1HF8A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Clathrin
total genus 102
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hf8A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hf8A01
1UJJA 3ONKA 1ELKA 2DIWA 1EYHA 4Q94A 2V8SE 4FLBA 5J08A 1JPLA 3D9LA 3D9IA 3D9MA 5CMYA 3G2VA 3RRUA 3D9OA 1JWFA 3G2UA 1SZ9A 1SZAA 4NACA 3D9JA 4Q96A 5LOZA 4FU3A 1UJKA 1JWGA 3ZYKA 1XGWA 4GZCA 3ZYMA 2QY7A 4HFGA 3ZYQA 3G2SA 1VDYA 3G2TA 1LF8A 1PY1A 2MOWA 3D9KA 1HG5A 1HFAA 1MHQA 2L0TB 3G2WA 2DCPA 1HX8A 3CLJA 3LDZA 4AVXA 5LP0A 3ONLA 1JUQA 2LO6A 2KM4A 3D9PA 4GZDA 4JXTA 3ZYLA 1HG2A 1HF8A 3D9NA 5CMWA 2L0IA 1EDUA 1INZA 1H0AA 2BF0X 1DVPA 1X5BA
chains in the Genus database with same CATH superfamily
5LHIB 4UR9A 3ZHEB 5B3SE 1FEWA 3KV5A 4EGWA 1H2TC 3N5LA 3SD5A 3O4ZA 3ZYKA 4APOA 2UU9T 1D8DA 1KLXA 2QZAA 2XHEA 3PZDA 3C98A 4H7XA 3CHOA 4DX5D 2KLQA 5AQNB 5AQTB 4U33A 5AQFB 2LE8A 4WYVA 4LF5T 2ZXWE 3P8CD 2P9PG 4DO0A 2ODUA 3PVLA 1Y6IA 3P4PA 2ES0A 4QKNA 4IE0A 2EIKE 2NW8A 2WAUA 2FBWA 2QYJA 3D9IA 3RRNB 2HHHT 4Q96A 3T9KA 1U2VG 3BUAA 2LSGA 5H6QB 3MKRA 2KXPC 4IRUA 4ZI3D 2IJGX 4JI6T 2PQRA 4EYYR 2P9IG 1P5QA 5DJQC 4LNBA 3DXKG 2A5EA 3AG1E 1HZ4A 3K1SA 5BPPA 1S35A 5LHGB 2WCAA 3ZXPA 3G2VA 1MX6A 1JNRA 4UVCB 2X9HA 1FPPA 3O1HA 1VCSA 3UUXB 4H9OC 4H63V 3T1YT 3CVYA 3LJCA 3DWLG 2GRQB 4DV3T 5FXVA 1IQUA 4UV8B 4HRMB 4LRZA 3CHSA 2WQ6A 2LRLA 2A72A 1Q2ZA 5H7PA 2BKGA 4CI2B 4AIFA 5ABFB 3CVLA 4U8VD 4A55A 4J6IA 3N2KE 5HCJA 2EHOB 4U0ZA 1KF6A 5BR8T 4JUYA 4TRQA 2VSNA 5ENPD 2XQ8A 4CXXA 3ABKE 4JHJA 3IBEA 3OVUA 3B57A 5LFAA 1N52A 3VR9A 2L6BA 2IF4A 2JMKA 4GTPA 3WXXA 3C5RA 1BU9A 4IDZA 3IKOB 4MKTA 4DR7T 1FT1A 1KZOA 4KI0F 1RW2A 3Q5EA 2IC9A 3M3ZB 5JH7E 2NR4A 2Y8DA 4CXWA 3RHWA 4G24A 2D5UA 3N9OA 5JRCB 4GTSA 4DVDA 2F0YA 5DBKA 2YDRA 1OXJA 3PUVF 4QHOA 4LEUA 3S7JA 3TG5A 2YU2A 4HFBA 3CK9A 3FH8A 4WZXA 3FUNA 2MAWA 4TN7B 3JC6C 3FY4A 3QJZA 5ENRD 2M67A 5ARGA 4GYWA 2YHCA 1L5JA 5FNVE 5DQWA 4I6GA 3QOUA 5FQ8A 4I50E 2EIJE 4JHRA 4DR6T 3CHPA 4AISA 4BERA 2JJ9A 1AJ3A 3I9WA 2H6GA 4XKCA 5BXUA 3CGHA 2IDOB 2R17C 3V2XA 4H9PC 2RA1A 2OLTA 5E0OA 3SGHA 3AS4A 2DNXA 2I59A 5AQ7A 2ZM6T 4FA6A 3PUAA 4N78D 2IIUA 4BSXA 4MRUA 3MKQB 3Q9NC 3PE4A 4JD2G 2JQKA 5D66A 2WB2A 4XBFB 4KX6A 2H6IA 3UM2A 1H2UA 2KNDA 3RH3A 5JTGA 4AM9A 5A7DB 4B6XA 1JPLA 4HNAD 4I6JA 4HFCA 1KZPA 3I5PA 5ARFA 4LNUD 4ATGA 3R7QA 3BQIA 4AQYT 3AU4A 5F5WA 4G1TA 4UXNB 1WCRA 2WMNA 4ILHB 3GZSA 2FJBA 3O1JA 1LTXA 3CKBA 2FJDA 4B8CB 1RZ4A 4IL4A 1Z8UA 3R6NA 3QB2A 3KVAA 3QNUA 4GK0E 4GAAA 5KJMA 4N2SA 3PUSA 3KSQA 5L3BB 1YQ3A 2RFAA 4H9RC 5KCMA 4ASKA 1X9BA 2X67A 5EN5D 2V0PA 4TUUA 3EHQA 4HBDA 4E7SA 3RU0A 3KVBA 2M6BA 3ABME 2WQ7A 2WB5A 3MZKB 5KJKA 3MA9A 1OEDB 4O4IE 3C4XA 4RLYA 2I2OA 4GYSA 4YJ3E 2WMOA 2NW7A 2BVMA 2X6KA 2KSRA 5G05J 3TAXA 4KBMB 5LMNT 5D0OD 2BS2A 3EAMA 3AG2E 4L23A 5ABHA 4GZ5A 1UX5A 3ESLA 4YTMA 4EB6E 3UM3A 4KHZF 4IHJE 4XZCA 5T3RA 2KCLA 4QXBB 3L13A 4H9QC 1SHZC 2BBJA 2OA5A 4U74A 3TLSA 2GROB 4P1NA 2C5KT 1BI7B 3MGBA 3P4WA 1N34T 1BPOA 4C0EA 4DX7D 5EYLA 2L0TB 3MA5A 2B0OE 4FJYA 4WWOA 1HH8A 1Z3YA 2C0LA 4QQIA 2PBIA 1TN8A 5FXZA 4EXTA 3UM1A 2QYWA 2LT3A 4Z8XA 4ZZBA 3FTUA 5ENTD 3UX4A 4TWDA 1INZA 4H7YA 1IBMT 3K3OA 4ZFHA 5J2TE 2NWBA 2BG9E 2PNNA 3KDSE 3UM0A 1D1CA 3QK6A 3TXNA 3CIRA 2DYSE 5AQQB 4PNIA 4Y6WA 2BG9A 3MK7C 2XCCA 5HWYA 3C4ZA 3PZ1A 3ZT5A 2BBHA 3GA8A 3AXJB 3E0ZA 3UKUG 4C9BB 2ETBA 1ZU2A 3ASNE 2V5FA 1KNPA 2Q9QA 3VHLA 1HS7A 4FLHA 3EHNA 4J8YA 3UUBA 2A4ZA 3SFZA 3HXFA 2DZOA 1HF8A 2WXRA 2V7JA 1H6KA 2ETAA 5FJYA 1S63A 5J08A 2KINB 4ANUA 2ZM2A 2C2LA 2IQCA 4QX7B 2XASB 4PH4B 4AQFA 3MZLB 2WWVA 5HKPA 5DIZA 1OWMA 1US7B 4L5GA 3UU6A 3CR3A 3HKCE 3S7BA 4CXYA 4GIWA 1QQEA 4G2AA 1ZEEA 3QB5K 2GRLA 5M4YA 2J9QA 4PS8A 2W00A 5LJNA 1JCQA 2F4VT 5L2LA 1E7PA 3E08A 3N9QA 4Q25A 2NTYA 4CDRA 3UXGA 3FFLA 5LG3A 4B3ST 2Q9QD 4EECA 3LFMA 2YU1A 3JAFA 5FYMA 2XPYA 2CM0A 4HWIB 2KATA 2AXVA 3HIZA 1IQRA 4ILIA 2W2UA 3M65A 5ANRA 5CBOA 4IN3B 3NOGD 4B8AA 3ZPJA 4IL9A 3AE4A 3PUKA 2MOWA 4I1AA 2K48A 3FUFA 2IAKA 2C0SA 2XAQB 1E7VA 3CMLA 3S4UA 2OCCE 3G06A 2MRIA 2QYUA 5FY7A 3ETUA 4APFA 2VKDA 3OJAA 4GYRA 5T8IA 4F7AA 4TNVA 3L6AA 3UT4A 2KXPB 4FU3A 4QWNB 2V7MA 3CVRA 4U72A 3X2QE 1BR0A 4FI5A 3SF4A 1O1TA 4DV1T 5M72A 3ML8A 4COFA 4KXKB 4V1Av 4JLEA 2IY0C 2V7KA 3VU7H 1IBLT 2X6IA 1S94A 4UI9K 2X0HA 5HCMA 1FJGT 1UCUA 4A3VA 1Y01A 3Q2MA 2VTBB 4FADA 5CCMA 4L7TA 2H88A 2XQ9A 3W9GA 2XJ7A 2XEHA 4PJNA 4K5BA 2BS3A 4H9SE 3KSLA 3ZKJA 4OVVA 3ZSSA 3PDNA 1V54E 2EILE 2D9DA 3LY8A 3PUWF 2XGMA 1SA5A 4U07A 5LHHB 4KP3C 2HO1A 3CHRA 2UWJG 4HOTA 2VGEA 4CRWA 1KNRA 2WQYA 5A6CA 3LS8A 2XM1A 2BKNA 2HYZA 2LKHA 1SE7A 3FXDB 3AE7A 2RG8A 1MJ0A 2L3LA 3G2UA 3Q75A 5BXOA 5HEJA 4O60A 2BKOA 4YJ2E 1TN7A 4G26A 4HFIA 3ETVA 1HG5A 2VB6A 4Q69A 2H3RA 2VL8A 2WSSV 3LDQB 5JQGE 4BT8A 4I9CA 5BT1A 1WYBA 4CEMA 3AEAA 4ILCA 2CHOA 2WU2A 5KJNA 3AE9A 5FVLA 3RK6A 4B89A 3V79K 1ZOYA 5JDMA 3KEAA 3FH5A 1UJJA 4EZ4A 5JR9C 5FT9A 1YCSB 3KAEA 1HO8A 3J5QB 1IZNB 4DR4T 4AKHA 2MPKA 3E4BA 2FO1E 3HI2A 2DWZA 4JB8P 4ZOLE 4FJOA 4OVUA 1WR0A 4GCOA 3SOLA 4YDWA 4OAVB 4XEIG 2H6FA 5C1DA 1MX4A 4ANWA 2DCPA 3FTVA 2AXUA 4J8DA 4EOZB 4EEBA 2J47A 1XMOT 4AVXA 5CB4E 3HVEA 2E9XA 4MBQA 4EV6A 1N95A 4UELA 4HRNA 2FI7A 4F6RD 2OV8A 4AKGA 3P4RA 4IE4A 3FUDA 5G2NA 4HVBA 2VGXB 1FIOA 3RRUA 4BSZB 4CDMA 3PNLB 3FULA 2UUCT 2D0UA 5L4EA 2QGSA 1TNYA 5CJ5A 2XPZA 2BVLA 5FMNA 3EHMA 2KZ7B 2P9BA 2UY1A 4JHKA 3AE1A 4YHJA 4KVMA 2ZU6B 2XGOA 3UT7A 5BNWA 5J0ZA 2LLYA 4OFZA 2XPIA 4XE0A 5A23A 4XAXB 4ERRA 2V5DA 2DVWA 3D9PA 4TX5A 3SFDA 3AA7B 3FHNA 3AJIA 5AAOA 2VSXE 2E5VA 1QYMA 3HXDA 4GTMA 5D2MC 3ZKRA 2CWOA 4O6FA 5BW8C 2R6GF 4WNEA 2E9XD 3FZKB 4JI2T 1U3CA 4I6EA 3ZLIA 1N11A 2GRPB 2WXPA 5KMGP 2UUAT 5KBAA 4F1PA 1JWGA 4DUYT 4GZCA 2QVAA 2AE9A 2LSVA 3ZXSA 4TWFA 4WWNA 3DSXA 5JDNA 4I43A 3I4GA 2W0GA 4U31A 4J0UA 1PY1A 2BG9C 3URZA 2N1GA 3QARA 2P2CP 4U95D 2OEWA 3TLTA 5LYJE 3RJVA 5CECB 2XQ5A 4K0UA 2KC7A 3PE0A 5L3CB 3ASHA 2PFVA 3RAUA 1ZBPA 5BUZA 2IO3C 2Q9QC 4JBWF 2E2EA 5CRUA 1MMNA 2MBGA 1GQEA 2XRZA 3WAKA 3KEZA 2OEVA 2DYRE 3AAAC 5EX3A 3TWSA 4A1SA 4NUVA 3Q5MA 3NZPA 4AQFC 3JYSA 2NXPA 3HKEE 4U7YA 2L8KA 3NBXX 2BKPA 1CHUA 2BKKB 1IAPA 2JQHA 4EIWA 5FQ4A 1IKND 1QUUA 2CBJA 2X0YA 4BJNA 5T4YA 4CT0A 4D10C 4IDPA 2AVPA 5JREA 2XQ0A 3L9TA 2YK0A 3OYXA 4KZCA 3NRXA 4EZKA 3APFA 3L3PA 4IGUA 3FDHA 2X68A 1X79A 4B94A 1OT8A 1MHQA 2XHEB 3C98B 5EIDA 4AIUA 3NF1A 4PFOA 1D8EA 3QDNA 2XM2A 2H7VC 2OOEA 3T5VA 4GKKT 2RP4A 4I1OB 2EINE 1DVPA 1NFIE 3JUIA 5JJ6A 1NAFA 1YKHB 3D9JA 4BT9A 4HI9A 4LUNU 4GYOA 5EK3A 2Q7FA 3AS5A 5ADXL 2A5UA 3PS6A 3IF8B 4AXHA 1WRDA 5FQ7A 2RPAA 3CK8A 4ABNA 5KXJA 3LVQE 3ZMUB 2ILRA 4N3AA 4E7ZA 3ZGQA 3FTZA 1YMPA 2JEKA 3CK6A 4PUCA 2V4LA 3QK0A 1X5BA 3EHZA 4AKIA 2VURA 3FZLB 2XAJB 3D9OA 5HS0A 1QNFA 5AQVB 2JQ9A 2KMFA 2HM8A 3CHMA 3C51A 4TZ4C 2M63A 2Y69E 1FMVA 4J7WA 3RPUA 3LK2B 4BWRA 5AQJB 3LCAA 4HLLA 3CLJA 4UWHA 4KYOB 4UVAB 3FUJA 3BK9A 3L39A 2WBLA 2XSBA 4TXQA 5TAOA 4DBQA 4ZS2A 4X65T 3PURA 5ETWA 3U3IA 4J8SA 3T8OA 4L9PA 5IYZE 3TG4A 3FTYA 1OY3D 1XGWA 3ZMVB 4YVOA 3LKUA 3CQCB 3U9WA 3Q5DA 3UU4A 1H6OA 3QOFA 1SW6A 3PTRB 3MKDA 4BX8A 2XEEA 2NYJA 5FP3A 3EUVA 2WU5A 1UW4B 2VL0A 4NQ0A 3N2OA 3PUJA 4TV9E 3TLVA 2RD0A 3ASDA 4JEUA 4ANJA 4F6RC 4DUIA 3Q9UC 4YLHA 2QA7A 3ZIMA 3H3MA 3RGLA 4HFHA 3S2AA 4OK0A 3D9LA 5AQSB 3JQ1A 4CN1A 1MIYA 1T98A 4HWFA 2J4BA 3Q78A 3DEPA 4G25A 2JQQA 1HNZT 1E8YA 3MV2B 2CA5A 5LGUB 1N36T 3HHMA 2I9CA 4X8QA 3ZCJA 1IJ6A 5ENQD 2CG2A 3ZHEA 2LO6A 3PEUB 5BV0A 2GK9A 3MYVA 3UINC 3BQLA 2KCKA 3MXZA 5B1AE 5JJTA 3F6QA 5LCWC 4CCAA 3B95A 2E9XC 4P29A 1HTJF 2UXCT 5LCWJ 3RRCA 5AQLB 3ZN0B 2ACXA 4B3RT 3B7BA 2ZISA 3VKHA 1YYHA 4HFDA 3DPYA 4IE6A 3CWZB 2IONA 2XQAA 1FT2A 2MTQA 2NW9A 1HR0T 1YXRA 5FVKA 4ZS3A 2GW1A 4ILAA 4WNDA 4ANVA 3CVWA 5HEUA 3KINB 3PUZF 3UFEA 2CG3A 1ZP0A 4G63A 4BETA 2PZIA 3U78A 1J5ET 2MHKA 1MIWA 3ANWB 3RQUA 4JI5T 4MS6A 3AA1B 2UUBT 4O4LE 5LMUT 4HOUA 1TNOA 3FB2A 3R9AB 1D0XA 3FTSA 4EEDA 2NSZA 2P9LG 4ZI2C 5G04C 1XNQT 2LM2A 3RRMB 5L3DB 5G04J 2VSOE 1H6PA 3L16A 5JR9B 3JCFA 5L47A 5FWQA 3U4TA 4AOFA 5KJLA 3N9LA 2OV9A 3HKDE 2XZTG 4YT0A 3K3NA 4OHFA 1A17A 4PJJA 3UUNA 3ASFA 3NB2A 4NACA 3RYIE 1K8KG 1ZB1A 3AAIA 4N5QA 2P9SG 4CI1B 4YDOA 1UN8A 4M7CA 3GN5A 3O1IA 4HWCA 4YSXA 1HE8A 4PAGA 2X6FA 5J1GA 2P9UG 3FZFB 4X66T 2R5SA 3RYCE 3LY9A 5EYPF 2LKGA 3RI5A 3QNKA 5LGNB 3EIQC 3RKVA 1TYQG 2HPJA 3JQ0A 4ILGA 4UWLA 1Z6TA 3HL6A 3OBVE 1WR6A 2FUPA 2V1DB 3TL5A 3AE2A 5CA1E 4JI4T 4DX1A 1DU2A 3PJAJ 3TLUA 2M6IA 4L2YA 3CIAA 3I3NA 4U2ZA 5KNHD 5EX0A 3VTYA 2V7LA 4X1KE 4BX9A 2Y4TA 3OTNA 1O1RA 4YXDA 2WQHA 5J90A 4ISTA 4UQZA 1NZNA 4U04A 2LHRA 3AA0B 1ELRA 4IIJE 2F37A 2N9DA 5AQHB 1KT1A 3HKBE 1YW0A 3NZUA 3SBSA 4A1GA 2XAGB 1BLXB 4XIFA 3MJWA 2BG9B 4N39A 3K9IA 3JUEA 1Z3XA 3MV3B 3MCXA 4WAFA 2Y3AA 3RIBA 2V8SV 5G05C 2VGYA 4YSYA 2VYIA 5DQVA 3HR0A 2Q9QB 3KV6A 5JMND 5C2YA 5JHAA 5CCLA 3AAEB 4FLBA 2HN2A 3IEEA 4LMKA 3ZEFA 1OXZA 1IYGA 1HX1B 2VVNA 4LF7T 2OVFA 3EABA 3W15B 4A3TA 4CYMD 5LBMA 2VQET 3AAAB 1WG0A 2AWIA 4Y6CA 3PNTB 5CEDB 3IBPA 1E8WA 3QWWA 