1HF8A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Clathrin
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 102
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hf8A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hf8A01
1JUQA 1JWGA 4GZCA 3CLJA 1HFAA 4NACA 4Q96A 3ZYLA 3ZYMA 1PY1A 3G2SA 3LDZA 1SZ9A 1INZA 3G2TA 3D9KA 5LOZA 5LP0A 4GZDA 3RRUA 3D9IA 1EYHA 5CMWA 1VDYA 1SZAA 2MOWA 4AVXA 3D9JA 2LO6A 3G2UA 3D9NA 4HFGA 1UJKA 1XGWA 3ZYKA 2BF0X 3D9OA 2L0IA 1JWFA 1UJJA 1X5BA 5J08A 3ONKA 1JPLA 1HG2A 1MHQA 2L0TB 4FLBA 3D9LA 1DVPA 4JXTA 4Q94A 1HX8A 2DCPA 1ELKA 2DIWA 3D9MA 1HF8A 1LF8A 2KM4A 1HG5A 1H0AA 1EDUA 3D9PA 3ZYQA 2V8SE 4FU3A 3ONLA 3G2WA 5CMYA 3G2VA 2QY7A
chains in the Genus database with same CATH superfamily
1JWGA 3C50A 3ZPJA 2WQYA 3KS2A 1O5MA 3VRAA 5AJLA 1N34T 2VSYA 2A4ZA 3Q4AB 4UF0A 3PH0C 2X67A 3GWHA 5ADXL 3TWUA 2RA1A 3U3WA 2CPTA 2Y3AA 2C5JA 2P58C 5F5WA 3O1IA 1SVXA 3N2OA 5AQ9A 2IFUA 3LJ3A 5ANRA 4WUYA 3ZSSA 2DCFA 4GTRA 3RKOA 4TUYE 2C5KT 3HRAA 3QDNA 1Y6IA 5KJLA 1L5JA 4UI9C 4EZ4A 1OWAA 3UQ3A 1TNOA 3FUJA 3MYVA 5JJ7A 1X9BA 4YSXA 3IV0A 4GCOA 4Q25A 4B93B 5FKYA 4P09A 3QC1A 3WG7E 3FUIA 4UI9K 4GZDA 1YA0A 4U63A 3D9JA 1XNFA 4U8HA 2VKDA 1XNQT 4JC8A 2KNDA 1D9SA 3L9TA 3N71A 4H9OC 4ANVA 1V55E 3QARA 5AQPB 4EEBA 5LP6E 3KBTA 3CVVA 4QHOA 4IREA 1NL4A 3PZ2A 2E9XA 4YNDA 2IU1A 3SFXA 2FJDA 3HXBA 4MLPA 4FLHA 3IA3A 4J8EA 2V6XA 3ONJA 2NP9A 4I1OB 3ZRHA 1HNWT 3DSXA 2LSKA 4HFHA 1SUMB 3CK8A 5LFAA 4HI9A 3TWWA 3Q7FA 3RK6A 4OFZA 1J5ET 1E8YA 2GK9A 4I55E 5J08A 5ENQD 3IKOB 4C48B 1LRZA 3QUJA 5CECB 5HEOA 4V1Av 2P9KG 5G04C 4OVVA 2B0OE 5H6QB 4MHCA 1E8XA 5AQQB 4GU5A 3JCKC 3TWXA 3T8MA 2LSVA 4U0SA 1QSDA 5HAXA 4WZXA 1E7VA 4GMRA 3UT7A 5G05C 2ZM8A 2V0PA 2E8IA 2CXDA 4E7SA 2XQAA 3AS5A 3PUYF 2V6YB 4UQYA 4MBGA 4TV3A 3DSUA 3HHMA 3EHZA 2XQ0A 4U33A 4DMVA 2YHCA 5BR8T 3MV2B 3HXFA 3ZMZB 4YVQC 3PUKA 2ES0A 3Q9DA 4KVMA 4KXKB 4HE8A 4DR4T 4G23A 3BUAA 1WAO1 3RAUA 5AQFB 2XY8B 3LDQB 5B3SE 4DPRA 4HWHA 3ZIMA 1OXZA 3R6NA 3RIFA 2CEAA 4I1MA 4BT9A 5ABHA 2OEWA 2W67A 2XPKA 1OWNA 2CHNA 3L08A 1D0ZA 5HXCA 4ILUA 5JR9B 3QOFA 3C98B 4X8QA 3AE4A 2MBGA 3IBPA 5FY0A 4PK6A 2WMOA 4GTVA 4RG6A 1NA3A 2PTFA 5JDQA 3BEEA 4GZCA 1HFAA 2PJQA 1WM5A 2GRRB 4WAFA 4IE0A 2IIUA 4AV7A 3HXCA 2VGEA 4NURA 3OYZA 4EHMA 5CBNA 3K1SA 2N2NA 3ZYKA 3Q49B 2NXPA 1WR6A 4XBFB 3Q2MA 4BTAA 2UXNB 4X66T 3BG1B 3CQCB 3UUXB 4L5GA 4YVOA 3PUXF 3KSLA 4F53A 3B7TA 2EHOD 4ZEYA 3RC8A 4JV5T 3Q9NC 3JC6D 3F57A 3B7RL 1OWLA 3L8RA 3AA6B 5IY5E 4OAUC 3DXKG 5G2NA 2BKKB 3F6QA 3CVWA 1MX2A 5J2UE 4MKTA 3NRYA 4XAXB 2DVWA 3EABA 3J7Yq 2KCKA 2FF4A 3CVQA 4LF8T 2Q7FA 3QB5K 2DNXA 5HS0A 2MOZA 4LMKA 4N3AA 4J7WA 2VTBA 4Q69A 1OEDE 4GB9A 3ZFWA 4KI0F 4E6HA 2MAWA 2L0TB 4JB8P 4QFVA 3OVUA 4PUCA 1TNUA 2MHKA 3UUNA 1HG5A 4MFRA 1D8EA 3CHOA 5D2MC 5T3RA 2Y4TA 5FVLA 5ENSD 4WWNA 4DLQA 3L6AA 2DYRE 4QXBB 3U9WA 1E96B 2H6GA 3NRXA 1W09A 2X9WA 4LG6A 3JYSA 3EDUA 2CLYB 4F6RC 4EB6E 4LNGA 2XTLA 5G05J 4GYRA 4UWGA 3UTKA 3KAEA 2K5BB 3H3AA 3B7BA 5HCMA 2PL2A 2BTDA 4J8DA 3D9LA 4HFIA 2FJEA 3KV4A 1HF8A 1N32T 4ASKA 4QXCB 4Y6CA 4DV3T 4PJJA 3VLFA 3BU8A 3HIZA 1KZPA 2CWYA 1BR2A 2I0MA 2G0UA 2XJ7A 2PZIA 5EILA 4LFAT 2XUEA 4KP3C 3TL5A 4HFBA 4LCTA 4A56A 2WPVA 4NIKA 4IHJE 1KZOA 4O4LE 4GTQA 1FJGT 1LD7A 4U7YA 3AG1E 2AXDS 4AQYT 1S63A 2DZOA 3SD5A 4CGVA 3Q5MA 1UCUA 4TV9E 1MMNA 2MTQA 2X9HA 1TNYA 2YINA 5CBOA 1LVFA 2YHEA 4DJAA 5FWQA 2WU5A 4PJNA 3RYFE 2W4XA 5BPPA 3O48A 3HG0D 3QWPA 5HEUA 5KWDA 2N1GA 4U31A 1S0PA 2V4LA 4NRHB 3CK7A 4CRWA 3SRZA 3AE5A 3FUNA 4IRUA 3MK7C 3HR0A 2H7OA 3CSFA 2OVBA 3MKQB 4ATZD 1E7UA 3ZCIA 2N9DA 2DBAA 1OWPA 4KHZF 4Q94A 5AQGB 4U7IA 4N39A 2IAKA 2XGSA 1E8WA 3DJBA 3E34A 3DTOA 3IHYA 1H19A 3O1JA 5CEAA 1YMPA 3QNUA 1BPOA 2GGFA 3FP3A 3NAWA 3V2OA 3LBXB 3JQ0A 4N2SA 1UN8A 4DUZT 4GTSA 2WXLA 2H6FA 3HXEA 2PQRA 2NOXA 4O2BE 2KZ7B 3RQWA 2DCPA 3RO3A 2IEJA 3SBTB 1IZNB 5L47A 4WYVA 2DHRA 5E0OA 3RSEG 3G2VA 4I0UA 2WXMA 5L3EB 3TXMA 1TEZA 1BU9A 3ASGA 3N9MA 3WI3A 1HH8A 2IOLA 4KBMB 4DV6T 4RSYA 1H6KA 1JCRA 2YNQA 4IYPA 4I6JA 4O1PA 4DV1T 3ULQA 1K1BA 4HFEA 1IJ5A 2VQ2A 1IKND 4QQIA 1KNZA 3N2KE 1J5WA 5AQNB 5HRYA 5BV1A 3N9OA 2Y69E 5B1BE 4O4IE 5JDNA 4YTMA 1U3DA 3HVEA 3C3RA 4ADZA 1IXVA 4AQGA 2XAQB 3C64A 1SA5A 4PJMA 3CVNA 4G24A 3EHRA 4JA7A 4PS3A 4TWFA 4KYOB 5CRUA 2V5DA 5D0OD 5CCMA 2WDRA 3KV6A 4LF7T 5ARFA 4A1GA 3HKEE 3HI2A 1KPSB 4AY6A 4JPSA 3C3QA 3CHMA 4FU3A 1YKHB 5JR9A 1MYOA 1WLXA 2NC9A 4ZI3C 3ZUVB 4AIUA 3LCAA 2P9BA 2HN2A 3ASHA 4GTTA 1OWOA 2EIKE 1BI8B 3LBXA 2LOSA 4WW0A 4FJZA 2FUPA 3ULYA 4ZS3A 5EZYE 1N0QA 3UI2A 2W62A 2J8SD 5CEDB 5EX3A 4XEIG 3VU7H 2HH7A 4ILBA 4HOSA 1HX8A 2P9NG 4IL9A 1SA4A 4PS7A 2XGMA 3BQKA 2B1EA 3BK9A 3RYIE 1D1BA 4QX7B 3FDHA 5LCYA 2K3WA 3DP7A 2C0MA 3PZ4A 2V7MA 1IBKT 2JQHA 5FY1A 4O60A 5D0QD 1TN8A 4CT4A 1SA0E 2XQYA 3AAIA 4BTBA 2J4BA 2JQKA 3P50A 2V8SV 2ILRA 5AQHB 2X38A 1HS7A 3FWVA 4HFDA 1LTXA 4R7LA 3TWTA 2JQ9A 4JLEA 2J09A 4DLOA 2WXPA 2XPYA 2R59A 5HWYA 3P7IA 3KD7A 4YFSA 3ZJ2A 3FZLB 2W66A 4I6GA 4TNVA 3KV9A 3U64A 4JI0T 1IHBA 3TAXA 2WZIA 4TX5A 1OY3D 2E0IA 1KT1A 3VHLA 2IOSA 4UQZA 2W00A 4IULA 5FZQA 2AW6A 1JWFA 4B8CB 5D66A 3DSSA 4HWDA 3ABVA 3T9KA 3PU3A 3Q75A 3C5RA 1A5EA 3E32A 2NYJA 4AJWA 2ZU6B 5AQSB 1X79A 3FULA 3ZYMA 4U8VD 2DYSE 2VL0A 3AG2E 4FULA 2UXXB 4LFBT 4XKBA 3UQ4A 3CKCA 2C5IT 1Z5SC 2BS2A 3NWIA 1O1TA 3ZKJA 4N5QA 2JMKA 2HR2A 1B7TA 2BZBA 3EVYA 4HBDA 5KX5E 1O1RA 5FT9A 2BVMA 4ILAA 4DIDB 4JL0A 2HO1A 2V7KA 1TYQG 1UOHA 2KZTA 2UUAT 2F0YA 2CHWA 2UU9T 3W9FA 4G1TA 2XAJB 3SZ7A 4HWIB 5L3BB 4N5CA 4H9SE 3RYCE 4DR5T 5B1AE 3PE0A 1U3CA 2A2FX 2RFMA 4EZHA 2GROB 4X1IE 3ZMTB 5JH7E 1IQRA 4LNUD 5AQIB 2LEHA 1ZHCA 4DV5T 1MZCA 2I1JA 3G2UA 2ODUA 3GN5B 2R2LA 1IYGA 2CBJA 4X1KE 1FMVA 1JCQA 1Y01A 4A1SA 5G04J 3AVRA 4UIGA 2XEVA 3NF1A 5AENA 4TZ4C 5J0ZA 4BT8A 3H3MA 3X1DA 5LOVE 3LYAA 3CVYA 2PNNA 4GA2A 3KEAA 4TNWA 1QZ2A 2PM7A 3EDTB 2IC9A 3R7RA 2KXPB 3EU9A 3ZNGA 3PDNA 3CHRA 4XI0A 3E0ZA 2AE9A 4P0BA 3AE9A 3Q78A 3PZ1A 4A97A 1S94A 2X6JA 5DJQC 4OHFA 2J4DA 2LSYA 4JI8T 2V7LA 1AJ3A 4HFCA 2BG9A 2YDQA 4NXNT 3BQOA 5JTGA 4U0ZA 1YQ3A 3CX8B 3RHWA 3SF4A 5L4HA 3AAEB 1OEDA 3U3IA 3ZXSA 2H3RA 4DV4T 4UWLA 4GTPA 2RKKA 3ZXPA 5ABFA 3P8CD 3O4ZA 2XPZA 3SI5A 3GA8A 4K0UA 4OYSA 2CA5A 3JUEA 2ZISA 1K3ZD 1MIWA 4U0UA 4ZZCA 4DX7D 2XEHA 2DL1A 5ETWA 1KNRA 3R9MA 3URZA 5LCWC 5DBKA 1TN7A 5F3JA 3GW4A 5T4YA 3VLEA 4HRNA 2ETCA 2MRIA 3CLJA 1ZEEA 4U3CA 4QH5A 3CIAA 3PREA 3DEOA 1KLXA 2XSAA 4UV9B 4HLLA 4EV6A 4J6IA 4GYOA 4CZZB 2XQ5A 3ESLA 3ZEFA 1TR4A 1EPUA 1FT2A 5FP3A 3O1HA 5DABA 2VGXB 2EINE 2H89A 1FMWA 2P9IG 4GMJA 3RQUA 1MNDA 1Z0PA 2XM2A 5CMYA 5CA1E 2IONA 4BEPA 2XAFB 3HL6A 2I1KA 1INZA 1N4QA 5FTPA 4H63V 3CEQA 2R02A 4YHJA 1T7SA 4PH4B 3HVEB 2RG8A 1L0VA 2J07A 2OEVA 2ZGDA 4HOTA 1MIYA 5FXXA 3AVSA 3FH8A 2WXRA 2LKGA 1MHQA 3W15B 3PJAA 3FB2A 2A9UA 1XDPA 4JEUA 3PE4A 2WXFA 4LF9T 3FUHA 4CDNA 1D1AA 3ETUA 3KVAA 2LAIA 1N95A 2ODVA 3RLFF 4JI6T 2OCCE 5JR9C 5JREA 3FU3A 3UX4A 3SHFA 5A6CA 1M7KA 3SWHA 3UUBA 3ZN3A 5KBAA 4WBOA 5FNVE 2BS3A 2E2AA 2M63A 3UU6A 3CK9A 4DVDA 1D0XA 3NVOA 4LFCT 4KBQA 4U7EB 5KNGA 2B6CA 3PV0F 1GQEA 4JHJA 1LD8A 4LNBA 4BX8A 2BKNA 3ZT6A 2A3DA 3EHQA 4B8AA 3OXFA 5AJDA 4LSZE 2CHXA 1S35A 2VKJA 2CG3A 2AXUA 3FBLA 2F8YA 2EHOB 3MA5A 2BKPA 5AN8A 2EILE 3EUVA 4LRZA 1DNPA 4U04A 3ZYQA 2D0TA 1N36T 4H9QC 5AQLB 3MJXA 2IC6A 2OV8A 3CVXA 1PY1A 2PFVA 1UX4A 2X51A 4P0AA 5LP0A 3FTXA 3E08A 3RRUA 4HWCA 4UQXA 4AKHA 2F37A 3I3NA 3BQLA 3L22A 2ZXWE 4A5XA 1N11A 3L54A 3PNTB 4L23A 4EXTA 4FADA 2F8XK 3S7FA 4EBAA 1ELKA 5AQKB 1XMOT 2FI7A 4IDPA 3PUQA 4X62T 2CLYC 2KCVA 3HKDE 4KZCA 4YY3T 5C3JA 1N33T 2JPFA 5AQVB 4IT4A 2H6HA 1GW6A 3PZDA 2WWVA 2VQFT 3S7DA 2CHOA 3FXEB 1EYHA 3ISMC 5HQ8A 2P9UG 4BJNA 1OCRE 5AQAA 4APFA 2NTXA 1PC2A 4EPZA 3DSWA 3M3ZB 3KFWX 3PEUB 3TJPA 3VTXA 1OCCE 2RFAA 5T8IA 5HEGA 2P9LG 4UI9J 5HI7A 4K5CA 2E9XB 3AE3A 2BBJA 3CX7B 5DQWA 4YSYA 5H6RB 3K3QC 3DRAA 4O8SA 5EKQD 1E7PA 4CXWA 3VKHA 3GMIA 4F3VA 5HCJA 1G8XA 1QNFA 2WXQA 1V9DA 2WXHA 3UIOC 5LG4A 4G63A 1NA0A 3QB2A 1YCSB 2UWJG 2L6JA 4C0EA 2ZMAA 3J9X1 2MYSA 4C91A 4HTEA 3SQVA 4PK4A 4I17A 1X5BA 3ONKA 4F6RD 1HG2A 4PFOA 5KMGP 3QB5A 3X2QE 3RGLA 1RZ4A 1WYCA 2IO3C 2P9PG 2DWGA 2QY7A 3AG4E 2Y0BG 1FPPA 3GZSA 4H9PC 2BG9B 4L7TA 5FY7A 2VVSA 4RG9A 3JCFA 2W2UA 3UT4A 3UU4A 3UULA 3ZC1A 2KT9A 2VWAA 5BXOA 3AEGA 2R5SA 2AXVA 2UXDT 1KFYA 4DX2A 3GZ2A 2X6IA 2KCLA 5E76A 2C2LA 2LAHA 2L9QA 3F2EA 5EIBE 5BW8C 3M65A 2PQNA 1G73A 2Q9QB 4RQIA 3FZMB 2XPIA 2EHOA 4O4JE 3D9PA 3RJVA 3IXEA 5ENTD 4AM9A 3L16A 4E7ZA 4JHRA 3AEBA 3Q7AA 5EK3A 3AU5A 2VSNA 4EZKA 2X6HA 5L3GB 2IUBA 2V26A 4I4TE 3RIUA 4YDYA 4LMJA 3LFMA 2EIJE 2X9YA 4J0UA 2LT3A 1VCSA 4BESA 4FLBA 2BUGA 3UIPC 4OK0A 2V8SE 5LCWJ 3JAFA 3AS4A 1R8IA 1XZYA 2IY0C 3FU5A 4ZHBA 3LDZA 3DEPA 2HM8A 3ONXA 4IDOA 2HHHT 2NR4A 1HCIA 2JRKA 5CGMA 1MIVA 2CRBA 4AEZC 1IBLT 2E2EA 3ZT5A 4AKGA 3L13A 2M6BA 2K48A 2VASA 3JADA 4ILIA 4EGWA 1P5QA 3RC3A 3R84B 4IN3B 3Q47B 5EN5D 1UK5A 2KWIB 4B0ZA 3EAMA 2WS3A 3HDXA 3TGOA 2D0UA 3C3OA 1G3NB 3LJCA 3FTVA 3WXXA 2XRYA 3FZKB 4PFPA 