1HF8A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
263
structure length
263
Chain Sequence
b'GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Clathrin
total genus 102
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hf8A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hf8A01
3D9JA 5J08A 2DCPA 1MHQA 1HG2A 3RRUA 3ZYQA 1EYHA 1JWFA 1HG5A 3LDZA 1HFAA 4HFGA 5LOZA 1SZAA 4NACA 1EDUA 1HF8A 2L0IA 4Q94A 3D9KA 3D9OA 5LP0A 1ELKA 3G2TA 1UJJA 5CMYA 2BF0X 4GZCA 3D9IA 3D9NA 2QY7A 3G2WA 1JUQA 4FLBA 3ZYLA 3ONKA 4GZDA 4AVXA 3D9MA 1JWGA 1HX8A 3G2SA 2L0TB 3ZYKA 1X5BA 1LF8A 4Q96A 3D9PA 1SZ9A 3ONLA 5CMWA 1XGWA 3G2VA 2KM4A 1INZA 4FU3A 1DVPA 3CLJA 2LO6A 3ZYMA 1H0AA 4JXTA 3G2UA 1UJKA 1JPLA 1PY1A 2DIWA 2V8SE 2MOWA 3D9LA 1VDYA
chains in the Genus database with same CATH superfamily
1HH8A 3FTSA 3RRUA 5G04J 4ACLA 3AAAB 4JL0A 2D5UA 3KVBA 3LCAA 2QA7A 2Y4UA 1O3XA 4HFDA 3T8KA 3G2TA 4FJYA 4LF6T 5H6RB 3SF4A 4HWCA 4BAYB 5ABGA 2OA5A 3E37A 2W00A 2X0YA 1N94A 2YQ8A 2UXNB 2V4HC 2WVIA 5JDLA 5FQ6A 3CSFA 4RLYA 2LSUA 1HXIA 5LOVE 4DBRA 3AEFA 1T8BA 4HOQA 4IE5A 2DHRA 3AECA 4HS2A 4G63A 3IF8B 1MNDA 4EZJA 4LRZA 3FUNA 3FB2A 2ILRA 1J5WA 2XUEA 4PS3A 4CCAA 3PDYA 2ZM8A 5L3BB 1X5BA 3AVSA 5G2NA 1FCHA 1YXRA 1XGWA 2AXZA 3ZLIA 3DBSA 2LHNA 4U63A 1UCUA 1QYMA 3CVNA 3J5PA 3OPCA 3SFZA 3ASHA 3DSVA 3KVAA 5JHBA 5LGUB 4LFCT 2J4BA 2JEKA 4FJZA 3UM0A 5C1DA 3UT8A 4KXKB 3D9OA 3ESLA 5KJLA 2DYRE 3MYVA 2QY7A 5EIDA 1JUQA 5ANRA 1FMVA 2LEHA 1WCRA 3ZCIA 3AS4A 1JWGA 4G1TA 3CVQA 4O60A 4O4HE 4TV8E 4ADZA 3WAJA 2UXBT 4U2YA 3TWWA 4GTRA 4EGWA 2RP4A 4XBFB 4AISA 4NXMT 2H89A 3EHRA 4L23A 3J9X1 5LCYA 5E76A 4LERA 2X38A 3CEQA 4GMJA 3N71A 3KSQA 1OCCE 4HWIB 4A98A 1UGOA 3T1HT 4NIKA 2H6IA 4A1GA 5JA4D 3E34A 4MLKA 3UQ4A 3C3OA 4E7SA 4EHMA 1M62A 4DIDB 4UI9K 3Q5EA 5EYPF 3ONLA 4FADA 3EHQA 3URZA 3FHNA 3FU0A 4YDYA 3P4QA 3G2UA 1OCRE 3DSSA 2RKKA 1QQEA 3TGOA 3KV4A 5ABEA 2CBIA 2LT3A 2XASB 3UUNA 2W62A 3CIRA 3TLTA 1IBLT 3FULA 3LDZA 4HFGA 3RO3A 3T1YT 4HNAD 4BY6A 1WY6A 4OAVB 5AQ9A 3Q9DA 3EDUA 5AQ7A 4APOA 3ABLE 1HCIA 5EK3A 2WXRA 1N4RA 3EHZA 4LF5T 4JPSA 2KZTB 4AVXA 4HWHA 4PS7A 1UG3A 4FA6A 2IO2C 3C5RA 2CFUA 4N3CA 2J08A 3CX8B 4BT9A 3B7BA 4JEUA 5ENRD 4FP7A 2CHXA 4YLHA 4ZS2A 1GQEA 4P0AA 1DU2A 2J4DA 3QB2A 4AKHA 5EX3A 2B76A 1XNFA 4DV3T 3MGBA 3EU9A 4H63V 4LNGA 4JI1T 2NWBA 5AIJA 5JRCB 3IKOB 1EZ3A 2VQET 2ZM6T 1HZ4A 3CVRA 1EF1C 1V9DA 2KNDA 2E5VA 3ONLC 4I50E 4PW8A 2XPYA 2XJ7A 3N9LA 5LJMA 4I17A 4I6GA 3WAKA 3RIUA 2Q9QD 2KINB 3I5PA 1NENA 2LLYA 1T7SA 2V6YA 3PUXF 5DIZA 1XNRT 2NR4A 5FZSA 3PURA 4OHFA 3F31A 4JLEA 4GZ3A 1MQSA 4QX8B 4C0MA 1BI8B 1EPUA 5ENOD 2WAUA 4CQIA 2VVNA 1OWOA 3TXNA 5HQ8A 3S7FA 3G2WA 2M6IA 3PZDA 3ZCJA 2PQRA 3NZUA 3ZN3A 1YKEB 5BR8T 3TKLB 4KBMB 4DBQA 3OTOT 2IFUA 3C98A 4H9QC 4BX8A 3FZHB 3C4WA 4P29A 4UF0A 2WCAA 3R6NA 4HWFA 4X65T 2X0LB 4ILAA 1E8ZA 2YHEA 2VURA 4JI2T 2P9SG 1KK7A 3PJAA 3OBVE 3AA0B 5IY5E 1FJGT 4GPMA 5KWDA 1ELWA 3AAIA 4ZHBA 5JDFA 4UEMA 1S35A 3DP7A 2MHKA 3Q7AA 4GTOA 3RIUC 3U3IA 5ABFA 1O5MA 3CMLA 5DBKA 2P9BA 1HNWT 5DQWA 5LG4A 3CLJA 5EN5D 4X5TA 4O1PA 4PUCA 4JYAT 1PY1A 4D10C 4PS8A 2E8IA 4F3VA 2X9WA 3L16A 1WYBA 2F0YA 5FXWA 5C3JA 2R02A 2NSZA 3ONXA 2XS8A 4LUNU 3C72A 4QH1A 4G8LA 4UV8B 3R84B 4K0KT 1PC2A 3HXBA 1KFYA 5CHEE 2E9XB 3A5XA 4OX9T 2XGSA 3CK9A 3EABA 4GMRA 5AFUL 1ELRA 3ESKA 2BKKB 3L8RA 2X66A 3X2QE 4LMJA 3PEUB 3FP3A 4HB5A 5HEGA 1U3DA 2HE0A 5EX0A 1SA4A 2X9HA 2ETBA 5JDHA 4YT0A 1AJ3A 3E4BA 2WQHA 4J8EA 5KX5E 3B13A 5L2LA 1HR0T 3L54A 4I2ZA 5AQPB 3APCA 2OVBA 2DI4A 4V3IA 4EOZB 4XKBA 4LMLA 4O6FA 3UXGA 2G0UA 2BKOA 3MX3A 1U3CA 3UUXB 2M67A 4HQDA 4ANWA 3FUFA 3RQUA 3V31A 3VHLA 4LFBT 2XSBA 2A2FX 3AEDA 4B0ZA 5CCMA 3RSEG 1UK5A 4EEBA 4XIFA 4IDNA 2JJ9A 4CZZB 2JABA 4DX2A 4M7CA 2OEWA 2L9QA 2FUPA 4BT8A 3FXEB 1RW2A 4F6RC 2RD0A 4CDMA 4GTMA 1DCEA 2J49A 1XZYA 3PUSA 2HHHT 4N78D 4UVBB 4U96D 3CK8A 5M4YA 5JDQA 5LNKA 2V7MA 3CHRA 2XQAA 2PQNA 2X67A 4AKLA 5AQFB 4YY3T 3WG7E 2NP9A 3T8OA 3CSTA 3O4ZA 5C2YA 2IQCA 5HWYA 2IUBA 5ABHA 3OXFA 4IE7A 5JDGA 2C0MA 4AKGA 4OYSA 4XZ4A 3PUQA 5HEHA 4ANXA 3SFDA 4IULA 3U4TA 5FMNA 4I1OB 3L13A 4FLBA 3QARA 2R17C 4TXRA 4H9PC 2LAHA 2P9UG 2BTDA 2NOXA 3VKHA 1KZOA 2LRKA 5EK4A 2IOSA 2LNIA 4RG9A 1H6KA 4YSYA 4LMKA 3ZKRA 4JD2G 2I6HA 4ILCA 1OEDA 2W67A 4B93B 3O9XA 1E8YA 2RFMA 4JI6T 2V5CA 4QWNB 2X6IA 4IDOA 4ZI3D 1HS6A 3P4SA 3ZSSA 3RO2A 4Y6WA 4DR3T 4EBAG 2AXVA 3PUGA 2XM2A 5LGNB 1W0AA 4EB6E 4YVQC 4U8HA 2CXDA 5LMUT 4GTPA 3C51A 3ZMVB 1WG0A 3SGHA 4JEHB 1TN6A 1Z3XA 2XQ6A 4TV9E 3AE3A 4AI6A 4UQXA 4AIUA 2KBXA 4U33A 3WXXA 1TNOA 1VRBA 2IC6A 5JVDE 1LVKA 1N95A 3DXMG 2CG2A 3CIAA 4WUYA 3DJBA 3ZJ1A 2A3DA 2ACZA 4JUYA 5G04C 3UM3A 3MKQA 4KMCA 1KNRA 4PDXA 1HX1B 3ZXSA 3PZ4A 2LE8A 1HTJF 2CLYC 2PL2A 2W61A 4ANUA 2F4VT 5JR9B 3NQPA 5LYJE 4B3RT 4Q94A 4UWLA 4JI3T 3ZKJA 2J1DG 3JXJA 4B3MT 2QYWA 3O1IA 2YU2A 4WNEA 4BSZB 5HS0A 4ZS3A 4N5QA 2XQ0A 1Y01A 4U31A 3UUMA 2E2AA 5KJNA 2ZGDA 3GN5B 4HTEA 2UU9T 1KT1A 3AE6A 3CHPA 5CERB 2WS3A 3Q15A 3I3NA 4GOUA 2DLRA 5FINA 3R9MA 2ZM2A 5J2UE 4E7ZA 5LMNT 4DUIA 2FJBA 5KDMC 1JCRA 4HBDA 2GRNB 4HORA 4YJ3E 4QX7B 5J2TE 3B7RL 2CHOA 2VWAA 3SHFA 2JQKA 3AE1A 4IE6A 4IL4A 3UI2A 4ZHQE 4ANVA 3U78A 1A5EA 4HN9A 3EJNA 2FBWA 3JC6D 3ZHEA 2CEAA 4LEUA 2J4GA 3NRXA 2WZHA 5KCMA 3FWVA 1N0QA 2IC9A 1MHQA 2WXHA 2WQ7A 2XEEA 2QZAA 3JUEA 2YU1A 2DWKA 2GRMA 4I1AA 5BT1A 3CVVA 2E9XD 4JI4T 2WXMA 3IXEA 4LCTA 1B7TA 4AEZC 1XDPA 3CVWA 2V5FA 2V7IA 2A9UA 2IHR1 2WU5A 4K03A 3ZYMA 5AQBA 2WP9A 2KZ7B 1YQ3A 3TWSA 3M65A 3RQWA 3KFWX 1LTXA 2UY1B 5FQ8A 3P8CD 2OEVA 4J8SA 1N32T 2YNQA 4EBAA 4WYVA 3KEZA 5FVLA 1KNPA 2I0MA 4H9OC 4UV9B 1N36T 1G73A 4CDNA 3NOGD 3W15B 3SBTB 1XWMA 3P50A 3QK6A 2DNXA 4JA7A 5LGTB 3GWHA 2F8XK 3QOFA 3QNKA 3FUMA 3N9NA 1JWFA 3U64A 4A3VA 5HEOA 4N5CA 5LCWJ 4DV1T 3CHQA 3DEPA 4AKIA 3SD5A 4MBGA 4AQYT 4KT6B 3JAFA 2ODVA 3HXEA 3E0ZA 3UIPC 1HS7A 3PV0F 4CI3B 3TWTA 3RI5A 1D1BA 4G2VA 4LF9T 3ZU7B 2Q9QA 3ZW3A 4O2AE 2AWIA 4JI7T 1I94T 5EK2A 3QWPA 1SE7A 2ZISA 5ENTD 4GYYA 5EILA 2QYJA 1WLXA 2SPCA 1FT2A 3BG1B 2V8SE 3FBLA 4H7XA 2CWYA 3ZIMA 5EIBE 4WAFA 2C0LA 3G06A 4O4LE 3RKVA 4FULA 4GYWA 2A5EA 2Y1LE 2LOSA 1MZCA 2MPKA 3Q78A 4HGAA 5FIOA 4NXNT 1WFDA 4DX1A 4I43A 4FJOA 1Y64B 4HE8A 1WR0A 1N54A 3AE7A 2WB2A 3J5QB 4RVBA 3VTXA 4GKJT 3IHRA 3ENEA 3Q5MA 3RC8A 5FVKA 2EHOC 2H3RA 3SO8A 2WDQA 3RYIE 5JHAA 3CKBA 3N9QA 4CN4A 2DCPA 3AS5A 3OAWA 4UWKA 1AP7A 4XX5A 3B95A 4C90A 4DMVA 2Q9QC 5AQOB 3I4GA 2JMKA 3BEEA 4DMWA 2XPIA 3D9MA 2NTXA 4X1IE 3C3QA 4YDWA 3Q9UC 2Y69E 1HE8A 4PK4A 4IE0A 3ML9A 4U8YD 1N4SA 2ZM0A 4PK6A 3SS1A 3L39A 2MRIA 4YTNA 3ZEFB 3FUEA 2VSOE 2L3LA 5FZRA 2CXLA 2XQ5A 3EHMA 1T72A 3ANWB 3RC3A 4DUYT 2RG8A 4JC8A 5HXSA 2UXDT 3LBXB 3CWZB 3UKUG 1IQUA 1TNYA 5BXUA 3ZYKA 5HI7A 4Q69A 1IJ6A 3ZC0A 3L82A 2KMFA 2XAGB 4G26A 4TNVA 2UXXB 4Z8XA 3NRYA 2K48A 5BPPA 2LKHA 2PFVA 2MOWA 1OCZE 4O1OA 3FTYA 5AQAA 5LP0A 2XZEA 3RPUA 4UI9J 4TUUA 4A1SA 2WQ6A 4DV4T 4AY5A 3KBUA 4FHKA 3LG7A 1Z0PA 1G8XA 2C5KT 3V2XA 2IOLA 5KMGP 2N1GA 4ZXLA 5KNGA 4L9PA 1TR4A 1H6OA 3VTYA 5JH7E 4GB9A 2LO6A 4ILUA 1OWAA 4QKNA 2WSSV 2ZMAA 4XZCA 4L7TA 4RSYA 3TWVA 3AXJB 1IZNB 5A23A 2RFAA 3KS2A 2IW5B 3UFGA 3PU3A 3CKDA 4GU5A 4HRNA 4DR6T 4IT4A 4JI8T 2PM6A 3N9PA 5JTGA 3K1SA 2I59A 1XMOT 3TLVA 3FZLB 3ZMUB 2VSXE 5IYZE 2EIKE 5JMND 5AENA 3AJIA 5FTPA 3TWRA 3PUAA 3AG4E 2EIME 3SRZA 5FYMA 3N9OA 3Q49B 3F57A 2YEVC 1L0VA 3Q2MA 3PRZA 4IDPA 5HXRA 4WNDA 4GCNA 4EQFA 4CT0A 2X6FA 1WYCA 4G25A 3B7SA 5ANLA 5LHHB 4K5CA 4HI9A 2W2UA 4F1PA 1HG2A 2WWVA 3ZT7A 4EAHA 3N2OA 5CB4E 4PJLA 2VKHA 3EIJA 3QJZA 3ZRHA 2GRPB 2FJAA 4JI0T 5HEJA 4WWPA 2VGXB 5AJLA 1BR0A 3RIFA 5AQHB 2QFCA 2VGEA 3PNLB 1U4QA 3FZMB 4GZDA 5EDSA 5JJ6A 2IEJA 4MALA 3L08A 3PS6A 1GW6A 3NKZA 1BLXB 3MK7C 3NVOA 5BNWA 4JBWF 2ES0A 3HKBE 5B3SE 3BK9A 3ZYQA 1YA0A 5HCJA 4EZKA 4B89A 5CJ5A 1OCOE 5L3DB 2NYJA 4AOFA 2Y0BG 2P9NG 4CRWA 3PUYF 2KZTA 1UJJA 1T98A 1MIYA 3NZQA 3D9NA 4PJNA 3DWLG 2CM0A 3RAUA 3LYAA 2Y4TA 3VRBA 2YK0A 3EDTB 3Q9NC 3ASGA 1XNQT 3PNTB 4UIGA 2LHRA 2I2OA 2WU2A 1ZEEA 5JRCA 3HXDA 3EUHA 4CGVA 4X62T 2YDQA 4ZI7E 2P9KG 3AU5A 4L9IA 2C2LA 2YN6A 3DSXA 4B8AA 2W4XA 5DJQC 2OCCE 3U9WA 4HOTA 4DLOA 4JW1A 4F53A 4X64T 3RU0A 4ACKA 4QH5A 4DX7D 3CVYA 1J5ET 4XE0A 1TJCA 1Z5SC 4KP3C 5FQ4A 5AQVB 2FEZA 4CZ2D 2WQYA 4I9CA 3F6QA 3IHVA 1NEKA 3PTRB 4DUZT 2X6JA 2WXLA 3LJ3A 1UJKA 2A72A 3ZN0B 5BV1A 3MEKA 3D0TA 2CMRA 1ZHCA 2IONA 4C0EA 1ZU2A 1BPOA 3F2EA 2JIWA 3FDHA 3LJNA 1CUNA 5FXXA 5ARFA 1IAPA 1MYOA 3T5XA 1MNEA 4APFA 2JQ9A 1PAQA 5T8IA 2Y8DA 4U0UA 4IN3B 1W3BA 5F8PA 4U8VD 4HWDA 4YDOA 5GONE 5D0QD 2IJGX 3RHWA 2WXFA 1DC2A 2XZDG 4AIFA 1TJFA 1NZNA 3DPDA 2B6CA 2L6JA 2LAIA 1IKND 4J8FA 3QNUA 3JYSA 2YKSA 3ZFWA 1UN8A 2YDSA 4A97A 5HXCA 3JUIA 3PE3A 3LY7A 1TNZA 2J9QA 1W0BA 4MLPA 3HL6A 1MMGA 2XQ9A 1XMQT 2P9PG 4H9NC 3GMIA 3QB5K 2K3WA 5A1LA 2BG9A 3FUKA 3CR3A 5G55A 5CA1E 3UPVA 3VLEA 4UF0B 1MIWA 1Z3YA 3BQIA 3UT4A 4KVOA 2LM9A 4GZ6A 2BZBA 1HF8A 3KV9A 2E9XA 4NQ0A 5AN8A 4IE4A 4HOSA 1W9RA 2WXGA 4J0UA 2R6GF 2BF0X 3ASDA 4KYOB 1JNRA 1MMNA 2WM9A 2MYOA 2P9IG 2ZIRA 3SY2A 