1HF8A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Clathrin
total genus 102
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hf8A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hf8A01
2LO6A 1HG5A 5CMWA 3D9OA 4NACA 2V8SE 2BF0X 5J08A 4Q94A 3G2TA 4GZDA 1PY1A 4FLBA 2KM4A 3D9LA 1HX8A 1INZA 3D9IA 3D9JA 1UJKA 2DIWA 3ONLA 3LDZA 4GZCA 1UJJA 1JWGA 4Q96A 3ONKA 1MHQA 1DVPA 1HF8A 1HG2A 4HFGA 3G2SA 3CLJA 3ZYKA 3ZYQA 3G2VA 1JWFA 1ELKA 3G2WA 1JUQA 1LF8A 1SZ9A 3D9PA 4FU3A 5CMYA 4AVXA 1XGWA 3D9KA 1X5BA 1H0AA 2DCPA 5LP0A 1SZAA 1JPLA 1HFAA 4JXTA 3G2UA 1EDUA 3ZYMA 2MOWA 1EYHA 1VDYA 2L0IA 2QY7A 3D9MA 3RRUA 2L0TB 3ZYLA 5LOZA 3D9NA
chains in the Genus database with same CATH superfamily
5ABGA 2XEEA 4H7YA 1GW6A 4XI0A 3V5UA 2WDRA 3ZNGA 5KBAA 2YHCA 3E33A 3SS1A 4GU5A 3K3NA 2E8IA 5F3JA 5AQRB 3EU9A 4LRZA 2MTQA 3NZSA 3S7FA 3C98B 3UU3A 2E2AA 4A98A 4ILCA 2UUBT 3S7DA 4JB8P 3FZMB 5KNGA 3J9X1 2J4DA 1T98A 4I50E 3VR9A 4EB6E 3QB5K 4BJNA 1HFAA 1IBKT 5BPPA 4P1NA 3LVQE 3UU8A 3LVRE 3DRAA 2LSUA 2XAGB 3NAWA 2L8KA 1JWGA 1IZNB 2VKDA 3AE6A 1DVPA 3QJZA 1SE7A 3Q9UC 5J1GA 3L8RA 2IJGX 1BD8A 2OEVA 1XDPA 2W66A 5KNHD 4CDMA 2LKGA 4OAVB 3C4ZA 5BXUA 1FEWA 2ACXA 3SWHA 3CX7B 3BQKA 4B6XA 4OX9T 5EIBE 4JXTA 3QC9A 4LF9T 4IE6A 4MRUA 1A17A 3PJAA 3Q7AA 2V4LA 3T5XA 1HG5A 2WXQA 2BF0X 3I9WA 3QWWA 1IBMT 1H2TC 4Q69A 1YA0A 4G1TA 2Q9QA 4CYMD 1HX1B 2FULA 5AQ9A 3SFEA 2L6JA 3QB5A 4AKRB 3UIOC 4IIJE 3CVVA 2AE9A 4YDEA 1O1TA 3RK6A 2MOWA 2LSJA 2PJQA 1N36T 4NXMT 4H63H 3L3PA 2NC9A 3BQIA 1S0PA 2DL1A 4GZDA 3ZFWA 2AXUA 5IWAT 3EVYA 5JDNA 5AQJB 3RC3A 3LDZA 5JR9C 3LJNA 3PUWF 2J8SD 3G2SA 2X66A 3FTYA 5M72A 3RX6A 1JCSA 5ENRD 1IKND 1JUQA 5JMND 4GTVA 4GTTA 4AVXA 1DCQA 3WXXA 4U7EB 2XQ8A 5ENOD 3SRZA 4GKKT 5G55A 2AXDS 2VSOE 1YMPA 2J49A 3EHMA 4PW8A 2AWIA 4AKGA 3KSLA 3OJAA 3ZMZB 4QKNA 4ILHB 3ZC1A 2XPIA 4ANVA 3VLFA 3CMLA 5G05J 3ZGQA 1YKHB 4JI4T 5JR9B 2KWHA 3CK7A 3T5VA 2ACZA 3O4XE 2MRIA 4UV8B 3MKRA 1HNWT 5J0ZA 3UT5E 1OEDE 4EEBA 2E9XC 4PNIA 3ZUVB 5JRCA 3O1JA 4ILUA 3CVWA 4QX7B 4LF8T 2XGOA 3UUBA 1E8ZA 3P4QA 2XQYA 2EHOB 3UMVA 2OV8A 3UULA 2DZNA 3MZKB 4HI9A 5KXJA 2H6HA 2H7OA 3FTUA 3HYMB 4HWHA 1HCIA 3CQXC 1LVKA 4LSZE 2HE0A 2BG9E 2C5IT 3AA0B 4H9SE 4F6RD 4DV4T 2NP9A 2W4XA 2QYJA 2E9XB 2YKSA 4PAGA 2RPAA 3TWWA 5CMWA 1TNUA 2DCFA 2K5BB 3UTKA 3CK8A 3MKDA 3NOCD 3LS8A 4WZXA 2WVIA 3UPVA 2WXHA 2LUHA 3WAKA 2YNQA 2XEHA 3AG3E 2YQ8A 4ZZCA 5FIOA 3RYFE 2LM9A 4RLYA 1HG2A 1BI8B 3RKOA 3LBXB 2H7VC 4IE0A 3GZSA 4X1YE 5EIDA 1KF6A 4DUYT 2QRXA 5JDFA 3FUFA 3ZYMA 2Y4TA 2BUGA 4G8LA 1OXJA 4GCOA 3FHNA 4ILGA 2NW9A 2XAHB 3PRZA 4GA0A 5HQ8A 3CVYA 2B76A 3QARA 2VQ2A 4DV3T 2HYZA 4ERRA 3D9JA 4A1SA 5FY7A 2R2LA 2VJ8A 4BWRA 4JBWF 2C0MA 3AXJA 4CXYA 1HO8A 1QYMA 2X38A 5EILA 2Q7FA 3ZMUB 3L13A 4HEAA 4CN1A 2V0PA 2XM1A 3KBUA 3AG4E 4XAXB 2XPYA 4ZHBA 2YHEA 2RD0A 2LSGA 2W2UA 3FEYA 2H88A 2CBJA 3OAWA 3SBSA 1XZYA 1MX6A 2X9HA 2VSXE 1NAFA 2LKHA 2A9UA 2P9UG 4AY5A 4HLLA 2HN2A 4K03A 4K5AB 3L6AA 1ZHCA 4DBQA 1E90A 2DHRA 4XEIG 4HRLA 4OFZA 3LSVA 3RIAA 2LNIA 2V7KA 5JDLA 3G2UA 5LP6E 4LG6A 2XAFB 4ZI2D 5JQGE 2W00A 3BEEA 3PZ4A 1SQMA 2DYSE 3CEQA 4BFRA 4J8FA 1NA3A 3CHOA 3NWIA 4BSZB 4UR9A 1NFIE 3TWQA 4GA1A 3I0QA 3CIAA 5C1DA 1SA5A 1U4QA 4OHFA 2ODUA 3NQPA 4DNDA 4TWHA 3PE3A 5HWYA 4DI4A 3PNLB 2P9NG 3QAQA 5G2NA 2FO1E 4JEHB 4UWHA 1AWCB 4JI0T 3RC8A 2IONA 4DMWA 3LY8A 2XGSA 2GGFA 4CT4A 1K3ZD 3CK6A 2Y8DA 1XMQT 4CQIA 3KV4A 2CXLA 5ANLA 1XWMA 4WNKA 4ADZA 3HKEE 4HXIA 4JZYA 5KDMC 1H7CA 5ARGA 4MBGA 2WAUA 4AIFA 3P4RA 5JJTA 2IAKA 1SZAA 3I0OA 3ZPOA 2ZIRA 1MIWA 1ZB1A 4E85A 3GA8A 3UU5A 2ZM8A 2CLYC 3LK2B 2LO6A 2DI4A 3LK3B 4EECA 2N1GA 5EDSA 3VKHA 2XQ4A 2HH7A 1D1AA 3FU6A 4XE0A 5DBKA 4FP7A 2QA7A 2WXKA 4IL9A 5FJYA 3C3QA 4X62T 4TV8E 2WZIA 1JCQA 1I6ZA 4IREA 5IY5E 3SZ7A 3GN5B 1SUMB 4EBAA 2CMRA 2PNNA 3UUMA 4DV5T 4DV6T 3RIBA 2WPVA 4I9CA 5FVLA 3ZC0A 2XQ0A 2FF4A 3ZXPA 4JVSA 3N9OA 4HS2A 3BK9A 2EQXA 2CLYB 4I6GA 2H89A 3AVRA 5CRVA 5ABFA 4UXNB 4O4JE 4GMRA 3MJXA 2ZGDA 2OA5A 3HXDA 3L54A 4JC8A 2LSVA 2NWBA 4HWIB 2I2OA 4UQZA 4J6IA 4ZEYA 3MK7C 4DR1T 3NF1A 3UTMA 2LOSA 2D9DA 4CGWA 1WR0A 3ZN3A 3EIQC 4UQYA 3NB2A 3M65A 3EIJA 2K24A 4OAUC 2F0YA 4D10C 1Z6TA 3DEPA 3C64A 3HXCA 5JDQA 3K1SA 1EZ3A 4XKBA 2XEVA 3KINB 1K8KG 2FBWA 3EUHA 2M63A 4JI6T 4YDWA 2YN6A 1U3DA 5CJ5A 4HWCA 2QYUA 1N11A 5AJLA 2JQ9A 1IQRA 1KEYA 1KNZA 3CV0A 3ASOE 2P2CP 4HORA 2ZM6T 4V3IA 3IBEA 3KD7A 1M62A 3FZHB 3Q2MA 3AG1E 4WBOA 4DUZT 3SFZA 4DV2T 3E34A 3UKUG 2VWAA 2X6KA 3TL5A 3CKBA 1MJ0A 1UW4B 1X81A 3ANWA 3AA6B 2B6CA 1WCRA 4CRWA 2ES0A 3G2TA 4FJOA 4FLBA 3P8CD 3N5LA 1ELWA 3ONLA 3ULEG 3K3OA 4Q96A 1UX4A 2XAJB 3E0ZA 5FL1A 5AQFB 5LGTB 5AQBA 2WQ7A 4HFVA 3ZJ1A 3G2VA 4AV7A 2J07A 3ONXA 3WG7E 1W0BA 2XZEA 3CHSA 3D9PA 3SOLA 5J2UE 4I2WA 2VGXA 4JI3T 2QC9A 2QY7A 3ZCJA 4JPSA 4A56A 2A5UA 2W61A 4NUVA 3TWTA 3ZPJA 1HU3A 5AARA 3IHRA 4TZ4C 3C50A 2WDQA 1FJGT 2GRPB 4O2AE 2XAQB 5EK4A 3PS6A 4X1IE 2JLBA 4N2SA 4O60A 4MALA 3ZEFB 4YT0A 1JNRA 3LDQB 3PNTB 3KVAA 2WY2A 2OVBA 4O2BE 3R9AB 2BEDA 5LMNT 5L3EB 2YU2A 3SI5A 4CCAA 5KJMA 4DV0T 2W63A 2NW7A 4BAYB 5LMUT 4JYAT 3L16A 4FJZA 3TJPA 5J08A 3R7QA 2WCAA 3MACA 3ZMTB 1MMGA 2WXNA 4C0MA 3AAAC 2HM8A 1E2AA 4KI0F 1UOHA 2E5LT 5CERB 1JNZA 1LF8A 1H6OA 3B5MA 4DUIA 3LXUX 2F37A 2X9YA 3F31A 5AQUB 4DV1T 5EKQD 4OYJA 2Y1LE 3J7Yq 3VHLA 5B3SE 4BA9A 3DTOA 4YLHA 4I2ZA 4LF7T 5AQIB 3PUZF 4YJ2E 1H2VC 4JHRA 1D0YA 3I5PA 3EJNA 3OTNA 5FT9A 1FMWA 1WY6A 1U5PA 3ZLIA 1MQSA 3LYAA 4ZXLA 2XHEA 3FFLA 3FH5A 3U3WA 4DX1A 2KZ7B 4Z8XA 4KVOA 3JC6C 4IN3B 2P9IG 4X1KE 1Q2ZA 1S94A 4LFCT 4N78D 4B3TT 4GK5E 4WNGA 2X0HA 3UINC 1WLXA 4NQ0A 4X5TA 4U72A 5AQ7A 1RW2A 3G06A 3B57A 2OV9A 4TWFA 4PK5A 4EIWA 1UG3A 2WXGA 4OVUA 4JHJA 3VR8A 4FADA 5JJ6A 4GZ5A 3FUEA 3PUXF 3DP7A 3LEWA 5LA6E 3UQ4A 3DJBA 3Q9DA 1O1RA 2XPZA 2CFZA 3X2QE 4ZI3D 2NW8A 4QH5A 5T8IA 3FBLA 1CUNA 4FLHA 5DQWA 5EN5D 1OEDA 3Q9NC 2E5VA 2PL2A 3JUIA 3V5SA 2I6HA 2XSBA 4EEDA 2UXDT 2VURA 1KT1A 1W3BA 3C3RA 3AA1B 5AQOB 4O6FA 2RP4A 2QZAA 3KV6A 4BTAA 4I4TE 1N9AA 5LP0A 3H37A 2DNXA 1JPLA 2RG8A 2L9BA 3L82A 4I55E 2BG9A 3NKZA 3U66A 2KWIB 3K8PC 1FT1A 1X79A 3UFGA 3PEVB 5G04J 3ZN0B 3T9KA 3AEEA 4YDOA 4GOUA 4JUYA 4TXRA 3W9GA 1FVFA 4LMLA 2J09A 4J2CA 2M67A 5L3CB 4YNDA 3QOUA 2VL8A 1TR4A 3ZYQA 1W09A 2CWOA 4JEUA 2VKHA 3ZSSA 1YCSB 2L6BA 5CEAA 5FP3A 1LTXA 1QQEA 3JQ0A 1M7KA 4PS8A 1N4SA 1FPPA 2FBNA 3EHRA 1IJ5A 2GRLA 2BKGA 1D0XA 3BQLA 3S7BA 4U7YA 2CHZA 1MMAA 3IHVA 4U33A 3FU0A 3B95A 3FUMA 3EHNA 3PZ1A 4X20E 4OVVA 4O4LE 2J4BA 2YOEA 1NP7A 3TLWA 2JQQA 4UEMA 1HNZT 1BR1A 3ABME 1TNOA 3JUEA 5JH7E 4XKCA 2JQKA 3PV0F 5CFBA 4GTPA 1OWPA 5ITZF 1Z3YA 3I9YA 3C3OA 4DR3T 3AE8A 3HXEA 2H6FA 1YQ4A 3FZLB 5EX0A 3U9WA 2DBAA 3ZKRA 1DCEA 2HR2A 3QDNA 1MX4A 4TN7B 1U3CA 3ZRHA 2VKOA 1OWMA 4QWNB 4I43A 1KT0A 3RLFF 4LF6T 1BLXB 4UVAB 5EZYE 3TG4A 1WM5A 4FC8A 2N9DA 5E76A 3ZHEA 4GTSA 4DI3A 1IHGA 5BUZA 3I4GA 2YDRA 4DR2T 2W0GA 1UK5A 4TXPA 4A5XA 5AAOA 2QGSA 2QVAA 3PU8A 2RFMA 3UUXA 4DO0A 2E2EA 4I9EA 4L23A 5HEUA 3L39A 3RSEG 3Q75A 3HR0A 1NL4A 3JYSA 3MGBA 2ODVA 1YYHA 3FTZA 1N52A 2ONDA 4FHKA 3L22A 3ZYKA 2NTXA 1Y6IA 4DK5A 5ENSD 2WS3A 4CZZB 3FUIA 4PS3A 5CBNA 5DJQC 4WBNE 3SFXA 3AEGA 1UN8A 4PJLA 5FQ6A 2HHHT 5JDMA 4QQIA 2WXMA 4HE8A 2J1DG 2IUBA 5T4YA 3B7BA 3P7IA 2UUCT 1D8EA 3UM2A 4TXQA 4WYVA 3QK0A 4BESA 3CHPA 5LCWC 4UIGA 1U2VG 5JDHA 2XENA 4H9OC 4ATGA 3TXMA 3P50A 5G04C 4QFVA 2F4VT 2EIME 2WMOA 4G11A 4KVMA 3PZDA 4AQFA 2VTBB 2X6FA 4DIDB 4AQYT 2BZBA 2WM9A 1G8XA 3AAIA 4HFIA 1EDUA 1VDYA 2L0IA 3TWSA 2KZTA 2LXLA 3MZLB 2V8SE 1KK7A 4PFOA 1OWAA 2X6IA 4EPZA 5LGUB 3DSSA 2Z6EA 3FBZA 2EHOC 2CHOA 2X68A 1WR6A 3Q15A 5TAOA 3HKCE 2Y69E 4IE7A 2DVWA 2ZU6B 1MZCA 3PJAJ 4XBFB 4F3VA 2CWYA 1ZBPA 2P9BA 3N71A 3CVLA 3EHQA 5KJNA 4HFHA 4MS6A 1LRZA 4TV9E 3ZXSA 3ZSTA 4MLPA 4DLQA 2GW1A 3Q49B 3HVEA 3CVQA 3CVPA 2WXLA 3QK6A 2N2NA 4YTMA 2CFUA 4HB5A 4N3CA 1BR0A 4RG6A 4XI9A 5ENPD 2JMKA 4HWDA 4TNWA 3W9FA 4K0KT 2ZISA 3GZ1A 4GZ3A 5HRYA 3AS8A 1WFDA 2K3WA 1H6KA 5IHYA 4IHJE 1XGWA 3ETVA 3O9XA 3EU5A 2XQ9A 5KWDA 2UXCT 3FTSA 3PH0C 4UWFA 5CBOA 2B0OE 2CPTA 4EZJA 3TGOA 4BX8A 1QSDA 4YHJA 4YSXA 3FULA 4GB9A 3UM3A 3AU5A 3R9MA 2FI7A 5AQHB 2JQHA 5DQVA 5LBMA 4K5CA 5LG4A 4I1AA 3VRAA 3LFMA 2RFAA 3UKRG 3IF8B 2WU2A 3V2XA 5CB4E 3CHRA 5FKYA 2UUAT 3QKYA 4I17A 4FJYA 4L5GA 4XZ4A 1KNPA 3AA7B 3FUDA 1XDOA 4CN6A 5FTPA 2WXFA 1YQ3A 4A55A 5AIJA 4GIWA 1SVXA 3V31A 4GTMA 3X1DA 3OPCA 3WI3A 3JXJA 4UWGA 1VRBA 1MIYA 5H7PA 3RYIE 2NXPA 2XJ7A 4AEZC 5AQTB 2HO1A 5CCLA 4PJJA 5C3JA 1UN9A 3UX4A 3ML8A 2V1DB 2WXOA 4TUMA 5A23A 3D9KA 4N3BA 4IGUA 1XNFA 4EZLA 4UI9J 3PUSA 3UT4A 2V6XA 3TLTA 2VL0A 5L2LA 3BU8A 2XY8B 2UY1B 4U0ZA 2CXDA 4NIKA 4CI3B 4E7ZA 5JDGA 3KDSE 5AQQB 5HWXA 4DR7T 2Y3AA 2CBIA 4ANXA 3MCXA 4EOZB 4EAHA 4ILIA 1SZ9A 3RH3A 2AVPA 4HQDA 5G05C 1S64A 3KS2A 1L0VA 2NTYA 3CWZB 3LCAA 3QB2A 5HXRA 4YHHT 2VKJA 1KNRA 1N34T 4J8DA 4KYOB 2UXXB 1TYQG 3ZIMA 3DSWA 4GYYA 5HXHA 2Q9QC 2SPCA 4IULA 3S2AA 4DBRA 4X8QA 4MKTA 3H3MA 5CGMA 2WQHA 4J8SA 4UELA 3ABVA 3ONJA 3AJIA 2NSZA 3HA4A 3ABLE 4UVCB 2H6IA 4GYSA 2I59A 