3FZLB 4APOA 3HG0D 2LSVA 2NOXA 3ANWB 3DSVA 4E7ZA 2VSNA 4X20E 4JXTA 1W0AA 4P0AA 1HE8A 2I9CA 5AQ7A 5AQAA 4HLEA 3N2KE 5AQNB 2RFMA 4M1PA 1UOHA 3ZMVB 4PJJA 2XQYA 4ILIA 3AEDA 4P09A 4OYKA 3FZMB 3DPDA 2RKKA 5G05C 4EBAG 3C4WA 4F3VA 5AQPB 5BMVE 4ILGA 2IOSA 4O60A 5AQLB 5LP6E 1E8XA 3PUAA 3KVAA 4U74A 4I1MA 2WDQA 3MJWA 5EX0A 5HI7A 3EJNA 3ASDA 2MHKA 1K1BA 3TWWA 2D9DA 3UT7A 5L3GB 4G24A 1HX8A 4H63V 3PZ4A 3J7Yq 2NSZA 3L54A 3Q49B 1Z8UA 2XAHB 4DVDA 4O1OA 4GB9A 2XRZA 3PZ1A 3TWVA 1FVFA 3LK3B 4L2YA 4LEUA 4H9SE 3FUKA 1ZV4X 3LJNA 2H6IA 4L23A 2J4BA 2Y6XA 2KM4A 4FC8A 3UQ7A 2I0MA 4CEMA 3DP7A 4YHJA 2LKGA 4QKNA 2N9DA 4JA7A 4DBRA 3CIRA 1HS6A 4YVOA 4HWIB 3QC9A 1E96B 3RIAA 3C98B 4EZLA 4U0UA 3C50A 5FKYA 4WW0A 3ZRHA 3AE7A 2J07A 2X68A 2VKOA 3FH7A 1JNRA 4LNBA 4J8EA 3NBXX 4B89A 4DV0T 4C90A 3BQOA 2E9XA 3ABVA 4HVBA 4YDYA 4ZEYA 4J8SA 4ATZD 3ZU7B 5HCMA 5EK2A 3KFWX 4JI6T 2XCBA 3K8PC 5AQ9A 2WXGA 2N1GA 5HEOA 5LX8A 3MEKA 3L8RA 3ESKA 2AVPA 3S2AA 4DJAA 2Y4TA 1HG5A 1YXRA 2E9XC 2JJ9A 4P0BA 2CCQA 3L08A 3EU5A 1JPLA 2C2LA 3ZYMA 2UUBT 1FVHA 5J1GA 2V5DA 4H9NC 1Z3XA 2KZTA 3EAMA 3UX4A 5CHEE 1S94A 2GW1A 2CHXA 4HFIA 3QKYA 5C2TA 1J1JA 2MRIA 3FTSA 3E32A 3LXUX 3CQXC 5E76A 2XJ7A 1IQUA 1IYGA 3NVOA 5CERB 3QB5K 4FJOA 2G0UA 3EU9A 4EBAA 3Q9DA 3ENEA 2ACXA 4ZS3A 2XGMA 3BG1B 1NWMX 4L2LA 1NFIE 2ZGGA 3SRZA 4WNKA 3EIQC 3JUEA 4HORA 1JWFA 2ZM8A 1MMAA 4UWGA 2XZDG 1OCCE 3NQPA 3UXGA 5KJMA 2ZMAA 1O1SA 2RD0A 3WAJA 2B76A 2UXCT 4YJ2E 3ONKA 3QUJA 2MOWA 4GZ3A 1XNQT 1N54A 4NURA 4XKCA 2BTDA 1D1AA 1BPOA 4XE0A 2BDEA 4U7EB 4CXXA 4GKJT 4XX5A 5LYJE 3BU8A 5FTPA 1VCTA 4IE5A 3D9KA 2W67A 2JQHA 4MS6A 3G2TA 1XDPA 4EYYR 4X62T 2KC7A 3F6QA 4DMVA 2PBIA 3ML8A 3GZ2A 2LSYA 4I1AA 1PY1A 2P9LG 1EZ3A 3O4XE 4OFZA 3ZLIA 3AG1E 2LSKA 3LDQB 3IEGA 5AQJB 3I5PA 4WNFA 2SPCA 2GRNB 4I6EA 2KMFA 4XI0A 3U3WA 3HXBA 3JCFA 2NTXA 5GONE 3K3NA 3OXFA 4I9EA 2KATA 3N9MA 3FTWA 4CRWA 4MKTA 1M7KA 1YW0A 2A9UA 3CQCB 4EIWA 2PQNA 4JEHA 3D9HA 2WXQA 3AU4A 4HNAD 3W9FA 3HYMB 3HXFA 3LY9A 3D3MA 4YDOA 4K5BA 1G73A 4EZHA 2NW8A 4JEUB 4B93B 4GK5E 5IUXA 2BS3A 2Y0BG 3FUMA 3CHPA 3WG7E 2IU1A 2V1DB 1O3XA 2V8SE 3ASNE 4HFCA 3Q79A 3Q73A 4NIQA 3TLTA 4KT6B 3SO8A 4G23A 5E75A 5FVKA 4L5GA 3GMIA 3URZA 3KBUA 2EHOB 4U3CA 1A17A 2GRPB 1N0RA 2AXVA 3ZCJA 1FMWA 2E5VA 1SE7A 5T4YA 2C5KT 2MYSA 2N2NA 4WWOA 2R5SA 4GMJA 1PAQA 5CBNA 5JHAA 2I1KA 2XEHA 2NWBA 2F0YA 4BT9A 1Z3YA 4LNGA 4GYWA 1IBKT 1SHZC 4I55E 3JAFA 2X3MA 2FO7A 4HOTA 3DWLG 3I1AA 1X9BA 4BFRA 4MBQA 2YINA 3AECA 5HXCA 4HWDA 4GYOA 2KCLA 5HWXA 2P9UG 2KBXA 2QRXA 2LNIA 3Q5XA 2Y4UA 5JDLA 3VRAA 4U96D 3ZEFA 2BZBA 4PNIA 4KVOA 5BXUA 4BJMA 4JYAT 1S64A 5KBAA 4AY6A 1QZ2A 2FUPA 2JEKA 1HXIA 3UIOC 3QK6A 3AA6B 3CMLA 5FXXA 1OWOA 5CECB 4A63B 4TNVA 4PK4A 1UX5A 5JJTA 1YQ3A 3VTXA 4C9BB 4B8CB 2FEZA 1SUMB 3T5VA 4OX9T 2WQHA 1KZOA 4PS3A 1OCOE 2C0SA 4GZCA 4KBQA 4UELA 5AQKB 5J90A 1TNOA 4DR1T 3RYCE 4JHKA 1L0VA 2LM9A 1ZP0A 4LRZA 4GTPA 4LCTA 1E7VA 4O4JE 3IBPA 5AQSB 5CMWA 3T5XA 5KJKA 4TNWA 3PUQA 2XS8A 4DLQA 1QNFA 3RRMB 3OBVE 1YA0A 2JQKA 1S35A 3RO2A 4HFEA 2ZISA 3ML9A 3FBLA 2E2AA 1WG0A 4J6IA 4FULA 4DI3A 4IL9A 5FZQA 2CA5A 4O4IE 1N95A 2XQ9A 4GYYA 3NRXA 3SQVA 3NZPA 2FBNA 2R02A 2EILE 5H7PA 3FEXA 3ONXA 3PZ2A 2CWYA 3CVRA 3WI3A 3NKZA 3OKQA 4W9RA 3V30A 2HE0A 4U2YA 3QARA 2HN2A 4PFPA 1LF8A 1TNUA 3FUIA 3LCAA 4JC8A 1ZB1A 3RKGA 3P50A 5EZYE 4GAAA 3LBXB 2B6CA 3Q5DA 4O4LE 3FTUA 4AXHA 2F8XK 5LGNB 4K0UA 4GA1A 3O4ZA 5LNKA 4URKA 4QH5A 3BEEA 2LOPA 4LMKA 2OEVA 2ODVA 5ABFB 5FQ6A 2WU2A 4EXTA 4G25A 4BESA 3NWIA 4CDNA 2J8SD 4B8AA 2X9WA 1H6KA 4B3ST 2X67A 5FQ8A 2HN1A 4KHZF 2E9XD 3FUDA 3AS5A 4HS2A 4DV5T 1WRDA 2D0TA 2KZ7B 5TAOA 4WAFA 5HQ8A 2M6BA 3AAAB 4MBGA 4U72A 2WXRA 3ZC1A 3G2UA 2VQFT 3I3NA 3FUJA 4XIFA 3X2QE 4UQYA 4WNEA 4DPRA 2HR2A 2AWIA 3B7SA 2WQ6A 3P4WA 4GTTA 4GTVA 4WBNE 3TXNA 4ERRA 4TWFA 2J08A 3CWZB 2H6FA 4BTAA 3L82A 5JDFA 1JCQA 4UI9K 4UWKA 1OEDC 3D0TA 4K0KT 5CMYA 3AEAA 4A98A 1QSDA 3AE3A 1NENA 2CHWA 3D9LA 5J2TE 2VL0A 3N2GE 1KZPA 3MJXA 4IE7A 4WBOA 5L3FB 2Y8DA 3Q7FA 3AE1A 2ONDA 5AQIB 1HX1B 4V3IA 1N11A 3MA5A 1BR4A 1H0AA 2CXLA 4KHPT 3A8YC 4FA6A 1U3CA 3HVEA 2YOEA 3B13A 3GYZA 4EOZB 3FH5A 1YKHB 1NA3A 4TWHA 4ZXLA 5KJLA 4OYSA 3RRCA 2VGYA 4CI2B 4BY6A 3E4BA 4AKLA 3SFZA 3LKUA 2XQAA 5IYZE 1MIVA 2ZU6B 2BBJA 1IZNB 3KS2A 3VLDA 2D5UA 3ZSSA 4LF8T 4I50E 3HXEA 3ASHA 1M62A 2DNXA 4A97A 2FO1E 4BSZB 3N9LA 4YY3T 1TNBA 4E85A 2XGOA 5HEHA 5EILA 5D66A 5AAOA 3GA8A 3RLFF 5M72A 4ZI3D 4YT0A 3PVLA 2Q9QA 1V9DA 3AE6A 2X6FA 1RW2A 2UXNB 4G1TA 3TLWA 4F6RD 3E37A 3M3ZB 1FT2A 2VL8A 2WWVA 3I9YA 2WXMA 3D9PA 4IE6A 5T8IA 5H6QB 3FZKB 3KV6A 1MIYA 4TV9E 3RF1A 3AJIA 4BT8A 5J0ZA 3N9OA 5HXSA 1J5WA 3OXLA 2M6IA 5BR8T 1NL4A 1X5BA 3V2OA 1HH8A 1XMOT 5AJLA 2CPTA 2XPZA 2I6HA 4O4HE 4IREA 3SHFA 2UUCT 4KUMB 1T72A 4PK5A 3SBTB 5JR9C 4J8YA 3S7BA 3FZHB 4DX1A 3C3RA 3LPZA 3TL5A 4O6FA 1BU9A 2MTQA 3D9NA 5AQGB 1H6PA 3UTMA 3QJZA 2NP9A 4IE0A 2W4XA 5F8PA 1MZCA 3HRAA 3HXDA 3UUXA 2LEHA 2ACZA 4QH1A 2P9IG 2WSSV 2M63A 2WXJA 3CHMA 3OJAA 3ASGA 3U9WA 1DC2A 1D0ZA 4AKRB 2FULA 1UCUA 2X0HA 4JB8P 3R7QA 3HXCA 3ZEFB 2IAKA 3FXEB 2DWKA 4LMLA 2HPLA 4NQ0A 2VTBB 1OUVA 4DR4T 2PNNA 2WDVA 5A7DB 3ZKJA 1HG2A 4AJWA 4PS8A 4BX8A 4GZDA 4ZHBA 4HI9A 4WWPA 2NR4A 4CCAA 1TEZA 4GCNA 4GCOA 3Q5EA 4YLHA 4LFAT 2OVBA 2WMOA 3CGHA 4UQZA 2XHEB 2V6YA 3LJCA 3PNTB 1WR0A 2J4GA 3GN5B 2HM8A 3KVBA 3GZ1A 2JQ9A 5EYPF 2HO1A 2VB6A 2HPJA 2IJGX 3B95A 2XEEA 3BK9A 4GA0A 3L22A 2MOZA 4AVXA 3SZ7A 2VKJA 3AA0B 1V55E 4JI5T 4DO0A 4UWHA 3ZVVA 5FYMA 1D1CA 3NAWA 5T3RA 4L7TA 3BG0B 3Q15A 2KINB 2ILRA 2UY1A 5JA4D 5G05J 3Q78A 5EDSA 2VGXB 1LKXA 4KMCA 2J49A 5LHHB 3CR3A 2EQXA 2XUEA 5L3BB 3AVRA 1IJ5A 3QNKA 2H7VC 4TUMA 3TXMA 3LVRE 2VVSA 3VTYA 4Q94A 3H37A 4PFOA 2OOEA 3DSTA 4BTBA 1N36T 2L6JA 4KXKB 5LXTE 2XSAA 1H2UA 4OK0A 5L4HA 5FY0A 5JR9B 3CK6A 3CIAA 4X8QA 2X51A 5DQVA 4A5XA 4B3TT 2K3WA 2BG9E 3IEEA 4Y6WA 1YMPA 4F7AA 2H88A 5LGTB 4HEAA 4GYRA 2XM2A 3RIBA 4TV3A 4AY5A 3ZHEA 2WU5A 4DV7T 3ZIMA 3C3OA 3AXJA 2CXDA 2JMKA 1HNXT 3ANWA 3VR9A 1FCHA 3RYFE 2RP4A 1UN9A 4FADA 4J8FA 4AKHA 2XGSA 4COFA 2A72A 4JL0A 2L0TB 4L9IA 2FF4A 3E34A 4RSYA 3HKEE 2XZTG 2LSJA 1SA4A 2EHOD 3T9KA 4O1PA 4B6XA 2QA7A 1D1BA 3ESLA 2LKHA 4KYOB 4CXWA 2VJ8A 4FU3A 4GTQA 2CFUA 4BETA 4RG9A 2QY7A 1E7PA 2K9AA 3VKGA 2XEVA 2DYSE 3RI5A 4HFHA 1LD7A 4XAXB 1IQRA 3FWVA 4I43A 4CGVA 2KXPB 1K3ZD 1X81A 1ZBPA 1U4QA 5LCWJ 2J09A 3LG7A 4CN6A 1MQSA 4JLEA 1YD8G 4DR5T 3B7TA 3PUZF 5EKQD 5IY5E 1S0PA 2Y1LE 4AQFA 3K3QC 2L9QA 4UI9C 3ZXPA 2W0GA 2ZXWE 3QOFA 4CT4A 2PG8A 3JQ1A 2YQ8A 2ETCA 1NZNA 1TNYA 1H2TC 3QC1A 5E0OA 1Z0PA 3N9PA 2WPVA 4ILBA 3RPUA 1WR6A 4DK5A 5EK3A 4I2WA 1MIWA 4OVVA 2YU2A 5ENTD 2VKHA 2PM6A 3DSWA 1ZEEA 1OEDA 2W66A 2DWGA 3ISMC 1N32T 2W2UA 2KWIB 2JIWA 3FUFA 5FIOA 3C4XA 3QB5A 3PUWF 1QBQA 2QGSA 3TLSA 3UUXB 3C64A 2E9XB 1N94A 4I2ZA 5JRCA 1W9RA 3ZXSA 1E1HB 4ZFHA 3V2XA 5AARA 2VQ2A 1V54E 3FXDB 5EYLA 2V6YB 3UT5E 1QLBA 3PDYA 4CZZB 3JUIA 3FFLA 4ZZBA 3R9MA 4DUIA 2V7IA 2P2CP 4TUYE 4E6HA 1TJFA 2A5UA 4PUCA 3SY2A 2BVLA 5AIJA 2KNDA 1HCIA 5AQOB 3CQGB 1TN6A 2P9BA 4HN9A 4PH4B 4YNDA 2UUAT 3QK0A 2WMNA 1H7CA 3RAUA 1JWGA 2LJLA 3SOLA 4NRHB 2V4LA 3MKDA 2NXPA 4IDZA 4GA2A 3EDVA 4MFRA 2WXIA 4K0RA 1FT1A 1Y01A 4CN1A 3GZSA 5JDNA 1YQ4A 4M3OA 3UM0A 4GKKT 1L5JA 4IDOA 4Z68A 3SFDA 2GRLA 4GU5A 4A1SA 4C0EA 5AQTB 1XGWA 3RK6A 5A23A 4PJMA 4G11A 2I59A 2BEDA 4N3AA 2XY8B 3J5PA 3L09A 4K03A 1LVFA 1OT8A 4PW8A 3UU3A 2DCPA 4DI4A 3ZFWA 4BSXA 4NXMT 3C72A 2YKSA 3HR0A 2WXOA 5KWDA 4PDXA 3G2VA 5EK4A 1MX4A 2WM9A 2R59A 5KCMA 2DI4A 1O5MA 5FINA 1YCSB 5KDMC 4IGUA 3DSUA 1IKND 3CVQA 4JI2T 4AIFA 3NBNB 4HFVA 3P4QA 1WM5A 2OA5A 4B3RT 5JR9A 1XDOA 4TXPA 5D0QD 4O8SA 2LRLA 1TN8A 2M67A 1UX4A 3MYVA 3B5MA 2V7LA 1IHGA 1IBLT 2XQ5A 5CFBA 4P29A 2DCFA 1OCRE 4U0ZA 2VTBA 4B94A 4AQYT 3ZJ1A 3N5LA 4AI6A 3FUEA 1WAO1 3CVNA 2BS4A 5ENPD 4JBWF 2CHNA 4HOUA 1U5PA 3CVPA 3K9IA 2XRYA 3ZN1B 2XSBA 1BR0A 5FMNA 1WYCA 2WB2A 1CHUA 2IC6A 4JI3T 4H9PC 3TGOA 3PUJA 5CA1E 3SWHA 4HTEA 1NA0A 1BR2A 2AXDS 3L16A 3B7UX 3AE8A 4NUUA 2KCKA 3UUNA 4JEHB 3FHEA 2XPYA 4UWLA 4PK6A 2LUHA 1TYQG 3U78A 3ZYQA 1O1RA 4MLPA 3CEQA 3F31A 4G8LA 4JD2G 4APFA 3W9GA 4HOSA 3UM1A 1MNEA 1DU2A 3O48A 4DIDB 4WZXA 1SVXA 4IL4A 2H6HA 3PTRB 2L0IA 1SZAA 4U31A 4N2SA 3HA4A 3CVWA 4YTPA 3KV4A 1HNWT 2BG9B 2W00A 5FXVA 3KEZA 3RRUA 1UW4B 4AV7A 4JW1A 2CMRA 3AEFA 4I0UA 5LOVE 5LCWC 1NP7A 2L8KA 3CVVA 3S7DA 4AM9A 4CDRA 4KMOA 4YSYA 3AE4A 4ANJA 3N9NA 3NRYA 1HO8A 1UN8A 4JZYA 2KCVA 5DABA 5JDGA 1MMDA 2OV9A 3L6AA 3DBSA 3AE9A 3HL6A 3E08A 2JQQA 2XASB 1KNRA 1LD8A 2OLTA 