4EPZA 5LJMA 3CVPA 3QKYA 4U0UA 4X1YE 2HN1A 5HEOA 4NXNT 3AE5A 1W9RA 1YQ4A 4UF0A 4EYUA 1Y64B 2WPVA 3OXLA 4GTQA 4KVOA 2CXFA 4DK5A 3HRAA 3ULEG 3EHRA 2V7IA 5HXCA 2E8IA 2F8YA 5CA0E 3C3RA 3E37A 5AJDA 4B93B 2WXHA 3I4RB 1CUNA 3PDYA 3GZ1A 4EZJA 4PDXA 3GWHA 5CEAA 4JA9A 1D1AA 4GKJT 3WAJA 4NIKA 1JCRA 1G8XA 3RF1A 3R7RA 1O5MA 3MEKA 4HORA 2LXMA 3N71A 4JI7T 3AEEA 1S70B 2EQXA 4DR2T 3BG1B 5HQ8A 3PU8A 3KV4A 1ZHCA 5LBQB 5AFUL 4QH5A 1DCEA 5ENSD 2VSYA 4JYAT 3Q7AA 1ZKEA 3HDXA 2CHWA 3ZMSB 3I0OA 2KT9A 4ZXLA 3R84B 4UWFA 2WXOA 3D9KA 2NTXA 2MYSA 4JEHA 1QBQA 3HG0D 3RC8A 1IJ5A 4HQDA 2CLYC 3P4SA 3FU3A 3L8RA 1N32T 4UQYA 4F8HA 5FZSA 5JJ7A 2W63A 2BS4A 2KZTB 1EYHA 4GPMA 3LJNA 3SY2A 4E85A 3O4XE 2CFZA 4LNGA 1T72A 3SWHA 4TNWA 4ACLA 1N0RA 4LFAT 4HKAA 4HWDA 2FO7A 1T8BA 3AVRA 4C90A 2X51A 4XX5A 1XWMA 1KPSB 4BEPA 3ENEA 4O1PA 1FCHA 3QWVA 5JDQA 2I1JA 3CEQA 4JXTA 1MX2A 3SO8A 3BQOA 3UU8A 2DL1A 3SBTB 5LCYA 2LAHA 4MLPA 1VRBA 2PL2A 4GTOA 2GRRB 2XPKA 4HEAA 2XSAA 4HWHA 1NL4A 3ZUVB 2XQ6A 2SPCA 5F3JA 3Q4AB 3E32A 1QLBA 1XNFA 3LJ3A 4UI9J 4RG9A 4Z68A 1I94T 4O4HE 3KD7A 5EKQD 4OAUC 1E90A 1KK7A 4TV3A 3DTOA 4G2VA 3KFWX 3AEGA 3RO2A 3L08A 4DPRA 5AARA 1IXVA 4IT4A 2P9NG 1VCTA 1LD7A 3GZ2A 4DX6D 3BQKA 3DRAA 5CERB 3PUXF 4XZ4A 4AV7A 4BY6A 3G2TA 3ML9A 1V55E 2R03A 4YTNA 4RG6A 1GW6A 3FUEA 2LXLA 2YNQA 1O3XA 1NWMX 3KS2A 2CWYA 3IHVA 4U96D 2HR2A 3EI0A 2CCQA 3E34A 4G8LA 4IE7A 4B3TT 2X9WA 3HVEB 2E9XB 2VQ2A 1N4RA 5HRYA 3FTWA 1SA4A 5C2TA 4OYJA 1TR4A 4GZ3A 5FZQA 3PEVB 4A5XA 3TXMA 4CZZB 5IWAT 4P09A 1TJCA 3VR8A 2I6HA 4NIQA 5AQBA 3TWUA 4ACKA 5B1BE 2IMLA 1Y8MA 1DC2A 1NA0A 4HRLA 3EU9A 5JDHA 2UXDT 5FY0A 2UY1B 3CX6B 3Q49B 2W62A 2W4XA 4IREA 4FJZA 2I0MA 1BD8A 4QH1A 1J1JA 3UFGA 3TLWA 5C8YE 5BV1A 2V6YA 4Z90A 3FUHA 2X3MA 3LY7A 4XI9A 1OWNA 1IBKT 4GA2A 2K5BB 5ENNA 4JL0A 4G11A 4DV6T 2ZMAA 2YHEA 2XAHB 1LF8A 3ASGA 3E33A 5GONE 4J8EA 2WP9A 2C0MA 4I43B 5LP0A 1NEKA 3MACA 4X62T 2XQYA 4P0AA 1NA3A 4UIGA 5AQUB 4BTBA 3H37A 3JXJA 4BTAA 4MBGA 2E0IA 4TXPA 5E75A 3DSTA 5LX8A 4UWGA 1MNEA 3KBUA 2QC9A 3PV0F 2YKSA 2XUEA 1E2AA 2XTLA 5KWDA 3JCKC 4TV8E 2J8SD 3UPVA 2PTFA 2A3DA 4ISSA 2A9UA 3F31A 3PU3A 2BF0X 4CGVA 3DSUA 2WDRA 4F3VA 1H7CA 2P58C 4KUMB 3APCA 3RO3A 4DI4A 1TEZA 4LFCT 2KWIB 3LK3B 2YDQA 4L9IA 3EU5A 2N2NA 4HFGA 3UI2A 3G2SA 1EZ3A 5LGTB 4JI3T 3EDVA 2L6JA 3CSFA 4AXPA 3R9MA 4OX9T 4JI0T 1OWOA 4PJLA 2J08A 3CQXC 1TNBA 1E8ZA 5AJLA 1D1BA 4I0UA 1N0QA 2XS8A 4UQXA 3OPCA 2XENA 2XQ3A 2WS3A 1JWFA 5F8PA 4X64T 2J1DG 5FZRA 3J5PA 5AQ9A 1YD8G 5FIOA 3C3QA 4HI8A 4C0MA 5FTPA 2X9YA 3PRZA 2YINA 1OCOE 4AP2A 4B0ZA 4BA9A 4CGWA 5LB7B 4LF9T 3AECA 3EIJA 5HI7A 4JPSA 3SQVA 5JDFA 3GYZA 3ZT7A 1R8IA 2V4HC 4ZI2D 3MX3A 3D9NA 3ZN1B 4ZHBA 2V26A 1O1SA 1UG3A 2V5QC 2FULA 1EPUA 5FKYA 2V8SE 3CPZA 4QXHB 3PJAA 2LSYA 1UN9A 2Y1LE 4KHPT 2CFUA 3V5SA 4JI8T 2KBXA 4NXMT 1D0YA 3X1DA 4EZLA 3L54A 5J2UE 5LXTE 2PQNA 1UGOA 1D0ZA 3AEBA 1HNXT 2PM7A 1HX8A 5EK2A 2B1EA 3APDA 1H2VC 4R7LA 4N3CA 3B7RL 2WM9A 3PUGA 4X20E 3B7UX 4KMOA 4EBAG 3UIPC 1WDYA 3CKCA 3LXUX 3FWVA 4NURA 3LYAA 2PG8A 1U5PA 4WWPA 3DSVA 3GW4A 3AG3E 2LHNA 2XQ4A 1W0AA 2XRYA 3RQWA 2EIME 2RKKA 3FBZA 2R02A 3RKOA 2K24A 3PZ3A 4I55E 3ONXA 2FBNA 1HU3A 3VRBA 4DV7T 3ZC1A 1TN6A 4GCNA 2XCBA 3SNXA 1BR2A 2AXZA 3SI5A 4JEUB 3UQ3A 4F1SA 3CVVA 1T7SA 4ZHQE 2XZEA 4DX2A 3T1HT 1MMAA 2HH7A 4K0KT 3ZC0A 3N9NA 3U66A 4QX8B 1N4PA 2WXQA 1WYCA 3VLFA 2CHZA 4L1BA 2LSKA 5EIBE 2BTDA 3K8PC 2CLYB 3H3AA 3EJNA 3CVNA 3TWXA 4U0SA 3NZQA 4U7IA 3C3OA 4URKA 3LBXA 4I1MA 2J62A 5FQ6A 1OCRE 2W61A 2WZIA 1YKEB 5FXXA 3QC9A 4KZ0A 1HCIA 4CZ2D 2ZM0A 4HFEA 1D9SA 4JC8A 4A56A 3HXEA 4U63A 4GOUA 4X1IE 1ZV4X 4H9NC 3I0QA 2XQ7A 4ZZCA 4HLEA 3E30A 1MNDA 3C4WA 4JI1T 3RSEG 3SRZA 2IU1A 4DBRA 5FL1A 4ATZD 3QB5A 3KV9A 2I1KA 2CHXA 2G0UA 4PK6A 4HN9A 1Z5SC 3SHFA 3W9FA 2WXNA 2ZM8A 1K1AA 3FP3A 5JDGA 3FTXA 4CN6A 1OWAA 3N2GE 5DABA 3FU6A 5CRVA 5AYWD 2ONDA 4CQIA 4C48B 3FZHB 3FEYA 3ZN3A 1SA0E 1MZCA 1W09A 2DCFA 4LCTA 2J4GA 5E76A 1LVFA 1HG2A 2ETCA 5AQRB 2Y4UA 1V9DA 4QXCB 2YN6A 5CGMA 4UV9B 5LG4A 1UK5A 2X66A 3ULQA 1SQMA 5D0QD 1OCZE 1SZAA 3UMVA 2LEHA 3CK7A 3TKLB 2IW5B 5IUXA 3IHYA 2QY7A 1UX4A 3P7IA 3E22E 2H6HA 4GPKA 3U64A 4L2LA 4OYSA 4IDQA 3GN5B 3D9HA 1BR4A 3FUMA 2ZIRA 3AVSA 1SUMB 3UU3A 4DR3T 2DI4A 3V31A 3L17A 2LNIA 2RFMA 3UT5E 2WDQA 2WXKA 3NRYA 4EHMA 1K1BA 2ZLYA 2WXFA 3A5XA 2V5CA 2LOPA 5HWXA 1VDYA 4AY6A 1PAQA 4FHKA 3TWQA 3KBTA 3A8YC 3B7TA 1JCSA 1H19A 3AG4E 3ZT6A 4FULA 4RQIA 3B5MA 4U3CA 2IC6A 2JMHA 4NPPA 4I4TE 3UQ7A 2DIWA 2CXDA 4JZYA 4BESA 2WWUA 3ASOE 4K5CA 3UUXA 2WVIA 4U2YA 4O1OA 4YVQC 1K3ZD 1OWLA 4YDYA 3L09A 2HE0A 5ABFA 4AY5A 2KCVA 2EHOA 4DMWA 5HXHA 1UUSA 3ONLA 3VTXA 2H7OA 2WZHA 2E5LT 5H6RB 4YNDA 3ZNGA 1XZYA 2D0TA 3LVRE 1U3DA 2F8XK 2ODVA 1E8XA 3QAQA 2IHR1 1FMWA 3LG7A 4GMLA 1QZ2A 1SZ9A 2R05A 4ADZA 5IHYA 2CXLA 3ZEFB 2JIWA 4G23A 5AENA 5FY1A 3RIAA 2NP9A 1LD8A 4IDNA 2X9XA 3DJBA 2DZNA 4PS3A 3ABLE 1U4QA 3RC3A 2P9KG 3SZ7A 3UKRG 3N9MA 1M7KA 3J9X1 2K9AA 2L9QA 4MALA 3UTKA 5JRCA 2YQ8A 3NZSA 4U8HA 3RRWA 3LK42 4UF0B 3ANWA 5ENOD 2EHOD 2IOLA 4I17A 4C91A 5ANLA 5HXSA 4U8YD 3ESKA 2QRXA 3PH0C 4GK5E 5HEGA 4X5TA 4JV5T 1E1HB 5EILA 5BMVE 3NAWA 2CPTA 3AE6A 4WUYA 5JR9A 4WBNE 1IHBA 2UXNB 2J07A 2WXIA 5HXEA 3HXCA 3FH7A 2L0IA 4MLKA 4DRXE 4I2WA 4K0RA 5G55A 3ONJA 5ITZF 2LM9A 3J7Yq 2LSJA 4DJAA 2R59A 4DI3A 3MKQA 2UXBT 4TUYE 3TWVA 4N3BA 3NOCD 1DNPA 3NVOA 4EAHA 3FZMB 3G2WA 3WI3A 2BEDA 2X0LB 3VRAA 3SFYA 3AE3A 2W67A 5AQIB 3ZJ2A 4JEHB 2L9BA 2LAIA 2CE7A 1IHGA 3K3QC 5AIJA 4WBOA 1MMDA 5L3EB 2C5JA 5CMYA 4NRHB 1M62A 2GRMA 2LJLA 4LMJA 3B7SA 5ABGA 4O2AE 4DR5T 4RSYA 4ZI3C 4WNKA 3RKGA 1E96B 4GMRA 4CDNA 4IDOA 3ZYQA 1OWPA 5LP6E 4HGAA 1MIVA 4KT6B 4M3OA 3RYHE 2CMRA 3PE3A 3P2BA 3UIOC 2FF4A 4AI6A 4HOQA 5A1LA 4EQFA 1Z0PA 3RX6A 3ZYLA 2LRKA 2KWHA 4AQGA 3L22A 3AB3B 2B76A 3UT8A 4GB9A 4AJWA 4ME2A 2A2FX 3ZMZB 2WXLA 4DR1T 4A63B 1OEDE 4B3MT 1OEDA 4HTEA 4DIDB 3RIFA 1WFDA 3V30A 2CBIA 4F53A 4EBAA 2W66A 4V3IA 4LG6A 2IFUA 3OKQA 3B13A 1B7TA 2J49A 1XDPA 3ZRHA 3UUMA 4UVBB 2DLRA 3IA3A 2JRKA 4GYYA 1HS6A 2XY8B 4K03A 3PZ4A 2JLBA 3HYMB 3AE8A 1UURA 4LERA 3CVQA 3CX7B 4DV4T 1TJFA 4ZI7E 2UXXB 4KBQA 4MFRA 3FU0A 4YFSA 1FVHA 4PK4A 3DEOA 5AN8A 3CVXA 2Y0BG 2CRBA 4QH4A 4GZDA 2AXDS 3F57A 3UU5A 4HE8A 4UWKA 4DNDA 5JHBA 4RVBA 4XKBA 1JNZA 1ELKA 2GGFA 4DLQA 2ZGDA 1HXIA 3FUIA 3AXJA 2X6JA 4I2ZA 4DV5T 4YTPA 2FJEA 4HXIA 2JPFA 3IHRA 4KMCA 3UQ4A 3CQGB 1QSDA 3O9XA 3BG0B 4GZ6A 2VKJA 4JVSA 4UI9C 1L0VA 4PK5A 3LSVA 1G3NB 4WNFA 3AA6B 3PREA 2BDEA 1JUQA 5EZYE 4CI3B 2FJAA 3ZFWA 3JADA 2Y48B 3RIUA 3Q15A 4LF6T 2VQFT 3ULYA 5HAXA 4A97A 1G73A 1FVFA 3D9MA 3EDTB 4WW0A 3ISMC 2QFCA 2V6YB 5JDLA 3OXGA 3V2OA 4AKLA 3ZMTB 2R2LA 3CVUA 3JAEA 4J2CA 4DV2T 2BUGA 3LEWA 2K3WA 4EZHA 3FU5A 4J8FA 2HPLA 1KEYA 4YY3T 1S0PA 3NQPA 3OYZA 3RYFE 3ABVA 3Q73A 1MYOA 4DV0T 2KZTA 3AS8A 3P50A 2KM4A 2LUHA 1SVXA 3Q79A 1EDUA 3D3MA 1OUVA 2EHOC 3ONLC 4QFVA 3OTOT 1A5EA 3Q5WA 2IUBA 2Z6EA 3CKDA 3SFEA 5LOZA 3VLDA 5AQPB 1N94A 4YHHT 4M1PA 5HYAA 2E2AA 2WXMA 3S7FA 4ILBA 1MQSA 3RLFF 4HS2A 4O4JE 4H63H 4GA0A 1PC2A 5KX5E 3S7DA 1BI8B 4YSZA 3EDUA 2X38A 3CHQA 4A98A 2GRNB 3EUHA 2AJAA 5AQAA 4N2QA 4MHCA 4I9EA 4ANXA 1H0AA 5AQMB 4FP7A 1YA0A 3LPZA 2PM6A 2XS1A 4BAYB 1KNZA 1NENA 2IOSA 3ZVVA 4LF4T 2XGSA 4AKRB 1WAO1 5AQOB 3DSWA 2WXGA 4FHJA 3Q9DA 3CV0A 2PJQA 5KNGA 1N9AA 2DWGA 3GMIA 4N5CA 1HFAA 2AW6A 1TNZA 3D0TA 4GTVA 2V6XA 3IXEA 1B89A 3Q47B 4GA1A 2VTBA 1AWCB 2J09A 3WG7E 3ONKA 1J5WA 1OCCE 3QUJA 4UEMA 3NBNB 3IEGA 3QC1A 5EDSA 3DP7A 1MMGA 4TXRA 4BFRA 3ZYMA 3AU5A 4PS7A 3TWRA 2LOSA 4GTRA 4JA7A 2VJ8A 1W0BA 3O48A 4P0BA 3A7MA 2DWKA 2VVSA 3CSTA 3LDZA 2VKHA 4CT4A 1XMQT 2CEAA 3BU8A 5CHEE 4IE5A 1W3BA 4LFBT 4IYPA 2Y6XA 4WNGA 4O8SA 4HFVA 3FEXA 3ZJ1A 1XNRT 3JXIA 5L3GB 4LF8T 1WY6A 3FBLA 1N54A 2IEJA 3FUKA 3DSSA 2WXJA 3T8MA 1NI1A 2YDSA 3DBSA 4GU5A 1WM5A 4DMVA 3SFXA 5FXWA 1N4SA 3NWIA 4L0RA 4LMLA 3F2EA 4Z91A 5CFBA 3ZW3A 3IV0A 3TWWA 4CN4A 3DXMG 4LSZE 1I6ZA 2LSUA 3QWPA 4BJMA 4JW1A 3P4QA 3PUQA 5LOVE 4U7EB 3AEFA 5LA6E 2X6HA 4OYKA 4YDEA 1XDOA 4GTTA 3OXFA 4ZEYA 2MYOA 2BZBA 1AP7A 3L82A 1OEDC 2FEZA 3SS1A 2WDVA 2VKOA 5KDMC 2OVBA 3OAWA 2VGXA 5C3JA 1N33T 3Q7FA 2JABA 5CMWA 1LVKA 3ZCIA 4Q94A 3HXBA 2XAFB 5HXRA 2D2SA 3HA4A 2C5IT 4AEZC 5EK4A 3N9PA 1UJKA 1NP7A 4FC8A 4HOSA 2LSIA 3V5UA 2YOEA 4PW8A 5JVDE 2YEVC 2MOZA 2DBAA 2DHRA 3MJXA 1BR1A 3JC6D 4DUZT 4K5AB 1UOHA 1X81A 5JA4D 2IO2C 1KFYA 3I9YA 4W9RA 2ACZA 3TJPA 1E7UA 3C50A 3ZSTA 3UTMA 4E6HA 3I1AA 2CHNA 4HB5A 2XZDG 1VOMA 2ZGGA 3FXEB 3T8KA 5FINA 3LBXB 2VWAA 2NOXA 3ZPOA 5AQKB 2B6CA 1ELWA 5LNKA 1KT0A 3UULA 3PZ2A 3C64A 1DCQA 3T5XA 3AEDA 4O2BE 1EF1C 3TGOA 2WY2A 2H89A 4PFPA 2XEVA 4TWHA 4PJMA 2VK9A 5L3FB 3TWTA 1HNWT 1LKXA 3P1UA 3EVYA 3VKGA 3ZU7B 3C72A 5ABEA 2VASA 3RIUC 3DPDA 4UUCA 3VLEA 3NKZA 5FL0A 3FHEA 1S64A 5IY5E 4GMJA 1WLXA 3Q5XA 5HEHA 4TUMA 3PUYF 4IULA 5L4HA 2J4DA 4DLOA 4ILUA 5CBNA 5AQGB 3CX8B 2NC9A 3BEEA 3U3WA 1LRZA 4NUUA 1N4QA 4XI0A 1TNUA 4G8KA
chains in the Genus database with same CATH topology
