3ULQA

Crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
376
structure length
376
Chain Sequence
SSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRHNLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIYLSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQGGVSLYEIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation/transcription activator
molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of response regulator inhibition by a bacterial anti-activator protein.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 160
structure length 376
sequence length 376
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ulqA00
3GW4A 3U3WA 3RO2A 4JL0A 2I6HA 4BTBA 2NC9A 4BTAA 3FFLA 4W9RA 1A17A 4YVQC 1QQEA 2XCBA 5M72A 2KCLA 1NA3A 3SZ7A 1ZBPA 2LSVA 3AS8A 4GCNA 4AIFA 2C0MA 1HXIA 5A7DB 4AM9A 4UI9C 4CDRA 3JYSA 4UI9K 1YA0A 4N39A 3MV2B 4KBQA 3PE4A 1B89A 4J0UA 2J9QA 3PDNA 4I2WA 2XCCA 3MKRA 4AY6A 5DBKA 3GYZA 1KLXA 2AVPA 3KS2A 5FTPA 2UY1A 3E4BA 2KC7A 3Q15A 4GPKA 3ASHA 4JA9A 2IFUA 4WUYA 3VTXA 3CVLA 3OXGA 4U0SA 5G05J 2FF4A 5D0QD 3FP3A 4H7YA 2DBAA 5CCLA 3CVNA 4G2VA 4GZ3A 5AYWD 4U0UA 3ZPJA 4WNGA 4N3BA 4GZ6A 2FO7A 3MA5A 4G25A 4J8FA 3Q49B 3LY8A 2IF4A 1ELRA 4HOTA 4I1AA 4NRHB 3CK7A 2C2LA 4Y6WA 2Y4UA 5EKQD 3LCAA 3IEGA 3ESKA 2UY1B 4I2ZA 4UI9J 4U04A 5DIZA 2Q7FA 3SF4A 4WNFA 4YVOA 4Y6CA 5JJ7A 4A1SA 3TG4A 3Q4AB 3CEQA 4XI0A 3BEEA 3ZFWA 3LYAA 3NF1A 5EX3A 4H7XA 3ULQA 3AS5A 5LCWJ 4I9CA 4N3AA 4XI9A 3AS4A 2JLBA 4AY5A 3TG5A 4GA2A 5ARGA 4GYYA 4WNEA 5C1DA 5FT9A 2R5SA 5D0OD 3CKCA 4N2SA 2QFCA 4N3CA 4CGWA 1Y8MA 2FI7A 5JJTA 3CK9A 3VTYA 5G04J 3WXXA 4LEUA 4GZ5A 3MV3B 4ABNA 1TJCA 2C0LA 3S7BA 4I17A 3QOUA 2KCKA 5EX0A 1ELWA 1P5QA 1HH8A 3RO3A 5HQ8A 1QZ2A 4HOSA 1FCHA 3CKBA 3QWVA 4BT9A 3UPVA 5JJ6A 3KAEA 3CVPA 4CGVA 3LY9A 2VGYA 3Q47B 4KXKB 2PQRA 4KYOB 3UQ3A 4BWRA 4XIFA 3QWPA 2VGXA 3ASGA 4G23A 4UQYA 3LKUA 2PL2A 3OXFA 2GW1A 2P58C 1IYGA 2LSUA 3N71A 2YQ8A 3K9IA 5FZQA 4EQFA 4G26A 3HYMB 1WAO1 4U07A 4GYWA 2KATA 2VYIA 4HOUA 3EDTB 1IHGA 3LPZA 4JA7A 5G05C 5KJNA 3S7DA 5ARFA 3GZ2A 3ZHEA 4F3VA 5KJMA 2WPVA 2LNIA 2PZIA 2VQ2A 1ZU2A 2FEZA 2ONDA 1E96B 4N5CA 3QWWA 2VGXB 3RKVA 4J8DA 1PC2A 3CV0A 5FJYA 5FZRA 5BNWA 2KCVA 3O48A 2Y4TA 4ME2A 1KT0A 1XNFA 2UWJG 3S7FA 1KT1A 2FBNA 2XGMA 4I9EA 5BT1A 2BUGA 4O6FA 4IN3B 1OUVA 4RG9A 3S7JA 1WM5A 4B94A 1NA0A 2L6JA 3URZA 3ZHEB 2V5FA 4GA1A 4WNDA 4NQ0A 4GA0A 3ASDA 3ZN3A 4UQXA 2XGOA 5LCWC 4U0ZA 5A6CA 4GYOA 4J8EA 4UQZA 4BT8A 2HO1A 2HYZA 4HORA 2XPIA 5FZSA 4YNDA 3LY7A 2PQNA 3FWVA 5CCMA 2YHCA 3RU0A 1HZ4A 3MEKA 3UUXA 2XEVA 3PE3A 2OOEA 3KD7A 4APOA 3QKYA 4N2QA 3R9AB 5CHEE 3ZGQA 4G1TA 5G04C 4RG6A 4G24A 3RJVA 3Q5MA 2HR2A 2VSNA 4HOQA 3CVQA 1NZNA 4GCOA 5KJLA 3TGOA 5KJKA 3RIBA 4JHRA 5BW8C 2E2EA 3OXLA 2WQHA 3TAXA 3ASFA 2VSYA 3QDNA 3CK8A 5HI7A 3GZ1A 2MHKA 3U4TA 1W3BA 2XGSA