3HI2A 1R8IA 5ETWA 1Y64B 5L3FB 1QNFA 3ABKE 5CECB 3F57A 4HFDA 4UF0A 5ENTD 2R05A 3VLEA 4ILAA 3LPZA 2Q9QB 1TJFA 5DABA 4TRQA 3NRXA 5LHHB 3O1IA 3PUGA 4LERA 5AQPB 4BEPA 3PUVF 3IXEA 3ASFA 3NVOA 3CQGB 1OY3D 2YU1A 1D8DA 2FJDA 4JLEA 2L9QA 1VCTA 1VCSA 4I6EA 2WQ6A 2WWVA 4CGVA 5LJNA 5AQGB 5AQSB 1NZNA 2KCKA 5C2YA 1LD8A 2IIUA 4AJWA 4HNAD 1H19A 3QUJA 3WAJA 5FINA 3T8OA 3NZPA 4WNEA 3OTOT 1NI1A 2PBIA 4KZCA 4B94A 4UV9B 2OOEA 1OUVA 2JJ9A 4DR5T 4LNBA 2BTDA 5AQKB 5ABEA 4COFA 4WWPA 2XZDG 3TXNA 1FT2A 4U3CA 2KM4A 5LXTE 2I9CA 2LHRA 4KUMB 5HCMA 3PZ3A 2UXNB 4BX9A 3J5PA 2PZIA 2CE7A 3RI5A 2X67A 5BXOA 2BKKB 3DPDA 2CA5A 3T1HT 3F2EA 4LNUD 3I1AA 1E7UA 2VQFT 4AI6A 2C5JA 1ELRA 1Z5SC 3RIUA 1E7VA 4EZHA 3B7UX 4LUNU 1CHUA 2P9SG 5AQAA 5L47A 5JRCB 4NRHB 2V8SV 3FXDB 3NZQA 4C48B 3EUVA 4GYOA 1TEZA 1OWNA 3SBTB 3JQ1A 4EQFA 5FZRA 4HTEA 3JC6D 2MHKA 4GYRA 1D0ZA 4BY6A 2GRNB 2AXVA 3SNXA 4G2VA 2KINB 1KPSB 3SD5A 2Y0BG 3Q47B 4HOTA 3AG2E 1QUUA 2LM2A 2V6YA 1ZU2A 3FUHA 1IHBA 2IOLA 5LG3A 5FXZA 3RKGA 3QNKA 3D9OA 1X9BA 2BKOA 3KBTA 3AEAA 5FQ8A 2JMHA 3AE3A 2VASA 3P4PA 2WXPA 2ETCA 3C98A 2HPJA 3FZKB 3IV0A 3C51A 3O1HA 3U3IA 3JXIA 1N54A 1TN6A 2IEJA 2MOZA 3TWUA 2LRLA 3L9TA 3R7RA 4FULA 3GYZA 4LFAT 3B13A 1MX2A 4HRMB 2IC9A 2V5QC 2GRMA 1EYHA 1N4RA 3CX8B 1HZ4A 3P1UA 2BKPA 3JAFA 2IQCA 4ILBA 2A5EA 3V2OA 3ASDA 3Q5XA 4H9NC 2IDOB 4GZ6A 3NZUA 3NBNB 4P0AA 2ZM0A 1DNPA 4BT9A 3IEEA 3AE4A 2X9WA 1MMNA 4GYWA 5L3DB 3UU6A 4DX7D 2LEHA 4O8SA 4TX5A 4UVBB 4JI5T 4IL4A 1K1BA 3APFA 3FHEA 4J8YA 4GMJA 1RZ4A 3HDXA 2CEAA 2IFUA 5FVKA 2X51A 5CCMA 1N94A 2ZM2A 3AXJB 3Q5MA 2I1KA 1HNXT 2DCPA 4A97A 2D5UA 1L5JA 4I0UA 3ASHA 4KMOA 2FJBA 3D0TA 5J2TE 2V5CA 4ACKA 3OYZA 5D66A 2DWKA 1IQUA 4WW0A 2R6GF 3E30A 2VYIA 2V7LA 4IDQA 4QXHB 1UJKA 3VRBA 3ZU7B 4H9QC 3CVNA 4LF4T 3IKOB 3KEZA 4U04A 2BBJA 3L08A 2AXZA 3S4UA 4H7XA 4X66T 3OYXA 1E8WA 2J4GA 2PTFA 3N2OA 4U7IA 3RYHE 5EX3A 3RPUA 3SQVA 4IDNA 1DU2A 2UXBT 2PQNA 3AEBA 2KATA 2LHNA 2LJLA 3TKLB 3ZCIA 3ZN1B 2Y6XA 2LT3A 1O5MA 1UCUA 4F1SA 3OKQA 3UFEA 2XZTG 2V5DA 4NXNT 3RQWA 2IOSA 3MJWA 3ZMVB 3B7RL 4P0BA 3MA9A 3A7MA 4C0EA 1SA0E 4G26A 4HVBA 3CIRA 1SHZC 4PDXA 4G63A 2XCCA 3CGHA 1XNRT 3MV3B 1J1JA 4Z90A 2XRYA 4LF5T 4WAFA 4A63B 5JR9A 2I1JA 4DV7T 2FEZA 4GCNA 3N9NA 5LFAA 4GK0E 4L0RA 4BTBA 1O1SA 4WUYA 5ABHA 2VGEA 1OXZA 4WWNA 4YY3T 5F5WA 4KBMB 3PUAA 5M4YA 4DMVA 3PREA 1E1HB 3GMIA 4ABNA 2CRBA 3HXFA 2LSKA 5HEOA 4J0UA 3CPZA 2R5SA 3I4RB 3R84B 4U63A 3K3QC 3ULYA 2XRZA 2WSSV 2XQ6A 1BPOA 2MYSA 2IF4A 4FU3A 5CRUA 5BV1A 4CI2B 2J08A 3RJVA 4I1OB 3SY2A 2E9XA 3TWXA 5CEDB 5FY0A 2D2SA 3T8MA 3PURA 2D0UA 1XNQT 2JEKA 4HRNA 4ZI7E 2VB6A 3C5RA 5AYWD 4AKIA 1OT8A 4F8HA 2G0UA 2BBHA 1OWLA 3D9LA 3BQOA 3DSTA 1T7SA 2RA1A 2BVLA 1N33T 5ABFB 3ZJ2A 4CDNA 3LBXA 1MNDA 3N2GE 1UURA 3FZFB 5ADXL 4KXKB 5LNKA 4O4IE 3ESKA 2KCVA 3KSQA 2YDQA 5JREA 3AE7A 4BT8A 1WYCA 3ASGA 4I6JA 2GRRB 4IE5A 2X6JA 3RHWA 3PUKA 3EHZA 3RKVA 3LJ3A 5BW8C 2LSIA 2PG8A 5AQVB 2IO3C 2GK9A 4EZ4A 2E0IA 1UUSA 3ETUA 3ONLC 2EHOD 3QC1A 5HXEA 2XCBA 2UU9T 1Z3XA 4B3ST 4BSXA 1ZV4X 5HI7A 4HGAA 3ZMSB 5HS0A 3Q5DA 4ISTA 2YK0A 1IJ6A 3MXZA 3L17A 2KXPC 2WQYA 3URZA 2E9XD 2P9KG 5ENQD 2J47A 1G73A 3RRMB 4JI8T 1OCZE 1WAO1 1TN7A 3VLDA 5L3BB 3ANWB 2EINE 2BS3A 2EIKE 4ZOLE 4PH4B 5LCYA 4H9RC 3HIZA 5BR8T 2AW6A 1YXRA 4JHKA 3EI0A 4TNVA 3UI2A 4EHMA 2CCQA 3VKGA 2YINA 1B89A 1G3NB 3B7SA 2NYJA 5LBQB 3PEUB 4GPMA 1B7TA 3S7JA 2ZLYA 2VGXB 3N9MA 4TUUA 2KXPB 2WU5A 5L4HA 2Y48B 1TN8A 4ME2A 5LB7B 3DXKG 3MKQA 3N2KE 3FTVA 1T72A 1MIVA 3OXGA 2WWUA 3N9PA 4L1BA 5EYLA 2W67A 3AE5A 2KSRA 2J9QA 4N3AA 3TWRA 5HCJA 5FYMA 4GZCA 2VQET 4JI7T 4HFGA 4U96D 2J62A 3K9IA 3CLJA 4K5BA 4ZI3C 2MYOA 3OVUA 3G2WA 3VTXA 4Q25A 2HPLA 1X5BA 4NPPA 4JV5T 3KV5A 4JEHA 4A3TA 4CXWA 4R7LA 3SFDA 1FCHA 1D1BA 3FB2A 3E32A 3KVBA 4BJMA 3TLUA 3AS4A 4FHJA 3CX6B 4DPRA 4E7SA 1KZPA 4ZZBA 5B1AE 1Z8UA 2W62A 3FTXA 4UI9K 3RQUA 1D9SA 5HXCA 2XUEA 5BV0A 4RQIA 3IHYA 3T1YT 4F53A 4AY6A 4BETA 3BUAA 4DLOA 5EK3A 4IRUA 2CG2A 3SO8A 1FVHA 1NEKA 4Y6WA 5ENNA 3UM0A 3PDYA 3D9NA 3SFYA 3CR3A 4U95D 1BR4A 4NUUA 4CN4A 1H6PA 4GTRA 1EF1C 3AB3B 2LLYA 4KMCA 2XHEB 4U2ZA 2MPKA 4U31A 1MNEA 4PK4A 3GN5A 4LEUA 4L2YA 3AECA 2XQ5A 1JWFA 3HXBA 5E0OA 2ILRA 1BR2A 3E4BA 2A2FX 1TNYA 5JHAA 2K9AA 5LYJE 1OCCE 2RKKA 5EYPF 1Y8MA 2BVMA 1K1AA 4MFRA 4YTNA 3KAEA 3IBPA 4V1Av 1OEDC 2XSAA 3TAXA 2B1EA 4FI5A 4Y6CA 3U4TA 5LHIB 2Q9QD 5A1LA 2KT9A 5LGNB 4MHCA 2BS4A 4X64T 3Q4AB 4F1PA 3LJCA 4G25A 4WNDA 3EDVA 1AJ3A 3CQCB 3KV9A 3F6QA 1QBQA 2PQRA 2CXFA 2VSNA 4WWOA 3DPYA 3ENEA 5L3GB 4W9RA 3ZT7A 2A72A 1E7PA 2WP9A 2BG9C 3DSXA 2JABA 1E8YA 2OCCE 5J90A 1OEDB 3PUYF 2IC6A 3D3MA 4RSYA 1A5EA 4ZS3A 1W9RA 3V79K 4LMJA 3BG0B 5ANRA 4JA9A 1LKXA 2V7IA 2CHXA 3CSFA 1H2UA 5LX8A 1OCRE 1QLBA 4YDYA 2EILE 4ZHQE 3AE2A 5FL0A 4YTPA 4ANUA 3JADA 2P9LG 2KMFA 3OXFA 3NOGD 3RF1A 5HEJA 3UQ7A 3EABA 2IO2C 3FUNA 2XS8A 1MMDA 4NACA 4AM9A 1UGOA 5HKPA 1J5WA 2BG9B 4CI1B 4AISA 1PC2A 2IY0C 2V7JA 3D9IA 3OBVE 2H3RA 2A4ZA 1N0QA 2LOPA 3AAEB 4HOQA 1JCRA 3OXLA 1MHQA 3DSUA 4TUYE 4HLEA 4C9BB 2OLTA 2PM6A 4AXPA 5FXXA 4I1MA 3A5XA 1WRDA 4JEUB 2IHR1 1O3XA 4KX6A 3MV2B 3UXGA 4YVQC 2XQAA 4U07A 2CHWA 4H63V 1V9DA 4UWKA 1PY1A 3FEXA 3DXMG 3ZEFA 4UWLA 4CDRA 3FDHA 5KMGP 2M6BA 2WDVA 4B0ZA 3LK42 3UM1A 4U0SA 3L09A 5KX5E 2C5KT 2VVNA 4KBQA 4KHPT 1IAPA 2V5FA 2WZHA 4DVDA 4ZFHA 4O1OA 2V4HC 4XIFA 4YVOA 3RO3A 5BNWA 3RIFA 2KC7A 4G2AA 4U8VD 4QH4A 4MBQA 5FZSA 2XASB 4ZS2A 1WYBA 5H6RB 1D1CA 2AJAA 5JHBA 4I43B 3AS5A 3E37A 4L9PA 4CXXA 3RRNB 3LG7A 3MEKA 4GTQA 3ZHEB 4YJ3E 3KEAA 4QH1A 2I0MA 3P4WA 5D0OD 5FWQA 2WB5A 3NBXX 5LOZA 3ASNE 3CHMA 3UUXB 2XQ3A 3MKQB 1E8XA 1V54E 1YW0A 2WB2A 4OYKA 3LY7A 2WXJA 5AN8A 3PZ2A 5LJMA 1UJJA 5AENA 1GQEA 2CG3A 2DWZA 3JCKC 4KT6B 4N39A 2JPFA 4U74A 4AQFC 2FO7A 3P4SA 4F6RC 1AP7A 4IDPA 1HS6A 5AQLB 5HAXA 1BU9A 2KLQA 3GW4A 2ZGGA 3ISMC 2C0SA 2JRKA 3I3NA 3FH7A 3CHQA 4ASKA 2WBLA 4WNFA 4M7CA 4IDZA 5FXWA 4DR4T 2HN1A 3SF4A 3FTWA 3PTRB 2V26A 1LVFA 5D0QD 3AE9A 5LOVE 1IXVA 3GWHA 1E96B 4HBDA 3T8KA 4HOUA 4BERA 5L4EA 3TLVA 1Z0PA 3APCA 1ZOYA 5A7DB 4DX5D 5FY1A 3QOFA 5AQMB 4PK6A 3GZ2A 1UX5A 1HS7A 1N95A 4AQGA 5FQ4A 1T8BA 2KZTB 4KZ0A 4U8HA 4ATZD 3QWPA 4UI9C 4XZCA 3VU7H 3Q7FA 2PM7A 3V30A 3MYVA 1YKEB 2R03A 2X6HA 4LCTA 3ZVVA 4HKAA 1FIOA 3EAMA 3RO2A 1MYOA 4U0UA 1N0RA 1TJCA 5AJDA 3Q78A 1QZ2A 3O48A 3Q73A 4HWFA 2PFVA 2X0YA 2GRQB 2WXRA 4ANWA 3ONKA 3P2BA 3H3AA 4APFA 4GAAA 2IU1A 4Z91A 4Q94A 4YFSA 4B93B 1TNBA 3HVEB 3APDA 3PUJA 1Y01A 5C2TA 1W0AA 4KHZF 4OK0A 5FMNA 3O4ZA 5AQNB 4AP2A 3MX3A 4HFCA 4HOSA 1TNZA 4JL0A 3FXEB 1OCOE 2A3DA 4LNGA 3PVLA 4PFPA 5CHEE 1NENA 3UUNA 3QWVA 1I94T 1V55E 3A8YC 4M3OA 4K0RA 4ZI2C 2DZOA 3EDUA 3NRYA 3C4WA 4GPKA 3UT7A 4IT4A 2WMNA 3AEDA 2LAIA 4GMLA 1US7B 2ZMAA 1IBLT 1INZA 4PJNA 5HEGA 4AIUA 4AKHA 3MA5A 1ZP0A 3LY9A 5IYZE 4AOFA 3RGLA 4B8CB 3R6NA 3D9HA 2BKNA 4L7TA 2X9XA 4APOA 1ELKA 1SW6A 3CVXA 1S63A 2D0TA 1SA4A 4RG9A 2KCLA 1S35A 1VOMA 4QX8B 4A1GA 2OEWA 2VSYA 3U78A 4L9IA 2L0TB 4YSZA 5BMVE 3RRCA 1IYGA 2ETAA 4RVBA 3PE4A 2XS1A 4B8AA 2R02A 3PU3A 5BT1A 5KJKA 4O4HE 2UWJG 4N5QA 2DLRA 1LD7A 3JAEA 3HG0D 1ZKEA 5KJLA 5HXSA 1HXIA 4NIQA 3FWVA 3RU0A 2K48A 2YEVC 3JCFA 1H0AA 2MAWA 4X65T 5FZQA 1N4PA 3Q5WA 4N5CA 3RRUA 3HRAA 4QXCB 2ETBA 4YXDA 3TWVA 2JIWA 1EPUA 3PE0A 3FUKA 4XX5A 3DSVA 1BI7B 2LXMA 3FUJA 4J8EA 4ANJA 2C2LA 1NWMX 3ZKJA 2DIWA 4UQXA 1HR0T 4O1PA 2F8XK 4C91A 1HF8A 3IA3A 2EIJE 3IEGA 1S70B 4KP3C 3UQ3A 4B89A 2LE8A 4ACLA 5A6CA 5JA4D 1J5ET 4IYPA 2FUPA 2NR4A 3SHFA 5GONE 3PDNA 2F8YA 1OWOA 2FJEA 2LAHA 2IMLA 4HI8A 3E08A 5CA0E 3ULQA 2C0LA 3M3ZB 2H6GA 2KBXA 2DYRE 2LSYA 3TLSA 4JD2G 3TG5A 5FNVE 1WG0A 2FJAA 3FY4A 3UU4A 2MBGA 3CK9A 3RAUA 3CVUA 4B3RT 3QNUA 2XTLA 3HKBE 2M6IA 2L3LA 4NURA 1PAQA 2VTBA 3PUQA 3FH8A 2KNDA 3AEFA 3LKUA 4U2YA 3ZT6A 4B3MT 2XM2A 3D9MA 4M1PA 5HEHA 2ZXWE 3ML9A 4URKA 2BDEA 4EYYR 4LFBT 3CVRA 1WDYA 1HX8A 2X0LB 5JVDE 5EK2A 4GKJT 1DC2A 4PJMA 4G23A 4UF0B 5KCMA 5ARFA 4GTOA 3AAAB 2LRKA 5DIZA 4P29A 4H9PC 4GA2A 4JA7A 4QXBB 4U8YD 4E6HA 1KLXA 3AU4A 5AFUL 4EYUA 4EXTA 5D2MC 2VGYA 3N9QA 3J5QB 2P58C 5E75A 2DWGA 5B1BE 4MLKA 4HFBA 5T3RA 2R17C 1P5QA 1ZEEA 2QFCA 4HFEA 2IW5B 4JI2T 5FQ7A 3ZT5A 1HE8A 2OVFA 2EHOA 2XQ7A 1N32T 1HH8A 3EDTB 4N2QA 2X3MA 3Q5EA 4C90A 4DR6T 3E22E 3W15B 4PUCA 5IUXA 1NA0A 4ISSA 4AXHA 3RYCE 4HN9A 3RIUC 3ZW3A 2XPKA 3HHMA 3CSTA 1KFYA 2V7MA 1N4QA 5F8PA 3ZYLA 3FP3A 4LMKA 3B7TA 4DX2A 3UIPC 2WXIA 4AKLA 1KZOA 4G8KA 3C4XA 2VK9A 3RRWA 3FU3A 2Y4UA 3AE1A 3BG1B 4TV3A 4K0UA 4JI1T 3Q79A 3HKDE 2R59A 4P09A 3UT8A 3FU5A 4EZKA 4EBAG 4EV6A 3DEOA 3AVSA 4DJAA 5JTGA 2VVSA 4CT0A 5HYAA 4DX6D 4JW1A 4Z68A 5LCWJ 3CKDA 3KFWX 4DRXE 5CMYA 3CKCA 4CZ2D 5CA1E 5C8YE 4TWDA 5H6QB 1HTJF 5JJ7A 2YDSA 4L2LA 4OYSA 4QHOA 2BS2A 3HL6A 2CHNA 2NOXA 4CEMA 4IDOA 3N9LA 3C72A 2GROB 5LHGB 4YSYA 1XMOT 3VTYA 3DWLG 4A3VA 4FA6A 4UUCA 4EGWA 2CM0A 1YD8G 3ESLA 3U64A 3SGHA 4F7AA 2QYWA 2P9PG 5FXVA 2XGMA 4G24A 4PS7A 2V6YB 1FMVA 2UY1A 3DBSA 4J7WA 4IE4A
chains in the Genus database with same CATH topology