1E2AA 4UWFA 5A23A 5HEHA 4CN4A 4ERRA 2VJ8A 4DK5A 2Y48B 2J62A 4N78D 5FZRA 2R05A 3P4RA 3RX6A 4JVSA 2QYJA 5AQ7A 4UR9A 4CN6A 3TWQA 5LMNT 5AIJA 4GAAA 5BT1A 5HXEA 3RI5A 4JA9A 2HYZA 2YDRA 4G8KA 2CM0A 1BR1A 3ZMVB 3AE7A 2WVIA 2BG9C 3AXJB 2LRLA 4F1SA 2YQ8A 4FHJA 2XQ3A 3VR9A 3RPUA 3D9NA 4YDWA 2H7VC 4ZFHA 4YSZA 4AXPA 4G11A 3S4UA 4L9PA 2D5UA 3R7QA 4ZI3D 2XGOA 4GOUA 4KUMB 3ABME 2LSGA 1NENA 3LKUA 3F31A 3TLVA 4NXMT 3TLUA 1IJ6A 2VVNA 3LVRE 4XI9A 3MV3B 4PK5A 4CT0A 3PS6A 1VCTA 2V6YA 3MKDA 3C4WA 3Q73A 3PRZA 4O2AE 2XAHB 3ZN0B 4N3BA 3EJNA 4YXDA 3OBVE 3AAAB 4H9RC 3C4ZA 3VRBA 4WNGA 4ISTA 4HS2A 2F4VT 4N3CA 4C9BB 4JXTA 4CI3B 1WYBA 4L9IA 2H88A 2XCCA 3NQPA 2X66A 1ZOYA 2X0LB 5AFUL 4ZI2D 4HNAD 3AG3E 1OXJA 3Q5WA 4TV8E 4GPKA 5HXSA 3E33A 2XHEB 5LOZA 3MKQA 3ZCJA 2JJ9A 4ANJA 2XASB 3OYXA 5J90A 3UT5E 2WM9A 5JDHA 3OTOT 3E22E 3NZPA 2DI4A 2MPKA 4BSZB 5FL0A 3SO8A 1YQ4A 2AJAA 3FHEA 3AJIA 2E9XD 4A3TA 3AEDA 1FEWA 1XNRT 1EF1C 4HFVA 4PJLA 5KXJA 3HKBE 4WWOA 5AQBA 2HN1A 1H2VC 3RRMB 4ACKA 3DSVA 1VDYA 5ARGA 2VTBB 5EDSA 3AXJA 2J4GA 5M4YA 4TXRA 1HX1B 3FFLA 5G55A 2VGYA 3AA1B 4TWHA 4KT6B 4DX5D 2DLRA 4JZYA 2LXMA 1QUUA 4I6EA 2ACXA 1N4RA 2JLBA 2QRXA 2XZTG 2LM2A 4N2QA 3ZYLA 5EK2A 3FEYA 1O3XA 4I9CA 4TUMA 1ZU2A 3S7JA 3TLTA 4AKLA 1SW6A 5AQMB 4K03A 4CDRA 5FXWA 4DX6D 3QOUA 3I0OA 4MRUA 4B3ST 2V5QC 4CI1B 3I9YA 1UURA 5KDMC 5DIZA 1E8ZA 1T72A 1QLBA 5HEJA 4FA6A 1XDOA 1U5PA 3CVLA 5AQOB 2WU2A 1KEYA 1BLXB 1HU3A 3PE3A 2YK0A 1LKXA 1X81A 3D9HA 3LK3B 4DX1A 2IMLA 3LY7A 3V31A 1I6ZA 3EIJA 5IHYA 2WXOA 2J47A 2KBXA 3FXDB 2OVFA 4U96D 3L3PA 2HPLA 1W3BA 3D0TA 2XCBA 3OXGA 3FTUA 5EX0A 1ZKEA 3CPZA 2EIME 1YW0A 3K8PC 1QBQA 2WCAA 2DWZA 2WQ6A 3G2TA 3FH7A 1UW4B 3CQXC 1IAPA 3LG7A 5AQTB 1HE8A 3TXNA 2FBNA 4B3MT 4K5BA 4MALA 4G2VA 3KVBA 3PURA 4CN1A 5LGUB 4V3IA 2X0HA 4G8LA 4BERA 3ZSTA 3IF8B 1TN6A 4PAGA 3ZN1B 2IW5B 3OXLA 4A98A 3G2SA 1SZ9A 1TJCA 2R03A 4YJ3E 5M72A 1LVKA 2VYIA 4AVXA 1SHZC 4HVBA 3NOGD 3L17A 4UUCA 1XGWA 2KLQA 2WBLA 4IE4A 4DUIA 2UUCT 4BSXA 3TWSA 4YHHT 3E37A 3NBXX 4G2AA 3B5MA 4I50E 1W0BA 5JDFA 4B3RT 5LX8A 2WB2A 1FCHA 2JMHA 2D9DA 3SBSA 1UX5A 2BBHA 4U72A 4ZI2C 1H2TC 5IYZE 2WWUA 2P2CP 4HOUA 3I9WA 4XZCA 3T1YT 1Z3YA 3MJWA 4I9EA 3TG5A 3RKGA 5GONE 3FTSA 3Q79A 5HKPA 3T8OA 3ZW3A 1MX6A 4BA9A 3RIAA 3UFGA 5BXUA 5L3DB 4QKNA 4UVBB 1I94T 1KT0A 3AE8A 3LK2B 3PUAA 1T8BA 2LXLA 2BF0X 4F7AA 2KZTB 3EDVA 3PNLB 4PDXA 3WAKA 2Y6XA 2XQ9A 1EDUA 3A7MA 3O4XE 2I6HA 5L4EA 4IL4A 3NBNB 3PUVF 3RKVA 4ZOLE 2LKHA 3ZC0A 1MJ0A 5HXHA 3RRNB 2QZAA 3ONLC 3GN5A 4GZ5A 4XZ4A 4YTPA 2Y4UA 4AXHA 5L3CB 5FINA 3CHPA 4ILCA 2QVAA 3V5UA 3IHVA 4ANXA 1UN9A 4DUYT 1DCQA 2KINB 3B13A 3CMLA 1W0AA 2CXFA 4U74A 1B89A 4EIWA 4JD2G 3RRWA 2RD0A 2K9AA 1K8KG 2ZM6T 1Z3XA 2WQHA 3DSTA 4U95D 4WBNE 5ENRD 4LEUA 3FY4A 3I4GA 3SS1A 3R9AB 2L9BA 3AEAA 4ZS2A 1N54A 3ZLIA 4DMWA 3UM2A 4AKRB 2MOWA 3T8KA 3ZJ1A 3SY2A 5H7PA 2C0LA 1FVFA 1HNZT 2OOEA 4HI8A 3FTYA 4OYKA 4DBQA 1Z6TA 2RPAA 5CERB 4X5TA 2CFUA 4Z68A 3A5XA 2AVPA 4K0KT 5KNHD 3B57A 5FXVA 5ABFB 3PUJA 3UU8A 3V30A 5ANLA 3P4SA 2WSSV 4GKJT 4BFRA 2KXPC 3UM0A 3ZT7A 2XHEA 2XQ4A 1T98A 4UF0B 4UELA 3ZU7B 1DCEA 2QYUA 4K0RA 3TLWA 4JI7T 4GYYA 4NUVA 4X20E 4HN9A 3Q15A 3N9QA 1LF8A 4QXHB 3LS8A 1NP7A 4O1OA 4A3VA 4GK5E 5FIOA 3BG0B 3G06A 4I2WA 1AWCB 2XS1A 4JW1A 4UVCB 3CIRA 4XKCA 2H6IA 5KCMA 1WRDA 3K3OA 2XZEA 3UM3A 4U2YA 4JEHB 4AISA 2X9XA 5IUXA 3CVRA 3ZMUB 3E30A 2V7JA 2NTYA 3ZEFB 3S7BA 3UT8A 2WXNA 3J5QB 4HB5A 3OPCA 1JCSA 4GTOA 5CCLA 4WNFA 5HYAA 2VL8A 2IQCA 5BMVE 2WDQA 5F8PA 2UY1B 4BJMA 2DIWA 5AQJB 3SFZA 3V5SA 3J5PA 4FP7A 5LG3A 1KF6A 2NW9A 1WCRA 1H6PA 3KV5A 5FQ7A 1JNZA 1UUSA 4ACLA 5JJ6A 4ZI7E 3QAQA 4WNDA 3QWVA 4DI3A 4IE5A 5CFBA 1FIOA 2X0YA 4FJYA 2LSIA 3FUMA 3B7SA 4YLHA 1OCZE 3UKRG 1Q2ZA 3A8YC 3ZHEB 4UV8B 3SFEA 4MLKA 3C72A 1CHUA 1D8DA 3PDYA 4RVBA 4GMLA 3AE6A 4IGUA 4KX6A 2IDOB 5LA6E 4JI4T 4LF6T 4JHKA 3K3NA 1ZBPA 5J1GA 3SOLA 2CCQA 4W9RA 3QK6A 1KNPA 1O1SA 2LUHA 2BKGA 4IE6A 4EQFA 4AI6A 2HE0A 5EK4A 2ZIRA 1WFDA 3EIQC 2NW8A 2LO6A 3H37A 2V7IA 2KC7A 4H9NC 2VB6A 4DR6T 1US7B 4AY5A 1UJJA 5EYLA 2EQXA 2K24A 3SNXA 3TKLB 3P4WA 3T1HT 3LPZA 2J9QA 2LNIA 4F1PA 4XIFA 3AA0B 4QH4A 2L8KA 5LGTB 5JJTA 5HXRA 3CR3A 3V2XA 3CSTA 3V79K 3C98A 2WP9A 5FMNA 3TWVA 1HXIA 2WDVA 3UFEA 3I4RB 3P2BA 3PZ3A 2I9CA 3JXIA 3AECA 3NKZA 4TN7B 5JHBA 2P9SG 1OWMA 2X3MA 2CHZA 5LJNA 3TLSA 3UU3A 3TG4A 4BY6A 3AE2A 4DR7T 2OLTA 3KBUA 4E85A 3MZKB 3UUXA 4IE7A 1BD8A 2IF4A 3CQGB 4LF4T 3JAEA 1IBMT 5LYJE 4DV7T 1ZB1A 1AP7A 4K5AB 3OTNA 3RU0A 1JNRA 1YYHA 3KDSE 1ELWA 1NFIE 3LXUX 2JQQA 3IHRA 4J8SA 4WNKA 1BR4A 4M1PA 1U4QA 1N4PA 5KJKA 3L82A 4JEHA 4HORA 5ENPD 2UXCT 3AU4A 4UEMA 5LNKA 4JYAT 3AEFA 4HLEA 4ATGA 3ASFA 2YU2A 1V54E 2GW1A 3IBEA 3B7UX 2WQ7A 4B94A 2LLYA 1S70B 3RF1A 3GZ1A 2CXLA 2CWOA 4COFA 1QYMA 1H6OA 3CVPA 4EAHA 3RO2A 4GK0E 1YXRA 5LMUT 4XX5A 5FYMA 4Z90A 3UINC 4DR2T 3ESKA 3U66A 1Y64B 2OV9A 3SGHA 5ENNA 5ABGA 3T5XA 2R17C 3W9GA 4ZZBA 2LSJA 5JRCB 4CI2B 2LJLA 2GRPB 4TWDA 5JDLA 3RIBA 3MX3A 1M62A 2BKOA 3FU6A 3FUDA 3NZQA 3ML8A 4ABNA 5C2TA 2NW7A 4RLYA 2LM9A 2J49A 1U2VG 3D9IA 4FJOA 2LE8A 4HFGA 2YN6A 5AYWD 2X6FA 4APOA 1ZP0A 3AB3B 2YKSA 1XMQT 1CUNA 3CHQA 4ZHQE 4GA0A 5LHIB 1Y8MA 2XAGB 4J8FA 4B89A 2YOEA 5CB4E 3UU5A 1MNEA 4GYWA 2WXIA 3N2GE 3OKQA 3DPYA 2EHOC 4EECA 3FH5A 3AAAC 4EZJA 4YTNA 1XWMA 3CWZB 3PUWF 4NIQA 4UWKA 2XQ7A 5FL1A 1WG0A 4P1NA 4IDZA 2FJBA 3AS8A 4PS8A 2OA5A 2A72A 3APDA 2L0IA 3UKUG 4NQ0A 5LXTE 4F8HA 2GRMA 2BEDA 1N4SA 4CEMA 1HS6A 3ZMSB 1TNBA 3Q5XA 3CV0A 4DV0T 3ABLE 1NZNA 1A17A 4UXNB 4KVOA 4CGWA 4XE0A 3MZLB 2UUBT 2JIWA 3NOCD 3CGHA 2JEKA 4X1YE 3FZHB 3IEEA 2WB5A 3N5LA 4ANUA 1SZAA 4WNEA 4Z91A 3LJNA 1NI1A 3MACA 1HNXT 1N9AA 4U2ZA 3D9OA 3MA9A 1PAQA 3RH3A 2Q9QC 5KJNA 2KM4A 4GA1A 3FZFB 4LF5T 2VQET 4GZ6A 4LMLA 4DI4A 2HPJA 2LOPA 2I2OA 3SFDA 2PBIA 3ANWB 5FJYA 4AKIA 4DNDA 4IIJE 4JI1T 1D1CA 3JQ1A 1ZV4X 5IWAT 2M67A 5JDGA 5KJMA 2FJAA 4KZ0A 3RRCA 2ZM2A 2M6IA 1VOMA 4JUYA 2XQ8A 2DWKA 5CJ5A 4OAVB 2ONDA 3C51A 4URKA 2MYOA 3CKBA 3EUHA 1DC2A 1MX4A 3I1AA 2WZHA 3ZGQA 1BR0A 2LHNA 2LRKA 3PJAJ 2UY1A 3CK6A 2B76A 3ASOE 5JDMA 2E5VA 4EYUA 1WY6A 4GKKT 2ZLYA 3UPVA 3QKYA 1UJKA 4UWHA 4FC8A 4B3TT 3LVQE 4MS6A 2E9XC 5BUZA 4EOZB 3CHSA 5JHAA 5ITZF 4JI3T 2PG8A 2PM6A 4H7YA 5AQRB 2QFCA 4O6FA 5CRVA 4AQFA 3PUSA 1Z8UA 2WAUA 1E1HB 2V5CA 2WXKA 3QNKA 5JRCA 3B95A 4LERA 5JVDE 4ZXLA 1HZ4A 2Q9QA 3ASDA 3Q9UC 5EIDA 3HA4A 3VTYA 2R6GF 4I43B 5LB7B 3QK0A 3LEWA 5BV0A 3T5VA 2Y1LE 5FVKA 1OUVA 5A7DB 4ISSA 4BWRA 2ETAA 2GRNB 2W0GA 3MCXA 1NEKA 4C0MA 3HXDA 4L0RA 1QQEA 3GYZA 4MBQA 3D9MA 3EU5A 2JABA 2QYWA 1VRBA 2V4HC 3ONLA 3L09A 3JUIA 2VKOA 1YKEB 3DXMG 3PUZF 4I2ZA 2AXZA 2VK9A 3FUEA 3CX6B 4GYSA 5LHHB 2BG9E 2I59A 4Z8XA 4OX9T 5JA4D 4CQIA 2ZM0A 4DR3T 4GCNA 2CBIA 1IQUA 4YT0A 3MEKA 3LY8A 2V1DB 3FHNA 4ANWA 1FT1A 2CG2A 2BVLA 2WXJA 3I5PA 1MMDA 3ZPOA 2IO2C 4BETA 3DBSA 3BQIA 4CXYA 2LHRA 4QX8B 4CCAA 3ABKE 3CVUA 1DU2A 5EYPF 3RYHE 2NSZA 4G25A 2XSBA 4UVAB 2XS8A 5JMND 1OEDC 3Q5EA 3ANWA 3CKDA 1E90A 4FI5A 4G26A 3OJAA 4YDEA 3U4TA 4HGAA 1MQSA 1RW2A 4OYJA 4X65T 4JI5T 4WWPA 3NZUA 1DVPA 2NWBA 1H0AA 3UM1A 4L2LA 5LGNB 2BS4A 5A1LA 2VGXA 4TXPA 3Q5DA 1IHGA 2L3LA 2QGSA 4Q96A 4IDQA 1TJFA 3VR8A 3PVLA 2VURA 3JC6C 3MGBA 4GPMA 2YDSA 2V5FA 3QJZA 4EYYR 5AARA 3D3MA 3ETVA 5FQ8A 2A5EA 2AWIA 2WXGA 4H63H 1FVHA 2W61A 2KATA 4A63B 2KWHA 4I1AA 1JPLA 2Y8DA 3OAWA 3AEEA 3C4XA 4Y6WA 4A55A 4JEUB 1N52A 3LK42 4L1BA 4DR1T 4IDNA 1UG3A 3FUKA 2VSOE 5LJMA 4YDOA 1YD8G 3UTMA 2CMRA 4BX9A 3FTZA 3P1UA 1OT8A 2YEVC 4CDMA 2RP4A 3FTWA 2X6KA 4DBRA 2D2SA 2IHR1 1HTJF 4DO0A 5ENOD 3ZHEA 5DQVA 4U07A 3ASNE 4AQFC 1H7CA 5C8YE 4X64T 2VKHA 3FBZA 4PW8A 3FU0A 4CYMD 3DPDA 4NACA 4TXQA 4D10C 4FHKA 3AA7B 3PEVB 5BNWA 4KHPT 4O4HE 5LBMA 2ETBA 4HQDA 1MMGA 3LSVA 4AOFA 2QA7A 2XZDG 5FZSA 2FBWA 3HKCE 4P29A 2L6BA 2A5UA 3N9NA 1S64A 1SE7A 3ML9A 4CZ2D 4HRMB 2SPCA 4YJ2E 2VSXE 3E4BA 2ACZA 1OCOE 5JQGE 1D0YA 1KK7A 2W63A 2XM1A 3PU8A 4QWNB 4JI2T 2FEZA 4EZLA 5LBQB 3FUFA 2GRQB 3ENEA 1K1AA 5FXZA 3AE1A 1WDYA 4GZ3A 3FEXA 4GTMA 1OEDB 5L3FB 2KSRA 1H2UA 1N94A 4M7CA 5AQUB 4H7XA 4HEAA 3KEZA 3IEGA 2FULA 3HYMB 5HWXA 2Z6EA 2WY2A 3P4QA 4KMOA 2QC9A 3TWRA 4DRXE 3NB2A 2ZGGA 3UQ7A 5TAOA 4U8YD 4B6XA 3MXZA 1J1JA 4EBAG 3JXJA 3P4PA 3ZKRA 4HKAA 5CMWA 2XEEA 3PTRB 1UGOA 4J8YA 4KMCA 3VKGA 3I0QA 5AAOA 1SQMA 3VLDA 2IJGX 2CE7A 3EI0A 3S2AA 5E75A 1EZ3A 2XRZA 5C2YA 3PUGA 3KSQA 4J2CA 3UMVA 4BAYB 3QC9A 3ULEG 5C1DA 4AP2A 3UXGA 2J1DG 3G2WA 4TRQA 4HOQA 1ELRA 3L39A 2DZNA 3ZVVA 1MMAA 4CXXA 4JBWF 3N9PA 1HR0T 4GIWA 4HXIA 3QWWA 5CA0E 4I43A 1W9RA 4HWFA 2BDEA 4AIFA 4ILGA 1HO8A 2FO1E 4TUUA 1TNZA 2YU1A 3NZSA 5LHGB 3APFA 2WMNA 3RIUC 5FQ6A 5L2LA 3K9IA 3APCA 5FQ4A 4OVUA 1JUQA 1NWMX 4ILHB 1NAFA 1N0RA 3DWLG 3MKRA 2KMFA 2GRLA 4L2YA 3EHNA 2E5LT 3U78A 3WAJA 3D9KA 5J2TE 4M3OA 4QH1A 2LSUA 3UUMA 2UXBT 3KINB 1BI7B 5CHEE 2C0SA 4PNIA 2J08A 3SFYA 4NPPA 4C90A 3O9XA 2FO7A 4EEDA 3EHMA 3LY9A 2XENA 2X68A 1WR0A 4DV2T 4LUNU 4HRLA 2XQ6A 3N9LA 2CFZA 4NUUA 5ABEA 2Q9QD 4ME2A
chains in the Genus database with same CATH topology