3AE9A 3V5SA 1B89A 3JCFA 2AJAA 2H6FA 3LDQB 3GA8A 4AKRB 2XCCA 3CX6B 2KXPC 1IQRA 2R5SA 2XAQB 4BERA 1NP7A 2NW9A 5LXTE 3ZMZB 4IDZA 3UUXA 3R7QA 2W0GA 3AA7B 2WB5A 5F3JA 2AVPA 4M1PA 3PVLA 2MBGA 4O2BE 3PUVF 5L3CB 4GTVA 4KVMA 4G8KA 2BG9C 3G2SA 5LHIB 4CEMA 3NZSA 1E90A 3EAMA 4L5GA 4BSXA 3GYZA 5EKQD 2XAHB 2XRZA 3MKRA 2CXFA 4XAXB 3VRAA 2I1JA 2KCVA 3CKCA 3MJWA 3QKYA 5ENPD 4HLEA 3HKCE 4BETA 2E9XC 1KPSB 2CE7A 4GIWA 1H2UA 1V55E 3LEWA 4NACA 2BUGA 3LSVA 4GAAA 2EIJE 3ZC1A 3CQXC 2PG8A 4TV3A 5FL0A 3VKGA 4COFA 3BQKA 3NZPA 1E8XA 1BU9A 3NOCD 4ZZBA 2LJLA 3TJPA 3DSWA 4GYRA 2VB6A 2L0TB 4ZI2C 4JHJA 4J8YA 3CGHA 5LCWC 4IGUA 2IO3C 4WBOA 2WXQA 3RIBA 5HXEA 2LSIA 4YXDA 3LVQE 2HYZA 3PREA 2HPJA 1X79A 3AEGA 4LG6A 3IEGA 1NWMX 3PE4A 5FQ7A 3FUJA 2HH7A 1D8EA 2XENA 2XEHA 4MRUA 1WM5A 5HCMA 3HVEB 5FY1A 5CRUA 2LXLA 3OXGA 3APDA 3ZYLA 2R03A 2Q7FA 2XQ7A 5BUZA 4ILBA 3G2VA 3UINC 1US7B 4CXXA 1FPPA 4TUYE 1P5QA 3RLFF 4HRMB 3ZSTA 5BV0A 2QGSA 3AA6B 3MACA 4U7IA 5CEAA 3HDXA 5J08A 3SI5A 3KV6A 1QNFA 1OXJA 5TAOA 2VQ2A 2WXJA 5CECB 3EI0A 3SBSA 3U66A 3ZUVB 3UT5E 2XAFB 1N11A 1YKHB 3HA4A 5FT9A 4K0RA 4RG6A 5FXZA 4IHJE 4CT4A 2XTLA 1QSDA 3KINB 3FTWA 2HN1A 3CHSA 3CK7A 2K5BB 5ENNA 3NBNB 3D9PA 4N3BA 1IXVA 4AM9A 3MJXA 1H0AA 4EXTA 3L9TA 2XAJB 4GK0E 3JADA 3UX4A 1IBMT 2XHEB 4CN1A 5FNVE 2X9XA 2XS1A 5H7PA 4C9BB 4OFZA 1NI1A 3FU5A 4BTBA 1Y8MA 1K1BA 3HG0D 5L3FB 1QZ2A 2OVFA 1JNZA 4NURA 2CWOA 2CLYB 4UQYA 3RRCA 4I4TE 2I9CA 4OK0A 1HX8A 3SNXA 5L3EB 1FMWA 5D66A 1TYQG 3JCKC 3HHMA 1HNZT 3PZ3A 1OWNA 2LOPA 4YSZA 3S7JA 1OEDC 1M7KA 2K9AA 3HIZA 3JAEA 5JR9A 1N4PA 3RRNB 4DR5T 2W66A 1FVFA 3ISMC 3AE8A 4C48B 5KJKA 4O8SA 4PK5A 4CN6A 3SFEA 1ELKA 2XSAA 1N0RA 4ATGA 5J90A 4CXWA 2PBIA 2YDRA 4QFVA 2LSGA 2XQ4A 4B8CB 2BS2A 1ZOYA 5JREA 1D0ZA 2QYUA 2XGMA 4XI0A 4BX9A 3FH5A 5KBAA 3GN5A 3TWUA 4GTTA 3TLWA 4AQGA 2F8YA 3RYCE 2UUAT 4KZCA 1H6PA 2R05A 4UI9C 4ERRA 3N9MA 4G24A 4IL9A 4JA9A 3HR0A 3HRAA 4NUUA 3BQOA 4ILGA 4MBQA 3U3WA 4DVDA 2BKPA 5FY0A 2AXUA 4FI5A 3PUKA 3PE0A 4GK5E 2N9DA 3D9IA 2R2LA 4B3TT 2BG9E 2UXCT 4F7AA 3V30A 3FBZA 3FTXA 3ETUA 4NIQA 4PH4B 4P09A 4QXHB 5B1BE 3AS8A 3P2BA 2GK9A 5JR9C 1S70B 4WZXA 3Q73A 2LM2A 3BUAA 1HG5A 5LBQB 1UX4A 4GA2A 5AQQB 1BI7B 3ZNGA 1Q2ZA 1E2AA 2VTBB 4NUVA 4G23A 2CA5A 3GZ2A 1NL4A 4UWHA 2XQ8A 4GZ5A 5ETWA 3TXMA 3V79K 4MS6A 3JQ1A 1AWCB 2AE9A 2DYSE 5CRVA 3L22A 2GW1A 5D2MC 3RH3A 3GW4A 4OVVA 3I0QA 1IHBA 2UY1A 5L3GB 3PU8A 4I55E 2NW7A 1QUUA 3ASFA 3ULQA 4A3TA 1N9AA 2L0IA 3Q5XA 4HOUA 3AU4A 5T4YA 5AQSB 3K3OA 3AEEA 2GRLA 3VLDA 2CCQA 2V7JA 4DR1T 5L4EA 4G2AA 4F6RD 3HI2A 4LSZE 1HNXT 3EDVA 1MJ0A 5HRYA 3K3NA 1RZ4A 4KI0F 3CVPA 1DNPA 5AARA 2UWJG 4K5BA 4A63B 1WR6A 2MYSA 3ZPOA 5CGMA 4GTQA 3V2OA 2QRXA 1BR4A 2KLQA 5J0ZA 3FUHA 2YINA 2DZOA 2VSNA 2KWIB 5LP6E 3AB3B 4BA9A 4DR2T 4U7EB 4LNUD 4AQFA 5CMYA 3RRWA 4ATZD 3EUVA 2X68A 3EVYA 4QXCB 2JPFA 3NWIA 2PNNA 3ABME 3QC1A 2VVSA 3FZKB 1BR1A 1SVXA 4U72A 2FI7A 1ZKEA 4KMOA 3RRMB 3UUBA 4N2SA 3Q5DA 3T5VA 3FY4A 2EHOB 2BDEA 3KV5A 4CGWA 5A7DB 5F5WA 4DNDA 3MCXA 5LBMA 2PZIA 2GRQB 4UXNB 2KT9A 3P4RA 3I9YA 2FO7A 2DVWA 3W9FA 1FVHA 3KSLA 3ULEG 1OXZA 2E5LT 1DVPA 2W63A 4AJWA 1OEDE 3K9IA 5JDNA 1LRZA 3D3MA 4KBQA 2QVAA 3FXDB 4F1SA 2C5IT 1LD7A 4HFIA 2J47A 5LFAA 5G05J 4YNDA 2DL1A 5LJNA 1G3NB 4AXPA 1OWLA 1QLBA 3SFXA 2H6GA 4A55A 1H2TC 3B7UX 5JJ7A 3KAEA 2M6BA 2KWHA 4LNBA 3FZFB 3CV0A 5AQNB 4H7YA 3LJCA 2LRLA 4AV7A 5H6QB 4YHJA 3A7MA 3D9JA 3HYMB 5A6CA 1MMAA 4U07A 3E33A 4PFPA 3ANWA 4U95D 4WWOA 3AEAA 1JCQA 1UOHA 4UUCA 1VCSA 2KC7A 3RGLA 3TLSA 4WBNE 4HXIA 2PM7A 2VKOA 5T3RA 1MX6A 3DTOA 4V1Av 2GROB 4URKA 2WXNA 4ABNA 4U3CA 3MA5A 3N5LA 4FHJA 5LHGB 4OAUC 3CK6A 3AEBA 4JHRA 1UUSA 2IU1A 1U2VG 1EYHA 1ZB1A 1HFAA 4IDQA 2XPZA 4CXYA 1TEZA 2HR2A 3ZGQA 1UURA 5FJYA 4KZ0A 2BBJA 4GYSA 4GPKA 5AQLB 3ZMTB 3OYZA 1O1TA 3DSTA 4O4JE 3AXJA 2L6BA 3AAAC 3QOUA 4H9SE 1WAO1 2FF4A 2Y6XA 5IUXA 2EILE 2ACXA 1WDYA 1OWMA 1BD8A 2V6XA 4TWHA 2XEVA 1IYGA 3QUJA 2J8SD 5ENSD 2OV9A 5DQVA 4KHZF 1N34T 3FEYA 1Z6TA 4U74A 3LK42 3KDSE 2P2CP 3RYHE 2L9BA 4X20E 2Y48B 4JZYA 2GRRB 3UQ7A 3C50A 2WXOA 4GTSA 3VU7H 1MX4A 3SWHA 2LSVA 1YMPA 2IMLA 5AQRB 1VDYA 3S4UA 2C5JA 3JQ0A 2K24A 5LG3A 1LD8A 2VGXA 1OY3D 3S2AA 4XI9A 4HFHA 5L4HA 2LSJA 4K0UA 2DCFA 4XKCA 3ZT6A 2J09A 4EEDA 4EECA 3IEEA 3Q47B 5FKYA 3AAEB 1S64A 1INZA 3FHEA 3RIAA 2WWUA 1NA3A 4TXPA 3D9LA 4TZ4C 1D8DA 1KLXA 2X6KA 2JQHA 2BVMA 1YQ4A 3UTMA 3UU3A 4WWNA 3QDNA 1S0PA 3ASOE 4ISTA 2N2NA 2WMNA 3Q7FA 4ILIA 4U0ZA 1OWPA 5C2TA 4U2ZA 1OUVA 4ME2A 3I9WA 1A17A 3FTUA 3EU5A 3E22E 1E7UA 4OVUA 4QH4A 3ZMSB 3AVRA 5FXVA 1MIVA 2LSKA 3L17A 1IJ5A 2GGFA 5HAXA 2CHNA 2WXKA 1KF6A 4HLLA 5LOZA 3RKGA 4DV7T 4PFOA 4X66T 1YYHA 2H88A 3OTNA 1DCQA 2D9DA 5E0OA 4WNFA 3I1AA 3RX6A 2CRBA 5JDMA 3B5MA 3P4PA 4Z90A 2BVLA 4TX5A 1D0XA 5JQGE 2ETCA 4JVSA 2DZNA 1ZBPA 1D1AA 5EYLA 5EZYE 2E0IA 3IA3A 4PAGA 4DV2T 1L5JA 1O1SA 4UVCB 2ONDA 4N39A 4JEUB 4ZI3C 1D0YA 2EHOD 4DI4A 3ML8A 5CCLA 3WI3A 4LF4T 3R9AB 4LF7T 3O48A 4L2YA 3CX7B 3AE5A 4HRLA 4X1YE 4ANJA 5KNHD 2JMHA 4L1BA 3PZ1A 5E75A 4UELA 4I0UA 1K1AA 1LF8A 1SHZC 2Z6EA 2XRYA 1UX5A 3T8MA 4DR7T 4JXTA 2ZU6B 4TWFA 4F8HA 1D9SA 3AE4A 1WRDA 4ZFHA 3QK0A 3B7TA 5J1GA 2CG3A 3EIQC 5IHYA 5BW8C 2V6YB 3AE2A 4QXBB 4Z68A 3IBEA 3RJVA 3L6AA 1U5PA 4UR9A 3FU6A 2OOEA 3E30A 2CHWA 2VYIA 3FH8A 2CHZA 5FP3A 4CI2B 3E32A 4HFBA 2UUCT 3TL5A 4E85A 3C64A 3CQCB 3N2KE 4HFVA 4EIWA 5HYAA 2X51A 3C98B 4DPRA 3ETVA 2C0SA 4ZZCA 4H9RC 5IWAT 4ISSA 4IYPA 2WBLA 4A56A 2KXPB 4MKTA 4HEAA 4L2LA 2X9YA 4KUMB 2WZIA 5ARGA 3CVUA 3HXCA 2XGOA 1BR2A 2LXMA 2JQQA 1LKXA 4EYYR 5ADXL 3AG2E 3S7DA 5DABA 3AG3E 5CBOA 5ABFB 1H7CA 1YD8G 3ZXPA 4DRXE 2BG9B 1ZP0A 3FU3A 3ONKA 3MV3B 3BG0B 4JB8P 3OVUA 3MV2B 2V26A 5B1AE 1TN7A 2F37A 3M3ZB 2V8SV 2XCBA 3JC6C 2B1EA 5BMVE 2Y3AA 4TN7B 4UWFA 3SOLA 2BS4A 3GZ1A 4N3AA 3RKOA 3APFA 2DWGA 4B94A 4YJ2E 4PJJA 3UM2A 3QAQA 2AW6A 4FLHA 2BS3A 5CFBA 2V7LA 3PEVB 3PH0C 4AY6A 2ZGGA 2NW8A 3FH7A 2IIUA 3D9KA 3TWXA 5L47A 3TLUA 5AQTB 3QC9A 3UU4A 4ZEYA 4DLQA 2LUHA 1V54E 2PJQA 1LVFA 3T9KA 2LKGA 5M72A 4W9RA 2KM4A 2KCKA 3CHOA 2OV8A 2EQXA 2EINE 4I6JA 2H7OA 3ZJ2A 1N52A 3I4RB 3HVEA 3PUJA 4WNGA 4G11A 3LK2B 3B57A 1NA0A 4DV6T 5ENQD 3IV0A 1HO8A 3IHYA 1R8IA 1TNUA 3FEXA 4HI8A 3UM1A 3ASNE 2ZXWE 5FZQA 3O4XE 4JV5T 3EHNA 2YOEA 2ODUA 1CHUA 3ABVA 2FULA 4BJNA 3UIOC 3W9GA 1Y6IA 4AP2A 3P4WA 3SFYA 2CFZA 5CA0E 2FO1E 4GYOA 5FWQA 2IF4A 3OYXA 1KT0A 3KD7A 1SQMA 2WDRA 1FEWA 3P1UA 1N4QA 5CEDB 4GCOA 3X1DA 4LFAT 3PDNA 1SZAA 4Z91A 2VASA 4J8DA 3PUWF 3H3MA 1SW6A 4DK5A 3HKEE 5ITZF 3HXFA 1D1CA 4IRUA 4GKKT 3DSUA 3JXIA 3HKDE 4IIJE 4FC8A 1IBKT 4LF8T 3Q4AB 2IY0C 1XDOA 3ZVVA 2XHEA 4Q25A 4JEHA 4YTPA 3S7BA 3E08A 1OT8A 5G05C 3ONJA 3FTZA 4A5XA 4QHOA 2H6HA 3UT7A 2BEDA 3LXUX 5AQUB 4JHKA 4NRHB 2PTFA 5C8YE 2VKJA 5AQJB 1Z8UA 2V5QC 3BQLA 3FUDA 4MFRA 4CYMD 1OEDB 1UN9A 3DXKG 1KZPA 4UVAB 4U0SA 1TN8A 4HFCA 2AXDS 2JRKA 3OJAA 3N2GE 4ILHB 2E2EA 2OLTA 3DEOA 2KCLA 4KHPT 4HVBA 2X3MA 3UULA 4IREA 1S63A 4DO0A 5BXOA 2HO1A 1JCSA 2XY8B 4BTAA 4DJAA 5AQMB 3CHMA 3CVXA 3LK3B 5AQGB 4J2CA 3H3AA 3C4ZA 4EZHA 3ZPJA 4DR4T 2WXPA 4JI5T 4L0RA 2P58C 3RF1A 3IBPA 3UU6A 3O1HA 3D9HA 2FJEA 2MAWA 1X9BA 4TRQA 3NAWA 4TUMA 3MKQB 2VGYA 1FT1A 2D0UA 5HXHA 5HKPA 3J7Yq 4BWRA 1VOMA 1W09A 1O1RA 1I6ZA 2IAKA 4K5AB 3NBXX 4ZOLE 1H2VC 4PJMA 1K8KG 3P7IA 1TNBA 4GZCA 2WPVA 4I9EA 5LB7B 1FIOA 4X1KE 1X81A 3MZLB 3SZ7A 3LVRE 3AA1B 4I6EA 3Q79A 1SZ9A 5AYWD 5CBNA 2JLBA 2VL8A 3KBTA 3K8PC 3BU8A 4DX5D 2NTYA 1N33T 3AG1E 3TWQA 4GA0A 1E7VA 3CQGB 2XPKA 2WDVA 2VTBA 1K3ZD 3H37A 4R7LA 5JJTA 5KXJA 4C91A 4DV5T 2WY2A 5HEUA 2M63A 4YSXA 3Q5WA 4CI1B 2J07A 4AXHA 5AAOA 2FJDA 2J62A 2YHCA 3FTVA 4NPPA 3NB2A 2V5DA 1SA5A 2WXIA 3MXZA 2CPTA 2VJ8A 4FU3A 2HN2A 4X8QA 2HPLA 3C4XA 3ZHEB 4BJMA 2VK9A 2WMOA 3RYFE 2P9LG 3ZT5A 2KATA 3QB5A 1NAFA 4DI3A 2NXPA 4P0BA 2FBNA 1HU3A 4U04A 4I2WA 4DV0T 4BFRA 1E96B 4CDRA 2H7VC 3UQ3A 3NF1A 4TWDA 3PJAJ 1IHGA 2D2SA 3A8YC 4J6IA 3OKQA 5CMWA 4PNIA 2DWZA 1QBQA 5LA6E 1E7PA 4B6XA 3L3PA 4EZLA 4ZI2D 2IDOB 4H63H 4HKAA 4MHCA 3MA9A 4OYKA 1EDUA 2HM8A 3KEAA 4E6HA 4WW0A 4TXQA 4BESA 4U7YA 1SA0E 5AQIB 4P1NA 3UU5A 5KJMA 2BBHA 3TG4A 5D0OD 3UTKA 2VQFT 4J7WA 1UW4B 4DX6D 4EZ4A 4EPZA 4I1MA 2DIWA 2V7KA 3OXLA 4EV6A 3LFMA 3UFEA 3PUZF 3DRAA 3QWWA 2EHOA 3O1JA 4RQIA 5AJDA 3K3QC 2R59A 3LS8A 4EYUA 4UQZA 3RK6A 3ABKE 2NC9A 2XQ3A 2X0HA 1J1JA 4YTMA 4BEPA 3LPZA 3QWVA 4GMLA 1E8WA 4M3OA 2ZLYA 1KEYA 1SUMB 2MTQA 3FFLA 3VLFA 4B3ST 2DBAA 4HFEA 2LSYA 2UUBT 2VKDA 2B0OE 2Q9QB 2BKGA 1H19A 1MX2A 3GZSA 2VL0A 2RA1A 4O4IE 3ZN1B 4AQFC 1E1HB 3DPYA 4WNKA 3V5UA 2ETAA 2VSYA 3LY8A 4XEIG 2KSRA 2XQYA 4UWGA 3SQVA 3FUIA 4N2QA 2BKNA 2V0PA 3PZ2A 4YDEA 4I43B 4Q96A 3Q75A 3LY9A 2QC9A 2A4ZA 2MOZA 3ZEFA 1YCSB 1YW0A 5AQKB 2X6HA 4YVOA 5FY7A 3ULYA 3I0OA 3UMVA 3TAXA 3MZKB 3LKUA 4YFSA 2V4LA 2XM1A 2XZTG 3VR8A 1ZV4X 3MKDA 4ASKA 3LBXA 4KX6A 2A5UA 3C3RA 2CBJA 1NFIE 5FL1A 3R7RA 4GA1A 2I1KA 5LX8A 3UKRG 3TG5A 1MMDA 3UU8A 4YHHT 1VCTA 2RPAA 4Y6CA 2L8KA 3CPZA 3VR9A 2V1DB 5HWXA 2D0TA 3L09A 4TNWA 1KNZA 4QQIA 3CVLA 1JPLA 4OYJA 1S94A