5LHIB 3ZHEB 1FEWA 3KV5A 1H2TC 3N5LA 3SD5A 3O4ZA 3ZYKA 4APOA 1KLXA 2XHEA 3PZDA 3C98A 4H7XA 3CHOA 2KLQA 2LE8A 3P8CD 4DO0A 2ODUA 3PVLA 1Y6IA 2ES0A 4QKNA 4IE0A 2NW8A 2WAUA 3D9IA 3RRNB 4Q96A 2LSGA 5H6QB 3MKRA 4IRUA 4ZI3D 2IJGX 2PQRA 4EYYR 1P5QA 5DJQC 1HZ4A 5BPPA 1S35A 5LHGB 3G2VA 4UVCB 2X9HA 3O1HA 3UUXB 4H9OC 4H63V 3CVYA 3LJCA 5FXVA 1IQUA 4UV8B 4LRZA 3CHSA 2WQ6A 2A72A 4AIFA 4CI2B 3CVLA 4A55A 4J6IA 3N2KE 2EHOB 4U0ZA 4JUYA 4TRQA 2VSNA 4CXXA 4JHJA 3IBEA 3B57A 5LFAA 1N52A 2IF4A 2JMKA 3WXXA 4IDZA 3IKOB 4MKTA 2IC9A 5JH7E 2Y8DA 4CXWA 4G24A 2D5UA 3N9OA 5JRCB 4DVDA 5DBKA 4LEUA 4QHOA 3S7JA 3TG5A 2YU2A 3CK9A 3FH8A 3FUNA 4TN7B 3JC6C 3FY4A 3QJZA 2M67A 5ARGA 4GYWA 2YHCA 1L5JA 5FNVE 5DQWA 4I6GA 3QOUA 5FQ8A 4I50E 4JHRA 3CHPA 2JJ9A 1AJ3A 3I9WA 4XKCA 3CGHA 2R17C 4H9PC 2RA1A 5E0OA 3SGHA 3AS4A 2DNXA 2I59A 4FA6A 3PUAA 4N78D 4BSXA 4MRUA 3MKQB 3PE4A 2WB2A 4XBFB 1H2UA 2KNDA 3RH3A 4AM9A 5A7DB 4B6XA 1JPLA 4I6JA 3I5PA 5ARFA 4ATGA 3R7QA 3BQIA 3AU4A 4G1TA 4UXNB 2WMNA 4ILHB 3GZSA 3O1JA 3CKBA 4B8CB 3R6NA 3QB2A 3KVAA 4GK0E 4GAAA 5KJMA 4N2SA 3PUSA 5L3BB 4H9RC 5KCMA 4ASKA 2X67A 2V0PA 4TUUA 4E7SA 3RU0A 3KVBA 2WQ7A 3MZKB 5KJKA 3MA9A 4O4IE 3C4XA 2I2OA 4GYSA 4YJ3E 2WMOA 2NW7A 2BVMA 2X6KA 5G05J 3TAXA 4KBMB 5D0OD 4L23A 4GZ5A 1UX5A 3ESLA 4EB6E 4IHJE 4XZCA 5T3RA 2KCLA 4QXBB 3L13A 4H9QC 1SHZC 2OA5A 4U74A 2C5KT 3MGBA 4C0EA 1BPOA 2L0TB 3MA5A 4FJYA 4WWOA 1HH8A 1Z3YA 2C0LA 2PBIA 5FXZA 4EXTA 2LT3A 4Z8XA 3FTUA 3UX4A 1INZA 4H7YA 3K3OA 5J2TE 2NWBA 3KDSE 1D1CA 3QK6A 3TXNA 4PNIA 4Y6WA 3MK7C 2XCCA 5HWYA 3C4ZA 3GA8A 3E0ZA 4C9BB 1ZU2A 2V5FA 3VHLA 2Q9QA 1HS7A 4FLHA 3EHNA 2A4ZA 3SFZA 1HF8A 2WXRA 2V7JA 1H6KA 5FJYA 5J08A 2KINB 4ANUA 2ZM2A 2C2LA 2IQCA 4QX7B 2XASB 4PH4B 4AQFA 3MZLB 5DIZA 1OWMA 1US7B 4L5GA 3CR3A 3HKCE 3S7BA 4CXYA 4GIWA 1QQEA 4G2AA 1ZEEA 2GRLA 5M4YA 2J9QA 4PS8A 2W00A 5LJNA 5L2LA 3N9QA 3E08A 2NTYA 4CDRA 3FFLA 4EECA 2Q9QD 3LFMA 2YU1A 5FYMA 2XPYA 2CM0A 2KATA 2AXVA 3HIZA 1IQRA 4ILIA 3M65A 5ANRA 4IN3B 4B8AA 3ZPJA 3PUKA 2MOWA 4I1AA 2K48A 3FUFA 2IAKA 2C0SA 2XAQB 1E7VA 3CMLA 3S4UA 2MRIA 5FY7A 3ETUA 4APFA 2VKDA 3OJAA 4GYRA 5T8IA 4F7AA 3L6AA 3UT4A 2KXPB 4FU3A 4QWNB 2V7MA 3CVRA 4U72A 1BR0A 4FI5A 3SF4A 5M72A 3ML8A 4KXKB 4V1Av 4JLEA 2V7KA 3VU7H 2X6IA 1S94A 4UI9K 1UCUA 4A3VA 3Q2MA 2VTBB 4FADA 5CCMA 4L7TA 4PJNA 4H9SE 4OVVA 3PDNA 3LY8A 2XGMA 4U07A 5LHHB 4KP3C 2HO1A 3CHRA 2UWJG 4HOTA 4CRWA 5A6CA 3LS8A 2HYZA 3FXDB 2RG8A 2L3LA 3G2UA 4YJ2E 4G26A 3ETVA 1HG5A 2VB6A 4Q69A 2H3RA 2VL8A 2WSSV 5JQGE 4BT8A 4I9CA 5BT1A 1WYBA 4CEMA 5KJNA 3RK6A 4B89A 5JDMA 3FH5A 1UJJA 4EZ4A 5JR9C 5FT9A 3KAEA 1HO8A 1IZNB 4AKHA 3E4BA 3HI2A 4ZOLE 4FJOA 4OVUA 4GCOA 3SOLA 5C1DA 4ANWA 2DCPA 3FTVA 2AXUA 4J8DA 4EOZB 4AVXA 5CB4E 3HVEA 2E9XA 4MBQA 4UELA 2FI7A 2OV8A 4AKGA 4IE4A 3FUDA 5G2NA 4HVBA 2VGXB 1FIOA 3RRUA 4CDMA 3PNLB 3FULA 2D0UA 2QGSA 2XPZA 2BVLA 5FMNA 3EHMA 2KZ7B 2P9BA 2UY1A 4JHKA 4YHJA 4KVMA 2ZU6B 2XGOA 3UT7A 5BNWA 5A23A 4OFZA 2XPIA 4XE0A 4XAXB 4ERRA 3D9PA 4TX5A 3AA7B 3FHNA 2VSXE 2CWOA 4O6FA 5BW8C 4WNEA 2E9XD 1U3CA 4I6EA 3ZLIA 2WXPA 5KMGP 1JWGA 4GZCA 2LSVA 3ZXSA 4WWNA 5JDNA 4I43A 3I4GA 2W0GA 4J0UA 1PY1A 3URZA 2N1GA 3QARA 5LYJE 3RJVA 2KC7A 4K0UA 3PE0A 5L3CB 3ASHA 2PFVA 1ZBPA 5BUZA 2Q9QC 2E2EA 1MMNA 2MBGA 2XRZA 3WAKA 3KEZA 5EX3A 4A1SA 4NUVA 3Q5MA 3NZPA 4AQFC 3JYSA 2NXPA 3HKEE 2L8KA 3NBXX 1IAPA 4EIWA 5FQ4A 1QUUA 4BJNA 5T4YA 4CT0A 4D10C 2AVPA 5JREA 2XQ0A 2YK0A 3OYXA 4KZCA 3NRXA 4EZKA 3APFA 3L3PA 4IGUA 3FDHA 2X68A 1X79A 4B94A 1MHQA 2XHEB 3C98B 3NF1A 4PFOA 3QDNA 2H7VC 2OOEA 3T5VA 2RP4A 4I1OB 1DVPA 3JUIA 5JJ6A 1NAFA 1YKHB 3D9JA 4BT9A 4LUNU 4GYOA 5EK3A 2Q7FA 3AS5A 5ADXL 2A5UA 3PS6A 3IF8B 4AXHA 1WRDA 5FQ7A 3CK8A 4ABNA 3LVQE 3ZMUB 2ILRA 4N3AA 4E7ZA 3ZGQA 3FTZA 2JEKA 4PUCA 2V4LA 3QK0A 1X5BA 4AKIA 2XAJB 3D9OA 1QNFA 2KMFA 2HM8A 3CHMA 3C51A 4TZ4C 2M63A 1FMVA 3RPUA 3LK2B 4BWRA 3LCAA 3CLJA 4UWHA 4KYOB 4UVAB 3FUJA 3BK9A 2WBLA 5TAOA 4DBQA 4ZS2A 3PURA 5ETWA 3U3IA 4J8SA 3T8OA 5IYZE 3TG4A 3FTYA 1XGWA 4YVOA 3ZMVB 3U9WA 3LKUA 3CQCB 3PTRB 3MKDA 4BX8A 5FP3A 1UW4B 4NQ0A 3N2OA 3PUJA 4TV9E 2RD0A 3ASDA 4JEUA 4ANJA 4F6RC 4YLHA 2QA7A 3ZIMA 3S2AA 4OK0A 3D9LA 3JQ1A 1MIYA 1T98A 2J4BA 4G25A 2JQQA 3MV2B 1E8YA 2CA5A 5LGUB 3HHMA 2I9CA 3ZCJA 1IJ6A 2CG2A 3ZHEA 2LO6A 3PEUB 5BV0A 2GK9A 3MYVA 3BQLA 2KCKA 3MXZA 5JJTA 5LCWC 4CCAA 2E9XC 4P29A 1HTJF 5LCWJ 3RRCA 3ZN0B 2ACXA 3VKHA 4IE6A 3CWZB 2IONA 2MTQA 2NW9A 2GW1A 4ZS3A 4WNDA 4ANVA 3CVWA 3KINB 3UFEA 2CG3A 4G63A 2PZIA 3U78A 2MHKA 1MIWA 3ANWB 4MS6A 3AA1B 4O4LE 4HOUA 3FB2A 3R9AB 1D0XA 3FTSA 2NSZA 4ZI2C 5G04C 3RRMB 5L3DB 5G04J 2VSOE 3L16A 5JR9B 3U4TA 5FWQA 4AOFA 5KJLA 3N9LA 3HKDE 3K3NA 4OHFA 1A17A 4PJJA 3UUNA 3ASFA 4NACA 3RYIE 3AAIA 4CI1B 1UN8A 3GN5A 3O1IA 1HE8A 4PAGA 2X6FA 5J1GA 2R5SA 3RYCE 3LY9A 3QNKA 5LGNB 3EIQC 3RKVA 2HPJA 3JQ0A 4ILGA 4UWLA 1Z6TA 3HL6A 3OBVE 1WR6A 2V1DB 3TL5A 5CA1E 4L2YA 3CIAA 3I3NA 5EX0A 3VTYA 2V7LA 4X1KE 4BX9A 2Y4TA 3OTNA 2WQHA 5J90A 4ISTA 4UQZA 1NZNA 4U04A 2LHRA 3AA0B 1ELRA 4IIJE 4A1GA 2N9DA 1KT1A 3NZUA 3HKBE 1YW0A 3SBSA 2XAGB 4XIFA 3MJWA 4N39A 3K9IA 1Z3XA 3MV3B 3MCXA 4WAFA 2Y3AA 3RIBA 5G05C 2VGYA 2VYIA 5DQVA 3HR0A 2Q9QB 3KV6A 5C2YA 5JHAA 5CCLA 3AAEB 4FLBA 3IEEA 3ZEFA 1OXZA 1IYGA 2OVFA 4A3TA 3W15B 5LBMA 3AAAB 2AWIA 4Y6CA 3PNTB 3IBPA 1E8WA 3QWWA 4EPZA 5LJMA 3CVPA 3QKYA 4U0UA 4X1YE 4UF0A 4EYUA 1Y64B 2WPVA 3OXLA 4DK5A 4KVOA 2CXFA 2V7IA 5HXCA 2E8IA 5CA0E 5AJDA 2WXHA 3I4RB 1CUNA 3PDYA 3GZ1A 4EZJA 4PDXA 3GWHA 4JA9A 1D1AA 3WAJA 1G8XA 3R7RA 3MEKA 4HORA 3N71A 2EQXA 5HQ8A 3BG1B 3PU8A 3KV4A 1ZHCA 5LBQB 5AFUL 2VSYA 1ZKEA 3HDXA 2CHWA 3ZMSB 3I0OA 2KT9A 3R84B 4UWFA 2WXOA 3D9KA 2NTXA 2MYSA 4JEHA 3RC8A 1IJ5A 2CLYC 3FU3A 4UQYA 5FZSA 5JJ7A 2W63A 2KZTB 1EYHA 4E85A 3O4XE 2CFZA 3SWHA 4ACLA 4HKAA 2FO7A 3AVRA 4C90A 2X51A 4XX5A 3ENEA 1FCHA 3QWVA 5JDQA 2I1JA 3CEQA 4JXTA 3SBTB 5LCYA 2LAHA 4MLPA 1VRBA 2PL2A 4HEAA 2SPCA 5F3JA 3Q4AB 1XNFA 3LJ3A 4UI9J 4RG9A 4O4HE 3KD7A 5EKQD 1E90A 1KK7A 4TV3A 3DTOA 4G2VA 3KFWX 3RO2A 3L08A 4DPRA 3GZ2A 3BQKA 4XZ4A 4AV7A 4BY6A 3G2TA 3ML9A 4RG6A 1GW6A 3FUEA 2YNQA 1O3XA 1NWMX 3KS2A 2CWYA 3IHVA 2HR2A 2CCQA 4IE7A 2X9WA 3HVEB 2E9XB 2VQ2A 3FTWA 4OYJA 4GZ3A 5FZQA 3PEVB 3TXMA 4CZZB 4P09A 1TJCA 2I6HA 4ACKA 1Y8MA 1NA0A 5JDHA 5FY0A 2UY1B 3CX6B 3Q49B 2W62A 4FJZA 5C8YE 5BV1A 3FUHA 2X3MA 3LY7A 4XI9A 1OWNA 4GA2A 5ENNA 2K5BB 4JL0A 4G11A 2ZMAA 2YHEA 2XAHB 1LF8A 3ASGA 5GONE 4J8EA 2C0MA 4I43B 5LP0A 3MACA 2XQYA 4P0AA 1NA3A 4UIGA 4BTBA 3H37A 4BTAA 2E0IA 5E75A 5LX8A 4UWGA 1MNEA 3KBUA 2XUEA 2XTLA 3JCKC 4TV8E 3UPVA 2A3DA 4ISSA 3F31A 3PU3A 2BF0X 4CGVA 4F3VA 1H7CA 2P58C 4KUMB 3APCA 3RO3A 4DI4A 1TEZA 2KWIB 3LK3B 4L9IA 2N2NA 4HFGA 3G2SA 1EZ3A 5LGTB 2L6JA 3EDVA 3CSFA 4AXPA 1OWOA 4PJLA 2J08A 3CQXC 1E8ZA 5AJLA 1D1BA 4UQXA 1JWFA 5F8PA 2J1DG 5FZRA 1YD8G 4C0MA 5FTPA 2X9YA 3PRZA 2YINA 4AP2A 4B0ZA 4BA9A 4CGWA 3EIJA 5HI7A 4JPSA 5JDFA 3GYZA 4ZI2D 3MX3A 3D9NA 3ZN1B 2V26A 1UG3A 2FULA 1EPUA 2V8SE 3CPZA 4QXHB 2LSYA 1UN9A 2CFUA 3V5SA 1D0YA 4EZLA 3L54A 5J2UE 5LXTE 2PQNA 1D0ZA 2PM7A 1HX8A 5EK2A 2B1EA 3APDA 1H2VC 4R7LA 4N3CA 3B7RL 2WM9A 3PUGA 4X20E 3B7UX 4KMOA 4EBAG 3CKCA 3LXUX 3FWVA 4NURA 3LYAA 2PG8A 1U5PA 4WWPA 3GW4A 2LHNA 2XRYA 3FBZA 3RKOA 2K24A 4I55E 3ONXA 2FBNA 1HU3A 3ZC1A 4GCNA 2XCBA 3SNXA 1BR2A 2AXZA 3SI5A 4JEUB 3UQ3A 4F1SA 3CVVA 4ZHQE 1MMAA 2HH7A 3ZC0A 3N9NA 3U66A 4QX8B 2WXQA 1WYCA 3VLFA 2CHZA 4L1BA 2LSKA 2BTDA 3K8PC 2CLYB 3H3AA 3EJNA 3CVNA 4U0SA 3NZQA 4URKA 3LBXA 4I1MA 5FQ6A 2W61A 1YKEB 5FXXA 3QC9A 4KZ0A 1HCIA 2ZM0A 4JC8A 4A56A 4U63A 4GOUA 4X1IE 1ZV4X 4H9NC 3I0QA 4HLEA 1MNDA 3C4WA 3SRZA 2IU1A 4DBRA 3KV9A 2I1KA 2CHXA 2G0UA 4PK6A 4HN9A 3SHFA 2WXNA 2ZM8A 3FP3A 5JDGA 3FTXA 1OWAA 3N2GE 5DABA 3FU6A 5AYWD 2ONDA 4CQIA 3FEYA 3ZN3A 1SA0E 2DCFA 4LCTA 5E76A 1LVFA 1HG2A 2Y4UA 1V9DA 4QXCB 4UV9B 5LG4A 3ULQA 2X66A 1SQMA 5D0QD 1SZAA 3UMVA 2LEHA 3CK7A 3TKLB 2IW5B 3IHYA 2QY7A 1UX4A 3P7IA 3E22E 4GPKA 3U64A 4L2LA 4OYSA 3GN5B 1BR4A 3FUMA 3AVSA 2DI4A 3L17A 2LNIA 3UT5E 2WXKA 3NRYA 2ZLYA 2WXFA 3A5XA 2LOPA 5HWXA 1VDYA 4AY6A 1PAQA 4FHKA 3KBTA 3B7TA 1H19A 4FULA 2IC6A 2JMHA 4I4TE 2DIWA 2CXDA 4JZYA 2WWUA 3UUXA 2WVIA 4YVQC 1OWLA 3L09A 4AY5A 2KCVA 2EHOA 4DMWA 5HXHA 3ONLA 3VTXA 2H7OA 4YNDA 5H6RB 2D0TA 3LVRE 1U3DA 2ODVA 1E8XA 3QAQA 1FMWA 3LG7A 4GMLA 1QZ2A 1SZ9A 4ADZA 5IHYA 2CXLA 3ZEFB 4G23A 5AENA 5FY1A 2NP9A 2X9XA 3DJBA 4PS3A 1U4QA 3RC3A 3SZ7A 3N9MA 3J9X1 2K9AA 2L9QA 4MALA 3UTKA 5JRCA 2YQ8A 3NZSA 4U8HA 3RRWA 3LK42 4UF0B 3ANWA 2EHOD 2IOLA 4I17A 4C91A 5ANLA 5HXSA 3ESKA 3PH0C 4GK5E 1E1HB 5BMVE 4WUYA 5JR9A 4WBNE 2UXNB 2J07A 2WXIA 5HXEA 3FH7A 2L0IA 4MLKA 4I2WA 4K0RA 5G55A 2LM9A 3J7Yq 2LSJA 4DJAA 2R59A 4DI3A 3MKQA 4TUYE 4N3BA 1DNPA 4EAHA 3G2WA 3WI3A 2X0LB 3ZJ2A 4JEHB 2L9BA 2LAIA 2CE7A 1IHGA 3K3QC 5AIJA 4WBOA 1MMDA 5L3EB 2C5JA 5CMYA 4NRHB 2GRMA 2LJLA 3B7SA 4O2AE 4RSYA 4ZI3C 4WNKA 1E96B 4CDNA 3ZYQA 1OWPA 5LP6E 4HGAA 1MIVA 4KT6B 4M3OA 3RYHE 2CMRA 3PE3A 3P2BA 2FF4A 4AI6A 4HOQA 5A1LA 4EQFA 1Z0PA 3RX6A 3ZYLA 2KWHA 4AQGA 3L22A 3AB3B 3UT8A 4GB9A 4AJWA 4ME2A 2A2FX 3ZMZB 