chains in the Genus database with same CATH superfamily
2LAHA 3RO2A 1K1AA 3IHVA 2X6IA 3T9KA 5CBOA 4OAVB 3MGBA 3UTMA 3TWRA 3B7SA 4BTAA 3SBSA 5ENSD 2R02A 3B7RL 4GCNA 4MLPA 3HVEA 4AJWA 1HXIA 5A7DB 4UI9C 4HQDA 1E8XA 3PH0C 3NQPA 1N4PA 2ZISA 4O60A 4B8CB 2JABA 3ZYMA 3G2UA 3BQOA 1UJJA 4JC8A 1GW6A 2RFAA 2FULA 4AY6A 1WY6A 1IHBA 1N4SA 3FULA 1EDUA 4B8AA 2AVPA 2MOWA 4FULA 3ZU7B 4JEUA 1ELKA 2FO1E 4GPKA 5ENPD 3CVLA 3DSWA 3TL5A 2PM6A 2YINA 5E75A 3QARA 3UT7A 2FF4A 2JEKA 2V0PA 5D0QD 3AJIA 4E85A 3MYVA 4GZ3A 5AYWD 3TXMA 4WNGA 4DLOA 4EECA 4U8HA 2WXOA 3MA5A 4RLYA 4J8FA 4ZHBA 4DUIA 2IF4A 4HOTA 1EF1C 4I1AA 4Y6WA 1BPOA 4D10C 5EILA 3ESKA 2UY1B 4UI9J 4U04A 5AQ7A 3ZEFA 3CHPA 3CVYA 5T3RA 5JJ7A 4R7LA 2J09A 2H6GA 3UX4A 4XI0A 3FEXA 1V54E 2CHZA 3LYAA 3EHMA 4AV7A 3AS5A 3HXDA 4WAFA 2CG2A 2KBXA 5B1BE 3LJ3A 5JHAA 4TXPA 3LVRE 2J07A 3TWVA 3DPDA 5H7PA 4GYYA 5A23A 4GTRA 3EIJA 4WNEA 5C1DA 5FT9A 3MX3A 3CHSA 2R5SA 4J8SA 3D9IA 4HI8A 5D0OD 2DYSE 2R03A 4N3CA 2FI7A 4AP2A 5JJTA 3CK9A 3VTYA 4K5BA 3NB2A 4K5AB 3CSTA 4U8YD 3VLFA 3JQ0A 4GZ5A 4CEMA 4HFGA 1KZPA 1HG5A 3D9OA 4WWPA 3S7BA 5JHBA 3T5VA 3QOUA 1MX6A 2AXUA 4AXHA 1HH8A 4HOSA 1OCRE 1FPPA 4BY6A 2H6FA 3L9TA 2LXMA 1NL4A 3ASOE 1N94A 2DCPA 1N0QA 2IY0C 3UPVA 5EDSA 1RW2A 3D9LA 2OEVA 3KAEA 4C0MA 3CVPA 1S70B 2I1JA 1HFAA 3B7BA 4KYOB 4BWRA 4BESA 4ZFHA 2RD0A 5LX8A 4DI4A 2ETBA 4G23A 4UQYA 2J4DA 2GW1A 2V5QC 4EZKA 4LSZE 1IYGA 2RKKA 3UM3A 4P29A 2I2OA 4ACKA 3UM2A 3SY2A 3PVLA 2EIKE 3EDTB 4X8QA 5ENOD 4JA7A 3ZHEA 1OY3D 4F3VA 5BV0A 5KJMA 1JCSA 4G8KA 5FINA 2VQ2A 4KZCA 1ZU2A 3ZNGA 4K5CA 5E76A 1E96B 4JB8P 3FH8A 4B93B 3I4GA 5LFAA 3DBSA 3PEVB 4OVUA 4V3IA 2VGXB 4HLLA 3TXNA 2OVFA 1EPUA 4J8DA 5FWQA 1PC2A 4GB9A 4BX9A 2Y1LE 3AG4E 2L0TB 1X5BA 3O48A 2Y4TA 3CHRA 1D8EA 1KT0A 2OCCE 2UWJG 4HI9A 4C0EA 1TNUA 4L7TA 3ABLE 3Q78A 4J6IA 2CFZA 2V5FA 2L6BA 4GA1A 1UW4B 2BTDA 4WNDA 1MZCA 1TJFA 1TNOA 2BEDA 3FTSA 2GRPB 4U0ZA 5A6CA 4GYOA 4UWFA 3FUKA 2HO1A 3CLJA 1H6PA 2PQNA 5CCMA 4DX6D 2YHCA 4K03A 3FU0A 1MYOA 1PY1A 3RU0A 1HZ4A 2H6IA 3FUIA 3CHQA 3PE3A 2WXLA 3VLDA 4ATZD 2VTBB 4DI3A 4N2QA 4TXQA 4LUNU 1DC2A 2NSZA 3MJWA 3HHMA 4G24A 3RJVA 3KSQA 2BKKB 4M7CA 2VSNA 2B6CA 4N5QA 3TGOA 4XKCA 3OXLA 2QYUA 3PZDA 3P2BA 1S63A 4XKBA 3IHYA 3Q75A 3QDNA 3Q7FA 3Q7AA 5HI7A 5ANRA 2CFUA 3V31A 4HRNA 1K1BA 2XGSA 3FUJA 3QB2A 4GMLA 2ZXWE 3FFLA 1LTXA 4ILIA 4YVQC 1QQEA 3FUEA 2ZIRA 1O1SA 4RSYA 1HE8A 5ENQD 2KZTB 1LD7A 4CDNA 4AM9A 2RFMA 3JYSA 4UI9K 1AWCB 3OTNA 4I1MA 1JWFA 2WXGA 3NBNB 3HXEA 3PE4A 4J0UA 3BU8A 2J9QA 3PDNA 3HG0D 3KEAA 4MBGA 4L23A 1E8WA 3FUNA 5CERB 3DSUA 3I5PA 5J08A 3PRZA 2UY1A 3EU5A 3E4BA 3FU5A 3Q15A 3SFYA 4JA9A 4FP7A 3VTXA 5J90A 4U0SA 4FC8A 1E8ZA 5AAOA 2R2LA 2LUHA 1H19A 4O1OA 2WMNA 3FTXA 4H7YA 1ZB1A 4G2VA 4PS8A 4U0UA 4WWNA 5AIJA 1OWLA 3L17A 3V79K 3FDHA 3UKUG 4G25A 3C5RA 3Q49B 3FUMA 3LY8A 4Q94A 4PUCA 