1JWGA 3C50A 3ZPJA 5AJLA 3KS2A 2VSYA 2A4ZA 3Q4AB 4UF0A 3PH0C 2X67A 3GWHA 5ADXL 2RA1A 3U3WA 2Y3AA 2C5JA 2P58C 3O1IA 3N2OA 2IFUA 3LJ3A 5ANRA 4WUYA 2DCFA 3RKOA 4TUYE 2C5KT 3QDNA 1Y6IA 5KJLA 1L5JA 4UI9C 4EZ4A 1OWAA 3UQ3A 3FUJA 3MYVA 5JJ7A 3IV0A 4GCOA 4P09A 3QC1A 3FUIA 4UI9K 4GZDA 1YA0A 4U63A 3D9JA 1XNFA 4U8HA 2VKDA 4JC8A 2KNDA 3N71A 4ANVA 4H9OC 3QARA 5LP6E 3KBTA 3CVVA 4QHOA 2E9XA 4YNDA 2IU1A 4MLPA 4FLHA 4J8EA 4I1OB 2NP9A 3ZRHA 2LSKA 3CK8A 5LFAA 3RK6A 4OFZA 1E8YA 2GK9A 4I55E 5J08A 3IKOB 1LRZA 3QUJA 4V1Av 5G04C 4OVVA 5H6QB 4MHCA 1E8XA 4GU5A 3JCKC 3T8MA 2LSVA 4U0SA 1QSDA 5HAXA 1E7VA 3UT7A 5G05C 2ZM8A 2V0PA 2E8IA 2CXDA 4E7SA 3AS5A 4UQYA 4TV3A 3HHMA 2XQ0A 4DMVA 2YHCA 3MV2B 4YVQC 3ZMZB 3PUKA 2ES0A 3Q9DA 4KVMA 4KXKB 4HE8A 4G23A 1WAO1 4DPRA 3ZIMA 1OXZA 3R6NA 2CEAA 4I1MA 4BT9A 1OWNA 3L08A 1D0ZA 5HXCA 4ILUA 5JR9B 3C98B 2MBGA 3IBPA 5FY0A 4PK6A 2WMOA 4RG6A 1NA3A 5JDQA 3BEEA 4GZCA 1HFAA 2PJQA 1WM5A 4WAFA 4IE0A 4AV7A 4NURA 3OYZA 2N2NA 3ZYKA 3Q49B 2NXPA 1WR6A 4XBFB 3Q2MA 4BTAA 2UXNB 3BG1B 3CQCB 3UUXB 4L5GA 4YVOA 4F53A 3B7TA 2EHOD 3RC8A 3JC6D 3F57A 3B7RL 1OWLA 3AA6B 5G2NA 3CVWA 5J2UE 4MKTA 3NRYA 4XAXB 3J7Yq 2KCKA 2FF4A 3CVQA 2Q7FA 2DNXA 2MOZA 4N3AA 2VTBA 4Q69A 4GB9A 3ZFWA 4E6HA 4QFVA 2L0TB 4PUCA 2MHKA 1HG5A 3UUNA 4MFRA 3CHOA 5T3RA 2Y4TA 4WWNA 4DLQA 3L6AA 4QXBB 3U9WA 1E96B 3NRXA 2X9WA 3JYSA 3EDUA 2CLYB 4F6RC 4EB6E 5G05J 2XTLA 4GYRA 4UWGA 3UTKA 3KAEA 2K5BB 3H3AA 2PL2A 2BTDA 4J8DA 3D9LA 3KV4A 1HF8A 4ASKA 4QXCB 4Y6CA 4PJJA 3VLFA 3HIZA 2CWYA 1BR2A 2G0UA 2PZIA 2XUEA 4KP3C 3TL5A 4LCTA 4A56A 2WPVA 4IHJE 4O4LE 3SD5A 4CGVA 3Q5MA 1UCUA 4TV9E 1MMNA 2MTQA 2X9HA 2YINA 1LVFA 2YHEA 4DJAA 5FWQA 4PJNA 3RYFE 5BPPA 3O48A 3QWPA 2N1GA 1S0PA 2V4LA 4NRHB 3CK7A 4CRWA 3SRZA 3FUNA 4IRUA 3MK7C 3HR0A 2H7OA 3CSFA 2OVBA 3MKQB 1E7UA 3ZCIA 2N9DA 2DBAA 1OWPA 4Q94A 4N39A 2IAKA 2XGSA 1E8WA 3DJBA 3DTOA 3IHYA 1H19A 3O1JA 1BPOA 2GGFA 3FP3A 3LBXB 3JQ0A 4N2SA 1UN8A 2WXLA 2PQRA 2NOXA 4O2BE 2KZ7B 2DCPA 3RO3A 3SBTB 1IZNB 2DHRA 5E0OA 3TXMA 3G2VA 2WXMA 5L3EB 1TEZA 3ASGA 3N9MA 3WI3A 1HH8A 2IOLA 4KBMB 4RSYA 1H6KA 2YNQA 4IYPA 4I6JA 3ULQA 1IJ5A 2VQ2A 1KNZA 3N2KE 5BV1A 3N9OA 4O4IE 5JDNA 3HVEA 1U3DA 4ADZA 4AQGA 2XAQB 3C64A 4PJMA 3CVNA 4G24A 4JA7A 4PS3A 4KYOB 5D0OD 5CCMA 3KV6A 5ARFA 4A1GA 3HKEE 3HI2A 4AY6A 4JPSA 3CHMA 4FU3A 1YKHB 5JR9A 1WLXA 2NC9A 4ZI3C 3LCAA 2P9BA 3ASHA 1OWOA 3LBXA 2LOSA 4WW0A 4FJZA 4ZS3A 5EZYE 2W62A 5EX3A 3VU7H 2HH7A 4HOSA 1HX8A 4PS7A 2XGMA 3BQKA 2B1EA 3BK9A 3RYIE 1D1BA 4QX7B 3FDHA 5LCYA 3DP7A 2C0MA 2V7MA 5FY1A 5D0QD 4CT4A 1SA0E 2XQYA 3AAIA 4BTBA 2J4BA 2ILRA 2X38A 1HS7A 3FWVA 4R7LA 4JLEA 2J09A 4DLOA 2WXPA 2XPYA 2R59A 5HWYA 3P7IA 3KD7A 4YFSA 3ZJ2A 4I6GA 3KV9A 3U64A 3TAXA 4TX5A 2E0IA 1KT1A 3VHLA 2IOSA 4UQZA 2W00A 4IULA 5FZQA 2AW6A 1JWFA 4B8CB 3PU3A 4AJWA 2ZU6B 1X79A 3FULA 3ZYMA 4FULA 2UXXB 4XKBA 3CKCA 2C5IT 2JMKA 2HR2A 1B7TA 2BZBA 3EVYA 5KX5E 5FT9A 2BVMA 4JL0A 2HO1A 2V7KA 2KZTA 2CHWA 4G1TA 2XAJB 3SZ7A 5L3BB 4N5CA 4H9SE 3RYCE 3PE0A 1U3CA 2A2FX 4EZHA 4X1IE 3ZMTB 5JH7E 1IQRA 2LEHA 1ZHCA 2I1JA 3G2UA 2ODUA 3GN5B 1IYGA 4X1KE 1FMVA 4A1SA 5G04J 3AVRA 4UIGA 2XEVA 3NF1A 5AENA 4TZ4C 4BT8A 5LOVE 3LYAA 3CVYA 4GA2A 1QZ2A 2PM7A 3EDTB 2IC9A 3R7RA 2KXPB 3PDNA 3CHRA 4XI0A 3E0ZA 4P0BA 1S94A 2X6JA 5DJQC 4OHFA 2J4DA 2LSYA 2V7LA 1AJ3A 4U0ZA 3CX8B 3SF4A 3AAEB 3U3IA 3ZXSA 2H3RA 4UWLA 3P8CD 3O4ZA 2XPZA 3SI5A 3GA8A 4K0UA 4OYSA 2CA5A 1MIWA 4U0UA 5ETWA 3URZA 5LCWC 5DBKA 5F3JA 3GW4A 5T4YA 3VLEA 2MRIA 3CLJA 1ZEEA 3CIAA 3PREA 1KLXA 4UV9B 4J6IA 4GYOA 4CZZB 3ESLA 3ZEFA 1EPUA 5FP3A 3O1HA 5DABA 2VGXB 1FMWA 4GMJA 1MNDA 1Z0PA 5CMYA 5CA1E 2IONA 2XAFB 3HL6A 2I1KA 1INZA 5FTPA 4H63V 3CEQA 4YHJA 4PH4B 3HVEB 2RG8A 2J07A 4HOTA 1MIYA 5FXXA 3AVSA 3FH8A 2WXRA 1MHQA 3W15B 3FB2A 4JEUA 3PE4A 2WXFA 3FUHA 4CDNA 1D1AA 3ETUA 3KVAA 2LAIA 2ODVA 5JR9C 5JREA 3FU3A 3UX4A 3SHFA 5A6CA 3SWHA 3ZN3A 4WBOA 5FNVE 2M63A 3CK9A 4DVDA 1D0XA 4KBQA 4JHJA 4BX8A 2A3DA 4B8AA 3OXFA 5AJDA 2CHXA 1S35A 2VKJA 2CG3A 2AXUA 3FBLA 2EHOB 3MA5A 4LRZA 1DNPA 4U04A 3ZYQA 2D0TA 4H9QC 3MJXA 2IC6A 2OV8A 3CVXA 1PY1A 2PFVA 1UX4A 2X51A 4P0AA 5LP0A 3FTXA 3E08A 3RRUA 4UQXA 4AKHA 3I3NA 3BQLA 3L22A 3L54A 3PNTB 4L23A 4EXTA 4FADA 3S7FA 4EBAA 1ELKA 2FI7A 3PUQA 2KCVA 2CLYC 3HKDE 4KZCA 2JPFA 1GW6A 3PZDA 3S7DA 3FXEB 1EYHA 5HQ8A 4BJNA 4APFA 2NTXA 1PC2A 4EPZA 3KFWX 3PEUB 3TJPA 3VTXA 5T8IA 4UI9J 5HI7A 2E9XB 3CX7B 5DQWA 5H6RB 3K3QC 4O8SA 5EKQD 4CXWA 3VKHA 3GMIA 4F3VA 1G8XA 1QNFA 2WXQA 1V9DA 2WXHA 4C0EA 5LG4A 4G63A 1NA0A 3QB2A 2UWJG 2L6JA 2ZMAA 3J9X1 2MYSA 4C91A 4HTEA 4PK4A 4I17A 1X5BA 3ONKA 1HG2A 4PFOA 5KMGP 1WYCA 2DWGA 2QY7A 3GZSA 4H9PC 4L7TA 5FY7A 4RG9A 3UT4A 3UULA 3ZC1A 2KT9A 2VWAA 2R5SA 2AXVA 3GZ2A 2X6IA 2KCLA 5E76A 2C2LA 2LAHA 2L9QA 3F2EA 5BW8C 3M65A 2PQNA 1G73A 2Q9QB 2XPIA 2EHOA 4O4JE 3D9PA 3RJVA 4AM9A 3L16A 4E7ZA 4JHRA 5EK3A 3AU5A 2VSNA 4EZKA 2X6HA 5L3GB 2V26A 4I4TE 3LFMA 4J0UA 2X9YA 2LT3A 4FLBA 2BUGA 4OK0A 2V8SE 5LCWJ 3AS4A 3FU5A 3LDZA 2HM8A 3ONXA 1HCIA 2JRKA 1MIVA 4AEZC 2E2EA 4AKGA 3L13A 2K48A 2VASA 4ILIA 1P5QA 3RC3A 3R84B 4IN3B 3Q47B 2KWIB 4B0ZA 3HDXA 3TGOA 2D0UA 3LJCA 3FTVA 3WXXA 2XRYA 4PFPA 4UWFA 5A23A 4ERRA 2VJ8A 4DK5A 2Y48B 4N78D 5FZRA 3RX6A 4JVSA 5AIJA 4GAAA 5BT1A 5HXEA 4JA9A 2HYZA 2CM0A 1BR1A 3ZMVB 2WVIA 4F1SA 2YQ8A 4FHJA 3RPUA 3D9NA 2H7VC 4AXPA 4G11A 3S4UA 2D5UA 3R7QA 4ZI3D 2XGOA 4GOUA 4KUMB 2LSGA 3LKUA 3F31A 1IJ6A 3LVRE 4XI9A 3MV3B 4PK5A 4CT0A 3PS6A 3MKDA 3C4WA 3PRZA 4O2AE 2XAHB 3ZN0B 4N3BA 3EJNA 3OBVE 3AAAB 4H9RC 3C4ZA 4WNGA 4ISTA 4HS2A 4N3CA 4C9BB 4JXTA 4CI3B 1WYBA 4L9IA 2XCCA 3NQPA 2X66A 2X0LB 5AFUL 4ZI2D 3Q5WA 4TV8E 4GPKA 5HXSA 2XHEB 5LOZA 3MKQA 3ZCJA 2JJ9A 4ANJA 2XASB 3OYXA 5J90A 3UT5E 2WM9A 5JDHA 3E22E 3NZPA 2DI4A 3FHEA 2E9XD 4A3TA 1FEWA 1EF1C 4HFVA 4PJLA 3HKBE 4WWOA 1H2VC 3RRMB 4ACKA 5ARGA 1VDYA 2VTBB 5EDSA 5M4YA 3FFLA 5G55A 2VGYA 3AA1B 4KT6B 2DLRA 4JZYA 1QUUA 4I6EA 2ACXA 2JLBA 4N2QA 3ZYLA 5EK2A 3FEYA 1O3XA 4I9CA 1ZU2A 3S7JA 4AKLA 4K03A 4CDRA 5FXWA 3QOUA 3I0OA 4MRUA 4CI1B 3I9YA 5KDMC 5DIZA 1E8ZA 4FA6A 1U5PA 3CVLA 1HU3A 3PE3A 2YK0A 1LKXA 3LK3B 3LY7A 3EIJA 5IHYA 2WXOA 3FXDB 2OVFA 3L3PA 2HPLA 1W3BA 3D0TA 2XCBA 3OXGA 3FTUA 5EX0A 1ZKEA 3CPZA 1YW0A 3K8PC 2WQ6A 3G2TA 3FH7A 1UW4B 3CQXC 1IAPA 3LG7A 3TXNA 1HE8A 2FBNA 4MALA 4G2VA 3KVBA 3PURA 5LGUB 4V3IA 3IF8B 4PAGA 3ZN1B 2IW5B 3OXLA 3G2SA 1SZ9A 1TJCA 5M72A 4YJ3E 1LVKA 2VYIA 4AVXA 1SHZC 4HVBA 3L17A 1XGWA 2KLQA 2WBLA 4IE4A 4BSXA 3NBXX 4G2AA 4I50E 5JDFA 5LX8A 2WB2A 1FCHA 2JMHA 3SBSA 1UX5A 4U72A 4ZI2C 1H2TC 5IYZE 2WWUA 4HOUA 3I9WA 4XZCA 1Z3YA 3MJWA 4I9EA 3TG5A 5GONE 3FTSA 3T8OA 3ZW3A 4BA9A 5L3DB 4QKNA 4UVBB 1KT0A 3PUAA 3LK2B 2BF0X 4F7AA 2KZTB 3EDVA 3PNLB 4PDXA 3WAKA 2Y6XA 1EDUA 3O4XE 2I6HA 3RKVA 4ZOLE 3ZC0A 5HXHA 3RRNB 3GN5A 4GZ5A 4XZ4A 2Y4UA 4AXHA 5L3CB 3CHPA 3V5UA 3IHVA 4ANXA 1UN9A 2KINB 3B13A 3CMLA 4U74A 2CXFA 1B89A 4EIWA 3RRWA 2RD0A 2K9AA 1Z3XA 2WQHA 4WBNE 4LEUA 3FY4A 3I4GA 3SS1A 3R9AB 2L9BA 1N54A 4ZS2A 3ZLIA 4DMWA 4AKRB 2MOWA 3ZJ1A 2C0LA 1FVFA 2OOEA 3FTYA 4OYKA 4DBQA 1Z6TA 2CFUA 3A5XA 2AVPA 3B57A 5FXVA 3PUJA 5ANLA 2WSSV 4BFRA 2XHEA 4UF0B 1T98A 4UELA 4K0RA 4GYYA 4NUVA 4X20E 4HN9A 3Q15A 3N9QA 1LF8A 4QXHB 3LS8A 1NP7A 4A3VA 4GK5E 3BG0B 4I2WA 4JW1A 4UVCB 4XKCA 5KCMA 1WRDA 3K3OA 4JEHB 2X9XA 3CVRA 3ZMUB 2V7JA 2NTYA 3ZEFB 3S7BA 3UT8A 2WXNA 5CCLA 4WNFA 5HYAA 2VL8A 2IQCA 5BMVE 5F8PA 2UY1B 4BJMA 2DIWA 3SFZA 3V5SA 4FP7A 2NW9A 3KV5A 5FQ7A 4ACLA 5JJ6A 4ZI7E 3QAQA 4WNDA 3QWVA 4DI3A 4IE5A 1FIOA 4FJYA 2LSIA 3FUMA 3B7SA 4YLHA 3ZHEB 4UV8B 4MLKA 3PDYA 4RVBA 4GMLA 4IGUA 5LA6E 4JHKA 3K3NA 1ZBPA 5J1GA 3SOLA 2CCQA 4W9RA 3QK6A 4IE6A 4EQFA 4AI6A 5EK4A 3EIQC 2NW8A 2LO6A 3H37A 2V7IA 2KC7A 4H9NC 2VB6A 1US7B 4AY5A 1UJJA 2EQXA 2K24A 3SNXA 3TKLB 3LPZA 2J9QA 2LNIA 4XIFA 3AA0B 2L8KA 5LGTB 5JJTA 5HXRA 3CR3A 3CSTA 3C98A 5FMNA 1HXIA 3UFEA 3I4RB 3P2BA 2I9CA 4TN7B 5JHBA 1OWMA 2X3MA 2CHZA 5LJNA 3TG4A 4BY6A 3KBUA 4E85A 3MZKB 3UUXA 4IE7A 2IF4A 3CQGB 5LYJE 3OTNA 3RU0A 3KDSE 1ELWA 3LXUX 2JQQA 3IHRA 4J8SA 4WNKA 1BR4A 4M1PA 1U4QA 5KJKA 4JEHA 4HORA 3AU4A 4UEMA 5LNKA 4HLEA 4ATGA 3ASFA 2YU2A 2GW1A 3IBEA 3B7UX 2WQ7A 4B94A 3GZ1A 2CXLA 2CWOA 3CVPA 4EAHA 3RO2A 4GK0E 4XX5A 5FYMA 3ESKA 3U66A 1Y64B 3SGHA 5ENNA 3T5XA 2R17C 2LSJA 5JRCB 4CI2B 2LJLA 5JDLA 3RIBA 3MX3A 3FU6A 3FUDA 3NZQA 3ML8A 4ABNA 2NW7A 2LM9A 2J49A 3D9IA 4FJOA 2LE8A 4HFGA 5AYWD 2X6FA 4APOA 3AB3B 1CUNA 3CHQA 4ZHQE 4GA0A 5LHIB 1Y8MA 2XAGB 4J8FA 4B89A 5CB4E 1MNEA 4GYWA 2WXIA 3N2GE 3OKQA 2EHOC 4EECA 3FH5A 4EZJA 3CWZB 4UWKA 4IDZA 3AS8A 4PS8A 2OA5A 2A72A 3APDA 2L0IA 4NQ0A 5LXTE 2GRMA 4CEMA 1HS6A 3ZMSB 3Q5XA 3CV0A 1NZNA 1A17A 4UXNB 4KVOA 4CGWA 4XE0A 3MZLB 3CGHA 2JEKA 4X1YE 3IEEA 3N5LA 4ANUA 1SZAA 4WNEA 3MACA 3D9OA 3MA9A 1PAQA 3RH3A 2Q9QC 5KJNA 2KM4A 4GA1A 4GZ6A 4DI4A 2HPJA 2LOPA 2I2OA 2PBIA 3ANWB 5FJYA 4AKIA 4DNDA 4IIJE 1D1CA 3JQ1A 1ZV4X 2M67A 5JDGA 5KJMA 4KZ0A 3RRCA 2ZM2A 1VOMA 4JUYA 2DWKA 2ONDA 3C51A 4URKA 3CKBA 3EUHA 3I1AA 3ZGQA 1BR0A 2LHNA 2UY1A 5JDMA 4EYUA 1WY6A 2ZLYA 3UPVA 3QKYA 