2WXLA 4HTEA 4F53A 4EBAA 4V3IA 2IFUA 3OKQA 3B13A 1B7TA 2J49A 3ZRHA 3UUMA 4UVBB 2DLRA 2JRKA 4GYYA 1HS6A 4K03A 2JLBA 3HYMB 4LERA 3CVQA 3CX7B 1TJFA 4ZI7E 2UXXB 4KBQA 4MFRA 3FU0A 4YFSA 1FVHA 4PK4A 3CVXA 4GZDA 3F57A 4UWKA 4HE8A 4DNDA 5JHBA 4RVBA 4XKBA 1ELKA 2GGFA 4DLQA 1HXIA 3FUIA 2X6JA 4I2ZA 4HXIA 2JPFA 3IHRA 4KMCA 3CQGB 1QSDA 3O9XA 3BG0B 4GZ6A 2VKJA 4JVSA 4UI9C 4PK5A 4WNFA 3AA6B 3PREA 2BDEA 1JUQA 5EZYE 4CI3B 3ZFWA 2Y48B 3Q15A 5HAXA 1G73A 1FVFA 3D9MA 3EDTB 4WW0A 2QFCA 5JDLA 3OXGA 4AKLA 3ZMTB 3CVUA 4J2CA 2BUGA 3LEWA 3FU5A 4EZHA 4J8FA 2HPLA 1S0PA 3NQPA 3OYZA 3RYFE 2KZTA 3AS8A 2KM4A 1EDUA 3D3MA 1OUVA 2EHOC 4QFVA 3Q5WA 2Z6EA 3CKDA 5LOZA 3VLDA 2WXMA 4M1PA 5HYAA 3S7FA 1MQSA 4HS2A 4O4JE 4H63H 4GA0A 1PC2A 5KX5E 3S7DA 3EDUA 2X38A 3CHQA 3EUHA 4N2QA 4MHCA 4I9EA 4ANXA 1H0AA 4FP7A 1YA0A 3LPZA 2PM6A 4BAYB 1KNZA 2IOSA 3ZVVA 2XGSA 4AKRB 1WAO1 2WXGA 4FHJA 3Q9DA 3CV0A 2PJQA 2DWGA 3GMIA 4N5CA 1HFAA 2AW6A 3D0TA 1B89A 3Q47B 4GA1A 2VTBA 2J09A 3ONKA 3QUJA 4UEMA 3IEGA 3QC1A 5EDSA 3DP7A 1MMGA 4BFRA 3ZYMA 3AU5A 4PS7A 2LOSA 4JA7A 2VJ8A 3O48A 4P0BA 2DWKA 3CSTA 3LDZA 2VKHA 4CT4A 2CEAA 5CHEE 4IE5A 1W3BA 4IYPA 2Y6XA 4WNGA 4O8SA 4HFVA 3FEXA 3ZJ1A 5L3GB 1WY6A 3FBLA 1N54A 3FUKA 2WXJA 3T8MA 3DBSA 4GU5A 1WM5A 4DMVA 5FXWA 4L0RA 3F2EA 3ZW3A 3IV0A 2LSUA 3QWPA 4BJMA 4JW1A 3PUQA 5LOVE 5LA6E 2X6HA 4OYKA 3OXFA 2BZBA 2FEZA 3SS1A 5KDMC 2VKOA 2OVBA 3OAWA 2VGXA 5CMWA 1LVKA 3ZCIA 4Q94A 2XAFB 5HXRA 2D2SA 3HA4A 2C5IT 4AEZC 5EK4A 3N9PA 1UJKA 1NP7A 4FC8A 4HOSA 2LSIA 3V5UA 4PW8A 5JVDE 2YEVC 2MOZA 2DBAA 2DHRA 3MJXA 1BR1A 3JC6D 3I9YA 4W9RA 3TJPA 1E7UA 3C50A 4E6HA 3I1AA 1VOMA 3FXEB 3LBXB 2VWAA 2NOXA 3ZPOA 1ELWA 5LNKA 1KT0A 3UULA 3C64A 3T5XA 4O2BE 1EF1C 3TGOA 4PFPA 2XEVA 4PJMA 2VK9A 5L3FB 1LKXA 3P1UA 3EVYA 3VKGA 2VASA 3DPDA 3VLEA 3FHEA 4GMJA 1WLXA 3Q5XA 4IULA 2J4DA 4DLOA 4ILUA 3CX8B 2NC9A 3BEEA 3U3WA 1LRZA 4NUUA 4XI0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJJ A;  3ONK A;  1ELK A;  2DIW A;  1EYH A;  4Q94 A;  2V8S E;  4FLB A;  5J08 A;  1JPL A;  3D9L A;  3D9I A;  3D9M A;  5CMY A;  3G2V A;  3RRU A;  3D9O A;  1JWF A;  3G2U A;  1SZ9 A;  1SZA A;  4NAC A;  3D9J A;  4Q96 A;  5LOZ A;  4FU3 A;  1UJK A;  1JWG A;  3ZYK A;  1XGW A;  4GZC A;  3ZYM A;  2QY7 A;  4HFG A;  3ZYQ A;  3G2S A;  1VDY A;  3G2T A;  1LF8 A;  1PY1 A;  2MOW A;  3D9K A;  1HG5 A;  1HFA A;  1MHQ A;  2L0T B;  3G2W A;  2DCP A;  1HX8 A;  3CLJ A;  3LDZ A;  4AVX A;  5LP0 A;  3ONL A;  1JUQ A;  2LO6 A;  2KM4 A;  3D9P A;  4GZD A;  4JXT A;  3ZYL A;  1HG2 A;  1HF8 A;  3D9N A;  5CMW A;  2L0I A;  1EDU A;  1INZ A;  1H0A A;  2BF0 X;  1DVP A;  1X5B A; 
#chains in the Genus database with same CATH topology
 5LHI B;  4UR9 A;  3ZHE B;  5B3S E;  1FEW A;  3KV5 A;  4EGW A;  1H2T C;  3N5L A;  3SD5 A;  3O4Z A;  3ZYK A;  4APO A;  2UU9 T;  1D8D A;  1KLX A;  2QZA A;  2XHE A;  3PZD A;  3C98 A;  4H7X A;  3CHO A;  4DX5 D;  2KLQ A;  5AQN B;  5AQT B;  4U33 A;  5AQF B;  2LE8 A;  4WYV A;  4LF5 T;  2ZXW E;  3P8C D;  2P9P G;  4DO0 A;  2ODU A;  3PVL A;  1Y6I A;  3P4P A;  2ES0 A;  4QKN A;  4IE0 A;  2EIK E;  2NW8 A;  2WAU A;  2FBW A;  2QYJ A;  3D9I A;  3RRN B;  2HHH T;  4Q96 A;  3T9K A;  1U2V G;  3BUA A;  2LSG A;  5H6Q B;  3MKR A;  2KXP C;  4IRU A;  4ZI3 D;  2IJG X;  4JI6 T;  2PQR A;  4EYY R;  2P9I G;  1P5Q A;  5DJQ C;  4LNB A;  3DXK G;  2A5E A;  3AG1 E;  1HZ4 A;  3K1S A;  5BPP A;  1S35 A;  5LHG B;  2WCA A;  3ZXP A;  3G2V A;  1MX6 A;  1JNR A;  4UVC B;  2X9H A;  1FPP A;  3O1H A;  1VCS A;  3UUX B;  4H9O C;  4H63 V;  3T1Y T;  3CVY A;  3LJC A;  3DWL G;  2GRQ B;  4DV3 T;  5FXV A;  1IQU A;  4UV8 B;  4HRM B;  4LRZ A;  3CHS A;  2WQ6 A;  2LRL A;  2A72 A;  1Q2Z A;  5H7P A;  2BKG A;  4CI2 B;  4AIF A;  5ABF B;  3CVL A;  4U8V D;  4A55 A;  4J6I A;  3N2K E;  5HCJ A;  2EHO B;  4U0Z A;  1KF6 A;  5BR8 T;  4JUY A;  4TRQ A;  2VSN A;  5ENP D;  2XQ8 A;  4CXX A;  3ABK E;  4JHJ A;  3IBE A;  3OVU A;  3B57 A;  5LFA A;  1N52 A;  3VR9 A;  2L6B A;  2IF4 A;  2JMK A;  4GTP A;  3WXX A;  3C5R A;  1BU9 A;  4IDZ A;  3IKO B;  4MKT A;  4DR7 T;  1FT1 A;  1KZO A;  4KI0 F;  1RW2 A;  3Q5E A;  2IC9 A;  3M3Z B;  5JH7 E;  2NR4 A;  2Y8D A;  4CXW A;  3RHW A;  4G24 A;  2D5U A;  3N9O A;  5JRC B;  4GTS A;  4DVD A;  2F0Y A;  5DBK A;  2YDR A;  1OXJ A;  3PUV F;  4QHO A;  4LEU A;  3S7J A;  3TG5 A;  2YU2 A;  4HFB A;  3CK9 A;  3FH8 A;  4WZX A;  3FUN A;  2MAW A;  4TN7 B;  3JC6 C;  3FY4 A;  3QJZ A;  5ENR D;  2M67 A;  5ARG A;  4GYW A;  2YHC A;  1L5J A;  5FNV E;  5DQW A;  4I6G A;  3QOU A;  5FQ8 A;  4I50 E;  2EIJ E;  4JHR A;  4DR6 T;  3CHP A;  4AIS A;  4BER A;  2JJ9 A;  1AJ3 A;  3I9W A;  2H6G A;  4XKC A;  5BXU A;  3CGH A;  2IDO B;  2R17 C;  3V2X A;  4H9P C;  2RA1 A;  2OLT A;  5E0O A;  3SGH A;  3AS4 A;  2DNX A;  2I59 A;  5AQ7 A;  2ZM6 T;  4FA6 A;  3PUA A;  4N78 D;  2IIU A;  4BSX A;  4MRU A;  3MKQ B;  3Q9N C;  3PE4 A;  4JD2 G;  2JQK A;  5D66 A;  2WB2 A;  4XBF B;  4KX6 A;  2H6I A;  3UM2 A;  1H2U A;  2KND A;  3RH3 A;  5JTG A;  4AM9 A;  5A7D B;  4B6X A;  1JPL A;  4HNA D;  4I6J A;  4HFC A;  1KZP A;  3I5P A;  5ARF A;  4LNU D;  4ATG A;  3R7Q A;  3BQI A;  4AQY T;  3AU4 A;  5F5W A;  4G1T A;  4UXN B;  1WCR A;  2WMN A;  4ILH B;  3GZS A;  2FJB A;  3O1J A;  1LTX A;  3CKB A;  2FJD A;  4B8C B;  1RZ4 A;  4IL4 A;  1Z8U A;  3R6N A;  3QB2 A;  3KVA A;  3QNU A;  4GK0 E;  4GAA A;  5KJM A;  4N2S A;  3PUS A;  3KSQ A;  5L3B B;  1YQ3 A;  2RFA A;  4H9R C;  5KCM A;  4ASK A;  1X9B A;  2X67 A;  5EN5 D;  2V0P A;  4TUU A;  3EHQ A;  4HBD A;  4E7S A;  3RU0 A;  3KVB A;  2M6B A;  3ABM E;  2WQ7 A;  2WB5 A;  3MZK B;  5KJK A;  3MA9 A;  1OED B;  4O4I E;  3C4X A;  4RLY A;  2I2O A;  4GYS A;  4YJ3 E;  2WMO A;  2NW7 A;  2BVM A;  2X6K A;  2KSR A;  5G05 J;  3TAX A;  4KBM B;  5LMN T;  5D0O D;  2BS2 A;  3EAM A;  3AG2 E;  4L23 A;  5ABH A;  4GZ5 A;  1UX5 A;  3ESL A;  4YTM A;  4EB6 E;  3UM3 A;  4KHZ F;  4IHJ E;  4XZC A;  5T3R A;  2KCL A;  4QXB B;  3L13 A;  4H9Q C;  1SHZ C;  2BBJ A;  2OA5 A;  4U74 A;  3TLS A;  2GRO B;  4P1N A;  2C5K T;  1BI7 B;  3MGB A;  3P4W A;  1N34 T;  1BPO A;  4C0E A;  4DX7 D;  5EYL A;  2L0T B;  3MA5 A;  2B0O E;  4FJY A;  4WWO A;  1HH8 A;  1Z3Y A;  2C0L A;  4QQI A;  2PBI A;  1TN8 A;  5FXZ A;  4EXT A;  3UM1 A;  2QYW A;  2LT3 A;  4Z8X A;  4ZZB A;  3FTU A;  5ENT D;  3UX4 A;  4TWD A;  1INZ A;  4H7Y A;  1IBM T;  3K3O A;  4ZFH A;  5J2T E;  2NWB A;  2BG9 E;  2PNN A;  3KDS E;  3UM0 A;  1D1C A;  3QK6 A;  3TXN A;  3CIR A;  2DYS E;  5AQQ B;  4PNI A;  4Y6W A;  2BG9 A;  3MK7 C;  2XCC A;  5HWY A;  3C4Z A;  3PZ1 A;  3ZT5 A;  2BBH A;  3GA8 A;  3AXJ B;  3E0Z A;  3UKU G;  4C9B B;  2ETB A;  1ZU2 A;  3ASN E;  2V5F A;  1KNP A;  2Q9Q A;  3VHL A;  1HS7 A;  4FLH A;  3EHN A;  4J8Y A;  3UUB A;  2A4Z A;  3SFZ A;  3HXF A;  2DZO A;  1HF8 A;  2WXR A;  2V7J A;  1H6K A;  2ETA A;  5FJY A;  1S63 A;  5J08 A;  2KIN B;  4ANU A;  2ZM2 A;  2C2L A;  2IQC A;  4QX7 B;  2XAS B;  4PH4 B;  4AQF A;  3MZL B;  2WWV A;  5HKP A;  5DIZ A;  1OWM A;  1US7 B;  4L5G A;  3UU6 A;  3CR3 A;  3HKC E;  3S7B A;  4CXY A;  4GIW A;  1QQE A;  4G2A A;  1ZEE A;  3QB5 K;  2GRL A;  5M4Y A;  2J9Q A;  4PS8 A;  2W00 A;  5LJN A;  1JCQ A;  2F4V T;  5L2L A;  1E7P A;  3E08 A;  3N9Q A;  4Q25 A;  2NTY A;  4CDR A;  3UXG A;  3FFL A;  5LG3 A;  4B3S T;  2Q9Q D;  4EEC A;  3LFM A;  2YU1 A;  3JAF A;  5FYM A;  2XPY A;  2CM0 A;  4HWI B;  2KAT A;  2AXV A;  3HIZ A;  1IQR A;  4ILI A;  2W2U A;  3M65 A;  5ANR A;  5CBO A;  4IN3 B;  3NOG D;  4B8A A;  3ZPJ A;  4IL9 A;  3AE4 A;  3PUK A;  2MOW A;  4I1A A;  2K48 A;  3FUF A;  2IAK A;  2C0S A;  2XAQ B;  1E7V A;  3CML A;  3S4U A;  2OCC E;  3G06 A;  2MRI A;  2QYU A;  5FY7 A;  3ETU A;  4APF A;  2VKD A;  3OJA A;  4GYR A;  5T8I A;  4F7A A;  4TNV A;  3L6A A;  3UT4 A;  2KXP B;  4FU3 A;  4QWN B;  2V7M A;  3CVR A;  4U72 A;  3X2Q E;  1BR0 A;  4FI5 A;  3SF4 A;  1O1T A;  4DV1 T;  5M72 A;  3ML8 A;  4COF A;  4KXK B;  4V1A v;  4JLE A;  2IY0 C;  2V7K A;  3VU7 H;  1IBL T;  2X6I A;  1S94 A;  4UI9 K;  2X0H A;  5HCM A;  1FJG T;  1UCU A;  4A3V A;  1Y01 A;  3Q2M A;  2VTB B;  4FAD A;  5CCM A;  4L7T A;  2H88 A;  2XQ9 A;  3W9G A;  2XJ7 A;  2XEH A;  4PJN A;  4K5B A;  2BS3 A;  4H9S E;  3KSL A;  3ZKJ A;  4OVV A;  3ZSS A;  3PDN A;  1V54 E;  2EIL E;  2D9D A;  3LY8 A;  3PUW F;  2XGM A;  1SA5 A;  4U07 A;  5LHH B;  4KP3 C;  2HO1 A;  3CHR A;  2UWJ G;  4HOT A;  2VGE A;  4CRW A;  1KNR A;  2WQY A;  5A6C A;  3LS8 A;  2XM1 A;  2BKN A;  2HYZ A;  2LKH A;  1SE7 A;  3FXD B;  3AE7 A;  2RG8 A;  1MJ0 A;  2L3L A;  3G2U A;  3Q75 A;  5BXO A;  5HEJ A;  4O60 A;  2BKO A;  4YJ2 E;  1TN7 A;  4G26 A;  4HFI A;  3ETV A;  1HG5 A;  2VB6 A;  4Q69 A;  2H3R A;  2VL8 A;  2WSS V;  3LDQ B;  5JQG E;  4BT8 A;  4I9C A;  5BT1 A;  1WYB A;  4CEM A;  3AEA A;  4ILC A;  2CHO A;  2WU2 A;  5KJN A;  3AE9 A;  5FVL A;  3RK6 A;  4B89 A;  3V79 K;  1ZOY A;  5JDM A;  3KEA A;  3FH5 A;  1UJJ A;  4EZ4 A;  5JR9 C;  5FT9 A;  1YCS