chains in the Genus database with same CATH topology
1HH8A 3FTSA 3RRUA 5G04J 4ACLA 3AAAB 4JL0A 2D5UA 3KVBA 3LCAA 2QA7A 2Y4UA 1O3XA 3G2TA 4FJYA 5H6RB 3SF4A 4BAYB 2OA5A 2W00A 2YQ8A 2UXNB 2WVIA 5JDLA 5FQ6A 3CSFA 2LSUA 1HXIA 5LOVE 4DBRA 4HOQA 4IE5A 2DHRA 4HS2A 4G63A 3IF8B 1MNDA 4EZJA 4LRZA 3FUNA 3FB2A 2ILRA 2XUEA 4PS3A 4CCAA 3PDYA 2ZM8A 5L3BB 1X5BA 3AVSA 5G2NA 1FCHA 1XGWA 2AXZA 3ZLIA 3DBSA 2LHNA 4U63A 1UCUA 3CVNA 3SFZA 3ASHA 5JHBA 3KVAA 5LGUB 2J4BA 2JEKA 4FJZA 5C1DA 3UT8A 4KXKB 3D9OA 3ESLA 5KJLA 3MYVA 2QY7A 1JUQA 5ANRA 1FMVA 2LEHA 3ZCIA 3AS4A 1JWGA 4G1TA 3CVQA 4O4HE 4TV8E 4ADZA 3WAJA 2RP4A 4XBFB 4L23A 3J9X1 5LCYA 5E76A 4LERA 2X38A 3CEQA 4GMJA 3N71A 4A1GA 4MLKA 4E7SA 4UI9K 3ONLA 4FADA 3URZA 3FHNA 3FU0A 3G2UA 3TGOA 1QQEA 3KV4A 2LT3A 2XASB 3UUNA 2W62A 3FULA 4HFGA 3LDZA 3RO3A 4BY6A 1WY6A 3Q9DA 3EDUA 4APOA 1HCIA 5EK3A 2WXRA 4JPSA 2KZTB 4AVXA 4PS7A 1UG3A 4FA6A 2CFUA 4N3CA 2J08A 3CX8B 4BT9A 4JEUA 4FP7A 2CHXA 4YLHA 4ZS2A 4P0AA 3QB2A 2J4DA 4AKHA 5EX3A 1XNFA 3MGBA 4H63V 2NWBA 5AIJA 5JRCB 3IKOB 1EZ3A 1HZ4A 3CVRA 1EF1C 1V9DA 2KNDA 4I50E 4PW8A 2XPYA 3N9LA 5LJMA 4I17A 4I6GA 3WAKA 2Q9QD 2KINB 3I5PA 5DIZA 5FZSA 3PURA 4OHFA 3F31A 4JLEA 4GZ3A 1MQSA 4QX8B 4C0MA 1EPUA 2WAUA 4CQIA 1OWOA 3TXNA 5HQ8A 3S7FA 3G2WA 3PZDA 3ZCJA 2PQRA 3NZUA 3ZN3A 1YKEB 3TKLB 4KBMB 4DBQA 4BX8A 2IFUA 3C98A 4H9QC 3C4WA 4P29A 4UF0A 3R6NA 2X0LB 1E8ZA 2YHEA 1KK7A 3OBVE 3AA0B 1ELWA 3AAIA 5JDFA 4UEMA 1S35A 3DP7A 2MHKA 3U3IA 5DBKA 3CMLA 2P9BA 5DQWA 5LG4A 3CLJA 4PUCA 1PY1A 4D10C 4PS8A 2E8IA 4F3VA 2X9WA 3L16A 1WYBA 5FXWA 2NSZA 3ONXA 4LUNU 4UV8B 3R84B 1PC2A 5CHEE 2E9XB 3A5XA 2XGSA 3CK9A 5AFUL 3ESKA 1ELRA 2X66A 3PEUB 3FP3A 5EX0A 1U3DA 2X9HA 5JDHA 4J8EA 1AJ3A 3E4BA 2WQHA 5KX5E 3B13A 5L2LA 3L54A 4I2ZA 3APCA 2OVBA 2DI4A 4V3IA 4EOZB 4XKBA 4O6FA 2G0UA 3MX3A 1U3CA 3UUXB 2M67A 4ANWA 3FUFA 3VHLA 2A2FX 4B0ZA 5CCMA 4XIFA 2JJ9A 4CZZB 2L9QA 4BT8A 3FXEB 4F6RC 2RD0A 4CDMA 2J49A 3PUSA 4N78D 4UVBB 3CK8A 5M4YA 5JDQA 5LNKA 2V7MA 3CHRA 2PQNA 2X67A 4AKLA 2NP9A 3T8OA 3CSTA 3O4ZA 5C2YA 2IQCA 5HWYA 3OXFA 4IE7A 5JDGA 2C0MA 4AKGA 4OYSA 4XZ4A 3PUQA 4ANXA 4IULA 3U4TA 5FMNA 4I1OB 3L13A 4FLBA 3QARA 2R17C 4H9PC 2LAHA 2BTDA 2NOXA 3VKHA 5EK4A 2IOSA 2LNIA 4RG9A 1H6KA 2I6HA 3O9XA 1E8YA 4QWNB 2X6IA 4ZI3D 1HS6A 3RO2A 4Y6WA 4EBAG 2AXVA 3PUGA 5LGNB 4EB6E 4YVQC 4U8HA 2CXDA 3C51A 3ZMVB 3SGHA 4JEHB 1Z3XA 4TV9E 4AI6A 4UQXA 3WXXA 1VRBA 2IC6A 5JVDE 1LVKA 2CG2A 3CIAA 4WUYA 3DJBA 3ZJ1A 2A3DA 4JUYA 5G04C 3MKQA 4KMCA 4PDXA 3ZXSA 2LE8A 1HTJF 2CLYC 2PL2A 2W61A 4ANUA 4Q94A 5JR9B 3NQPA 5LYJE 4UWLA 2J1DG 3O1IA 2YU2A 4WNEA 4ZS3A 2XQ0A 3UUMA 5KJNA 3GN5B 4HTEA 1KT1A 3CHPA 3Q15A 3I3NA 4GOUA 2DLRA 2ZM2A 5J2UE 4E7ZA 5KDMC 4HORA 4YJ3E 4QX7B 5J2TE 3B7RL 2VWAA 3SHFA 4ANVA 4IE6A 4ZHQE 3U78A 4HN9A 3EJNA 3JC6D 3ZHEA 2CEAA 4LEUA 3NRXA 5KCMA 3FWVA 2IC9A 1MHQA 2WXHA 2WQ7A 2YU1A 2DWKA 2GRMA 4I1AA 5BT1A 3CVVA 2E9XD 2WXMA 4LCTA 1B7TA 4AEZC 3CVWA 2V5FA 2V7IA 4K03A 3ZYMA 2KZ7B 3M65A 3KFWX 2UY1B 5FQ8A 3P8CD 4J8SA 2YNQA 4EBAA 3KEZA 4H9OC 4UV9B 1G73A 4CDNA 3W15B 3SBTB 3QK6A 2DNXA 4JA7A 5LGTB 3GWHA 3QNKA 3FUMA 3N9NA 1JWFA 3U64A 4A3VA 4N5CA 5LCWJ 3CHQA 4AKIA 3SD5A 4KT6B 2ODVA 3E0ZA 1HS7A 4CI3B 1D1BA 4G2VA 2Q9QA 3ZW3A 4O2AE 2AWIA 5EK2A 3QWPA 4GYYA 1WLXA 2SPCA 3BG1B 4H7XA 2V8SE 3FBLA 2CWYA 3ZIMA 4WAFA 2C0LA 4O4LE 3RKVA 4FULA 4GYWA 2LOSA 4HGAA 4I43A 4FJOA 1Y64B 4HE8A 1N54A 2WB2A 4RVBA 3VTXA 3IHRA 3ENEA 3Q5MA 3RC8A 2EHOC 2H3RA 3RYIE 5JHAA 3CKBA 3N9QA 2DCPA 3AS5A 3OAWA 4UWKA 4XX5A 4C90A 4DMVA 2Q9QC 3I4GA 2JMKA 3BEEA 4DMWA 2XPIA 3D9MA 2NTXA 4X1IE 1HE8A 4PK4A 4IE0A 3ML9A 2ZM0A 4PK6A 3SS1A 2MRIA 3ZEFB 3FUEA 2VSOE 2L3LA 5FZRA 2CXLA 3EHMA 3ANWB 3RC3A 2RG8A 4JC8A 5HXSA 3LBXB 3CWZB 1IQUA 3ZYKA 5HI7A 4Q69A 1IJ6A 3ZC0A 2KMFA 2XAGB 4G26A 2UXXB 4Z8XA 3NRYA 2K48A 5BPPA 2PFVA 2MOWA 3FTYA 5LP0A 3RPUA 4UI9J 4TUUA 4A1SA 2WQ6A 4AY5A 3KBUA 4FHKA 3LG7A 1Z0PA 1G8XA 2C5KT 2IOLA 5KMGP 2N1GA 3VTYA 5JH7E 4GB9A 2LO6A 4ILUA 1OWAA 4QKNA 2WSSV 2ZMAA 4XZCA 4L7TA 4RSYA 1IZNB 5A23A 3KS2A 2IW5B 3PU3A 3CKDA 4GU5A 2PM6A 3N9PA 2I59A 3ZMUB 2VSXE 5IYZE 5AENA 5FTPA 3PUAA 3SRZA 5FYMA 3N9OA 3Q49B 3F57A 2YEVC 3Q2MA 3PRZA 5HXRA 4WNDA 4GCNA 4EQFA 4CT0A 2X6FA 1WYCA 4G25A 3B7SA 5ANLA 5LHHB 1HG2A 4EAHA 3N2OA 5CB4E 4PJLA 2VKHA 3EIJA 3QJZA 3ZRHA 4WWPA 2VGXB 5AJLA 1BR0A 2QFCA 3PNLB 1U4QA 4GZDA 5EDSA 5JJ6A 4MALA 3L08A 3PS6A 1GW6A 3MK7C 5BNWA 2ES0A 3HKBE 3BK9A 3ZYQA 1YA0A 4EZKA 4B89A 5L3DB 4AOFA 4CRWA 2KZTA 1UJJA 1T98A 1MIYA 3NZQA 3D9NA 4PJNA 2CM0A 3LYAA 2Y4TA 2YK0A 3EDTB 3ASGA 3PNTB 4UIGA 2LHRA 2I2OA 1ZEEA 5JRCA 3EUHA 4CGVA 4ZI7E 3AU5A 4L9IA 2C2LA 4B8AA 5DJQC 3U9WA 4HOTA 4DLOA 4JW1A 4F53A 3RU0A 4ACKA 3CVYA 4XE0A 1TJCA 4KP3C 5FQ4A 2FEZA 4I9CA 3IHVA 3PTRB 2X6JA 2WXLA 3LJ3A 1UJKA 2A72A 3ZN0B 5BV1A 3MEKA 3D0TA 2CMRA 1ZHCA 2IONA 4C0EA 1ZU2A 1BPOA 3F2EA 3FDHA 1CUNA 5FXXA 5ARFA 1IAPA 3T5XA 1MNEA 4APFA 1PAQA 5T8IA 2Y8DA 4U0UA 4IN3B 1W3BA 5F8PA 5GONE 5D0QD 2IJGX 2WXFA 4AIFA 1TJFA 1NZNA 3DPDA 2L6JA 2LAIA 4J8FA 3JYSA 3ZFWA 1UN8A 5HXCA 3JUIA 3PE3A 3LY7A 2J9QA 4MLPA 3HL6A 1MMGA 4H9NC 3GMIA 5A1LA 3FUKA 3CR3A 5G55A 5CA1E 3UPVA 3VLEA 4UF0B 1MIWA 1Z3YA 3BQIA 3UT4A 4KVOA 2LM9A 4GZ6A 2BZBA 1HF8A 3KV9A 2E9XA 4NQ0A 4HOSA 4IE4A 2WXGA 4J0UA 2BF0X 4KYOB 3ASDA 1MMNA 2WM9A 3V5SA 1B89A 3GA8A 4AKRB 2XCCA 3CX6B 1IQRA 2R5SA 2XAQB 1NP7A 2NW9A 5LXTE 3ZMZB 4IDZA 3UUXA 3R7QA 2W0GA 3AA7B 5F3JA 2AVPA 4M1PA 3PVLA 2MBGA 4O2BE 5L3CB 4KVMA 3G2SA 5LHIB 4CEMA 3NZSA 1E90A 4L5GA 4BSXA 3GYZA 5EKQD 2XAHB 2XRZA 3MKRA 2CXFA 4XAXB 2KCVA 2I1JA 3CKCA 3QKYA 3MJWA 4HLEA 3HKCE 2E9XC 2CE7A 4GIWA 1H2UA 3LEWA 4NACA 2BUGA 4GAAA 3ZC1A 3CQXC 2PG8A 4TV3A 3VKGA 3BQKA 3NZPA 1E8XA 3TJPA 2LJLA 4GYRA 2L0TB 2VB6A 4ZI2C 4JHJA 3CGHA 5LCWC 4IGUA 4WBOA 2WXQA 3RIBA 5HXEA 2LSIA 3LVQE 2HYZA 3PREA 2HPJA 1X79A 3IEGA 1NWMX 3PE4A 5FQ7A 3FUJA 2HH7A 4MRUA 1WM5A 3HVEB 5FY1A 3OXGA 3APDA 3ZYLA 2Q7FA 5BUZA 3G2VA 1US7B 4CXXA 4TUYE 1P5QA 5BV0A 2QGSA 3AA6B 3MACA 3HDXA 5J08A 3SI5A 3KV6A 1QNFA 5TAOA 2VQ2A 2WXJA 3SBSA 3U66A 3UT5E 2XAFB 1YKHB 3HA4A 5FT9A 4K0RA 4RG6A 5FXZA 4IHJE 4CT4A 2XTLA 1QSDA 3KINB 3FTWA 3CHSA 3CK7A 2K5BB 5ENNA 3D9PA 4N3BA 4AM9A 3MJXA 1H0AA 4EXTA 2XAJB 4GK0E 3UX4A 2XHEB 5FNVE 2X9XA 4C9BB 4OFZA 3FU5A 4BTBA 1Y8MA 5L3FB 1QZ2A 2OVFA 4NURA 2CWOA 2CLYB 4UQYA 3RRCA 4I4TE 2I9CA 4OK0A 1HX8A 3SNXA 5L3EB 1FMWA 3JCKC 3HHMA 1OWNA 2LOPA 3S7JA 2K9AA 3HIZA 5JR9A 3RRNB 1FVFA 5KJKA 4O8SA 4PK5A 1ELKA 4ATGA 5J90A 4CXWA 2PBIA 4QFVA 2LSGA 4B8CB 5JREA 1D0ZA 2XGMA 4XI0A 4BX9A 3FH5A 3GN5A 4AQGA 3RYCE 4KZCA 4UI9C 4ERRA 3N9MA 4G24A 4JA9A 3HR0A 4NUUA 4ILGA 4MBQA 3U3WA 4DVDA 5FY0A 2AXUA 4FI5A 3PUKA 3PE0A 4GK5E 2N9DA 3D9IA 4F7AA 3FBZA 3FTXA 3ETUA 4PH4B 4P09A 4QXHB 3AS8A 3P2BA 2GK9A 5JR9C 1HG5A 5LBQB 1UX4A 4GA2A 2VTBB 4NUVA 4G23A 2CA5A 3GZ2A 4UWHA 4GZ5A 5ETWA 3TXMA 4MS6A 3JQ1A 3L22A 2GW1A 3RH3A 3GW4A 4OVVA 3I0QA 2UY1A 5L3GB 3PU8A 4I55E 2NW7A 1QUUA 3ASFA 3ULQA 4A3TA 2L0IA 3Q5XA 4HOUA 3AU4A 5T4YA 3K3OA 2GRLA 3VLDA 2CCQA 2V7JA 4G2AA 3HI2A 3EDVA 3K3NA 3CVPA 1DNPA 2UWJG 1WR6A 2MYSA 3ZPOA 1BR4A 2KLQA 3FUHA 2YINA 2VSNA 2KWIB 5LP6E 3AB3B 4BA9A 4AQFA 5CMYA 3RRWA 2X68A 3EVYA 4QXCB 2JPFA 3QC1A 1BR1A 4U72A 2FI7A 1ZKEA 4KMOA 3RRMB 4N2SA 3T5VA 3FY4A 2EHOB 2BDEA 3KV5A 4CGWA 5A7DB 4DNDA 3MCXA 5LBMA 2PZIA 4UXNB 2KT9A 2FO7A 3I9YA 1FVHA 1OXZA 1DVPA 2W63A 4AJWA 3K9IA 5JDNA 1LRZA 3D3MA 4KBQA 3FXDB 4F1SA 2C5IT 5LFAA 5G05J 4YNDA 5LJNA 4AXPA 1OWLA 4A55A 1H2TC 3B7UX 5JJ7A 3KAEA 2KWHA 3CV0A 4H7YA 3LJCA 4AV7A 5H6QB 4YHJA 3HYMB 3D9JA 5A6CA 1MMAA 4U07A 4PFPA 3ANWA 4WWOA 2KC7A 4WBNE 4HXIA 2PM7A 2VKOA 5T3RA 3DTOA 4V1Av 4URKA 2WXNA 4ABNA 3MA5A 3N5LA 4FHJA 5LHGB 4JHRA 2IU1A 1EYHA 1HFAA 2XPZA 4CXYA 1TEZA 2HR2A 3ZGQA 5FJYA 4KZ0A 4GYSA 4GPKA 3ZMTB 3OYZA 4O4JE 3QOUA 4H9SE 1WAO1 2FF4A 2Y6XA 2ACXA 1OWMA 1IYGA 2XEVA 3QUJA 5DQVA 3FEYA 1Z6TA 4U74A 3LK42 3KDSE 3RYHE 2L9BA 4X20E 2Y48B 4JZYA 3C50A 2WXOA 3VU7H 3SWHA 2LSVA 1VDYA 3S4UA 2C5JA 3JQ0A 2K24A 2VGXA 3S2AA 4XI9A 2LSJA 4K0UA 2DCFA 4XKCA 2J09A 4EECA 3IEEA 3Q47B 3AAEB 1INZA 3FHEA 2WWUA 1NA3A 3D9LA 4TZ4C 2X6KA 1KLXA 2BVMA 4WWNA 3QDNA 1S0PA 4ISTA 2N2NA 2WMNA 4ILIA 4U0ZA 1OWPA 1OUVA 4ME2A 3I9WA 1A17A 3FTUA 3E22E 1E7UA 4OVUA 3ZMSB 3AVRA 5FXVA 1MIVA 2LSKA 3L17A 1IJ5A 2GGFA 5HAXA 2WXKA 5LOZA 4PFOA 3OTNA 4WNFA 5E0OA 3I1AA 3RX6A 5JDMA 2BVLA 4TX5A 1D0XA 5JQGE 4JVSA 1ZBPA 1D1AA 5EZYE 2E0IA 4PAGA 1L5JA 4UVCB 2ONDA 4N39A 4JEUB 4ZI3C 1D0YA 2EHOD 4DI4A 3ML8A 5CCLA 3WI3A 3R9AB 3O48A 4L2YA 3CX7B 4X1YE 4ANJA 2JMHA 4L1BA 5E75A 4UELA 1LF8A 1SHZC 2Z6EA 2XRYA 1UX5A 3T8MA 4JXTA 2ZU6B 1WRDA 3QK0A 3B7TA 5J1GA 2CG3A 3EIQC 5IHYA 5BW8C 4QXBB 3IBEA 3RJVA 3L6AA 1U5PA 3FU6A 2OOEA 2CHWA 2VYIA 3FH8A 2CHZA 5FP3A 4CI2B 3TL5A 4E85A 3C64A 3CQCB 3N2KE 4HFVA 4EIWA 5HYAA 2X51A 3C98B 4DPRA 3ETVA 2C0SA 4H9RC 4ISSA 4IYPA 2WBLA 4A56A 2KXPB 4MKTA 4HEAA 4L2LA 2X9YA 4KUMB 5ARGA 3CVUA 2XGOA 1BR2A 2JQQA 1LKXA 4EYYR 5ADXL 3S7DA 5DABA 1H7CA 1YD8G 3FU3A 3ONKA 3MV3B 3BG0B 3MV2B 2V26A 2XCBA 3JC6C 2B1EA 5BMVE 2Y3AA 4TN7B 4UWFA 3SOLA 3GZ1A 