1UJKA 4UWHA 4FC8A 4MS6A 3LVQE 2E9XC 5BUZA 4EOZB 3CHSA 5JHAA 2PG8A 2PM6A 4H7YA 2QFCA 4O6FA 4AQFA 3PUSA 2WAUA 1E1HB 2WXKA 3QNKA 5JRCA 4LERA 5JVDE 1HZ4A 2Q9QA 3ASDA 3VTYA 3HA4A 4I43B 3QK0A 3LEWA 5BV0A 3T5VA 1OUVA 5A7DB 4ISSA 4BWRA 2W0GA 3MCXA 4C0MA 4L0RA 1QQEA 3GYZA 4MBQA 3D9MA 1VRBA 3ONLA 3L09A 3JUIA 2VKOA 1YKEB 4I2ZA 2AXZA 2VK9A 3FUEA 3CX6B 4GYSA 5LHHB 2I59A 4Z8XA 4CQIA 2ZM0A 4GCNA 1IQUA 3MEKA 3LY8A 2V1DB 3FHNA 4ANWA 2CG2A 2BVLA 2WXJA 3I5PA 1MMDA 3ZPOA 3DBSA 3BQIA 4CXYA 2LHRA 4QX8B 4CCAA 3CVUA 3RYHE 2NSZA 4G25A 4UVAB 3ANWA 3CKDA 1E90A 4FI5A 4G26A 3OJAA 3U4TA 4HGAA 1MQSA 4OYJA 4WWPA 3NZUA 1DVPA 2NWBA 1H0AA 4L2LA 5LGNB 5A1LA 2VGXA 1IHGA 2L3LA 2QGSA 4Q96A 1TJFA 3PVLA 3JC6C 3MGBA 2V5FA 3QJZA 4EYYR 3D3MA 3ETVA 5FQ8A 2AWIA 2WXGA 4H63H 1FVHA 2W61A 2KATA 2KWHA 4I1AA 1JPLA 2Y8DA 3OAWA 3C4XA 4Y6WA 4A55A 4JEUB 1N52A 3LK42 4L1BA 1UG3A 3FUKA 2VSOE 5LJMA 1YD8G 2CMRA 4BX9A 3FTZA 3P1UA 2YEVC 4CDMA 2RP4A 3FTWA 2X6KA 4DBRA 2D2SA 1HTJF 4DO0A 3ZHEA 5DQVA 4U07A 4AQFC 1H7CA 5C8YE 2VKHA 3FBZA 4PW8A 3FU0A 3DPDA 4NACA 4D10C 4FHKA 3AA7B 3PEVB 5BNWA 4O4HE 5LBMA 1MMGA 4AOFA 2QA7A 5FZSA 3HKCE 4P29A 2A5UA 3N9NA 3ML9A 2SPCA 4YJ2E 2VSXE 3E4BA 1D0YA 3PU8A 1KK7A 2W63A 4QWNB 5JQGE 4EZLA 2FEZA 5LBQB 3FUFA 3ENEA 5FXZA 4GZ3A 3FEXA 5L3FB 1H2UA 4H7XA 4HEAA 3KEZA 3IEGA 2FULA 3HYMB 5HWXA 2Z6EA 4KMOA 5TAOA 4B6XA 3MXZA 4EBAG 4HKAA 5CMWA 3PTRB 4KMCA 3VKGA 3I0QA 1SQMA 3VLDA 2IJGX 2CE7A 3S2AA 5E75A 1EZ3A 2XRZA 5C2YA 3PUGA 4J2CA 3UMVA 4BAYB 3QC9A 5C1DA 4AP2A 2J1DG 3G2WA 4TRQA 4HOQA 1ELRA 3ZVVA 1MMAA 4CXXA 3N9PA 4GIWA 4HXIA 3QWWA 5CA0E 4I43A 2BDEA 4AIFA 4ILGA 1HO8A 4TUUA 2YU1A 3NZSA 5LHGB 3APFA 2WMNA 5FQ6A 5L2LA 3K9IA 3APCA 5FQ4A 4OVUA 1JUQA 1NWMX 4ILHB 1NAFA 3MKRA 2KMFA 2GRLA 4L2YA 3EHNA 3U78A 3WAJA 3D9KA 5J2TE 4M3OA 2LSUA 3UUMA 3KINB 5CHEE 2C0SA 4PNIA 2J08A 4C90A 3O9XA 2FO7A 3EHMA 3LY9A 2X68A 4LUNU 3N9LA 2CFZA 4NUUA 2Q9QD 4ME2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JUQ A;  1JWG A;  4GZC A;  3CLJ A;  1HFA A;  4NAC A;  4Q96 A;  3ZYL A;  3ZYM A;  1PY1 A;  3G2S A;  3LDZ A;  1SZ9 A;  1INZ A;  3G2T A;  3D9K A;  5LOZ A;  5LP0 A;  4GZD A;  3RRU A;  3D9I A;  1EYH A;  5CMW A;  1VDY A;  1SZA A;  2MOW A;  4AVX A;  3D9J A;  2LO6 A;  3G2U A;  3D9N A;  4HFG A;  1UJK A;  1XGW A;  3ZYK A;  2BF0 X;  3D9O A;  2L0I A;  1JWF A;  1UJJ A;  1X5B A;  5J08 A;  3ONK A;  1JPL A;  1HG2 A;  1MHQ A;  2L0T B;  4FLB A;  3D9L A;  1DVP A;  4JXT A;  4Q94 A;  1HX8 A;  2DCP A;  1ELK A;  2DIW A;  3D9M A;  1HF8 A;  1LF8 A;  2KM4 A;  1HG5 A;  1H0A A;  1EDU A;  3D9P A;  3ZYQ A;  2V8S E;  4FU3 A;  3ONL A;  3G2W A;  5CMY A;  3G2V A;  2QY7 A; 
#chains in the Genus database with same CATH topology
 1JWG A;  3C50 A;  3ZPJ A;  2WQY A;  3KS2 A;  1O5M A;  3VRA A;  5AJL A;  1N34 T;  2VSY A;  2A4Z A;  3Q4A B;  4UF0 A;  3PH0 C;  2X67 A;  3GWH A;  5ADX L;  3TWU A;  2RA1 A;  3U3W A;  2CPT A;  2Y3A A;  2C5J A;  2P58 C;  5F5W A;  3O1I A;  1SVX A;  3N2O A;  5AQ9 A;  2IFU A;  3LJ3 A;  5ANR A;  4WUY A;  3ZSS A;  2DCF A;  4GTR A;  3RKO A;  4TUY E;  2C5K T;  3HRA A;  3QDN A;  1Y6I A;  5KJL A;  1L5J A;  4UI9 C;  4EZ4 A;  1OWA A;  3UQ3 A;  1TNO A;  3FUJ A;  3MYV A;  5JJ7 A;  1X9B A;  4YSX A;  3IV0 A;  4GCO A;  4Q25 A;  4B93 B;  5FKY A;  4P09 A;  3QC1 A;  3WG7 E;  3FUI A;  4UI9 K;  4GZD A;  1YA0 A;  4U63 A;  3D9J A;  1XNF A;  4U8H A;  2VKD A;  1XNQ T;  4JC8 A;  2KND A;  1D9S A;  3L9T A;  3N71 A;  4H9O C;  4ANV A;  1V55 E;  3QAR A;  5AQP B;  4EEB A;  5LP6 E;  3KBT A;  3CVV A;  4QHO A;  4IRE A;  1NL4 A;  3PZ2 A;  2E9X A;  4YND A;  2IU1 A;  3SFX A;  2FJD A;  3HXB A;  4MLP A;  4FLH A;  3IA3 A;  4J8E A;  2V6X A;  3ONJ A;  2NP9 A;  4I1O B;  3ZRH A;  1HNW T;  3DSX A;  2LSK A;  4HFH A;  1SUM B;  3CK8 A;  5LFA A;  4HI9 A;  3TWW A;  3Q7F A;  3RK6 A;  4OFZ A;  1J5E T;  1E8Y A;  2GK9 A;  4I55 E;  5J08 A;  5ENQ D;  3IKO B;  4C48 B;  1LRZ A;  3QUJ A;  5CEC B;  5HEO A;  4V1A v;  2P9K G;  5G04 C;  4OVV A;  2B0O E;  5H6Q B;  4MHC A;  1E8X A;  5AQQ B;  4GU5 A;  3JCK C;  3TWX A;  3T8M A;  2LSV A;  4U0S A;  1QSD A;  5HAX A;  4WZX A;  1E7V A;  4GMR A;  3UT7 A;  5G05 C;  2ZM8 A;  2V0P A;  2E8I A;  2CXD A;  4E7S A;  2XQA A;  3AS5 A;  3PUY F;  2V6Y B;  4UQY A;  4MBG A;  4TV3 A;  3DSU A;  3HHM A;  3EHZ A;  2XQ0 A;  4U33 A;  4DMV A;  2YHC A;  5BR8 T;  3MV2 B;  3HXF A;  3ZMZ B;  4YVQ C;  3PUK A;  2ES0 A;  3Q9D A;  4KVM A;  4KXK B;  4HE8 A;  4DR4 T;  4G23 A;  3BUA A;  1WAO 1;  3RAU A;  5AQF B;  2XY8 B;  3LDQ B;  5B3S E;  4DPR A;  4HWH A;  3ZIM A;  1OXZ A;  3R6N A;  3RIF A;  2CEA A;  4I1M A;  4BT9 A;  5ABH A;  2OEW A;  2W67 A;  2XPK A;  1OWN A;  2CHN A;  3L08 A;  1D0Z A;  5HXC A;  4ILU A;  5JR9 B;  3QOF A;  3C98 B;  4X8Q A;  3AE4 A;  2MBG A;  3IBP A;  5FY0 A;  4PK6 A;  2WMO A;  4GTV A;  4RG6 A;  1NA3 A;  2PTF A;  5JDQ A;  3BEE A;  4GZC A;  1HFA A;  2PJQ A;  1WM5 A;  2GRR B;  4WAF A;  4IE0 A;  2IIU A;  4AV7 A;  3HXC A;  2VGE A;  4NUR A;  3OYZ A;  4EHM A;  5CBN A;  3K1S A;  2N2N A;  3ZYK A;  3Q49 B;  2NXP A;  1WR6 A;  4XBF B;  3Q2M A;  4BTA A;  2UXN B;  4X66 T;  3BG1 B;  3CQC B;  3UUX B;  4L5G A;  4YVO A;  3PUX F;  3KSL A;  4F53 A;  3B7T A;  2EHO D;  4ZEY A;  3RC8 A;  4JV5 T;  3Q9N C;  3JC6 D;  3F57 A;  3B7R L;  1OWL A;  3L8R A;  3AA6 B;  5IY5 E;  4OAU C;  3DXK G;  5G2N A;  2BKK B;  3F6Q A;  3CVW A;  1MX2 A;  5J2U E;  4MKT A;  3NRY A;  4XAX B;  2DVW A;  3EAB A;  3J7Y q;  2KCK A;  2FF4 A;  3CVQ A;  4LF8 T;  2Q7F A;  3QB5 K;  2DNX A;  5HS0 A;  2MOZ A;  4LMK A;  4N3A A;  4J7W A;  2VTB A;  4Q69 A;  1OED E;  4GB9 A;  3ZFW A;  4KI0 F;  4E6H A;  2MAW A;  2L0T B;  4JB8 P;  4QFV A;  3OVU A;  4PUC A;  1TNU A;  2MHK A;  3UUN A;  1HG5 A;  4MFR A;  1D8E A;  3CHO A;  5D2M C;  5T3R A;  2Y4T A;  5FVL A;  5ENS D;  4WWN A;  4DLQ A;  3L6A A;  2DYR E;  4QXB B;  3U9W A;  1E96 B;  2H6G A;  3NRX A;  1W09 A;  2X9W A;  4LG6 A;  3JYS A;  3EDU A;  2CLY B;  4F6R C;  4EB6 E;  4LNG A;  2XTL A;  5G05 J;  4GYR A;  4UWG A;  3UTK A;  3KAE A;  2K5B B;  3H3A A;  3B7B A;  5HCM A;  2PL2 A;  2BTD A;  4J8D A;  3D9L A;  4HFI A;  2FJE A;  3KV4 A;  1HF8 A;  1N32 T;  4ASK A;  4QXC B;  4Y6C A;  4DV3 T;  4PJJ A;  3VLF A;  3BU8 A;  3HIZ A;  1KZP A;  2CWY A;  1BR2 A;  2I0M A;  2G0U A;  2XJ7 A;  2PZI A;  5EIL A;  4LFA T;  2XUE A;  4KP3 C;  3TL5 A;  4HFB A;  4LCT A;  4A56 A;  2WPV A;  4NIK A;  4IHJ E;  1KZO A;  4O4L E;  4GTQ A;  1FJG T;  1LD7 A;  4U7Y A;  3AG1 E;  2AXD S;  4AQY T;  1S63 A;  2DZO A;  3SD5 A;  4CGV A;  3Q5M A;  1UCU A;  4TV9 E;  1MMN A;  2MTQ A;  2X9H A;  1TNY A;  2YIN A;  5CBO A;  1LVF A;  2YHE A;  4DJA A;  5FWQ A;  2WU5 A;  4PJN A;  3RYF E;  2W4X A;  5BPP A;  3O48 A;  3HG0 D;  3QWP A;  5HEU A;  5KWD A;  2N1G A;  4U31 A;  1S0P A;  2V4L A;  4NRH B;  3CK7 A;  4CRW A;  3SRZ A;  3AE5 A;  3FUN A;  4IRU A;  3MK7 C;  3HR0 A;  2H7O A;  3CSF A;  2OVB A;  3MKQ B;  4ATZ D;  1E7U A;  3ZCI A;  2N9D A;  2DBA A;  1OWP A;  4KHZ F;  4Q94 A;  5AQG B;  4U7I A;  4N39 A;  2IAK A;  2XGS A;  1E8W A;  3DJB A;  3E34 A;  3DTO A;  3IHY A;  1H19 A;  3O1J A;  5CEA A;  1YMP A;  3QNU A;  1BPO A;  2GGF A;  3FP3 A;  3NAW A;  3V2O A;  3LBX B;  3JQ0 A;  4N2S A;  1UN8 A;  4DUZ T;  4GTS A;  2WXL A;  2H6F A;  3HXE A;  2PQR A;  2NOX A;  4O2B E;  2KZ7 B;  3RQW A;  2DCP A;  3RO3 A;  2IEJ A;  3SBT B;  1IZN B;  5L47 A;  4WYV A;  2DHR A;  5E0O A;  3RSE G;  3G2V A;  4I0U A;  2WXM A;  5L3E B;  3TXM A;  1TEZ A;  1BU9 A;  3ASG A;  3N9M A;  3WI3 A;  1HH8 A;  2IOL A;  4KBM B;  4DV6 T;  4RSY A;  1H6K A;  1JCR A;  2YNQ A;  4IYP A;  4I6J A;  4O1P A;  4DV1 T;  3ULQ A;  1K1B A;  4HFE A;  1IJ5 A;  2VQ2 A;  1IKN D;  4QQI A;  1KNZ A;  3N2K E;  1J5W A;  5AQN B;  5HRY A;  5BV1 A;  3N9O A;  2Y69 E;  5B1B E;  4O4I E;  5JDN A;  4YTM A;  1U3D A;  3HVE A;  3C3R A;  4ADZ A;  1IXV A;  4AQG A;  2XAQ B;  3C64 A;  1SA5 A;  4PJM A;  3CVN A;  4G24 A;  3EHR A;  4JA7 A;  4PS3 A;  4TWF A;  4KYO B;  5CRU A;  2V5D A;  5D0O D;  5CCM A;  2WDR A;  3KV6 A;  4LF7 T;  5ARF A;  4A1G A;  3HKE E;  3HI2 A;  1KPS B;  4AY6 A;  4JPS A;  3C3Q A;  3CHM A;  4FU3 A;  1YKH B;  5JR9 A;  1MYO A;  1WLX A;  2NC9 A;  4ZI3 C;  3ZUV B;  4AIU A;  3LCA A;  2P9B A;  2HN2 A;  3ASH A;  4GTT A;  1OWO A;  2EIK E;  1BI8 B;  3LBX A;  2LOS A;  4WW0 A;  4FJZ A;  2FUP A;  3ULY A;  4ZS3 A;  5EZY E;  1N0Q A;  3UI2 A;  2W62 A;  2J8S D;  5CED B;  5EX3 A;  4XEI G;  3VU7 H;  2HH7 A;  4ILB A;  4HOS A;  1HX8 A;  2P9N G;  4IL9 A;  1SA4 A;  4PS7 A;  2XGM A;  3BQK A;  2B1E A;  3BK9 A;  3RYI E;  1D1B A;  4QX7 B;  3FDH A;  5LCY A;  2K3W A;  3DP7 A;  2C0M A;  3PZ4 A;  2V7M A;  1IBK T;  2JQH A;  5FY1 A;  4O60 A;  5D0Q D;  1TN8 A;  4CT4 A;  1SA0 E;  2XQY A;  3AAI A;  4BTB A;  2J4B A;  2JQK A;  3P50 A;  2V8S V;  2ILR A;  5AQH B;  2X38 A;  1HS7 A;  3FWV A;  4HFD A;  1LTX A;  4R7L A;  3TWT A;  2JQ9 A;  4JLE A;  2J09 A;  4DLO A;  2WXP A;  2XPY A;  2R59 A;  5HWY A;  3P7I