1MJ0A 2V7MA 4U8YD 2ZGDA 4U7IA 5L47A 4OAUC 2BUGA 4QX7B 1EDUA 4Y6CA 3OTOT 5CEDB 3SFYA 1WDYA 3R7RA 4IE4A 4FP7A 2UXDT 2DBAA 3UQ3A 3ZUVB 2IEJA 4HOQA 4C48B 3P4PA 4G26A 3NOCD 3PJAA 3KV5A 2CHOA 3T1HT 3FU6A 4DV1T 2QFCA 4HFGA 5LOZA 1D0YA 1YYHA 4NUVA 4TUUA 5ENSD 3K3OA 3VLEA 5G2NA 3DRAA 2A4ZA 4TN7B 4CXYA 2XCCA 3CHOA 2P9KG 2VSOE 3ZMTB 1MHQA 3M65A 1LVKA 5C2YA 2KSRA 4EEDA 3ZW3A 4YVQC 2V26A 3PDNA 2AW6A 3EDTB 2VQET 2AJAA 4U2ZA 1BD8A 2XAQB 3CKBA 3E30A 2K24A 2BG9A 2PTFA 3PREA 1E90A 2QZAA 3HIZA 2XZEA 4U33A 1J5ET 2L3LA 1D8EA 2VURA 3CK8A 1ZHCA 4NACA 3KDSE 3AEBA 3JC6D 1N9AA 3MZLB 3CKCA 3T8KA 2YDSA 1KNPA 1U2VG 5AQHB 3WAKA 3DEOA 5HEJA 3E33A 4EPZA 4CDMA 3JADA 3AAEB 1NAFA 4ZI7E 2VK9A 3JYSA 2EINE 4QXHB 5LG3A 5CBOA 2AE9A 4ZOLE 3ZGQA 2MYOA 2X6IA 5LG4A 4RLYA 5ABGA 2NC9A 4FLBA 1KFYA 4I9CA 3PE4A 1SQMA 1T98A 3UFEA 2YEVC 3PU3A 4YTMA 3AS4A 3Q9NC 4UUCA 4H63H 5IWAT 1IXVA 1HNZT 1ZKEA 5KMGP 2J9QA 3V31A 1OWLA 2EHOC 1X79A 3UFGA 1O1TA 2K48A 4P1NA 4AOFA 3ZC0A 4X64T 3KSLA 1TNZA 4JHJA 3RJVA 4YTNA 1KNZA 3VKHA 1K1AA 1KT0A 4DX7D 1WY6A 1UK5A 2X0LB 1E2AA 4EV6A 2GRQB 2WXPA 4HGAA 4CT0A 3ZMUB 5A6CA 2V0PA 3U64A 1QQEA 3OPCA 4G8KA 3VU7H 5J08A 5DIZA 2V6XA 4UWFA 3J5QB 5F5WA 4DV3T 4ILCA 4FHJA 2WBLA 2MAWA 5JQGE 3CX6B 1VOMA 4AKGA 1W09A 1KLXA 2PJQA 3GW4A 5KJNA 3HHMA 3EABA 4HXIA 4EYUA 1N4PA 2E8IA 2CE7A 1ELWA 2RA1A 5ADXL 3AA7B 2R05A 3IKOB 4A3VA 5KX5E 1LTXA 2J1DG 4HWHA 3CSFA 2LHNA 3NOGD 1EYHA 3S7JA 1OWAA 4A3TA 3PS6A 2Y48B 1OXZA 3U66A 1R8IA 2WWUA 4CI3B 3FDHA 2P9SG 4HFBA 3Q2MA 3NB2A 2XAGB 5BNWA 5HXEA 3DEPA 1HFAA 3MK7C 1XMQT 5CCLA 5LBQB 3MGBA 4LSZE 1MX2A 3EHRA 3CHQA 3MKRA 3ZSTA 2WXNA 4WNGA 5FNVE 4J8DA 3H3AA 3OTNA 5LA6E 1RZ4A 2WQYA 3MCXA 3MKQA 5BT1A 3FTYA 3EUHA 3EDUA 2ZM6T 1S63A 3RYHE 4EEBA 4AISA 4HE8A 3RIFA 3PE0A 4J7WA 5G04J 4G2AA 5ABFA 3GN5A 1VDYA 4DV6T 2JMHA 1WLXA 4GK0E 4TZ4C 5HYAA 2I1JA 3G2SA 1TJCA 5EIDA 1TR4A 4M7CA 1XNFA 5LP0A 5BPPA 5FXZA 4J2CA 3OVUA 2XENA 3ABLE 3T8MA 3RX6A 2VSXE 4QXCB 3CK7A 3ONLA 2WZHA 1Z5SC 3LDZA 4KX6A 3TWUA 2Q9QB 4AXPA 1IBMT 4LFCT 3SD5A 2LHRA 3RU0A 5FL1A 2C0LA 2IOLA 5FQ4A 5FZSA 4F53A 3O1IA 4N3BA 4UXNB 1ELRA 5BUZA 5LJMA 1OXJA 4F1SA 2VGXA 2HH7A 2CXFA 3EVYA 2V4HC 4LMJA 5ENOD 1N52A 4MALA 4AEZC 4FJZA 4YSZA 3ZCIA 3U3IA 2VYIA 2H89A 3I4RB 2LO6A 3MZKB 2XQ8A 5D2MC 4AQFC 2Y3AA 2LOSA 3UQ4A 2V8SV 5AQMB 2E2EA 2RPAA 3C4ZA 3G2WA 3FP3A 5ABEA 2YDQA 1AWCB 4DX2A 4WWNA 4ISTA 4ASKA 4ZI2D 3MKQB 5JH7E 3I0OA 3V79K 4UIGA 1HU3A 3LS8A 4EHMA 4ZZCA 3RYIE 1N4SA 3NZSA 3DXMG 3D9IA 2WCAA 2NYJA 1B7TA 5B1AE 4CGWA 2BKPA 2XHEA 4HBDA 3CVXA 4LFBT 4KZ0A 3UPVA 1QUUA 1D9SA 3AEGA 1KEYA 2ZIRA 3CK9A 1ELKA 2BS2A 2BBHA 2H3RA 2EIJE 2CEAA 2EIME 4BA9A 2BG9C 3K1SA 3TJPA 3LK42 3BQLA 3EHMA 4H7YA 5B3SE 4ANUA 3ZKRA 5C1DA 1G3NB 4N78D 4N5QA 4E7SA 2R17C 3AS8A 3BUAA 4QQIA 5FZRA 4GMLA 3HKDE 3FH8A 3JQ0A 2ZM2A 4I6JA 5B1BE 4PJNA 5FY7A 5JTGA 2ETBA 3UU4A 4PS7A 3UT8A 2VGEA 3G06A 1UG3A 4QX8B 3PUKA 2FBWA 1KPSB 3T1YT 2KZTB 5CJ5A 4LUNU 3RQWA 3D9JA 5LJNA 3Q4AB 4LF5T 5LCYA 3OXGA 2XQ0A 3UUMA 4FLHA 1JUQA 3AG4E 4LF9T 2J47A 4XZ4A 2R2LA 5CGMA 3NZQA 3H3MA 3PJAJ 3RIUC 2OV8A 4WNDA 5BW8C 3CLJA 3R84B 3OYZA 3AA1B 2IF4A 4ILAA 4Z8XA 4CYMD 4MLKA 5FT9A 3RC8A 3ULQA 3DSSA 4D10C 4GZ5A 2WQ7A 4XZCA 3P7IA 4GTOA 1MYOA 2PL2A 3TWQA 2DZNA 1GQEA 4X66T 4BX9A 4DMWA 4Q25A 1N33T 2ES0A 4QXBB 3TLVA 2QC9A 1I6ZA 2XQ6A 3P8CD 4TWDA 3SS1A 3DJBA 4R7LA 1T7SA 3SFEA 3IHVA 2WDRA 5HCJA 4IT4A 2LLYA 5DJQC 4UI9J 1IAPA 2V5QC 3SNXA 2WP9A 1SA0E 3N9QA 2F8YA 3Q5WA 2E5LT 3KEAA 2V5CA 3KAEA 3ZHEB 5BXOA 4YDEA 4UVCB 4ANXA 4A55A 2FI7A 3T8OA 2LSGA 1N4RA 2X6KA 1UGOA 2Z6EA 2IO2C 4BEPA 4QH4A 1K8KG 2XQ3A 4U63A 2VVNA 1AJ3A 2V5FA 3IA3A 3LFMA 4DX5D 4OAVB 1DVPA 4JEUA 1DCEA 3CV0A 4B0ZA 3I4GA 4JI0T 4TV8E 5JVDE 4DR3T 2WZIA 2IDOB 5L2LA 5CRUA 3JCKC 4WUYA 2X9HA 3FHNA 5LMUT 3ONLC 2WXHA 2JRKA 2X38A 5LBMA 2IHR1 3ZN3A 3RH3A 4JI7T 2R6GF 1JCSA 4U04A 2VKDA 3AB3B 3UINC 3S4UA 3F2EA 2AXUA 2PQRA 1A5EA 2KWHA 3LK2B 2X6HA 3PRZA 4ZI2C 2K5BB 4UV8B 1FIOA 4JHRA 3TWSA 5J2UE 3KINB 3TWXA 3PZDA 1MMNA 1INZA 3LVQE 3CVLA 2CM0A 2D2SA 2DHRA 1N34T 4HRLA 4YDWA 5ITZF 4DV4T 4O2AE 3PH0C 3SI5A 4ADZA 5AQQB 3HI2A 1UURA 3AE2A 2UY1B 5AQBA 4YXDA 2XTLA 3LY8A 4DX6D 2CWOA 4ACKA 2X9XA 3FU0A 1GW6A 3PUSA 1E8WA 1DNPA 2F37A 5CB4E 4EQFA 2CBJA 1OEDB 4U8HA 1PC2A 2BVMA 4EZ4A 5JMND 3C98A 2VWAA 4HB5A 1H6OA 2X9YA 5C3JA 3UUBA 4LERA 3F57A 5KNGA 2UXXB 5JREA 4AP2A 3DPYA 3QWWA 3IHYA 2JLBA 1MX6A 3IF8B 3HKCE 3OAWA 3J9X1 1FPPA 4CQIA 2YU1A 3RKOA 1E8ZA 3W15B 4FHKA 4ZI3C 5LGUB 4BERA 3ASFA 1XWMA 2LXMA 2A3DA 5FVLA 4HI8A 3PUYF 5IHYA 4N2QA 2IQCA 3AVSA 4H9OC 3PUVF 3FB2A 1OY3D 1H19A 2C5JA 1N4QA 4QFVA 4EZKA 5KXJA 5AENA 2RFAA 5HXRA 3HDXA 4YSXA 2X66A 4JI8T 3L3PA 2WS3A 4F1PA 3LY7A 5CA0E 4C0MA 5AN8A 4EB6E 3ETVA 2LT3A 2XAFB 5ENRD 2JABA 3QWPA 5JDQA 4F8HA 4EGWA 2H7OA 5KNHD 3KV9A 4DUYT 3VLFA 3ULEG 4KZCA 2RG8A 2Y69E 4K5AB 4Q69A 3QNUA 3EHZA 3ZMSB 3RSEG 2LSIA 4GOUA 4Z90A 1BR1A 3C5RA 2WAUA 3AAIA 2DLRA 3B7BA 3DXKG 3N71A 2XQ7A 4DUZT 1HS7A 4ANVA 3P4SA 5JJ6A 4GTRA 3A5XA 4TXQA 2HHHT 4IDQA 3PZ3A 3KD7A 5ARFA 2FJDA 2FJAA 3JXJA 2WY2A 1OCZE 4A1GA 1MMGA 5CRVA 3OYXA 3UULA 3RGLA 4I6GA 3DSXA 4JI1T 2GK9A 3UIPC 5DQWA 4Q96A 3CHRA 3TWTA 5FQ7A 4UVAB 5JRCB 3FZFB 1ZU2A 3UMVA 2DYRE 4IIJE 3PEVB 4JVSA 2LRKA 5FXWA 3CX7B 4XEIG 3RRNB 3UM3A 3TAXA 2BKNA 5L3CB 4MRUA 2DVWA 3JAEA 2W63A 4O2BE 3FU3A 5AYWD 1VRBA 4IDPA 1I94T 1ZOYA
chains in the Genus database with same CATH topology
1KT1A 3O9XA 3ZJ2A 4EZJA 3IHRA 5EX3A 2IC9A 2JPFA 3FUHA 1FMVA 2PFVA 5FJYA 3MXZA 4H9RC 3FY4A 1KK7A 3QB2A 4XBFB 2V7KA 5AJDA 2W61A 1Y8MA 4GZ6A 3ZYLA 2BF0X 3C51A 2WXLA 4N3CA 3HVEB 3JC6C 4I43B 5JHBA 2GGFA 2NW9A 3HKBE 4BAYB 5ANLA 5G04C 3RKVA 4AKIA 4G63A 4RVBA 2EHOA 4N5CA 4A56A 4BJNA 2ODUA 3R9AB 3L13A 3QOUA 3ZPOA 3CPZA 3SGHA 3NZUA 1SZ9A 3FU5A 5HWYA 5HAXA 4J0UA 1OWMA 4ILHB 2E0IA 3TG5A 4TRQA 2WXKA 2YK0A 3DTOA 5ARGA 5LFAA 4QWNB 3Q47B 5F3JA 2C5IT 1E8YA 3FEYA 3ETUA 4IN3B 4RG6A 3ZPJA 4ME2A 4N39A 2CHZA 2A2FX 5ETWA 4JA9A 1WYBA 2CLYB 2NTYA 2C0MA 2D0UA 2W62A 2CLYC 2LSUA 3ZN0B 1G8XA 4DBQA 3MX3A 4X1KE 5FY1A 3APCA 4I1OB 3PU8A 2OVFA 5AFUL 2IONA 2KT9A 4FJYA 3PE3A 2ZM0A 3FTXA 5JDMA 3D9OA 4YFSA 5BV0A 2ZLYA 3CKDA 2CG3A 4G2VA 2X6JA 3BQKA 3EIJA 3L17A 3QAQA 3P2BA 4OVUA 3TKLB 3D9MA 4GYSA 1OWNA 1H2VC 3S7FA 3MACA 4V1Av 4ZHQE 3B7RL 1HF8A 3ZMZB 3ZYKA 1Y6IA 4ZS2A 3LBXA 5C8YE 2YHEA 4FI5A 4U0SA 4C91A 4UF0A 4X1YE 3PNLB 4OHFA 4QHOA 4ANWA 1UJKA 2VASA 2L9BA 2DIWA 4XKBA 3CVUA 3PUGA 1W3BA 2IW5B 3IV0A 3APDA 3AU5A 3MV2B 5FP3A 2XPIA 3Q5MA 4YJ3E 2P58C 3CX8B 3PURA 2VSYA 4F6RC 5LHGB 4KP3C 2XAJB 4PJLA 2LAHA 4EECA 3IBEA 2HYZA 2NW7A 3RC3A 5L3EB 4UEMA 5JDHA 3E22E 2AXZA 1FEWA 1LRZA 4BWRA 3O1JA 3GWHA 2I2OA 5FWQA 2WVIA 1EF1C 4DLOA 3SBSA 2PM7A 2WXFA 1MNDA 1B89A 3I9WA 3FBZA 2YNQA 4ILUA 1US7B 3FTVA 1UJJA 4ABNA 3R6NA 4ATGA 3RRWA 3LEWA 3PEUB 3P1UA 1HTJF 4UF0B 5JJ7A 1CUNA 2LE8A 2IFUA 4L1BA 3APFA 4I4TE 1Z6TA 1Y64B 1IJ6A 1YKEB 2UWJG 3FULA 3FUNA 4UV9B 4L0RA 3N2OA 2V7JA 3E0ZA 4EAHA 4JPSA 2GRMA 4IYPA 3QWVA 4I17A 1EPUA 3SF4A 3TG4A 3MA9A 1U3DA 3CSTA 1P5QA 4IULA 3LJ3A 1D0XA 3BQIA 1HZ4A 5BV1A 3QDNA 4CI1B 3B57A 5HXHA 3UTKA 4GIWA 4HKAA 5H6RB 3I0QA 4KVMA 4JUYA 3RO3A 5LHIB 1E7UA 2YHCA 3FTZA 4UQXA 2LAIA 3CHSA 2PZIA 4ACLA 5D0OD 3V5UA 2B1EA 2CFZA 3WXXA 4GPKA 4UVBB 2Q9QC 2Q9QD 3U4TA 5M4YA 4ISSA 5L3DB 3VHLA 4KBMB 5CCMA 3NF1A 1OWPA 4H9QC 3UT4A 2J4DA 4PAGA 3KBTA 3EHNA 3V5SA 4H7XA 4IRUA 3LYAA 3CVYA 5G55A 4XI9A 4MHCA 2KLQA 5ENNA 3MV3B 4X1IE 4TX5A 4DNDA 4OYJA 4IHJE 5DBKA 2CG2A 3O1HA 4AQGA 5A1LA 2Q7FA 2MBGA 5ANRA 4U07A 4APOA 2LSVA 2NOXA 3ANWB 4E7ZA 2VSNA 4X20E 4JXTA 4P0AA 1HE8A 2I9CA 4HLEA 3N2KE 4M1PA 3ZMVB 4PJJA 2XQYA 4ILIA 4P09A 4OYKA 3DPDA 5G05C 4EBAG 3C4WA 4F3VA 5BMVE 4ILGA 2IOSA 5LP6E 3PUAA 3KVAA 4U74A 1E8XA 4I1MA 3MJWA 5EX0A 5HI7A 3EJNA 3ASDA 2MHKA 3UT7A 5L3GB 4G24A 1HX8A 4H63V 3J7Yq 2NSZA 3L54A 3Q49B 2XAHB 4DVDA 4GB9A 2XRZA 1FVFA 3LK3B 4L2YA 4LEUA 4H9SE 3FUKA 1ZV4X 4L23A 2J4BA 2Y6XA 2KM4A 4FC8A 4CEMA 3DP7A 4YHJA 4QKNA 2N9DA 4JA7A 4DBRA 1HS6A 4YVOA 3QC9A 1E96B 3C98B 4EZLA 4U0UA 3C50A 4WW0A 3ZRHA 2J07A 2X68A 2VKOA 3FH7A 4J8EA 3NBXX 4B89A 4C90A 2E9XA 4HVBA 4J8SA 2XCBA 5EK2A 3KFWX 3K8PC 2WXGA 2N1GA 5LX8A 3MEKA 3ESKA 2AVPA 3S2AA 4DJAA 2Y4TA 1HG5A 2E9XC 2JJ9A 4P0BA 3L08A 2CCQA 1JPLA 2C2LA 3ZYMA 1FVHA 5J1GA 4H9NC 2KZTA 1Z3XA 3UX4A 5CHEE 1S94A 2GW1A 2CHXA 3QKYA 2MRIA 3LXUX 3FTSA 3CQXC 5E76A 1IQUA 1IYGA 4FJOA 2G0UA 4EBAA 3Q9DA 3ENEA 2ACXA 4ZS3A 2XGMA 3BG1B 1NWMX 4L2LA 3SRZA 4WNKA 3EIQC 4HORA 1JWFA 2ZM8A 1MMAA 4UWGA 