B;  3KAE A;  1HO8 A;  3J5Q B;  1IZN B;  4DR4 T;  4AKH A;  2MPK A;  3E4B A;  2FO1 E;  3HI2 A;  2DWZ A;  4JB8 P;  4ZOL E;  4FJO A;  4OVU A;  1WR0 A;  4GCO A;  3SOL A;  4YDW A;  4OAV B;  4XEI G;  2H6F A;  5C1D A;  1MX4 A;  4ANW A;  2DCP A;  3FTV A;  2AXU A;  4J8D A;  4EOZ B;  4EEB A;  2J47 A;  1XMO T;  4AVX A;  5CB4 E;  3HVE A;  2E9X A;  4MBQ A;  4EV6 A;  1N95 A;  4UEL A;  4HRN A;  2FI7 A;  4F6R D;  2OV8 A;  4AKG A;  3P4R A;  4IE4 A;  3FUD A;  5G2N A;  4HVB A;  2VGX B;  1FIO A;  3RRU A;  4BSZ B;  4CDM A;  3PNL B;  3FUL A;  2UUC T;  2D0U A;  5L4E A;  2QGS A;  1TNY A;  5CJ5 A;  2XPZ A;  2BVL A;  5FMN A;  3EHM A;  2KZ7 B;  2P9B A;  2UY1 A;  4JHK A;  3AE1 A;  4YHJ A;  4KVM A;  2ZU6 B;  2XGO A;  3UT7 A;  5BNW A;  5J0Z A;  2LLY A;  4OFZ A;  2XPI A;  4XE0 A;  5A23 A;  4XAX B;  4ERR A;  2V5D A;  2DVW A;  3D9P A;  4TX5 A;  3SFD A;  3AA7 B;  3FHN A;  3AJI A;  5AAO A;  2VSX E;  2E5V A;  1QYM A;  3HXD A;  4GTM A;  5D2M C;  3ZKR A;  2CWO A;  4O6F A;  5BW8 C;  2R6G F;  4WNE A;  2E9X D;  3FZK B;  4JI2 T;  1U3C A;  4I6E A;  3ZLI A;  1N11 A;  2GRP B;  2WXP A;  5KMG P;  2UUA T;  5KBA A;  4F1P A;  1JWG A;  4DUY T;  4GZC A;  2QVA A;  2AE9 A;  2LSV A;  3ZXS A;  4TWF A;  4WWN A;  3DSX A;  5JDN A;  4I43 A;  3I4G A;  2W0G A;  4U31 A;  4J0U A;  1PY1 A;  2BG9 C;  3URZ A;  2N1G A;  3QAR A;  2P2C P;  4U95 D;  2OEW A;  3TLT A;  5LYJ E;  3RJV A;  5CEC B;  2XQ5 A;  4K0U A;  2KC7 A;  3PE0 A;  5L3C B;  3ASH A;  2PFV A;  3RAU A;  1ZBP A;  5BUZ A;  2IO3 C;  2Q9Q C;  4JBW F;  2E2E A;  5CRU A;  1MMN A;  2MBG A;  1GQE A;  2XRZ A;  3WAK A;  3KEZ A;  2OEV A;  2DYR E;  3AAA C;  5EX3 A;  3TWS A;  4A1S A;  4NUV A;  3Q5M A;  3NZP A;  4AQF C;  3JYS A;  2NXP A;  3HKE E;  4U7Y A;  2L8K A;  3NBX X;  2BKP A;  1CHU A;  2BKK B;  1IAP A;  2JQH A;  4EIW A;  5FQ4 A;  1IKN D;  1QUU A;  2CBJ A;  2X0Y A;  4BJN A;  5T4Y A;  4CT0 A;  4D10 C;  4IDP A;  2AVP A;  5JRE A;  2XQ0 A;  3L9T A;  2YK0 A;  3OYX A;  4KZC A;  3NRX A;  4EZK A;  3APF A;  3L3P A;  4IGU A;  3FDH A;  2X68 A;  1X79 A;  4B94 A;  1OT8 A;  1MHQ A;  2XHE B;  3C98 B;  5EID A;  4AIU A;  3NF1 A;  4PFO A;  1D8E A;  3QDN A;  2XM2 A;  2H7V C;  2OOE A;  3T5V A;  4GKK T;  2RP4 A;  4I1O B;  2EIN E;  1DVP A;  1NFI E;  3JUI A;  5JJ6 A;  1NAF A;  1YKH B;  3D9J A;  4BT9 A;  4HI9 A;  4LUN U;  4GYO A;  5EK3 A;  2Q7F A;  3AS5 A;  5ADX L;  2A5U A;  3PS6 A;  3IF8 B;  4AXH A;  1WRD A;  5FQ7 A;  2RPA A;  3CK8 A;  4ABN A;  5KXJ A;  3LVQ E;  3ZMU B;  2ILR A;  4N3A A;  4E7Z A;  3ZGQ A;  3FTZ A;  1YMP A;  2JEK A;  3CK6 A;  4PUC A;  2V4L A;  3QK0 A;  1X5B A;  3EHZ A;  4AKI A;  2VUR A;  3FZL B;  2XAJ B;  3D9O A;  5HS0 A;  1QNF A;  5AQV B;  2JQ9 A;  2KMF A;  2HM8 A;  3CHM A;  3C51 A;  4TZ4 C;  2M63 A;  2Y69 E;  1FMV A;  4J7W A;  3RPU A;  3LK2 B;  4BWR A;  5AQJ B;  3LCA A;  4HLL A;  3CLJ A;  4UWH A;  4KYO B;  4UVA B;  3FUJ A;  3BK9 A;  3L39 A;  2WBL A;  2XSB A;  4TXQ A;  5TAO A;  4DBQ A;  4ZS2 A;  4X65 T;  3PUR A;  5ETW A;  3U3I A;  4J8S A;  3T8O A;  4L9P A;  5IYZ E;  3TG4 A;  3FTY A;  1OY3 D;  1XGW A;  3ZMV B;  4YVO A;  3LKU A;  3CQC B;  3U9W A;  3Q5D A;  3UU4 A;  1H6O A;  3QOF A;  1SW6 A;  3PTR B;  3MKD A;  4BX8 A;  2XEE A;  2NYJ A;  5FP3 A;  3EUV A;  2WU5 A;  1UW4 B;  2VL0 A;  4NQ0 A;  3N2O A;  3PUJ A;  4TV9 E;  3TLV A;  2RD0 A;  3ASD A;  4JEU A;  4ANJ A;  4F6R C;  4DUI A;  3Q9U C;  4YLH A;  2QA7 A;  3ZIM A;  3H3M A;  3RGL A;  4HFH A;  3S2A A;  4OK0 A;  3D9L A;  5AQS B;  3JQ1 A;  4CN1 A;  1MIY A;  1T98 A;  4HWF A;  2J4B A;  3Q78 A;  3DEP A;  4G25 A;  2JQQ A;  1HNZ T;  1E8Y A;  3MV2 B;  2CA5 A;  5LGU B;  1N36 T;  3HHM A;  2I9C A;  4X8Q A;  3ZCJ A;  1IJ6 A;  5ENQ D;  2CG2 A;  3ZHE A;  2LO6 A;  3PEU B;  5BV0 A;  2GK9 A;  3MYV A;  3UIN C;  3BQL A;  2KCK A;  3MXZ A;  5B1A E;  5JJT A;  3F6Q A;  5LCW C;  4CCA A;  3B95 A;  2E9X C;  4P29 A;  1HTJ F;  2UXC T;  5LCW J;  3RRC A;  5AQL B;  3ZN0 B;  2ACX A;  4B3R T;  3B7B A;  2ZIS A;  3VKH A;  1YYH A;  4HFD A;  3DPY A;  4IE6 A;  3CWZ B;  2ION A;  2XQA A;  1FT2 A;  2MTQ A;  2NW9 A;  1HR0 T;  1YXR A;  5FVK A;  4ZS3 A;  2GW1 A;  4ILA A;  4WND A;  4ANV A;  3CVW A;  5HEU A;  3KIN B;  3PUZ F;  3UFE A;  2CG3 A;  1ZP0 A;  4G63 A;  4BET A;  2PZI A;  3U78 A;  1J5E T;  2MHK A;  1MIW A;  3ANW B;  3RQU A;  4JI5 T;  4MS6 A;  3AA1 B;  2UUB T;  4O4L E;  5LMU T;  4HOU A;  1TNO A;  3FB2 A;  3R9A B;  1D0X A;  3FTS A;  4EED A;  2NSZ A;  2P9L G;  4ZI2 C;  5G04 C;  1XNQ T;  2LM2 A;  3RRM B;  5L3D B;  5G04 J;  2VSO E;  1H6P A;  3L16 A;  5JR9 B;  3JCF A;  5L47 A;  5FWQ A;  3U4T A;  4AOF A;  5KJL A;  3N9L A;  2OV9 A;  3HKD E;  2XZT G;  4YT0 A;  3K3N A;  4OHF A;  1A17 A;  4PJJ A;  3UUN A;  3ASF A;  3NB2 A;  4NAC A;  3RYI E;  1K8K G;  1ZB1 A;  3AAI A;  4N5Q A;  2P9S G;  4CI1 B;  4YDO A;  1UN8 A;  4M7C A;  3GN5 A;  3O1I A;  4HWC A;  4YSX A;  1HE8 A;  4PAG A;  2X6F A;  5J1G A;  2P9U G;  3FZF B;  4X66 T;  2R5S A;  3RYC E;  3LY9 A;  5EYP F;  2LKG A;  3RI5 A;  3QNK A;  5LGN B;  3EIQ C;  3RKV A;  1TYQ G;  2HPJ A;  3JQ0 A;  4ILG A;  4UWL A;  1Z6T A;  3HL6 A;  3OBV E;  1WR6 A;  2FUP A;  2V1D B;  3TL5 A;  3AE2 A;  5CA1 E;  4JI4 T;  4DX1 A;  1DU2 A;  3PJA J;  3TLU A;  2M6I A;  4L2Y A;  3CIA A;  3I3N A;  4U2Z A;  5KNH D;  5EX0 A;  3VTY A;  2V7L A;  4X1K E;  4BX9 A;  2Y4T A;  3OTN A;  1O1R A;  4YXD A;  2WQH A;  5J90 A;  4IST A;  4UQZ A;  1NZN A;  4U04 A;  2LHR A;  3AA0 B;  1ELR A;  4IIJ E;  2F37 A;  2N9D A;  5AQH B;  1KT1 A;  3HKB E;  1YW0 A;  3NZU A;  3SBS A;  4A1G A;  2XAG B;  1BLX B;  4XIF A;  3MJW A;  2BG9 B;  4N39 A;  3K9I A;  3JUE A;  1Z3X A;  3MV3 B;  3MCX A;  4WAF A;  2Y3A A;  3RIB A;  2V8S V;  5G05 C;  2VGY A;  4YSY A;  2VYI A;  5DQV A;  3HR0 A;  2Q9Q B;  3KV6 A;  5JMN D;  5C2Y A;  5JHA A;  5CCL A;  3AAE B;  4FLB A;  2HN2 A;  3IEE A;  4LMK A;  3ZEF A;  1OXZ A;  1IYG A;  1HX1 B;  2VVN A;  4LF7 T;  2OVF A;  3EAB A;  3W15 B;  4A3T A;  4CYM D;  5LBM A;  2VQE T;  3AAA B;  1WG0 A;  2AWI A;  4Y6C A;  3PNT B;  5CED B;  3IBP A;  1E8W A;  3QWW A;  4EPZ A;  5LJM A;  3CVP A;  3QKY A;  4U0U A;  4X1Y E;  2HN1 A;  5HEO A;  4NXN T;  3AE5 A;  1W9R A;  1YQ4 A;  4UF0 A;  4EYU A;  1Y64 B;  2WPV A;  3OXL A;  4GTQ A;  4KVO A;  2CXF A;  4DK5 A;  3HRA A;  3ULE G;  3EHR A;  2V7I A;  5HXC A;  2E8I A;  2F8Y A;  5CA0 E;  3C3R A;  3E37 A;  5AJD A;  4B93 B;  2WXH A;  3I4R B;  1CUN A;  3PDY A;  3GZ1 A;  4EZJ A;  4PDX A;  3GWH A;  5CEA A;  4JA9 A;  1D1A A;  4GKJ T;  3WAJ A;  4NIK A;  1JCR A;  1G8X A;  3RF1 A;  3R7R A;  1O5M A;  3MEK A;  4HOR A;  2LXM A;  3N71 A;  4JI7 T;  3AEE A;  1S70 B;  2EQX A;  4DR2 T;  3BG1 B;  5HQ8 A;  3PU8 A;  3KV4 A;  1ZHC A;  5LBQ B;  5AFU L;  4QH5 A;  1DCE A;  5ENS D;  2VSY A;  4JYA T;  3Q7A A;  1ZKE A;  3HDX A;  2CHW A;  3ZMS B;  3I0O A;  2KT9 A;  4ZXL A;  3R84 B;  4UWF A;  2WXO A;  3D9K A;  2NTX A;  2MYS A;  4JEH A;  1QBQ A;  3HG0 D;  3RC8 A;  1IJ5 A;  4HQD A;  2CLY C;  3P4S A;  3FU3 A;  3L8R A;  1N32 T;  4UQY A;  4F8H A;  5FZS A;  5JJ7 A;  2W63 A;  2BS4 A;  2KZT B;  1EYH A;  4GPM A;  3LJN A;  3SY2 A;  4E85 A;  3O4X E;  2CFZ A;  4LNG A;  1T72 A;  3SWH A;  4TNW A;  4ACL A;  1N0R A;  4LFA T;  4HKA A;  4HWD A;  2FO7 A;  1T8B A;  3AVR A;  4C90 A;  2X51 A;  4XX5 A;  1XWM A;  1KPS B;  4BEP A;  3ENE A;  4O1P A;  1FCH A;  3QWV A;  5JDQ A;  2I1J A;  3CEQ A;  4JXT A;  1MX2 A;  3SO8 A;  3BQO A;  3UU8 A;  2DL1 A;  3SBT B;  5LCY A;  2LAH A;  4MLP A;  1VRB A;  2PL2 A;  4GTO A;  2GRR B;  2XPK A;  4HEA A;  2XSA A;  4HWH A;  1NL4 A;  3ZUV B;  2XQ6 A;  2SPC A;  5F3J A;  3Q4A B;  3E32 A;  1QLB A;  1XNF A;  3LJ3 A;  4UI9 J;  4RG9 A;  4Z68 A;  1I94 T;  4O4H E;  3KD7 A;  5EKQ D;  4OAU C;  1E90 A;  1KK7 A;  4TV3 A;  3DTO A;  4G2V A;  3KFW X;  3AEG A;  3RO2 A;  3L08 A;  4DPR A;  5AAR A;  1IXV A;  4IT4 A;  2P9N G;  1VCT A;  1LD7 A;  3GZ2 A;  4DX6 D;  3BQK A;  3DRA A;  5CER B;  3PUX F;  4XZ4 A;  4AV7 A;  4BY6 A;  3G2T A;  3ML9 A;  1V55 E;  2R03 A;  4YTN A;  4RG6 A;  1GW6 A;  3FUE A;  2LXL A;  2YNQ A;  1O3X A;  1NWM X;  3KS2 A;  2CWY A;  3IHV A;  4U96 D;  2HR2 A;  3EI0 A;  2CCQ A;  3E34 A;  4G8L A;  4IE7 A;  4B3T T;  2X9W A;  3HVE B;  2E9X B;  2VQ2 A;  1N4R A;  5HRY A;  3FTW A;  1SA4 A;  5C2T A;  4OYJ A;  1TR4 A;  4GZ3 A;  5FZQ A;  3PEV B;  4A5X A;  3TXM A;  4CZZ B;  5IWA T;  4P09 A;  1TJC A;  3VR8 A;  2I6H A;  4NIQ A;  5AQB A;  3TWU A;  4ACK A;  5B1B E;  2IML A;  1Y8M A;  1DC2 A;  1NA0 A;  4HRL A;  3EU9 A;  5JDH A;  2UXD T;  5FY0 A;  2UY1 B;  3CX6 B;  3Q49 B;  2W62 A;  2W4X A;  4IRE A;  4FJZ A;  2I0M A;  1BD8 A;  4QH1 A;  1J1J A;  3UFG A;  3TLW A;  5C8Y E;  5BV1 A;  2V6Y A;  4Z90 A;  3FUH A;  2X3M A;  3LY7 A;  4XI9 A;  1OWN A;  1IBK T;  4GA2 A;  2K5B B;  5ENN A;  4JL0 A;  4G11 A;  4DV6 T;  2ZMA A;  2YHE A;  2XAH B;  1LF8 A;  3ASG A;  3E33 A;  5GON E;  4J8E A;  2WP9 A;  2C0M A;  4I43 B;  5LP0 A;  1NEK A;  3MAC A;  4X62 