4N3AA 3RKOA 3APFA 2DWGA 4B94A 4YJ2E 4PJJA 3QAQA 2AW6A 4FLHA 2V7LA 3PEVB 3PH0C 4AY6A 3FH7A 2NW8A 3D9KA 3QC9A 4DLQA 2PJQA 1LVFA 5M72A 4W9RA 2KM4A 2KCKA 3CHOA 2OV8A 2EQXA 4I6JA 2H7OA 3ZJ2A 1N52A 3I4RB 3HVEA 3PUJA 4WNGA 4G11A 3LK2B 3B57A 1NA0A 3IV0A 1HO8A 3IHYA 3FEXA 5FZQA 3O4XE 3EHNA 2ODUA 2FULA 4AP2A 4BJNA 1Y6IA 2CFZA 5CA0E 4GYOA 5FWQA 2IF4A 3OYXA 1KT0A 3KD7A 1SQMA 1FEWA 3P1UA 4GCOA 3PDNA 1SZAA 2VASA 4J8DA 4DK5A 3HKEE 1D1CA 4IRUA 3HKDE 4IIJE 4FC8A 3Q4AB 3ZVVA 2XHEA 4JEHA 3S7BA 3E08A 5G05C 3FTZA 4QHOA 3UT7A 3LXUX 4JHKA 4NRHB 2VKJA 5C8YE 3FUDA 3BQLA 4MFRA 1UN9A 4UVAB 4U0SA 2JRKA 3OJAA 3N2GE 4ILHB 2E2EA 2KCLA 4HVBA 2X3MA 3UULA 4DO0A 2HO1A 4BTAA 4DJAA 3CHMA 3CVXA 3LK3B 4J2CA 3H3AA 3C4ZA 4EZHA 3ZPJA 2WXPA 4L0RA 2P58C 3IBPA 3O1HA 4TRQA 3MKQB 2VGYA 2D0UA 5HXHA 3J7Yq 4BWRA 1VOMA 2IAKA 3NBXX 4ZOLE 1H2VC 4PJMA 3P7IA 4GZCA 2WPVA 4I9EA 1FIOA 4X1KE 3MZLB 3SZ7A 3LVRE 3AA1B 4I6EA 1SZ9A 5AYWD 2JLBA 2VL8A 3KBTA 3K8PC 2NTYA 4GA0A 1E7VA 3CQGB 2VTBA 3H37A 4R7LA 5JJTA 4C91A 2M63A 3Q5WA 4CI1B 2J07A 4AXHA 2YHCA 3FTVA 2WXIA 3MXZA 2VJ8A 4FU3A 2HPLA 3C4XA 3ZHEB 4BJMA 2VK9A 2WMOA 3RYFE 2KATA 1NAFA 4DI3A 2NXPA 4P0BA 2FBNA 1HU3A 4U04A 4I2WA 4BFRA 1E96B 4CDRA 2H7VC 3UQ3A 3NF1A 1IHGA 2D2SA 4J6IA 5CMWA 3OKQA 4PNIA 5LA6E 4B6XA 3L3PA 4EZLA 4ZI2D 4H63H 4HKAA 4MHCA 3MA9A 4OYKA 1EDUA 2HM8A 4E6HA 4WW0A 1SA0E 5KJMA 3TG4A 5D0OD 3UTKA 1UW4B 4EZ4A 4EPZA 4I1MA 2DIWA 2V7KA 3OXLA 3LFMA 3UFEA 3QWWA 2EHOA 3O1JA 5AJDA 3K3QC 2R59A 3LS8A 4EYUA 4UQZA 3RK6A 2NC9A 3LPZA 3QWVA 4GMLA 1E8WA 4M3OA 2ZLYA 2MTQA 3FFLA 3VLFA 2DBAA 2LSYA 2VKDA 2Q9QB 1H19A 3GZSA 2RA1A 4O4IE 3ZN1B 4AQFC 1E1HB 4WNKA 3V5UA 2VSYA 3LY8A 2XQYA 4UWGA 3FUIA 4N2QA 2V0PA 4I43B 4Q96A 3LY9A 2A4ZA 2MOZA 3ZEFA 1YW0A 2X6HA 4YVOA 5FY7A 3I0OA 3UMVA 3TAXA 3MZKB 3LKUA 4YFSA 2V4LA 1ZV4X 3MKDA 3LBXA 4ASKA 2A5UA 3R7RA 4GA1A 2I1KA 5LX8A 3TG5A 1MMDA 4Y6CA 2L8KA 3CPZA 2V1DB 5HWXA 2D0TA 3L09A 1KNZA 3CVLA 1JPLA 4OYJA 1S94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9J A;  5J08 A;  2DCP A;  1MHQ A;  1HG2 A;  3RRU A;  3ZYQ A;  1EYH A;  1JWF A;  1HG5 A;  3LDZ A;  1HFA A;  4HFG A;  5LOZ A;  1SZA A;  4NAC A;  1EDU A;  1HF8 A;  2L0I A;  4Q94 A;  3D9K A;  3D9O A;  5LP0 A;  1ELK A;  3G2T A;  1UJJ A;  5CMY A;  2BF0 X;  4GZC A;  3D9I A;  3D9N A;  2QY7 A;  3G2W A;  1JUQ A;  4FLB A;  3ZYL A;  3ONK A;  4GZD A;  4AVX A;  3D9M A;  1JWG A;  1HX8 A;  3G2S A;  2L0T B;  3ZYK A;  1X5B A;  1LF8 A;  4Q96 A;  3D9P A;  1SZ9 A;  3ONL A;  5CMW A;  1XGW A;  3G2V A;  2KM4 A;  1INZ A;  4FU3 A;  1DVP A;  3CLJ A;  2LO6 A;  3ZYM A;  1H0A A;  4JXT A;  3G2U A;  1UJK A;  1JPL A;  1PY1 A;  2DIW A;  2V8S E;  2MOW A;  3D9L A;  1VDY A; 
#chains in the Genus database with same CATH topology
 1HH8 A;  3FTS A;  3RRU A;  5G04 J;  4ACL A;  3AAA B;  4JL0 A;  2D5U A;  3KVB A;  3LCA A;  2QA7 A;  2Y4U A;  1O3X A;  4HFD A;  3T8K A;  3G2T A;  4FJY A;  4LF6 T;  5H6R B;  3SF4 A;  4HWC A;  4BAY B;  5ABG A;  2OA5 A;  3E37 A;  2W00 A;  2X0Y A;  1N94 A;  2YQ8 A;  2UXN B;  2V4H C;  2WVI A;  5JDL A;  5FQ6 A;  3CSF A;  4RLY A;  2LSU A;  1HXI A;  5LOV E;  4DBR A;  3AEF A;  1T8B A;  4HOQ A;  4IE5 A;  2DHR A;  3AEC A;  4HS2 A;  4G63 A;  3IF8 B;  1MND A;  4EZJ A;  4LRZ A;  3FUN A;  3FB2 A;  2ILR A;  1J5W A;  2XUE A;  4PS3 A;  4CCA A;  3PDY A;  2ZM8 A;  5L3B B;  1X5B A;  3AVS A;  5G2N A;  1FCH A;  1YXR A;  1XGW A;  2AXZ A;  3ZLI A;  3DBS A;  2LHN A;  4U63 A;  1UCU A;  1QYM A;  3CVN A;  3J5P A;  3OPC A;  3SFZ A;  3ASH A;  3DSV A;  3KVA A;  5JHB A;  5LGU B;  4LFC T;  2J4B A;  2JEK A;  4FJZ A;  3UM0 A;  5C1D A;  3UT8 A;  4KXK B;  3D9O A;  3ESL A;  5KJL A;  2DYR E;  3MYV A;  2QY7 A;  5EID A;  1JUQ A;  5ANR A;  1FMV A;  2LEH A;  1WCR A;  3ZCI A;  3AS4 A;  1JWG A;  4G1T A;  3CVQ A;  4O60 A;  4O4H E;  4TV8 E;  4ADZ A;  3WAJ A;  2UXB T;  4U2Y A;  3TWW A;  4GTR A;  4EGW A;  2RP4 A;  4XBF B;  4AIS A;  4NXM T;  2H89 A;  3EHR A;  4L23 A;  3J9X 1;  5LCY A;  5E76 A;  4LER A;  2X38 A;  3CEQ A;  4GMJ A;  3N71 A;  3KSQ A;  1OCC E;  4HWI B;  4A98 A;  1UGO A;  3T1H T;  4NIK A;  2H6I A;  4A1G A;  5JA4 D;  3E34 A;  4MLK A;  3UQ4 A;  3C3O A;  4E7S A;  4EHM A;  1M62 A;  4DID B;  4UI9 K;  3Q5E A;  5EYP F;  3ONL A;  4FAD A;  3EHQ A;  3URZ A;  3FHN A;  3FU0 A;  4YDY A;  3P4Q A;  3G2U A;  1OCR E;  3DSS A;  2RKK A;  1QQE A;  3TGO A;  3KV4 A;  5ABE A;  2CBI A;  2LT3 A;  2XAS B;  3UUN A;  2W62 A;  3CIR A;  3TLT A;  1IBL T;  3FUL A;  3LDZ A;  4HFG A;  3RO3 A;  3T1Y T;  4HNA D;  4BY6 A;  1WY6 A;  4OAV B;  5AQ9 A;  3Q9D A;  3EDU A;  5AQ7 A;  4APO A;  3ABL E;  1HCI A;  5EK3 A;  2WXR A;  1N4R A;  3EHZ A;  4LF5 T;  4JPS A;  2KZT B;  4AVX A;  4HWH A;  4PS7 A;  1UG3 A;  4FA6 A;  2IO2 C;  3C5R A;  2CFU A;  4N3C A;  2J08 A;  3CX8 B;  4BT9 A;  3B7B A;  4JEU A;  5ENR D;  4FP7 A;  2CHX A;  4YLH A;  4ZS2 A;  1GQE A;  4P0A A;  1DU2 A;  2J4D A;  3QB2 A;  4AKH A;  5EX3 A;  2B76 A;  1XNF A;  4DV3 T;  3MGB A;  3EU9 A;  4H63 V;  4LNG A;  4JI1 T;  2NWB A;  5AIJ A;  5JRC B;  3IKO B;  1EZ3 A;  2VQE T;  2ZM6 T;  1HZ4 A;  3CVR A;  1EF1 C;  1V9D A;  2KND A;  2E5V A;  3ONL C;  4I50 E;  4PW8 A;  2XPY A;  2XJ7 A;  3N9L A;  5LJM A;  4I17 A;  4I6G A;  3WAK A;  3RIU A;  2Q9Q D;  2KIN B;  3I5P A;  1NEN A;  2LLY A;  1T7S A;  2V6Y A;  3PUX F;  5DIZ A;  1XNR T;  2NR4 A;  5FZS A;  3PUR A;  4OHF A;  3F31 A;  4JLE A;  4GZ3 A;  1MQS A;  4QX8 B;  4C0M A;  1BI8 B;  1EPU A;  5ENO D;  2WAU A;  4CQI A;  2VVN A;  1OWO A;  3TXN A;  5HQ8 A;  3S7F A;  3G2W A;  2M6I A;  3PZD A;  3ZCJ A;  2PQR A;  3NZU A;  3ZN3 A;  1YKE B;  5BR8 T;  3TKL B;  4KBM B;  4DBQ A;  3OTO T;  2IFU A;  3C98 A;  4H9Q C;  4BX8 A;  3FZH B;  3C4W A;  4P29 A;  4UF0 A;  2WCA A;  3R6N A;  4HWF A;  4X65 T;  2X0L B;  4ILA A;  1E8Z A;  2YHE A;  2VUR A;  4JI2 T;  2P9S G;  1KK7 A;  3PJA A;  3OBV E;  3AA0 B;  5IY5 E;  1FJG T;  4GPM A;  5KWD A;  1ELW A;  3AAI A;  4ZHB A;  5JDF A;  4UEM A;  1S35 A;  3DP7 A;  2MHK A;  3Q7A A;  4GTO A;  3RIU C;  3U3I A;  5ABF A;  1O5M A;  3CML A;  5DBK A;  2P9B A;  1HNW T;  5DQW A;  5LG4 A;  3CLJ A;  5EN5 D;  4X5T A;  4O1P A;  4PUC A;  4JYA T;  1PY1 A;  4D10 C;  4PS8 A;  2E8I A;  4F3V A;  2X9W A;  3L16 A;  1WYB A;  2F0Y A;  5FXW A;  5C3J A;  2R02 A;  2NSZ A;  3ONX A;  2XS8 A;  4LUN U;  3C72 A;  4QH1 A;  4G8L A;  4UV8 B;  3R84 B;  4K0K T;  1PC2 A;  3HXB A;  1KFY A;  5CHE E;  2E9X B;  3A5X A;  4OX9 T;  2XGS A;  3CK9 A;  3EAB A;  4GMR A;  5AFU L;  1ELR A;  3ESK A;  2BKK B;  3L8R A;  2X66 A;  3X2Q E;  4LMJ A;  3PEU B;  3FP3 A;  4HB5 A;  5HEG A;  1U3D A;  2HE0 A;  5EX0 A;  1SA4 A;  2X9H A;  2ETB A;  5JDH A;  4YT0 A;  1AJ3 A;  3E4B A;  2WQH A;  4J8E A;  5KX5 E;  3B13 A;  5L2L A;  1HR0 T;  3L54 A;  4I2Z A;  5AQP B;  3APC A;  2OVB A;  2DI4 A;  4V3I A;  4EOZ B;  4XKB A;  4LML A;  4O6F A;  3UXG A;  2G0U A;  2BKO A;  3MX3 A;  1U3C A;  3UUX B;  2M67 A;  4HQD A;  4ANW A;  3FUF A;  3RQU A;  3V31 A;  3VHL A;  4LFB T;  2XSB A;  2A2F X;  3AED A;  4B0Z A;  5CCM A;  3RSE G;  1UK5 A;  4EEB A;  4XIF A;  4IDN A;  2JJ9 A;  4CZZ B;  2JAB A;  4DX2 A;  4M7C A;  2OEW A;  2L9Q A;  2FUP A;  4BT8 A;  3FXE B;  1RW2 A;  4F6R C;  2RD0 A;  4CDM A;  4GTM A;  1DCE A;  2J49 A;  1XZY A;  3PUS A;  2HHH T;  4N78 D;  4UVB B;  4U96 D;  3CK8 A;  5M4Y A;  5JDQ A;  5LNK A;  2V7M A;  3CHR A;  2XQA A;  2PQN A;  2X67 A;  4AKL A;  5AQF B;  4YY3 T;  3WG7 E;  2NP9 A;  3T8O A;  3CST A;  3O4Z A;  5C2Y A;  2IQC A;  5HWY A;  2IUB A;  5ABH A;  3OXF A;  4IE7 A;  5JDG A;  2C0M A;  4AKG A;  4OYS A;  4XZ4 A;  3PUQ A;  5HEH A;  4ANX A;  3SFD A;  4IUL A;  3U4T A;  5FMN A;  4I1O B;  3L13 A;  4FLB A;  3QAR A;  2R17 C;  4TXR A;  4H9P C;  2LAH A;  2P9U G;  2BTD A;  2NOX A;  3VKH A;  1KZO A;  2LRK A;  5EK4 A;  2IOS A;  2LNI A;  4RG9 A;  1H6K A;  4YSY A;  4LMK A;  3ZKR A;  4JD2 G;  2I6H A;  4ILC A;  1OED A;  2W67 A;  4B93 B;  3O9X A;  1E8Y A;  2RFM A;  4JI6 T;  2V5C A;  4QWN B;  2X6I A;  4IDO A;  4ZI3 D;  1HS6 A;  3P4S A;  3ZSS A;  3RO2 A;  4Y6W A;  4DR3 T;  4EBA G;  2AXV A;  3PUG A;  2XM2 A;  5LGN B;  1W0A A;  4EB6 E;  4YVQ C;  4U8H A;  2CXD A;  5LMU T;  4GTP A;  3C51 A;  3ZMV B;  1WG0 A;  3SGH A;  4JEH B;  1TN6 A;  1Z3X A;  2XQ6 A;  4TV9 E;  3AE3 A;  4AI6 A;  4UQX A;  4AIU A;  2KBX A;  4U33 A;  3WXX A;  1TNO A;  1VRB A;  2IC6 A;  5JVD E;  1LVK A;  1N95 A;  3DXM G;  2CG2 A;  3CIA A;  4WUY A;  3DJB A;  3ZJ1 A;  2A3D A;  2ACZ A;  4JUY A;  5G04 C;  3UM3 A;  3MKQ A;  4KMC A;  1KNR A;  4PDX A;  1HX1 B;  3ZXS A;  3PZ4 A;  2LE8 A;  1HTJ F;  2CLY C;  2PL2 A;  2W61 A;  4ANU A;  2F4V T;  5JR9 B;  3NQP A;  5LYJ E;  4B3R T;  4Q94 A;  4UWL A;  4JI3 T;  3ZKJ A;  2J1D G;  3JXJ A;  4B3M T;  2QYW A;  3O1I A;  2YU2 A;  4WNE A;  4BSZ B;  5HS0 A;  4ZS3 A;  4N5Q A;  2XQ0 A;  1Y01 A;  4U31 A;  3UUM A;  2E2A A;  5KJN A;  2ZGD A;  3GN5 B;  4HTE A;  2UU9 T;  1KT1 A;  3AE6 A;  3CHP A;  5CER B;  2WS3 A;  3Q15 A;  3I3N A;  4GOU