3NQPA 5KJMA 2ZMAA 2RD0A 3WAJA 4YJ2E 3ONKA 3QUJA 2MOWA 4GZ3A 1N54A 4NURA 4XKCA 2BTDA 1D1AA 1BPOA 4XE0A 2BDEA 4CXXA 4XX5A 5LYJE 5FTPA 4IE5A 3D9KA 4MS6A 3G2TA 4EYYR 2KC7A 4DMVA 2PBIA 3ML8A 3GZ2A 2LSYA 4I1AA 1PY1A 1EZ3A 3O4XE 4OFZA 3ZLIA 2LSKA 3IEGA 3I5PA 4WNFA 2SPCA 4I6EA 2KMFA 4XI0A 3U3WA 2NTXA 5GONE 3K3NA 3OXFA 4I9EA 2KATA 3N9MA 3FTWA 4CRWA 4MKTA 1YW0A 3CQCB 4EIWA 2PQNA 4JEHA 2WXQA 3AU4A 3HYMB 3LY9A 3D3MA 1G73A 4EZHA 2NW8A 4JEUB 4GK5E 3FUMA 3CHPA 2IU1A 2V1DB 1O3XA 2V8SE 4KT6B 4G23A 5E75A 4L5GA 3GMIA 3URZA 3KBUA 2EHOB 1A17A 2AXVA 3ZCJA 1FMWA 5T4YA 2C5KT 2MYSA 2N2NA 4WWOA 2R5SA 4GMJA 1PAQA 5JHAA 2I1KA 2NWBA 4BT9A 1Z3YA 4GYWA 1SHZC 4I55E 2X3MA 2FO7A 4HOTA 3I1AA 4BFRA 4MBQA 2YINA 5HXCA 4GYOA 2KCLA 5HWXA 2Y4UA 2LNIA 3Q5XA 5JDLA 3ZEFA 2BZBA 4PNIA 4KVOA 4BJMA 4AY6A 1QZ2A 2JEKA 1HXIA 3QK6A 3AA6B 3CMLA 5FXXA 1OWOA 4PK4A 1UX5A 5JJTA 3VTXA 4C9BB 4B8CB 2FEZA 3T5VA 2WQHA 4PS3A 2C0SA 4GZCA 4KBQA 4UELA 5J90A 3RYCE 4JHKA 2LM9A 4LRZA 4LCTA 1E7VA 4O4JE 3IBPA 5CMWA 5KJKA 3T5XA 3PUQA 4DLQA 1QNFA 3RRMB 3OBVE 1YA0A 1S35A 3RO2A 3ML9A 3FBLA 4J6IA 4FULA 4DI3A 5FZQA 2CA5A 4O4IE 4GYYA 3NRXA 3NZPA 2FBNA 3FEXA 3ONXA 2CWYA 3CVRA 3WI3A 3OKQA 4W9RA 3QARA 4PFPA 3LCAA 1LF8A 4JC8A 3FUIA 5EZYE 4GAAA 3LBXB 4O4LE 3FTUA 4AXHA 5LGNB 4K0UA 4GA1A 3O4ZA 5LNKA 4URKA 3BEEA 2LOPA 2ODVA 5FQ6A 4EXTA 4G25A 4CDNA 4B8AA 2X9WA 1H6KA 2X67A 5FQ8A 2E9XD 3FUDA 3AS5A 4HS2A 1WRDA 2D0TA 2KZ7B 5TAOA 4WAFA 5HQ8A 3AAAB 4U72A 2WXRA 3ZC1A 3G2UA 3I3NA 3FUJA 4XIFA 4UQYA 4WNEA 4DPRA 2HR2A 3B7SA 2AWIA 2WQ6A 3TXNA 4WBNE 4ERRA 2J08A 3CWZB 4BTAA 5JDFA 4UI9K 4UWKA 3D0TA 5CMYA 1QSDA 2CHWA 3D9LA 5J2TE 3N2GE 3MJXA 4IE7A 4WBOA 5L3FB 2Y8DA 2ONDA 4V3IA 3MA5A 1BR4A 1H0AA 2CXLA 4FA6A 1U3CA 3HVEA 3B13A 3GYZA 4EOZB 3FH5A 1YKHB 1NA3A 5KJLA 4OYSA 3RRCA 2VGYA 4CI2B 4BY6A 3E4BA 4AKLA 3SFZA 3LKUA 5IYZE 1MIVA 2ZU6B 1IZNB 3KS2A 3VLDA 2D5UA 4I50E 3ASHA 2DNXA 3N9LA 4E85A 2XGOA 3GA8A 5M72A 4ZI3D 3PVLA 2Q9QA 1V9DA 2X6FA 2UXNB 4G1TA 2VL8A 3I9YA 2WXMA 3D9PA 4IE6A 5T8IA 5H6QB 3KV6A 1MIYA 4TV9E 4BT8A 3N9OA 5HXSA 3OXLA 1X5BA 1HH8A 5AJLA 2XPZA 2I6HA 4O4HE 3SHFA 4KUMB 4PK5A 3SBTB 5JR9C 3S7BA 3LPZA 3TL5A 4O6FA 2MTQA 3D9NA 3QJZA 2NP9A 4IE0A 5F8PA 3UUXA 2LEHA 2WSSV 2M63A 2WXJA 3CHMA 3OJAA 3ASGA 3U9WA 1D0ZA 4AKRB 2FULA 1UCUA 3R7QA 3ZEFB 2IAKA 3FXEB 2DWKA 2HPLA 4NQ0A 2VTBB 1OUVA 5A7DB 4AJWA 1HG2A 4BX8A 4PS8A 4GZDA 4WWPA 4CCAA 1TEZA 4GCNA 4GCOA 4YLHA 3CGHA 2OVBA 4UQZA 2WMOA 2XHEB 3LJCA 3PNTB 3GN5B 2HM8A 3KVBA 3GZ1A 2HO1A 2VB6A 2HPJA 2IJGX 3BK9A 4GA0A 3L22A 2MOZA 4AVXA 3SZ7A 2VKJA 3AA0B 4DO0A 4UWHA 3ZVVA 5FYMA 1D1CA 5T3RA 4L7TA 3BG0B 3Q15A 2KINB 2ILRA 2UY1A 5G05J 5EDSA 2VGXB 1LKXA 4KMCA 2J49A 5LHHB 3CR3A 2EQXA 2XUEA 5L3BB 3AVRA 1IJ5A 3QNKA 2H7VC 3TXMA 3LVRE 3VTYA 4Q94A 3H37A 4PFOA 2OOEA 4BTBA 2L6JA 4KXKB 5LXTE 1H2UA 4OK0A 5FY0A 5JR9B 3CIAA 2X51A 5DQVA 3IEEA 4Y6WA 4F7AA 5LGTB 4HEAA 4GYRA 3RIBA 4TV3A 4AY5A 3ZHEA 3ZIMA 2CXDA 2JMKA 3ANWA 1FCHA 3RYFE 2RP4A 1UN9A 4FADA 4J8FA 4AKHA 2XGSA 2A72A 4JL0A 2L0TB 4L9IA 2FF4A 4RSYA 3HKEE 2LSJA 2EHOD 4B6XA 2QA7A 1D1BA 3ESLA 4KYOB 4CXWA 2VJ8A 4FU3A 2CFUA 4RG9A 2QY7A 2K9AA 3VKGA 2XEVA 4I43A 4XAXB 1IQRA 3FWVA 4CGVA 2KXPB 1ZBPA 1U4QA 5LCWJ 2J09A 3LG7A 1MQSA 4JLEA 1YD8G 3B7TA 5EKQD 1S0PA 4AQFA 3K3QC 2L9QA 4UI9C 2W0GA 4CT4A 2PG8A 3JQ1A 2YQ8A 1NZNA 3QC1A 1H2TC 5E0OA 1Z0PA 3N9PA 2WPVA 3RPUA 1WR6A 4DK5A 5EK3A 4I2WA 1MIWA 4OVVA 2YU2A 2VKHA 2PM6A 1ZEEA 2DWGA 2KWIB 3FUFA 3C4XA 2QGSA 3UUXB 3C64A 2E9XB 4I2ZA 5JRCA 3ZXSA 1E1HB 2VQ2A 3FXDB 3UT5E 4CZZB 3PDYA 3JUIA 3FFLA 2V7IA 4TUYE 4E6HA 1TJFA 2A5UA 4PUCA 2BVLA 5AIJA 2KNDA 1HCIA 3CQGB 2P9BA 4HN9A 4PH4B 4YNDA 3QK0A 2WMNA 1H7CA 1JWGA 2LJLA 3SOLA 4NRHB 2V4LA 3MKDA 2NXPA 4IDZA 4GA2A 3EDVA 4MFRA 2WXIA 4K0RA 3GZSA 5JDNA 4M3OA 1L5JA 2GRLA 4GU5A 4A1SA 4C0EA 1XGWA 3RK6A 5A23A 4PJMA 4G11A 2I59A 4N3AA 3L09A 4K03A 1LVFA 4PW8A 2DCPA 4DI4A 3ZFWA 4BSXA 3HR0A 2WXOA 4PDXA 3G2VA 5EK4A 2WM9A 2R59A 5KCMA 2DI4A 5KDMC 4IGUA 3CVQA 4AIFA 4HFVA 1WM5A 2OA5A 5JR9A 5D0QD 4O8SA 2M67A 1UX4A 3MYVA 2V7LA 1IHGA 4P29A 2DCFA 4U0ZA 2VTBA 4B94A 3ZJ1A 3N5LA 4AI6A 3FUEA 1WAO1 3CVNA 4HOUA 1U5PA 3CVPA 3K9IA 2XRYA 3ZN1B 5FMNA 1BR0A 1WYCA 2WB2A 2IC6A 4H9PC 3TGOA 3PUJA 5CA1E 3SWHA 4HTEA 1NA0A 1BR2A 3L16A 3B7UX 4NUUA 2KCKA 3UUNA 4JEHB 3FHEA 2XPYA 4UWLA 4PK6A 3U78A 3ZYQA 4MLPA 3CEQA 3F31A 4APFA 4HOSA 1MNEA 3O48A 3PTRB 2L0IA 1SZAA 4N2SA 3HA4A 3CVWA 3KV4A 5FXVA 2W00A 3KEZA 3RRUA 1UW4B 4AV7A 4JW1A 2CMRA 5LOVE 5LCWC 1NP7A 2L8KA 3CVVA 3S7DA 4AM9A 4CDRA 4KMOA 4ANJA 3N9NA 3NRYA 1HO8A 1UN8A 4JZYA 2KCVA 5DABA 5JDGA 1MMDA 3L6AA 3DBSA 3HL6A 3E08A 2JQQA 2XASB 2V7MA 2BUGA 4QX7B 1EDUA 4Y6CA 3R7RA 4IE4A 4FP7A 2DBAA 3UQ3A 4HOQA 4G26A 3KV5A 3FU6A 2QFCA 4HFGA 5LOZA 1D0YA 4TUUA 4NUVA 3K3OA 3VLEA 5G2NA 2A4ZA 4TN7B 4CXYA 2XCCA 3CHOA 2VSOE 3ZMTB 1MHQA 3M65A 1LVKA 5C2YA 3ZW3A 4YVQC 2V26A 3PDNA 2AW6A 3EDTB 2XAQB 3CKBA 2K24A 3PREA 1E90A 3HIZA 2L3LA 3CK8A 1ZHCA 4NACA 3KDSE 3JC6D 3MZLB 3CKCA 3WAKA 4EPZA 4CDMA 3AAEB 1NAFA 4ZI7E 2VK9A 3JYSA 4QXHB 4ZOLE 3ZGQA 2X6IA 5LG4A 2NC9A 4FLBA 4I9CA 3PE4A 1SQMA 1T98A 3UFEA 2YEVC 3PU3A 3AS4A 4H63H 1ZKEA 5KMGP 2J9QA 1OWLA 2EHOC 1X79A 2K48A 4AOFA 3ZC0A 3RJVA 4JHJA 1KNZA 3VKHA 1KT0A 1WY6A 2X0LB 2WXPA 4HGAA 4CT0A 3ZMUB 5A6CA 2V0PA 3U64A 1QQEA 3VU7H 5J08A 5DIZA 4UWFA 4FHJA 2WBLA 5JQGE 3CX6B 1VOMA 4AKGA 1KLXA 2PJQA 3GW4A 5KJNA 3HHMA 4HXIA 4EYUA 2E8IA 2CE7A 1ELWA 2RA1A 5ADXL 3AA7B 3IKOB 4A3VA 5KX5E 2J1DG 3CSFA 2LHNA 1EYHA 3S7JA 1OWAA 4A3TA 3PS6A 2Y48B 1OXZA 3U66A 2WWUA 4CI3B 3FDHA 3Q2MA 2XAGB 5BNWA 5HXEA 1HFAA 3MK7C 5CCLA 5LBQB 3MGBA 3CHQA 3MKRA 2WXNA 4WNGA 5FNVE 4J8DA 3H3AA 3OTNA 5LA6E 3MCXA 5BT1A 3MKQA 3FTYA 3EUHA 3EDUA 3RYHE 4HE8A 3PE0A 5G04J 4G2AA 3GN5A 1VDYA 2JMHA 1WLXA 4GK0E 4TZ4C 5HYAA 2I1JA 3G2SA 1TJCA 1XNFA 5LP0A 5BPPA 5FXZA 4J2CA 3T8MA 3RX6A 2VSXE 4QXCB 3CK7A 3ONLA 3LDZA 2Q9QB 4AXPA 3SD5A 2LHRA 3RU0A 2C0LA 2IOLA 5FQ4A 5FZSA 4F53A 3O1IA 4N3BA 4UXNB 1ELRA 5BUZA 5LJMA 4F1SA 2VGXA 2HH7A 2CXFA 3EVYA 1N52A 4MALA 4AEZC 4FJZA 3ZCIA 3U3IA 2VYIA 3I4RB 2LO6A 3MZKB 4AQFC 2Y3AA 2LOSA 2E2EA 3C4ZA 3G2WA 3FP3A 4WWNA 4ISTA 4ASKA 4ZI2D 3MKQB 5JH7E 3I0OA 4UIGA 1HU3A 3LS8A 3RYIE 3NZSA 3D9IA 1B7TA 4CGWA 2XHEA 3CVXA 4KZ0A 3UPVA 1QUUA 3CK9A 1ELKA 2H3RA 2CEAA 4BA9A 3TJPA 3LK42 3BQLA 3EHMA 4H7YA 4ANUA 5C1DA 4N78D 4E7SA 2R17C 3AS8A 5FZRA 4GMLA 3HKDE 3FH8A 3JQ0A 2ZM2A 4I6JA 4PJNA 5FY7A 4PS7A 3UT8A 1UG3A 4QX8B 3PUKA 2KZTB 4LUNU 3D9JA 5LJNA 3Q4AB 5LCYA 3OXGA 2XQ0A 3UUMA 4FLHA 1JUQA 4XZ4A 3NZQA 2OV8A 4WNDA 5BW8C 3CLJA 3R84B 3OYZA 3AA1B 2IF4A 4Z8XA 4MLKA 5FT9A 3RC8A 3ULQA 4D10C 2WQ7A 4GZ5A 4XZCA 3P7IA 2PL2A 4BX9A 4DMWA 2ES0A 4QXBB 3P8CD 4R7LA 3SS1A 3DJBA 3IHVA 5DJQC 4UI9J 1IAPA 3SNXA 1SA0E 3N9QA 3Q5WA 3ZHEB 3KAEA 4UVCB 4ANXA 4A55A 2FI7A 3T8OA 2LSGA 2X6KA 2Z6EA 4U63A 1AJ3A 2V5FA 3LFMA 1DVPA 4JEUA 3CV0A 4B0ZA 3I4GA 4TV8E 5JVDE 5L2LA 3JCKC 4WUYA 2X9HA 3FHNA 2WXHA 2JRKA 2X38A 5LBMA 3ZN3A 3RH3A 4U04A 2VKDA 3AB3B 3S4UA 3F2EA 2AXUA 2PQRA 2KWHA 3LK2B 2X6HA 3PRZA 4ZI2C 2K5BB 4UV8B 1FIOA 4JHRA 5J2UE 3KINB 3PZDA 1MMNA 1INZA 3LVQE 3CVLA 2CM0A 2D2SA 2DHRA 4O2AE 3PH0C 3SI5A 4ADZA 3HI2A 2UY1B 2XTLA 3LY8A 2CWOA 4ACKA 2X9XA 3FU0A 1GW6A 3PUSA 1E8WA 1DNPA 5CB4E 4EQFA 4U8HA 1PC2A 2BVMA 4EZ4A 3C98A 2VWAA 2X9YA 4LERA 3F57A 2UXXB 5JREA 4AP2A 3QWWA 3IHYA 2JLBA 3IF8B 3HKCE 3OAWA 3J9X1 4CQIA 2YU1A 3RKOA 1E8ZA 3W15B 4FHKA 4ZI3C 5LGUB 3ASFA 2A3DA 5IHYA 4N2QA 2IQCA 3AVSA 4H9OC 3FB2A 1H19A 2C5JA 4QFVA 4EZKA 5AENA 5HXRA 3HDXA 2X66A 3L3PA 3LY7A 5CA0E 4C0MA 4EB6E 3ETVA 2LT3A 2XAFB 3QWPA 5JDQA 2H7OA 3KV9A 3VLFA 4KZCA 2RG8A 4Q69A 3ZMSB 2LSIA 4GOUA 1BR1A 2WAUA 3AAIA 2DLRA 3N71A 1HS7A 4ANVA 5JJ6A 3A5XA 3KD7A 5ARFA 4A1GA 1MMGA 3OYXA 3UULA 4I6GA 2GK9A 5DQWA 4Q96A 3CHRA 5FQ7A 4UVAB 5JRCB 1ZU2A 3UMVA 4IIJE 3PEVB 4JVSA 5FXWA 3CX7B 3RRNB 3TAXA 5L3CB 4MRUA 2W63A 4O2BE 3FU3A 5AYWD 1VRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LP0 A;  1EDU A;  1EYH A;  1SZ9 A;  2DIW A;  2KM4 A;  3G2T A;  3ONK A;  4GZC A;  1XGW A;  5J08 A;  1MHQ A;  2MOW A;  5CMY A;  1UJJ A;  3ZYQ A;  3ONL A;  2LO6 A;  3CLJ A;  3LDZ A;  1DVP A;  1LF8 A;  5CMW A;  3D9N A;  4JXT A;  1JWG A;  3D9L A;  3D9M A;  1HX8 A;  4Q94 A;  4AVX A;  1HG5 A;  4FU3 A;  1PY1 A;  3G2U A;  3D9I A;  1HG2 A;  2QY7 A;  2DCP A;  2L0I A;  4GZD A;  1HFA A;  1SZA A;  1X5B A;  3G2W A;  4NAC A;  1HF8 A;  4HFG A;  1VDY A;  5LOZ A;  1JPL A;  1JWF A;  3ZYK A;  4FLB A;  1INZ A;  3D9O A;  3D9J A;  1ELK A;  2V8S E;  3ZYL A;  2BF0 X;  3RRU A;  3ZYM A;  3G2V A;  3D9P A;  3G2S A;  2L0T B;  1H0A A;  3D9K A;  4Q96 A;  1JUQ A;  1UJK A; 