4H7YA 1GW6A 4XI0A 3V5UA 2YHCA 4GU5A 3SS1A 3K3NA 2E8IA 5F3JA 4LRZA 2MTQA 3NZSA 3S7FA 3C98B 3S7DA 3J9X1 2J4DA 1T98A 4I50E 4EB6E 4BJNA 1HFAA 5BPPA 3LVQE 3LVRE 2LSUA 2XAGB 2L8KA 1JWGA 1IZNB 2VKDA 1DVPA 3QJZA 5J1GA 2IJGX 4CDMA 3C4ZA 1FEWA 2ACXA 3SWHA 3CX7B 3BQKA 4B6XA 4JXTA 3QC9A 4IE6A 4MRUA 1A17A 2V4LA 3T5XA 1HG5A 2WXQA 2BF0X 3I9WA 3QWWA 1H2TC 4Q69A 1YA0A 4G1TA 2Q9QA 2FULA 2L6JA 4AKRB 4IIJE 3CVVA 3RK6A 2MOWA 2LSJA 2PJQA 4H63H 3L3PA 2NC9A 3BQIA 1S0PA 3ZFWA 4GZDA 2AXUA 3EVYA 5JDNA 3RC3A 3LDZA 5JR9C 3G2SA 2X66A 3FTYA 5M72A 3RX6A 1JUQA 4AVXA 3WXXA 3SRZA 5G55A 2VSOE 2J49A 3EHMA 4PW8A 2AWIA 4AKGA 3OJAA 3ZMZB 4QKNA 4ILHB 3ZC1A 2XPIA 4ANVA 3VLFA 3CMLA 5G05J 3ZGQA 1YKHB 5JR9B 2KWHA 3CK7A 3T5VA 3O4XE 2MRIA 4UV8B 3MKRA 3UT5E 2E9XC 4PNIA 5JRCA 3O1JA 4ILUA 3CVWA 4QX7B 2XGOA 1E8ZA 2XQYA 2EHOB 3UMVA 2OV8A 3UULA 3MZKB 2H7OA 3FTUA 3HYMB 1HCIA 3CQXC 1LVKA 3AA0B 2C5IT 4H9SE 2NP9A 2E9XB 4PAGA 5CMWA 2DCFA 2K5BB 3UTKA 3CK8A 3MKDA 3LS8A 2WVIA 3UPVA 2WXHA 3WAKA 2YNQA 2YQ8A 3RYFE 2LM9A 1HG2A 3RKOA 3LBXB 2H7VC 4IE0A 3GZSA 4X1YE 5JDFA 3FUFA 3ZYMA 2Y4TA 2BUGA 4GCOA 3FHNA 4ILGA 2NW9A 2XAHB 3PRZA 4GA0A 5HQ8A 3CVYA 3QARA 2VQ2A 2HYZA 4ERRA 3D9JA 4A1SA 5FY7A 2VJ8A 4BWRA 2C0MA 4CXYA 1HO8A 2X38A 2Q7FA 3ZMUB 3L13A 4HEAA 2V0PA 3KBUA 4XAXB 2XPYA 2YHEA 2RD0A 2LSGA 3FEYA 3OAWA 3SBSA 2X9HA 2VSXE 1NAFA 4AY5A 4K03A 3L6AA 1ZHCA 4DBQA 1E90A 2DHRA 4OFZA 2LNIA 2V7KA 5JDLA 3G2UA 5LP6E 2XAFB 4ZI2D 5JQGE 2W00A 3BEEA 1SQMA 3CEQA 4BFRA 4J8FA 1NA3A 3CHOA 4GA1A 3I0QA 3CIAA 5C1DA 1U4QA 4OHFA 2ODUA 3NQPA 4DNDA 3PE3A 5HWYA 4DI4A 3PNLB 3QAQA 5G2NA 4JEHB 4UWHA 3RC8A 2IONA 4DMWA 3LY8A 2XGSA 2GGFA 4CT4A 2Y8DA 4CQIA 3KV4A 2CXLA 5ANLA 4WNKA 4ADZA 3HKEE 4HXIA 4JZYA 5KDMC 1H7CA 5ARGA 2WAUA 4AIFA 5JJTA 2IAKA 1SZAA 3I0OA 3ZPOA 1MIWA 4E85A 3GA8A 2ZM8A 2CLYC 3LK2B 2LO6A 2DI4A 3LK3B 4EECA 2N1GA 5EDSA 3VKHA 2HH7A 1D1AA 3FU6A 4XE0A 5DBKA 4FP7A 2QA7A 2WXKA 5FJYA 4TV8E 3SZ7A 3GN5B 4EBAA 2CMRA 3UUMA 3RIBA 2WPVA 4I9CA 3ZC0A 2XQ0A 2FF4A 4JVSA 3N9OA 4HS2A 3BK9A 2EQXA 2CLYB 4I6GA 3AVRA 4UXNB 4O4JE 3MJXA 2OA5A 3L54A 4JC8A 2LSVA 2NWBA 2I2OA 4UQZA 4J6IA 3MK7C 3NF1A 2LOSA 4CGWA 3ZN3A 3EIQC 4UQYA 3M65A 3EIJA 2K24A 4D10C 1Z6TA 3C64A 5JDQA 1EZ3A 4XKBA 2XEVA 3KINB 2M63A 3EUHA 1U3DA 5AJLA 1IQRA 1KNZA 3CV0A 4HORA 4V3IA 3IBEA 3KD7A 3Q2MA 4WBOA 3SFZA 2VWAA 2X6KA 3TL5A 3CKBA 1UW4B 3ANWA 3AA6B 4CRWA 2ES0A 3G2TA 4FJOA 4FLBA 3P8CD 3N5LA 1ELWA 3ONLA 3K3OA 4Q96A 1UX4A 2XAJB 3E0ZA 5LGTB 2WQ7A 4HFVA 3ZJ1A 3G2VA 4AV7A 2J07A 3ONXA 3CHSA 3D9PA 3SOLA 5J2UE 4I2WA 2VGXA 2QY7A 3ZCJA 4JPSA 4A56A 2A5UA 2W61A 4NUVA 3ZPJA 1HU3A 3IHRA 4TZ4C 3C50A 3PS6A 4O2AE 2XAQB 5EK4A 4N2SA 4X1IE 2JLBA 4MALA 3ZEFB 3PNTB 3KVAA 2OVBA 4O2BE 3R9AB 5L3EB 2YU2A 3SI5A 4CCAA 5KJMA 2W63A 2NW7A 4BAYB 3L16A 4FJZA 5J08A 3TJPA 3R7QA 3MACA 3ZMTB 1MMGA 2WXNA 4C0MA 2HM8A 1LF8A 3LXUX 2X9YA 3F31A 5EKQD 4OYJA 3J7Yq 3VHLA 4BA9A 3DTOA 4YLHA 4I2ZA 4YJ2E 1H2VC 4JHRA 1D0YA 3I5PA 3EJNA 3OTNA 5FT9A 1FMWA 1WY6A 1U5PA 3ZLIA 1MQSA 3LYAA 2XHEA 3FFLA 3FH5A 3U3WA 2KZ7B 4Z8XA 4KVOA 3JC6C 4IN3B 4X1KE 1S94A 4N78D 4GK5E 4WNGA 1WLXA 4NQ0A 4U72A 3B57A 4PK5A 4EIWA 1UG3A 2WXGA 4OVUA 4JHJA 4FADA 5JJ6A 4GZ5A 3FUEA 3DP7A 3LEWA 5LA6E 3DJBA 3Q9DA 2XPZA 2CFZA 4ZI3D 2NW8A 5T8IA 3FBLA 1CUNA 4FLHA 5DQWA 2PL2A 3JUIA 3V5SA 1KT1A 2I6HA 1W3BA 3AA1B 4O6FA 2RP4A 3KV6A 4BTAA 4I4TE 5LP0A 3H37A 2DNXA 1JPLA 2RG8A 2L9BA 4I55E 3U66A 2KWIB 3K8PC 1X79A 3PEVB 5G04J 3ZN0B 4GOUA 4JUYA 1FVFA 2J09A 4J2CA 2M67A 5L3CB 4YNDA 3QOUA 2VL8A 3ZYQA 2CWOA 4JEUA 2VKHA 5FP3A 3JQ0A 1QQEA 4PS8A 2FBNA 1IJ5A 2GRLA 1D0XA 3BQLA 3S7BA 2CHZA 1MMAA 3IHVA 3FU0A 3FUMA 3EHNA 4X20E 4OVVA 4O4LE 2J4BA 1NP7A 2JQQA 4UEMA 1BR1A 5JH7E 4XKCA 1OWPA 1Z3YA 3I9YA 5EX0A 3U9WA 2DBAA 2HR2A 3QDNA 3ZRHA 1U3CA 4TN7B 2VKOA 1OWMA 4QWNB 4I43A 1KT0A 4UVAB 5EZYE 3TG4A 1WM5A 4FC8A 2N9DA 5E76A 3ZHEA 4DI3A 1IHGA 5BUZA 3I4GA 2W0GA 2QGSA 3PU8A 3UUXA 4DO0A 2E2EA 4I9EA 4L23A 3HR0A 3JYSA 3MGBA 2ODVA 3FTZA 1N52A 2ONDA 4FHKA 3L22A 3ZYKA 2NTXA 1Y6IA 4DK5A 4CZZB 3FUIA 4PS3A 5DJQC 4WBNE 1UN8A 4PJLA 5FQ6A 5JDMA 2WXMA 4HE8A 2J1DG 5T4YA 3P7IA 3QK0A 3CHPA 5LCWC 4UIGA 5JDHA 4H9OC 4ATGA 3TXMA 5G04C 4QFVA 2WMOA 4G11A 4KVMA 3PZDA 4AQFA 2VTBB 2X6FA 2BZBA 2WM9A 1G8XA 3AAIA 1EDUA 1VDYA 2L0IA 2KZTA 3MZLB 2V8SE 1KK7A 4PFOA 1OWAA 2X6IA 4EPZA 5LGUB 2Z6EA 3FBZA 2EHOC 2X68A 1WR6A 3Q15A 5TAOA 3HKCE 2ZU6B 4IE7A 4XBFB 4F3VA 2CWYA 1ZBPA 2P9BA 3N71A 3CVLA 5KJNA 4MS6A 1LRZA 4TV9E 3ZXSA 4MLPA 4DLQA 2GW1A 3Q49B 3HVEA 3CVQA 3CVPA 2WXLA 3QK6A 2N2NA 2CFUA 4RG6A 4N3CA 1BR0A 4XI9A 2JMKA 3GZ1A 4GZ3A 3AS8A 1H6KA 5IHYA 4IHJE 1XGWA 3ETVA 3O9XA 3FTSA 3PH0C 4UWFA 4EZJA 3TGOA 4BX8A 1QSDA 4YHJA 3FULA 4GB9A 3AU5A 2FI7A 5DQVA 5LBMA 5LG4A 4I1AA 3LFMA 3IF8B 5CB4E 3CHRA 3QKYA 4I17A 4FJYA 4L5GA 4XZ4A 3AA7B 3FUDA 5FTPA 2WXFA 4A55A 5AIJA 4GIWA 3WI3A 4UWGA 1VRBA 1MIYA 3RYIE 2NXPA 4AEZC 2HO1A 5CCLA 4PJJA 3UX4A 1UN9A 5A23A 3ML8A 2V1DB 2WXOA 3D9KA 4N3BA 4IGUA 1XNFA 4EZLA 4UI9J 3PUSA 3UT4A 5L2LA 2UY1B 4U0ZA 2CXDA 4CI3B 4E7ZA 5JDGA 3KDSE 5HWXA 2Y3AA 4ANXA 3MCXA 4EOZB 4EAHA 4ILIA 1SZ9A 3RH3A 2AVPA 5G05C 3KS2A 2NTYA 3CWZB 3LCAA 3QB2A 5HXRA 2VKJA 4J8DA 4KYOB 2UXXB 3ZIMA 4GYYA 5HXHA 2Q9QC 2SPCA 4IULA 3S2AA 4DBRA 4MKTA 2WQHA 4J8SA 4UELA 2NSZA 3HA4A 4UVCB 4GYSA 2I59A 3HI2A 5ETWA 1Y64B 5L3FB 1QNFA 3F57A 4UF0A 3VLEA 3LPZA 2Q9QB 1TJFA 5DABA 4TRQA 3NRXA 3O1IA 5LHHB 3PUGA 4LERA 3ASFA 3CQGB 2YU1A 4JLEA 2L9QA 4I6EA 2WQ6A 4CGVA 5LJNA 1NZNA 2KCKA 5C2YA 4AJWA 1H19A 3QUJA 3WAJA 3T8OA 3NZPA 4WNEA 2PBIA 4KZCA 4B94A 4UV9B 2OOEA 1OUVA 2JJ9A 2BTDA 4WWPA 3TXNA 2KM4A 5LXTE 2I9CA 2LHRA 4KUMB 2UXNB 4BX9A 2PZIA 2CE7A 2X67A 3DPDA 2CA5A 3F2EA 3I1AA 1E7UA 4AI6A 2C5JA 1ELRA 1E7VA 4EZHA 3B7UX 4LUNU 5JRCB 4NRHB 3FXDB 3NZQA 4GYOA 1TEZA 1OWNA 3SBTB 3JQ1A 4EQFA 5FZRA 4HTEA 3JC6D 2MHKA 4GYRA 1D0ZA 4BY6A 3SNXA 2AXVA 4G2VA 2KINB 3SD5A 3Q47B 4HOTA 1QUUA 1ZU2A 3FUHA 2IOLA 5FXZA 3QNKA 3D9OA 3KBTA 5FQ8A 2JMHA 2VASA 2WXPA 3C98A 2HPJA 3IV0A 3C51A 3O1HA 3U3IA 1N54A 2MOZA 3R7RA 4FULA 3GYZA 3B13A 2IC9A 2GRMA 1EYHA 3CX8B 1HZ4A 3P1UA 2IQCA 3ASDA 3Q5XA 4H9NC 4GZ6A 3NZUA 4P0AA 2ZM0A 1DNPA 4BT9A 3IEEA 2X9WA 1MMNA 4GYWA 5L3DB 2LEHA 4O8SA 4TX5A 4UVBB 3FHEA 3APFA 4GMJA 3HDXA 2CEAA 2IFUA 2X51A 5CCMA 2ZM2A 3Q5MA 2I1KA 2DCPA 2D5UA 1L5JA 3ASHA 4KMOA 3D0TA 5J2TE 4ACKA 3OYZA 2DWKA 1IQUA 4WW0A 2VYIA 2V7LA 4QXHB 1UJKA 4H9QC 3CVNA 3IKOB 3KEZA 4U04A 3L08A 2AXZA 3S4UA 4H7XA 3OYXA 1E8WA 3N2OA 3RYHE 5EX3A 3RPUA 2PQNA 2KATA 2LHNA 2LJLA 3TKLB 3ZCIA 3ZN1B 2Y6XA 2LT3A 4F1SA 1UCUA 3OKQA 3UFEA 2IOSA 3MJWA 3ZMVB 3B7RL 4P0BA 3MA9A 4C0EA 1SA0E 4G26A 4HVBA 1SHZC 4PDXA 4G63A 2XCCA 3CGHA 3MV3B 2XRYA 4WAFA 5JR9A 2I1JA 2FEZA 4GCNA 3N9NA 5LFAA 4GK0E 4L0RA 4BTBA 4WUYA 1OXZA 4WWNA 4KBMB 3PUAA 5M4YA 4DMVA 3PREA 1E1HB 3GMIA 4ABNA 2LSKA 4J0UA 3CPZA 2R5SA 3I4RB 3R84B 4U63A 3K3QC 2XRZA 2WSSV 1BPOA 2MYSA 2IF4A 4FU3A 5BV1A 4CI2B 2J08A 3RJVA 4I1OB 2E9XA 5FY0A 2D2SA 3T8MA 3PURA 2D0UA 2JEKA 4ZI7E 2VB6A 5AYWD 4AKIA 2G0UA 1OWLA 3D9LA 2RA1A 2BVLA 3ZJ2A 4CDNA 3LBXA 1MNDA 3N2GE 5ADXL 4KXKB 5LNKA 4O4IE 3ESKA 2KCVA 5JREA 4BT8A 1WYCA 3ASGA 4I6JA 4IE5A 2X6JA 3PUKA 3RKVA 3LJ3A 5BW8C 2LSIA 2PG8A 2GK9A 4EZ4A 2E0IA 3ETUA 2EHOD 3QC1A 5HXEA 2XCBA 1Z3XA 4BSXA 1ZV4X 5HI7A 4HGAA 3ZMSB 4ISTA 2YK0A 1IJ6A 3MXZA 3L17A 3URZA 2E9XD 1G73A 3RRMB 1WAO1 3VLDA 5L3BB 3ANWB 4ZOLE 4PH4B 5LCYA 4H9RC 3HIZA 2AW6A 4JHKA 2CCQA 3VKGA 2YINA 1B89A 3B7SA 5LBQB 3PEUB 3S7JA 1B7TA 2ZLYA 2VGXB 3N9MA 4TUUA 2KXPB 4ME2A 2Y48B 3MKQA 3N2KE 3FTVA 1MIVA 3OXGA 2WWUA 3N9PA 4L1BA 2J9QA 4N3AA 5FYMA 4GZCA 4HFGA 3K9IA 3CLJA 4ZI3C 3G2WA 3VTXA 2HPLA 1X5BA 3KV5A 4JEHA 4A3TA 4CXWA 4R7LA 1FCHA 1D1BA 3FB2A 3KVBA 4BJMA 3AS4A 4FHJA 3CX6B 4DPRA 4E7SA 2W62A 3FTXA 4UI9K 5HXCA 2XUEA 5BV0A 3IHYA 4F53A 4AY6A 4DLOA 5EK3A 4IRUA 2CG2A 1FVHA 4Y6WA 5ENNA 3PDYA 3D9NA 3CR3A 1BR4A 4NUUA 1EF1C 3AB3B 4KMCA 2XHEB 1MNEA 4PK4A 3GN5A 4LEUA 4L2YA 1JWFA 5E0OA 2ILRA 1BR2A 3E4BA 2A2FX 5JHAA 2K9AA 5LYJE 1Y8MA 2BVMA 4MFRA 3KAEA 3IBPA 4V1Av 3TAXA 2B1EA 4FI5A 4Y6CA 3U4TA 5LHIB 2Q9QD 5A1LA 2KT9A 5LGNB 4MHCA 3Q4AB 3LJCA 4G25A 4WNDA 3EDVA 1AJ3A 3CQCB 3KV9A 2PQRA 2CXFA 2VSNA 4WWOA 3ENEA 5L3GB 4W9RA 2A72A 1E8YA 5J90A 4RSYA 2IC6A 3D3MA 4ZS3A 3BG0B 5ANRA 4JA9A 1LKXA 2V7IA 2CHXA 3CSFA 1H2UA 5LX8A 4ZHQE 4ANUA 2KMFA 3OXFA 3FUNA 1MMDA 4NACA 4AM9A 4CI1B 1PC2A 2V7JA 3D9IA 3OBVE 2H3RA 2A4ZA 3AAEB 2LOPA 4HOQA 3OXLA 1MHQA 4TUYE 4HLEA 4C9BB 2PM6A 4AXPA 5FXXA 4I1MA 3A5XA 1WRDA 4JEUB 1O3XA 3MV2B 4YVQC 4U07A 2CHWA 4H63V 1V9DA 4UWKA 1PY1A 3FEXA 3ZEFA 4UWLA 4CDRA 3FDHA 5KMGP 4B0ZA 3LK42 4U0SA 3L09A 5KX5E 2C5KT 4KBQA 2V5FA 1IAPA 4DVDA 4XIFA 4YVOA 3RO3A 5BNWA 2KC7A 4G2AA 5FZSA 4MBQA 2XASB 4ZS2A 1WYBA 5H6RB 1D1CA 5JHBA 4I43B 3AS5A 4CXXA 3RRNB 3LG7A 3MEKA 3ZHEB 4YJ3E 5D0OD 5FWQA 3NBXX 5LOZA 3CHMA 3UUXB 3MKQB 1E8XA 1YW0A 2WB2A 4OYKA 3LY7A 2WXJA 5LJMA 1UJJA 5AENA 2CG3A 3JCKC 4KT6B 4N39A 2JPFA 4U74A 4AQFC 2FO7A 4F6RC 1HS6A 5HAXA 2KLQA 3GW4A 2C0SA 2JRKA 3I3NA 3FH7A 3CHQA 4ASKA 2WBLA 4WNFA 4IDZA 5FXWA 3SF4A 3FTWA 3PTRB 2V26A 1LVFA 