4KVMA 4OAUC 4O1PA 3Q79A 2C2LA 3NZUA 2J8SD 3LCAA 3ZYLA 1LD8A 1MHQA 3W9FA 2IEJA 2XQ0A 4I2ZA 2MRIA 4XZ4A 5DIZA 1YCSB 2M63A 3D9JA 5G55A 4CDMA 2ZGDA 1YYHA 4Y6CA 4YVOA 1SA4A 4U8VD 1HG2A 3L54A 1N54A 3J5PA 4HLEA 2P9IG 3CEQA 2ETCA 4I6EA 3BG0B 3NF1A 4PDXA 5FQ7A 3KSLA 3ULQA 2E0IA 3PNTB 2BF0X 3FEYA 4IRUA 4U7EB 3RRNB 4JEHA 2F0YA 4I6GA 3IKOB 3ESLA 2LAIA 1N95A 2JLBA 4BEPA 3T5XA 4AY5A 3PS6A 5ARGA 3EIQC 4GTPA 2Y69E 3QNKA 5JA4D 1NFIE 3AU5A 1INZA 2QC9A 4N2SA 3D9NA 4CGWA 3DSSA 4MRUA 1MQSA 3T8KA 3WXXA 3E33A 4CRWA 2V4HC 3MV3B 1TJCA 1TNYA 2WVIA 5D2MC 4ANXA 2C0LA 2VSXE 3U64A 1YMPA 4MKTA 3AG3E 4YDOA 1P5QA 1DCQA 1FCHA 3PZ1A 3CKBA 3Q73A 2YHEA 3QWVA 4BT9A 1U3CA 3D3MA 2KM4A 2I9CA 4BETA 4CGVA 3LY9A 2VGYA 2WQ7A 2KXPC 1H6KA 4XIFA 2LO6A 3QWPA 3CQCB 2WXNA 3ONLA 2R05A 5CEAA 2VGXA 3ASGA 4GZDA 3DEOA 3LKUA 2PL2A 3OXFA 3FTVA 2DZNA 4JHJA 1FT1A 4CZ2D 4DJAA 2XPZA 2P58C 1NI1A 4GZCA 3N71A 2B0OE 2ETAA 4GMJA 3HXFA 4EQFA 4ANUA 4G26A 3HYMB 1WAO1 2CG3A 2XRZA 4ANVA 4Z68A 5CMWA 2VJ8A 4GMRA 5CECB 2GROB 3E32A 3ZIMA 5G05C 3S7DA 5ARFA 2X6FA 4L2YA 1IQUA 3LDZA 2PZIA 3ISMC 4GTSA 2J49A 3FH7A 3RKVA 5AQ9A 4HXIA 2XZTG 1V55E 3SGHA 4C9BB 5FJYA 1JCQA 4UWHA 5D66A 4GTVA 4DRXE 3CVVA 1NP7A 3C3RA 1XNFA 4CCAA 1QNFA 2EQXA 4B0ZA 2XGMA 4O6FA 4IN3B 5JMND 4HRMB 1NA0A 2L6JA 4F1PA 4JPSA 4FA6A 3B7UX 3U9WA 1DNPA 3ASDA 3O4ZA 2XGOA 5LCWC 4L9PA 3DWLG 3CVUA 5BXOA 1FVHA 1FT2A 4BT8A 4HORA 3JUIA 4GTOA 1N0RA 1OCCE 4F6RD 4DX2A 3UUXA 3APDA 3SQVA 2GGFA 3L13A 2R17C 3APCA 3R9AB 5AN8A 5CHEE 2IU1A 3C3QA 5ITZF 4G1TA 4AVXA 5EYLA 3J5QB 5G04C 4FJYA 3U66A 3PREA 4GU5A 4GAAA 2WXHA 2EINE 2PNNA 2EIJE 3UI2A 4HOQA 3CGHA 5HS0A 5KJLA 5ENNA 4ACLA 3RIBA 5B1AE 5BV1A 3DSTA 2XS1A 2E2EA 4FHJA 4EZLA 5KCMA 1N4QA 1TNZA 2F8XK 3SBTB 2X38A 1WG0A 3GZ1A 3E34A 3U4TA 2ZU6B 4OYSA 3ZXPA 1QBQA 3UM1A 3DXKG 3IBEA 4JL0A 2I6HA 4BTBA 1OCZE 2WXIA 3ENEA 1A17A 2MYOA 3HXCA 2XCBA 1NA3A 1ZBPA 3AS8A 1QYMA 3PUJA 3ABME 3E30A 3TWXA 2OVBA 2GRNB 2WXQA 4KBQA 3ZRHA 3FU3A 1BI8B 4I6JA 1OCOE 2P9LG 1B89A 1JCRA 2XCCA 5FQ4A 4ATGA 3NOGD 3L6AA 3MKRA 1K3ZD 4G11A 3ZYKA 4EBAA 4IULA 3CR3A 1HF8A 5DBKA 3GYZA 2F37A 1E7UA 2QY7A 4BSZB 3KS2A 3PNLB 5EYPF 2Y0BG 2KC7A 4LCTA 2IFUA 5FQ6A 4WUYA 2WXKA 3OXGA 4HS2A 4TUUA 2ZGGA 3CSFA 3TWSA 1O1TA 4JW1A 5ENRD 4QFVA 2P9SG 3FUHA 4ILGA 3ZXSA 3FP3A 3BUAA 4NURA 1SA5A 3ZPJA 4EZJA 4E6HA 4GZ6A 2FO7A 3UINC 3ABKE 1TNBA 2OV8A 3OAWA 4BERA 4RQIA 4URKA 3ZVVA 2Y3AA 2Y4UA 3IEGA 5AARA 3L82A 2WMOA 3E37A 2Q7FA 3SF4A 2P9PG 1OWNA 4WNFA 5AQAA 1H2VC 4A1SA 2XRYA 3TG4A 3Q4AB 4PS7A 3BEEA 3Q9UC 3JXIA 3ZFWA 5CRVA 1MX4A 3VLEA 1WDYA 2IOSA 5EX3A 3V2OA 4I9CA 3ZYQA 5BXUA 3QAQA 4XE0A 4NIKA 4N3AA 5EIDA 2XS8A 4A55A 3CHOA 4Q96A 3AS4A 3TG5A 2HE0A 3G2WA 4GA2A 4TXRA 3SO8A 3L16A 3G2SA 3JCKC 3LS8A 1SVXA 3TWUA 1LF8A 2CHXA 5ENTD 4LNUD 3CKCA 2QFCA 4BSXA 4GTMA 1Y8MA 4L2LA 3Q9NC 2CHWA 4F1SA 3AG2E 1HO8A 