T;  2XQY A;  4P0A A;  1NA3 A;  4UIG A;  5AQU B;  4BTB A;  3H37 A;  3JXJ A;  4BTA A;  4MBG A;  2E0I A;  4TXP A;  5E75 A;  3DST A;  5LX8 A;  4UWG A;  1MNE A;  3KBU A;  2QC9 A;  3PV0 F;  2YKS A;  2XUE A;  1E2A A;  2XTL A;  5KWD A;  3JCK C;  4TV8 E;  2J8S D;  3UPV A;  2PTF A;  2A3D A;  4ISS A;  2A9U A;  3F31 A;  3PU3 A;  2BF0 X;  4CGV A;  3DSU A;  2WDR A;  4F3V A;  1H7C A;  2P58 C;  4KUM B;  3APC A;  3RO3 A;  4DI4 A;  1TEZ A;  4LFC T;  2KWI B;  3LK3 B;  2YDQ A;  4L9I A;  3EU5 A;  2N2N A;  4HFG A;  3UI2 A;  3G2S A;  1EZ3 A;  5LGT B;  4JI3 T;  3EDV A;  2L6J A;  3CSF A;  4AXP A;  3R9M A;  4OX9 T;  4JI0 T;  1OWO A;  4PJL A;  2J08 A;  3CQX C;  1TNB A;  1E8Z A;  5AJL A;  1D1B A;  4I0U A;  1N0Q A;  2XS8 A;  4UQX A;  3OPC A;  2XEN A;  2XQ3 A;  2WS3 A;  1JWF A;  5F8P A;  4X64 T;  2J1D G;  5FZR A;  3J5P A;  5AQ9 A;  1YD8 G;  5FIO A;  3C3Q A;  4HI8 A;  4C0M A;  5FTP A;  2X9Y A;  3PRZ A;  2YIN A;  1OCO E;  4AP2 A;  4B0Z A;  4BA9 A;  4CGW A;  5LB7 B;  4LF9 T;  3AEC A;  3EIJ A;  5HI7 A;  4JPS A;  3SQV A;  5JDF A;  3GYZ A;  3ZT7 A;  1R8I A;  2V4H C;  4ZI2 D;  3MX3 A;  3D9N A;  3ZN1 B;  4ZHB A;  2V26 A;  1O1S A;  1UG3 A;  2V5Q C;  2FUL A;  1EPU A;  5FKY A;  2V8S E;  3CPZ A;  4QXH B;  3PJA A;  2LSY A;  1UN9 A;  2Y1L E;  4KHP T;  2CFU A;  3V5S A;  4JI8 T;  2KBX A;  4NXM T;  1D0Y A;  3X1D A;  4EZL A;  3L54 A;  5J2U E;  5LXT E;  2PQN A;  1UGO A;  1D0Z A;  3AEB A;  1HNX T;  2PM7 A;  1HX8 A;  5EK2 A;  2B1E A;  3APD A;  1H2V C;  4R7L A;  4N3C A;  3B7R L;  2WM9 A;  3PUG A;  4X20 E;  3B7U X;  4KMO A;  4EBA G;  3UIP C;  1WDY A;  3CKC A;  3LXU X;  3FWV A;  4NUR A;  3LYA A;  2PG8 A;  1U5P A;  4WWP A;  3DSV A;  3GW4 A;  3AG3 E;  2LHN A;  2XQ4 A;  1W0A A;  2XRY A;  3RQW A;  2EIM E;  2RKK A;  3FBZ A;  2R02 A;  3RKO A;  2K24 A;  3PZ3 A;  4I55 E;  3ONX A;  2FBN A;  1HU3 A;  3VRB A;  4DV7 T;  3ZC1 A;  1TN6 A;  4GCN A;  2XCB A;  3SNX A;  1BR2 A;  2AXZ A;  3SI5 A;  4JEU B;  3UQ3 A;  4F1S A;  3CVV A;  1T7S A;  4ZHQ E;  2XZE A;  4DX2 A;  3T1H T;  1MMA A;  2HH7 A;  4K0K T;  3ZC0 A;  3N9N A;  3U66 A;  4QX8 B;  1N4P A;  2WXQ A;  1WYC A;  3VLF A;  2CHZ A;  4L1B A;  2LSK A;  5EIB E;  2BTD A;  3K8P C;  2CLY B;  3H3A A;  3EJN A;  3CVN A;  3TWX A;  4U0S A;  3NZQ A;  4U7I A;  3C3O A;  4URK A;  3LBX A;  4I1M A;  2J62 A;  5FQ6 A;  1OCR E;  2W61 A;  2WZI A;  1YKE B;  5FXX A;  3QC9 A;  4KZ0 A;  1HCI A;  4CZ2 D;  2ZM0 A;  4HFE A;  1D9S A;  4JC8 A;  4A56 A;  3HXE A;  4U63 A;  4GOU A;  4X1I E;  1ZV4 X;  4H9N C;  3I0Q A;  2XQ7 A;  4ZZC A;  4HLE A;  3E30 A;  1MND A;  3C4W A;  4JI1 T;  3RSE G;  3SRZ A;  2IU1 A;  4DBR A;  5FL1 A;  4ATZ D;  3QB5 A;  3KV9 A;  2I1K A;  2CHX A;  2G0U A;  4PK6 A;  4HN9 A;  1Z5S C;  3SHF A;  3W9F A;  2WXN A;  2ZM8 A;  1K1A A;  3FP3 A;  5JDG A;  3FTX A;  4CN6 A;  1OWA A;  3N2G E;  5DAB A;  3FU6 A;  5CRV A;  5AYW D;  2OND A;  4CQI A;  4C48 B;  3FZH B;  3FEY A;  3ZN3 A;  1SA0 E;  1MZC A;  1W09 A;  2DCF A;  4LCT A;  2J4G A;  5E76 A;  1LVF A;  1HG2 A;  2ETC A;  5AQR B;  2Y4U A;  1V9D A;  4QXC B;  2YN6 A;  5CGM A;  4UV9 B;  5LG4 A;  1UK5 A;  2X66 A;  3ULQ A;  1SQM A;  5D0Q D;  1OCZ E;  1SZA A;  3UMV A;  2LEH A;  3CK7 A;  3TKL B;  2IW5 B;  5IUX A;  3IHY A;  2QY7 A;  1UX4 A;  3P7I A;  3E22 E;  2H6H A;  4GPK A;  3U64 A;  4L2L A;  4OYS A;  4IDQ A;  3GN5 B;  3D9H A;  1BR4 A;  3FUM A;  2ZIR A;  3AVS A;  1SUM B;  3UU3 A;  4DR3 T;  2DI4 A;  3V31 A;  3L17 A;  2LNI A;  2RFM A;  3UT5 E;  2WDQ A;  2WXK A;  3NRY A;  4EHM A;  1K1B A;  2ZLY A;  2WXF A;  3A5X A;  2V5C A;  2LOP A;  5HWX A;  1VDY A;  4AY6 A;  1PAQ A;  4FHK A;  3TWQ A;  3KBT A;  3A8Y C;  3B7T A;  1JCS A;  1H19 A;  3AG4 E;  3ZT6 A;  4FUL A;  4RQI A;  3B5M A;  4U3C A;  2IC6 A;  2JMH A;  4NPP A;  4I4T E;  3UQ7 A;  2DIW A;  2CXD A;  4JZY A;  4BES A;  2WWU A;  3ASO E;  4K5C A;  3UUX A;  2WVI A;  4U2Y A;  4O1O A;  4YVQ C;  1K3Z D;  1OWL A;  4YDY A;  3L09 A;  2HE0 A;  5ABF A;  4AY5 A;  2KCV A;  2EHO A;  4DMW A;  5HXH A;  1UUS A;  3ONL A;  3VTX A;  2H7O A;  2WZH A;  2E5L T;  5H6R B;  4YND A;  3ZNG A;  1XZY A;  2D0T A;  3LVR E;  1U3D A;  2F8X K;  2ODV A;  1E8X A;  3QAQ A;  2IHR 1;  1FMW A;  3LG7 A;  4GML A;  1QZ2 A;  1SZ9 A;  2R05 A;  4ADZ A;  5IHY A;  2CXL A;  3ZEF B;  2JIW A;  4G23 A;  5AEN A;  5FY1 A;  3RIA A;  2NP9 A;  1LD8 A;  4IDN A;  2X9X A;  3DJB A;  2DZN A;  4PS3 A;  3ABL E;  1U4Q A;  3RC3 A;  2P9K G;  3SZ7 A;  3UKR G;  3N9M A;  1M7K A;  3J9X 1;  2K9A A;  2L9Q A;  4MAL A;  3UTK A;  5JRC A;  2YQ8 A;  3NZS A;  4U8H A;  3RRW A;  3LK4 2;  4UF0 B;  3ANW A;  5ENO D;  2EHO D;  2IOL A;  4I17 A;  4C91 A;  5ANL A;  5HXS A;  4U8Y D;  3ESK A;  2QRX A;  3PH0 C;  4GK5 E;  5HEG A;  4X5T A;  4JV5 T;  1E1H B;  5EIL A;  5BMV E;  3NAW A;  2CPT A;  3AE6 A;  4WUY A;  5JR9 A;  4WBN E;  1IHB A;  2UXN B;  2J07 A;  2WXI A;  5HXE A;  3HXC A;  3FH7 A;  2L0I A;  4MLK A;  4DRX E;  4I2W A;  4K0R A;  5G55 A;  3ONJ A;  5ITZ F;  2LM9 A;  3J7Y q;  2LSJ A;  4DJA A;  2R59 A;  4DI3 A;  3MKQ A;  2UXB T;  4TUY E;  3TWV A;  4N3B A;  3NOC D;  1DNP A;  3NVO A;  4EAH A;  3FZM B;  3G2W A;  3WI3 A;  2BED A;  2X0L B;  3VRA A;  3SFY A;  3AE3 A;  2W67 A;  5AQI B;  3ZJ2 A;  4JEH B;  2L9B A;  2LAI A;  2CE7 A;  1IHG A;  3K3Q C;  5AIJ A;  4WBO A;  1MMD A;  5L3E B;  2C5J A;  5CMY A;  4NRH B;  1M62 A;  2GRM A;  2LJL A;  4LMJ A;  3B7S A;  5ABG A;  4O2A E;  4DR5 T;  4RSY A;  4ZI3 C;  4WNK A;  3RKG A;  1E96 B;  4GMR A;  4CDN A;  4IDO A;  3ZYQ A;  1OWP A;  5LP6 E;  4HGA A;  1MIV A;  4KT6 B;  4M3O A;  3RYH E;  2CMR A;  3PE3 A;  3P2B A;  3UIO C;  2FF4 A;  4AI6 A;  4HOQ A;  5A1L A;  4EQF A;  1Z0P A;  3RX6 A;  3ZYL A;  2LRK A;  2KWH A;  4AQG A;  3L22 A;  3AB3 B;  2B76 A;  3UT8 A;  4GB9 A;  4AJW A;  4ME2 A;  2A2F X;  3ZMZ B;  2WXL A;  4DR1 T;  4A63 B;  1OED E;  4B3M T;  1OED A;  4HTE A;  4DID B;  3RIF A;  1WFD A;  3V30 A;  2CBI A;  4F53 A;  4EBA A;  2W66 A;  4V3I A;  4LG6 A;  2IFU A;  3OKQ A;  3B13 A;  1B7T A;  2J49 A;  1XDP A;  3ZRH A;  3UUM A;  4UVB B;  2DLR A;  3IA3 A;  2JRK A;  4GYY A;  1HS6 A;  2XY8 B;  4K03 A;  3PZ4 A;  2JLB A;  3HYM B;  3AE8 A;  1UUR A;  4LER A;  3CVQ A;  3CX7 B;  4DV4 T;  1TJF A;  4ZI7 E;  2UXX B;  4KBQ A;  4MFR A;  3FU0 A;  4YFS A;  1FVH A;  4PK4 A;  3DEO A;  5AN8 A;  3CVX A;  2Y0B G;  2CRB A;  4QH4 A;  4GZD A;  2AXD S;  3F57 A;  3UU5 A;  4HE8 A;  4UWK A;  4DND A;  5JHB A;  4RVB A;  4XKB A;  1JNZ A;  1ELK A;  2GGF A;  4DLQ A;  2ZGD A;  1HXI A;  3FUI A;  3AXJ A;  2X6J A;  4I2Z A;  4DV5 T;  4YTP A;  2FJE A;  4HXI A;  2JPF A;  3IHR A;  4KMC A;  3UQ4 A;  3CQG B;  1QSD A;  3O9X A;  3BG0 B;  4GZ6 A;  2VKJ A;  4JVS A;  4UI9 C;  1L0V A;  4PK5 A;  3LSV A;  1G3N B;  4WNF A;  3AA6 B;  3PRE A;  2BDE A;  1JUQ A;  5EZY E;  4CI3 B;  2FJA A;  3ZFW A;  3JAD A;  2Y48 B;  3RIU A;  3Q15 A;  4LF6 T;  2VQF T;  3ULY A;  5HAX A;  4A97 A;  1G73 A;  1FVF A;  3D9M A;  3EDT B;  4WW0 A;  3ISM C;  2QFC A;  2V6Y B;  5JDL A;  3OXG A;  3V2O A;  4AKL A;  3ZMT B;  2R2L A;  3CVU A;  3JAE A;  4J2C A;  4DV2 T;  2BUG A;  3LEW A;  2K3W A;  4EZH A;  3FU5 A;  4J8F A;  2HPL A;  1KEY A;  4YY3 T;  1S0P A;  3NQP A;  3OYZ A;  3RYF E;  3ABV A;  3Q73 A;  1MYO A;  4DV0 T;  2KZT A;  3AS8 A;  3P50 A;  2KM4 A;  2LUH A;  1SVX A;  3Q79 A;  1EDU A;  3D3M A;  1OUV A;  2EHO C;  3ONL C;  4QFV A;  3OTO T;  1A5E A;  3Q5W A;  2IUB A;  2Z6E A;  3CKD A;  3SFE A;  5LOZ A;  3VLD A;  5AQP B;  1N94 A;  4YHH T;  4M1P A;  5HYA A;  2E2A A;  2WXM A;  3S7F A;  4ILB A;  1MQS A;  3RLF F;  4HS2 A;  4O4J E;  4H63 H;  4GA0 A;  1PC2 A;  5KX5 E;  3S7D A;  1BI8 B;  4YSZ A;  3EDU A;  2X38 A;  3CHQ A;  4A98 A;  2GRN B;  3EUH A;  2AJA A;  5AQA A;  4N2Q A;  4MHC A;  4I9E A;  4ANX A;  1H0A A;  5AQM B;  4FP7 A;  1YA0 A;  3LPZ A;  2PM6 A;  2XS1 A;  4BAY B;  1KNZ A;  1NEN A;  2IOS A;  3ZVV A;  4LF4 T;  2XGS A;  4AKR B;  1WAO 1;  5AQO B;  3DSW A;  2WXG A;  4FHJ A;  3Q9D A;  3CV0 A;  2PJQ A;  5KNG A;  1N9A A;  2DWG A;  3GMI A;  4N5C A;  1HFA A;  2AW6 A;  1TNZ A;  3D0T A;  4GTV A;  2V6X A;  3IXE A;  1B89 A;  3Q47 B;  4GA1 A;  2VTB A;  1AWC B;  2J09 A;  3WG7 E;  3ONK A;  1J5W A;  1OCC E;  3QUJ A;  4UEM A;  3NBN B;  3IEG A;  3QC1 A;  5EDS A;  3DP7 A;  1MMG A;  4TXR A;  4BFR A;  3ZYM A;  3AU5 A;  4PS7 A;  3TWR A;  2LOS A;  4GTR A;  4JA7 A;  2VJ8 A;  1W0B A;  3O48 A;  4P0B A;  3A7M A;  2DWK A;  2VVS A;  3CST A;  3LDZ A;  2VKH A;  4CT4 A;  1XMQ T;  2CEA A;  3BU8 A;  5CHE E;  4IE5 A;  1W3B A;  4LFB T;  4IYP A;  2Y6X A;  4WNG A;  4O8S A;  4HFV A;  3FEX A;  3ZJ1 A;  1XNR T;  3JXI A;  5L3G B;  4LF8 T;  1WY6 A;  3FBL A;  1N54 A;  2IEJ A;  3FUK A;  3DSS A;  2WXJ A;  3T8M A;  1NI1 A;  2YDS A;  3DBS A;  4GU5 A;  1WM5 A;  4DMV A;  3SFX A;  5FXW A;  1N4S A;  3NWI A;  4L0R A;  4LML A;  3F2E A;  4Z91 A;  5CFB A;  3ZW3 A;  3IV0 A;  3TWW A;  4CN4 A;  3DXM G;  4LSZ E;  1I6Z A;  2LSU A;  3QWP A;  4BJM A;  4JW1 