A;  3KD7 A;  4YFS A;  3ZJ2 A;  3FZL B;  2W66 A;  4I6G A;  4TNV A;  3KV9 A;  3U64 A;  4JI0 T;  1IHB A;  3TAX A;  2WZI A;  4TX5 A;  1OY3 D;  2E0I A;  1KT1 A;  3VHL A;  2IOS A;  4UQZ A;  2W00 A;  4IUL A;  5FZQ A;  2AW6 A;  1JWF A;  4B8C B;  5D66 A;  3DSS A;  4HWD A;  3ABV A;  3T9K A;  3PU3 A;  3Q75 A;  3C5R A;  1A5E A;  3E32 A;  2NYJ A;  4AJW A;  2ZU6 B;  5AQS B;  1X79 A;  3FUL A;  3ZYM A;  4U8V D;  2DYS E;  2VL0 A;  3AG2 E;  4FUL A;  2UXX B;  4LFB T;  4XKB A;  3UQ4 A;  3CKC A;  2C5I T;  1Z5S C;  2BS2 A;  3NWI A;  1O1T A;  3ZKJ A;  4N5Q A;  2JMK A;  2HR2 A;  1B7T A;  2BZB A;  3EVY A;  4HBD A;  5KX5 E;  1O1R A;  5FT9 A;  2BVM A;  4ILA A;  4DID B;  4JL0 A;  2HO1 A;  2V7K A;  1TYQ G;  1UOH A;  2KZT A;  2UUA T;  2F0Y A;  2CHW A;  2UU9 T;  3W9F A;  4G1T A;  2XAJ B;  3SZ7 A;  4HWI B;  5L3B B;  4N5C A;  4H9S E;  3RYC E;  4DR5 T;  5B1A E;  3PE0 A;  1U3C A;  2A2F X;  2RFM A;  4EZH A;  2GRO B;  4X1I E;  3ZMT B;  5JH7 E;  1IQR A;  4LNU D;  5AQI B;  2LEH A;  1ZHC A;  4DV5 T;  1MZC A;  2I1J A;  3G2U A;  2ODU A;  3GN5 B;  2R2L A;  1IYG A;  2CBJ A;  4X1K E;  1FMV A;  1JCQ A;  1Y01 A;  4A1S A;  5G04 J;  3AVR A;  4UIG A;  2XEV A;  3NF1 A;  5AEN A;  4TZ4 C;  5J0Z A;  4BT8 A;  3H3M A;  3X1D A;  5LOV E;  3LYA A;  3CVY A;  2PNN A;  4GA2 A;  3KEA A;  4TNW A;  1QZ2 A;  2PM7 A;  3EDT B;  2IC9 A;  3R7R A;  2KXP B;  3EU9 A;  3ZNG A;  3PDN A;  3CHR A;  4XI0 A;  3E0Z A;  2AE9 A;  4P0B A;  3AE9 A;  3Q78 A;  3PZ1 A;  4A97 A;  1S94 A;  2X6J A;  5DJQ C;  4OHF A;  2J4D A;  2LSY A;  4JI8 T;  2V7L A;  1AJ3 A;  4HFC A;  2BG9 A;  2YDQ A;  4NXN T;  3BQO A;  5JTG A;  4U0Z A;  1YQ3 A;  3CX8 B;  3RHW A;  3SF4 A;  5L4H A;  3AAE B;  1OED A;  3U3I A;  3ZXS A;  2H3R A;  4DV4 T;  4UWL A;  4GTP A;  2RKK A;  3ZXP A;  5ABF A;  3P8C D;  3O4Z A;  2XPZ A;  3SI5 A;  3GA8 A;  4K0U A;  4OYS A;  2CA5 A;  3JUE A;  2ZIS A;  1K3Z D;  1MIW A;  4U0U A;  4ZZC A;  4DX7 D;  2XEH A;  2DL1 A;  5ETW A;  1KNR A;  3R9M A;  3URZ A;  5LCW C;  5DBK A;  1TN7 A;  5F3J A;  3GW4 A;  5T4Y A;  3VLE A;  4HRN A;  2ETC A;  2MRI A;  3CLJ A;  1ZEE A;  4U3C A;  4QH5 A;  3CIA A;  3PRE A;  3DEO A;  1KLX A;  2XSA A;  4UV9 B;  4HLL A;  4EV6 A;  4J6I A;  4GYO A;  4CZZ B;  2XQ5 A;  3ESL A;  3ZEF A;  1TR4 A;  1EPU A;  1FT2 A;  5FP3 A;  3O1H A;  5DAB A;  2VGX B;  2EIN E;  2H89 A;  1FMW A;  2P9I G;  4GMJ A;  3RQU A;  1MND A;  1Z0P A;  2XM2 A;  5CMY A;  5CA1 E;  2ION A;  4BEP A;  2XAF B;  3HL6 A;  2I1K A;  1INZ A;  1N4Q A;  5FTP A;  4H63 V;  3CEQ A;  2R02 A;  4YHJ A;  1T7S A;  4PH4 B;  3HVE B;  2RG8 A;  1L0V A;  2J07 A;  2OEV A;  2ZGD A;  4HOT A;  1MIY A;  5FXX A;  3AVS A;  3FH8 A;  2WXR A;  2LKG A;  1MHQ A;  3W15 B;  3PJA A;  3FB2 A;  2A9U A;  1XDP A;  4JEU A;  3PE4 A;  2WXF A;  4LF9 T;  3FUH A;  4CDN A;  1D1A A;  3ETU A;  3KVA A;  2LAI A;  1N95 A;  2ODV A;  3RLF F;  4JI6 T;  2OCC E;  5JR9 C;  5JRE A;  3FU3 A;  3UX4 A;  3SHF A;  5A6C A;  1M7K A;  3SWH A;  3UUB A;  3ZN3 A;  5KBA A;  4WBO A;  5FNV E;  2BS3 A;  2E2A A;  2M63 A;  3UU6 A;  3CK9 A;  4DVD A;  1D0X A;  3NVO A;  4LFC T;  4KBQ A;  4U7E B;  5KNG A;  2B6C A;  3PV0 F;  1GQE A;  4JHJ A;  1LD8 A;  4LNB A;  4BX8 A;  2BKN A;  3ZT6 A;  2A3D A;  3EHQ A;  4B8A A;  3OXF A;  5AJD A;  4LSZ E;  2CHX A;  1S35 A;  2VKJ A;  2CG3 A;  2AXU A;  3FBL A;  2F8Y A;  2EHO B;  3MA5 A;  2BKP A;  5AN8 A;  2EIL E;  3EUV A;  4LRZ A;  1DNP A;  4U04 A;  3ZYQ A;  2D0T A;  1N36 T;  4H9Q C;  5AQL B;  3MJX A;  2IC6 A;  2OV8 A;  3CVX A;  1PY1 A;  2PFV A;  1UX4 A;  2X51 A;  4P0A A;  5LP0 A;  3FTX A;  3E08 A;  3RRU A;  4HWC A;  4UQX A;  4AKH A;  2F37 A;  3I3N A;  3BQL A;  3L22 A;  2ZXW E;  4A5X A;  1N11 A;  3L54 A;  3PNT B;  4L23 A;  4EXT A;  4FAD A;  2F8X K;  3S7F A;  4EBA A;  1ELK A;  5AQK B;  1XMO T;  2FI7 A;  4IDP A;  3PUQ A;  4X62 T;  2CLY C;  2KCV A;  3HKD E;  4KZC A;  4YY3 T;  5C3J A;  1N33 T;  2JPF A;  5AQV B;  4IT4 A;  2H6H A;  1GW6 A;  3PZD A;  2WWV A;  2VQF T;  3S7D A;  2CHO A;  3FXE B;  1EYH A;  3ISM C;  5HQ8 A;  2P9U G;  4BJN A;  1OCR E;  5AQA A;  4APF A;  2NTX A;  1PC2 A;  4EPZ A;  3DSW A;  3M3Z B;  3KFW X;  3PEU B;  3TJP A;  3VTX A;  1OCC E;  2RFA A;  5T8I A;  5HEG A;  2P9L G;  4UI9 J;  5HI7 A;  4K5C A;  2E9X B;  3AE3 A;  2BBJ A;  3CX7 B;  5DQW A;  4YSY A;  5H6R B;  3K3Q C;  3DRA A;  4O8S A;  5EKQ D;  1E7P A;  4CXW A;  3VKH A;  3GMI A;  4F3V A;  5HCJ A;  1G8X A;  1QNF A;  2WXQ A;  1V9D A;  2WXH A;  3UIO C;  5LG4 A;  4G63 A;  1NA0 A;  3QB2 A;  1YCS B;  2UWJ G;  2L6J A;  4C0E A;  2ZMA A;  3J9X 1;  2MYS A;  4C91 A;  4HTE A;  3SQV A;  4PK4 A;  4I17 A;  1X5B A;  3ONK A;  4F6R D;  1HG2 A;  4PFO A;  5KMG P;  3QB5 A;  3X2Q E;  3RGL A;  1RZ4 A;  1WYC A;  2IO3 C;  2P9P G;  2DWG A;  2QY7 A;  3AG4 E;  2Y0B G;  1FPP A;  3GZS A;  4H9P C;  2BG9 B;  4L7T A;  5FY7 A;  2VVS A;  4RG9 A;  3JCF A;  2W2U A;  3UT4 A;  3UU4 A;  3UUL A;  3ZC1 A;  2KT9 A;  2VWA A;  5BXO A;  3AEG A;  2R5S A;  2AXV A;  2UXD T;  1KFY A;  4DX2 A;  3GZ2 A;  2X6I A;  2KCL A;  5E76 A;  2C2L A;  2LAH A;  2L9Q A;  3F2E A;  5EIB E;  5BW8 C;  3M65 A;  2PQN A;  1G73 A;  2Q9Q B;  4RQI A;  3FZM B;  2XPI A;  2EHO A;  4O4J E;  3D9P A;  3RJV A;  3IXE A;  5ENT D;  4AM9 A;  3L16 A;  4E7Z A;  4JHR A;  3AEB A;  3Q7A A;  5EK3 A;  3AU5 A;  2VSN A;  4EZK A;  2X6H A;  5L3G B;  2IUB A;  2V26 A;  4I4T E;  3RIU A;  4YDY A;  4LMJ A;  3LFM A;  2EIJ E;  2X9Y A;  4J0U A;  2LT3 A;  1VCS A;  4BES A;  4FLB A;  2BUG A;  3UIP C;  4OK0 A;  2V8S E;  5LCW J;  3JAF A;  3AS4 A;  1R8I A;  1XZY A;  2IY0 C;  3FU5 A;  4ZHB A;  3LDZ A;  3DEP A;  2HM8 A;  3ONX A;  4IDO A;  2HHH T;  2NR4 A;  1HCI A;  2JRK A;  5CGM A;  1MIV A;  2CRB A;  4AEZ C;  1IBL T;  2E2E A;  3ZT5 A;  4AKG A;  3L13 A;  2M6B A;  2K48 A;  2VAS A;  3JAD A;  4ILI A;  4EGW A;  1P5Q A;  3RC3 A;  3R84 B;  4IN3 B;  3Q47 B;  5EN5 D;  1UK5 A;  2KWI B;  4B0Z A;  3EAM A;  2WS3 A;  3HDX A;  3TGO A;  2D0U A;  3C3O A;  1G3N B;  3LJC A;  3FTV A;  3WXX A;  2XRY A;  3FZK B;  4PFP A;  1E2A A;  4UWF A;  5A23 A;  5HEH A;  4CN4 A;  4ERR A;  2VJ8 A;  4DK5 A;  2Y48 B;  2J62 A;  4N78 D;  5FZR A;  2R05 A;  3P4R A;  3RX6 A;  4JVS A;  2QYJ A;  5AQ7 A;  4UR9 A;  4CN6 A;  3TWQ A;  5LMN T;  5AIJ A;  4GAA A;  5BT1 A;  5HXE A;  3RI5 A;  4JA9 A;  2HYZ A;  2YDR A;  4G8K A;  2CM0 A;  1BR1 A;  3ZMV B;  3AE7 A;  2WVI A;  2BG9 C;  3AXJ B;  2LRL A;  4F1S A;  2YQ8 A;  4FHJ A;  2XQ3 A;  3VR9 A;  3RPU A;  3D9N A;  4YDW A;  2H7V C;  4ZFH A;  4YSZ A;  4AXP A;  4G11 A;  3S4U A;  4L9P A;  2D5U A;  3R7Q A;  4ZI3 D;  2XGO A;  4GOU A;  4KUM B;  3ABM E;  2LSG A;  1NEN A;  3LKU A;  3F31 A;  3TLV A;  4NXM T;  3TLU A;  1IJ6 A;  2VVN A;  3LVR E;  4XI9 A;  3MV3 B;  4PK5 A;  4CT0 A;  3PS6 A;  1VCT A;  2V6Y A;  3MKD A;  3C4W A;  3Q73 A;  3PRZ A;  4O2A E;  2XAH B;  3ZN0 B;  4N3B A;  3EJN A;  4YXD A;  3OBV E;  3AAA B;  4H9R C;  3C4Z A;  3VRB A;  4WNG A;  4IST A;  4HS2 A;  2F4V T;  4N3C A;  4C9B B;  4JXT A;  4CI3 B;  1WYB A;  4L9I A;  2H88 A;  2XCC A;  3NQP A;  2X66 A;  1ZOY A;  2X0L B;  5AFU L;  4ZI2 D;  4HNA D;  3AG3 E;  1OXJ A;  3Q5W A;  4TV8 E;  4GPK A;  5HXS A;  3E33 A;  2XHE B;  5LOZ A;  3MKQ A;  3ZCJ A;  2JJ9 A;  4ANJ A;  2XAS B;  3OYX A;  5J90 A;  3UT5 E;  2WM9 A;  5JDH A;  3OTO T;  3E22 E;  3NZP A;  2DI4 A;  2MPK A;  4BSZ B;  5FL0 A;  3SO8 A;  1YQ4 A;  2AJA A;  3FHE A;  3AJI A;  2E9X D;  4A3T A;  3AED A;  1FEW A;  1XNR T;  1EF1 C;  4HFV A;  4PJL A;  5KXJ A;  3HKB E;  4WWO A;  5AQB A;  2HN1 A;  1H2V C;  3RRM B;  4ACK A;  3DSV A;  1VDY A;  5ARG A;  2VTB B;  5EDS A;  3AXJ A;  2J4G A;  5M4Y A;  4TXR A;  1HX1 B;  3FFL A;  5G55 A;  2VGY A;  3AA1 B;  4TWH A;  4KT6 B;  4DX5 D;  2DLR A;  4JZY A;  2LXM A;  1QUU A;  4I6E A;  2ACX A;  1N4R A;  2JLB A;  2QRX A;  2XZT G;  2LM2 A;  4N2Q A;  3ZYL A;  5EK2 A;  3FEY A;  1O3X A;  4I9C A;  4TUM A;  1ZU2 A;  3S7J A;  3TLT A;  4AKL A;  1SW6 A;  5AQM B;  4K03 A;  4CDR A;  5FXW A;  4DX6 D;  3QOU A;  3I0O A;  4MRU A;  4B3S T;  2V5Q C;  4CI1 B;  3I9Y A;  1UUR A;  5KDM C;  5DIZ A;  1E8Z A;  1T72 A;  1QLB A;  5HEJ A;  4FA6 A;  1XDO A;  1U5P A;  3CVL A;  5AQO B;  2WU2 A;  1KEY A;  1BLX B;  1HU3 A;  3PE3 A;  2YK0 A;  1LKX A;  1X81 A;  3D9H A;  3LK3 B;  4DX1 A;  2IML A;  3LY7 A;  3V31 A;  1I6Z A;  3EIJ A;  5IHY A;  2WXO A;  2J47 A;  2KBX A;  3FXD B;  2OVF A;  4U96 D;  3L3P A;  2HPL A;  1W3B A;  3D0T A;  2XCB A;  3OXG A;  3FTU A;  5EX0 A;  1ZKE A;  3CPZ A;  2EIM E;  1YW0 A;  3K8P C;  1QBQ A;  2WCA A;  2DWZ A;  2WQ6 A;  3G2T A;  3FH7 A;  1UW4 B;  3CQX C;  1IAP A;  3LG7 A;  5AQT B;  1HE8 A;  3TXN A;  2FBN A;  4B3M T;  4K5B A;  4MAL A;  4G2V A;  3KVB A;  3PUR A;  4CN1 A;  5LGU B;  4V3I A;  2X0H A;  4G8L A;  4BER A;  3ZST A;  3IF8 B;  1TN6 A;  4PAG A;  3ZN1 B;  2IW5 B;  3OXL A;  4A98 A;  3G2S A;  1SZ9 A;  1TJC A;  2R03 A;  4YJ3 E;  5M72 A;  1LVK A;  2VYI A;  4AVX A;  1SHZ C;  4HVB A;  3NOG D;  