5D0QD 5LOVE 3GWHA 1E96B 4HOUA 1Z0PA 3APCA 5A7DB 5FY1A 3GZ2A 4PK6A 1UX5A 1HS7A 4AQGA 5FQ4A 2KZTB 4KZ0A 4U8HA 3QWPA 4UI9C 4XZCA 3VU7H 2PM7A 3MYVA 1YKEB 2X6HA 4LCTA 3ZVVA 4HKAA 1FIOA 3RO2A 4U0UA 1TJCA 5AJDA 1QZ2A 3O48A 2PFVA 2WXRA 4ANWA 3ONKA 3P2BA 3H3AA 4APFA 4GAAA 2IU1A 4Q94A 4YFSA 3HVEB 3APDA 3PUJA 4OK0A 5FMNA 3O4ZA 4AP2A 3MX3A 4HOSA 4JL0A 3FXEB 2A3DA 3PVLA 4PFPA 5CHEE 3QWVA 3UUNA 4M3OA 4K0RA 4ZI2C 3EDUA 3NRYA 3C4WA 4GPKA 3UT7A 2WMNA 2LAIA 4GMLA 1US7B 2ZMAA 1INZA 4PJNA 4AKHA 3MA5A 3LY9A 5IYZE 4AOFA 4B8CB 3R6NA 4L7TA 3CVXA 2X9XA 4APOA 1ELKA 2D0TA 4RG9A 2KCLA 1S35A 1VOMA 4QX8B 4A1GA 2VSYA 3U78A 4L9IA 2L0TB 5BMVE 3RRCA 1IYGA 4RVBA 3PE4A 4B8AA 3PU3A 5BT1A 5KJKA 4O4HE 2UWJG 2DLRA 1ZKEA 5KJLA 5HXSA 1HXIA 3FWVA 3RU0A 2K48A 2YEVC 1H0AA 5FZQA 3RRUA 3Q5WA 4N5CA 4QXCB 1EPUA 3PE0A 3FUKA 4XX5A 3FUJA 4J8EA 4ANJA 2C2LA 1NWMX 2DIWA 4UQXA 4C91A 1HF8A 3IEGA 4KP3C 3UQ3A 4B89A 2LE8A 4ACLA 5A6CA 4IYPA 3SHFA 5GONE 3PDNA 1OWOA 2LAHA 3E08A 5CA0E 3ULQA 2C0LA 2LSYA 3TG5A 5FNVE 3FY4A 2MBGA 3CK9A 3CVUA 2XTLA 3HKBE 2L3LA 4NURA 1PAQA 2VTBA 3PUQA 3FH8A 2KNDA 3LKUA 3D9MA 4M1PA 3ML9A 4URKA 2BDEA 4EYYR 3CVRA 1HX8A 2X0LB 5JVDE 5EK2A 4PJMA 4G23A 4UF0B 5KCMA 5ARFA 3AAAB 5DIZA 4P29A 4H9PC 4GA2A 4JA7A 4QXBB 4E6HA 1KLXA 3AU4A 5AFUL 4EYUA 4EXTA 2VGYA 3N9QA 2P58C 5E75A 2DWGA 4MLKA 5T3RA 2R17C 1P5QA 1ZEEA 2QFCA 5FQ7A 2IW5B 1HE8A 2OVFA 2EHOA 1HH8A 3EDTB 4N2QA 2X3MA 4C90A 3E22E 3W15B 4PUCA 4AXHA 1NA0A 4ISSA 3RYCE 4HN9A 3ZW3A 3HHMA 3CSTA 2V7MA 5F8PA 3ZYLA 3FP3A 3B7TA 2WXIA 4AKLA 3C4XA 2VK9A 3RRWA 3FU3A 2Y4UA 3BG1B 4TV3A 4K0UA 3HKDE 2R59A 4P09A 3UT8A 3FU5A 4EZKA 4EBAG 3AVSA 4DJAA 4CT0A 5HYAA 4JW1A 5LCWJ 3CKDA 3KFWX 5CMYA 3CKCA 5CA1E 5C8YE 5H6QB 1HTJF 5JJ7A 4L2LA 4OYSA 4QHOA 3HL6A 2NOXA 4CEMA 3N9LA 5LHGB 3VTYA 4A3VA 4FA6A 2CM0A 1YD8G 3ESLA 3U64A 3SGHA 4F7AA 5FXVA 2XGMA 4G24A 4PS7A 1FMVA 2UY1A 3DBSA 4IE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LO6 A;  1HG5 A;  5CMW A;  3D9O A;  4NAC A;  2V8S E;  2BF0 X;  5J08 A;  4Q94 A;  3G2T A;  4GZD A;  1PY1 A;  4FLB A;  2KM4 A;  3D9L A;  1HX8 A;  1INZ A;  3D9I A;  3D9J A;  1UJK A;  2DIW A;  3ONL A;  3LDZ A;  4GZC A;  1UJJ A;  1JWG A;  4Q96 A;  3ONK A;  1MHQ A;  1DVP A;  1HF8 A;  1HG2 A;  4HFG A;  3G2S A;  3CLJ A;  3ZYK A;  3ZYQ A;  3G2V A;  1JWF A;  1ELK A;  3G2W A;  1JUQ A;  1LF8 A;  1SZ9 A;  3D9P A;  4FU3 A;  5CMY A;  4AVX A;  1XGW A;  3D9K A;  1X5B A;  1H0A A;  2DCP A;  5LP0 A;  1SZA A;  1JPL A;  1HFA A;  4JXT A;  3G2U A;  1EDU A;  3ZYM A;  2MOW A;  1EYH A;  1VDY A;  2L0I A;  2QY7 A;  3D9M A;  3RRU A;  2L0T B;  3ZYL A;  5LOZ A;  3D9N A; 
#chains in the Genus database with same CATH topology
 5ABG A;  2XEE A;  4H7Y A;  1GW6 A;  4XI0 A;  3V5U A;  2WDR A;  3ZNG A;  5KBA A;  2YHC A;  3E33 A;  3SS1 A;  4GU5 A;  3K3N A;  2E8I A;  5F3J A;  5AQR B;  3EU9 A;  4LRZ A;  2MTQ A;  3NZS A;  3S7F A;  3C98 B;  3UU3 A;  2E2A A;  4A98 A;  4ILC A;  2UUB T;  3S7D A;  4JB8 P;  3FZM B;  5KNG A;  3J9X 1;  2J4D A;  1T98 A;  4I50 E;  3VR9 A;  4EB6 E;  3QB5 K;  4BJN A;  1HFA A;  1IBK T;  5BPP A;  4P1N A;  3LVQ E;  3UU8 A;  3LVR E;  3DRA A;  2LSU A;  2XAG B;  3NAW A;  2L8K A;  1JWG A;  1IZN B;  2VKD A;  3AE6 A;  1DVP A;  3QJZ A;  1SE7 A;  3Q9U C;  5J1G A;  3L8R A;  2IJG X;  1BD8 A;  2OEV A;  1XDP A;  2W66 A;  5KNH D;  4CDM A;  2LKG A;  4OAV B;  3C4Z A;  5BXU A;  1FEW A;  2ACX A;  3SWH A;  3CX7 B;  3BQK A;  4B6X A;  4OX9 T;  5EIB E;  4JXT A;  3QC9 A;  4LF9 T;  4IE6 A;  4MRU A;  1A17 A;  3PJA A;  3Q7A A;  2V4L A;  3T5X A;  1HG5 A;  2WXQ A;  2BF0 X;  3I9W A;  3QWW A;  1IBM T;  1H2T C;  4Q69 A;  1YA0 A;  4G1T A;  2Q9Q A;  4CYM D;  1HX1 B;  2FUL A;  5AQ9 A;  3SFE A;  2L6J A;  3QB5 A;  4AKR B;  3UIO C;  4IIJ E;  3CVV A;  2AE9 A;  4YDE A;  1O1T A;  3RK6 A;  2MOW A;  2LSJ A;  2PJQ A;  1N36 T;  4NXM T;  4H63 H;  3L3P A;  2NC9 A;  3BQI A;  1S0P A;  2DL1 A;  4GZD A;  3ZFW A;  2AXU A;  5IWA T;  3EVY A;  5JDN A;  5AQJ B;  3RC3 A;  3LDZ A;  5JR9 C;  3LJN A;  3PUW F;  2J8S D;  3G2S A;  2X66 A;  3FTY A;  5M72 A;  3RX6 A;  1JCS A;  5ENR D;  1IKN D;  1JUQ A;  5JMN D;  4GTV A;  4GTT A;  4AVX A;  1DCQ A;  3WXX A;  4U7E B;  2XQ8 A;  5ENO D;  3SRZ A;  4GKK T;  5G55 A;  2AXD S;  2VSO E;  1YMP A;  2J49 A;  3EHM A;  4PW8 A;  2AWI A;  4AKG A;  3KSL A;  3OJA A;  3ZMZ B;  4QKN A;  4ILH B;  3ZC1 A;  2XPI A;  4ANV A;  3VLF A;  3CML A;  5G05 J;  3ZGQ A;  1YKH B;  4JI4 T;  5JR9 B;  2KWH A;  3CK7 A;  3T5V A;  2ACZ A;  3O4X E;  2MRI A;  4UV8 B;  3MKR A;  1HNW T;  5J0Z A;  3UT5 E;  1OED E;  4EEB A;  2E9X C;  4PNI A;  3ZUV B;  5JRC A;  3O1J A;  4ILU A;  3CVW A;  4QX7 B;  4LF8 T;  2XGO A;  3UUB A;  1E8Z A;  3P4Q A;  2XQY A;  2EHO B;  3UMV A;  2OV8 A;  3UUL A;  2DZN A;  3MZK B;  4HI9 A;  5KXJ A;  2H6H A;  2H7O A;  3FTU A;  3HYM B;  4HWH A;  1HCI A;  3CQX C;  1LVK A;  4LSZ E;  2HE0 A;  2BG9 E;  2C5I T;  3AA0 B;  4H9S E;  4F6R D;  4DV4 T;  2NP9 A;  2W4X A;  2QYJ A;  2E9X B;  2YKS A;  4PAG A;  2RPA A;  3TWW A;  5CMW A;  1TNU A;  2DCF A;  2K5B B;  3UTK A;  3CK8 A;  3MKD A;  3NOC D;  3LS8 A;  4WZX A;  2WVI A;  3UPV A;  2WXH A;  2LUH A;  3WAK A;  2YNQ A;  2XEH A;  3AG3 E;  2YQ8 A;  4ZZC A;  5FIO A;  3RYF E;  2LM9 A;  4RLY A;  1HG2 A;  1BI8 B;  3RKO A;  3LBX B;  2H7V C;  4IE0 A;  3GZS A;  4X1Y E;  5EID A;  1KF6 A;  4DUY T;  2QRX A;  5JDF A;  3FUF A;  3ZYM A;  2Y4T A;  2BUG A;  4G8L A;  1OXJ A;  4GCO A;  3FHN A;  4ILG A;  2NW9 A;  2XAH B;  3PRZ A;  4GA0 A;  5HQ8 A;  3CVY A;  2B76 A;  3QAR A;  2VQ2 A;  4DV3 T;  2HYZ A;  4ERR A;  3D9J A;  4A1S A;  5FY7 A;  2R2L A;  2VJ8 A;  4BWR A;  4JBW F;  2C0M A;  3AXJ A;  4CXY A;  1HO8 A;  1QYM A;  2X38 A;  5EIL A;  2Q7F A;  3ZMU B;  3L13 A;  4HEA A;  4CN1 A;  2V0P A;  2XM1 A;  3KBU A;  3AG4 E;  4XAX B;  2XPY A;  4ZHB A;  2YHE A;  2RD0 A;  2LSG A;  2W2U A;  3FEY A;  2H88 A;  2CBJ A;  3OAW A;  3SBS A;  1XZY A;  1MX6 A;  2X9H A;  2VSX E;  1NAF A;  2LKH A;  2A9U A;  2P9U G;  4AY5 A;  4HLL A;  2HN2 A;  4K03 A;  4K5A B;  3L6A A;  1ZHC A;  4DBQ A;  1E90 A;  2DHR A;  4XEI G;  4HRL A;  4OFZ A;  3LSV A;  3RIA A;  2LNI A;  2V7K A;  5JDL A;  3G2U A;  5LP6 E;  4LG6 A;  2XAF B;  4ZI2 D;  5JQG E;  2W00 A;  3BEE A;  3PZ4 A;  1SQM A;  2DYS E;  3CEQ A;  4BFR A;  4J8F A;  1NA3 A;  3CHO A;  3NWI A;  4BSZ B;  4UR9 A;  1NFI E;  3TWQ A;  4GA1 A;  3I0Q A;  3CIA A;  5C1D A;  1SA5 A;  1U4Q A;  4OHF A;  2ODU A;  3NQP A;  4DND A;  4TWH A;  3PE3 A;  5HWY A;  4DI4 A;  3PNL B;  2P9N G;  3QAQ A;  5G2N A;  2FO1 E;  4JEH B;  4UWH A;  1AWC B;  4JI0 T;  3RC8 A;  2ION A;  4DMW A;  3LY8 A;  2XGS A;  2GGF A;  4CT4 A;  1K3Z D;  3CK6 A;  2Y8D A;  1XMQ T;  4CQI A;  3KV4 A;  2CXL A;  5ANL A;  1XWM A;  4WNK A;  4ADZ A;  3HKE E;  4HXI A;  4JZY A;  5KDM C;  1H7C A;  5ARG A;  4MBG A;  2WAU A;  4AIF A;  3P4R A;  5JJT A;  2IAK A;  1SZA A;  3I0O A;  3ZPO A;  2ZIR A;  1MIW A;  1ZB1 A;  4E85 A;  3GA8 A;  3UU5 A;  2ZM8 A;  2CLY C;  3LK2 B;  2LO6 A;  2DI4 A;  3LK3 B;  4EEC A;  2N1G A;  5EDS A;  3VKH A;  2XQ4 A;  2HH7 A;  1D1A A;  3FU6 A;  4XE0 A;  5DBK A;  4FP7 A;  2QA7 A;  2WXK A;  4IL9 A;  5FJY A;  3C3Q A;  4X62 T;  4TV8 E;  2WZI A;  1JCQ A;  1I6Z A;  4IRE A;  5IY5 E;  3SZ7 A;  3GN5 B;  1SUM B;  4EBA A;  2CMR A;  2PNN A;  3UUM A;  4DV5 T;  4DV6 T;  3RIB A;  2WPV A;  4I9C A;  5FVL A;  3ZC0 A;  2XQ0 A;  2FF4 A;  3ZXP A;  4JVS A;  3N9O A;  4HS2 A;  3BK9 A;  2EQX A;  2CLY B;  4I6G A;  2H89 A;  3AVR A;  5CRV A;  5ABF A;  4UXN B;  4O4J E;  4GMR A;  3MJX A;  2ZGD A;  2OA5 A;  3HXD A;  3L54 A;  4JC8 A;  2LSV A;  2NWB A;  4HWI B;  2I2O A;  4UQZ A;  4J6I A;  4ZEY A;  3MK7 C;  4DR1 T;  3NF1 A;  3UTM A;  2LOS A;  2D9D A;  4CGW A;  1WR0 A;  3ZN3 A;  3EIQ C;  4UQY A;  3NB2 A;  3M65 A;  3EIJ A;  2K24 A;  4OAU C;  2F0Y A;  4D10 C;  1Z6T A;  3DEP A;  3C64 A;  3HXC A;  5JDQ A;  3K1S A;  1EZ3 A;  4XKB A;  2XEV A;  3KIN B;  1K8K G;  2FBW A;  3EUH A;  2M63 A;  4JI6 T;  4YDW A;  2YN6 A;  1U3D A;  5CJ5 A;  4HWC A;  2QYU A;  1N11 A;  5AJL A;  2JQ9 A;  1IQR A;  1KEY A;  1KNZ A;  3CV0 A;  3ASO E;  2P2C P;  4HOR A;  2ZM6 T;  4V3I A;  3IBE A;  3KD7 A;  1M62 A;  3FZH B;  3Q2M A;  3AG1 E;  4WBO A;  4DUZ T;  3SFZ A;  4DV2 T;  3E34 A;  3UKU G;  2VWA A;  2X6K A;  3TL5 A;  3CKB A;  1MJ0 A;  1UW4 B;  1X81 A;  3ANW A;  3AA6 B;  2B6C A;  1WCR A;  4CRW A;  2ES0 A;  3G2T A;  4FJO A;  4FLB A;  3P8C D;  3N5L A;  1ELW A;  3ONL A;  3ULE G;  3K3O A;  4Q96 A;  1UX4 A;  2XAJ B;  3E0Z A;  5FL1 A;  5AQF B;  5LGT B;  5AQB A;  2WQ7 A;  4HFV A;  3ZJ1 A;  3G2V A;  4AV7 A;  2J07 A;  3ONX A;  3WG7 E;  1W0B A;  2XZE A;  3CHS A;  3D9P A;  3SOL A;  5J2U E;  4I2W A;  2VGX A;  4JI3 T;  2QC9 A;  2QY7 A;  3ZCJ A;  4JPS A;  4A56 A;  2A5U A;  2W61 A;  4NUV A;  3TWT A;  3ZPJ A;  1HU3 A;  5AAR A;  3IHR A;  4TZ4 C;  3C50 A;  2WDQ A;  1FJG T;  2GRP B;  4O2A E;  2XAQ B;  5EK4 A;  3PS6 A;  4X1I E;  2JLB A;  4N2S A;  4O60 