1O5MA 1IXVA 4C48B 5CBNA 5CMYA 4LEUA 2EIME 4I17A 3EU9A 4NACA 5EX0A 1ELWA 3HDXA 3RO3A 1QZ2A 1SZAA 3RRMB 2DZOA 4ILHB 4TV3A 1H6OA 4LERA 1E90A 4K0RA 2NYJA 3SHFA 3Q47B 1X81A 1N9AA 4UWGA 2DVWA 4DX7D 2PQRA 1Z6TA 1VDYA 1OWMA 4EPZA 2IJGX 1BU9A 4GTQA 5KBAA 4L1BA 1TN6A 1FVFA 2LSUA 4FADA 2YQ8A 3ML9A 5FZQA 4CT4A 3SFZA 3LJNA 2OEWA 3RAUA 2KATA 2VYIA 3CQGB 3UKRG 4HOUA 1OWOA 1IHGA 2P9NG 1L5JA 3LPZA 1K8KG 1MJ0A 2LNIA 3GZSA 3SI5A 2FEZA 1D8DA 4N5CA 3QC1A 5IY5E 2WQ6A 4XEIG 3B7TA 5CEDB 3MKQB 2X6KA 1TYQG 1TEZA 3CV0A 3UIOC 4FU3A 5FZRA 3SFXA 5BNWA 2KCVA 1O1RA 4WWOA 3ZKJA 3LVQE 2XEHA 2WXRA 1HS6A 4ME2A 2IO2C 3S7FA 2FBNA 4I9EA 3PEUB 3ML8A 2V4LA 5BT1A 1MX2A 4EBAG 2BUGA 3FTUA 4DX1A 2L0IA 4HB5A 3CVWA 4RG9A 3FUDA 3S7JA 3URZA 5HKPA 3FH5A 3FY4A 2WXPA 4JXTA 2H6HA 2I1KA 1E7VA 3MZLB 4J8EA 1BLXB 5FIOA 4UQZA 1UN9A 3PZ2A 3R7QA 2L9BA 3JXJA 5FZSA 3FWVA 1UN8A 3F6QA 3EHNA 3D9HA 3T8MA 4G8LA 3WG7E 2XHEA 3D9KA 3MEKA 2WXJA 4ANWA 3MCXA 3KD7A 3QKYA 4UWLA 2GRRB 3ZGQA 5LP0A 3I4RB 3NAWA 1H2TC 4U63A 1IKND 2AJAA 4RG6A 3Q5MA 2HR2A 4IYPA 4I1OB 3CVQA 1NZNA 1E8YA 4JVSA 4FJZA 5KJKA 2YNQA 4JHRA 2DIWA 2IQCA 3C98A 3TJPA 5KNHD 2WQHA 3TAXA 3ASFA 2DYRE 2AXVA 3UIPC 3CK8A 4TUMA 2MHKA 1XGWA 4B89A 3GW4A 3UT8A 3U3WA 3S2AA 5AJLA 3HIZA 5T4YA 3P1UA 2EILE 2NC9A 3EHQA 2DWZA 4W9RA 1Y6IA 4KVOA 5M72A 2KCLA 4HVBA 2RG8A 3SZ7A 3V30A 2LSVA 4YDYA 3X2QE 4AIFA 1IQRA 2C0MA 4U96D 1BD8A 4M3OA 4CDRA 3DXMG 2J4BA 4DLQA 1YA0A 4N39A 2VTBA 3MV2B 3LEWA 3DEPA 4I2WA 3DSXA 1A5EA 3G2VA 3PUKA 4TRQA 2GRQB 3AU4A 1BI7B 4AOFA 1KLXA 3ASNE 3I3NA 3NZSA 2QZAA 4A3TA 5FTPA 3PZ3A 3L08A 3ASHA 5AQBA 4U95D 3CVXA 4LNGA 5CRUA 4DPRA 4PH4B 3AAAC 4F53A 3UMVA 5G05J 1Z3YA 3HVEB 1U3DA 1DVPA 5HRYA 2DBAA 5CCLA 5T8IA 3CVNA 4JHKA 3B95A 1KPSB 2WXMA 3ZW3A 4N3BA 3HXBA 2KZTA 3IV0A 1ELRA 5EIBE 4NRHB 3CK7A 2X3MA 5EKQD 4J7WA 2ILRA 1H2UA 3EHRA 4A1GA 4FLBA 2AW6A 3TWWA 4Q69A 3CIAA 3L22A 3FU6A 1HX8A 5KWDA 5EN5D 3ONKA 1S64A 4JZYA 2V8SE 4H7XA 3FTWA 3R9MA 5LCWJ 3QJZA 2QYJA 2J08A 5BPPA 1JPLA 4XI9A 1S0PA 4APFA 1G3NB 1TR4A 4OVVA 3TWTA 4KT6B 3ULYA 3FHEA 1KZOA 1UG3A 1PAQA 2R59A 4DK5A 3EJNA 1JUQA 1EYHA 4DX5D 2VGEA 4J8YA 1Z5SC 2GRLA 4XX5A 1OXJA 5G04J 4ABNA 4FLHA 4KZ0A 4KMOA 3JUEA 2KCKA 3BG1B 3R7RA 5HQ8A 1AP7A 5C2YA 4FHKA 1TN7A 3ULEG 5JJ6A 2F8YA 4LNBA 3DPYA 4GTTA 4KXKB 3V2XA 4PS3A 3D9PA 1SZ9A 3UQ3A 3SD5A 3NOCD 2XEEA 2AXZA 1UOHA 4HBDA 2X6HA 4JD2G 3MKQA 2P2CP 1Z3XA 5B3SE 2HM8A 2IO3C 1Q2ZA 4I43A 1SW6A 3IXEA 4UWKA 1DCEA 5BUZA 3K9IA 3G2TA 2WM9A 3C72A 4U07A 4A3VA 4GYWA 5KNGA 3W9GA 1UJKA 3RK6A 5KJNA 3GZ2A 1OT8A 3DSVA 2WPVA 3CHMA 3D9MA 4HNAD 3APFA 2ONDA 2AWIA 4BX8A 1N4RA 2IOLA 3QWWA 2LXLA 3FUFA 2P9UG 1JWGA 3RSEG 4A63B 3UT4A 3JQ1A 4YDWA 4CT0A 2PM7A 4HRLA 4CYMD 2XENA 3RRUA 2X6JA 2P9KG 1KT1A 1TN8A 1OUVA 2VSOE 2A5EA 1H0AA 1WM5A 4B94A 4QQIA 3ZHEB 1N52A 4NQ0A 3ZN3A 4GA0A 2XPYA 3PZ4A 4UQXA 4F7AA 2A5UA 3DRAA 4RVBA 3C3OA 3LXUX 2HYZA 1OWPA 2XPIA 4YDEA 3B13A 4YNDA 3LY7A 3UXGA 2GRMA 4GPMA 3AG1E 4MS6A 3EUVA 4LRZA 5G2NA 2WXFA 5LOZA 1RZ4A 2XEVA 2NXPA 2OOEA 4APOA 5AJDA 2XZDG 1SQMA 1U2VG 3HRAA 5FQ8A 3FTYA 1D9SA 4GCOA 4EHMA 3TWQA 2WB2A 5BW8C 4BFRA 1HU3A 4UUCA 3KEZA 4LG6A 3UM0A 2IONA 2BKGA 2VSYA 4AEZC 5ANLA 5AENA 2A4ZA 3FTZA 3QK0A 1N11A 3ZUVB 1W3BA 3SNXA