A;  2DLR A;  5FIN A;  3R9M A;  2ZM2 A;  5J2U E;  4E7Z A;  5LMN T;  4DUI A;  2FJB A;  5KDM C;  1JCR A;  4HBD A;  2GRN B;  4HOR A;  4YJ3 E;  4QX7 B;  5J2T E;  3B7R L;  2CHO A;  2VWA A;  3SHF A;  2JQK A;  3AE1 A;  4IE6 A;  4IL4 A;  3UI2 A;  4ZHQ E;  4ANV A;  3U78 A;  1A5E A;  4HN9 A;  3EJN A;  2FBW A;  3JC6 D;  3ZHE A;  2CEA A;  4LEU A;  2J4G A;  3NRX A;  2WZH A;  5KCM A;  3FWV A;  1N0Q A;  2IC9 A;  1MHQ A;  2WXH A;  2WQ7 A;  2XEE A;  2QZA A;  3JUE A;  2YU1 A;  2DWK A;  2GRM A;  4I1A A;  5BT1 A;  3CVV A;  2E9X D;  4JI4 T;  2WXM A;  3IXE A;  4LCT A;  1B7T A;  4AEZ C;  1XDP A;  3CVW A;  2V5F A;  2V7I A;  2A9U A;  2IHR 1;  2WU5 A;  4K03 A;  3ZYM A;  5AQB A;  2WP9 A;  2KZ7 B;  1YQ3 A;  3TWS A;  3M65 A;  3RQW A;  3KFW X;  1LTX A;  2UY1 B;  5FQ8 A;  3P8C D;  2OEV A;  4J8S A;  1N32 T;  2YNQ A;  4EBA A;  4WYV A;  3KEZ A;  5FVL A;  1KNP A;  2I0M A;  4H9O C;  4UV9 B;  1N36 T;  1G73 A;  4CDN A;  3NOG D;  3W15 B;  3SBT B;  1XWM A;  3P50 A;  3QK6 A;  2DNX A;  4JA7 A;  5LGT B;  3GWH A;  2F8X K;  3QOF A;  3QNK A;  3FUM A;  3N9N A;  1JWF A;  3U64 A;  4A3V A;  5HEO A;  4N5C A;  5LCW J;  4DV1 T;  3CHQ A;  3DEP A;  4AKI A;  3SD5 A;  4MBG A;  4AQY T;  4KT6 B;  3JAF A;  2ODV A;  3HXE A;  3E0Z A;  3UIP C;  1HS7 A;  3PV0 F;  4CI3 B;  3TWT A;  3RI5 A;  1D1B A;  4G2V A;  4LF9 T;  3ZU7 B;  2Q9Q A;  3ZW3 A;  4O2A E;  2AWI A;  4JI7 T;  1I94 T;  5EK2 A;  3QWP A;  1SE7 A;  2ZIS A;  5ENT D;  4GYY A;  5EIL A;  2QYJ A;  1WLX A;  2SPC A;  1FT2 A;  3BG1 B;  2V8S E;  3FBL A;  4H7X A;  2CWY A;  3ZIM A;  5EIB E;  4WAF A;  2C0L A;  3G06 A;  4O4L E;  3RKV A;  4FUL A;  4GYW A;  2A5E A;  2Y1L E;  2LOS A;  1MZC A;  2MPK A;  3Q78 A;  4HGA A;  5FIO A;  4NXN T;  1WFD A;  4DX1 A;  4I43 A;  4FJO A;  1Y64 B;  4HE8 A;  1WR0 A;  1N54 A;  3AE7 A;  2WB2 A;  3J5Q B;  4RVB A;  3VTX A;  4GKJ T;  3IHR A;  3ENE A;  3Q5M A;  3RC8 A;  5FVK A;  2EHO C;  2H3R A;  3SO8 A;  2WDQ A;  3RYI E;  5JHA A;  3CKB A;  3N9Q A;  4CN4 A;  2DCP A;  3AS5 A;  3OAW A;  4UWK A;  1AP7 A;  4XX5 A;  3B95 A;  4C90 A;  4DMV A;  2Q9Q C;  5AQO B;  3I4G A;  2JMK A;  3BEE A;  4DMW A;  2XPI A;  3D9M A;  2NTX A;  4X1I E;  3C3Q A;  4YDW A;  3Q9U C;  2Y69 E;  1HE8 A;  4PK4 A;  4IE0 A;  3ML9 A;  4U8Y D;  1N4S A;  2ZM0 A;  4PK6 A;  3SS1 A;  3L39 A;  2MRI A;  4YTN A;  3ZEF B;  3FUE A;  2VSO E;  2L3L A;  5FZR A;  2CXL A;  2XQ5 A;  3EHM A;  1T72 A;  3ANW B;  3RC3 A;  4DUY T;  2RG8 A;  4JC8 A;  5HXS A;  2UXD T;  3LBX B;  3CWZ B;  3UKU G;  1IQU A;  1TNY A;  5BXU A;  3ZYK A;  5HI7 A;  4Q69 A;  1IJ6 A;  3ZC0 A;  3L82 A;  2KMF A;  2XAG B;  4G26 A;  4TNV A;  2UXX B;  4Z8X A;  3NRY A;  2K48 A;  5BPP A;  2LKH A;  2PFV A;  2MOW A;  1OCZ E;  4O1O A;  3FTY A;  5AQA A;  5LP0 A;  2XZE A;  3RPU A;  4UI9 J;  4TUU A;  4A1S A;  2WQ6 A;  4DV4 T;  4AY5 A;  3KBU A;  4FHK A;  3LG7 A;  1Z0P A;  1G8X A;  2C5K T;  3V2X A;  2IOL A;  5KMG P;  2N1G A;  4ZXL A;  5KNG A;  4L9P A;  1TR4 A;  1H6O A;  3VTY A;  5JH7 E;  4GB9 A;  2LO6 A;  4ILU A;  1OWA A;  4QKN A;  2WSS V;  2ZMA A;  4XZC A;  4L7T A;  4RSY A;  3TWV A;  3AXJ B;  1IZN B;  5A23 A;  2RFA A;  3KS2 A;  2IW5 B;  3UFG A;  3PU3 A;  3CKD A;  4GU5 A;  4HRN A;  4DR6 T;  4IT4 A;  4JI8 T;  2PM6 A;  3N9P A;  5JTG A;  3K1S A;  2I59 A;  1XMO T;  3TLV A;  3FZL B;  3ZMU B;  2VSX E;  5IYZ E;  2EIK E;  5JMN D;  5AEN A;  3AJI A;  5FTP A;  3TWR A;  3PUA A;  3AG4 E;  2EIM E;  3SRZ A;  5FYM A;  3N9O A;  3Q49 B;  3F57 A;  2YEV C;  1L0V A;  3Q2M A;  3PRZ A;  4IDP A;  5HXR A;  4WND A;  4GCN A;  4EQF A;  4CT0 A;  2X6F A;  1WYC A;  4G25 A;  3B7S A;  5ANL A;  5LHH B;  4K5C A;  4HI9 A;  2W2U A;  4F1P A;  1HG2 A;  2WWV A;  3ZT7 A;  4EAH A;  3N2O A;  5CB4 E;  4PJL A;  2VKH A;  3EIJ A;  3QJZ A;  3ZRH A;  2GRP B;  2FJA A;  4JI0 T;  5HEJ A;  4WWP A;  2VGX B;  5AJL A;  1BR0 A;  3RIF A;  5AQH B;  2QFC A;  2VGE A;  3PNL B;  1U4Q A;  3FZM B;  4GZD A;  5EDS A;  5JJ6 A;  2IEJ A;  4MAL A;  3L08 A;  3PS6 A;  1GW6 A;  3NKZ A;  1BLX B;  3MK7 C;  3NVO A;  5BNW A;  4JBW F;  2ES0 A;  3HKB E;  5B3S E;  3BK9 A;  3ZYQ A;  1YA0 A;  5HCJ A;  4EZK A;  4B89 A;  5CJ5 A;  1OCO E;  5L3D B;  2NYJ A;  4AOF A;  2Y0B G;  2P9N G;  4CRW A;  3PUY F;  2KZT A;  1UJJ A;  1T98 A;  1MIY A;  3NZQ A;  3D9N A;  4PJN A;  3DWL G;  2CM0 A;  3RAU A;  3LYA A;  2Y4T A;  3VRB A;  2YK0 A;  3EDT B;  3Q9N C;  3ASG A;  1XNQ T;  3PNT B;  4UIG A;  2LHR A;  2I2O A;  2WU2 A;  1ZEE A;  5JRC A;  3HXD A;  3EUH A;  4CGV A;  4X62 T;  2YDQ A;  4ZI7 E;  2P9K G;  3AU5 A;  4L9I A;  2C2L A;  2YN6 A;  3DSX A;  4B8A A;  2W4X A;  5DJQ C;  2OCC E;  3U9W A;  4HOT A;  4DLO A;  4JW1 A;  4F53 A;  4X64 T;  3RU0 A;  4ACK A;  4QH5 A;  4DX7 D;  3CVY A;  1J5E T;  4XE0 A;  1TJC A;  1Z5S C;  4KP3 C;  5FQ4 A;  5AQV B;  2FEZ A;  4CZ2 D;  2WQY A;  4I9C A;  3F6Q A;  3IHV A;  1NEK A;  3PTR B;  4DUZ T;  2X6J A;  2WXL A;  3LJ3 A;  1UJK A;  2A72 A;  3ZN0 B;  5BV1 A;  3MEK A;  3D0T A;  2CMR A;  1ZHC A;  2ION A;  4C0E A;  1ZU2 A;  1BPO A;  3F2E A;  2JIW A;  3FDH A;  3LJN A;  1CUN A;  5FXX A;  5ARF A;  1IAP A;  1MYO A;  3T5X A;  1MNE A;  4APF A;  2JQ9 A;  1PAQ A;  5T8I A;  2Y8D A;  4U0U A;  4IN3 B;  1W3B A;  5F8P A;  4U8V D;  4HWD A;  4YDO A;  5GON E;  5D0Q D;  2IJG X;  3RHW A;  2WXF A;  1DC2 A;  2XZD G;  4AIF A;  1TJF A;  1NZN A;  3DPD A;  2B6C A;  2L6J A;  2LAI A;  1IKN D;  4J8F A;  3QNU A;  3JYS A;  2YKS A;  3ZFW A;  1UN8 A;  2YDS A;  4A97 A;  5HXC A;  3JUI A;  3PE3 A;  3LY7 A;  1TNZ A;  2J9Q A;  1W0B A;  4MLP A;  3HL6 A;  1MMG A;  2XQ9 A;  1XMQ T;  2P9P G;  4H9N C;  3GMI A;  3QB5 K;  2K3W A;  5A1L A;  2BG9 A;  3FUK A;  3CR3 A;  5G55 A;  5CA1 E;  3UPV A;  3VLE A;  4UF0 B;  1MIW A;  1Z3Y A;  3BQI A;  3UT4 A;  4KVO A;  2LM9 A;  4GZ6 A;  2BZB A;  1HF8 A;  3KV9 A;  2E9X A;  4NQ0 A;  5AN8 A;  4IE4 A;  4HOS A;  1W9R A;  2WXG A;  4J0U A;  2R6G F;  2BF0 X;  3ASD A;  4KYO B;  1JNR A;  1MMN A;  2WM9 A;  2MYO A;  2P9I G;  2ZIR A;  3SY2 A;  3AE9 A;  3V5S A;  1B89 A;  3JCF A;  2AJA A;  2H6F A;  3LDQ B;  3GA8 A;  4AKR B;  2XCC A;  3CX6 B;  2KXP C;  1IQR A;  2R5S A;  2XAQ B;  4BER A;  1NP7 A;  2NW9 A;  5LXT E;  3ZMZ B;  4IDZ A;  3UUX A;  3R7Q A;  2W0G A;  3AA7 B;  2WB5 A;  5F3J A;  2AVP A;  4M1P A;  3PVL A;  2MBG A;  4O2B E;  3PUV F;  5L3C B;  4GTV A;  4KVM A;  4G8K A;  2BG9 C;  3G2S A;  5LHI B;  4CEM A;  3NZS A;  1E90 A;  3EAM A;  4L5G A;  4BSX A;  3GYZ A;  5EKQ D;  2XAH B;  2XRZ A;  3MKR A;  2CXF A;  4XAX B;  3VRA A;  2I1J A;  2KCV A;  3CKC A;  3MJW A;  3QKY A;  5ENP D;  4HLE A;  3HKC E;  4BET A;  2E9X C;  1KPS B;  2CE7 A;  4GIW A;  1H2U A;  1V55 E;  3LEW A;  4NAC A;  2BUG A;  3LSV A;  4GAA A;  2EIJ E;  3ZC1 A;  3CQX C;  2PG8 A;  4TV3 A;  5FL0 A;  3VKG A;  4COF A;  3BQK A;  3NZP A;  1E8X A;  1BU9 A;  3NOC D;  4ZZB A;  2LJL A;  3TJP A;  3DSW A;  4GYR A;  2VB6 A;  2L0T B;  4ZI2 C;  4JHJ A;  4J8Y A;  3CGH A;  5LCW C;  4IGU A;  2IO3 C;  4WBO A;  2WXQ A;  3RIB A;  5HXE A;  2LSI A;  4YXD A;  3LVQ E;  2HYZ A;  3PRE A;  2HPJ A;  1X79 A;  3AEG A;  4LG6 A;  3IEG A;  1NWM X;  3PE4 A;  5FQ7 A;  3FUJ A;  2HH7 A;  1D8E A;  2XEN A;  2XEH A;  4MRU A;  1WM5 A;  5HCM A;  3HVE B;  5FY1 A;  5CRU A;  2LXL A;  3OXG A;  3APD A;  3ZYL A;  2R03 A;  2Q7F A;  2XQ7 A;  5BUZ A;  4ILB A;  3G2V A;  3UIN C;  1US7 B;  4CXX A;  1FPP A;  4TUY E;  1P5Q A;  3RLF F;  4HRM B;  3ZST A;  5BV0 A;  2QGS A;  3AA6 B;  3MAC A;  4U7I A;  5CEA A;  3HDX A;  5J08 A;  3SI5 A;  3KV6 A;  1QNF A;  1OXJ A;  5TAO A;  2VQ2 A;  2WXJ A;  5CEC B;  3EI0 A;  3SBS A;  3U66 A;  3ZUV B;  3UT5 E;  2XAF B;  1N11 A;  1YKH B;  3HA4 A;  5FT9 A;  4K0R A;  4RG6 A;  5FXZ A;  4IHJ E;  4CT4 A;  2XTL A;  1QSD A;  3KIN B;  3FTW A;  2HN1 A;  3CHS A;  3CK7 A;  2K5B B;  5ENN A;  3NBN B;  3D9P A;  4N3B A;  1IXV A;  4AM9 A;  3MJX A;  1H0A A;  4EXT A;  3L9T A;  2XAJ B;  4GK0 E;  3JAD A;  3UX4 A;  1IBM T;  2XHE B;  4CN1 A;  5FNV E;  2X9X A;  2XS1 A;  5H7P A;  4C9B B;  4OFZ A;  1NI1 A;  3FU5 A;  4BTB A;  1Y8M A;  1K1B A;  3HG0 D;  5L3F B;  1QZ2 A;  2OVF A;  1JNZ A;  4NUR A;  2CWO A;  2CLY B;  4UQY A;  3RRC A;  4I4T E;  2I9C A;  4OK0 A;  1HX8 A;  3SNX A;  5L3E B;  1FMW A;  5D66 A;  1TYQ G;  3JCK C;  3HHM A;  1HNZ T;  3PZ3 A;  1OWN A;  2LOP A;  4YSZ A;  3S7J A;  1OED C;  1M7K A;  2K9A A;  3HIZ A;  3JAE A;  5JR9 A;  1N4P A;  3RRN B;  4DR5 T;  2W66 A;  1FVF A;  3ISM C;  3AE8 A;  4C48 B;  5KJK A;  4O8S A;  4PK5 A;  4CN6 A;  3SFE A;  1ELK A;  2XSA A;  1N0R A;  4ATG A;  5J90 A;  4CXW A;  2PBI A;  2YDR A;  4QFV A;  2LSG A;  2XQ4 A;  4B8C B;  2BS2 A;  1ZOY A;  5JRE A;  1D0Z A;  2QYU A;  2XGM A;  4XI0 A;  4BX9 A;  3FH5 A;  5KBA A;  3GN5 A;  3TWU A;  4GTT A;  3TLW A;  4AQG A;  2F8Y A;  3RYC E;  2UUA T;  4KZC A;  1H6P A;  2R05 A;  4UI9 C;  4ERR A;  3N9M A;  4G24 A;  4IL9 A;  4JA9 A;  3HR0 A;  3HRA A;  4NUU A;  3BQO A;  4ILG A;  4MBQ A;  3U3W A;  4DVD A;  2BKP A;  5FY0 A;  2AXU