A;  3P4Q A;  3PUQ A;  5LOV E;  4U7E B;  3AEF A;  5LA6 E;  2X6H A;  4OYK A;  4YDE A;  1XDO A;  4GTT A;  3OXF A;  4ZEY A;  2MYO A;  2BZB A;  1AP7 A;  3L82 A;  1OED C;  2FEZ A;  3SS1 A;  2WDV A;  2VKO A;  5KDM C;  2OVB A;  3OAW A;  2VGX A;  5C3J A;  1N33 T;  3Q7F A;  2JAB A;  5CMW A;  1LVK A;  3ZCI A;  4Q94 A;  3HXB A;  2XAF B;  5HXR A;  2D2S A;  3HA4 A;  2C5I T;  4AEZ C;  5EK4 A;  3N9P A;  1UJK A;  1NP7 A;  4FC8 A;  4HOS A;  2LSI A;  3V5U A;  2YOE A;  4PW8 A;  5JVD E;  2YEV C;  2MOZ A;  2DBA A;  2DHR A;  3MJX A;  1BR1 A;  3JC6 D;  4DUZ T;  4K5A B;  1UOH A;  1X81 A;  5JA4 D;  2IO2 C;  1KFY A;  3I9Y A;  4W9R A;  2ACZ A;  3TJP A;  1E7U A;  3C50 A;  3ZST A;  3UTM A;  4E6H A;  3I1A A;  2CHN A;  4HB5 A;  2XZD G;  1VOM A;  2ZGG A;  3FXE B;  3T8K A;  5FIN A;  3LBX B;  2VWA A;  2NOX A;  3ZPO A;  5AQK B;  2B6C A;  1ELW A;  5LNK A;  1KT0 A;  3UUL A;  3PZ2 A;  3C64 A;  1DCQ A;  3T5X A;  3AED A;  4O2B E;  1EF1 C;  3TGO A;  2WY2 A;  2H89 A;  4PFP A;  2XEV A;  4TWH A;  4PJM A;  2VK9 A;  5L3F B;  3TWT A;  1HNW T;  1LKX A;  3P1U A;  3EVY A;  3VKG A;  3ZU7 B;  3C72 A;  5ABE A;  2VAS A;  3RIU C;  3DPD A;  4UUC A;  3VLE A;  3NKZ A;  5FL0 A;  3FHE A;  1S64 A;  5IY5 E;  4GMJ A;  1WLX A;  3Q5X A;  5HEH A;  4TUM A;  3PUY F;  4IUL A;  5L4H A;  2J4D A;  4DLO A;  4ILU A;  5CBN A;  5AQG B;  3CX8 B;  2NC9 A;  3BEE A;  3U3W A;  1LRZ A;  4NUU A;  1N4Q A;  4XI0 A;  1TNU A;  4G8K A; 
#chains in the Genus database with same CATH homology
 5LHI B;  3ZHE B;  1FEW A;  3KV5 A;  1H2T C;  3N5L A;  3SD5 A;  3O4Z A;  3ZYK A;  4APO A;  1KLX A;  2XHE A;  3PZD A;  3C98 A;  4H7X A;  3CHO A;  2KLQ A;  2LE8 A;  3P8C D;  4DO0 A;  2ODU A;  3PVL A;  1Y6I A;  2ES0 A;  4QKN A;  4IE0 A;  2NW8 A;  2WAU A;  3D9I A;  3RRN B;  4Q96 A;  2LSG A;  5H6Q B;  3MKR A;  4IRU A;  4ZI3 D;  2IJG X;  2PQR A;  4EYY R;  1P5Q A;  5DJQ C;  1HZ4 A;  5BPP A;  1S35 A;  5LHG B;  3G2V A;  4UVC B;  2X9H A;  3O1H A;  3UUX B;  4H9O C;  4H63 V;  3CVY A;  3LJC A;  5FXV A;  1IQU A;  4UV8 B;  4LRZ A;  3CHS A;  2WQ6 A;  2A72 A;  4AIF A;  4CI2 B;  3CVL A;  4A55 A;  4J6I A;  3N2K E;  2EHO B;  4U0Z A;  4JUY A;  4TRQ A;  2VSN A;  4CXX A;  4JHJ A;  3IBE A;  3B57 A;  5LFA A;  1N52 A;  2IF4 A;  2JMK A;  3WXX A;  4IDZ A;  3IKO B;  4MKT A;  2IC9 A;  5JH7 E;  2Y8D A;  4CXW A;  4G24 A;  2D5U A;  3N9O A;  5JRC B;  4DVD A;  5DBK A;  4LEU A;  4QHO A;  3S7J A;  3TG5 A;  2YU2 A;  3CK9 A;  3FH8 A;  3FUN A;  4TN7 B;  3JC6 C;  3FY4 A;  3QJZ A;  2M67 A;  5ARG A;  4GYW A;  2YHC A;  1L5J A;  5FNV E;  5DQW A;  4I6G A;  3QOU A;  5FQ8 A;  4I50 E;  4JHR A;  3CHP A;  2JJ9 A;  1AJ3 A;  3I9W A;  4XKC A;  3CGH A;  2R17 C;  4H9P C;  2RA1 A;  5E0O A;  3SGH A;  3AS4 A;  2DNX A;  2I59 A;  4FA6 A;  3PUA A;  4N78 D;  4BSX A;  4MRU A;  3MKQ B;  3PE4 A;  2WB2 A;  4XBF B;  1H2U A;  2KND A;  3RH3 A;  4AM9 A;  5A7D B;  4B6X A;  1JPL A;  4I6J A;  3I5P A;  5ARF A;  4ATG A;  3R7Q A;  3BQI A;  3AU4 A;  4G1T A;  4UXN B;  2WMN A;  4ILH B;  3GZS A;  3O1J A;  3CKB A;  4B8C B;  3R6N A;  3QB2 A;  3KVA A;  4GK0 E;  4GAA A;  5KJM A;  4N2S A;  3PUS A;  5L3B B;  4H9R C;  5KCM A;  4ASK A;  2X67 A;  2V0P A;  4TUU A;  4E7S A;  3RU0 A;  3KVB A;  2WQ7 A;  3MZK B;  5KJK A;  3MA9 A;  4O4I E;  3C4X A;  2I2O A;  4GYS A;  4YJ3 E;  2WMO A;  2NW7 A;  2BVM A;  2X6K A;  5G05 J;  3TAX A;  4KBM B;  5D0O D;  4L23 A;  4GZ5 A;  1UX5 A;  3ESL A;  4EB6 E;  4IHJ E;  4XZC A;  5T3R A;  2KCL A;  4QXB B;  3L13 A;  4H9Q C;  1SHZ C;  2OA5 A;  4U74 A;  2C5K T;  3MGB A;  4C0E A;  1BPO A;  2L0T B;  3MA5 A;  4FJY A;  4WWO A;  1HH8 A;  1Z3Y A;  2C0L A;  2PBI A;  5FXZ A;  4EXT A;  2LT3 A;  4Z8X A;  3FTU A;  3UX4 A;  1INZ A;  4H7Y A;  3K3O A;  5J2T E;  2NWB A;  3KDS E;  1D1C A;  3QK6 A;  3TXN A;  4PNI A;  4Y6W A;  3MK7 C;  2XCC A;  5HWY A;  3C4Z A;  3GA8 A;  3E0Z A;  4C9B B;  1ZU2 A;  2V5F A;  3VHL A;  2Q9Q A;  1HS7 A;  4FLH A;  3EHN A;  2A4Z A;  3SFZ A;  1HF8 A;  2WXR A;  2V7J A;  1H6K A;  5FJY A;  5J08 A;  2KIN B;  4ANU A;  2ZM2 A;  2C2L A;  2IQC A;  4QX7 B;  2XAS B;  4PH4 B;  4AQF A;  3MZL B;  5DIZ A;  1OWM A;  1US7 B;  4L5G A;  3CR3 A;  3HKC E;  3S7B A;  4CXY A;  4GIW A;  1QQE A;  4G2A A;  1ZEE A;  2GRL A;  5M4Y A;  2J9Q A;  4PS8 A;  2W00 A;  5LJN A;  5L2L A;  3N9Q A;  3E08 A;  2NTY A;  4CDR A;  3FFL A;  4EEC A;  2Q9Q D;  3LFM A;  2YU1 A;  5FYM A;  2XPY A;  2CM0 A;  2KAT A;  2AXV A;  3HIZ A;  1IQR A;  4ILI A;  3M65 A;  5ANR A;  4IN3 B;  4B8A A;  3ZPJ A;  3PUK A;  2MOW A;  4I1A A;  2K48 A;  3FUF A;  2IAK A;  2C0S A;  2XAQ B;  1E7V A;  3CML A;  3S4U A;  2MRI A;  5FY7 A;  3ETU A;  4APF A;  2VKD A;  3OJA A;  4GYR A;  5T8I A;  4F7A A;  3L6A A;  3UT4 A;  2KXP B;  4FU3 A;  4QWN B;  2V7M A;  3CVR A;  4U72 A;  1BR0 A;  4FI5 A;  3SF4 A;  5M72 A;  3ML8 A;  4KXK B;  4V1A v;  4JLE A;  2V7K A;  3VU7 H;  2X6I A;  1S94 A;  4UI9 K;  1UCU A;  4A3V A;  3Q2M A;  2VTB B;  4FAD A;  5CCM A;  4L7T A;  4PJN A;  4H9S E;  4OVV A;  3PDN A;  3LY8 A;  2XGM A;  4U07 A;  5LHH B;  4KP3 C;  2HO1 A;  3CHR A;  2UWJ G;  4HOT A;  4CRW A;  5A6C A;  3LS8 A;  2HYZ A;  3FXD B;  2RG8 A;  2L3L A;  3G2U A;  4YJ2 E;  4G26 A;  3ETV A;  1HG5 A;  2VB6 A;  4Q69 A;  2H3R A;  2VL8 A;  2WSS V;  5JQG E;  4BT8 A;  4I9C A;  5BT1 A;  1WYB A;  4CEM A;  5KJN A;  3RK6 A;  4B89 A;  5JDM A;  3FH5 A;  1UJJ A;  4EZ4 A;  5JR9 C;  5FT9 A;  3KAE A;  1HO8 A;  1IZN B;  4AKH A;  3E4B A;  3HI2 A;  4ZOL E;  4FJO A;  4OVU A;  4GCO A;  3SOL A;  5C1D A;  4ANW A;  2DCP A;  3FTV A;  2AXU A;  4J8D A;  4EOZ B;  4AVX A;  5CB4 E;  3HVE A;  2E9X A;  4MBQ A;  4UEL A;  2FI7 A;  2OV8 A;  4AKG A;  4IE4 A;  3FUD A;  5G2N A;  4HVB A;  2VGX B;  1FIO A;  3RRU A;  4CDM A;  3PNL B;  3FUL A;  2D0U A;  2QGS A;  2XPZ A;  2BVL A;  5FMN A;  3EHM A;  2KZ7 B;  2P9B A;  2UY1 A;  4JHK A;  4YHJ A;  4KVM A;  2ZU6 B;  2XGO A;  3UT7 A;  5BNW A;  5A23 A;  4OFZ A;  2XPI A;  4XE0 A;  4XAX B;  4ERR A;  3D9P A;  4TX5 A;  3AA7 B;  3FHN A;  2VSX E;  2CWO A;  4O6F A;  5BW8 C;  4WNE A;  2E9X D;  1U3C A;  4I6E A;  3ZLI A;  2WXP A;  5KMG P;  1JWG A;  4GZC A;  2LSV A;  3ZXS A;  4WWN A;  5JDN A;  4I43 A;  3I4G A;  2W0G A;  4J0U A;  1PY1 A;  3URZ A;  2N1G A;  3QAR A;  5LYJ E;  3RJV A;  2KC7 A;  4K0U A;  3PE0 A;  5L3C B;  3ASH A;  2PFV A;  1ZBP A;  5BUZ A;  2Q9Q C;  2E2E A;  1MMN A;  2MBG A;  2XRZ A;  3WAK A;  3KEZ A;  5EX3 A;  4A1S A;  4NUV A;  3Q5M A;  3NZP A;  4AQF C;  3JYS A;  2NXP A;  3HKE E;  2L8K A;  3NBX X;  1IAP A;  4EIW A;  5FQ4 A;  1QUU A;  4BJN A;  5T4Y A;  4CT0 A;  4D10 C;  2AVP A;  5JRE A;  2XQ0 A;  2YK0 A;  3OYX A;  4KZC A;  3NRX A;  4EZK A;  3APF A;  3L3P A;  4IGU A;  3FDH A;  2X68 A;  1X79 A;  4B94 A;  1MHQ A;  2XHE B;  3C98 B;  3NF1 A;  4PFO A;  3QDN A;  2H7V C;  2OOE A;  3T5V A;  2RP4 A;  4I1O B;  1DVP A;  3JUI A;  5JJ6 A;  1NAF A;  1YKH B;  3D9J A;  4BT9 A;  4LUN U;  4GYO A;  5EK3 A;  2Q7F A;  3AS5 A;  5ADX L;  2A5U A;  3PS6 A;  3IF8 B;  4AXH A;  1WRD A;  5FQ7 A;  3CK8 A;  4ABN A;  3LVQ E;  3ZMU B;  2ILR A;  4N3A A;  4E7Z A;  3ZGQ A;  3FTZ A;  2JEK A;  4PUC A;  2V4L A;  3QK0 A;  1X5B A;  4AKI A;  2XAJ B;  3D9O A;  1QNF A;  2KMF A;  2HM8 A;  3CHM A;  3C51 A;  4TZ4 C;  2M63 A;  1FMV A;  3RPU A;  3LK2 B;  4BWR A;  3LCA A;  3CLJ A;  4UWH A;  4KYO B;  4UVA B;  3FUJ A;  3BK9 A;  2WBL A;  5TAO A;  4DBQ A;  4ZS2 A;  3PUR A;  5ETW A;  3U3I A;  4J8S A;  3T8O A;  5IYZ E;  3TG4 A;  3FTY A;  1XGW A;  4YVO A;  3ZMV B;  3U9W A;  3LKU A;  3CQC B;  3PTR B;  3MKD A;  4BX8 A;  5FP3 A;  1UW4 B;  4NQ0 A;  3N2O A;  3PUJ A;  4TV9 E;  2RD0 A;  3ASD A;  4JEU A;  4ANJ A;  4F6R C;  4YLH A;  2QA7 A;  3ZIM A;  3S2A A;  4OK0 A;  3D9L A;  3JQ1 A;  1MIY A;  1T98 A;  2J4B A;  4G25 A;  2JQQ A;  3MV2 B;  1E8Y A;  2CA5 A;  5LGU B;  3HHM A;  2I9C A;  3ZCJ A;  1IJ6 A;  2CG2 A;  3ZHE A;  2LO6 A;  3PEU B;  5BV0 A;  2GK9 A;  3MYV A;  3BQL A;  2KCK A;  3MXZ A;  5JJT A;  5LCW C;  4CCA A;  2E9X C;  4P29 A;  1HTJ F;  5LCW J;  3RRC A;  3ZN0 B;  2ACX A;  3VKH A;  4IE6 A;  3CWZ B;  2ION A;  2MTQ A;  2NW9 A;  2GW1 A;  4ZS3 A;  4WND A;  4ANV A;  3CVW A;  3KIN B;  3UFE A;  2CG3 A;  4G63 A;  2PZI A;  3U78 A;  2MHK A;  1MIW A;  3ANW B;  4MS6 A;  3AA1 B;  4O4L E;  4HOU A;  3FB2 A;  3R9A B;  1D0X A;  3FTS A;  2NSZ A;  4ZI2 C;  5G04 C;  3RRM B;  5L3D B;  5G04 J;  2VSO E;  3L16 A;  5JR9 B;  3U4T A;  5FWQ A;  4AOF A;  5KJL A;  3N9L A;  3HKD E;  3K3N A;  4OHF A;  1A17 A;  4PJJ A;  3UUN A;  3ASF A;  4NAC A;  3RYI E;  3AAI A;  4CI1 B;  1UN8 A;  3GN5 A;  3O1I A;  1HE8 A;  4PAG A;  2X6F A;  5J1G A;  2R5S A;  3RYC E;  3LY9 A;  3QNK A;  5LGN B;  3EIQ C;  3RKV A;  2HPJ A;  3JQ0 A;  4ILG A;  4UWL A;  1Z6T A;  3HL6 A;  3OBV E;  1WR6 A;  2V1D B;  3TL5 A;  5CA1 E;  4L2Y A;  3CIA A;  3I3N A;  5EX0 A;  3VTY A;  2V7L A;  4X1K E;  4BX9 A;  2Y4T A;  3OTN A;  2WQH A;  5J90 A;  4IST A;  4UQZ A;  1NZN A;  4U04 A;  2LHR