3L17 A;  4UUC A;  1XGW A;  2KLQ A;  2WBL A;  4IE4 A;  4DUI A;  2UUC T;  4BSX A;  3TWS A;  4YHH T;  3E37 A;  3NBX X;  4G2A A;  3B5M A;  4I50 E;  1W0B A;  5JDF A;  4B3R T;  5LX8 A;  2WB2 A;  1FCH A;  2JMH A;  2D9D A;  3SBS A;  1UX5 A;  2BBH A;  4U72 A;  4ZI2 C;  1H2T C;  5IYZ E;  2WWU A;  2P2C P;  4HOU A;  3I9W A;  4XZC A;  3T1Y T;  1Z3Y A;  3MJW A;  4I9E A;  3TG5 A;  3RKG A;  5GON E;  3FTS A;  3Q79 A;  5HKP A;  3T8O A;  3ZW3 A;  1MX6 A;  4BA9 A;  3RIA A;  3UFG A;  5BXU A;  5L3D B;  4QKN A;  4UVB B;  1I94 T;  1KT0 A;  3AE8 A;  3LK2 B;  3PUA A;  1T8B A;  2LXL A;  2BF0 X;  4F7A A;  2KZT B;  3EDV A;  3PNL B;  4PDX A;  3WAK A;  2Y6X A;  2XQ9 A;  1EDU A;  3A7M A;  3O4X E;  2I6H A;  5L4E A;  4IL4 A;  3NBN B;  3PUV F;  3RKV A;  4ZOL E;  2LKH A;  3ZC0 A;  1MJ0 A;  5HXH A;  3RRN B;  2QZA A;  3ONL C;  3GN5 A;  4GZ5 A;  4XZ4 A;  4YTP A;  2Y4U A;  4AXH A;  5L3C B;  5FIN A;  3CHP A;  4ILC A;  2QVA A;  3V5U A;  3IHV A;  4ANX A;  1UN9 A;  4DUY T;  1DCQ A;  2KIN B;  3B13 A;  3CML A;  1W0A A;  2CXF A;  4U74 A;  1B89 A;  4EIW A;  4JD2 G;  3RRW A;  2RD0 A;  2K9A A;  1K8K G;  2ZM6 T;  1Z3X A;  2WQH A;  3DST A;  4U95 D;  4WBN E;  5ENR D;  4LEU A;  3FY4 A;  3I4G A;  3SS1 A;  3R9A B;  2L9B A;  3AEA A;  4ZS2 A;  1N54 A;  3ZLI A;  4DMW A;  3UM2 A;  4AKR B;  2MOW A;  3T8K A;  3ZJ1 A;  3SY2 A;  5H7P A;  2C0L A;  1FVF A;  1HNZ T;  2OOE A;  4HI8 A;  3FTY A;  4OYK A;  4DBQ A;  1Z6T A;  2RPA A;  5CER B;  4X5T A;  2CFU A;  4Z68 A;  3A5X A;  2AVP A;  4K0K T;  5KNH D;  3B57 A;  5FXV A;  5ABF B;  3PUJ A;  3UU8 A;  3V30 A;  5ANL A;  3P4S A;  2WSS V;  4GKJ T;  4BFR A;  2KXP C;  3UM0 A;  3ZT7 A;  2XHE A;  2XQ4 A;  1T98 A;  4UF0 B;  4UEL A;  3ZU7 B;  1DCE A;  2QYU A;  4K0R A;  3TLW A;  4JI7 T;  4GYY A;  4NUV A;  4X20 E;  4HN9 A;  3Q15 A;  3N9Q A;  1LF8 A;  4QXH B;  3LS8 A;  1NP7 A;  4O1O A;  4A3V A;  4GK5 E;  5FIO A;  3BG0 B;  3G06 A;  4I2W A;  1AWC B;  2XS1 A;  4JW1 A;  4UVC B;  3CIR A;  4XKC A;  2H6I A;  5KCM A;  1WRD A;  3K3O A;  2XZE A;  3UM3 A;  4U2Y A;  4JEH B;  4AIS A;  2X9X A;  5IUX A;  3CVR A;  3ZMU B;  3E30 A;  2V7J A;  2NTY A;  3ZEF B;  3S7B A;  3UT8 A;  2WXN A;  3J5Q B;  4HB5 A;  3OPC A;  1JCS A;  4GTO A;  5CCL A;  4WNF A;  5HYA A;  2VL8 A;  2IQC A;  5BMV E;  2WDQ A;  5F8P A;  2UY1 B;  4BJM A;  2DIW A;  5AQJ B;  3SFZ A;  3V5S A;  3J5P A;  4FP7 A;  5LG3 A;  1KF6 A;  2NW9 A;  1WCR A;  1H6P A;  3KV5 A;  5FQ7 A;  1JNZ A;  1UUS A;  4ACL A;  5JJ6 A;  4ZI7 E;  3QAQ A;  4WND A;  3QWV A;  4DI3 A;  4IE5 A;  5CFB A;  1FIO A;  2X0Y A;  4FJY A;  2LSI A;  3FUM A;  3B7S A;  4YLH A;  1OCZ E;  3UKR G;  1Q2Z A;  3A8Y C;  3ZHE B;  4UV8 B;  3SFE A;  4MLK A;  3C72 A;  1CHU A;  1D8D A;  3PDY A;  4RVB A;  4GML A;  3AE6 A;  4IGU A;  4KX6 A;  2IDO B;  5LA6 E;  4JI4 T;  4LF6 T;  4JHK A;  3K3N A;  1ZBP A;  5J1G A;  3SOL A;  2CCQ A;  4W9R A;  3QK6 A;  1KNP A;  1O1S A;  2LUH A;  2BKG A;  4IE6 A;  4EQF A;  4AI6 A;  2HE0 A;  5EK4 A;  2ZIR A;  1WFD A;  3EIQ C;  2NW8 A;  2LO6 A;  3H37 A;  2V7I A;  2KC7 A;  4H9N C;  2VB6 A;  4DR6 T;  1US7 B;  4AY5 A;  1UJJ A;  5EYL A;  2EQX A;  2K24 A;  3SNX A;  3TKL B;  3P4W A;  3T1H T;  3LPZ A;  2J9Q A;  2LNI A;  4F1P A;  4XIF A;  3AA0 B;  4QH4 A;  2L8K A;  5LGT B;  5JJT A;  5HXR A;  3CR3 A;  3V2X A;  3CST A;  3V79 K;  3C98 A;  2WP9 A;  5FMN A;  3TWV A;  1HXI A;  2WDV A;  3UFE A;  3I4R B;  3P2B A;  3PZ3 A;  2I9C A;  3JXI A;  3AEC A;  3NKZ A;  4TN7 B;  5JHB A;  2P9S G;  1OWM A;  2X3M A;  2CHZ A;  5LJN A;  3TLS A;  3UU3 A;  3TG4 A;  4BY6 A;  3AE2 A;  4DR7 T;  2OLT A;  3KBU A;  4E85 A;  3MZK B;  3UUX A;  4IE7 A;  1BD8 A;  2IF4 A;  3CQG B;  4LF4 T;  3JAE A;  1IBM T;  5LYJ E;  4DV7 T;  1ZB1 A;  1AP7 A;  4K5A B;  3OTN A;  3RU0 A;  1JNR A;  1YYH A;  3KDS E;  1ELW A;  1NFI E;  3LXU X;  2JQQ A;  3IHR A;  4J8S A;  4WNK A;  1BR4 A;  4M1P A;  1U4Q A;  1N4P A;  5KJK A;  3L82 A;  4JEH A;  4HOR A;  5ENP D;  2UXC T;  3AU4 A;  4UEM A;  5LNK A;  4JYA T;  3AEF A;  4HLE A;  4ATG A;  3ASF A;  2YU2 A;  1V54 E;  2GW1 A;  3IBE A;  3B7U X;  2WQ7 A;  4B94 A;  2LLY A;  1S70 B;  3RF1 A;  3GZ1 A;  2CXL A;  2CWO A;  4COF A;  1QYM A;  1H6O A;  3CVP A;  4EAH A;  3RO2 A;  4GK0 E;  1YXR A;  5LMU T;  4XX5 A;  5FYM A;  4Z90 A;  3UIN C;  4DR2 T;  3ESK A;  3U66 A;  1Y64 B;  2OV9 A;  3SGH A;  5ENN A;  5ABG A;  3T5X A;  2R17 C;  3W9G A;  4ZZB A;  2LSJ A;  5JRC B;  4CI2 B;  2LJL A;  2GRP B;  4TWD A;  5JDL A;  3RIB A;  3MX3 A;  1M62 A;  2BKO A;  3FU6 A;  3FUD A;  3NZQ A;  3ML8 A;  4ABN A;  5C2T A;  2NW7 A;  4RLY A;  2LM9 A;  2J49 A;  1U2V G;  3D9I A;  4FJO A;  2LE8 A;  4HFG A;  2YN6 A;  5AYW D;  2X6F A;  4APO A;  1ZP0 A;  3AB3 B;  2YKS A;  1XMQ T;  1CUN A;  3CHQ A;  4ZHQ E;  4GA0 A;  5LHI B;  1Y8M A;  2XAG B;  4J8F A;  4B89 A;  2YOE A;  5CB4 E;  3UU5 A;  1MNE A;  4GYW A;  2WXI A;  3N2G E;  3OKQ A;  3DPY A;  2EHO C;  4EEC A;  3FH5 A;  3AAA C;  4EZJ A;  4YTN A;  1XWM A;  3CWZ B;  3PUW F;  4NIQ A;  4UWK A;  2XQ7 A;  5FL1 A;  1WG0 A;  4P1N A;  4IDZ A;  2FJB A;  3AS8 A;  4PS8 A;  2OA5 A;  2A72 A;  3APD A;  2L0I A;  3UKU G;  4NQ0 A;  5LXT E;  4F8H A;  2GRM A;  2BED A;  1N4S A;  4CEM A;  1HS6 A;  3ZMS B;  1TNB A;  3Q5X A;  3CV0 A;  4DV0 T;  3ABL E;  1NZN A;  1A17 A;  4UXN B;  4KVO A;  4CGW A;  4XE0 A;  3MZL B;  2UUB T;  2JIW A;  3NOC D;  3CGH A;  2JEK A;  4X1Y E;  3FZH B;  3IEE A;  2WB5 A;  3N5L A;  4ANU A;  1SZA A;  4WNE A;  4Z91 A;  3LJN A;  1NI1 A;  3MAC A;  1HNX T;  1N9A A;  4U2Z A;  3D9O A;  3MA9 A;  1PAQ A;  3RH3 A;  2Q9Q C;  5KJN A;  2KM4 A;  4GA1 A;  3FZF B;  4LF5 T;  2VQE T;  4GZ6 A;  4LML A;  4DI4 A;  2HPJ A;  2LOP A;  2I2O A;  3SFD A;  2PBI A;  3ANW B;  5FJY A;  4AKI A;  4DND A;  4IIJ E;  4JI1 T;  1D1C A;  3JQ1 A;  1ZV4 X;  5IWA T;  2M67 A;  5JDG A;  5KJM A;  2FJA A;  4KZ0 A;  3RRC A;  2ZM2 A;  2M6I A;  1VOM A;  4JUY A;  2XQ8 A;  2DWK A;  5CJ5 A;  4OAV B;  2OND A;  3C51 A;  4URK A;  2MYO A;  3CKB A;  3EUH A;  1DC2 A;  1MX4 A;  3I1A A;  2WZH A;  3ZGQ A;  1BR0 A;  2LHN A;  2LRK A;  3PJA J;  2UY1 A;  3CK6 A;  2B76 A;  3ASO E;  5JDM A;  2E5V A;  4EYU A;  1WY6 A;  4GKK T;  2ZLY A;  3UPV A;  3QKY A;  1UJK A;  4UWH A;  4FC8 A;  4B3T T;  3LVQ E;  4MS6 A;  2E9X C;  5BUZ A;  4EOZ B;  3CHS A;  5JHA A;  5ITZ F;  4JI3 T;  2PG8 A;  2PM6 A;  4H7Y A;  5AQR B;  2QFC A;  4O6F A;  5CRV A;  4AQF A;  3PUS A;  1Z8U A;  2WAU A;  1E1H B;  2V5C A;  2WXK A;  3QNK A;  5JRC A;  3B95 A;  4LER A;  5JVD E;  4ZXL A;  1HZ4 A;  2Q9Q A;  3ASD A;  3Q9U C;  5EID A;  3HA4 A;  3VTY A;  2R6G F;  4I43 B;  5LB7 B;  3QK0 A;  3LEW A;  5BV0 A;  3T5V A;  2Y1L E;  5FVK A;  1OUV A;  5A7D B;  4ISS A;  4BWR A;  2ETA A;  2GRN B;  2W0G A;  3MCX A;  1NEK A;  4C0M A;  3HXD A;  4L0R A;  1QQE A;  3GYZ A;  4MBQ A;  3D9M A;  3EU5 A;  2JAB A;  2QYW A;  1VRB A;  2V4H C;  3ONL A;  3L09 A;  3JUI A;  2VKO A;  1YKE B;  3DXM G;  3PUZ F;  4I2Z A;  2AXZ A;  2VK9 A;  3FUE A;  3CX6 B;  4GYS A;  5LHH B;  2BG9 E;  2I59 A;  4Z8X A;  4OX9 T;  5JA4 D;  4CQI A;  2ZM0 A;  4DR3 T;  4GCN A;  2CBI A;  1IQU A;  4YT0 A;  3MEK A;  3LY8 A;  2V1D B;  3FHN A;  4ANW A;  1FT1 A;  2CG2 A;  2BVL A;  2WXJ A;  3I5P A;  1MMD A;  3ZPO A;  2IO2 C;  4BET A;  3DBS A;  3BQI A;  4CXY A;  2LHR A;  4QX8 B;  4CCA A;  3ABK E;  3CVU A;  1DU2 A;  5EYP F;  3RYH E;  2NSZ A;  4G25 A;  2XSB A;  4UVA B;  2XS8 A;  5JMN D;  1OED C;  3Q5E A;  3ANW A;  3CKD A;  1E90 A;  4FI5 A;  4G26 A;  3OJA A;  4YDE A;  3U4T A;  4HGA A;  1MQS A;  1RW2 A;  4OYJ A;  4X65 T;  4JI5 T;  4WWP A;  3NZU A;  1DVP A;  2NWB A;  1H0A A;  3UM1 A;  4L2L A;  5LGN B;  2BS4 A;  5A1L A;  2VGX A;  4TXP A;  3Q5D A;  1IHG A;  2L3L A;  2QGS A;  4Q96 A;  4IDQ A;  1TJF A;  3VR8 A;  3PVL A;  2VUR A;  3JC6 C;  3MGB A;  4GPM A;  2YDS A;  2V5F A;  3QJZ A;  4EYY R;  5AAR A;  3D3M A;  3ETV A;  5FQ8 A;  2A5E A;  2AWI A;  2WXG A;  4H63 H;  1FVH A;  2W61 A;  2KAT A;  4A63 B;  2KWH A;  4I1A A;  1JPL A;  2Y8D A;  3OAW A;  3AEE A;  3C4X A;  4Y6W A;  4A55 A;  4JEU B;  1N52 A;  3LK4 2;  4L1B A;  4DR1 T;  4IDN A;  1UG3 A;  3FUK A;  2VSO E;  5LJM A;  4YDO A;  1YD8 G;  3UTM A;  2CMR A;  4BX9 A;  3FTZ A;  3P1U A;  1OT8 A;  2YEV C;  4CDM A;  2RP4 A;  3FTW A;  2X6K A;  4DBR A;  2D2S A;  2IHR 1;  1HTJ F;  4DO0 A;  5ENO D;  3ZHE A;  5DQV A;  4U07 A;  3ASN E;  4AQF C;  1H7C A;  5C8Y E;  4X64 T;  2VKH A;  3FBZ A;  4PW8 A;  3FU0 A;  4CYM D;  3DPD A;  4NAC A;  4TXQ A;  4D10 C;  4FHK A;  3AA7 B;  3PEV B;  5BNW A;  4KHP T;  4O4H E;  5LBM A;  2ETB A;  4HQD A;  1MMG A;  3LSV A;  4AOF A;  2QA7 A;  2XZD G;  5FZS A;  2FBW A;  3HKC E;  4P29 A;  2L6B A;  2A5U A;  3N9N A;  1S64 A;  1SE7 A;  3ML9 A;  4CZ2 D;  4HRM B;  2SPC A;  4YJ2 E;  2VSX E;  3E4B A;  2ACZ A;  1OCO E;  5JQG E;  1D0Y A;  1KK7 A;  2W63 A;  2XM1 A;  3PU8 A;  4QWN B;  4JI2 T;  2FEZ A;  4EZL A;  5LBQ B;  3FUF A;  2GRQ B;  3ENE A;  1K1A A;  5FXZ A;  3AE1 A;  1WDY