A;  4MAL A;  3ZEF B;  4YT0 A;  1JNR A;  3LDQ B;  3PNT B;  3KVA A;  2WY2 A;  2OVB A;  4O2B E;  3R9A B;  2BED A;  5LMN T;  5L3E B;  2YU2 A;  3SI5 A;  4CCA A;  5KJM A;  4DV0 T;  2W63 A;  2NW7 A;  4BAY B;  5LMU T;  4JYA T;  3L16 A;  4FJZ A;  3TJP A;  5J08 A;  3R7Q A;  2WCA A;  3MAC A;  3ZMT B;  1MMG A;  2WXN A;  4C0M A;  3AAA C;  2HM8 A;  1E2A A;  4KI0 F;  1UOH A;  2E5L T;  5CER B;  1JNZ A;  1LF8 A;  1H6O A;  3B5M A;  4DUI A;  3LXU X;  2F37 A;  2X9Y A;  3F31 A;  5AQU B;  4DV1 T;  5EKQ D;  4OYJ A;  2Y1L E;  3J7Y q;  3VHL A;  5B3S E;  4BA9 A;  3DTO A;  4YLH A;  4I2Z A;  4LF7 T;  5AQI B;  3PUZ F;  4YJ2 E;  1H2V C;  4JHR A;  1D0Y A;  3I5P A;  3EJN A;  3OTN A;  5FT9 A;  1FMW A;  1WY6 A;  1U5P A;  3ZLI A;  1MQS A;  3LYA A;  4ZXL A;  2XHE A;  3FFL A;  3FH5 A;  3U3W A;  4DX1 A;  2KZ7 B;  4Z8X A;  4KVO A;  3JC6 C;  4IN3 B;  2P9I G;  4X1K E;  1Q2Z A;  1S94 A;  4LFC T;  4N78 D;  4B3T T;  4GK5 E;  4WNG A;  2X0H A;  3UIN C;  1WLX A;  4NQ0 A;  4X5T A;  4U72 A;  5AQ7 A;  1RW2 A;  3G06 A;  3B57 A;  2OV9 A;  4TWF A;  4PK5 A;  4EIW A;  1UG3 A;  2WXG A;  4OVU A;  4JHJ A;  3VR8 A;  4FAD A;  5JJ6 A;  4GZ5 A;  3FUE A;  3PUX F;  3DP7 A;  3LEW A;  5LA6 E;  3UQ4 A;  3DJB A;  3Q9D A;  1O1R A;  2XPZ A;  2CFZ A;  3X2Q E;  4ZI3 D;  2NW8 A;  4QH5 A;  5T8I A;  3FBL A;  1CUN A;  4FLH A;  5DQW A;  5EN5 D;  1OED A;  3Q9N C;  2E5V A;  2PL2 A;  3JUI A;  3V5S A;  2I6H A;  2XSB A;  4EED A;  2UXD T;  2VUR A;  1KT1 A;  1W3B A;  3C3R A;  3AA1 B;  5AQO B;  4O6F A;  2RP4 A;  2QZA A;  3KV6 A;  4BTA A;  4I4T E;  1N9A A;  5LP0 A;  3H37 A;  2DNX A;  1JPL A;  2RG8 A;  2L9B A;  3L82 A;  4I55 E;  2BG9 A;  3NKZ A;  3U66 A;  2KWI B;  3K8P C;  1FT1 A;  1X79 A;  3UFG A;  3PEV B;  5G04 J;  3ZN0 B;  3T9K A;  3AEE A;  4YDO A;  4GOU A;  4JUY A;  4TXR A;  3W9G A;  1FVF A;  4LML A;  2J09 A;  4J2C A;  2M67 A;  5L3C B;  4YND A;  3QOU A;  2VL8 A;  1TR4 A;  3ZYQ A;  1W09 A;  2CWO A;  4JEU A;  2VKH A;  3ZSS A;  1YCS B;  2L6B A;  5CEA A;  5FP3 A;  1LTX A;  1QQE A;  3JQ0 A;  1M7K A;  4PS8 A;  1N4S A;  1FPP A;  2FBN A;  3EHR A;  1IJ5 A;  2GRL A;  2BKG A;  1D0X A;  3BQL A;  3S7B A;  4U7Y A;  2CHZ A;  1MMA A;  3IHV A;  4U33 A;  3FU0 A;  3B95 A;  3FUM A;  3EHN A;  3PZ1 A;  4X20 E;  4OVV A;  4O4L E;  2J4B A;  2YOE A;  1NP7 A;  3TLW A;  2JQQ A;  4UEM A;  1HNZ T;  1BR1 A;  3ABM E;  1TNO A;  3JUE A;  5JH7 E;  4XKC A;  2JQK A;  3PV0 F;  5CFB A;  4GTP A;  1OWP A;  5ITZ F;  1Z3Y A;  3I9Y A;  3C3O A;  4DR3 T;  3AE8 A;  3HXE A;  2H6F A;  1YQ4 A;  3FZL B;  5EX0 A;  3U9W A;  2DBA A;  3ZKR A;  1DCE A;  2HR2 A;  3QDN A;  1MX4 A;  4TN7 B;  1U3C A;  3ZRH A;  2VKO A;  1OWM A;  4QWN B;  4I43 A;  1KT0 A;  3RLF F;  4LF6 T;  1BLX B;  4UVA B;  5EZY E;  3TG4 A;  1WM5 A;  4FC8 A;  2N9D A;  5E76 A;  3ZHE A;  4GTS A;  4DI3 A;  1IHG A;  5BUZ A;  3I4G A;  2YDR A;  4DR2 T;  2W0G A;  1UK5 A;  4TXP A;  4A5X A;  5AAO A;  2QGS A;  2QVA A;  3PU8 A;  2RFM A;  3UUX A;  4DO0 A;  2E2E A;  4I9E A;  4L23 A;  5HEU A;  3L39 A;  3RSE G;  3Q75 A;  3HR0 A;  1NL4 A;  3JYS A;  3MGB A;  2ODV A;  1YYH A;  3FTZ A;  1N52 A;  2OND A;  4FHK A;  3L22 A;  3ZYK A;  2NTX A;  1Y6I A;  4DK5 A;  5ENS D;  2WS3 A;  4CZZ B;  3FUI A;  4PS3 A;  5CBN A;  5DJQ C;  4WBN E;  3SFX A;  3AEG A;  1UN8 A;  4PJL A;  5FQ6 A;  2HHH T;  5JDM A;  4QQI A;  2WXM A;  4HE8 A;  2J1D G;  2IUB A;  5T4Y A;  3B7B A;  3P7I A;  2UUC T;  1D8E A;  3UM2 A;  4TXQ A;  4WYV A;  3QK0 A;  4BES A;  3CHP A;  5LCW C;  4UIG A;  1U2V G;  5JDH A;  2XEN A;  4H9O C;  4ATG A;  3TXM A;  3P50 A;  5G04 C;  4QFV A;  2F4V T;  2EIM E;  2WMO A;  4G11 A;  4KVM A;  3PZD A;  4AQF A;  2VTB B;  2X6F A;  4DID B;  4AQY T;  2BZB A;  2WM9 A;  1G8X A;  3AAI A;  4HFI A;  1EDU A;  1VDY A;  2L0I A;  3TWS A;  2KZT A;  2LXL A;  3MZL B;  2V8S E;  1KK7 A;  4PFO A;  1OWA A;  2X6I A;  4EPZ A;  5LGU B;  3DSS A;  2Z6E A;  3FBZ A;  2EHO C;  2CHO A;  2X68 A;  1WR6 A;  3Q15 A;  5TAO A;  3HKC E;  2Y69 E;  4IE7 A;  2DVW A;  2ZU6 B;  1MZC A;  3PJA J;  4XBF B;  4F3V A;  2CWY A;  1ZBP A;  2P9B A;  3N71 A;  3CVL A;  3EHQ A;  5KJN A;  4HFH A;  4MS6 A;  1LRZ A;  4TV9 E;  3ZXS A;  3ZST A;  4MLP A;  4DLQ A;  2GW1 A;  3Q49 B;  3HVE A;  3CVQ A;  3CVP A;  2WXL A;  3QK6 A;  2N2N A;  4YTM A;  2CFU A;  4HB5 A;  4N3C A;  1BR0 A;  4RG6 A;  4XI9 A;  5ENP D;  2JMK A;  4HWD A;  4TNW A;  3W9F A;  4K0K T;  2ZIS A;  3GZ1 A;  4GZ3 A;  5HRY A;  3AS8 A;  1WFD A;  2K3W A;  1H6K A;  5IHY A;  4IHJ E;  1XGW A;  3ETV A;  3O9X A;  3EU5 A;  2XQ9 A;  5KWD A;  2UXC T;  3FTS A;  3PH0 C;  4UWF A;  5CBO A;  2B0O E;  2CPT A;  4EZJ A;  3TGO A;  4BX8 A;  1QSD A;  4YHJ A;  4YSX A;  3FUL A;  4GB9 A;  3UM3 A;  3AU5 A;  3R9M A;  2FI7 A;  5AQH B;  2JQH A;  5DQV A;  5LBM A;  4K5C A;  5LG4 A;  4I1A A;  3VRA A;  3LFM A;  2RFA A;  3UKR G;  3IF8 B;  2WU2 A;  3V2X A;  5CB4 E;  3CHR A;  5FKY A;  2UUA T;  3QKY A;  4I17 A;  4FJY A;  4L5G A;  4XZ4 A;  1KNP A;  3AA7 B;  3FUD A;  1XDO A;  4CN6 A;  5FTP A;  2WXF A;  1YQ3 A;  4A55 A;  5AIJ A;  4GIW A;  1SVX A;  3V31 A;  4GTM A;  3X1D A;  3OPC A;  3WI3 A;  3JXJ A;  4UWG A;  1VRB A;  1MIY A;  5H7P A;  3RYI E;  2NXP A;  2XJ7 A;  4AEZ C;  5AQT B;  2HO1 A;  5CCL A;  4PJJ A;  5C3J A;  1UN9 A;  3UX4 A;  3ML8 A;  2V1D B;  2WXO A;  4TUM A;  5A23 A;  3D9K A;  4N3B A;  4IGU A;  1XNF A;  4EZL A;  4UI9 J;  3PUS A;  3UT4 A;  2V6X A;  3TLT A;  2VL0 A;  5L2L A;  3BU8 A;  2XY8 B;  2UY1 B;  4U0Z A;  2CXD A;  4NIK A;  4CI3 B;  4E7Z A;  5JDG A;  3KDS E;  5AQQ B;  5HWX A;  4DR7 T;  2Y3A A;  2CBI A;  4ANX A;  3MCX A;  4EOZ B;  4EAH A;  4ILI A;  1SZ9 A;  3RH3 A;  2AVP A;  4HQD A;  5G05 C;  1S64 A;  3KS2 A;  1L0V A;  2NTY A;  3CWZ B;  3LCA A;  3QB2 A;  5HXR A;  4YHH T;  2VKJ A;  1KNR A;  1N34 T;  4J8D A;  4KYO B;  2UXX B;  1TYQ G;  3ZIM A;  3DSW A;  4GYY A;  5HXH A;  2Q9Q C;  2SPC A;  4IUL A;  3S2A A;  4DBR A;  4X8Q A;  4MKT A;  3H3M A;  5CGM A;  2WQH A;  4J8S A;  4UEL A;  3ABV A;  3ONJ A;  3AJI A;  2NSZ A;  3HA4 A;  3ABL E;  4UVC B;  2H6I A;  4GYS A;  2I59 A;  3HI2 A;  1R8I A;  5ETW A;  1Y64 B;  5L3F B;  1QNF A;  3ABK E;  5CEC B;  3F57 A;  4HFD A;  4UF0 A;  5ENT D;  2R05 A;  3VLE A;  4ILA A;  3LPZ A;  2Q9Q B;  1TJF A;  5DAB A;  4TRQ A;  3NRX A;  5LHH B;  3O1I A;  3PUG A;  4LER A;  5AQP B;  4BEP A;  3PUV F;  3IXE A;  3ASF A;  3NVO A;  3CQG B;  1OY3 D;  2YU1 A;  1D8D A;  2FJD A;  4JLE A;  2L9Q A;  1VCT A;  1VCS A;  4I6E A;  2WQ6 A;  2WWV A;  4CGV A;  5LJN A;  5AQG B;  5AQS B;  1NZN A;  2KCK A;  5C2Y A;  1LD8 A;  2IIU A;  4AJW A;  4HNA D;  1H19 A;  3QUJ A;  3WAJ A;  5FIN A;  3T8O A;  3NZP A;  4WNE A;  3OTO T;  1NI1 A;  2PBI A;  4KZC A;  4B94 A;  4UV9 B;  2OOE A;  1OUV A;  2JJ9 A;  4DR5 T;  4LNB A;  2BTD A;  5AQK B;  5ABE A;  4COF A;  4WWP A;  2XZD G;  3TXN A;  1FT2 A;  4U3C A;  2KM4 A;  5LXT E;  2I9C A;  2LHR A;  4KUM B;  5HCM A;  3PZ3 A;  2UXN B;  4BX9 A;  3J5P A;  2PZI A;  2CE7 A;  3RI5 A;  2X67 A;  5BXO A;  2BKK B;  3DPD A;  2CA5 A;  3T1H T;  3F2E A;  4LNU D;  3I1A A;  1E7U A;  2VQF T;  4AI6 A;  2C5J A;  1ELR A;  1Z5S C;  3RIU A;  1E7V A;  4EZH A;  3B7U X;  4LUN U;  1CHU A;  2P9S G;  5AQA A;  5L47 A;  5JRC B;  4NRH B;  2V8S V;  3FXD B;  3NZQ A;  4C48 B;  3EUV A;  4GYO A;  1TEZ A;  1OWN A;  3SBT B;  3JQ1 A;  4EQF A;  5FZR A;  4HTE A;  3JC6 D;  2MHK A;  4GYR A;  1D0Z A;  4BY6 A;  2GRN B;  2AXV A;  3SNX A;  4G2V A;  2KIN B;  1KPS B;  3SD5 A;  2Y0B G;  3Q47 B;  4HOT A;  3AG2 E;  1QUU A;  2LM2 A;  2V6Y A;  1ZU2 A;  3FUH A;  1IHB A;  2IOL A;  5LG3 A;  5FXZ A;  3RKG A;  3QNK A;  3D9O A;  1X9B A;  2BKO A;  3KBT A;  3AEA A;  5FQ8 A;  2JMH A;  3AE3 A;  2VAS A;  3P4P A;  2WXP A;  2ETC A;  3C98 A;  2HPJ A;  3FZK B;  3IV0 A;  3C51 A;  3O1H A;  3U3I A;  3JXI A;  1N54 A;  1TN6 A;  2IEJ A;  2MOZ A;  3TWU A;  2LRL A;  3L9T A;  3R7R A;  4FUL A;  3GYZ A;  4LFA T;  3B13 A;  1MX2 A;  4HRM B;  2IC9 A;  2V5Q C;  2GRM A;  1EYH A;  1N4R A;  3CX8 B;  1HZ4 A;  3P1U A;  2BKP A;  3JAF A;  2IQC A;  4ILB A;  2A5E A;  3V2O A;  3ASD A;  3Q5X A;  4H9N C;  2IDO B;  4GZ6 A;  3NZU A;  3NBN B;  4P0A A;  2ZM0 A;  1DNP A;  4BT9 A;  3IEE A;  3AE4 A;  2X9W A;  1MMN A;  4GYW A;  5L3D B;  3UU6 A;  4DX7 D;  2LEH A;  4O8S A;  4TX5 A;  4UVB B;  4JI5 T;  4IL4 A;  1K1B A;  3APF A;  3FHE A;  4J8Y A;  4GMJ A;  1RZ4 A;  3HDX A;  2CEA A;  2IFU A;  5FVK A;  2X51 A;  5CCM A;  1N94 A;  2ZM2 A;  3AXJ B;  3Q5M A;  2I1K A;  1HNX T;  2DCP A;  4A97 A;  2D5U A;  1L5J A;  4I0U A;  3ASH A;  4KMO A;  2FJB A;  3D0T A;  5J2T E;  2V5C A;  4ACK A;  3OYZ A;  5D66 A;  2DWK A;  1IQU A;  4WW0 A;  2R6G F;  3E30 A;  2VYI A;  2V7L A;  4IDQ A;  4QXH B;  1UJK A;  3VRB A;  3ZU7 B;  4H9Q C;  3CVN A;  4LF4 T;  3IKO B;  3KEZ A;  4U04 A;  2BBJ A;  3L08 A;  2AXZ A;  3S4U A;  4H7X A;  4X66 T;  3OYX A;  1E8W A;  2J4G A;  2PTF A;  3N2O A;  4U7I A;  3RYH E;  5EX3 A;  3RPU A;  3SQV A;  4IDN A;  1DU2 