A;  3AA0 B;  1ELR A;  4IIJ E;  4A1G A;  2N9D A;  1KT1 A;  3NZU A;  3HKB E;  1YW0 A;  3SBS A;  2XAG B;  4XIF A;  3MJW A;  4N39 A;  3K9I A;  1Z3X A;  3MV3 B;  3MCX A;  4WAF A;  2Y3A A;  3RIB A;  5G05 C;  2VGY A;  2VYI A;  5DQV A;  3HR0 A;  2Q9Q B;  3KV6 A;  5C2Y A;  5JHA A;  5CCL A;  3AAE B;  4FLB A;  3IEE A;  3ZEF A;  1OXZ A;  1IYG A;  2OVF A;  4A3T A;  3W15 B;  5LBM A;  3AAA B;  2AWI A;  4Y6C A;  3PNT B;  3IBP A;  1E8W A;  3QWW A;  4EPZ A;  5LJM A;  3CVP A;  3QKY A;  4U0U A;  4X1Y E;  4UF0 A;  4EYU A;  1Y64 B;  2WPV A;  3OXL A;  4DK5 A;  4KVO A;  2CXF A;  2V7I A;  5HXC A;  2E8I A;  5CA0 E;  5AJD A;  2WXH A;  3I4R B;  1CUN A;  3PDY A;  3GZ1 A;  4EZJ A;  4PDX A;  3GWH A;  4JA9 A;  1D1A A;  3WAJ A;  1G8X A;  3R7R A;  3MEK A;  4HOR A;  3N71 A;  2EQX A;  5HQ8 A;  3BG1 B;  3PU8 A;  3KV4 A;  1ZHC A;  5LBQ B;  5AFU L;  2VSY A;  1ZKE A;  3HDX A;  2CHW A;  3ZMS B;  3I0O A;  2KT9 A;  3R84 B;  4UWF A;  2WXO A;  3D9K A;  2NTX A;  2MYS A;  4JEH A;  3RC8 A;  1IJ5 A;  2CLY C;  3FU3 A;  4UQY A;  5FZS A;  5JJ7 A;  2W63 A;  2KZT B;  1EYH A;  4E85 A;  3O4X E;  2CFZ A;  3SWH A;  4ACL A;  4HKA A;  2FO7 A;  3AVR A;  4C90 A;  2X51 A;  4XX5 A;  3ENE A;  1FCH A;  3QWV A;  5JDQ A;  2I1J A;  3CEQ A;  4JXT A;  3SBT B;  5LCY A;  2LAH A;  4MLP A;  1VRB A;  2PL2 A;  4HEA A;  2SPC A;  5F3J A;  3Q4A B;  1XNF A;  3LJ3 A;  4UI9 J;  4RG9 A;  4O4H E;  3KD7 A;  5EKQ D;  1E90 A;  1KK7 A;  4TV3 A;  3DTO A;  4G2V A;  3KFW X;  3RO2 A;  3L08 A;  4DPR A;  3GZ2 A;  3BQK A;  4XZ4 A;  4AV7 A;  4BY6 A;  3G2T A;  3ML9 A;  4RG6 A;  1GW6 A;  3FUE A;  2YNQ A;  1O3X A;  1NWM X;  3KS2 A;  2CWY A;  3IHV A;  2HR2 A;  2CCQ A;  4IE7 A;  2X9W A;  3HVE B;  2E9X B;  2VQ2 A;  3FTW A;  4OYJ A;  4GZ3 A;  5FZQ A;  3PEV B;  3TXM A;  4CZZ B;  4P09 A;  1TJC A;  2I6H A;  4ACK A;  1Y8M A;  1NA0 A;  5JDH A;  5FY0 A;  2UY1 B;  3CX6 B;  3Q49 B;  2W62 A;  4FJZ A;  5C8Y E;  5BV1 A;  3FUH A;  2X3M A;  3LY7 A;  4XI9 A;  1OWN A;  4GA2 A;  5ENN A;  2K5B B;  4JL0 A;  4G11 A;  2ZMA A;  2YHE A;  2XAH B;  1LF8 A;  3ASG A;  5GON E;  4J8E A;  2C0M A;  4I43 B;  5LP0 A;  3MAC A;  2XQY A;  4P0A A;  1NA3 A;  4UIG A;  4BTB A;  3H37 A;  4BTA A;  2E0I A;  5E75 A;  5LX8 A;  4UWG A;  1MNE A;  3KBU A;  2XUE A;  2XTL A;  3JCK C;  4TV8 E;  3UPV A;  2A3D A;  4ISS A;  3F31 A;  3PU3 A;  2BF0 X;  4CGV A;  4F3V A;  1H7C A;  2P58 C;  4KUM B;  3APC A;  3RO3 A;  4DI4 A;  1TEZ A;  2KWI B;  3LK3 B;  4L9I A;  2N2N A;  4HFG A;  3G2S A;  1EZ3 A;  5LGT B;  2L6J A;  3EDV A;  3CSF A;  4AXP A;  1OWO A;  4PJL A;  2J08 A;  3CQX C;  1E8Z A;  5AJL A;  1D1B A;  4UQX A;  1JWF A;  5F8P A;  2J1D G;  5FZR A;  1YD8 G;  4C0M A;  5FTP A;  2X9Y A;  3PRZ A;  2YIN A;  4AP2 A;  4B0Z A;  4BA9 A;  4CGW A;  3EIJ A;  5HI7 A;  4JPS A;  5JDF A;  3GYZ A;  4ZI2 D;  3MX3 A;  3D9N A;  3ZN1 B;  2V26 A;  1UG3 A;  2FUL A;  1EPU A;  2V8S E;  3CPZ A;  4QXH B;  2LSY A;  1UN9 A;  2CFU A;  3V5S A;  1D0Y A;  4EZL A;  3L54 A;  5J2U E;  5LXT E;  2PQN A;  1D0Z A;  2PM7 A;  1HX8 A;  5EK2 A;  2B1E A;  3APD A;  1H2V C;  4R7L A;  4N3C A;  3B7R L;  2WM9 A;  3PUG A;  4X20 E;  3B7U X;  4KMO A;  4EBA G;  3CKC A;  3LXU X;  3FWV A;  4NUR A;  3LYA A;  2PG8 A;  1U5P A;  4WWP A;  3GW4 A;  2LHN A;  2XRY A;  3FBZ A;  3RKO A;  2K24 A;  4I55 E;  3ONX A;  2FBN A;  1HU3 A;  3ZC1 A;  4GCN A;  2XCB A;  3SNX A;  1BR2 A;  2AXZ A;  3SI5 A;  4JEU B;  3UQ3 A;  4F1S A;  3CVV A;  4ZHQ E;  1MMA A;  2HH7 A;  3ZC0 A;  3N9N A;  3U66 A;  4QX8 B;  2WXQ A;  1WYC A;  3VLF A;  2CHZ A;  4L1B A;  2LSK A;  2BTD A;  3K8P C;  2CLY B;  3H3A A;  3EJN A;  3CVN A;  4U0S A;  3NZQ A;  4URK A;  3LBX A;  4I1M A;  5FQ6 A;  2W61 A;  1YKE B;  5FXX A;  3QC9 A;  4KZ0 A;  1HCI A;  2ZM0 A;  4JC8 A;  4A56 A;  4U63 A;  4GOU A;  4X1I E;  1ZV4 X;  4H9N C;  3I0Q A;  4HLE A;  1MND A;  3C4W A;  3SRZ A;  2IU1 A;  4DBR A;  3KV9 A;  2I1K A;  2CHX A;  2G0U A;  4PK6 A;  4HN9 A;  3SHF A;  2WXN A;  2ZM8 A;  3FP3 A;  5JDG A;  3FTX A;  1OWA A;  3N2G E;  5DAB A;  3FU6 A;  5AYW D;  2OND A;  4CQI A;  3FEY A;  3ZN3 A;  1SA0 E;  2DCF A;  4LCT A;  5E76 A;  1LVF A;  1HG2 A;  2Y4U A;  1V9D A;  4QXC B;  4UV9 B;  5LG4 A;  3ULQ A;  2X66 A;  1SQM A;  5D0Q D;  1SZA A;  3UMV A;  2LEH A;  3CK7 A;  3TKL B;  2IW5 B;  3IHY A;  2QY7 A;  1UX4 A;  3P7I A;  3E22 E;  4GPK A;  3U64 A;  4L2L A;  4OYS A;  3GN5 B;  1BR4 A;  3FUM A;  3AVS A;  2DI4 A;  3L17 A;  2LNI A;  3UT5 E;  2WXK A;  3NRY A;  2ZLY A;  2WXF A;  3A5X A;  2LOP A;  5HWX A;  1VDY A;  4AY6 A;  1PAQ A;  4FHK A;  3KBT A;  3B7T A;  1H19 A;  4FUL A;  2IC6 A;  2JMH A;  4I4T E;  2DIW A;  2CXD A;  4JZY A;  2WWU A;  3UUX A;  2WVI A;  4YVQ C;  1OWL A;  3L09 A;  4AY5 A;  2KCV A;  2EHO A;  4DMW A;  5HXH A;  3ONL A;  3VTX A;  2H7O A;  4YND A;  5H6R B;  2D0T A;  3LVR E;  1U3D A;  2ODV A;  1E8X A;  3QAQ A;  1FMW A;  3LG7 A;  4GML A;  1QZ2 A;  1SZ9 A;  4ADZ A;  5IHY A;  2CXL A;  3ZEF B;  4G23 A;  5AEN A;  5FY1 A;  2NP9 A;  2X9X A;  3DJB A;  4PS3 A;  1U4Q A;  3RC3 A;  3SZ7 A;  3N9M A;  3J9X 1;  2K9A A;  2L9Q A;  4MAL A;  3UTK A;  5JRC A;  2YQ8 A;  3NZS A;  4U8H A;  3RRW A;  3LK4 2;  4UF0 B;  3ANW A;  2EHO D;  2IOL A;  4I17 A;  4C91 A;  5ANL A;  5HXS A;  3ESK A;  3PH0 C;  4GK5 E;  1E1H B;  5BMV E;  4WUY A;  5JR9 A;  4WBN E;  2UXN B;  2J07 A;  2WXI A;  5HXE A;  3FH7 A;  2L0I A;  4MLK A;  4I2W A;  4K0R A;  5G55 A;  2LM9 A;  3J7Y q;  2LSJ A;  4DJA A;  2R59 A;  4DI3 A;  3MKQ A;  4TUY E;  4N3B A;  1DNP A;  4EAH A;  3G2W A;  3WI3 A;  2X0L B;  3ZJ2 A;  4JEH B;  2L9B A;  2LAI A;  2CE7 A;  1IHG A;  3K3Q C;  5AIJ A;  4WBO A;  1MMD A;  5L3E B;  2C5J A;  5CMY A;  4NRH B;  2GRM A;  2LJL A;  3B7S A;  4O2A E;  4RSY A;  4ZI3 C;  4WNK A;  1E96 B;  4CDN A;  3ZYQ A;  1OWP A;  5LP6 E;  4HGA A;  1MIV A;  4KT6 B;  4M3O A;  3RYH E;  2CMR A;  3PE3 A;  3P2B A;  2FF4 A;  4AI6 A;  4HOQ A;  5A1L A;  4EQF A;  1Z0P A;  3RX6 A;  3ZYL A;  2KWH A;  4AQG A;  3L22 A;  3AB3 B;  3UT8 A;  4GB9 A;  4AJW A;  4ME2 A;  2A2F X;  3ZMZ B;  2WXL A;  4HTE A;  4F53 A;  4EBA A;  4V3I A;  2IFU A;  3OKQ A;  3B13 A;  1B7T A;  2J49 A;  3ZRH A;  3UUM A;  4UVB B;  2DLR A;  2JRK A;  4GYY A;  1HS6 A;  4K03 A;  2JLB A;  3HYM B;  4LER A;  3CVQ A;  3CX7 B;  1TJF A;  4ZI7 E;  2UXX B;  4KBQ A;  4MFR A;  3FU0 A;  4YFS A;  1FVH A;  4PK4 A;  3CVX A;  4GZD A;  3F57 A;  4UWK A;  4HE8 A;  4DND A;  5JHB A;  4RVB A;  4XKB A;  1ELK A;  2GGF A;  4DLQ A;  1HXI A;  3FUI A;  2X6J A;  4I2Z A;  4HXI A;  2JPF A;  3IHR A;  4KMC A;  3CQG B;  1QSD A;  3O9X A;  3BG0 B;  4GZ6 A;  2VKJ A;  4JVS A;  4UI9 C;  4PK5 A;  4WNF A;  3AA6 B;  3PRE A;  2BDE A;  1JUQ A;  5EZY E;  4CI3 B;  3ZFW A;  2Y48 B;  3Q15 A;  5HAX A;  1G73 A;  1FVF A;  3D9M A;  3EDT B;  4WW0 A;  2QFC A;  5JDL A;  3OXG A;  4AKL A;  3ZMT B;  3CVU A;  4J2C A;  2BUG A;  3LEW A;  3FU5 A;  4EZH A;  4J8F A;  2HPL A;  1S0P A;  3NQP A;  3OYZ A;  3RYF E;  2KZT A;  3AS8 A;  2KM4 A;  1EDU A;  3D3M A;  1OUV A;  2EHO C;  4QFV A;  3Q5W A;  2Z6E A;  3CKD A;  5LOZ A;  3VLD A;  2WXM A;  4M1P A;  5HYA A;  3S7F A;  1MQS A;  4HS2 A;  4O4J E;  4H63 H;  4GA0 A;  1PC2 A;  5KX5 E;  3S7D A;  3EDU A;  2X38 A;  3CHQ A;  3EUH A;  4N2Q A;  4MHC A;  4I9E A;  4ANX A;  1H0A A;  4FP7 A;  1YA0 A;  3LPZ A;  2PM6 A;  4BAY B;  1KNZ A;  2IOS A;  3ZVV A;  2XGS A;  4AKR B;  1WAO 1;  2WXG A;  4FHJ A;  3Q9D A;  3CV0 A;  2PJQ A;  2DWG A;  3GMI A;  4N5C A;  1HFA A;  2AW6 A;  3D0T A;  1B89 A;  3Q47 B;  4GA1 A;  2VTB A;  2J09 A;  3ONK A;  3QUJ A;  4UEM A;  3IEG A;  3QC1 A;  5EDS A;  3DP7 A;  1MMG A;  4BFR A;  3ZYM A;  3AU5 A;  4PS7 A;  2LOS A;  4JA7 A;  2VJ8 A;  3O48 A;  4P0B A;  2DWK A;  3CST A;  3LDZ A;  2VKH A;  4CT4 A;  2CEA A;  5CHE E;  4IE5 A;  1W3B A;  4IYP A;  2Y6X A;  4WNG A;  4O8S A;  4HFV A;  3FEX A;  3ZJ1 A;  5L3G B;  1WY6 A;  3FBL A;  1N54 A;  3FUK A;  2WXJ A;  3T8M A;  3DBS A;  4GU5 A;  1WM5 A;  4DMV A;  5FXW A;  4L0R A;  3F2E A;  3ZW3 A;  3IV0 A;  2LSU A;  3QWP A;  4BJM A;  4JW1 A;  3PUQ A;  5LOV E;  5LA6 E;  2X6H A;  4OYK A;  3OXF A;  2BZB A;  2FEZ A;  3SS1 A;  5KDM C;  2VKO A;  2OVB A;  3OAW A;  2VGX A;  5CMW A;  1LVK A;  3ZCI A;  4Q94 A;  2XAF B;  5HXR A;  2D2S A;  3HA4 A;  2C5I T;  4AEZ C;  5EK4 A;  3N9P A;  1UJK A;  1NP7 A;  4FC8 A;  4HOS A;  2LSI A;  3V5U A;  4PW8 A;  5JVD E;  2YEV C;  2MOZ A;  2DBA A;  2DHR A;  3MJX A;  1BR1 A;  3JC6 D;  3I9Y A;  4W9R A;  3TJP A;  1E7U A;  3C50 A;  4E6H A;  3I1A A;  1VOM A;  3FXE B;  3LBX B;  2VWA A;  2NOX A;  3ZPO A;  1ELW A;  5LNK A;  1KT0 A;  3UUL A;  3C64 A;  3T5X A;  4O2B E;  1EF1 C;  3TGO A;  4PFP A;  2XEV A;  4PJM A;  2VK9 A;  5L3F B;  1LKX A;  3P1U A;  3EVY A;  3VKG A;  2VAS A;  3DPD A;  3VLE A;  3FHE A;  4GMJ A;  1WLX A;  3Q5X A;  4IUL A;  2J4D A;  4DLO A;  4ILU A;  3CX8 B;  2NC9 A;  3BEE A;  3U3W A;  1LRZ A;  4NUU A;  4XI0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...