chains in the Genus database with same CATH topology
3FUJA 3GW4A 2LAHA 3UT8A 3U3WA 3QB2A 3RO2A 3S2AA 5AJLA 3HIZA 3IHVA 2X6IA 5T4YA 3IBEA 3MGBA 3P1UA 4GMLA 4JL0A 2I6HA 4BTBA 2NC9A 3B7SA 4BTAA 3FFLA 2WXIA 4W9RA 1Y6IA 3ENEA 1A17A 3SBSA 4ILIA 4YVQC 4KVOA 2XCBA 1QQEA 5M72A 2KCLA 4HVBA 1NA3A 2RG8A 1ZBPA 3SZ7A 2LSVA 3AS8A 3FUEA 3B7RL 4RSYA 1HE8A 4GCNA 4AIFA 4MLPA 3HVEA 1IQRA 2KZTB 3PUJA 2C0MA 4CDNA 4AJWA 1HXIA 5A7DB 4AM9A 4UI9C 4M3OA 4CDRA 1E8XA 3JYSA 2J4BA 3PH0C 3NQPA 4UI9K 4DLQA 3OTNA 1YA0A 4I1MA 4N39A 2VTBA 1JWFA 2WXGA 3MV2B 2OVBA 4B8CB 4KBQA 2WXQA 3ZRHA 3FU3A 3LEWA 4I6JA 3ZYMA 3PE4A 3G2UA 1B89A 4J0UA 2J9QA 3PDNA 4I2WA 2XCCA 5FQ4A 4ATGA 3L6AA 1UJJA 4JC8A 3G2VA 3PUKA 3MKRA 4TRQA 4L23A 1GW6A 4G11A 3AU4A 3ZYKA 4IULA 2FULA 3CR3A 4AOFA 1E8WA 4EBAA 1HF8A 3FUNA 5DBKA 4AY6A 3GYZA 1KLXA 1WY6A 1E7UA 3I3NA 3FULA 2QY7A 1EDUA 3NZSA 4B8AA 2AVPA 3I5PA 2MOWA 4A3TA 5J08A 3KS2A 3PNLB 3PRZA 5FTPA 2UY1A 4FULA 3E4BA 2KC7A 4JEUA 1ELKA 3FU5A 3Q15A 4GPKA 3L08A 3ASHA 4LCTA 4JA9A 2IFUA 5FQ6A 4WUYA 4FP7A 3VTXA 2WXKA 3CVLA 5J90A 3OXGA 3CVXA 4HS2A 4U0SA 4DPRA 4FC8A 4PH4B 4TUUA 1E8ZA 2PM6A 3CSFA 2YINA 3TL5A 4F53A 5E75A 4JW1A 4QFVA 3FUHA 4ILGA 1H19A 3QARA 3UMVA 5G05J 3ZXSA 1Z3YA 2WMNA 3FTXA 3UT7A 2FF4A 2JEKA 2V0PA 5D0QD 3HVEB 3FP3A 4H7YA 1U3DA 1DVPA 4NURA 2DBAA 5CCLA 4E85A 3MYVA 5T8IA 3CVNA 4G2VA 4JHKA 4GZ3A 4PS8A 4U0UA 4WWNA 5AYWD 2WXMA 3ZPJA 3TXMA 3ZW3A 5AIJA 1OWLA 3L17A 4WNGA 4DLOA 4EECA 4EZJA 4U8HA 4N3BA 3FDHA 4E6HA 4GZ6A 2WXOA 2FO7A 3MA5A 2KZTA 4G25A 4J8FA 3Q49B 3FUMA 3LY8A 4Q94A 4PUCA 2IF4A 3IV0A 1ELRA 4HOTA 2OV8A 3OAWA 1EF1C 4KVMA 4I1AA 4NRHB 3CK7A 2C2LA 4Y6WA 4URKA 3ZVVA 3NZUA 2Y3AA 2Y4UA 1BPOA 2X3MA 5EKQD 4D10C 3LCAA 2ILRA 3ZYLA 1H2UA 3IEGA 1MHQA 3ESKA 2UY1B 2XQ0A 4I2ZA 4UI9J 2WMOA 4U04A 2MRIA 4XZ4A 5DIZA 2Q7FA 4FLBA 2M63A 3SF4A 4A1GA 1OWNA 3D9JA 3CHPA 4WNFA 5G55A 3ZEFA 2AW6A 4CDMA 3CVYA 4YVOA 4Y6CA 5T3RA 5JJ7A 4R7LA 4Q69A 1H2VC 2J09A 4A1SA 1HG2A 3L54A 1N54A 2XRYA 4HLEA 3TG4A 3Q4AB 3UX4A 3ZN3A 3CIAA 3CEQA 4PS7A 3L22A 4XI0A 3FU6A 1HX8A 3FEXA 3BEEA 2CHZA 4I6EA 3ZFWA 3ONKA 3LYAA 4JZYA 3EHMA 3BG0B 2V8SE 3VLEA 3NF1A 2IOSA 5EX3A 4H7XA 4PDXA 5FQ7A 3ULQA 2E0IA 4AV7A 3AS5A 3FTWA 3PNTB 2BF0X 3FEYA 4I9CA 3ZYQA 4WAFA 5LCWJ 2CG2A 3QAQA 4XE0A 4IRUA 3QJZA 4N3AA 3LJ3A 5JHAA 2J08A 5BPPA 1JPLA 4XI9A 4A55A 3RRNB 4JEHA 1S0PA 3LVRE 4APFA 2J07A 4I6GA 3IKOB 3CHOA 3ESLA 2LAIA 2JLBA 3AS4A 4Q96A 4OVVA 3T5XA 4AY5A 3TG5A 3PS6A 3G2WA 3DPDA 