A;  2UXB T;  2PQN A;  3AEB A;  2KAT A;  2LHN A;  2LJL A;  3TKL B;  3ZCI A;  3ZN1 B;  2Y6X A;  2LT3 A;  1O5M A;  1UCU A;  4F1S A;  3OKQ A;  3UFE A;  2XZT G;  2V5D A;  4NXN T;  3RQW A;  2IOS A;  3MJW A;  3ZMV B;  3B7R L;  4P0B A;  3MA9 A;  3A7M A;  4C0E A;  1SA0 E;  4G26 A;  4HVB A;  3CIR A;  1SHZ C;  4PDX A;  4G63 A;  2XCC A;  3CGH A;  1XNR T;  3MV3 B;  1J1J A;  4Z90 A;  2XRY A;  4LF5 T;  4WAF A;  4A63 B;  5JR9 A;  2I1J A;  4DV7 T;  2FEZ A;  4GCN A;  3N9N A;  5LFA A;  4GK0 E;  4L0R A;  4BTB A;  1O1S A;  4WUY A;  5ABH A;  2VGE A;  1OXZ A;  4WWN A;  4YY3 T;  5F5W A;  4KBM B;  3PUA A;  5M4Y A;  4DMV A;  3PRE A;  1E1H B;  3GMI A;  4ABN A;  2CRB A;  3HXF A;  2LSK A;  5HEO A;  4J0U A;  3CPZ A;  2R5S A;  3I4R B;  3R84 B;  4U63 A;  3K3Q C;  3ULY A;  2XRZ A;  2WSS V;  2XQ6 A;  1BPO A;  2MYS A;  2IF4 A;  4FU3 A;  5CRU A;  5BV1 A;  4CI2 B;  2J08 A;  3RJV A;  4I1O B;  3SY2 A;  2E9X A;  3TWX A;  5CED B;  5FY0 A;  2D2S A;  3T8M A;  3PUR A;  2D0U A;  1XNQ T;  2JEK A;  4HRN A;  4ZI7 E;  2VB6 A;  3C5R A;  5AYW D;  4AKI A;  1OT8 A;  4F8H A;  2G0U A;  2BBH A;  1OWL A;  3D9L A;  3BQO A;  3DST A;  1T7S A;  2RA1 A;  2BVL A;  1N33 T;  5ABF B;  3ZJ2 A;  4CDN A;  3LBX A;  1MND A;  3N2G E;  1UUR A;  3FZF B;  5ADX L;  4KXK B;  5LNK A;  4O4I E;  3ESK A;  2KCV A;  3KSQ A;  2YDQ A;  5JRE A;  3AE7 A;  4BT8 A;  1WYC A;  3ASG A;  4I6J A;  2GRR B;  4IE5 A;  2X6J A;  3RHW A;  3PUK A;  3EHZ A;  3RKV A;  3LJ3 A;  5BW8 C;  2LSI A;  2PG8 A;  5AQV B;  2IO3 C;  2GK9 A;  4EZ4 A;  2E0I A;  1UUS A;  3ETU A;  3ONL C;  2EHO D;  3QC1 A;  5HXE A;  2XCB A;  2UU9 T;  1Z3X A;  4B3S T;  4BSX A;  1ZV4 X;  5HI7 A;  4HGA A;  3ZMS B;  5HS0 A;  3Q5D A;  4IST A;  2YK0 A;  1IJ6 A;  3MXZ A;  3L17 A;  2KXP C;  2WQY A;  3URZ A;  2E9X D;  2P9K G;  5ENQ D;  2J47 A;  1G73 A;  3RRM B;  4JI8 T;  1OCZ E;  1WAO 1;  1TN7 A;  3VLD A;  5L3B B;  3ANW B;  2EIN E;  2BS3 A;  2EIK E;  4ZOL E;  4PH4 B;  5LCY A;  4H9R C;  3HIZ A;  5BR8 T;  2AW6 A;  1YXR A;  4JHK A;  3EI0 A;  4TNV A;  3UI2 A;  4EHM A;  2CCQ A;  3VKG A;  2YIN A;  1B89 A;  1G3N B;  3B7S A;  2NYJ A;  5LBQ B;  3PEU B;  4GPM A;  1B7T A;  3S7J A;  2ZLY A;  2VGX B;  3N9M A;  4TUU A;  2KXP B;  2WU5 A;  5L4H A;  2Y48 B;  1TN8 A;  4ME2 A;  5LB7 B;  3DXK G;  3MKQ A;  3N2K E;  3FTV A;  1T72 A;  1MIV A;  3OXG A;  2WWU A;  3N9P A;  4L1B A;  5EYL A;  2W67 A;  3AE5 A;  2KSR A;  2J9Q A;  4N3A A;  3TWR A;  5HCJ A;  5FYM A;  4GZC A;  2VQE T;  4JI7 T;  4HFG A;  4U96 D;  2J62 A;  3K9I A;  3CLJ A;  4K5B A;  4ZI3 C;  2MYO A;  3OVU A;  3G2W A;  3VTX A;  4Q25 A;  2HPL A;  1X5B A;  4NPP A;  4JV5 T;  3KV5 A;  4JEH A;  4A3T A;  4CXW A;  4R7L A;  3SFD A;  1FCH A;  1D1B A;  3FB2 A;  3E32 A;  3KVB A;  4BJM A;  3TLU A;  3AS4 A;  4FHJ A;  3CX6 B;  4DPR A;  4E7S A;  1KZP A;  4ZZB A;  5B1A E;  1Z8U A;  2W62 A;  3FTX A;  4UI9 K;  3RQU A;  1D9S A;  5HXC A;  2XUE A;  5BV0 A;  4RQI A;  3IHY A;  3T1Y T;  4F53 A;  4AY6 A;  4BET A;  3BUA A;  4DLO A;  5EK3 A;  4IRU A;  2CG2 A;  3SO8 A;  1FVH A;  1NEK A;  4Y6W A;  5ENN A;  3UM0 A;  3PDY A;  3D9N A;  3SFY A;  3CR3 A;  4U95 D;  1BR4 A;  4NUU A;  4CN4 A;  1H6P A;  4GTR A;  1EF1 C;  3AB3 B;  2LLY A;  4KMC A;  2XHE B;  4U2Z A;  2MPK A;  4U31 A;  1MNE A;  4PK4 A;  3GN5 A;  4LEU A;  4L2Y A;  3AEC A;  2XQ5 A;  1JWF A;  3HXB A;  5E0O A;  2ILR A;  1BR2 A;  3E4B A;  2A2F X;  1TNY A;  5JHA A;  2K9A A;  5LYJ E;  1OCC E;  2RKK A;  5EYP F;  1Y8M A;  2BVM A;  1K1A A;  4MFR A;  4YTN A;  3KAE A;  3IBP A;  4V1A v;  1OED C;  2XSA A;  3TAX A;  2B1E A;  4FI5 A;  4Y6C A;  3U4T A;  5LHI B;  2Q9Q D;  5A1L A;  2KT9 A;  5LGN B;  4MHC A;  2BS4 A;  4X64 T;  3Q4A B;  4F1P A;  3LJC A;  4G25 A;  4WND A;  3EDV A;  1AJ3 A;  3CQC B;  3KV9 A;  3F6Q A;  1QBQ A;  2PQR A;  2CXF A;  2VSN A;  4WWO A;  3DPY A;  3ENE A;  5L3G B;  4W9R A;  3ZT7 A;  2A72 A;  1E7P A;  2WP9 A;  2BG9 C;  3DSX A;  2JAB A;  1E8Y A;  2OCC E;  5J90 A;  1OED B;  3PUY F;  2IC6 A;  3D3M A;  4RSY A;  1A5E A;  4ZS3 A;  1W9R A;  3V79 K;  4LMJ A;  3BG0 B;  5ANR A;  4JA9 A;  1LKX A;  2V7I A;  2CHX A;  3CSF A;  1H2U A;  5LX8 A;  1OCR E;  1QLB A;  4YDY A;  2EIL E;  4ZHQ E;  3AE2 A;  5FL0 A;  4YTP A;  4ANU A;  3JAD A;  2P9L G;  2KMF A;  3OXF A;  3NOG D;  3RF1 A;  5HEJ A;  3UQ7 A;  3EAB A;  2IO2 C;  3FUN A;  2XS8 A;  1MMD A;  4NAC A;  4AM9 A;  1UGO A;  5HKP A;  1J5W A;  2BG9 B;  4CI1 B;  4AIS A;  1PC2 A;  2IY0 C;  2V7J A;  3D9I A;  3OBV E;  2H3R A;  2A4Z A;  1N0Q A;  2LOP A;  3AAE B;  4HOQ A;  1JCR A;  3OXL A;  1MHQ A;  3DSU A;  4TUY E;  4HLE A;  4C9B B;  2OLT A;  2PM6 A;  4AXP A;  5FXX A;  4I1M A;  3A5X A;  1WRD A;  4JEU B;  2IHR 1;  1O3X A;  4KX6 A;  3MV2 B;  3UXG A;  4YVQ C;  2XQA A;  4U07 A;  2CHW A;  4H63 V;  1V9D A;  4UWK A;  1PY1 A;  3FEX A;  3DXM G;  3ZEF A;  4UWL A;  4CDR A;  3FDH A;  5KMG P;  2M6B A;  2WDV A;  4B0Z A;  3LK4 2;  3UM1 A;  4U0S A;  3L09 A;  5KX5 E;  2C5K T;  2VVN A;  4KBQ A;  4KHP T;  1IAP A;  2V5F A;  2WZH A;  4DVD A;  4ZFH A;  4O1O A;  2V4H C;  4XIF A;  4YVO A;  3RO3 A;  5BNW A;  3RIF A;  2KC7 A;  4G2A A;  4U8V D;  4QH4 A;  4MBQ A;  5FZS A;  2XAS B;  4ZS2 A;  1WYB A;  5H6R B;  1D1C A;  2AJA A;  5JHB A;  4I43 B;  3AS5 A;  3E37 A;  4L9P A;  4CXX A;  3RRN B;  3LG7 A;  3MEK A;  4GTQ A;  3ZHE B;  4YJ3 E;  3KEA A;  4QH1 A;  2I0M A;  3P4W A;  5D0O D;  5FWQ A;  2WB5 A;  3NBX X;  5LOZ A;  3ASN E;  3CHM A;  3UUX B;  2XQ3 A;  3MKQ B;  1E8X A;  1V54 E;  1YW0 A;  2WB2 A;  4OYK A;  3LY7 A;  2WXJ A;  5AN8 A;  3PZ2 A;  5LJM A;  1UJJ A;  5AEN A;  1GQE A;  2CG3 A;  2DWZ A;  3JCK C;  4KT6 B;  4N39 A;  2JPF A;  4U74 A;  4AQF C;  2FO7 A;  3P4S A;  4F6R C;  1AP7 A;  4IDP A;  1HS6 A;  5AQL B;  5HAX A;  1BU9 A;  2KLQ A;  3GW4 A;  2ZGG A;  3ISM C;  2C0S A;  2JRK A;  3I3N A;  3FH7 A;  3CHQ A;  4ASK A;  2WBL A;  4WNF A;  4M7C A;  4IDZ A;  5FXW A;  4DR4 T;  2HN1 A;  3SF4 A;  3FTW A;  3PTR B;  2V26 A;  1LVF A;  5D0Q D;  3AE9 A;  5LOV E;  1IXV A;  3GWH A;  1E96 B;  4HBD A;  3T8K A;  4HOU A;  4BER A;  5L4E A;  3TLV A;  1Z0P A;  3APC A;  1ZOY A;  5A7D B;  4DX5 D;  5FY1 A;  3QOF A;  5AQM B;  4PK6 A;  3GZ2 A;  1UX5 A;  1HS7 A;  1N95 A;  4AQG A;  5FQ4 A;  1T8B A;  2KZT B;  4KZ0 A;  4U8H A;  4ATZ D;  3QWP A;  4UI9 C;  4XZC A;  3VU7 H;  3Q7F A;  2PM7 A;  3V30 A;  3MYV A;  1YKE B;  2R03 A;  2X6H A;  4LCT A;  3ZVV A;  4HKA A;  1FIO A;  3EAM A;  3RO2 A;  1MYO A;  4U0U A;  1N0R A;  1TJC A;  5AJD A;  3Q78 A;  1QZ2 A;  3O48 A;  3Q73 A;  4HWF A;  2PFV A;  2X0Y A;  2GRQ B;  2WXR A;  4ANW A;  3ONK A;  3P2B A;  3H3A A;  4APF A;  4GAA A;  2IU1 A;  4Z91 A;  4Q94 A;  4YFS A;  4B93 B;  1TNB A;  3HVE B;  3APD A;  3PUJ A;  1Y01 A;  5C2T A;  1W0A A;  4KHZ F;  4OK0 A;  5FMN A;  3O4Z A;  5AQN B;  4AP2 A;  3MX3 A;  4HFC A;  4HOS A;  1TNZ A;  4JL0 A;  3FXE B;  1OCO E;  2A3D A;  4LNG A;  3PVL A;  4PFP A;  5CHE E;  1NEN A;  3UUN A;  3QWV A;  1I94 T;  1V55 E;  3A8Y C;  4M3O A;  4K0R A;  4ZI2 C;  2DZO A;  3EDU A;  3NRY A;  3C4W A;  4GPK A;  3UT7 A;  4IT4 A;  2WMN A;  3AED A;  2LAI A;  4GML A;  1US7 B;  2ZMA A;  1IBL T;  1INZ A;  4PJN A;  5HEG A;  4AIU A;  4AKH A;  3MA5 A;  1ZP0 A;  3LY9 A;  5IYZ E;  4AOF A;  3RGL A;  4B8C B;  3R6N A;  3D9H A;  2BKN A;  4L7T A;  2X9X A;  4APO A;  1ELK A;  1SW6 A;  3CVX A;  1S63 A;  2D0T A;  1SA4 A;  4RG9 A;  2KCL A;  1S35 A;  1VOM A;  4QX8 B;  4A1G A;  2OEW A;  2VSY A;  3U78 A;  4L9I A;  2L0T B;  4YSZ A;  5BMV E;  3RRC A;  1IYG A;  2ETA A;  4RVB A;  3PE4 A;  2XS1 A;  4B8A A;  2R02 A;  3PU3 A;  5BT1 A;  5KJK A;  4O4H E;  2UWJ G;  4N5Q A;  2DLR A;  1LD7 A;  3JAE A;  3HG0 D;  1ZKE A;  5KJL A;  5HXS A;  1HXI A;  4NIQ A;  3FWV A;  3RU0 A;  2K48 A;  2YEV C;  3JCF A;  1H0A A;  2MAW A;  4X65 T;  5FZQ A;  1N4P A;  3Q5W A;  4N5C A;  3RRU A;  3HRA A;  4QXC B;  2ETB A;  4YXD A;  3TWV A;  2JIW A;  1EPU A;  3PE0 A;  3FUK A;  4XX5 A;  3DSV A;  1BI7 B;  2LXM A;  3FUJ A;  4J8E A;  4ANJ A;  2C2L A;  1NWM X;  3ZKJ A;  2DIW A;  4UQX A;  1HR0 T;  4O1P A;  2F8X K;  4C91 A;  1HF8 A;  3IA3 A;  2EIJ E;  3IEG A;  1S70 B;  4KP3 C;  3UQ3 A;  4B89 A;  2LE8 A;  4ACL A;  5A6C A;  5JA4 D;  1J5E T;  4IYP A;  2FUP A;  2NR4 A;  3SHF A;  5GON E;  3PDN A;  2F8Y A;  1OWO A;  2FJE A;  2LAH A;  2IML A;  4HI8 A;  3E08 A;  5CA0 E;  3ULQ A;  2C0L A;  3M3Z B;  2H6G A;  2KBX A;  2DYR E;  2LSY A;  3TLS A;  4JD2 G;  3TG5 A;  5FNV E;  1WG0 A;  2FJA A;  3FY4 A;  3UU4 A;  2MBG A;  3CK9 A;  3RAU A;  3CVU A;  4B3R T;  3QNU A;  2XTL A;  3HKB E;  2M6I A;  2L3L A;  4NUR A;  1PAQ A;  2VTB A;  3PUQ A;  3FH8 A;  2KND A;  3AEF A;  3LKU A;  4U2Y A;  3ZT6 A;  4B3M T;  2XM2 A;  3D9M A;  4M1P A;  5HEH A;  2ZXW E;  3ML9 A;  4URK A;  2BDE A;  4EYY R;  4LFB T;  3CVR A;  1WDY A;  1HX8 A;  2X0L B;  5JVD E;  5EK2 A;  4GKJ T;  1DC2 A;  4PJM A;  4G23 A;  4UF0 B;  5KCM A;  5ARF A;  4GTO A;  3AAA B;  2LRK A;  5DIZ A;  4P29 A;  4H9P