A;  4FI5 A;  3PUK A;  3PE0 A;  4GK5 E;  2N9D A;  3D9I A;  2R2L A;  4B3T T;  2BG9 E;  2UXC T;  4F7A A;  3V30 A;  3FBZ A;  3FTX A;  3ETU A;  4NIQ A;  4PH4 B;  4P09 A;  4QXH B;  5B1B E;  3AS8 A;  3P2B A;  2GK9 A;  5JR9 C;  1S70 B;  4WZX A;  3Q73 A;  2LM2 A;  3BUA A;  1HG5 A;  5LBQ B;  1UX4 A;  4GA2 A;  5AQQ B;  1BI7 B;  3ZNG A;  1Q2Z A;  1E2A A;  2VTB B;  4NUV A;  4G23 A;  2CA5 A;  3GZ2 A;  1NL4 A;  4UWH A;  2XQ8 A;  4GZ5 A;  5ETW A;  3TXM A;  3V79 K;  4MS6 A;  3JQ1 A;  1AWC B;  2AE9 A;  2DYS E;  5CRV A;  3L22 A;  2GW1 A;  5D2M C;  3RH3 A;  3GW4 A;  4OVV A;  3I0Q A;  1IHB A;  2UY1 A;  5L3G B;  3PU8 A;  4I55 E;  2NW7 A;  1QUU A;  3ASF A;  3ULQ A;  4A3T A;  1N9A A;  2L0I A;  3Q5X A;  4HOU A;  3AU4 A;  5T4Y A;  5AQS B;  3K3O A;  3AEE A;  2GRL A;  3VLD A;  2CCQ A;  2V7J A;  4DR1 T;  5L4E A;  4G2A A;  4F6R D;  3HI2 A;  4LSZ E;  1HNX T;  3EDV A;  1MJ0 A;  5HRY A;  3K3N A;  1RZ4 A;  4KI0 F;  3CVP A;  1DNP A;  5AAR A;  2UWJ G;  4K5B A;  4A63 B;  1WR6 A;  2MYS A;  3ZPO A;  5CGM A;  4GTQ A;  3V2O A;  2QRX A;  1BR4 A;  2KLQ A;  5J0Z A;  3FUH A;  2YIN A;  2DZO A;  2VSN A;  2KWI B;  5LP6 E;  3AB3 B;  4BA9 A;  4DR2 T;  4U7E B;  4LNU D;  4AQF A;  5CMY A;  3RRW A;  4ATZ D;  3EUV A;  2X68 A;  3EVY A;  4QXC B;  2JPF A;  3NWI A;  2PNN A;  3ABM E;  3QC1 A;  2VVS A;  3FZK B;  1BR1 A;  1SVX A;  4U72 A;  2FI7 A;  1ZKE A;  4KMO A;  3RRM B;  3UUB A;  4N2S A;  3Q5D A;  3T5V A;  3FY4 A;  2EHO B;  2BDE A;  3KV5 A;  4CGW A;  5A7D B;  5F5W A;  4DND A;  3MCX A;  5LBM A;  2PZI A;  2GRQ B;  4UXN B;  2KT9 A;  3P4R A;  3I9Y A;  2FO7 A;  2DVW A;  3W9F A;  1FVH A;  3KSL A;  3ULE G;  1OXZ A;  2E5L T;  1DVP A;  2W63 A;  4AJW A;  1OED E;  3K9I A;  5JDN A;  1LRZ A;  3D3M A;  4KBQ A;  2QVA A;  3FXD B;  4F1S A;  2C5I T;  1LD7 A;  4HFI A;  2J47 A;  5LFA A;  5G05 J;  4YND A;  2DL1 A;  5LJN A;  1G3N B;  4AXP A;  1OWL A;  1QLB A;  3SFX A;  2H6G A;  4A55 A;  1H2T C;  3B7U X;  5JJ7 A;  3KAE A;  2M6B A;  2KWH A;  4LNB A;  3FZF B;  3CV0 A;  5AQN B;  4H7Y A;  3LJC A;  2LRL A;  4AV7 A;  5H6Q B;  4YHJ A;  3A7M A;  3D9J A;  3HYM B;  5A6C A;  1MMA A;  4U07 A;  3E33 A;  4PFP A;  3ANW A;  4U95 D;  4WWO A;  3AEA A;  1JCQ A;  1UOH A;  4UUC A;  1VCS A;  2KC7 A;  3RGL A;  3TLS A;  4WBN E;  4HXI A;  2PM7 A;  2VKO A;  5T3R A;  1MX6 A;  3DTO A;  4V1A v;  2GRO B;  4URK A;  2WXN A;  4ABN A;  4U3C A;  3MA5 A;  3N5L A;  4FHJ A;  5LHG B;  4OAU C;  3CK6 A;  3AEB A;  4JHR A;  1UUS A;  2IU1 A;  1U2V G;  1EYH A;  1ZB1 A;  1HFA A;  4IDQ A;  2XPZ A;  4CXY A;  1TEZ A;  2HR2 A;  3ZGQ A;  1UUR A;  5FJY A;  4KZ0 A;  2BBJ A;  4GYS A;  4GPK A;  5AQL B;  3ZMT B;  3OYZ A;  1O1T A;  3DST A;  4O4J E;  3AXJ A;  2L6B A;  3AAA C;  3QOU A;  4H9S E;  1WAO 1;  2FF4 A;  2Y6X A;  5IUX A;  2EIL E;  2ACX A;  1WDY A;  1OWM A;  1BD8 A;  2V6X A;  4TWH A;  2XEV A;  1IYG A;  3QUJ A;  2J8S D;  5ENS D;  2OV9 A;  5DQV A;  4KHZ F;  1N34 T;  3FEY A;  1Z6T A;  4U74 A;  3LK4 2;  3KDS E;  2P2C P;  3RYH E;  2L9B A;  4X20 E;  2Y48 B;  4JZY A;  2GRR B;  3UQ7 A;  3C50 A;  2WXO A;  4GTS A;  3VU7 H;  1MX4 A;  3SWH A;  2LSV A;  1YMP A;  2IML A;  5AQR B;  1VDY A;  3S4U A;  2C5J A;  3JQ0 A;  2K24 A;  5LG3 A;  1LD8 A;  2VGX A;  1OY3 D;  3S2A A;  4XI9 A;  4HFH A;  5L4H A;  2LSJ A;  4K0U A;  2DCF A;  4XKC A;  3ZT6 A;  2J09 A;  4EED A;  4EEC A;  3IEE A;  3Q47 B;  5FKY A;  3AAE B;  1S64 A;  1INZ A;  3FHE A;  3RIA A;  2WWU A;  1NA3 A;  4TXP A;  3D9L A;  4TZ4 C;  1D8D A;  1KLX A;  2X6K A;  2JQH A;  2BVM A;  1YQ4 A;  3UTM A;  3UU3 A;  4WWN A;  3QDN A;  1S0P A;  3ASO E;  4IST A;  2N2N A;  2WMN A;  3Q7F A;  4ILI A;  4U0Z A;  1OWP A;  5C2T A;  4U2Z A;  1OUV A;  4ME2 A;  3I9W A;  1A17 A;  3FTU A;  3EU5 A;  3E22 E;  1E7U A;  4OVU A;  4QH4 A;  3ZMS B;  3AVR A;  5FXV A;  1MIV A;  2LSK A;  3L17 A;  1IJ5 A;  2GGF A;  5HAX A;  2CHN A;  2WXK A;  1KF6 A;  4HLL A;  5LOZ A;  3RKG A;  4DV7 T;  4PFO A;  4X66 T;  1YYH A;  2H88 A;  3OTN A;  1DCQ A;  2D9D A;  5E0O A;  4WNF A;  3I1A A;  3RX6 A;  2CRB A;  5JDM A;  3B5M A;  3P4P A;  4Z90 A;  2BVL A;  4TX5 A;  1D0X A;  5JQG E;  2ETC A;  4JVS A;  2DZN A;  1ZBP A;  1D1A A;  5EYL A;  5EZY E;  2E0I A;  3IA3 A;  4PAG A;  4DV2 T;  1L5J A;  1O1S A;  4UVC B;  2OND A;  4N39 A;  4JEU B;  4ZI3 C;  1D0Y A;  2EHO D;  4DI4 A;  3ML8 A;  5CCL A;  3WI3 A;  4LF4 T;  3R9A B;  4LF7 T;  3O48 A;  4L2Y A;  3CX7 B;  3AE5 A;  4HRL A;  4X1Y E;  4ANJ A;  5KNH D;  2JMH A;  4L1B A;  3PZ1 A;  5E75 A;  4UEL A;  4I0U A;  1K1A A;  1LF8 A;  1SHZ C;  2Z6E A;  2XRY A;  1UX5 A;  3T8M A;  4DR7 T;  4JXT A;  2ZU6 B;  4TWF A;  4F8H A;  1D9S A;  3AE4 A;  1WRD A;  4ZFH A;  3QK0 A;  3B7T A;  5J1G A;  2CG3 A;  3EIQ C;  5IHY A;  5BW8 C;  2V6Y B;  3AE2 A;  4QXB B;  4Z68 A;  3IBE A;  3RJV A;  3L6A A;  1U5P A;  4UR9 A;  3FU6 A;  2OOE A;  3E30 A;  2CHW A;  2VYI A;  3FH8 A;  2CHZ A;  5FP3 A;  4CI2 B;  3E32 A;  4HFB A;  2UUC T;  3TL5 A;  4E85 A;  3C64 A;  3CQC B;  3N2K E;  4HFV A;  4EIW A;  5HYA A;  2X51 A;  3C98 B;  4DPR A;  3ETV A;  2C0S A;  4ZZC A;  4H9R C;  5IWA T;  4ISS A;  4IYP A;  2WBL A;  4A56 A;  2KXP B;  4MKT A;  4HEA A;  4L2L A;  2X9Y A;  4KUM B;  2WZI A;  5ARG A;  3CVU A;  3HXC A;  2XGO A;  1BR2 A;  2LXM A;  2JQQ A;  1LKX A;  4EYY R;  5ADX L;  3AG2 E;  3S7D A;  5DAB A;  3AG3 E;  5CBO A;  5ABF B;  1H7C A;  1YD8 G;  3ZXP A;  4DRX E;  2BG9 B;  1ZP0 A;  3FU3 A;  3ONK A;  3MV3 B;  3BG0 B;  4JB8 P;  3OVU A;  3MV2 B;  2V26 A;  5B1A E;  1TN7 A;  2F37 A;  3M3Z B;  2V8S V;  2XCB A;  3JC6 C;  2B1E A;  5BMV E;  2Y3A A;  4TN7 B;  4UWF A;  3SOL A;  2BS4 A;  3GZ1 A;  4N3A A;  3RKO A;  3APF A;  2DWG A;  4B94 A;  4YJ2 E;  4PJJ A;  3UM2 A;  3QAQ A;  2AW6 A;  4FLH A;  2BS3 A;  5CFB A;  2V7L A;  3PEV B;  3PH0 C;  4AY6 A;  2ZGG A;  2NW8 A;  3FH7 A;  2IIU A;  3D9K A;  3TWX A;  5L47 A;  3TLU A;  5AQT B;  3QC9 A;  3UU4 A;  4ZEY A;  4DLQ A;  2LUH A;  1V54 E;  2PJQ A;  1LVF A;  3T9K A;  2LKG A;  5M72 A;  4W9R A;  2KM4 A;  2KCK A;  3CHO A;  2OV8 A;  2EQX A;  2EIN E;  4I6J A;  2H7O A;  3ZJ2 A;  1N52 A;  3I4R B;  3HVE A;  3PUJ A;  4WNG A;  4G11 A;  3LK2 B;  3B57 A;  1NA0 A;  4DV6 T;  5ENQ D;  3IV0 A;  1HO8 A;  3IHY A;  1R8I A;  1TNU A;  3FEX A;  4HI8 A;  3UM1 A;  3ASN E;  2ZXW E;  5FZQ A;  3O4X E;  4JV5 T;  3EHN A;  2YOE A;  2ODU A;  1CHU A;  3ABV A;  2FUL A;  4BJN A;  3UIO C;  3W9G A;  1Y6I A;  4AP2 A;  3P4W A;  3SFY A;  2CFZ A;  5CA0 E;  2FO1 E;  4GYO A;  5FWQ A;  2IF4 A;  3OYX A;  1KT0 A;  3KD7 A;  1SQM A;  2WDR A;  1FEW A;  3P1U A;  1N4Q A;  5CED B;  4GCO A;  3X1D A;  4LFA T;  3PDN A;  1SZA A;  4Z91 A;  2VAS A;  4J8D A;  3PUW F;  3H3M A;  1SW6 A;  4DK5 A;  3HKE E;  5ITZ F;  3HXF A;  1D1C A;  4IRU A;  4GKK T;  3DSU A;  3JXI A;  3HKD E;  4IIJ E;  4FC8 A;  1IBK T;  4LF8 T;  3Q4A B;  2IY0 C;  1XDO A;  3ZVV A;  2XHE A;  4Q25 A;  4JEH A;  4YTP A;  3S7B A;  3E08 A;  1OT8 A;  5G05 C;  3ONJ A;  3FTZ A;  4A5X A;  4QHO A;  2H6H A;  3UT7 A;  2BED A;  3LXU X;  5AQU B;  4JHK A;  4NRH B;  2PTF A;  5C8Y E;  2VKJ A;  5AQJ B;  1Z8U A;  2V5Q C;  3BQL A;  3FUD A;  4MFR A;  4CYM D;  1OED B;  1UN9 A;  3DXK G;  1KZP A;  4UVA B;  4U0S A;  1TN8 A;  4HFC A;  2AXD S;  2JRK A;  3OJA A;  3N2G E;  4ILH B;  2E2E A;  2OLT A;  3DEO A;  2KCL A;  4KHP T;  4HVB A;  2X3M A;  3UUL A;  4IRE A;  1S63 A;  4DO0 A;  5BXO A;  2HO1 A;  1JCS A;  2XY8 B;  4BTA A;  4DJA A;  5AQM B;  3CHM A;  3CVX A;  3LK3 B;  5AQG B;  4J2C A;  3H3A A;  3C4Z A;  4EZH A;  3ZPJ A;  4DR4 T;  2WXP A;  4JI5 T;  4L0R A;  2P58 C;  3RF1 A;  3IBP A;  3UU6 A;  3O1H A;  3D9H A;  2FJE A;  2MAW A;  1X9B A;  4TRQ A;  3NAW A;  4TUM A;  3MKQ B;  2VGY A;  1FT1 A;  2D0U A;  5HXH A;  5HKP A;  3J7Y q;  4BWR A;  1VOM A;  1W09 A;  1O1R A;  1I6Z A;  2IAK A;  4K5A B;  3NBX X;  4ZOL E;  1H2V C;  4PJM A;  1K8K G;  3P7I A;  1TNB A;  4GZC A;  2WPV A;  4I9E A;  5LB7 B;  1FIO A;  4X1K E;  1X81 A;  3MZL B;  3SZ7 A;  3LVR E;  3AA1 B;  4I6E A;  3Q79 A;  1SZ9 A;  5AYW D;  5CBN A;  2JLB A;  2VL8 A;  3KBT A;  3K8P C;  3BU8 A;  4DX5 D;  2NTY A;  1N33 T;  3AG1 E;  3TWQ A;  4GA0 A;  1E7V A;  3CQG B;  2XPK A;  2WDV A;  2VTB A;  1K3Z D;  3H37 A;  4R7L A;  5JJT A;  5KXJ A;  4C91 A;  4DV5 T;  2WY2 A;  5HEU A;  2M63 A;  4YSX A;  3Q5W A;  4CI1 B;  2J07 A;  4AXH A;  5AAO A;  2FJD A;  2J62 A;  2YHC A;  3FTV A;  4NPP A;  3NB2 A;  2V5D A;  1SA5 A;  2WXI A;  3MXZ A;  2CPT A;  2VJ8 A;  4FU3 A;  2HN2 A;  4X8Q A;  2HPL A;  3C4X A;  3ZHE B;  4BJM A;  2VK9 A;  2WMO A;  3RYF E;  2P9L G;  3ZT5 A;  2KAT A;  3QB5 A;  1NAF A;  4DI3 A;  2NXP A;  4P0B A;  2FBN A;  1HU3 A;  4U04 A;  4I2W A;  4DV0 T;  4BFR A;  1E96 B;  4CDR A;  2H7V C;  3UQ3 A;  3NF1 A;  4TWD A;  3PJA J;  1IHG A;  2D2S A;  3A8Y C;  4J6I A;  3OKQ A;  5CMW A;  4PNI A;  2DWZ A;  1QBQ A;  5LA6 E;  1E7P A;  4B6X A;  3L3P A;  4EZL A;  4ZI2 D;  2IDO B;  4H63 H;  4HKA A;  4MHC A;  3MA9 A;  4OYK A;  1EDU A;  2HM8 A;  