4GA2A 5ARGA 3EIQC 4GYYA 4KT6B 3L16A 5A23A 3FHEA 3EIJA 1UG3A 3G2SA 1PAQA 2R59A 3JCKC 4WNEA 5C1DA 4DK5A 3LS8A 3EJNA 5FT9A 3QNKA 1JUQA 3MX3A 3CHSA 1LF8A 2R5SA 2CHXA 1EYHA 4J8SA 3D9IA 3AU5A 5D0OD 1INZA 3CKCA 4N2SA 2QFCA 4BSXA 3D9NA 4N3CA 4CGWA 1Y8MA 2FI7A 4L2LA 4AP2A 5JJTA 3CK9A 4MRUA 4XX5A 2GRLA 3VTYA 2CHWA 4F1SA 5G04J 1MQSA 3CSTA 3VLFA 1HO8A 3JQ0A 3WXXA 5CMYA 4LEUA 4GZ5A 4CEMA 4CRWA 3MV3B 4HFGA 4ABNA 1TJCA 1HG5A 2WVIA 3D9OA 4FLHA 4KZ0A 4ANXA 2C0LA 4WWPA 2VSXE 4KMOA 3U64A 3S7BA 4MKTA 4I17A 5JHBA 3QOUA 3T5VA 4NACA 2KCKA 5EX0A 1ELWA 2AXUA 1P5QA 4AXHA 3HDXA 1HH8A 3BG1B 3R7RA 3RO3A 5HQ8A 1QZ2A 5C2YA 4HOSA 1FCHA 1SZAA 4BY6A 3CKBA 2YHEA 4FHKA 3QWVA 2DCPA 4BT9A 3UPVA 3RRMB 5EDSA 1U3CA 3D3MA 3D9LA 2KM4A 5JJ6A 2I9CA 3KAEA 4C0MA 3CVPA 4ILHB 4TV3A 4LERA 4CGVA 1E90A 4K0RA 3LY9A 2VGYA 2I1JA 3SHFA 1HFAA 3Q47B 2WQ7A 4KXKB 4PS3A 4UWGA 3D9PA 1SZ9A 2PQRA 4KYOB 1Z6TA 3SD5A 1VDYA 1OWMA 1H6KA 3UQ3A 4BWRA 4XIFA 4EPZA 2AXZA 2RD0A 2LO6A 3QWPA 2IJGX 3CQCB 2WXNA 5LX8A 4DI4A 3ONLA 2VGXA 3ASGA 2X6HA 4G23A 4L1BA 4GZDA 4UQYA 3LKUA 3MKQA 2PL2A 3OXFA 1Z3XA 3FTVA 2J4DA 4JHJA 2GW1A 4DJAA 2HM8A 4EZKA 2XPZA 4I43A 2P58C 1FVFA 4GZCA 1IYGA 2LSUA 3N71A 4UWKA 4P29A 4FADA 5BUZA 2YQ8A 3K9IA 3G2TA 4GMJA 3ML9A 5FZQA 4ANUA 4EQFA 4CT4A 4G26A 3HYMB 3SFZA 2WM9A 1WAO1 2I2OA 4U07A 4ACKA 2CG3A 4A3VA 2XRZA 4ANVA 5CMWA 4GYWA 2KATA 2VYIA 3CQGB 3PVLA 2VJ8A 4HOUA 3EDTB 1OWOA 1UJKA 3RK6A 1IHGA 3LPZA 1L5JA 4JA7A 5G05C 3ZIMA 5KJNA 3S7DA 5ARFA 2X6FA 3GZ2A 4L2YA 3ZHEA 1IQUA 4F3VA 5BV0A 5KJMA 2WPVA 2LNIA 3CHMA 3GZSA 3LDZA 2PZIA 2VQ2A 4KZCA 3D9MA 3SI5A 1ZU2A 3APFA 2FEZA 5E76A 2ONDA 1E96B 3FH8A 5LFAA 3I4GA 2AWIA 3DBSA 4N5CA 4BX8A 3PEVB 4OVUA 2IOLA 3QWWA 2J49A 4V3IA 3FUFA 3QC1A 2WQ6A 2VGXB 3FH7A 3RKVA 3B7TA 1JWGA 3UT4A 3MKQB 3TXNA 2OVFA 3JQ1A 4HXIA 1EPUA 4CT0A 4J8DA 5FWQA 2X6KA 1PC2A 1TEZA 3CV0A 3SGHA 4C9BB 4GB9A 5FJYA 4FU3A 5FZRA 5BNWA 2PM7A 2KCVA 4BX9A 2L0TB 4WWOA 1X5BA 4UWHA 3O48A 3LVQE 2Y4TA 3CHRA 2WXRA 3CVVA 1NP7A 1HS6A 4ME2A 1KT0A 1XNFA 3RRUA 4CCAA 2UWJG 2X6JA 3S7FA 1QNFA 1KT1A 2FBNA 2EQXA 4B0ZA 2XGMA 4C0EA 3U66A 4I9EA 3PEUB 3ML8A 2V4LA 5BT1A 4EBAG 2BUGA 4O6FA 3FTUA 4IN3B 1OUVA 2L0IA 4L7TA 2VSOE 3CVWA 1H0AA 4RG9A 3FUDA 3S7JA 1WM5A 4B94A 1NA0A 2L6JA 3URZA 3ZHEB 4JPSA 4J6IA 1N52A 2CFZA 3FH5A 2V5FA 4FA6A 4GA1A 3B7UX 1UW4B 2BTDA 4WNDA 3FY4A 4NQ0A 1DNPA 3ASDA 4GA0A 2XPYA 3O4ZA 2WXPA 2XGOA 4UQXA 3U9WA 4JXTA 4F7AA 5LCWC 2A5UA 1TJFA 3CVUA 3FTSA 4RVBA 4U0ZA 5A6CA 2I1KA 4GYOA 3LXUX 1E7VA 3MZLB 1FVHA 4J8EA 3FUKA 4UWFA 4UQZA 4BT8A 1UN9A 2HO1A 2HYZA 1OWPA 3CLJA 4HORA 2XPIA 3JUIA 2L9BA 3R7QA 5FZSA 3B13A 4YNDA 3LY7A 2PQNA 3FWVA 2GRMA 5CCMA 2YHCA 4K03A 1UN8A 4MS6A 3FU0A 3EHNA 1PY1A 3RU0A 1HZ4A 3T8MA 2XHEA 4LRZA 5G2NA 2WXFA 3D9KA 3MEKA 5LOZA 3FUIA 3APDA 3CHQA 2WXJA 3UUXA 2GGFA 2XEVA 4ANWA 2NXPA 3PE3A 2WXLA 3L13A 