#chains in the Genus database with same CATH topology
 4LF7 T;  4DR2 T;  1KT1 A;  3Q7A A;  4X5T A;  3O9X A;  3ZJ2 A;  2IO3 C;  4EZJ A;  3IHR A;  2IUB A;  5EX3 A;  2IC9 A;  2JPF A;  3ABM E;  3FUH A;  3C3Q A;  1FMV A;  3TLU A;  2PFV A;  5EN5 D;  5LB7 B;  3MXZ A;  4LG6 A;  4H9R C;  5FJY A;  3FY4 A;  1KK7 A;  3QB2 A;  4XBF B;  2V7K A;  5AJD A;  4CZ2 D;  1N0Q A;  2W61 A;  1Y8M A;  4GZ6 A;  3ZYL A;  2BF0 X;  3C51 A;  2WXL A;  4N3C A;  3X1D A;  3HVE B;  2WB5 A;  5HS0 A;  3JC6 C;  4I43 B;  3ZT5 A;  2CBI A;  5JHB A;  5AQF B;  4K5C A;  2GGF A;  2NW9 A;  3HKB E;  5AQU B;  2QVA A;  4BAY B;  5ANL A;  5G04 C;  3RKV A;  4AKI A;  4G63 A;  1D8D A;  4RVB A;  3PV0 F;  2B0O E;  4NIK A;  2EHO A;  1DCQ A;  4UR9 A;  4N5C A;  4A56 A;  4BJN A;  4U95 D;  2ODU A;  3R9A B;  3L13 A;  4IDN A;  4NPP A;  2OEW A;  3QOU A;  3ZPO A;  2DWZ A;  3CPZ A;  5LMN T;  4U8V D;  1SA5 A;  1QYM A;  3SGH A;  3EUV A;  2P9P G;  4LF4 T;  3NZU A;  2XS1 A;  4AIU A;  1SZ9 A;  4HRM B;  1NI1 A;  3FU5 A;  2J62 A;  5HWY A;  5HAX A;  4GPM A;  4J0U A;  1OWM A;  4ILH B;  2E0I A;  2BKG A;  3TG5 A;  4TRQ A;  2WXK A;  2YK0 A;  3DTO A;  2QYW A;  2KXP C;  4HQD A;  5ARG A;  2F4V T;  5LFA A;  4QWN B;  3Q47 B;  5F3J A;  2C5I T;  1E8Y A;  3FEY A;  3ETU A;  4IN3 B;  2GRR B;  4RG6 A;  3ZPJ A;  4ME2 A;  4N39 A;  1SW6 A;  2CHZ A;  2A2F X;  5ETW A;  3EHQ A;  3Q75 A;  4JA9 A;  1WYB A;  4DR6 T;  3AG3 E;  3ZNG A;  2CLY B;  2NTY A;  1BI7 B;  2C0M A;  2D0U A;  2W62 A;  2ETA A;  2CLY C;  2LSU A;  3ZN0 B;  1Q2Z A;  1G8X A;  3ABK E;  4DBQ A;  4HWC A;  3MX3 A;  3RHW A;  4X1K E;  5FY1 A;  3APC A;  4I1O B;  3PU8 A;  4HFD A;  2OVF A;  5AFU L;  3ZT7 A;  2LM2 A;  2ION A;  2A5E A;  2KT9 A;  4FJY A;  4GTS A;  2QYJ A;  3UKU G;  3PE3 A;  2UU9 T;  5HRY A;  2ZM0 A;  3FTX A;  5JDM A;  3D9O A;  4YFS A;  5BV0 A;  2ZLY A;  2H6G A;  5ENQ D;  3CKD A;  2CG3 A;  4G2V A;  1IHB A;  2X6J A;  3BQK A;  3AE5 A;  3UU6 A;  1TN7 A;  3RQU A;  3EIJ A;  3L17 A;  3QAQ A;  3SFX A;  3ASO E;  3P2B A;  4OVU A;  2FJB A;  3TKL B;  3D9M A;  4GYS A;  1OWN A;  1H2V C;  3S7F A;  3MAC A;  4WYV A;  2OCC E;  4V1A v;  4ZHQ E;  3RIU A;  2IY0 C;  3AG2 E;  1HF8 A;  3B7R L;  3ZMZ B;  3IXE A;  2IIU A;  3ZYK A;  1Y6I A;  4ZS2 A;  2UXB T;  3LBX A;  5C8Y E;  2YHE A;  4FI5 A;  4U0S A;  4C91 A;  4UF0 A;  4X1Y E;  3PNL B;  4OHF A;  4QHO A;  3P4R A;  4ANW A;  1UJK A;  2VAS A;  2L9B A;  2DIW A;  4HLL A;  5AQV B;  1S70 B;  4XKB A;  1KF6 A;  3CVU A;  5FL0 A;  3PUG A;  1W3B A;  3UI2 A;  3UU8 A;  2IW5 B;  2LXL A;  3IV0 A;  3APD A;  3AU5 A;  4LF6 T;  1VCS A;  2FJE A;  3MV2 B;  5FP3 A;  2XPI A;  3Q5M A;  4YJ3 E;  2P58 C;  3CX8 B;  3PUR A;  2VSY A;  4F6R C;  5LHG B;  2GRO B;  4KP3 C;  2XAJ B;  4X65 T;  4PJL A;  2LAH A;  4EEC A;  3IBE A;  1XNR T;  4JV5 T;  3AAA C;  2NW7 A;  2HYZ A;  3KSQ A;  3RC3 A;  5L3E B;  4UEM A;  5JDH A;  3E22 E;  4B3M T;  4GTM A;  2AXZ A;  1FEW A;  4L9P A;  1HR0 T;  4TXR A;  2YDR A;  1LRZ A;  4BWR A;  3O1J A;  1T8B A;  3GWH A;  2I2O A;  5FWQ A;  4Z91 A;  2WVI A;  2QYU A;  1EF1 C;  1WFD A;  4DLO A;  3SBS A;  1W0B A;  2PM7 A;  2WXF A;  1MND A;  1B89 A;  3I9W A;  3FBZ A;  2YNQ A;  4ILU A;  1US7 B;  3FTV A;  1UJJ A;  4ABN A;  1BLX B;  2DL1 A;  3R6N A;  4ATG A;  3AEE A;  3ULY A;  2IML A;  3RRW A;  2EIK E;  3UM2 A;  2XM1 A;  3LEW A;  4HRN A;  4DV2 T;  3PEU B;  3A7M A;  3P1U A;  1HTJ F;  4UF0 B;  5JJ7 A;  2MPK A;  4LNU D;  1CUN A;  1NEK A;  2XPK A;  3AXJ B;  2LE8 A;  2IFU A;  4L1B A;  3APF A;  4I4T E;  3L39 A;  1Z6T A;  1Y64 B;  2X0Y A;  1IJ6 A;  1YKE B;  3LSV A;  5HEU A;  2UWJ G;  1XZY A;  3FUL A;  1WCR A;  3FUN A;  4UV9 B;  4L0R A;  3N2O A;  3VRB A;  2V7J A;  3E0Z A;  1JNZ A;  4EAH A;  4RQI A;  4JPS A;  4HWF A;  1JCR A;  2GRM A;  4IYP A;  3QWV A;  3UU5 A;  4I17 A;  1EPU A;  3SF4 A;  3TG4 A;  3MA9 A;  1U3D A;  3CST A;  1P5Q A;  4IUL A;  3LJ3 A;  1D0X A;  3BQI A;  4CN4 A;  3UKR G;  1HZ4 A;  4DRX E;  5BV1 A;  3QDN A;  4CI1 B;  3B57 A;  5HXH A;  1BI8 B;  3UTK A;  4GIW A;  2YN6 A;  4HKA A;  5H6R B;  4NXN T;  3I0Q A;  4KVM A;  4JUY A;  3RO3 A;  5LHI B;  1E7U A;  2YHC A;  3FTZ A;  4UQX A;  2LAI A;  3ZT6 A;  2BKK B;  3CHS A;  3ONJ A;  2PZI A;  5EIB E;  2R03 A;  2BKO A;  4KI0 F;  4ACL A;  5D0O D;  3V5U A;  2B1E A;  2CFZ A;  3WXX A;  4GPK A;  4UVB B;  2Q9Q C;  2Q9Q D;  3U4T A;  4U7Y A;  5M4Y A;  5L3D B;  4ISS A;  4JI4 T;  5HEG A;  3L9T A;  3VHL A;  4KBM B;  4DR7 T;  2L6B A;  1OED E;  5CCM A;  3NF1 A;  1OWP A;  4H9Q C;  3UT4 A;  1UUS A;  2DZO A;  3TWR A;  2J4D A;  5CEA A;  1FJG T;  4GMR A;  3EI0 A;  3KBT A;  4PAG A;  3V5S A;  5ABH A;  3EHN A;  4H7X A;  3LYA A;  4IRU A;  5HKP A;  3CVY A;  1AP7 A;  5G55 A;  3JXI A;  4XI9 A;  4YHH T;  5L4E A;  2XQ4 A;  4MHC A;  3Q9U C;  2KLQ A;  5ENN A;  4X1I E;  3MV3 B;  5AQR B;  4TX5 A;  4DND A;  4OYJ A;  2CRB A;  4IHJ E;  5DBK A;  2CG2 A;  3VR8 A;  2P9N G;  3O1H A;  4AQG A;  5A1L A;  2Q7F A;  2MBG A;  5ANR A;  3PUX F;  4U07 A;  3FZL B;  4APO A;  3HG0 D;  2LSV A;  2NOX A;  3ANW B;  3DSV A;  4E7Z A;  2VSN A;  4X20 E;  4JXT A;  1W0A A;  4P0A A;  1HE8 A;  2I9C A;  5AQ7 A;  5AQA A;  4HLE A;  3N2K E;  5AQN B;  2RFM A;  4M1P A;  1UOH A;  3ZMV B;  4PJJ A;  2XQY A;  4ILI A;  3AED A;  4P09 A;  4OYK A;  3FZM B;  3DPD A;  2RKK A;  5G05 C;  4EBA G;  3C4W A;  4F3V A;  5AQP B;  5BMV E;  4ILG A;  2IOS A;  4O60 A;  5AQL B;  5LP6 E;  1E8X A;  3PUA A;  3KVA A;  4U74 A;  4I1M A;  2WDQ A;  3MJW A;  5EX0 A;  5HI7 A;  3EJN A;  3ASD A;  2MHK A;  1K1B A;  3TWW A;  2D9D A;  3UT7 A;  5L3G B;  4G24 A;  1HX8 A;  4H63 V;  3PZ4 A;  3J7Y q;  2NSZ A;  3L54 A;  3Q49 B;  1Z8U A;  2XAH B;  4DVD A;  4O1O A;  4GB9 A;  2XRZ A;  3PZ1 A;  3TWV A;  1FVF A;  3LK3 B;  4L2Y A;  4LEU A;  4H9S E;  3FUK A;  1ZV4 X;  3LJN A;  2H6I A;  4L23 A;  2J4B A;  2Y6X A;  2KM4 A;  4FC8 A;  3UQ7 A;  2I0M A;  4CEM A;  3DP7 A;  4YHJ A;  2LKG A;  4QKN A;  2N9D A;  4JA7 A;  4DBR A;  3CIR A;  1HS6 A;  4YVO A;  4HWI B;  3QC9 A;  1E96 B;  3RIA A;  3C98 B;  4EZL A;  4U0U A;  3C50 A;  5FKY A;  4WW0 A;  3ZRH A;  3AE7 A;  2J07 A;  2X68 A;  2VKO A;  3FH7 A;  1JNR A;  4LNB A;  4J8E A;  3NBX X;  4B89 A;  4DV0 T;  4C90 A;  3BQO A;  2E9X A;  3ABV A;  4HVB A;  4YDY A;  4ZEY A;  4J8S A;  4ATZ D;  3ZU7 B;  5HCM A;  5EK2 A;  3KFW X;  4JI6 T;  2XCB A;  3K8P C;  5AQ9 A;  2WXG A;  2N1G A;  5HEO A;  5LX8 A;  3MEK A;  3L8R A;  3ESK A;  2AVP A;  3S2A A;  4DJA A;  2Y4T A;  1HG5 A;  1YXR A;  2E9X C;  2JJ9 A;  4P0B A;  2CCQ A;  3L08 A;  3EU5 A;  1JPL A;  2C2L A;  3ZYM A;  2UUB T;  1FVH A;  5J1G A;  2V5D A;  4H9N C;  1Z3X A;  2KZT A;  3EAM A;  3UX4 A;  5CHE E;  1S94 A;  2GW1 A;  2CHX A;  4HFI A;  3QKY A;  5C2T A;  1J1J A;  2MRI A;  3FTS A;  3E32 A;  3LXU X;  3CQX C;  5E76 A;  2XJ7 A;  1IQU A;  1IYG A;  3NVO A;  5CER B;  3QB5 K;  4FJO A;  2G0U A;  3EU9 A;  4EBA A;  3Q9D A;  3ENE A;  2ACX A;  4ZS3 A;  2XGM A;  3BG1 B;  1NWM X;  4L2L A;  1NFI E;  2ZGG A;  3SRZ A;  4WNK A;  3EIQ C;  3JUE A;  4HOR A;  1JWF A;  2ZM8 A;  1MMA A;  4UWG A;  2XZD G;  1OCC E;  3NQP A;  3UXG A;  5KJM A;  2ZMA A;  1O1S A;  2RD0 A;  3WAJ A;  2B76 A;  2UXC T;  4YJ2 E;  3ONK A;  3QUJ A;  2MOW A;  4GZ3 A;  1XNQ T;  1N54 A;  4NUR A;  4XKC A;  2BTD A;  1D1A A;  1BPO A;  4XE0 A;  2BDE A;  4U7E B;  4CXX A;  4GKJ T;  4XX5 A;  5LYJ E;  3BU8 A;  5FTP A;  1VCT A;  4IE5 A;  3D9K A;  2W67 A;  2JQH A;  4MS6 A;  3G2T A;  1XDP A;  4EYY R;  4X62 T;  2KC7 A;  3F6Q A;  4DMV A;  2PBI A;  3ML8 A;  3GZ2 A;  2LSY A;  4I1A A;  1PY1 A;  2P9L G;  1EZ3 A;  3O4X E;  4OFZ A;  3ZLI A;  3AG1 E;  2LSK A;  3LDQ B;  3IEG A;  5AQJ B;  3I5P A;  4WNF A;  2SPC A;  2GRN B;  4I6E A;  2KMF A;  4XI0 A;  3U3W A;  3HXB A;  3JCF A;  2NTX A;  5GON E;  3K3N A;  3OXF A;  4I9E A;  2KAT A;  3N9M A;  3FTW A;  4CRW A;  4MKT A;  1M7K A;  1YW0 A;  2A9U A;  3CQC B;  4EIW A;  2PQN A;  4JEH A;  3D9H A;  2WXQ A;  3AU4 A;  4HNA D;  3W9F A;  3HYM B;  3HXF A;  3LY9 A;  3D3M A;  4YDO A;  4K5B A;  1G73 A;  4EZH A;  2NW8 A;  4JEU B;  4B93 B;  4GK5 E;  5IUX A;  2BS3 A;  2Y0B G;  3FUM A;  3CHP A;  3WG7 E;  2IU1 A;  2V1D B;  1O3X A;  2V8S E;  3ASN E;  4HFC A;  3Q79 A;  3Q73 A;  4NIQ A;  3TLT A;  4KT6 B;  3SO8 A;  4G23 A;  5E75 A;  5FVK A;  4L5G A;  3GMI A;  3URZ A;  3KBU A;  2EHO B;  