3KEA A;  4E6H A;  4WW0 A;  4TXQ A;  4BES A;  4U7Y A;  1SA0 E;  5AQI B;  4P1N A;  3UU5 A;  5KJM A;  2BBH A;  3TG4 A;  5D0O D;  3UTK A;  2VQF T;  4J7W A;  1UW4 B;  4DX6 D;  4EZ4 A;  4EPZ A;  4I1M A;  2DIW A;  2V7K A;  3OXL A;  4EV6 A;  3LFM A;  3UFE A;  3PUZ F;  3DRA A;  3QWW A;  2EHO A;  3O1J A;  4RQI A;  5AJD A;  3K3Q C;  2R59 A;  3LS8 A;  4EYU A;  4UQZ A;  3RK6 A;  3ABK E;  2NC9 A;  2XQ3 A;  2X0H A;  1J1J A;  4YTM A;  4BEP A;  3LPZ A;  3QWV A;  4GML A;  1E8W A;  4M3O A;  2ZLY A;  1KEY A;  1SUM B;  2MTQ A;  3FFL A;  3VLF A;  4B3S T;  2DBA A;  4HFE A;  2LSY A;  2UUB T;  2VKD A;  2B0O E;  2Q9Q B;  2BKG A;  1H19 A;  1MX2 A;  3GZS A;  2VL0 A;  2RA1 A;  4O4I E;  3ZN1 B;  4AQF C;  1E1H B;  3DPY A;  4WNK A;  3V5U A;  2ETA A;  2VSY A;  3LY8 A;  4XEI G;  2KSR A;  2XQY A;  4UWG A;  3SQV A;  3FUI A;  4N2Q A;  2BKN A;  2V0P A;  3PZ2 A;  4YDE A;  4I43 B;  4Q96 A;  3Q75 A;  3LY9 A;  2QC9 A;  2A4Z A;  2MOZ A;  3ZEF A;  1YCS B;  1YW0 A;  5AQK B;  2X6H A;  4YVO A;  5FY7 A;  3ULY A;  3I0O A;  3UMV A;  3TAX A;  3MZK B;  3LKU A;  4YFS A;  2V4L A;  2XM1 A;  2XZT G;  3VR8 A;  1ZV4 X;  3MKD A;  4ASK A;  3LBX A;  4KX6 A;  2A5U A;  3C3R A;  2CBJ A;  1NFI E;  5FL1 A;  3R7R A;  4GA1 A;  2I1K A;  5LX8 A;  3UKR G;  3TG5 A;  1MMD A;  3UU8 A;  4YHH T;  1VCT A;  2RPA A;  4Y6C A;  2L8K A;  3CPZ A;  3VR9 A;  2V1D B;  5HWX A;  2D0T A;  3L09 A;  4TNW A;  1KNZ A;  4QQI A;  3CVL A;  1JPL A;  4OYJ A;  1S94 A; 
#chains in the Genus database with same CATH homology
 1HH8 A;  3FTS A;  3RRU A;  5G04 J;  4ACL A;  3AAA B;  4JL0 A;  2D5U A;  3KVB A;  3LCA A;  2QA7 A;  2Y4U A;  1O3X A;  3G2T A;  4FJY A;  5H6R B;  3SF4 A;  4BAY B;  2OA5 A;  2W00 A;  2YQ8 A;  2UXN B;  2WVI A;  5JDL A;  5FQ6 A;  3CSF A;  2LSU A;  1HXI A;  5LOV E;  4DBR A;  4HOQ A;  4IE5 A;  2DHR A;  4HS2 A;  4G63 A;  3IF8 B;  1MND A;  4EZJ A;  4LRZ A;  3FUN A;  3FB2 A;  2ILR A;  2XUE A;  4PS3 A;  4CCA A;  3PDY A;  2ZM8 A;  5L3B B;  1X5B A;  3AVS A;  5G2N A;  1FCH A;  1XGW A;  2AXZ A;  3ZLI A;  3DBS A;  2LHN A;  4U63 A;  1UCU A;  3CVN A;  3SFZ A;  3ASH A;  5JHB A;  3KVA A;  5LGU B;  2J4B A;  2JEK A;  4FJZ A;  5C1D A;  3UT8 A;  4KXK B;  3D9O A;  3ESL A;  5KJL A;  3MYV A;  2QY7 A;  1JUQ A;  5ANR A;  1FMV A;  2LEH A;  3ZCI A;  3AS4 A;  1JWG A;  4G1T A;  3CVQ A;  4O4H E;  4TV8 E;  4ADZ A;  3WAJ A;  2RP4 A;  4XBF B;  4L23 A;  3J9X 1;  5LCY A;  5E76 A;  4LER A;  2X38 A;  3CEQ A;  4GMJ A;  3N71 A;  4A1G A;  4MLK A;  4E7S A;  4UI9 K;  3ONL A;  4FAD A;  3URZ A;  3FHN A;  3FU0 A;  3G2U A;  3TGO A;  1QQE A;  3KV4 A;  2LT3 A;  2XAS B;  3UUN A;  2W62 A;  3FUL A;  4HFG A;  3LDZ A;  3RO3 A;  4BY6 A;  1WY6 A;  3Q9D A;  3EDU A;  4APO A;  1HCI A;  5EK3 A;  2WXR A;  4JPS A;  2KZT B;  4AVX A;  4PS7 A;  1UG3 A;  4FA6 A;  2CFU A;  4N3C A;  2J08 A;  3CX8 B;  4BT9 A;  4JEU A;  4FP7 A;  2CHX A;  4YLH A;  4ZS2 A;  4P0A A;  3QB2 A;  2J4D A;  4AKH A;  5EX3 A;  1XNF A;  3MGB A;  4H63 V;  2NWB A;  5AIJ A;  5JRC B;  3IKO B;  1EZ3 A;  1HZ4 A;  3CVR A;  1EF1 C;  1V9D A;  2KND A;  4I50 E;  4PW8 A;  2XPY A;  3N9L A;  5LJM A;  4I17 A;  4I6G A;  3WAK A;  2Q9Q D;  2KIN B;  3I5P A;  5DIZ A;  5FZS A;  3PUR A;  4OHF A;  3F31 A;  4JLE A;  4GZ3 A;  1MQS A;  4QX8 B;  4C0M A;  1EPU A;  2WAU A;  4CQI A;  1OWO A;  3TXN A;  5HQ8 A;  3S7F A;  3G2W A;  3PZD A;  3ZCJ A;  2PQR A;  3NZU A;  3ZN3 A;  1YKE B;  3TKL B;  4KBM B;  4DBQ A;  4BX8 A;  2IFU A;  3C98 A;  4H9Q C;  3C4W A;  4P29 A;  4UF0 A;  3R6N A;  2X0L B;  1E8Z A;  2YHE A;  1KK7 A;  3OBV E;  3AA0 B;  1ELW A;  3AAI A;  5JDF A;  4UEM A;  1S35 A;  3DP7 A;  2MHK A;  3U3I A;  5DBK A;  3CML A;  2P9B A;  5DQW A;  5LG4 A;  3CLJ A;  4PUC A;  1PY1 A;  4D10 C;  4PS8 A;  2E8I A;  4F3V A;  2X9W A;  3L16 A;  1WYB A;  5FXW A;  2NSZ A;  3ONX A;  4LUN U;  4UV8 B;  3R84 B;  1PC2 A;  5CHE E;  2E9X B;  3A5X A;  2XGS A;  3CK9 A;  5AFU L;  3ESK A;  1ELR A;  2X66 A;  3PEU B;  3FP3 A;  5EX0 A;  1U3D A;  2X9H A;  5JDH A;  4J8E A;  1AJ3 A;  3E4B A;  2WQH A;  5KX5 E;  3B13 A;  5L2L A;  3L54 A;  4I2Z A;  3APC A;  2OVB A;  2DI4 A;  4V3I A;  4EOZ B;  4XKB A;  4O6F A;  2G0U A;  3MX3 A;  1U3C A;  3UUX B;  2M67 A;  4ANW A;  3FUF A;  3VHL A;  2A2F X;  4B0Z A;  5CCM A;  4XIF A;  2JJ9 A;  4CZZ B;  2L9Q A;  4BT8 A;  3FXE B;  4F6R C;  2RD0 A;  4CDM A;  2J49 A;  3PUS A;  4N78 D;  4UVB B;  3CK8 A;  5M4Y A;  5JDQ A;  5LNK A;  2V7M A;  3CHR A;  2PQN A;  2X67 A;  4AKL A;  2NP9 A;  3T8O A;  3CST A;  3O4Z A;  5C2Y A;  2IQC A;  5HWY A;  3OXF A;  4IE7 A;  5JDG A;  2C0M A;  4AKG A;  4OYS A;  4XZ4 A;  3PUQ A;  4ANX A;  4IUL A;  3U4T A;  5FMN A;  4I1O B;  3L13 A;  4FLB A;  3QAR A;  2R17 C;  4H9P C;  2LAH A;  2BTD A;  2NOX A;  3VKH A;  5EK4 A;  2IOS A;  2LNI A;  4RG9 A;  1H6K A;  2I6H A;  3O9X A;  1E8Y A;  4QWN B;  2X6I A;  4ZI3 D;  1HS6 A;  3RO2 A;  4Y6W A;  4EBA G;  2AXV A;  3PUG A;  5LGN B;  4EB6 E;  4YVQ C;  4U8H A;  2CXD A;  3C51 A;  3ZMV B;  3SGH A;  4JEH B;  1Z3X A;  4TV9 E;  4AI6 A;  4UQX A;  3WXX A;  1VRB A;  2IC6 A;  5JVD E;  1LVK A;  2CG2 A;  3CIA A;  4WUY A;  3DJB A;  3ZJ1 A;  2A3D A;  4JUY A;  5G04 C;  3MKQ A;  4KMC A;  4PDX A;  3ZXS A;  2LE8 A;  1HTJ F;  2CLY C;  2PL2 A;  2W61 A;  4ANU A;  4Q94 A;  5JR9 B;  3NQP A;  5LYJ E;  4UWL A;  2J1D G;  3O1I A;  2YU2 A;  4WNE A;  4ZS3 A;  2XQ0 A;  3UUM A;  5KJN A;  3GN5 B;  4HTE A;  1KT1 A;  3CHP A;  3Q15 A;  3I3N A;  4GOU A;  2DLR A;  2ZM2 A;  5J2U E;  4E7Z A;  5KDM C;  4HOR A;  4YJ3 E;  4QX7 B;  5J2T E;  3B7R L;  2VWA A;  3SHF A;  4ANV A;  4IE6 A;  4ZHQ E;  3U78 A;  4HN9 A;  3EJN A;  3JC6 D;  3ZHE A;  2CEA A;  4LEU A;  3NRX A;  5KCM A;  3FWV A;  2IC9 A;  1MHQ A;  2WXH A;  2WQ7 A;  2YU1 A;  2DWK A;  2GRM A;  4I1A A;  5BT1 A;  3CVV A;  2E9X D;  2WXM A;  4LCT A;  1B7T A;  4AEZ C;  3CVW A;  2V5F A;  2V7I A;  4K03 A;  3ZYM A;  2KZ7 B;  3M65 A;  3KFW X;  2UY1 B;  5FQ8 A;  3P8C D;  4J8S A;  2YNQ A;  4EBA A;  3KEZ A;  4H9O C;  4UV9 B;  1G73 A;  4CDN A;  3W15 B;  3SBT B;  3QK6 A;  2DNX A;  4JA7 A;  5LGT B;  3GWH A;  3QNK A;  3FUM A;  3N9N A;  1JWF A;  3U64 A;  4A3V A;  4N5C A;  5LCW J;  3CHQ A;  4AKI A;  3SD5 A;  4KT6 B;  2ODV A;  3E0Z A;  1HS7 A;  4CI3 B;  1D1B A;  4G2V A;  2Q9Q A;  3ZW3 A;  4O2A E;  2AWI A;  5EK2 A;  3QWP A;  4GYY A;  1WLX A;  2SPC A;  3BG1 B;  4H7X A;  2V8S E;  3FBL A;  2CWY A;  3ZIM A;  4WAF A;  2C0L A;  4O4L E;  3RKV A;  4FUL A;  4GYW A;  2LOS A;  4HGA A;  4I43 A;  4FJO A;  1Y64 B;  4HE8 A;  1N54 A;  2WB2 A;  4RVB A;  3VTX A;  3IHR A;  3ENE A;  3Q5M A;  3RC8 A;  2EHO C;  2H3R A;  3RYI E;  5JHA A;  3CKB A;  3N9Q A;  2DCP A;  3AS5 A;  3OAW A;  4UWK A;  4XX5 A;  4C90 A;  4DMV A;  2Q9Q C;  3I4G A;  2JMK A;  3BEE A;  4DMW A;  2XPI A;  3D9M A;  2NTX A;  4X1I E;  1HE8 A;  4PK4 A;  4IE0 A;  3ML9 A;  2ZM0 A;  4PK6 A;  3SS1 A;  2MRI A;  3ZEF B;  3FUE A;  2VSO E;  2L3L A;  5FZR A;  2CXL A;  3EHM A;  3ANW B;  3RC3 A;  2RG8 A;  4JC8 A;  5HXS A;  3LBX B;  3CWZ B;  1IQU A;  3ZYK A;  5HI7 A;  4Q69 A;  1IJ6 A;  3ZC0 A;  2KMF A;  2XAG B;  4G26 A;  2UXX B;  4Z8X A;  3NRY A;  2K48 A;  5BPP A;  2PFV A;  2MOW A;  3FTY A;  5LP0 A;  3RPU A;  4UI9 J;  4TUU A;  4A1S A;  2WQ6 A;  4AY5 A;  3KBU A;  4FHK A;  3LG7 A;  1Z0P A;  1G8X A;  2C5K T;  2IOL A;  5KMG P;  2N1G A;  3VTY A;  5JH7 E;  4GB9 A;  2LO6 A;  4ILU A;  1OWA A;  4QKN A;  2WSS V;  2ZMA A;  4XZC A;  4L7T A;  4RSY A;  1IZN B;  5A23 A;  3KS2 A;  2IW5 B;  3PU3 A;  3CKD A;  4GU5 A;  2PM6 A;  3N9P A;  2I59 A;  3ZMU B;  2VSX E;  5IYZ E;  5AEN A;  5FTP A;  3PUA A;  3SRZ A;  5FYM A;  3N9O A;  3Q49 B;  3F57 A;  2YEV C;  3Q2M A;  3PRZ A;  5HXR A;  4WND A;  4GCN A;  4EQF A;  4CT0 A;  2X6F A;  1WYC A;  4G25 A;  3B7S A;  5ANL A;  5LHH B;  1HG2 A;  4EAH A;  3N2O A;  5CB4 E;  4PJL A;  2VKH A;  3EIJ A;  3QJZ A;  3ZRH A;  4WWP A;  2VGX B;  5AJL A;  1BR0 A;  2QFC A;  3PNL B;  1U4Q A;  4GZD A;  5EDS A;  5JJ6 A;  4MAL A;  3L08 A;  3PS6 A;  1GW6 A;  3MK7 C;  5BNW A;  2ES0 A;  3HKB E;  3BK9 A;  3ZYQ A;  1YA0 A;  4EZK A;  4B89 A;  5L3D B;  4AOF A;  4CRW A;  2KZT A;  1UJJ A;  1T98 A;  1MIY A;  3NZQ A;  3D9N A;  4PJN A;  2CM0 A;  3LYA A;  2Y4T A;  2YK0 A;  3EDT B;  3ASG A;  3PNT B;  4UIG A;  2LHR A;  2I2O A;  1ZEE A;  5JRC A;  3EUH A;  4CGV A;  4ZI7 E;  3AU5 A;  4L9I A;  2C2L A;  4B8A A;  5DJQ C;  3U9W A;  4HOT A;  4DLO A;  4JW1 A;  4F53 A;  3RU0 A;  4ACK A;  3CVY A;  4XE0 A;  1TJC A;  4KP3 C;  5FQ4 A;  2FEZ A;  4I9C A;  3IHV A;  3PTR B;  2X6J A;  2WXL A;  3LJ3 A;  1UJK A;  2A72 A;  3ZN0 B;  5BV1 A;  3MEK A;  3D0T A;  2CMR A;  1ZHC A;  2ION A;  4C0E A;  1ZU2 A;  1BPO A;  3F2E A;  3FDH A;  1CUN A;  5FXX A;  5ARF A;  1IAP A;  3T5X A;  1MNE A;  4APF A;  1PAQ A;  5T8I A;  2Y8D A;  4U0U A;  4IN3 B;  1W3B A;  5F8P A;  5GON E;  5D0Q D;  2IJG X;  2WXF A;  4AIF A;  1TJF A;  1NZN A;  3DPD A;  2L6J A;  2LAI A;  4J8F A;  3JYS A;  3ZFW A;  1UN8 A;  5HXC