A;  4GZ3 A;  3FEX A;  4GTM A;  1OED B;  5L3F B;  2KSR A;  1H2U A;  1N94 A;  4M7C A;  5AQU B;  4H7X A;  4HEA A;  3KEZ A;  3IEG A;  2FUL A;  3HYM B;  5HWX A;  2Z6E A;  2WY2 A;  3P4Q A;  4KMO A;  2QC9 A;  3TWR A;  4DRX E;  3NB2 A;  2ZGG A;  3UQ7 A;  5TAO A;  4U8Y D;  4B6X A;  3MXZ A;  1J1J A;  4EBA G;  3JXJ A;  3P4P A;  3ZKR A;  4HKA A;  5CMW A;  2XEE A;  3PTR B;  1UGO A;  4J8Y A;  4KMC A;  3VKG A;  3I0Q A;  5AAO A;  1SQM A;  3VLD A;  2IJG X;  2CE7 A;  3EI0 A;  3S2A A;  5E75 A;  1EZ3 A;  2XRZ A;  5C2Y A;  3PUG A;  3KSQ A;  4J2C A;  3UMV A;  4BAY B;  3QC9 A;  3ULE G;  5C1D A;  4AP2 A;  3UXG A;  2J1D G;  3G2W A;  4TRQ A;  4HOQ A;  1ELR A;  3L39 A;  2DZN A;  3ZVV A;  1MMA A;  4CXX A;  4JBW F;  3N9P A;  1HR0 T;  4GIW A;  4HXI A;  3QWW A;  5CA0 E;  4I43 A;  1W9R A;  4HWF A;  2BDE A;  4AIF A;  4ILG A;  1HO8 A;  2FO1 E;  4TUU A;  1TNZ A;  2YU1 A;  3NZS A;  5LHG B;  3APF A;  2WMN A;  3RIU C;  5FQ6 A;  5L2L A;  3K9I A;  3APC A;  5FQ4 A;  4OVU A;  1JUQ A;  1NWM X;  4ILH B;  1NAF A;  1N0R A;  3DWL G;  3MKR A;  2KMF A;  2GRL A;  4L2Y A;  3EHN A;  2E5L T;  3U78 A;  3WAJ A;  3D9K A;  5J2T E;  4M3O A;  4QH1 A;  2LSU A;  3UUM A;  2UXB T;  3KIN B;  1BI7 B;  5CHE E;  2C0S A;  4PNI A;  2J08 A;  3SFY A;  4NPP A;  4C90 A;  3O9X A;  2FO7 A;  4EED A;  3EHM A;  3LY9 A;  2XEN A;  2X68 A;  1WR0 A;  4DV2 T;  4LUN U;  4HRL A;  2XQ6 A;  3N9L A;  2CFZ A;  4NUU A;  5ABE A;  2Q9Q D;  4ME2 A; 
#chains in the Genus database with same CATH homology
 1JWG A;  3C50 A;  3ZPJ A;  5AJL A;  3KS2 A;  2VSY A;  2A4Z A;  3Q4A B;  4UF0 A;  3PH0 C;  2X67 A;  3GWH A;  5ADX L;  2RA1 A;  3U3W A;  2Y3A A;  2C5J A;  2P58 C;  3O1I A;  3N2O A;  2IFU A;  3LJ3 A;  5ANR A;  4WUY A;  2DCF A;  3RKO A;  4TUY E;  2C5K T;  3QDN A;  1Y6I A;  5KJL A;  1L5J A;  4UI9 C;  4EZ4 A;  1OWA A;  3UQ3 A;  3FUJ A;  3MYV A;  5JJ7 A;  3IV0 A;  4GCO A;  4P09 A;  3QC1 A;  3FUI A;  4UI9 K;  4GZD A;  1YA0 A;  4U63 A;  3D9J A;  1XNF A;  4U8H A;  2VKD A;  4JC8 A;  2KND A;  3N71 A;  4ANV A;  4H9O C;  3QAR A;  5LP6 E;  3KBT A;  3CVV A;  4QHO A;  2E9X A;  4YND A;  2IU1 A;  4MLP A;  4FLH A;  4J8E A;  4I1O B;  2NP9 A;  3ZRH A;  2LSK A;  3CK8 A;  5LFA A;  3RK6 A;  4OFZ A;  1E8Y A;  2GK9 A;  4I55 E;  5J08 A;  3IKO B;  1LRZ A;  3QUJ A;  4V1A v;  5G04 C;  4OVV A;  5H6Q B;  4MHC A;  1E8X A;  4GU5 A;  3JCK C;  3T8M A;  2LSV A;  4U0S A;  1QSD A;  5HAX A;  1E7V A;  3UT7 A;  5G05 C;  2ZM8 A;  2V0P A;  2E8I A;  2CXD A;  4E7S A;  3AS5 A;  4UQY A;  4TV3 A;  3HHM A;  2XQ0 A;  4DMV A;  2YHC A;  3MV2 B;  4YVQ C;  3ZMZ B;  3PUK A;  2ES0 A;  3Q9D A;  4KVM A;  4KXK B;  4HE8 A;  4G23 A;  1WAO 1;  4DPR A;  3ZIM A;  1OXZ A;  3R6N A;  2CEA A;  4I1M A;  4BT9 A;  1OWN A;  3L08 A;  1D0Z A;  5HXC A;  4ILU A;  5JR9 B;  3C98 B;  2MBG A;  3IBP A;  5FY0 A;  4PK6 A;  2WMO A;  4RG6 A;  1NA3 A;  5JDQ A;  3BEE A;  4GZC A;  1HFA A;  2PJQ A;  1WM5 A;  4WAF A;  4IE0 A;  4AV7 A;  4NUR A;  3OYZ A;  2N2N A;  3ZYK A;  3Q49 B;  2NXP A;  1WR6 A;  4XBF B;  3Q2M A;  4BTA A;  2UXN B;  3BG1 B;  3CQC B;  3UUX B;  4L5G A;  4YVO A;  4F53 A;  3B7T A;  2EHO D;  3RC8 A;  3JC6 D;  3F57 A;  3B7R L;  1OWL A;  3AA6 B;  5G2N A;  3CVW A;  5J2U E;  4MKT A;  3NRY A;  4XAX B;  3J7Y q;  2KCK A;  2FF4 A;  3CVQ A;  2Q7F A;  2DNX A;  2MOZ A;  4N3A A;  2VTB A;  4Q69 A;  4GB9 A;  3ZFW A;  4E6H A;  4QFV A;  2L0T B;  4PUC A;  2MHK A;  1HG5 A;  3UUN A;  4MFR A;  3CHO A;  5T3R A;  2Y4T A;  4WWN A;  4DLQ A;  3L6A A;  4QXB B;  3U9W A;  1E96 B;  3NRX A;  2X9W A;  3JYS A;  3EDU A;  2CLY B;  4F6R C;  4EB6 E;  5G05 J;  2XTL A;  4GYR A;  4UWG A;  3UTK A;  3KAE A;  2K5B B;  3H3A A;  2PL2 A;  2BTD A;  4J8D A;  3D9L A;  3KV4 A;  1HF8 A;  4ASK A;  4QXC B;  4Y6C A;  4PJJ A;  3VLF A;  3HIZ A;  2CWY A;  1BR2 A;  2G0U A;  2PZI A;  2XUE A;  4KP3 C;  3TL5 A;  4LCT A;  4A56 A;  2WPV A;  4IHJ E;  4O4L E;  3SD5 A;  4CGV A;  3Q5M A;  1UCU A;  4TV9 E;  1MMN A;  2MTQ A;  2X9H A;  2YIN A;  1LVF A;  2YHE A;  4DJA A;  5FWQ A;  4PJN A;  3RYF E;  5BPP A;  3O48 A;  3QWP A;  2N1G A;  1S0P A;  2V4L A;  4NRH B;  3CK7 A;  4CRW A;  3SRZ A;  3FUN A;  4IRU A;  3MK7 C;  3HR0 A;  2H7O A;  3CSF A;  2OVB A;  3MKQ B;  1E7U A;  3ZCI A;  2N9D A;  2DBA A;  1OWP A;  4Q94 A;  4N39 A;  2IAK A;  2XGS A;  1E8W A;  3DJB A;  3DTO A;  3IHY A;  1H19 A;  3O1J A;  1BPO A;  2GGF A;  3FP3 A;  3LBX B;  3JQ0 A;  4N2S A;  1UN8 A;  2WXL A;  2PQR A;  2NOX A;  4O2B E;  2KZ7 B;  2DCP A;  3RO3 A;  3SBT B;  1IZN B;  2DHR A;  5E0O A;  3TXM A;  3G2V A;  2WXM A;  5L3E B;  1TEZ A;  3ASG A;  3N9M A;  3WI3 A;  1HH8 A;  2IOL A;  4KBM B;  4RSY A;  1H6K A;  2YNQ A;  4IYP A;  4I6J A;  3ULQ A;  1IJ5 A;  2VQ2 A;  1KNZ A;  3N2K E;  5BV1 A;  3N9O A;  4O4I E;  5JDN A;  3HVE A;  1U3D A;  4ADZ A;  4AQG A;  2XAQ B;  3C64 A;  4PJM A;  3CVN A;  4G24 A;  4JA7 A;  4PS3 A;  4KYO B;  5D0O D;  5CCM A;  3KV6 A;  5ARF A;  4A1G A;  3HKE E;  3HI2 A;  4AY6 A;  4JPS A;  3CHM A;  4FU3 A;  1YKH B;  5JR9 A;  1WLX A;  2NC9 A;  4ZI3 C;  3LCA A;  2P9B A;  3ASH A;  1OWO A;  3LBX A;  2LOS A;  4WW0 A;  4FJZ A;  4ZS3 A;  5EZY E;  2W62 A;  5EX3 A;  3VU7 H;  2HH7 A;  4HOS A;  1HX8 A;  4PS7 A;  2XGM A;  3BQK A;  2B1E A;  3BK9 A;  3RYI E;  1D1B A;  4QX7 B;  3FDH A;  5LCY A;  3DP7 A;  2C0M A;  2V7M A;  5FY1 A;  5D0Q D;  4CT4 A;  1SA0 E;  2XQY A;  3AAI A;  4BTB A;  2J4B A;  2ILR A;  2X38 A;  1HS7 A;  3FWV A;  4R7L A;  4JLE A;  2J09 A;  4DLO A;  2WXP A;  2XPY A;  2R59 A;  5HWY A;  3P7I A;  3KD7 A;  4YFS A;  3ZJ2 A;  4I6G A;  3KV9 A;  3U64 A;  3TAX A;  4TX5 A;  2E0I A;  1KT1 A;  3VHL A;  2IOS A;  4UQZ A;  2W00 A;  4IUL A;  5FZQ A;  2AW6 A;  1JWF A;  4B8C B;  3PU3 A;  4AJW A;  2ZU6 B;  1X79 A;  3FUL A;  3ZYM A;  4FUL A;  2UXX B;  4XKB A;  3CKC A;  2C5I T;  2JMK A;  2HR2 A;  1B7T A;  2BZB A;  3EVY A;  5KX5 E;  5FT9 A;  2BVM A;  4JL0 A;  2HO1 A;  2V7K A;  2KZT A;  2CHW A;  4G1T A;  2XAJ B;  3SZ7 A;  5L3B B;  4N5C A;  4H9S E;  3RYC E;  3PE0 A;  1U3C A;  2A2F X;  4EZH A;  4X1I E;  3ZMT B;  5JH7 E;  1IQR A;  2LEH A;  1ZHC A;  2I1J A;  3G2U A;  2ODU A;  3GN5 B;  1IYG A;  4X1K E;  1FMV A;  4A1S A;  5G04 J;  3AVR A;  4UIG A;  2XEV A;  3NF1 A;  5AEN A;  4TZ4 C;  4BT8 A;  5LOV E;  3LYA A;  3CVY A;  4GA2 A;  1QZ2 A;  2PM7 A;  3EDT B;  2IC9 A;  3R7R A;  2KXP B;  3PDN A;  3CHR A;  4XI0 A;  3E0Z A;  4P0B A;  1S94 A;  2X6J A;  5DJQ C;  4OHF A;  2J4D A;  2LSY A;  2V7L A;  1AJ3 A;  4U0Z A;  3CX8 B;  3SF4 A;  3AAE B;  3U3I A;  3ZXS A;  2H3R A;  4UWL A;  3P8C D;  3O4Z A;  2XPZ A;  3SI5 A;  3GA8 A;  4K0U A;  4OYS A;  2CA5 A;  1MIW A;  4U0U A;  5ETW A;  3URZ A;  5LCW C;  5DBK A;  5F3J A;  3GW4 A;  5T4Y A;  3VLE A;  2MRI A;  3CLJ A;  1ZEE A;  3CIA A;  3PRE A;  1KLX A;  4UV9 B;  4J6I A;  4GYO A;  4CZZ B;  3ESL A;  3ZEF A;  1EPU A;  5FP3 A;  3O1H A;  5DAB A;  2VGX B;  1FMW A;  4GMJ A;  1MND A;  1Z0P A;  5CMY A;  5CA1 E;  2ION A;  2XAF B;  3HL6 A;  2I1K A;  1INZ A;  5FTP A;  4H63 V;  3CEQ A;  4YHJ A;  4PH4 B;  3HVE B;  2RG8 A;  2J07 A;  4HOT A;  1MIY A;  5FXX A;  3AVS A;  3FH8 A;  2WXR A;  1MHQ A;  3W15 B;  3FB2 A;  4JEU A;  3PE4 A;  2WXF A;  3FUH A;  4CDN A;  1D1A A;  3ETU A;  3KVA A;  2LAI A;  2ODV A;  5JR9 C;  5JRE A;  3FU3 A;  3UX4 A;  3SHF A;  5A6C A;  3SWH A;  3ZN3 A;  4WBO A;  5FNV E;  2M63 A;  3CK9 A;  4DVD A;  1D0X A;  4KBQ A;  4JHJ A;  4BX8 A;  2A3D A;  4B8A A;  3OXF A;  5AJD A;  2CHX A;  1S35 A;  2VKJ A;  2CG3 A;  2AXU A;  3FBL A;  2EHO B;  3MA5 A;  4LRZ A;  1DNP A;  4U04 A;  3ZYQ A;  2D0T A;  4H9Q C;  3MJX A;  2IC6 A;  2OV8 A;  3CVX A;  1PY1 A;  2PFV A;  1UX4 A;  2X51 A;  4P0A A;  5LP0 A;  3FTX A;  3E08 A;  3RRU A;  4UQX A;  4AKH A;  3I3N A;  3BQL A;  3L22 A;  3L54 A;  3PNT B;  4L23 A;  4EXT A;  4FAD A;  3S7F A;  4EBA A;  1ELK A;  2FI7 A;  3PUQ A;  2KCV A;  2CLY C;  3HKD E;  4KZC A;  2JPF A;  1GW6 A;  3PZD A;  3S7D A;  3FXE B;  1EYH A;  5HQ8 A;  4BJN A;  4APF A;  2NTX A;  1PC2 A;  4EPZ A;  3KFW X;  3PEU B;  3TJP A;  3VTX A;  5T8I A;  4UI9 J;  5HI7 A;  2E9X B;  3CX7 B;  5DQW A;  5H6R B;  3K3Q C;  4O8S A;  5EKQ D;  4CXW A;  3VKH A;  3GMI A;  4F3V A;  1G8X A;  1QNF A;  2WXQ A;  1V9D A;  2WXH A;  4C0E A;  5LG4 A;  4G63 A;  1NA0 A;  3QB2 A;  2UWJ G;  2L6J A;  2ZMA A;  3J9X 1;  2MYS A;  4C91 A;  4HTE A;  4PK4 A;  4I17 A;  1X5B A;  3ONK A;  1HG2 A;  4PFO A;  5KMG P;  1WYC A;  2DWG A;  2QY7 A;  3GZS A;  4H9P C;  4L7T A;  5FY7 A;  4RG9 A;  3UT4 A;  3UUL A;  3ZC1 A;  2KT9 A;  2VWA A;  2R5S A;  2AXV A;  3GZ2 A;  2X6I A;  2KCL A;  5E76 A;  2C2L A;  2LAH A;  2L9Q A;  3F2E A;  5BW8 C;  3M65 A;  2PQN A;  1G73 A;  2Q9Q B;  2XPI A;  2EHO A;  4O4J E;  3D9P A;  3RJV A;  4AM9 A;  3L16 A;  4E7Z A;  4JHR A;  5EK3 A;  3AU5 A;  2VSN A;  4EZK A;  2X6H A;  5L3G B;  2V26 A;  4I4T E;  3LFM A;  4J0U A;  2X9Y A;  2LT3 A;  4FLB A;  2BUG A;  4OK0 A;  2V8S E;  5LCW J;  3AS4 A;  3FU5 A;  3LDZ A;  