4U3C A;  1A17 A;  2GRP B;  1N0R A;  2AXV A;  3ZCJ A;  1FMW A;  2E5V A;  1SE7 A;  5T4Y A;  2C5K T;  2MYS A;  2N2N A;  4WWO A;  2R5S A;  4GMJ A;  1PAQ A;  5CBN A;  5JHA A;  2I1K A;  2XEH A;  2NWB A;  2F0Y A;  4BT9 A;  1Z3Y A;  4LNG A;  4GYW A;  1IBK T;  1SHZ C;  4I55 E;  3JAF A;  2X3M A;  2FO7 A;  4HOT A;  3DWL G;  3I1A A;  1X9B A;  4BFR A;  4MBQ A;  2YIN A;  3AEC A;  5HXC A;  4HWD A;  4GYO A;  2KCL A;  5HWX A;  2P9U G;  2KBX A;  2QRX A;  2LNI A;  3Q5X A;  2Y4U A;  5JDL A;  3VRA A;  4U96 D;  3ZEF A;  2BZB A;  4PNI A;  4KVO A;  5BXU A;  4BJM A;  4JYA T;  1S64 A;  5KBA A;  4AY6 A;  1QZ2 A;  2FUP A;  2JEK A;  1HXI A;  3UIO C;  3QK6 A;  3AA6 B;  3CML A;  5FXX A;  1OWO A;  5CEC B;  4A63 B;  4TNV A;  4PK4 A;  1UX5 A;  5JJT A;  1YQ3 A;  3VTX A;  4C9B B;  4B8C B;  2FEZ A;  1SUM B;  3T5V A;  4OX9 T;  2WQH A;  1KZO A;  4PS3 A;  1OCO E;  2C0S A;  4GZC A;  4KBQ A;  4UEL A;  5AQK B;  5J90 A;  1TNO A;  4DR1 T;  3RYC E;  4JHK A;  1L0V A;  2LM9 A;  1ZP0 A;  4LRZ A;  4GTP A;  4LCT A;  1E7V A;  4O4J E;  3IBP A;  5AQS B;  5CMW A;  3T5X A;  5KJK A;  4TNW A;  3PUQ A;  2XS8 A;  4DLQ A;  1QNF A;  3RRM B;  3OBV E;  1YA0 A;  2JQK A;  1S35 A;  3RO2 A;  4HFE A;  2ZIS A;  3ML9 A;  3FBL A;  2E2A A;  1WG0 A;  4J6I A;  4FUL A;  4DI3 A;  4IL9 A;  5FZQ A;  2CA5 A;  4O4I E;  1N95 A;  2XQ9 A;  4GYY A;  3NRX A;  3SQV A;  3NZP A;  2FBN A;  2R02 A;  2EIL E;  5H7P A;  3FEX A;  3ONX A;  3PZ2 A;  2CWY A;  3CVR A;  3WI3 A;  3NKZ A;  3OKQ A;  4W9R A;  3V30 A;  2HE0 A;  4U2Y A;  3QAR A;  2HN2 A;  4PFP A;  1LF8 A;  1TNU A;  3FUI A;  3LCA A;  4JC8 A;  1ZB1 A;  3RKG A;  3P50 A;  5EZY E;  4GAA A;  3LBX B;  2B6C A;  3Q5D A;  4O4L E;  3FTU A;  4AXH A;  2F8X K;  5LGN B;  4K0U A;  4GA1 A;  3O4Z A;  5LNK A;  4URK A;  4QH5 A;  3BEE A;  2LOP A;  4LMK A;  2OEV A;  2ODV A;  5ABF B;  5FQ6 A;  2WU2 A;  4EXT A;  4G25 A;  4BES A;  3NWI A;  4CDN A;  2J8S D;  4B8A A;  2X9W A;  1H6K A;  4B3S T;  2X67 A;  5FQ8 A;  2HN1 A;  4KHZ F;  2E9X D;  3FUD A;  3AS5 A;  4HS2 A;  4DV5 T;  1WRD A;  2D0T A;  2KZ7 B;  5TAO A;  4WAF A;  5HQ8 A;  2M6B A;  3AAA B;  4MBG A;  4U72 A;  2WXR A;  3ZC1 A;  3G2U A;  2VQF T;  3I3N A;  3FUJ A;  4XIF A;  3X2Q E;  4UQY A;  4WNE A;  4DPR A;  2HR2 A;  2AWI A;  3B7S A;  2WQ6 A;  3P4W A;  4GTT A;  4GTV A;  4WBN E;  3TXN A;  4ERR A;  4TWF A;  2J08 A;  3CWZ B;  2H6F A;  4BTA A;  3L82 A;  5JDF A;  1JCQ A;  4UI9 K;  4UWK A;  1OED C;  3D0T A;  4K0K T;  5CMY A;  3AEA A;  4A98 A;  1QSD A;  3AE3 A;  1NEN A;  2CHW A;  3D9L A;  5J2T E;  2VL0 A;  3N2G E;  1KZP A;  3MJX A;  4IE7 A;  4WBO A;  5L3F B;  2Y8D A;  3Q7F A;  3AE1 A;  2OND A;  5AQI B;  1HX1 B;  4V3I A;  1N11 A;  3MA5 A;  1BR4 A;  1H0A A;  2CXL A;  4KHP T;  3A8Y C;  4FA6 A;  1U3C A;  3HVE A;  2YOE A;  3B13 A;  3GYZ A;  4EOZ B;  3FH5 A;  1YKH B;  1NA3 A;  4TWH A;  4ZXL A;  5KJL A;  4OYS A;  3RRC A;  2VGY A;  4CI2 B;  4BY6 A;  3E4B A;  4AKL A;  3SFZ A;  3LKU A;  2XQA A;  5IYZ E;  1MIV A;  2ZU6 B;  2BBJ A;  1IZN B;  3KS2 A;  3VLD A;  2D5U A;  3ZSS A;  4LF8 T;  4I50 E;  3HXE A;  3ASH A;  1M62 A;  2DNX A;  4A97 A;  2FO1 E;  4BSZ B;  3N9L A;  4YY3 T;  1TNB A;  4E85 A;  2XGO A;  5HEH A;  5EIL A;  5D66 A;  5AAO A;  3GA8 A;  3RLF F;  5M72 A;  4ZI3 D;  4YT0 A;  3PVL A;  2Q9Q A;  1V9D A;  3AE6 A;  2X6F A;  1RW2 A;  2UXN B;  4G1T A;  3TLW A;  4F6R D;  3E37 A;  3M3Z B;  1FT2 A;  2VL8 A;  2WWV A;  3I9Y A;  2WXM A;  3D9P A;  4IE6 A;  5T8I A;  5H6Q B;  3FZK B;  3KV6 A;  1MIY A;  4TV9 E;  3RF1 A;  3AJI A;  4BT8 A;  5J0Z A;  3N9O A;  5HXS A;  1J5W A;  3OXL A;  2M6I A;  5BR8 T;  1NL4 A;  1X5B A;  3V2O A;  1HH8 A;  1XMO T;  5AJL A;  2CPT A;  2XPZ A;  2I6H A;  4O4H E;  4IRE A;  3SHF A;  2UUC T;  4KUM B;  1T72 A;  4PK5 A;  3SBT B;  5JR9 C;  4J8Y A;  3S7B A;  3FZH B;  4DX1 A;  3C3R A;  3LPZ A;  3TL5 A;  4O6F A;  1BU9 A;  2MTQ A;  3D9N A;  5AQG B;  1H6P A;  3UTM A;  3QJZ A;  2NP9 A;  4IE0 A;  2W4X A;  5F8P A;  1MZC A;  3HRA A;  3HXD A;  3UUX A;  2LEH A;  2ACZ A;  4QH1 A;  2P9I G;  2WSS V;  2M63 A;  2WXJ A;  3CHM A;  3OJA A;  3ASG A;  3U9W A;  1DC2 A;  1D0Z A;  4AKR B;  2FUL A;  1UCU A;  2X0H A;  4JB8 P;  3R7Q A;  3HXC A;  3ZEF B;  2IAK A;  3FXE B;  2DWK A;  4LML A;  2HPL A;  4NQ0 A;  2VTB B;  1OUV A;  4DR4 T;  2PNN A;  2WDV A;  5A7D B;  3ZKJ A;  1HG2 A;  4AJW A;  4PS8 A;  4BX8 A;  4GZD A;  4ZHB A;  4HI9 A;  4WWP A;  2NR4 A;  4CCA A;  1TEZ A;  4GCN A;  4GCO A;  3Q5E A;  4YLH A;  4LFA T;  2OVB A;  2WMO A;  3CGH A;  4UQZ A;  2XHE B;  2V6Y A;  3LJC A;  3PNT B;  1WR0 A;  2J4G A;  3GN5 B;  2HM8 A;  3KVB A;  3GZ1 A;  2JQ9 A;  5EYP F;  2HO1 A;  2VB6 A;  2HPJ A;  2IJG X;  3B95 A;  2XEE A;  3BK9 A;  4GA0 A;  3L22 A;  2MOZ A;  4AVX A;  3SZ7 A;  2VKJ A;  3AA0 B;  1V55 E;  4JI5 T;  4DO0 A;  4UWH A;  3ZVV A;  5FYM A;  1D1C A;  3NAW A;  5T3R A;  4L7T A;  3BG0 B;  3Q15 A;  2KIN B;  2ILR A;  2UY1 A;  5JA4 D;  5G05 J;  3Q78 A;  5EDS A;  2VGX B;  1LKX A;  4KMC A;  2J49 A;  5LHH B;  3CR3 A;  2EQX A;  2XUE A;  5L3B B;  3AVR A;  1IJ5 A;  3QNK A;  2H7V C;  4TUM A;  3TXM A;  3LVR E;  2VVS A;  3VTY A;  4Q94 A;  3H37 A;  4PFO A;  2OOE A;  3DST A;  4BTB A;  1N36 T;  2L6J A;  4KXK B;  5LXT E;  2XSA A;  1H2U A;  4OK0 A;  5L4H A;  5FY0 A;  5JR9 B;  3CK6 A;  3CIA A;  4X8Q A;  2X51 A;  5DQV A;  4A5X A;  4B3T T;  2K3W A;  2BG9 E;  3IEE A;  4Y6W A;  1YMP A;  4F7A A;  2H88 A;  5LGT B;  4HEA A;  4GYR A;  2XM2 A;  3RIB A;  4TV3 A;  4AY5 A;  3ZHE A;  2WU5 A;  4DV7 T;  3ZIM A;  3C3O A;  3AXJ A;  2CXD A;  2JMK A;  1HNX T;  3ANW A;  3VR9 A;  1FCH A;  3RYF E;  2RP4 A;  1UN9 A;  4FAD A;  4J8F A;  4AKH A;  2XGS A;  4COF A;  2A72 A;  4JL0 A;  2L0T B;  4L9I A;  2FF4 A;  3E34 A;  4RSY A;  3HKE E;  2XZT G;  2LSJ A;  1SA4 A;  2EHO D;  3T9K A;  4O1P A;  4B6X A;  2QA7 A;  1D1B A;  3ESL A;  2LKH A;  4KYO B;  4CXW A;  2VJ8 A;  4FU3 A;  4GTQ A;  2CFU A;  4BET A;  4RG9 A;  2QY7 A;  1E7P A;  2K9A A;  3VKG A;  2XEV A;  2DYS E;  3RI5 A;  4HFH A;  1LD7 A;  4XAX B;  1IQR A;  3FWV A;  4I43 A;  4CGV A;  2KXP B;  1K3Z D;  1X81 A;  1ZBP A;  1U4Q A;  5LCW J;  2J09 A;  3LG7 A;  4CN6 A;  1MQS A;  4JLE A;  1YD8 G;  4DR5 T;  3B7T A;  3PUZ F;  5EKQ D;  5IY5 E;  1S0P A;  2Y1L E;  4AQF A;  3K3Q C;  2L9Q A;  4UI9 C;  3ZXP A;  2W0G A;  2ZXW E;  3QOF A;  4CT4 A;  2PG8 A;  3JQ1 A;  2YQ8 A;  2ETC A;  1NZN A;  1TNY A;  1H2T C;  3QC1 A;  5E0O A;  1Z0P A;  3N9P A;  2WPV A;  4ILB A;  3RPU A;  1WR6 A;  4DK5 A;  5EK3 A;  4I2W A;  1MIW A;  4OVV A;  2YU2 A;  5ENT D;  2VKH A;  2PM6 A;  3DSW A;  1ZEE A;  1OED A;  2W66 A;  2DWG A;  3ISM C;  1N32 T;  2W2U A;  2KWI B;  2JIW A;  3FUF A;  5FIO A;  3C4X A;  3QB5 A;  3PUW F;  1QBQ A;  2QGS A;  3TLS A;  3UUX B;  3C64 A;  2E9X B;  1N94 A;  4I2Z A;  5JRC A;  1W9R A;  3ZXS A;  1E1H B;  4ZFH A;  3V2X A;  5AAR A;  2VQ2 A;  1V54 E;  3FXD B;  5EYL A;  2V6Y B;  3UT5 E;  1QLB A;  3PDY A;  4CZZ B;  3JUI A;  3FFL A;  4ZZB A;  3R9M A;  4DUI A;  2V7I A;  2P2C P;  4TUY E;  4E6H A;  1TJF A;  2A5U A;  4PUC A;  3SY2 A;  2BVL A;  5AIJ A;  2KND A;  1HCI A;  5AQO B;  3CQG B;  1TN6 A;  2P9B A;  4HN9 A;  4PH4 B;  4YND A;  2UUA T;  3QK0 A;  2WMN A;  1H7C A;  3RAU A;  1JWG A;  2LJL A;  3SOL A;  4NRH B;  2V4L A;  3MKD A;  2NXP A;  4IDZ A;  4GA2 A;  3EDV A;  4MFR A;  2WXI A;  4K0R A;  1FT1 A;  1Y01 A;  4CN1 A;  3GZS A;  5JDN A;  1YQ4 A;  4M3O A;  3UM0 A;  4GKK T;  1L5J A;  4IDO A;  4Z68 A;  3SFD A;  2GRL A;  4GU5 A;  4A1S A;  4C0E A;  5AQT B;  1XGW A;  3RK6 A;  5A23 A;  4PJM A;  4G11 A;  2I59 A;  2BED A;  4N3A A;  2XY8 B;  3J5P A;  3L09 A;  4K03 A;  1LVF A;  1OT8 A;  4PW8 A;  3UU3 A;  2DCP A;  4DI4 A;  3ZFW A;  4BSX A;  4NXM T;  3C72 A;  2YKS A;  3HR0 A;  2WXO A;  5KWD A;  4PDX A;  3G2V A;  5EK4 A;  1MX4 A;  2WM9 A;  2R59 A;  5KCM A;  2DI4 A;  1O5M A;  5FIN A;  1YCS B;  5KDM C;  4IGU A;  3DSU A;  1IKN D;  3CVQ A;  4JI2 T;  4AIF A;  3NBN B;  4HFV A;  3P4Q A;  1WM5 A;  2OA5 A;  4B3R T;  5JR9 A;  1XDO A;  4TXP A;  5D0Q D;  4O8S A;  2LRL A;  1TN8 A;  2M67 A;  1UX4 A;  3MYV A;  3B5M A;  2V7L A;  1IHG A;  1IBL T;  2XQ5 A;  5CFB A;  4P29 A;  2DCF A;  1OCR E;  4U0Z A;  2VTB A;  4B94 A;  4AQY T;  3ZJ1 A;  3N5L A;  4AI6 A;  3FUE A;  1WAO 1;  3CVN A;  2BS4 A;  5ENP D;  4JBW F;  2CHN A;  4HOU A;  1U5P A;  3CVP A;  3K9I A;  2XRY A;  3ZN1 B;  2XSB A;  1BR0 A;  5FMN A;  1WYC A;  2WB2 A;  1CHU A;  2IC6 A;  4JI3 T;  4H9P