C;  4GA2 A;  4JA7 A;  4QXB B;  4U8Y D;  4E6H A;  1KLX A;  3AU4 A;  5AFU L;  4EYU A;  4EXT A;  5D2M C;  2VGY A;  3N9Q A;  3J5Q B;  2P58 C;  5E75 A;  2DWG A;  5B1B E;  4MLK A;  4HFB A;  5T3R A;  2R17 C;  1P5Q A;  1ZEE A;  2QFC A;  4HFE A;  2IW5 B;  4JI2 T;  5FQ7 A;  3ZT5 A;  1HE8 A;  2OVF A;  2EHO A;  2XQ7 A;  1N32 T;  1HH8 A;  3EDT B;  4N2Q A;  2X3M A;  3Q5E A;  4C90 A;  4DR6 T;  3E22 E;  3W15 B;  4PUC A;  5IUX A;  1NA0 A;  4ISS A;  4AXH A;  3RYC E;  4HN9 A;  3RIU C;  3ZW3 A;  2XPK A;  3HHM A;  3CST A;  1KFY A;  2V7M A;  1N4Q A;  5F8P A;  3ZYL A;  3FP3 A;  4LMK A;  3B7T A;  4DX2 A;  3UIP C;  2WXI A;  4AKL A;  1KZO A;  4G8K A;  3C4X A;  2VK9 A;  3RRW A;  3FU3 A;  2Y4U A;  3AE1 A;  3BG1 B;  4TV3 A;  4K0U A;  4JI1 T;  3Q79 A;  3HKD E;  2R59 A;  4P09 A;  3UT8 A;  3FU5 A;  4EZK A;  4EBA G;  4EV6 A;  3DEO A;  3AVS A;  4DJA A;  5JTG A;  2VVS A;  4CT0 A;  5HYA A;  4DX6 D;  4JW1 A;  4Z68 A;  5LCW J;  3CKD A;  3KFW X;  4DRX E;  5CMY A;  3CKC A;  4CZ2 D;  5CA1 E;  5C8Y E;  4TWD A;  5H6Q B;  1HTJ F;  5JJ7 A;  2YDS A;  4L2L A;  4OYS A;  4QHO A;  2BS2 A;  3HL6 A;  2CHN A;  2NOX A;  4CEM A;  4IDO A;  3N9L A;  3C72 A;  2GRO B;  5LHG B;  4YSY A;  1XMO T;  3VTY A;  3DWL G;  4A3V A;  4FA6 A;  4UUC A;  4EGW A;  2CM0 A;  1YD8 G;  3ESL A;  3U64 A;  3SGH A;  4F7A A;  2QYW A;  2P9P G;  5FXV A;  2XGM A;  4G24 A;  4PS7 A;  2V6Y B;  1FMV A;  2UY1 A;  3DBS A;  4J7W A;  4IE4 A; 
#chains in the Genus database with same CATH homology
 4H7Y A;  1GW6 A;  4XI0 A;  3V5U A;  2YHC A;  4GU5 A;  3SS1 A;  3K3N A;  2E8I A;  5F3J A;  4LRZ A;  2MTQ A;  3NZS A;  3S7F A;  3C98 B;  3S7D A;  3J9X 1;  2J4D A;  1T98 A;  4I50 E;  4EB6 E;  4BJN A;  1HFA A;  5BPP A;  3LVQ E;  3LVR E;  2LSU A;  2XAG B;  2L8K A;  1JWG A;  1IZN B;  2VKD A;  1DVP A;  3QJZ A;  5J1G A;  2IJG X;  4CDM A;  3C4Z A;  1FEW A;  2ACX A;  3SWH A;  3CX7 B;  3BQK A;  4B6X A;  4JXT A;  3QC9 A;  4IE6 A;  4MRU A;  1A17 A;  2V4L A;  3T5X A;  1HG5 A;  2WXQ A;  2BF0 X;  3I9W A;  3QWW A;  1H2T C;  4Q69 A;  1YA0 A;  4G1T A;  2Q9Q A;  2FUL A;  2L6J A;  4AKR B;  4IIJ E;  3CVV A;  3RK6 A;  2MOW A;  2LSJ A;  2PJQ A;  4H63 H;  3L3P A;  2NC9 A;  3BQI A;  1S0P A;  3ZFW A;  4GZD A;  2AXU A;  3EVY A;  5JDN A;  3RC3 A;  3LDZ A;  5JR9 C;  3G2S A;  2X66 A;  3FTY A;  5M72 A;  3RX6 A;  1JUQ A;  4AVX A;  3WXX A;  3SRZ A;  5G55 A;  2VSO E;  2J49 A;  3EHM A;  4PW8 A;  2AWI A;  4AKG A;  3OJA A;  3ZMZ B;  4QKN A;  4ILH B;  3ZC1 A;  2XPI A;  4ANV A;  3VLF A;  3CML A;  5G05 J;  3ZGQ A;  1YKH B;  5JR9 B;  2KWH A;  3CK7 A;  3T5V A;  3O4X E;  2MRI A;  4UV8 B;  3MKR A;  3UT5 E;  2E9X C;  4PNI A;  5JRC A;  3O1J A;  4ILU A;  3CVW A;  4QX7 B;  2XGO A;  1E8Z A;  2XQY A;  2EHO B;  3UMV A;  2OV8 A;  3UUL A;  3MZK B;  2H7O A;  3FTU A;  3HYM B;  1HCI A;  3CQX C;  1LVK A;  3AA0 B;  2C5I T;  4H9S E;  2NP9 A;  2E9X B;  4PAG A;  5CMW A;  2DCF A;  2K5B B;  3UTK A;  3CK8 A;  3MKD A;  3LS8 A;  2WVI A;  3UPV A;  2WXH A;  3WAK A;  2YNQ A;  2YQ8 A;  3RYF E;  2LM9 A;  1HG2 A;  3RKO A;  3LBX B;  2H7V C;  4IE0 A;  3GZS A;  4X1Y E;  5JDF A;  3FUF A;  3ZYM A;  2Y4T A;  2BUG A;  4GCO A;  3FHN A;  4ILG A;  2NW9 A;  2XAH B;  3PRZ A;  4GA0 A;  5HQ8 A;  3CVY A;  3QAR A;  2VQ2 A;  2HYZ A;  4ERR A;  3D9J A;  4A1S A;  5FY7 A;  2VJ8 A;  4BWR A;  2C0M A;  4CXY A;  1HO8 A;  2X38 A;  2Q7F A;  3ZMU B;  3L13 A;  4HEA A;  2V0P A;  3KBU A;  4XAX B;  2XPY A;  2YHE A;  2RD0 A;  2LSG A;  3FEY A;  3OAW A;  3SBS A;  2X9H A;  2VSX E;  1NAF A;  4AY5 A;  4K03 A;  3L6A A;  1ZHC A;  4DBQ A;  1E90 A;  2DHR A;  4OFZ A;  2LNI A;  2V7K A;  5JDL A;  3G2U A;  5LP6 E;  2XAF B;  4ZI2 D;  5JQG E;  2W00 A;  3BEE A;  1SQM A;  3CEQ A;  4BFR A;  4J8F A;  1NA3 A;  3CHO A;  4GA1 A;  3I0Q A;  3CIA A;  5C1D A;  1U4Q A;  4OHF A;  2ODU A;  3NQP A;  4DND A;  3PE3 A;  5HWY A;  4DI4 A;  3PNL B;  3QAQ A;  5G2N A;  4JEH B;  4UWH A;  3RC8 A;  2ION A;  4DMW A;  3LY8 A;  2XGS A;  2GGF A;  4CT4 A;  2Y8D A;  4CQI A;  3KV4 A;  2CXL A;  5ANL A;  4WNK A;  4ADZ A;  3HKE E;  4HXI A;  4JZY A;  5KDM C;  1H7C A;  5ARG A;  2WAU A;  4AIF A;  5JJT A;  2IAK A;  1SZA A;  3I0O A;  3ZPO A;  1MIW A;  4E85 A;  3GA8 A;  2ZM8 A;  2CLY C;  3LK2 B;  2LO6 A;  2DI4 A;  3LK3 B;  4EEC A;  2N1G A;  5EDS A;  3VKH A;  2HH7 A;  1D1A A;  3FU6 A;  4XE0 A;  5DBK A;  4FP7 A;  2QA7 A;  2WXK A;  5FJY A;  4TV8 E;  3SZ7 A;  3GN5 B;  4EBA A;  2CMR A;  3UUM A;  3RIB A;  2WPV A;  4I9C A;  3ZC0 A;  2XQ0 A;  2FF4 A;  4JVS A;  3N9O A;  4HS2 A;  3BK9 A;  2EQX A;  2CLY B;  4I6G A;  3AVR A;  4UXN B;  4O4J E;  3MJX A;  2OA5 A;  3L54 A;  4JC8 A;  2LSV A;  2NWB A;  2I2O A;  4UQZ A;  4J6I A;  3MK7 C;  3NF1 A;  2LOS A;  4CGW A;  3ZN3 A;  3EIQ C;  4UQY A;  3M65 A;  3EIJ A;  2K24 A;  4D10 C;  1Z6T A;  3C64 A;  5JDQ A;  1EZ3 A;  4XKB A;  2XEV A;  3KIN B;  2M63 A;  3EUH A;  1U3D A;  5AJL A;  1IQR A;  1KNZ A;  3CV0 A;  4HOR A;  4V3I A;  3IBE A;  3KD7 A;  3Q2M A;  4WBO A;  3SFZ A;  2VWA A;  2X6K A;  3TL5 A;  3CKB A;  1UW4 B;  3ANW A;  3AA6 B;  4CRW A;  2ES0 A;  3G2T A;  4FJO A;  4FLB A;  3P8C D;  3N5L A;  1ELW A;  3ONL A;  3K3O A;  4Q96 A;  1UX4 A;  2XAJ B;  3E0Z A;  5LGT B;  2WQ7 A;  4HFV A;  3ZJ1 A;  3G2V A;  4AV7 A;  2J07 A;  3ONX A;  3CHS A;  3D9P A;  3SOL A;  5J2U E;  4I2W A;  2VGX A;  2QY7 A;  3ZCJ A;  4JPS A;  4A56 A;  2A5U A;  2W61 A;  4NUV A;  3ZPJ A;  1HU3 A;  3IHR A;  4TZ4 C;  3C50 A;  3PS6 A;  4O2A E;  2XAQ B;  5EK4 A;  4N2S A;  4X1I E;  2JLB A;  4MAL A;  3ZEF B;  3PNT B;  3KVA A;  2OVB A;  4O2B E;  3R9A B;  5L3E B;  2YU2 A;  3SI5 A;  4CCA A;  5KJM A;  2W63 A;  2NW7 A;  4BAY B;  3L16 A;  4FJZ A;  5J08 A;  3TJP A;  3R7Q A;  3MAC A;  3ZMT B;  1MMG A;  2WXN A;  4C0M A;  2HM8 A;  1LF8 A;  3LXU X;  2X9Y A;  3F31 A;  5EKQ D;  4OYJ A;  3J7Y q;  3VHL A;  4BA9 A;  3DTO A;  4YLH A;  4I2Z A;  4YJ2 E;  1H2V C;  4JHR A;  1D0Y A;  3I5P A;  3EJN A;  3OTN A;  5FT9 A;  1FMW A;  1WY6 A;  1U5P A;  3ZLI A;  1MQS A;  3LYA A;  2XHE A;  3FFL A;  3FH5 A;  3U3W A;  2KZ7 B;  4Z8X A;  4KVO A;  3JC6 C;  4IN3 B;  4X1K E;  1S94 A;  4N78 D;  4GK5 E;  4WNG A;  1WLX A;  4NQ0 A;  4U72 A;  3B57 A;  4PK5 A;  4EIW A;  1UG3 A;  2WXG A;  4OVU A;  4JHJ A;  4FAD A;  5JJ6 A;  4GZ5 A;  3FUE A;  3DP7 A;  3LEW A;  5LA6 E;  3DJB A;  3Q9D A;  2XPZ A;  2CFZ A;  4ZI3 D;  2NW8 A;  5T8I A;  3FBL A;  1CUN A;  4FLH A;  5DQW A;  2PL2 A;  3JUI A;  3V5S A;  1KT1 A;  2I6H A;  1W3B A;  3AA1 B;  4O6F A;  2RP4 A;  3KV6 A;  4BTA A;  4I4T E;  5LP0 A;  3H37 A;  2DNX A;  1JPL A;  2RG8 A;  2L9B A;  4I55 E;  3U66 A;  2KWI B;  3K8P C;  1X79 A;  3PEV B;  5G04 J;  3ZN0 B;  4GOU A;  4JUY A;  1FVF A;  2J09 A;  4J2C A;  2M67 A;  5L3C B;  4YND A;  3QOU A;  2VL8 A;  3ZYQ A;  2CWO A;  4JEU A;  2VKH A;  5FP3 A;  3JQ0 A;  1QQE A;  4PS8 A;  2FBN A;  1IJ5 A;  2GRL A;  1D0X A;  3BQL A;  3S7B A;  2CHZ A;  1MMA A;  3IHV A;  3FU0 A;  3FUM A;  3EHN A;  4X20 E;  4OVV A;  4O4L E;  2J4B A;  1NP7 A;  2JQQ A;  4UEM A;  1BR1 A;  5JH7 E;  4XKC A;  1OWP A;  1Z3Y A;  3I9Y A;  5EX0 A;  3U9W A;  2DBA A;  2HR2 A;  3QDN A;  3ZRH A;  1U3C A;  4TN7 B;  2VKO A;  1OWM A;  4QWN B;  4I43 A;  1KT0 A;  4UVA B;  5EZY E;  3TG4 A;  1WM5 A;  4FC8 A;  2N9D A;  5E76 A;  3ZHE A;  4DI3 A;  1IHG A;  5BUZ A;  3I4G A;  2W0G A;  2QGS A;  3PU8 A;  3UUX A;  4DO0 A;  2E2E A;  4I9E A;  4L23 A;  3HR0 A;  3JYS A;  3MGB A;  2ODV A;  3FTZ A;  1N52 A;  2OND A;  4FHK A;  3L22 A;  3ZYK A;  2NTX A;  1Y6I A;  4DK5 A;  4CZZ B;  3FUI A;  4PS3 A;  5DJQ C;  4WBN E;  1UN8 A;  4PJL A;  5FQ6 A;  5JDM A;  2WXM A;  4HE8 A;  2J1D G;  5T4Y A;  3P7I A;  3QK0 A;  3CHP A;  5LCW C;  4UIG A;  5JDH A;  4H9O C;  4ATG A;  3TXM A;  5G04 C;  4QFV A;  2WMO A;  4G11 A;  4KVM A;  3PZD A;  4AQF A;  2VTB B;  2X6F A;  2BZB A;  2WM9 A;  1G8X A;  3AAI A;  1EDU A;  1VDY A;  2L0I A;  2KZT A;  3MZL B;  2V8S E;  1KK7 A;  4PFO A;  1OWA A;  2X6I A;  4EPZ A;  5LGU B;  2Z6E A;  3FBZ A;  2EHO C;  2X68 A;  1WR6 A;  3Q15 A;  5TAO A;  3HKC E;  2ZU6 B;  4IE7 A;  4XBF B;  4F3V A;  2CWY A;  1ZBP A;  2P9B A;  3N71 A;  3CVL A;  5KJN A;  4MS6 A;  1LRZ A;  4TV9 E;  3ZXS A;  4MLP A;  4DLQ A;  2GW1 A;  3Q49 B;  3HVE A;  3CVQ A;  3CVP A;  2WXL A;  3QK6 A;  2N2N A;  2CFU A;  4RG6 A;  4N3C A;  1BR0 A;  4XI9 A;  2JMK A;  3GZ1 A;  4GZ3 A;  3AS8 A;  1H6K A;  5IHY A;  4IHJ E;  1XGW A;  3ETV A;  3O9X A;  3FTS A;  3PH0 C;  4UWF A;  4EZJ A;  3TGO A;  4BX8 A;  1QSD A;  4YHJ A;  3FUL A;  4GB9 A;  3AU5 A;  2FI7 A;  5DQV A;  5LBM A;  5LG4 A;  4I1A A;  3LFM A;  3IF8 B;  5CB4 E;  3CHR A;  3QKY A;  4I17 A;  4FJY A;  4L5G A;  4XZ4 A;  3AA7 B;  3FUD A;  5FTP A;  2WXF A;  4A55 A;  5AIJ A;  4GIW A;  3WI3 A;  4UWG A;  1VRB A;  1MIY A;  3RYI E;  2NXP A;  4AEZ C;  2HO1 A;  5CCL A;  4PJJ A;  3UX4 A;  1UN9 A;  5A23 A;  3ML8 A;  2V1D B;  2WXO A;  3D9K A;  4N3B A;  4IGU A;  1XNF A;  4EZL A;  4UI9 J;  3PUS A;  3UT4 