3MCXA 2OOEA 3KD7A 3VLDA 4APOA 2R17C 3APCA 3QKYA 4UWLA 5AJDA 3R9AB 4DI3A 2VTBB 5CHEE 3ZGQA 4N2QA 2IU1A 4LUNU 3I4RB 5LP0A 4G1TA 4AVXA 5G04C 4FJYA 2NSZA 1H2TC 3HHMA 3MJWA 3PREA 4GU5A 4U63A 4GAAA 1SQMA 4RG6A 2WXHA 4G24A 3RJVA 5FQ8A 3Q5MA 2HR2A 3FTYA 4IYPA 2VSNA 4HOQA 3CGHA 3CVQA 4I1OB 1NZNA 1E8YA 4GCOA 4JVSA 5KJLA 4FJZA 5ENNA 4ACLA 4XKCA 2YNQA 3RIBA 5KJKA 3TGOA 5BV1A 2WB2A 4JHRA 2DIWA 2E2EA 5BW8C 2IQCA 3C98A 4FHJA 4BFRA 3OXLA 4EZLA 1HU3A 3PZDA 3P2BA 3KEZA 5KCMA 3TJPA 2WQHA 4XKBA 3IHYA 3TAXA 2IONA 3ASFA 2VSYA 4AEZC 2AXVA 3QDNA 5ANLA 3SBTB 5AENA 2A4ZA 2X38A 3CK8A 3FTZA 3QK0A 5HI7A 3GZ1A 2MHKA 5ANRA 1XGWA 3U4TA 1W3BA 2CFUA 3SNXA 2ZU6B 4OYSA 4B89A 2XGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GW4 A;  3U3W A;  3RO2 A;  4JL0 A;  2I6H A;  4BTB A;  2NC9 A;  4BTA A;  3FFL A;  4W9R A;  1A17 A;  4YVQ C;  1QQE A;  2XCB A;  5M72 A;  2KCL A;  1NA3 A;  3SZ7 A;  1ZBP A;  2LSV A;  3AS8 A;  4GCN A;  4AIF A;  2C0M A;  1HXI A;  5A7D B;  4AM9 A;  4UI9 C;  4CDR A;  3JYS A;  4UI9 K;  1YA0 A;  4N39 A;  3MV2 B;  4KBQ A;  3PE4 A;  1B89 A;  4J0U A;  2J9Q A;  3PDN A;  4I2W A;  2XCC A;  3MKR A;  4AY6 A;  5DBK A;  3GYZ A;  1KLX A;  2AVP A;  3KS2 A;  5FTP A;  2UY1 A;  3E4B A;  2KC7 A;  3Q15 A;  4GPK A;  3ASH A;  4JA9 A;  2IFU A;  4WUY A;  3VTX A;  3CVL A;  3OXG A;  4U0S A;  5G05 J;  2FF4 A;  5D0Q D;  3FP3 A;  4H7Y A;  2DBA A;  5CCL A;  3CVN A;  4G2V A;  4GZ3 A;  5AYW D;  4U0U A;  3ZPJ A;  4WNG A;  4N3B A;  4GZ6 A;  2FO7 A;  3MA5 A;  4G25 A;  4J8F A;  3Q49 B;  3LY8 A;  2IF4 A;  1ELR A;  4HOT A;  4I1A A;  4NRH B;  3CK7 A;  2C2L A;  4Y6W A;  2Y4U A;  5EKQ D;  3LCA A;  3IEG A;  3ESK A;  2UY1 B;  4I2Z A;  4UI9 J;  4U04 A;  5DIZ A;  2Q7F A;  3SF4 A;  4WNF A;  4YVO A;  4Y6C A;  5JJ7 A;  4A1S A;  3TG4 A;  3Q4A B;  3CEQ A;  4XI0 A;  3BEE A;  3ZFW A;  3LYA A;  3NF1 A;  5EX3 A;  4H7X A;  3ULQ A;  3AS5 A;  5LCW J;  4I9C A;  4N3A A;  4XI9 A;  3AS4 A;  2JLB A;  4AY5 A;  3TG5 A;  4GA2 A;  5ARG A;  4GYY A;  4WNE A;  5C1D A;  5FT9 A;  2R5S A;  5D0O D;  3CKC A;  4N2S A;  2QFC A;  4N3C A;  4CGW A;  1Y8M A;  2FI7 A;  5JJT A;  3CK9 A;  3VTY A;  5G04 J;  3WXX A;  4LEU A;  4GZ5 A;  3MV3 B;  4ABN A;  1TJC A;  2C0L A;  3S7B A;  4I17 A;  3QOU A;  2KCK A;  5EX0 A;  1ELW A;  1P5Q A;  1HH8 A;  3RO3 A;  5HQ8 A;  1QZ2 A;  4HOS A;  1FCH A;  3CKB A;  3QWV A;  4BT9 A;  3UPV A;  5JJ6 A;  3KAE A;  3CVP A;  4CGV A;  3LY9 A;  2VGY A;  3Q47 B;  4KXK B;  2PQR A;  4KYO B;  3UQ3 A;  4BWR A;  4XIF A;  3QWP A;  2VGX A;  3ASG A;  4G23 A;  4UQY A;  3LKU A;  2PL2 A;  3OXF A;  2GW1 A;  2P58 C;  1IYG A;  2LSU A;  3N71 A;  2YQ8 A;  3K9I A;  5FZQ A;  4EQF A;  4G26 A;  3HYM B;  1WAO 1;  4U07 A;  4GYW A;  2KAT A;  2VYI A;  4HOU A;  3EDT B;  1IHG A;  3LPZ A;  4JA7 A;  5G05 C;  5KJN A;  3S7D A;  5ARF A;  3GZ2 A;  