C;  3TGO A;  3PUJ A;  5CA1 E;  3SWH A;  4HTE A;  1NA0 A;  1BR2 A;  2AXD S;  3L16 A;  3B7U X;  3AE8 A;  4NUU A;  2KCK A;  3UUN A;  4JEH B;  3FHE A;  2XPY A;  4UWL A;  4PK6 A;  2LUH A;  1TYQ G;  3U78 A;  3ZYQ A;  1O1R A;  4MLP A;  3CEQ A;  3F31 A;  4G8L A;  4JD2 G;  4APF A;  3W9G A;  4HOS A;  3UM1 A;  1MNE A;  1DU2 A;  3O48 A;  4DID B;  4WZX A;  1SVX A;  4IL4 A;  2H6H A;  3PTR B;  2L0I A;  1SZA A;  4U31 A;  4N2S A;  3HA4 A;  3CVW A;  4YTP A;  3KV4 A;  1HNW T;  2BG9 B;  2W00 A;  5FXV A;  3KEZ A;  3RRU A;  1UW4 B;  4AV7 A;  4JW1 A;  2CMR A;  3AEF A;  4I0U A;  5LOV E;  5LCW C;  1NP7 A;  2L8K A;  3CVV A;  3S7D A;  4AM9 A;  4CDR A;  4KMO A;  4YSY A;  3AE4 A;  4ANJ A;  3N9N A;  3NRY A;  1HO8 A;  1UN8 A;  4JZY A;  2KCV A;  5DAB A;  5JDG A;  1MMD A;  2OV9 A;  3L6A A;  3DBS A;  3AE9 A;  3HL6 A;  3E08 A;  2JQQ A;  2XAS B;  1KNR A;  1LD8 A;  2OLT A;  1MJ0 A;  2V7M A;  4U8Y D;  2ZGD A;  4U7I A;  5L47 A;  4OAU C;  2BUG A;  4QX7 B;  1EDU A;  4Y6C A;  3OTO T;  5CED B;  3SFY A;  1WDY A;  3R7R A;  4IE4 A;  4FP7 A;  2UXD T;  2DBA A;  3UQ3 A;  3ZUV B;  2IEJ A;  4HOQ A;  4C48 B;  3P4P A;  4G26 A;  3NOC D;  3PJA A;  3KV5 A;  2CHO A;  3T1H T;  3FU6 A;  4DV1 T;  2QFC A;  4HFG A;  5LOZ A;  1D0Y A;  1YYH A;  4NUV A;  4TUU A;  5ENS D;  3K3O A;  3VLE A;  5G2N A;  3DRA A;  2A4Z A;  4TN7 B;  4CXY A;  2XCC A;  3CHO A;  2P9K G;  2VSO E;  3ZMT B;  1MHQ A;  3M65 A;  1LVK A;  5C2Y A;  2KSR A;  4EED A;  3ZW3 A;  4YVQ C;  2V26 A;  3PDN A;  2AW6 A;  3EDT B;  2VQE T;  2AJA A;  4U2Z A;  1BD8 A;  2XAQ B;  3CKB A;  3E30 A;  2K24 A;  2BG9 A;  2PTF A;  3PRE A;  1E90 A;  2QZA A;  3HIZ A;  2XZE A;  4U33 A;  1J5E T;  2L3L A;  1D8E A;  2VUR A;  3CK8 A;  1ZHC A;  4NAC A;  3KDS E;  3AEB A;  3JC6 D;  1N9A A;  3MZL B;  3CKC A;  3T8K A;  2YDS A;  1KNP A;  1U2V G;  5AQH B;  3WAK A;  3DEO A;  5HEJ A;  3E33 A;  4EPZ A;  4CDM A;  3JAD A;  3AAE B;  1NAF A;  4ZI7 E;  2VK9 A;  3JYS A;  2EIN E;  4QXH B;  5LG3 A;  5CBO A;  2AE9 A;  4ZOL E;  3ZGQ A;  2MYO A;  2X6I A;  5LG4 A;  4RLY A;  5ABG A;  2NC9 A;  4FLB A;  1KFY A;  4I9C A;  3PE4 A;  1SQM A;  1T98 A;  3UFE A;  2YEV C;  3PU3 A;  4YTM A;  3AS4 A;  3Q9N C;  4UUC A;  4H63 H;  5IWA T;  1IXV A;  1HNZ T;  1ZKE A;  5KMG P;  2J9Q A;  3V31 A;  1OWL A;  2EHO C;  1X79 A;  3UFG A;  1O1T A;  2K48 A;  4P1N A;  4AOF A;  3ZC0 A;  4X64 T;  3KSL A;  1TNZ A;  4JHJ A;  3RJV A;  4YTN A;  1KNZ A;  3VKH A;  1K1A A;  1KT0 A;  4DX7 D;  1WY6 A;  1UK5 A;  2X0L B;  1E2A A;  4EV6 A;  2GRQ B;  2WXP A;  4HGA A;  4CT0 A;  3ZMU B;  5A6C A;  2V0P A;  3U64 A;  1QQE A;  3OPC A;  4G8K A;  3VU7 H;  5J08 A;  5DIZ A;  2V6X A;  4UWF A;  3J5Q B;  5F5W A;  4DV3 T;  4ILC A;  4FHJ A;  2WBL A;  2MAW A;  5JQG E;  3CX6 B;  1VOM A;  4AKG A;  1W09 A;  1KLX A;  2PJQ A;  3GW4 A;  5KJN A;  3HHM A;  3EAB A;  4HXI A;  4EYU A;  1N4P A;  2E8I A;  2CE7 A;  1ELW A;  2RA1 A;  5ADX L;  3AA7 B;  2R05 A;  3IKO B;  4A3V A;  5KX5 E;  1LTX A;  2J1D G;  4HWH A;  3CSF A;  2LHN A;  3NOG D;  1EYH A;  3S7J A;  1OWA A;  4A3T A;  3PS6 A;  2Y48 B;  1OXZ A;  3U66 A;  1R8I A;  2WWU A;  4CI3 B;  3FDH A;  2P9S G;  4HFB A;  3Q2M A;  3NB2 A;  2XAG B;  5BNW A;  5HXE A;  3DEP A;  1HFA A;  3MK7 C;  1XMQ T;  5CCL A;  5LBQ B;  3MGB A;  4LSZ E;  1MX2 A;  3EHR A;  3CHQ A;  3MKR A;  3ZST A;  2WXN A;  4WNG A;  5FNV E;  4J8D A;  3H3A A;  3OTN A;  5LA6 E;  1RZ4 A;  2WQY A;  3MCX A;  3MKQ A;  5BT1 A;  3FTY A;  3EUH A;  3EDU A;  2ZM6 T;  1S63 A;  3RYH E;  4EEB A;  4AIS A;  4HE8 A;  3RIF A;  3PE0 A;  4J7W A;  5G04 J;  4G2A A;  5ABF A;  3GN5 A;  1VDY A;  4DV6 T;  2JMH A;  1WLX A;  4GK0 E;  4TZ4 C;  5HYA A;  2I1J A;  3G2S A;  1TJC A;  5EID A;  1TR4 A;  4M7C A;  1XNF A;  5LP0 A;  5BPP A;  5FXZ A;  4J2C A;  3OVU A;  2XEN A;  3ABL E;  3T8M A;  3RX6 A;  2VSX E;  4QXC B;  3CK7 A;  3ONL A;  2WZH A;  1Z5S C;  3LDZ A;  4KX6 A;  3TWU A;  2Q9Q B;  4AXP A;  1IBM T;  4LFC T;  3SD5 A;  2LHR A;  3RU0 A;  5FL1 A;  2C0L A;  2IOL A;  5FQ4 A;  5FZS A;  4F53 A;  3O1I A;  4N3B A;  4UXN B;  1ELR A;  5BUZ A;  5LJM A;  1OXJ A;  4F1S A;  2VGX A;  2HH7 A;  2CXF A;  3EVY A;  2V4H C;  4LMJ A;  5ENO D;  1N52 A;  4MAL A;  4AEZ C;  4FJZ A;  4YSZ A;  3ZCI A;  3U3I A;  2VYI A;  2H89 A;  3I4R B;  2LO6 A;  3MZK B;  2XQ8 A;  5D2M C;  4AQF C;  2Y3A A;  2LOS A;  3UQ4 A;  2V8S V;  5AQM B;  2E2E A;  2RPA A;  3C4Z A;  3G2W A;  3FP3 A;  5ABE A;  2YDQ A;  1AWC B;  4DX2 A;  4WWN A;  4IST A;  4ASK A;  4ZI2 D;  3MKQ B;  5JH7 E;  3I0O A;  3V79 K;  4UIG A;  1HU3 A;  3LS8 A;  4EHM A;  4ZZC A;  3RYI E;  1N4S A;  3NZS A;  3DXM G;  3D9I A;  2WCA A;  2NYJ A;  1B7T A;  5B1A E;  4CGW A;  2BKP A;  2XHE A;  4HBD A;  3CVX A;  4LFB T;  4KZ0 A;  3UPV A;  1QUU A;  1D9S A;  3AEG A;  1KEY A;  2ZIR A;  3CK9 A;  1ELK A;  2BS2 A;  2BBH A;  2H3R A;  2EIJ E;  2CEA A;  2EIM E;  4BA9 A;  2BG9 C;  3K1S A;  3TJP A;  3LK4 2;  3BQL A;  3EHM A;  4H7Y A;  5B3S E;  4ANU A;  3ZKR A;  5C1D A;  1G3N B;  4N78 D;  4N5Q A;  4E7S A;  2R17 C;  3AS8 A;  3BUA A;  4QQI A;  5FZR A;  4GML A;  3HKD E;  3FH8 A;  3JQ0 A;  2ZM2 A;  4I6J A;  5B1B E;  4PJN A;  5FY7 A;  5JTG A;  2ETB A;  3UU4 A;  4PS7 A;  3UT8 A;  2VGE A;  3G06 A;  1UG3 A;  4QX8 B;  3PUK A;  2FBW A;  1KPS B;  3T1Y T;  2KZT B;  5CJ5 A;  4LUN U;  3RQW A;  3D9J A;  5LJN A;  3Q4A B;  4LF5 T;  5LCY A;  3OXG A;  2XQ0 A;  3UUM A;  4FLH A;  1JUQ A;  3AG4 E;  4LF9 T;  2J47 A;  4XZ4 A;  2R2L A;  5CGM A;  3NZQ A;  3H3M A;  3PJA J;  3RIU C;  2OV8 A;  4WND A;  5BW8 C;  3CLJ A;  3R84 B;  3OYZ A;  3AA1 B;  2IF4 A;  4ILA A;  4Z8X A;  4CYM D;  4MLK A;  5FT9 A;  3RC8 A;  3ULQ A;  3DSS A;  4D10 C;  4GZ5 A;  2WQ7 A;  4XZC A;  3P7I A;  4GTO A;  1MYO A;  2PL2 A;  3TWQ A;  2DZN A;  1GQE A;  4X66 T;  4BX9 A;  4DMW A;  4Q25 A;  1N33 T;  2ES0 A;  4QXB B;  3TLV A;  2QC9 A;  1I6Z A;  2XQ6 A;  3P8C D;  4TWD A;  3SS1 A;  3DJB A;  4R7L A;  1T7S A;  3SFE A;  3IHV A;  2WDR A;  5HCJ A;  4IT4 A;  2LLY A;  5DJQ C;  4UI9 J;  1IAP A;  2V5Q C;  3SNX A;  2WP9 A;  1SA0 E;  3N9Q A;  2F8Y A;  3Q5W A;  2E5L T;  3KEA A;  2V5C A;  3KAE A;  3ZHE B;  5BXO A;  4YDE A;  4UVC B;  4ANX A;  4A55 A;  2FI7 A;  3T8O A;  2LSG A;  1N4R A;  2X6K A;  1UGO A;  2Z6E A;  2IO2 C;  4BEP A;  4QH4 A;  1K8K G;  2XQ3 A;  4U63 A;  2VVN A;  1AJ3 A;  2V5F A;  3IA3 A;  3LFM A;  4DX5 D;  4OAV B;  1DVP A;  4JEU A;  1DCE A;  3CV0 A;  4B0Z A;  3I4G A;  4JI0 T;  4TV8 E;  5JVD E;  4DR3 T;  2WZI A;  2IDO B;  5L2L A;  5CRU A;  3JCK C;  4WUY A;  2X9H A;  3FHN A;  5LMU T;  3ONL C;  2WXH A;  2JRK A;  2X38 A;  5LBM A;  2IHR 1;  3ZN3 A;  3RH3 A;  4JI7 T;  2R6G F;  1JCS A;  4U04 A;  2VKD A;  3AB3 B;  3UIN C;  3S4U A;  3F2E A;  2AXU A;  2PQR A;  1A5E A;  2KWH A;  3LK2 B;  2X6H A;  3PRZ A;  4ZI2 C;  2K5B B;  4UV8 B;  1FIO A;  4JHR A;  3TWS A;  5J2U E;  3KIN B;  3TWX A;  3PZD A;  1MMN A;  1INZ A;  3LVQ E;  3CVL A;  2CM0 A;  2D2S A;  2DHR A;  1N34 T;  4HRL A;  4YDW A;  5ITZ F;  4DV4 T;  4O2A E;  3PH0 C;  3SI5 A;  4ADZ A;  5AQQ B;  3HI2 A;  1UUR A;  3AE2 A;  2UY1 B;  5AQB A;  4YXD A;  2XTL A;  3LY8 A;  4DX6 D;  2CWO A;  4ACK A;  2X9X A;  3FU0 A;  1GW6 A;  3PUS A;  1E8W A;  1DNP A;  2F37 A;  5CB4 E;  4EQF A;  2CBJ A;  1OED B;  4U8H A;  1PC2 A;  2BVM A;  4EZ4 A;  5JMN D;  3C98 A;  2VWA A;  4HB5 A;  1H6O A;  2X9Y A;  5C3J A;  3UUB A;  4LER A;  3F57 A;  5KNG A;  2UXX B;  5JRE A;  4AP2 A;  3DPY A;  3QWW A;  3IHY A;  2JLB A;  1MX6 A;  3IF8 B;  3HKC E;  3OAW A;  3J9X 1;  1FPP A;  4CQI A;  2YU1 A;  3RKO A;  1E8Z A;  3W15 B;  4FHK A;  4ZI3 C;  5LGU B;  4BER A;  3ASF A;  1XWM A;  2LXM A;  2A3D A;  5FVL A;  4HI8 A;  3PUY F;  5IHY A;  4N2Q A;  2IQC A;  3AVS A;  4H9O C;  3PUV F;  3FB2 A;  1OY3 D;  1H19 A;  2C5J A;  1N4Q A;  4QFV A;  4EZK A;  5KXJ A;  5AEN A;  2RFA A;  5HXR A;  3HDX A;  4YSX A;  2X66 A;  4JI8 T;  3L3P A;  2WS3 A;  4F1P A;  3LY7 A;  5CA0 E;  4C0M A;  5AN8 A;  4EB6 E;  3ETV A;  2LT3 A;  2XAF B;  5ENR D;  2JAB A;  3QWP A;  5JDQ A;  4F8H A;  4EGW A;  2H7O A;  5KNH D;  3KV9 A;  4DUY T;  3VLF A;  3ULE G;  4KZC A;  2RG8 A;  2Y69 E;  4K5A B;  4Q69 A;  3QNU A;  3EHZ A;  3ZMS B;  3RSE G;  2LSI A;  4GOU A;  4Z90 A;  1BR1 A;  3C5R A;  2WAU A;  3AAI A;  2DLR A;  3B7B A;  3DXK G;  3N71 A;  2XQ7 A;  4DUZ T;  1HS7 A;  4ANV A;  3P4S A;  5JJ6 A;  4GTR A;  3A5X A;  4TXQ A;  2HHH T;  4IDQ A;  3PZ3 A;  3KD7 A;  5ARF A;  2FJD A;  2FJA A;  3JXJ A;  2WY2 A;  1OCZ E;  4A1G A;  1MMG A;  5CRV A;  3OYX A;  3UUL A;  3RGL A;  4I6G A;  3DSX A;  4JI1 T;  2GK9 A;  3UIP C;  5DQW A;  4Q96 A;  3CHR A;  3TWT A;  5FQ7 A;  4UVA B;  5JRC B;  3FZF B;  1ZU2 A;  3UMV A;  2DYR E;  4IIJ E;  3PEV B;  4JVS A;  2LRK A;  5FXW A;  3CX7 B;  4XEI G;  3RRN B;  3UM3 A;  3TAX A;  2BKN A;  5L3C B;  4MRU A;  2DVW A;  3JAE A;  2W63 A;  4O2B E;  3FU3 A;  5AYW D;  1VRB A;  4IDP A;  1I94 T;  1ZOY A; 