A;  3JUI A;  3PE3 A;  3LY7 A;  2J9Q A;  4MLP A;  3HL6 A;  1MMG A;  4H9N C;  3GMI A;  5A1L A;  3FUK A;  3CR3 A;  5G55 A;  5CA1 E;  3UPV A;  3VLE A;  4UF0 B;  1MIW A;  1Z3Y A;  3BQI A;  3UT4 A;  4KVO A;  2LM9 A;  4GZ6 A;  2BZB A;  1HF8 A;  3KV9 A;  2E9X A;  4NQ0 A;  4HOS A;  4IE4 A;  2WXG A;  4J0U A;  2BF0 X;  4KYO B;  3ASD A;  1MMN A;  2WM9 A;  3V5S A;  1B89 A;  3GA8 A;  4AKR B;  2XCC A;  3CX6 B;  1IQR A;  2R5S A;  2XAQ B;  1NP7 A;  2NW9 A;  5LXT E;  3ZMZ B;  4IDZ A;  3UUX A;  3R7Q A;  2W0G A;  3AA7 B;  5F3J A;  2AVP A;  4M1P A;  3PVL A;  2MBG A;  4O2B E;  5L3C B;  4KVM A;  3G2S A;  5LHI B;  4CEM A;  3NZS A;  1E90 A;  4L5G A;  4BSX A;  3GYZ A;  5EKQ D;  2XAH B;  2XRZ A;  3MKR A;  2CXF A;  4XAX B;  2KCV A;  2I1J A;  3CKC A;  3QKY A;  3MJW A;  4HLE A;  3HKC E;  2E9X C;  2CE7 A;  4GIW A;  1H2U A;  3LEW A;  4NAC A;  2BUG A;  4GAA A;  3ZC1 A;  3CQX C;  2PG8 A;  4TV3 A;  3VKG A;  3BQK A;  3NZP A;  1E8X A;  3TJP A;  2LJL A;  4GYR A;  2L0T B;  2VB6 A;  4ZI2 C;  4JHJ A;  3CGH A;  5LCW C;  4IGU A;  4WBO A;  2WXQ A;  3RIB A;  5HXE A;  2LSI A;  3LVQ E;  2HYZ A;  3PRE A;  2HPJ A;  1X79 A;  3IEG A;  1NWM X;  3PE4 A;  5FQ7 A;  3FUJ A;  2HH7 A;  4MRU A;  1WM5 A;  3HVE B;  5FY1 A;  3OXG A;  3APD A;  3ZYL A;  2Q7F A;  5BUZ A;  3G2V A;  1US7 B;  4CXX A;  4TUY E;  1P5Q A;  5BV0 A;  2QGS A;  3AA6 B;  3MAC A;  3HDX A;  5J08 A;  3SI5 A;  3KV6 A;  1QNF A;  5TAO A;  2VQ2 A;  2WXJ A;  3SBS A;  3U66 A;  3UT5 E;  2XAF B;  1YKH B;  3HA4 A;  5FT9 A;  4K0R A;  4RG6 A;  5FXZ A;  4IHJ E;  4CT4 A;  2XTL A;  1QSD A;  3KIN B;  3FTW A;  3CHS A;  3CK7 A;  2K5B B;  5ENN A;  3D9P A;  4N3B A;  4AM9 A;  3MJX A;  1H0A A;  4EXT A;  2XAJ B;  4GK0 E;  3UX4 A;  2XHE B;  5FNV E;  2X9X A;  4C9B B;  4OFZ A;  3FU5 A;  4BTB A;  1Y8M A;  5L3F B;  1QZ2 A;  2OVF A;  4NUR A;  2CWO A;  2CLY B;  4UQY A;  3RRC A;  4I4T E;  2I9C A;  4OK0 A;  1HX8 A;  3SNX A;  5L3E B;  1FMW A;  3JCK C;  3HHM A;  1OWN A;  2LOP A;  3S7J A;  2K9A A;  3HIZ A;  5JR9 A;  3RRN B;  1FVF A;  5KJK A;  4O8S A;  4PK5 A;  1ELK A;  4ATG A;  5J90 A;  4CXW A;  2PBI A;  4QFV A;  2LSG A;  4B8C B;  5JRE A;  1D0Z A;  2XGM A;  4XI0 A;  4BX9 A;  3FH5 A;  3GN5 A;  4AQG A;  3RYC E;  4KZC A;  4UI9 C;  4ERR A;  3N9M A;  4G24 A;  4JA9 A;  3HR0 A;  4NUU A;  4ILG A;  4MBQ A;  3U3W A;  4DVD A;  5FY0 A;  2AXU A;  4FI5 A;  3PUK A;  3PE0 A;  4GK5 E;  2N9D A;  3D9I A;  4F7A A;  3FBZ A;  3FTX A;  3ETU A;  4PH4 B;  4P09 A;  4QXH B;  3AS8 A;  3P2B A;  2GK9 A;  5JR9 C;  1HG5 A;  5LBQ B;  1UX4 A;  4GA2 A;  2VTB B;  4NUV A;  4G23 A;  2CA5 A;  3GZ2 A;  4UWH A;  4GZ5 A;  5ETW A;  3TXM A;  4MS6 A;  3JQ1 A;  3L22 A;  2GW1 A;  3RH3 A;  3GW4 A;  4OVV A;  3I0Q A;  2UY1 A;  5L3G B;  3PU8 A;  4I55 E;  2NW7 A;  1QUU A;  3ASF A;  3ULQ A;  4A3T A;  2L0I A;  3Q5X A;  4HOU A;  3AU4 A;  5T4Y A;  3K3O A;  2GRL A;  3VLD A;  2CCQ A;  2V7J A;  4G2A A;  3HI2 A;  3EDV A;  3K3N A;  3CVP A;  1DNP A;  2UWJ G;  1WR6 A;  2MYS A;  3ZPO A;  1BR4 A;  2KLQ A;  3FUH A;  2YIN A;  2VSN A;  2KWI B;  5LP6 E;  3AB3 B;  4BA9 A;  4AQF A;  5CMY A;  3RRW A;  2X68 A;  3EVY A;  4QXC B;  2JPF A;  3QC1 A;  1BR1 A;  4U72 A;  2FI7 A;  1ZKE A;  4KMO A;  3RRM B;  4N2S A;  3T5V A;  3FY4 A;  2EHO B;  2BDE A;  3KV5 A;  4CGW A;  5A7D B;  4DND A;  3MCX A;  5LBM A;  2PZI A;  4UXN B;  2KT9 A;  2FO7 A;  3I9Y A;  1FVH A;  1OXZ A;  1DVP A;  2W63 A;  4AJW A;  3K9I A;  5JDN A;  1LRZ A;  3D3M A;  4KBQ A;  3FXD B;  4F1S A;  2C5I T;  5LFA A;  5G05 J;  4YND A;  5LJN A;  4AXP A;  1OWL A;  4A55 A;  1H2T C;  3B7U X;  5JJ7 A;  3KAE A;  2KWH A;  3CV0 A;  4H7Y A;  3LJC A;  4AV7 A;  5H6Q B;  4YHJ A;  3HYM B;  3D9J A;  5A6C A;  1MMA A;  4U07 A;  4PFP A;  3ANW A;  4WWO A;  2KC7 A;  4WBN E;  4HXI A;  2PM7 A;  2VKO A;  5T3R A;  3DTO A;  4V1A v;  4URK A;  2WXN A;  4ABN A;  3MA5 A;  3N5L A;  4FHJ A;  5LHG B;  4JHR A;  2IU1 A;  1EYH A;  1HFA A;  2XPZ A;  4CXY A;  1TEZ A;  2HR2 A;  3ZGQ A;  5FJY A;  4KZ0 A;  4GYS A;  4GPK A;  3ZMT B;  3OYZ A;  4O4J E;  3QOU A;  4H9S E;  1WAO 1;  2FF4 A;  2Y6X A;  2ACX A;  1OWM A;  1IYG A;  2XEV A;  3QUJ A;  5DQV A;  3FEY A;  1Z6T A;  4U74 A;  3LK4 2;  3KDS E;  3RYH E;  2L9B A;  4X20 E;  2Y48 B;  4JZY A;  3C50 A;  2WXO A;  3VU7 H;  3SWH A;  2LSV A;  1VDY A;  3S4U A;  2C5J A;  3JQ0 A;  2K24 A;  2VGX A;  3S2A A;  4XI9 A;  2LSJ A;  4K0U A;  2DCF A;  4XKC A;  2J09 A;  4EEC A;  3IEE A;  3Q47 B;  3AAE B;  1INZ A;  3FHE A;  2WWU A;  1NA3 A;  3D9L A;  4TZ4 C;  2X6K A;  1KLX A;  2BVM A;  4WWN A;  3QDN A;  1S0P A;  4IST A;  2N2N A;  2WMN A;  4ILI A;  4U0Z A;  1OWP A;  1OUV A;  4ME2 A;  3I9W A;  1A17 A;  3FTU A;  3E22 E;  1E7U A;  4OVU A;  3ZMS B;  3AVR A;  5FXV A;  1MIV A;  2LSK A;  3L17 A;  1IJ5 A;  2GGF A;  5HAX A;  2WXK A;  5LOZ A;  4PFO A;  3OTN A;  4WNF A;  5E0O A;  3I1A A;  3RX6 A;  5JDM A;  2BVL A;  4TX5 A;  1D0X A;  5JQG E;  4JVS A;  1ZBP A;  1D1A A;  5EZY E;  2E0I A;  4PAG A;  1L5J A;  4UVC B;  2OND A;  4N39 A;  4JEU B;  4ZI3 C;  1D0Y A;  2EHO D;  4DI4 A;  3ML8 A;  5CCL A;  3WI3 A;  3R9A B;  3O48 A;  4L2Y A;  3CX7 B;  4X1Y E;  4ANJ A;  2JMH A;  4L1B A;  5E75 A;  4UEL A;  1LF8 A;  1SHZ C;  2Z6E A;  2XRY A;  1UX5 A;  3T8M A;  4JXT A;  2ZU6 B;  1WRD A;  3QK0 A;  3B7T A;  5J1G A;  2CG3 A;  3EIQ C;  5IHY A;  5BW8 C;  4QXB B;  3IBE A;  3RJV A;  3L6A A;  1U5P A;  3FU6 A;  2OOE A;  2CHW A;  2VYI A;  3FH8 A;  2CHZ A;  5FP3 A;  4CI2 B;  3TL5 A;  4E85 A;  3C64 A;  3CQC B;  3N2K E;  4HFV A;  4EIW A;  5HYA A;  2X51 A;  3C98 B;  4DPR A;  3ETV A;  2C0S A;  4H9R C;  4ISS A;  4IYP A;  2WBL A;  4A56 A;  2KXP B;  4MKT A;  4HEA A;  4L2L A;  2X9Y A;  4KUM B;  5ARG A;  3CVU A;  2XGO A;  1BR2 A;  2JQQ A;  1LKX A;  4EYY R;  5ADX L;  3S7D A;  5DAB A;  1H7C A;  1YD8 G;  3FU3 A;  3ONK A;  3MV3 B;  3BG0 B;  3MV2 B;  2V26 A;  2XCB A;  3JC6 C;  2B1E A;  5BMV E;  2Y3A A;  4TN7 B;  4UWF A;  3SOL A;  3GZ1 A;  4N3A A;  3RKO A;  3APF A;  2DWG A;  4B94 A;  4YJ2 E;  4PJJ A;  3QAQ A;  2AW6 A;  4FLH A;  2V7L A;  3PEV B;  3PH0 C;  4AY6 A;  3FH7 A;  2NW8 A;  3D9K A;  3QC9 A;  4DLQ A;  2PJQ A;  1LVF A;  5M72 A;  4W9R A;  2KM4 A;  2KCK A;  3CHO A;  2OV8 A;  2EQX A;  4I6J A;  2H7O A;  3ZJ2 A;  1N52 A;  3I4R B;  3HVE A;  3PUJ A;  4WNG A;  4G11 A;  3LK2 B;  3B57 A;  1NA0 A;  3IV0 A;  1HO8 A;  3IHY A;  3FEX A;  5FZQ A;  3O4X E;  3EHN A;  2ODU A;  2FUL A;  4AP2 A;  4BJN A;  1Y6I A;  2CFZ A;  5CA0 E;  4GYO A;  5FWQ A;  2IF4 A;  3OYX A;  1KT0 A;  3KD7 A;  1SQM A;  1FEW A;  3P1U A;  4GCO A;  3PDN A;  1SZA A;  2VAS A;  4J8D A;  4DK5 A;  3HKE E;  1D1C A;  4IRU A;  3HKD E;  4IIJ E;  4FC8 A;  3Q4A B;  3ZVV A;  2XHE A;  4JEH A;  3S7B A;  3E08 A;  5G05 C;  3FTZ A;  4QHO A;  3UT7 A;  3LXU X;  4JHK A;  4NRH B;  2VKJ A;  5C8Y E;  3FUD A;  3BQL A;  4MFR A;  1UN9 A;  4UVA B;  4U0S A;  2JRK A;  3OJA A;  3N2G E;  4ILH B;  2E2E A;  2KCL A;  4HVB A;  2X3M A;  3UUL A;  4DO0 A;  2HO1 A;  4BTA A;  4DJA A;  3CHM A;  3CVX A;  3LK3 B;  4J2C A;  3H3A A;  3C4Z A;  4EZH A;  3ZPJ A;  2WXP A;  4L0R A;  2P58 C;  3IBP A;  3O1H A;  4TRQ A;  3MKQ B;  2VGY A;  2D0U A;  5HXH A;  3J7Y q;  4BWR A;  1VOM A;  2IAK A;  3NBX X;  4ZOL E;  1H2V C;  4PJM A;  3P7I A;  4GZC A;  2WPV A;  4I9E A;  1FIO A;  4X1K E;  3MZL B;  3SZ7 A;  3LVR E;  3AA1 B;  4I6E A;  1SZ9 A;  5AYW D;  2JLB A;  2VL8 A;  3KBT A;  3K8P C;  2NTY A;  4GA0 A;  1E7V A;  3CQG B;  2VTB A;  3H37 A;  4R7L A;  5JJT A;  4C91 A;  2M63 A;  3Q5W A;  4CI1 B;  2J07 A;  4AXH A;  2YHC A;  3FTV A;  2WXI A;  3MXZ A;  2VJ8 A;  4FU3 A;  2HPL A;  3C4X A;  3ZHE B;  4BJM A;  2VK9 A;  2WMO A;  3RYF E;  2KAT A;  1NAF A;  4DI3 A;  2NXP A;  4P0B A;  2FBN A;  1HU3 A;  4U04 A;  4I2W A;  4BFR A;  1E96 B;  4CDR A;  2H7V C;  3UQ3 A;  3NF1 A;  1IHG A;  2D2S A;  4J6I A;  5CMW A;  3OKQ A;  4PNI A;  5LA6 E;  4B6X A;  3L3P A;  4EZL A;  4ZI2 D;  4H63 H;  4HKA A;  4MHC A;  3MA9 A;  4OYK A;  1EDU A;  2HM8 A;  4E6H A;  4WW0 A;  1SA0 E;  5KJM A;  3TG4 A;  5D0O D;  3UTK A;  1UW4 B;  4EZ4 A;  4EPZ A;  4I1M A;  2DIW A;  2V7K A;  3OXL A;  3LFM A;  3UFE A;  3QWW A;  2EHO A;  3O1J A;  5AJD A;  3K3Q C;  2R59 A;  3LS8 A;  4EYU A;  4UQZ A;  3RK6 A;  2NC9 A;  3LPZ A;  3QWV A;  4GML A;  1E8W A;  4M3O A;  2ZLY A;  2MTQ A;  3FFL A;  3VLF A;  2DBA A;  2LSY A;  2VKD A;  2Q9Q B;  1H19 A;  3GZS A;  2RA1 A;  4O4I E;  3ZN1 B;  4AQF C;  1E1H B;  4WNK A;  3V5U A;  2VSY A;  3LY8 A;  2XQY A;  4UWG A;  3FUI A;  4N2Q A;  2V0P A;  4I43 B;  4Q96 A;  3LY9 A;  2A4Z A;  2MOZ A;  3ZEF A;  1YW0 A;  2X6H A;  4YVO A;  5FY7 A;  3I0O A;  3UMV A;  3TAX A;  3MZK B;  3LKU A;  4YFS A;  2V4L A;  1ZV4 X;  3MKD A;  3LBX A;  4ASK A;  2A5U A;  3R7R A;  4GA1 A;  2I1K A;  5LX8 A;  3TG5 A;  1MMD A;  4Y6C A;  2L8K A;  3CPZ A;  2V1D B;  5HWX A;  2D0T A;  3L09 A;  1KNZ A;  3CVL A;  1JPL A;  4OYJ A;  1S94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...