A;  5L2L A;  2UY1 B;  4U0Z A;  2CXD A;  4CI3 B;  4E7Z A;  5JDG A;  3KDS E;  5HWX A;  2Y3A A;  4ANX A;  3MCX A;  4EOZ B;  4EAH A;  4ILI A;  1SZ9 A;  3RH3 A;  2AVP A;  5G05 C;  3KS2 A;  2NTY A;  3CWZ B;  3LCA A;  3QB2 A;  5HXR A;  2VKJ A;  4J8D A;  4KYO B;  2UXX B;  3ZIM A;  4GYY A;  5HXH A;  2Q9Q C;  2SPC A;  4IUL A;  3S2A A;  4DBR A;  4MKT A;  2WQH A;  4J8S A;  4UEL A;  2NSZ A;  3HA4 A;  4UVC B;  4GYS A;  2I59 A;  3HI2 A;  5ETW A;  1Y64 B;  5L3F B;  1QNF A;  3F57 A;  4UF0 A;  3VLE A;  3LPZ A;  2Q9Q B;  1TJF A;  5DAB A;  4TRQ A;  3NRX A;  3O1I A;  5LHH B;  3PUG A;  4LER A;  3ASF A;  3CQG B;  2YU1 A;  4JLE A;  2L9Q A;  4I6E A;  2WQ6 A;  4CGV A;  5LJN A;  1NZN A;  2KCK A;  5C2Y A;  4AJW A;  1H19 A;  3QUJ A;  3WAJ A;  3T8O A;  3NZP A;  4WNE A;  2PBI A;  4KZC A;  4B94 A;  4UV9 B;  2OOE A;  1OUV A;  2JJ9 A;  2BTD A;  4WWP A;  3TXN A;  2KM4 A;  5LXT E;  2I9C A;  2LHR A;  4KUM B;  2UXN B;  4BX9 A;  2PZI A;  2CE7 A;  2X67 A;  3DPD A;  2CA5 A;  3F2E A;  3I1A A;  1E7U A;  4AI6 A;  2C5J A;  1ELR A;  1E7V A;  4EZH A;  3B7U X;  4LUN U;  5JRC B;  4NRH B;  3FXD B;  3NZQ A;  4GYO A;  1TEZ A;  1OWN A;  3SBT B;  3JQ1 A;  4EQF A;  5FZR A;  4HTE A;  3JC6 D;  2MHK A;  4GYR A;  1D0Z A;  4BY6 A;  3SNX A;  2AXV A;  4G2V A;  2KIN B;  3SD5 A;  3Q47 B;  4HOT A;  1QUU A;  1ZU2 A;  3FUH A;  2IOL A;  5FXZ A;  3QNK A;  3D9O A;  3KBT A;  5FQ8 A;  2JMH A;  2VAS A;  2WXP A;  3C98 A;  2HPJ A;  3IV0 A;  3C51 A;  3O1H A;  3U3I A;  1N54 A;  2MOZ A;  3R7R A;  4FUL A;  3GYZ A;  3B13 A;  2IC9 A;  2GRM A;  1EYH A;  3CX8 B;  1HZ4 A;  3P1U A;  2IQC A;  3ASD A;  3Q5X A;  4H9N C;  4GZ6 A;  3NZU A;  4P0A A;  2ZM0 A;  1DNP A;  4BT9 A;  3IEE A;  2X9W A;  1MMN A;  4GYW A;  5L3D B;  2LEH A;  4O8S A;  4TX5 A;  4UVB B;  3FHE A;  3APF A;  4GMJ A;  3HDX A;  2CEA A;  2IFU A;  2X51 A;  5CCM A;  2ZM2 A;  3Q5M A;  2I1K A;  2DCP A;  2D5U A;  1L5J A;  3ASH A;  4KMO A;  3D0T A;  5J2T E;  4ACK A;  3OYZ A;  2DWK A;  1IQU A;  4WW0 A;  2VYI A;  2V7L A;  4QXH B;  1UJK A;  4H9Q C;  3CVN A;  3IKO B;  3KEZ A;  4U04 A;  3L08 A;  2AXZ A;  3S4U A;  4H7X A;  3OYX A;  1E8W A;  3N2O A;  3RYH E;  5EX3 A;  3RPU A;  2PQN A;  2KAT A;  2LHN A;  2LJL A;  3TKL B;  3ZCI A;  3ZN1 B;  2Y6X A;  2LT3 A;  4F1S A;  1UCU A;  3OKQ A;  3UFE A;  2IOS A;  3MJW A;  3ZMV B;  3B7R L;  4P0B A;  3MA9 A;  4C0E A;  1SA0 E;  4G26 A;  4HVB A;  1SHZ C;  4PDX A;  4G63 A;  2XCC A;  3CGH A;  3MV3 B;  2XRY A;  4WAF A;  5JR9 A;  2I1J A;  2FEZ A;  4GCN A;  3N9N A;  5LFA A;  4GK0 E;  4L0R A;  4BTB A;  4WUY A;  1OXZ A;  4WWN A;  4KBM B;  3PUA A;  5M4Y A;  4DMV A;  3PRE A;  1E1H B;  3GMI A;  4ABN A;  2LSK A;  4J0U A;  3CPZ A;  2R5S A;  3I4R B;  3R84 B;  4U63 A;  3K3Q C;  2XRZ A;  2WSS V;  1BPO A;  2MYS A;  2IF4 A;  4FU3 A;  5BV1 A;  4CI2 B;  2J08 A;  3RJV A;  4I1O B;  2E9X A;  5FY0 A;  2D2S A;  3T8M A;  3PUR A;  2D0U A;  2JEK A;  4ZI7 E;  2VB6 A;  5AYW D;  4AKI A;  2G0U A;  1OWL A;  3D9L A;  2RA1 A;  2BVL A;  3ZJ2 A;  4CDN A;  3LBX A;  1MND A;  3N2G E;  5ADX L;  4KXK B;  5LNK A;  4O4I E;  3ESK A;  2KCV A;  5JRE A;  4BT8 A;  1WYC A;  3ASG A;  4I6J A;  4IE5 A;  2X6J A;  3PUK A;  3RKV A;  3LJ3 A;  5BW8 C;  2LSI A;  2PG8 A;  2GK9 A;  4EZ4 A;  2E0I A;  3ETU A;  2EHO D;  3QC1 A;  5HXE A;  2XCB A;  1Z3X A;  4BSX A;  1ZV4 X;  5HI7 A;  4HGA A;  3ZMS B;  4IST A;  2YK0 A;  1IJ6 A;  3MXZ A;  3L17 A;  3URZ A;  2E9X D;  1G73 A;  3RRM B;  1WAO 1;  3VLD A;  5L3B B;  3ANW B;  4ZOL E;  4PH4 B;  5LCY A;  4H9R C;  3HIZ A;  2AW6 A;  4JHK A;  2CCQ A;  3VKG A;  2YIN A;  1B89 A;  3B7S A;  5LBQ B;  3PEU B;  3S7J A;  1B7T A;  2ZLY A;  2VGX B;  3N9M A;  4TUU A;  2KXP B;  4ME2 A;  2Y48 B;  3MKQ A;  3N2K E;  3FTV A;  1MIV A;  3OXG A;  2WWU A;  3N9P A;  4L1B A;  2J9Q A;  4N3A A;  5FYM A;  4GZC A;  4HFG A;  3K9I A;  3CLJ A;  4ZI3 C;  3G2W A;  3VTX A;  2HPL A;  1X5B A;  3KV5 A;  4JEH A;  4A3T A;  4CXW A;  4R7L A;  1FCH A;  1D1B A;  3FB2 A;  3KVB A;  4BJM A;  3AS4 A;  4FHJ A;  3CX6 B;  4DPR A;  4E7S A;  2W62 A;  3FTX A;  4UI9 K;  5HXC A;  2XUE A;  5BV0 A;  3IHY A;  4F53 A;  4AY6 A;  4DLO A;  5EK3 A;  4IRU A;  2CG2 A;  1FVH A;  4Y6W A;  5ENN A;  3PDY A;  3D9N A;  3CR3 A;  1BR4 A;  4NUU A;  1EF1 C;  3AB3 B;  4KMC A;  2XHE B;  1MNE A;  4PK4 A;  3GN5 A;  4LEU A;  4L2Y A;  1JWF A;  5E0O A;  2ILR A;  1BR2 A;  3E4B A;  2A2F X;  5JHA A;  2K9A A;  5LYJ E;  1Y8M A;  2BVM A;  4MFR A;  3KAE A;  3IBP A;  4V1A v;  3TAX A;  2B1E A;  4FI5 A;  4Y6C A;  3U4T A;  5LHI B;  2Q9Q D;  5A1L A;  2KT9 A;  5LGN B;  4MHC A;  3Q4A B;  3LJC A;  4G25 A;  4WND A;  3EDV A;  1AJ3 A;  3CQC B;  3KV9 A;  2PQR A;  2CXF A;  2VSN A;  4WWO A;  3ENE A;  5L3G B;  4W9R A;  2A72 A;  1E8Y A;  5J90 A;  4RSY A;  2IC6 A;  3D3M A;  4ZS3 A;  3BG0 B;  5ANR A;  4JA9 A;  1LKX A;  2V7I A;  2CHX A;  3CSF A;  1H2U A;  5LX8 A;  4ZHQ E;  4ANU A;  2KMF A;  3OXF A;  3FUN A;  1MMD A;  4NAC A;  4AM9 A;  4CI1 B;  1PC2 A;  2V7J A;  3D9I A;  3OBV E;  2H3R A;  2A4Z A;  3AAE B;  2LOP A;  4HOQ A;  3OXL A;  1MHQ A;  4TUY E;  4HLE A;  4C9B B;  2PM6 A;  4AXP A;  5FXX A;  4I1M A;  3A5X A;  1WRD A;  4JEU B;  1O3X A;  3MV2 B;  4YVQ C;  4U07 A;  2CHW A;  4H63 V;  1V9D A;  4UWK A;  1PY1 A;  3FEX A;  3ZEF A;  4UWL A;  4CDR A;  3FDH A;  5KMG P;  4B0Z A;  3LK4 2;  4U0S A;  3L09 A;  5KX5 E;  2C5K T;  4KBQ A;  2V5F A;  1IAP A;  4DVD A;  4XIF A;  4YVO A;  3RO3 A;  5BNW A;  2KC7 A;  4G2A A;  5FZS A;  4MBQ A;  2XAS B;  4ZS2 A;  1WYB A;  5H6R B;  1D1C A;  5JHB A;  4I43 B;  3AS5 A;  4CXX A;  3RRN B;  3LG7 A;  3MEK A;  3ZHE B;  4YJ3 E;  5D0O D;  5FWQ A;  3NBX X;  5LOZ A;  3CHM A;  3UUX B;  3MKQ B;  1E8X A;  1YW0 A;  2WB2 A;  4OYK A;  3LY7 A;  2WXJ A;  5LJM A;  1UJJ A;  5AEN A;  2CG3 A;  3JCK C;  4KT6 B;  4N39 A;  2JPF A;  4U74 A;  4AQF C;  2FO7 A;  4F6R C;  1HS6 A;  5HAX A;  2KLQ A;  3GW4 A;  2C0S A;  2JRK A;  3I3N A;  3FH7 A;  3CHQ A;  4ASK A;  2WBL A;  4WNF A;  4IDZ A;  5FXW A;  3SF4 A;  3FTW A;  3PTR B;  2V26 A;  1LVF A;  5D0Q D;  5LOV E;  3GWH A;  1E96 B;  4HOU A;  1Z0P A;  3APC A;  5A7D B;  5FY1 A;  3GZ2 A;  4PK6 A;  1UX5 A;  1HS7 A;  4AQG A;  5FQ4 A;  2KZT B;  4KZ0 A;  4U8H A;  3QWP A;  4UI9 C;  4XZC A;  3VU7 H;  2PM7 A;  3MYV A;  1YKE B;  2X6H A;  4LCT A;  3ZVV A;  4HKA A;  1FIO A;  3RO2 A;  4U0U A;  1TJC A;  5AJD A;  1QZ2 A;  3O48 A;  2PFV A;  2WXR A;  4ANW A;  3ONK A;  3P2B A;  3H3A A;  4APF A;  4GAA A;  2IU1 A;  4Q94 A;  4YFS A;  3HVE B;  3APD A;  3PUJ A;  4OK0 A;  5FMN A;  3O4Z A;  4AP2 A;  3MX3 A;  4HOS A;  4JL0 A;  3FXE B;  2A3D A;  3PVL A;  4PFP A;  5CHE E;  3QWV A;  3UUN A;  4M3O A;  4K0R A;  4ZI2 C;  3EDU A;  3NRY A;  3C4W A;  4GPK A;  3UT7 A;  2WMN A;  2LAI A;  4GML A;  1US7 B;  2ZMA A;  1INZ A;  4PJN A;  4AKH A;  3MA5 A;  3LY9 A;  5IYZ E;  4AOF A;  4B8C B;  3R6N A;  4L7T A;  3CVX A;  2X9X A;  4APO A;  1ELK A;  2D0T A;  4RG9 A;  2KCL A;  1S35 A;  1VOM A;  4QX8 B;  4A1G A;  2VSY A;  3U78 A;  4L9I A;  2L0T B;  5BMV E;  3RRC A;  1IYG A;  4RVB A;  3PE4 A;  4B8A A;  3PU3 A;  5BT1 A;  5KJK A;  4O4H E;  2UWJ G;  2DLR A;  1ZKE A;  5KJL A;  5HXS A;  1HXI A;  3FWV A;  3RU0 A;  2K48 A;  2YEV C;  1H0A A;  5FZQ A;  3RRU A;  3Q5W A;  4N5C A;  4QXC B;  1EPU A;  3PE0 A;  3FUK A;  4XX5 A;  3FUJ A;  4J8E A;  4ANJ A;  2C2L A;  1NWM X;  2DIW A;  4UQX A;  4C91 A;  1HF8 A;  3IEG A;  4KP3 C;  3UQ3 A;  4B89 A;  2LE8 A;  4ACL A;  5A6C A;  4IYP A;  3SHF A;  5GON E;  3PDN A;  1OWO A;  2LAH A;  3E08 A;  5CA0 E;  3ULQ A;  2C0L A;  2LSY A;  3TG5 A;  5FNV E;  3FY4 A;  2MBG A;  3CK9 A;  3CVU A;  2XTL A;  3HKB E;  2L3L A;  4NUR A;  1PAQ A;  2VTB A;  3PUQ A;  3FH8 A;  2KND A;  3LKU A;  3D9M A;  4M1P A;  3ML9 A;  4URK A;  2BDE A;  4EYY R;  3CVR A;  1HX8 A;  2X0L B;  5JVD E;  5EK2 A;  4PJM A;  4G23 A;  4UF0 B;  5KCM A;  5ARF A;  3AAA B;  5DIZ A;  4P29 A;  4H9P C;  4GA2 A;  4JA7 A;  4QXB B;  4E6H A;  1KLX A;  3AU4 A;  5AFU L;  4EYU A;  4EXT A;  2VGY A;  3N9Q A;  2P58 C;  5E75 A;  2DWG A;  4MLK A;  5T3R A;  2R17 C;  1P5Q A;  1ZEE A;  2QFC A;  5FQ7 A;  2IW5 B;  1HE8 A;  2OVF A;  2EHO A;  1HH8 A;  3EDT B;  4N2Q A;  2X3M A;  4C90 A;  3E22 E;  3W15 B;  4PUC A;  4AXH A;  1NA0 A;  4ISS A;  3RYC E;  4HN9 A;  3ZW3 A;  3HHM A;  3CST A;  2V7M A;  5F8P A;  3ZYL A;  3FP3 A;  3B7T A;  2WXI A;  4AKL A;  3C4X A;  2VK9 A;  3RRW A;  3FU3 A;  2Y4U A;  3BG1 B;  4TV3 A;  4K0U A;  3HKD E;  2R59 A;  4P09 A;  3UT8 A;  3FU5 A;  4EZK A;  4EBA G;  3AVS A;  4DJA A;  4CT0 A;  5HYA A;  4JW1 A;  5LCW J;  3CKD A;  3KFW X;  5CMY A;  3CKC A;  5CA1 E;  5C8Y E;  5H6Q B;  1HTJ F;  5JJ7 A;  4L2L A;  4OYS A;  4QHO A;  3HL6 A;  2NOX A;  4CEM A;  3N9L A;  5LHG B;  3VTY A;  4A3V A;  4FA6 A;  2CM0 A;  1YD8 G;  3ESL A;  3U64 A;  3SGH A;  4F7A A;  5FXV A;  2XGM A;  4G24 A;  4PS7 A;  1FMV A;  2UY1 A;  3DBS A;  4IE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...