#chains in the Genus database with same CATH homology
 1KT1 A;  3O9X A;  3ZJ2 A;  4EZJ A;  3IHR A;  5EX3 A;  2IC9 A;  2JPF A;  3FUH A;  1FMV A;  2PFV A;  5FJY A;  3MXZ A;  4H9R C;  3FY4 A;  1KK7 A;  3QB2 A;  4XBF B;  2V7K A;  5AJD A;  2W61 A;  1Y8M A;  4GZ6 A;  3ZYL A;  2BF0 X;  3C51 A;  2WXL A;  4N3C A;  3HVE B;  3JC6 C;  4I43 B;  5JHB A;  2GGF A;  2NW9 A;  3HKB E;  4BAY B;  5ANL A;  5G04 C;  3RKV A;  4AKI A;  4G63 A;  4RVB A;  2EHO A;  4N5C A;  4A56 A;  4BJN A;  2ODU A;  3R9A B;  3L13 A;  3QOU A;  3ZPO A;  3CPZ A;  3SGH A;  3NZU A;  1SZ9 A;  3FU5 A;  5HWY A;  5HAX A;  4J0U A;  1OWM A;  4ILH B;  2E0I A;  3TG5 A;  4TRQ A;  2WXK A;  2YK0 A;  3DTO A;  5ARG A;  5LFA A;  4QWN B;  3Q47 B;  5F3J A;  2C5I T;  1E8Y A;  3FEY A;  3ETU A;  4IN3 B;  4RG6 A;  3ZPJ A;  4ME2 A;  4N39 A;  2CHZ A;  2A2F X;  5ETW A;  4JA9 A;  1WYB A;  2CLY B;  2NTY A;  2C0M A;  2D0U A;  2W62 A;  2CLY C;  2LSU A;  3ZN0 B;  1G8X A;  4DBQ A;  3MX3 A;  4X1K E;  5FY1 A;  3APC A;  4I1O B;  3PU8 A;  2OVF A;  5AFU L;  2ION A;  2KT9 A;  4FJY A;  3PE3 A;  2ZM0 A;  3FTX A;  5JDM A;  3D9O A;  4YFS A;  5BV0 A;  2ZLY A;  3CKD A;  2CG3 A;  4G2V A;  2X6J A;  3BQK A;  3EIJ A;  3L17 A;  3QAQ A;  3P2B A;  4OVU A;  3TKL B;  3D9M A;  4GYS A;  1OWN A;  1H2V C;  3S7F A;  3MAC A;  4V1A v;  4ZHQ E;  3B7R L;  1HF8 A;  3ZMZ B;  3ZYK A;  1Y6I A;  4ZS2 A;  3LBX A;  5C8Y E;  2YHE A;  4FI5 A;  4U0S A;  4C91 A;  4UF0 A;  4X1Y E;  3PNL B;  4OHF A;  4QHO A;  4ANW A;  1UJK A;  2VAS A;  2L9B A;  2DIW A;  4XKB A;  3CVU A;  3PUG A;  1W3B A;  2IW5 B;  3IV0 A;  3APD A;  3AU5 A;  3MV2 B;  5FP3 A;  2XPI A;  3Q5M A;  4YJ3 E;  2P58 C;  3CX8 B;  3PUR A;  2VSY A;  4F6R C;  5LHG B;  4KP3 C;  2XAJ B;  4PJL A;  2LAH A;  4EEC A;  3IBE A;  2HYZ A;  2NW7 A;  3RC3 A;  5L3E B;  4UEM A;  5JDH A;  3E22 E;  2AXZ A;  1FEW A;  1LRZ A;  4BWR A;  3O1J A;  3GWH A;  2I2O A;  5FWQ A;  2WVI A;  1EF1 C;  4DLO A;  3SBS A;  2PM7 A;  2WXF A;  1MND A;  1B89 A;  3I9W A;  3FBZ A;  2YNQ A;  4ILU A;  1US7 B;  3FTV A;  1UJJ A;  4ABN A;  3R6N A;  4ATG A;  3RRW A;  3LEW A;  3PEU B;  3P1U A;  1HTJ F;  4UF0 B;  5JJ7 A;  1CUN A;  2LE8 A;  2IFU A;  4L1B A;  3APF A;  4I4T E;  1Z6T A;  1Y64 B;  1IJ6 A;  1YKE B;  2UWJ G;  3FUL A;  3FUN A;  4UV9 B;  4L0R A;  3N2O A;  2V7J A;  3E0Z A;  4EAH A;  4JPS A;  2GRM A;  4IYP A;  3QWV A;  4I17 A;  1EPU A;  3SF4 A;  3TG4 A;  3MA9 A;  1U3D A;  3CST A;  1P5Q A;  4IUL A;  3LJ3 A;  1D0X A;  3BQI A;  1HZ4 A;  5BV1 A;  3QDN A;  4CI1 B;  3B57 A;  5HXH A;  3UTK A;  4GIW A;  4HKA A;  5H6R B;  3I0Q A;  4KVM A;  4JUY A;  3RO3 A;  5LHI B;  1E7U A;  2YHC A;  3FTZ A;  4UQX A;  2LAI A;  3CHS A;  2PZI A;  4ACL A;  5D0O D;  3V5U A;  2B1E A;  2CFZ A;  3WXX A;  4GPK A;  4UVB B;  2Q9Q C;  2Q9Q D;  3U4T A;  5M4Y A;  4ISS A;  5L3D B;  3VHL A;  4KBM B;  5CCM A;  3NF1 A;  1OWP A;  4H9Q C;  3UT4 A;  2J4D A;  4PAG A;  3KBT A;  3EHN A;  3V5S A;  4H7X A;  4IRU A;  3LYA A;  3CVY A;  5G55 A;  4XI9 A;  4MHC A;  2KLQ A;  5ENN A;  3MV3 B;  4X1I E;  4TX5 A;  4DND A;  4OYJ A;  4IHJ E;  5DBK A;  2CG2 A;  3O1H A;  4AQG A;  5A1L A;  2Q7F A;  2MBG A;  5ANR A;  4U07 A;  4APO A;  2LSV A;  2NOX A;  3ANW B;  4E7Z A;  2VSN A;  4X20 E;  4JXT A;  4P0A A;  1HE8 A;  2I9C A;  4HLE A;  3N2K E;  4M1P A;  3ZMV B;  4PJJ A;  2XQY A;  4ILI A;  4P09 A;  4OYK A;  3DPD A;  5G05 C;  4EBA G;  3C4W A;  4F3V A;  5BMV E;  4ILG A;  2IOS A;  5LP6 E;  3PUA A;  3KVA A;  4U74 A;  1E8X A;  4I1M A;  3MJW A;  5EX0 A;  5HI7 A;  3EJN A;  3ASD A;  2MHK A;  3UT7 A;  5L3G B;  4G24 A;  1HX8 A;  4H63 V;  3J7Y q;  2NSZ A;  3L54 A;  3Q49 B;  2XAH B;  4DVD A;  4GB9 A;  2XRZ A;  1FVF A;  3LK3 B;  4L2Y A;  4LEU A;  4H9S E;  3FUK A;  1ZV4 X;  4L23 A;  2J4B A;  2Y6X A;  2KM4 A;  4FC8 A;  4CEM A;  3DP7 A;  4YHJ A;  4QKN A;  2N9D A;  4JA7 A;  4DBR A;  1HS6 A;  4YVO A;  3QC9 A;  1E96 B;  3C98 B;  4EZL A;  4U0U A;  3C50 A;  4WW0 A;  3ZRH A;  2J07 A;  2X68 A;  2VKO A;  3FH7 A;  4J8E A;  3NBX X;  4B89 A;  4C90 A;  2E9X A;  4HVB A;  4J8S A;  2XCB A;  5EK2 A;  3KFW X;  3K8P C;  2WXG A;  2N1G A;  5LX8 A;  3MEK A;  3ESK A;  2AVP A;  3S2A A;  4DJA A;  2Y4T A;  1HG5 A;  2E9X C;  2JJ9 A;  4P0B A;  3L08 A;  2CCQ A;  1JPL A;  2C2L A;  3ZYM A;  1FVH A;  5J1G A;  4H9N C;  2KZT A;  1Z3X A;  3UX4 A;  5CHE E;  1S94 A;  2GW1 A;  2CHX A;  3QKY A;  2MRI A;  3LXU X;  3FTS A;  3CQX C;  5E76 A;  1IQU A;  1IYG A;  4FJO A;  2G0U A;  4EBA A;  3Q9D A;  3ENE A;  2ACX A;  4ZS3 A;  2XGM A;  3BG1 B;  1NWM X;  4L2L A;  3SRZ A;  4WNK A;  3EIQ C;  4HOR A;  1JWF A;  2ZM8 A;  1MMA A;  4UWG A;  3NQP A;  5KJM A;  2ZMA A;  2RD0 A;  3WAJ A;  4YJ2 E;  3ONK A;  3QUJ A;  2MOW A;  4GZ3 A;  1N54 A;  4NUR A;  4XKC A;  2BTD A;  1D1A A;  1BPO A;  4XE0 A;  2BDE A;  4CXX A;  4XX5 A;  5LYJ E;  5FTP A;  4IE5 A;  3D9K A;  4MS6 A;  3G2T A;  4EYY R;  2KC7 A;  4DMV A;  2PBI A;  3ML8 A;  3GZ2 A;  2LSY A;  4I1A A;  1PY1 A;  1EZ3 A;  3O4X E;  4OFZ A;  3ZLI A;  2LSK A;  3IEG A;  3I5P A;  4WNF A;  2SPC A;  4I6E A;  2KMF A;  4XI0 A;  3U3W A;  2NTX A;  5GON E;  3K3N A;  3OXF A;  4I9E A;  2KAT A;  3N9M A;  3FTW A;  4CRW A;  4MKT A;  1YW0 A;  3CQC B;  4EIW A;  2PQN A;  4JEH A;  2WXQ A;  3AU4 A;  3HYM B;  3LY9 A;  3D3M A;  1G73 A;  4EZH A;  2NW8 A;  4JEU B;  4GK5 E;  3FUM A;  3CHP A;  2IU1 A;  2V1D B;  1O3X A;  2V8S E;  4KT6 B;  4G23 A;  5E75 A;  4L5G A;  3GMI A;  3URZ A;  3KBU A;  2EHO B;  1A17 A;  2AXV A;  3ZCJ A;  1FMW A;  5T4Y A;  2C5K T;  2MYS A;  2N2N A;  4WWO A;  2R5S A;  4GMJ A;  1PAQ A;  5JHA A;  2I1K A;  2NWB A;  4BT9 A;  1Z3Y A;  4GYW A;  1SHZ C;  4I55 E;  2X3M A;  2FO7 A;  4HOT A;  3I1A A;  4BFR A;  4MBQ A;  2YIN A;  5HXC A;  4GYO A;  2KCL A;  5HWX A;  2Y4U A;  2LNI A;  3Q5X A;  5JDL A;  3ZEF A;  2BZB A;  4PNI A;  4KVO A;  4BJM A;  4AY6 A;  1QZ2 A;  2JEK A;  1HXI A;  3QK6 A;  3AA6 B;  3CML A;  5FXX A;  1OWO A;  4PK4 A;  1UX5 A;  5JJT A;  3VTX A;  4C9B B;  4B8C B;  2FEZ A;  3T5V A;  2WQH A;  4PS3 A;  2C0S A;  4GZC A;  4KBQ A;  4UEL A;  5J90 A;  3RYC E;  4JHK A;  2LM9 A;  4LRZ A;  4LCT A;  1E7V A;  4O4J E;  3IBP A;  5CMW A;  5KJK A;  3T5X A;  3PUQ A;  4DLQ A;  1QNF A;  3RRM B;  3OBV E;  1YA0 A;  1S35 A;  3RO2 A;  3ML9 A;  3FBL A;  4J6I A;  4FUL A;  4DI3 A;  5FZQ A;  2CA5 A;  4O4I E;  4GYY A;  3NRX A;  3NZP A;  2FBN A;  3FEX A;  3ONX A;  2CWY A;  3CVR A;  3WI3 A;  3OKQ A;  4W9R A;  3QAR A;  4PFP A;  3LCA A;  1LF8 A;  4JC8 A;  3FUI A;  5EZY E;  4GAA A;  3LBX B;  4O4L E;  3FTU A;  4AXH A;  5LGN B;  4K0U A;  4GA1 A;  3O4Z A;  5LNK A;  4URK A;  3BEE A;  2LOP A;  2ODV A;  5FQ6 A;  4EXT A;  4G25 A;  4CDN A;  4B8A A;  2X9W A;  1H6K A;  2X67 A;  5FQ8 A;  2E9X D;  3FUD A;  3AS5 A;  4HS2 A;  1WRD A;  2D0T A;  2KZ7 B;  5TAO A;  4WAF A;  5HQ8 A;  3AAA B;  4U72 A;  2WXR A;  3ZC1 A;  3G2U A;  3I3N A;  3FUJ A;  4XIF A;  4UQY A;  4WNE A;  4DPR A;  2HR2 A;  3B7S A;  2AWI A;  2WQ6 A;  3TXN A;  4WBN E;  4ERR A;  2J08 A;  3CWZ B;  4BTA A;  5JDF A;  4UI9 K;  4UWK A;  3D0T A;  5CMY A;  1QSD A;  2CHW A;  3D9L A;  5J2T E;  3N2G E;  3MJX A;  4IE7 A;  4WBO A;  5L3F B;  2Y8D A;  2OND A;  4V3I A;  3MA5 A;  1BR4 A;  1H0A A;  2CXL A;  4FA6 A;  1U3C A;  3HVE A;  3B13 A;  3GYZ A;  4EOZ B;  3FH5 A;  1YKH B;  1NA3 A;  5KJL A;  4OYS A;  3RRC A;  2VGY A;  4CI2 B;  4BY6 A;  3E4B A;  4AKL A;  3SFZ A;  3LKU A;  5IYZ E;  1MIV A;  2ZU6 B;  1IZN B;  3KS2 A;  3VLD A;  2D5U A;  4I50 E;  3ASH A;  2DNX A;  3N9L A;  4E85 A;  2XGO A;  3GA8 A;  5M72 A;  4ZI3 D;  3PVL A;  2Q9Q A;  1V9D A;  2X6F A;  2UXN B;  4G1T A;  2VL8 A;  3I9Y A;  2WXM A;  3D9P A;  4IE6 A;  5T8I A;  5H6Q B;  3KV6 A;  1MIY A;  4TV9 E;  4BT8 A;  3N9O A;  5HXS A;  3OXL A;  1X5B A;  1HH8 A;  5AJL A;  2XPZ A;  2I6H A;  4O4H E;  3SHF A;  4KUM B;  4PK5 A;  3SBT B;  5JR9 C;  3S7B A;  3LPZ A;  3TL5 A;  4O6F A;  2MTQ A;  3D9N A;  3QJZ A;  2NP9 A;  4IE0 A;  5F8P A;  3UUX A;  2LEH A;  2WSS V;  2M63 A;  