2HM8 A;  3ONX A;  1HCI A;  2JRK A;  1MIV A;  4AEZ C;  2E2E A;  4AKG A;  3L13 A;  2K48 A;  2VAS A;  4ILI A;  1P5Q A;  3RC3 A;  3R84 B;  4IN3 B;  3Q47 B;  2KWI B;  4B0Z A;  3HDX A;  3TGO A;  2D0U A;  3LJC A;  3FTV A;  3WXX A;  2XRY A;  4PFP A;  4UWF A;  5A23 A;  4ERR A;  2VJ8 A;  4DK5 A;  2Y48 B;  4N78 D;  5FZR A;  3RX6 A;  4JVS A;  5AIJ A;  4GAA A;  5BT1 A;  5HXE A;  4JA9 A;  2HYZ A;  2CM0 A;  1BR1 A;  3ZMV B;  2WVI A;  4F1S A;  2YQ8 A;  4FHJ A;  3RPU A;  3D9N A;  2H7V C;  4AXP A;  4G11 A;  3S4U A;  2D5U A;  3R7Q A;  4ZI3 D;  2XGO A;  4GOU A;  4KUM B;  2LSG A;  3LKU A;  3F31 A;  1IJ6 A;  3LVR E;  4XI9 A;  3MV3 B;  4PK5 A;  4CT0 A;  3PS6 A;  3MKD A;  3C4W A;  3PRZ A;  4O2A E;  2XAH B;  3ZN0 B;  4N3B A;  3EJN A;  3OBV E;  3AAA B;  4H9R C;  3C4Z A;  4WNG A;  4IST A;  4HS2 A;  4N3C A;  4C9B B;  4JXT A;  4CI3 B;  1WYB A;  4L9I A;  2XCC A;  3NQP A;  2X66 A;  2X0L B;  5AFU L;  4ZI2 D;  3Q5W A;  4TV8 E;  4GPK A;  5HXS A;  2XHE B;  5LOZ A;  3MKQ A;  3ZCJ A;  2JJ9 A;  4ANJ A;  2XAS B;  3OYX A;  5J90 A;  3UT5 E;  2WM9 A;  5JDH A;  3E22 E;  3NZP A;  2DI4 A;  3FHE A;  2E9X D;  4A3T A;  1FEW A;  1EF1 C;  4HFV A;  4PJL A;  3HKB E;  4WWO A;  1H2V C;  3RRM B;  4ACK A;  5ARG A;  1VDY A;  2VTB B;  5EDS A;  5M4Y A;  3FFL A;  5G55 A;  2VGY A;  3AA1 B;  4KT6 B;  2DLR A;  4JZY A;  1QUU A;  4I6E A;  2ACX A;  2JLB A;  4N2Q A;  3ZYL A;  5EK2 A;  3FEY A;  1O3X A;  4I9C A;  1ZU2 A;  3S7J A;  4AKL A;  4K03 A;  4CDR A;  5FXW A;  3QOU A;  3I0O A;  4MRU A;  4CI1 B;  3I9Y A;  5KDM C;  5DIZ A;  1E8Z A;  4FA6 A;  1U5P A;  3CVL A;  1HU3 A;  3PE3 A;  2YK0 A;  1LKX A;  3LK3 B;  3LY7 A;  3EIJ A;  5IHY A;  2WXO A;  3FXD B;  2OVF A;  3L3P A;  2HPL A;  1W3B A;  3D0T A;  2XCB A;  3OXG A;  3FTU A;  5EX0 A;  1ZKE A;  3CPZ A;  1YW0 A;  3K8P C;  2WQ6 A;  3G2T A;  3FH7 A;  1UW4 B;  3CQX C;  1IAP A;  3LG7 A;  3TXN A;  1HE8 A;  2FBN A;  4MAL A;  4G2V A;  3KVB A;  3PUR A;  5LGU B;  4V3I A;  3IF8 B;  4PAG A;  3ZN1 B;  2IW5 B;  3OXL A;  3G2S A;  1SZ9 A;  1TJC A;  5M72 A;  4YJ3 E;  1LVK A;  2VYI A;  4AVX A;  1SHZ C;  4HVB A;  3L17 A;  1XGW A;  2KLQ A;  2WBL A;  4IE4 A;  4BSX A;  3NBX X;  4G2A A;  4I50 E;  5JDF A;  5LX8 A;  2WB2 A;  1FCH A;  2JMH A;  3SBS A;  1UX5 A;  4U72 A;  4ZI2 C;  1H2T C;  5IYZ E;  2WWU A;  4HOU A;  3I9W A;  4XZC A;  1Z3Y A;  3MJW A;  4I9E A;  3TG5 A;  5GON E;  3FTS A;  3T8O A;  3ZW3 A;  4BA9 A;  5L3D B;  4QKN A;  4UVB B;  1KT0 A;  3PUA A;  3LK2 B;  2BF0 X;  4F7A A;  2KZT B;  3EDV A;  3PNL B;  4PDX A;  3WAK A;  2Y6X A;  1EDU A;  3O4X E;  2I6H A;  3RKV A;  4ZOL E;  3ZC0 A;  5HXH A;  3RRN B;  3GN5 A;  4GZ5 A;  4XZ4 A;  2Y4U A;  4AXH A;  5L3C B;  3CHP A;  3V5U A;  3IHV A;  4ANX A;  1UN9 A;  2KIN B;  3B13 A;  3CML A;  4U74 A;  2CXF A;  1B89 A;  4EIW A;  3RRW A;  2RD0 A;  2K9A A;  1Z3X A;  2WQH A;  4WBN E;  4LEU A;  3FY4 A;  3I4G A;  3SS1 A;  3R9A B;  2L9B A;  1N54 A;  4ZS2 A;  3ZLI A;  4DMW A;  4AKR B;  2MOW A;  3ZJ1 A;  2C0L A;  1FVF A;  2OOE A;  3FTY A;  4OYK A;  4DBQ A;  1Z6T A;  2CFU A;  3A5X A;  2AVP A;  3B57 A;  5FXV A;  3PUJ A;  5ANL A;  2WSS V;  4BFR A;  2XHE A;  4UF0 B;  1T98 A;  4UEL A;  4K0R A;  4GYY A;  4NUV A;  4X20 E;  4HN9 A;  3Q15 A;  3N9Q A;  1LF8 A;  4QXH B;  3LS8 A;  1NP7 A;  4A3V A;  4GK5 E;  3BG0 B;  4I2W A;  4JW1 A;  4UVC B;  4XKC A;  5KCM A;  1WRD A;  3K3O A;  4JEH B;  2X9X A;  3CVR A;  3ZMU B;  2V7J A;  2NTY A;  3ZEF B;  3S7B A;  3UT8 A;  2WXN A;  5CCL A;  4WNF A;  5HYA A;  2VL8 A;  2IQC A;  5BMV E;  5F8P A;  2UY1 B;  4BJM A;  2DIW A;  3SFZ A;  3V5S A;  4FP7 A;  2NW9 A;  3KV5 A;  5FQ7 A;  4ACL A;  5JJ6 A;  4ZI7 E;  3QAQ A;  4WND A;  3QWV A;  4DI3 A;  4IE5 A;  1FIO A;  4FJY A;  2LSI A;  3FUM A;  3B7S A;  4YLH A;  3ZHE B;  4UV8 B;  4MLK A;  3PDY A;  4RVB A;  4GML A;  4IGU A;  5LA6 E;  4JHK A;  3K3N A;  1ZBP A;  5J1G A;  3SOL A;  2CCQ A;  4W9R A;  3QK6 A;  4IE6 A;  4EQF A;  4AI6 A;  5EK4 A;  3EIQ C;  2NW8 A;  2LO6 A;  3H37 A;  2V7I A;  2KC7 A;  4H9N C;  2VB6 A;  1US7 B;  4AY5 A;  1UJJ A;  2EQX A;  2K24 A;  3SNX A;  3TKL B;  3LPZ A;  2J9Q A;  2LNI A;  4XIF A;  3AA0 B;  2L8K A;  5LGT B;  5JJT A;  5HXR A;  3CR3 A;  3CST A;  3C98 A;  5FMN A;  1HXI A;  3UFE A;  3I4R B;  3P2B A;  2I9C A;  4TN7 B;  5JHB A;  1OWM A;  2X3M A;  2CHZ A;  5LJN A;  3TG4 A;  4BY6 A;  3KBU A;  4E85 A;  3MZK B;  3UUX A;  4IE7 A;  2IF4 A;  3CQG B;  5LYJ E;  3OTN A;  3RU0 A;  3KDS E;  1ELW A;  3LXU X;  2JQQ A;  3IHR A;  4J8S A;  4WNK A;  1BR4 A;  4M1P A;  1U4Q A;  5KJK A;  4JEH A;  4HOR A;  3AU4 A;  4UEM A;  5LNK A;  4HLE A;  4ATG A;  3ASF A;  2YU2 A;  2GW1 A;  3IBE A;  3B7U X;  2WQ7 A;  4B94 A;  3GZ1 A;  2CXL A;  2CWO A;  3CVP A;  4EAH A;  3RO2 A;  4GK0 E;  4XX5 A;  5FYM A;  3ESK A;  3U66 A;  1Y64 B;  3SGH A;  5ENN A;  3T5X A;  2R17 C;  2LSJ A;  5JRC B;  4CI2 B;  2LJL A;  5JDL A;  3RIB A;  3MX3 A;  3FU6 A;  3FUD A;  3NZQ A;  3ML8 A;  4ABN A;  2NW7 A;  2LM9 A;  2J49 A;  3D9I A;  4FJO A;  2LE8 A;  4HFG A;  5AYW D;  2X6F A;  4APO A;  3AB3 B;  1CUN A;  3CHQ A;  4ZHQ E;  4GA0 A;  5LHI B;  1Y8M A;  2XAG B;  4J8F A;  4B89 A;  5CB4 E;  1MNE A;  4GYW A;  2WXI A;  3N2G E;  3OKQ A;  2EHO C;  4EEC A;  3FH5 A;  4EZJ A;  3CWZ B;  4UWK A;  4IDZ A;  3AS8 A;  4PS8 A;  2OA5 A;  2A72 A;  3APD A;  2L0I A;  4NQ0 A;  5LXT E;  2GRM A;  4CEM A;  1HS6 A;  3ZMS B;  3Q5X A;  3CV0 A;  1NZN A;  1A17 A;  4UXN B;  4KVO A;  4CGW A;  4XE0 A;  3MZL B;  3CGH A;  2JEK A;  4X1Y E;  3IEE A;  3N5L A;  4ANU A;  1SZA A;  4WNE A;  3MAC A;  3D9O A;  3MA9 A;  1PAQ A;  3RH3 A;  2Q9Q C;  5KJN A;  2KM4 A;  4GA1 A;  4GZ6 A;  4DI4 A;  2HPJ A;  2LOP A;  2I2O A;  2PBI A;  3ANW B;  5FJY A;  4AKI A;  4DND A;  4IIJ E;  1D1C A;  3JQ1 A;  1ZV4 X;  2M67 A;  5JDG A;  5KJM A;  4KZ0 A;  3RRC A;  2ZM2 A;  1VOM A;  4JUY A;  2DWK A;  2OND A;  3C51 A;  4URK A;  3CKB A;  3EUH A;  3I1A A;  3ZGQ A;  1BR0 A;  2LHN A;  2UY1 A;  5JDM A;  4EYU A;  1WY6 A;  2ZLY A;  3UPV A;  3QKY A;  1UJK A;  4UWH A;  4FC8 A;  4MS6 A;  3LVQ E;  2E9X C;  5BUZ A;  4EOZ B;  3CHS A;  5JHA A;  2PG8 A;  2PM6 A;  4H7Y A;  2QFC A;  4O6F A;  4AQF A;  3PUS A;  2WAU A;  1E1H B;  2WXK A;  3QNK A;  5JRC A;  4LER A;  5JVD E;  1HZ4 A;  2Q9Q A;  3ASD A;  3VTY A;  3HA4 A;  4I43 B;  3QK0 A;  3LEW A;  5BV0 A;  3T5V A;  1OUV A;  5A7D B;  4ISS A;  4BWR A;  2W0G A;  3MCX A;  4C0M A;  4L0R A;  1QQE A;  3GYZ A;  4MBQ A;  3D9M A;  1VRB A;  3ONL A;  3L09 A;  3JUI A;  2VKO A;  1YKE B;  4I2Z A;  2AXZ A;  2VK9 A;  3FUE A;  3CX6 B;  4GYS A;  5LHH B;  2I59 A;  4Z8X A;  4CQI A;  2ZM0 A;  4GCN A;  1IQU A;  3MEK A;  3LY8 A;  2V1D B;  3FHN A;  4ANW A;  2CG2 A;  2BVL A;  2WXJ A;  3I5P A;  1MMD A;  3ZPO A;  3DBS A;  3BQI A;  4CXY A;  2LHR A;  4QX8 B;  4CCA A;  3CVU A;  3RYH E;  2NSZ A;  4G25 A;  4UVA B;  3ANW A;  3CKD A;  1E90 A;  4FI5 A;  4G26 A;  3OJA A;  3U4T A;  4HGA A;  1MQS A;  4OYJ A;  4WWP A;  3NZU A;  1DVP A;  2NWB A;  1H0A A;  4L2L A;  5LGN B;  5A1L A;  2VGX A;  1IHG A;  2L3L A;  2QGS A;  4Q96 A;  1TJF A;  3PVL A;  3JC6 C;  3MGB A;  2V5F A;  3QJZ A;  4EYY R;  3D3M A;  3ETV A;  5FQ8 A;  2AWI A;  2WXG A;  4H63 H;  1FVH A;  2W61 A;  2KAT A;  2KWH A;  4I1A A;  1JPL A;  2Y8D A;  3OAW A;  3C4X A;  4Y6W A;  4A55 A;  4JEU B;  1N52 A;  3LK4 2;  4L1B A;  1UG3 A;  3FUK A;  2VSO E;  5LJM A;  1YD8 G;  2CMR A;  4BX9 A;  3FTZ A;  3P1U A;  2YEV C;  4CDM A;  2RP4 A;  3FTW A;  2X6K A;  4DBR A;  2D2S A;  1HTJ F;  4DO0 A;  3ZHE A;  5DQV A;  4U07 A;  4AQF C;  1H7C A;  5C8Y E;  2VKH A;  3FBZ A;  4PW8 A;  3FU0 A;  3DPD A;  4NAC A;  4D10 C;  4FHK A;  3AA7 B;  3PEV B;  5BNW A;  4O4H E;  5LBM A;  1MMG A;  4AOF A;  2QA7 A;  5FZS A;  3HKC E;  4P29 A;  2A5U A;  3N9N A;  3ML9 A;  2SPC A;  4YJ2 E;  2VSX E;  3E4B A;  1D0Y A;  3PU8 A;  1KK7 A;  2W63 A;  4QWN B;  5JQG E;  4EZL A;  2FEZ A;  5LBQ B;  3FUF A;  3ENE A;  5FXZ A;  4GZ3 A;  3FEX A;  5L3F B;  1H2U A;  4H7X A;  4HEA A;  3KEZ A;  3IEG A;  2FUL A;  3HYM B;  5HWX A;  2Z6E A;  4KMO A;  5TAO A;  4B6X A;  3MXZ A;  4EBA G;  4HKA A;  5CMW A;  3PTR B;  4KMC A;  3VKG A;  3I0Q A;  1SQM A;  3VLD A;  2IJG X;  2CE7 A;  3S2A A;  5E75 A;  1EZ3 A;  2XRZ A;  5C2Y A;  3PUG A;  4J2C A;  3UMV A;  4BAY B;  3QC9 A;  5C1D A;  4AP2 A;  2J1D G;  3G2W A;  4TRQ A;  4HOQ A;  1ELR A;  3ZVV A;  1MMA A;  4CXX A;  3N9P A;  4GIW A;  4HXI A;  3QWW A;  5CA0 E;  4I43 A;  2BDE A;  4AIF A;  4ILG A;  1HO8 A;  4TUU A;  2YU1 A;  3NZS A;  5LHG B;  3APF A;  2WMN A;  5FQ6 A;  5L2L A;  3K9I A;  3APC A;  5FQ4 A;  4OVU A;  1JUQ A;  1NWM X;  4ILH B;  1NAF A;  3MKR A;  2KMF A;  2GRL A;  4L2Y A;  3EHN A;  3U78 A;  3WAJ A;  3D9K A;  5J2T E;  4M3O A;  2LSU A;  3UUM A;  3KIN B;  5CHE E;  2C0S A;  4PNI A;  2J08 A;  4C90 A;  3O9X A;  2FO7 A;  3EHM A;  3LY9 A;  2X68 A;  4LUN U;  3N9L A;  2CFZ A;  4NUU A;  2Q9Q D;  4ME2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...