2WXJ A;  3CHM A;  3OJA A;  3ASG A;  3U9W A;  1D0Z A;  4AKR B;  2FUL A;  1UCU A;  3R7Q A;  3ZEF B;  2IAK A;  3FXE B;  2DWK A;  2HPL A;  4NQ0 A;  2VTB B;  1OUV A;  5A7D B;  4AJW A;  1HG2 A;  4BX8 A;  4PS8 A;  4GZD A;  4WWP A;  4CCA A;  1TEZ A;  4GCN A;  4GCO A;  4YLH A;  3CGH A;  2OVB A;  4UQZ A;  2WMO A;  2XHE B;  3LJC A;  3PNT B;  3GN5 B;  2HM8 A;  3KVB A;  3GZ1 A;  2HO1 A;  2VB6 A;  2HPJ A;  2IJG X;  3BK9 A;  4GA0 A;  3L22 A;  2MOZ A;  4AVX A;  3SZ7 A;  2VKJ A;  3AA0 B;  4DO0 A;  4UWH A;  3ZVV A;  5FYM A;  1D1C A;  5T3R A;  4L7T A;  3BG0 B;  3Q15 A;  2KIN B;  2ILR A;  2UY1 A;  5G05 J;  5EDS A;  2VGX B;  1LKX A;  4KMC A;  2J49 A;  5LHH B;  3CR3 A;  2EQX A;  2XUE A;  5L3B B;  3AVR A;  1IJ5 A;  3QNK A;  2H7V C;  3TXM A;  3LVR E;  3VTY A;  4Q94 A;  3H37 A;  4PFO A;  2OOE A;  4BTB A;  2L6J A;  4KXK B;  5LXT E;  1H2U A;  4OK0 A;  5FY0 A;  5JR9 B;  3CIA A;  2X51 A;  5DQV A;  3IEE A;  4Y6W A;  4F7A A;  5LGT B;  4HEA A;  4GYR A;  3RIB A;  4TV3 A;  4AY5 A;  3ZHE A;  3ZIM A;  2CXD A;  2JMK A;  3ANW A;  1FCH A;  3RYF E;  2RP4 A;  1UN9 A;  4FAD A;  4J8F A;  4AKH A;  2XGS A;  2A72 A;  4JL0 A;  2L0T B;  4L9I A;  2FF4 A;  4RSY A;  3HKE E;  2LSJ A;  2EHO D;  4B6X A;  2QA7 A;  1D1B A;  3ESL A;  4KYO B;  4CXW A;  2VJ8 A;  4FU3 A;  2CFU A;  4RG9 A;  2QY7 A;  2K9A A;  3VKG A;  2XEV A;  4I43 A;  4XAX B;  1IQR A;  3FWV A;  4CGV A;  2KXP B;  1ZBP A;  1U4Q A;  5LCW J;  2J09 A;  3LG7 A;  1MQS A;  4JLE A;  1YD8 G;  3B7T A;  5EKQ D;  1S0P A;  4AQF A;  3K3Q C;  2L9Q A;  4UI9 C;  2W0G A;  4CT4 A;  2PG8 A;  3JQ1 A;  2YQ8 A;  1NZN A;  3QC1 A;  1H2T C;  5E0O A;  1Z0P A;  3N9P A;  2WPV A;  3RPU A;  1WR6 A;  4DK5 A;  5EK3 A;  4I2W A;  1MIW A;  4OVV A;  2YU2 A;  2VKH A;  2PM6 A;  1ZEE A;  2DWG A;  2KWI B;  3FUF A;  3C4X A;  2QGS A;  3UUX B;  3C64 A;  2E9X B;  4I2Z A;  5JRC A;  3ZXS A;  1E1H B;  2VQ2 A;  3FXD B;  3UT5 E;  4CZZ B;  3PDY A;  3JUI A;  3FFL A;  2V7I A;  4TUY E;  4E6H A;  1TJF A;  2A5U A;  4PUC A;  2BVL A;  5AIJ A;  2KND A;  1HCI A;  3CQG B;  2P9B A;  4HN9 A;  4PH4 B;  4YND A;  3QK0 A;  2WMN A;  1H7C A;  1JWG A;  2LJL A;  3SOL A;  4NRH B;  2V4L A;  3MKD A;  2NXP A;  4IDZ A;  4GA2 A;  3EDV A;  4MFR A;  2WXI A;  4K0R A;  3GZS A;  5JDN A;  4M3O A;  1L5J A;  2GRL A;  4GU5 A;  4A1S A;  4C0E A;  1XGW A;  3RK6 A;  5A23 A;  4PJM A;  4G11 A;  2I59 A;  4N3A A;  3L09 A;  4K03 A;  1LVF A;  4PW8 A;  2DCP A;  4DI4 A;  3ZFW A;  4BSX A;  3HR0 A;  2WXO A;  4PDX A;  3G2V A;  5EK4 A;  2WM9 A;  2R59 A;  5KCM A;  2DI4 A;  5KDM C;  4IGU A;  3CVQ A;  4AIF A;  4HFV A;  1WM5 A;  2OA5 A;  5JR9 A;  5D0Q D;  4O8S A;  2M67 A;  1UX4 A;  3MYV A;  2V7L A;  1IHG A;  4P29 A;  2DCF A;  4U0Z A;  2VTB A;  4B94 A;  3ZJ1 A;  3N5L A;  4AI6 A;  3FUE A;  1WAO 1;  3CVN A;  4HOU A;  1U5P A;  3CVP A;  3K9I A;  2XRY A;  3ZN1 B;  5FMN A;  1BR0 A;  1WYC A;  2WB2 A;  2IC6 A;  4H9P C;  3TGO A;  3PUJ A;  5CA1 E;  3SWH A;  4HTE A;  1NA0 A;  1BR2 A;  3L16 A;  3B7U X;  4NUU A;  2KCK A;  3UUN A;  4JEH B;  3FHE A;  2XPY A;  4UWL A;  4PK6 A;  3U78 A;  3ZYQ A;  4MLP A;  3CEQ A;  3F31 A;  4APF A;  4HOS A;  1MNE A;  3O48 A;  3PTR B;  2L0I A;  1SZA A;  4N2S A;  3HA4 A;  3CVW A;  3KV4 A;  5FXV A;  2W00 A;  3KEZ A;  3RRU A;  1UW4 B;  4AV7 A;  4JW1 A;  2CMR A;  5LOV E;  5LCW C;  1NP7 A;  2L8K A;  3CVV A;  3S7D A;  4AM9 A;  4CDR A;  4KMO A;  4ANJ A;  3N9N A;  3NRY A;  1HO8 A;  1UN8 A;  4JZY A;  2KCV A;  5DAB A;  5JDG A;  1MMD A;  3L6A A;  3DBS A;  3HL6 A;  3E08 A;  2JQQ A;  2XAS B;  2V7M A;  2BUG A;  4QX7 B;  1EDU A;  4Y6C A;  3R7R A;  4IE4 A;  4FP7 A;  2DBA A;  3UQ3 A;  4HOQ A;  4G26 A;  3KV5 A;  3FU6 A;  2QFC A;  4HFG A;  5LOZ A;  1D0Y A;  4TUU A;  4NUV A;  3K3O A;  3VLE A;  5G2N A;  2A4Z A;  4TN7 B;  4CXY A;  2XCC A;  3CHO A;  2VSO E;  3ZMT B;  1MHQ A;  3M65 A;  1LVK A;  5C2Y A;  3ZW3 A;  4YVQ C;  2V26 A;  3PDN A;  2AW6 A;  3EDT B;  2XAQ B;  3CKB A;  2K24 A;  3PRE A;  1E90 A;  3HIZ A;  2L3L A;  3CK8 A;  1ZHC A;  4NAC A;  3KDS E;  3JC6 D;  3MZL B;  3CKC A;  3WAK A;  4EPZ A;  4CDM A;  3AAE B;  1NAF A;  4ZI7 E;  2VK9 A;  3JYS A;  4QXH B;  4ZOL E;  3ZGQ A;  2X6I A;  5LG4 A;  2NC9 A;  4FLB A;  4I9C A;  3PE4 A;  1SQM A;  1T98 A;  3UFE A;  2YEV C;  3PU3 A;  3AS4 A;  4H63 H;  1ZKE A;  5KMG P;  2J9Q A;  1OWL A;  2EHO C;  1X79 A;  2K48 A;  4AOF A;  3ZC0 A;  3RJV A;  4JHJ A;  1KNZ A;  3VKH A;  1KT0 A;  1WY6 A;  2X0L B;  2WXP A;  4HGA A;  4CT0 A;  3ZMU B;  5A6C A;  2V0P A;  3U64 A;  1QQE A;  3VU7 H;  5J08 A;  5DIZ A;  4UWF A;  4FHJ A;  2WBL A;  5JQG E;  3CX6 B;  1VOM A;  4AKG A;  1KLX A;  2PJQ A;  3GW4 A;  5KJN A;  3HHM A;  4HXI A;  4EYU A;  2E8I A;  2CE7 A;  1ELW A;  2RA1 A;  5ADX L;  3AA7 B;  3IKO B;  4A3V A;  5KX5 E;  2J1D G;  3CSF A;  2LHN A;  1EYH A;  3S7J A;  1OWA A;  4A3T A;  3PS6 A;  2Y48 B;  1OXZ A;  3U66 A;  2WWU A;  4CI3 B;  3FDH A;  3Q2M A;  2XAG B;  5BNW A;  5HXE A;  1HFA A;  3MK7 C;  5CCL A;  5LBQ B;  3MGB A;  3CHQ A;  3MKR A;  2WXN A;  4WNG A;  5FNV E;  4J8D A;  3H3A A;  3OTN A;  5LA6 E;  3MCX A;  5BT1 A;  3MKQ A;  3FTY A;  3EUH A;  3EDU A;  3RYH E;  4HE8 A;  3PE0 A;  5G04 J;  4G2A A;  3GN5 A;  1VDY A;  2JMH A;  1WLX A;  4GK0 E;  4TZ4 C;  5HYA A;  2I1J A;  3G2S A;  1TJC A;  1XNF A;  5LP0 A;  5BPP A;  5FXZ A;  4J2C A;  3T8M A;  3RX6 A;  2VSX E;  4QXC B;  3CK7 A;  3ONL A;  3LDZ A;  2Q9Q B;  4AXP A;  3SD5 A;  2LHR A;  3RU0 A;  2C0L A;  2IOL A;  5FQ4 A;  5FZS A;  4F53 A;  3O1I A;  4N3B A;  4UXN B;  1ELR A;  5BUZ A;  5LJM A;  4F1S A;  2VGX A;  2HH7 A;  2CXF A;  3EVY A;  1N52 A;  4MAL A;  4AEZ C;  4FJZ A;  3ZCI A;  3U3I A;  2VYI A;  3I4R B;  2LO6 A;  3MZK B;  4AQF C;  2Y3A A;  2LOS A;  2E2E A;  3C4Z A;  3G2W A;  3FP3 A;  4WWN A;  4IST A;  4ASK A;  4ZI2 D;  3MKQ B;  5JH7 E;  3I0O A;  4UIG A;  1HU3 A;  3LS8 A;  3RYI E;  3NZS A;  3D9I A;  1B7T A;  4CGW A;  2XHE A;  3CVX A;  4KZ0 A;  3UPV A;  1QUU A;  3CK9 A;  1ELK A;  2H3R A;  2CEA A;  4BA9 A;  3TJP A;  3LK4 2;  3BQL A;  3EHM A;  4H7Y A;  4ANU A;  5C1D A;  4N78 D;  4E7S A;  2R17 C;  3AS8 A;  5FZR A;  4GML A;  3HKD E;  3FH8 A;  3JQ0 A;  2ZM2 A;  4I6J A;  4PJN A;  5FY7 A;  4PS7 A;  3UT8 A;  1UG3 A;  4QX8 B;  3PUK A;  2KZT B;  4LUN U;  3D9J A;  5LJN A;  3Q4A B;  5LCY A;  3OXG A;  2XQ0 A;  3UUM A;  4FLH A;  1JUQ A;  4XZ4 A;  3NZQ A;  2OV8 A;  4WND A;  5BW8 C;  3CLJ A;  3R84 B;  3OYZ A;  3AA1 B;  2IF4 A;  4Z8X A;  4MLK A;  5FT9 A;  3RC8 A;  3ULQ A;  4D10 C;  2WQ7 A;  4GZ5 A;  4XZC A;  3P7I A;  2PL2 A;  4BX9 A;  4DMW A;  2ES0 A;  4QXB B;  3P8C D;  4R7L A;  3SS1 A;  3DJB A;  3IHV A;  5DJQ C;  4UI9 J;  1IAP A;  3SNX A;  1SA0 E;  3N9Q A;  3Q5W A;  3ZHE B;  3KAE A;  4UVC B;  4ANX A;  4A55 A;  2FI7 A;  3T8O A;  2LSG A;  2X6K A;  2Z6E A;  4U63 A;  1AJ3 A;  2V5F A;  3LFM A;  1DVP A;  4JEU A;  3CV0 A;  4B0Z A;  3I4G A;  4TV8 E;  5JVD E;  5L2L A;  3JCK C;  4WUY A;  2X9H A;  3FHN A;  2WXH A;  2JRK A;  2X38 A;  5LBM A;  3ZN3 A;  3RH3 A;  4U04 A;  2VKD A;  3AB3 B;  3S4U A;  3F2E A;  2AXU A;  2PQR A;  2KWH A;  3LK2 B;  2X6H A;  3PRZ A;  4ZI2 C;  2K5B B;  4UV8 B;  1FIO A;  4JHR A;  5J2U E;  3KIN B;  3PZD A;  1MMN A;  1INZ A;  3LVQ E;  3CVL A;  2CM0 A;  2D2S A;  2DHR A;  4O2A E;  3PH0 C;  3SI5 A;  4ADZ A;  3HI2 A;  2UY1 B;  2XTL A;  3LY8 A;  2CWO A;  4ACK A;  2X9X A;  3FU0 A;  1GW6 A;  3PUS A;  1E8W A;  1DNP A;  5CB4 E;  4EQF A;  4U8H A;  1PC2 A;  2BVM A;  4EZ4 A;  3C98 A;  2VWA A;  2X9Y A;  4LER A;  3F57 A;  2UXX B;  5JRE A;  4AP2 A;  3QWW A;  3IHY A;  2JLB A;  3IF8 B;  3HKC E;  3OAW A;  3J9X 1;  4CQI A;  2YU1 A;  3RKO A;  1E8Z A;  3W15 B;  4FHK A;  4ZI3 C;  5LGU B;  3ASF A;  2A3D A;  5IHY A;  4N2Q A;  2IQC A;  3AVS A;  4H9O C;  3FB2 A;  1H19 A;  2C5J A;  4QFV A;  4EZK A;  5AEN A;  5HXR A;  3HDX A;  2X66 A;  3L3P A;  3LY7 A;  5CA0 E;  4C0M A;  4EB6 E;  3ETV A;  2LT3 A;  2XAF B;  3QWP A;  5JDQ A;  2H7O A;  3KV9 A;  3VLF A;  4KZC A;  2RG8 A;  4Q69 A;  3ZMS B;  2LSI A;  4GOU A;  1BR1 A;  2WAU A;  3AAI A;  2DLR A;  3N71 A;  1HS7 A;  4ANV A;  5JJ6 A;  3A5X A;  3KD7 A;  5ARF A;  4A1G A;  1MMG A;  3OYX A;  3UUL A;  4I6G A;  2GK9 A;  5DQW A;  4Q96 A;  3CHR A;  5FQ7 A;  4UVA B;  5JRC B;  1ZU2 A;  3UMV A;  4IIJ E;  3PEV B;  4JVS A;  5FXW A;  3CX7 B;  3RRN B;  3TAX A;  5L3C B;  4MRU A;  2W63 A;  4O2B E;  3FU3 A;  5AYW D;  1VRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...