3ZHE A;  4F3V A;  5KJM A;  2WPV A;  2LNI A;  2PZI A;  2VQ2 A;  1ZU2 A;  2FEZ A;  2OND A;  1E96 B;  4N5C A;  3QWW A;  2VGX B;  3RKV A;  4J8D A;  1PC2 A;  3CV0 A;  5FJY A;  5FZR A;  5BNW A;  2KCV A;  3O48 A;  2Y4T A;  4ME2 A;  1KT0 A;  1XNF A;  2UWJ G;  3S7F A;  1KT1 A;  2FBN A;  2XGM A;  4I9E A;  5BT1 A;  2BUG A;  4O6F A;  4IN3 B;  1OUV A;  4RG9 A;  3S7J A;  1WM5 A;  4B94 A;  1NA0 A;  2L6J A;  3URZ A;  3ZHE B;  2V5F A;  4GA1 A;  4WND A;  4NQ0 A;  4GA0 A;  3ASD A;  3ZN3 A;  4UQX A;  2XGO A;  5LCW C;  4U0Z A;  5A6C A;  4GYO A;  4J8E A;  4UQZ A;  4BT8 A;  2HO1 A;  2HYZ A;  4HOR A;  2XPI A;  5FZS A;  4YND A;  3LY7 A;  2PQN A;  3FWV A;  5CCM A;  2YHC A;  3RU0 A;  1HZ4 A;  3MEK A;  3UUX A;  2XEV A;  3PE3 A;  2OOE A;  3KD7 A;  4APO A;  3QKY A;  4N2Q A;  3R9A B;  5CHE E;  3ZGQ A;  4G1T A;  5G04 C;  4RG6 A;  4G24 A;  3RJV A;  3Q5M A;  2HR2 A;  2VSN A;  4HOQ A;  3CVQ A;  1NZN A;  4GCO A;  5KJL A;  3TGO A;  5KJK A;  3RIB A;  4JHR A;  5BW8 C;  2E2E A;  3OXL A;  2WQH A;  3TAX A;  3ASF A;  2VSY A;  3QDN A;  3CK8 A;  5HI7 A;  3GZ1 A;  2MHK A;  3U4T A;  1W3B A;  2XGS A; 
#chains in the Genus database with same CATH topology
 2LAH A;  3RO2 A;  1K1A A;  3IHV A;  2X6I A;  3T9K A;  5CBO A;  4OAV B;  3MGB A;  3UTM A;  3TWR A;  3B7S A;  4BTA A;  3SBS A;  5ENS D;  2R02 A;  3B7R L;  4GCN A;  4MLP A;  3HVE A;  4AJW A;  1HXI A;  5A7D B;  4UI9 C;  4HQD A;  1E8X A;  3PH0 C;  3NQP A;  1N4P A;  2ZIS A;  4O60 A;  4B8C B;  2JAB A;  3ZYM A;  3G2U A;  3BQO A;  1UJJ A;  4JC8 A;  1GW6 A;  2RFA A;  2FUL A;  4AY6 A;  1WY6 A;  1IHB A;  1N4S A;  3FUL A;  1EDU A;  4B8A A;  2AVP A;  2MOW A;  4FUL A;  3ZU7 B;  4JEU A;  1ELK A;  2FO1 E;  4GPK A;  5ENP D;  3CVL A;  3DSW A;  3TL5 A;  2PM6 A;  2YIN A;  5E75 A;  3QAR A;  3UT7 A;  2FF4 A;  2JEK A;  2V0P A;  5D0Q D;  3AJI A;  4E85 A;  3MYV A;  4GZ3 A;  5AYW D;  3TXM A;  4WNG A;  4DLO A;  4EEC A;  4U8H A;  2WXO A;  3MA5 A;  4RLY A;  4J8F A;  4ZHB A;  4DUI A;  2IF4 A;  4HOT A;  1EF1 C;  4I1A A;  4Y6W A;  1BPO A;  4D10 C;  5EIL A;  3ESK A;  2UY1 B;  4UI9 J;  4U04 A;  5AQ7 A;  3ZEF A;  3CHP A;  3CVY A;  5T3R A;  5JJ7 A;  4R7L A;  2J09 A;  2H6G A;  3UX4 A;  4XI0 A;  3FEX A;  1V54 E;  2CHZ A;  3LYA A;  3EHM A;  4AV7 A;  3AS5 A;  3HXD A;  4WAF A;  2CG2 A;  2KBX A;  5B1B E;  3LJ3 A;  5JHA A;  4TXP A;  3LVR E;  2J07 A;  3TWV A;  3DPD A;  5H7P A;  4GYY A;  5A23 A;  4GTR A;  3EIJ A;  4WNE A;  5C1D A;  5FT9 A;  3MX3 A;  3CHS A;  2R5S A;  4J8S A;  3D9I A;  4HI8 A;  5D0O D;  2DYS E;  2R03 A;  4N3C A;  2FI7 A;  4AP2 A;  5JJT A;  3CK9 A;  3VTY A;  4K5B A;  3NB2 A;  4K5A B;  3CST A;  4U8Y D;  3VLF A;  3JQ0 A;  4GZ5 A;  4CEM A;  4HFG A;  1KZP A;  1HG5 A;  3D9O A;  4WWP A;  3S7B A;  5JHB A;  3T5V A;  3QOU A;  1MX6 A;  2AXU A;  4AXH A;  1HH8 A;  4HOS A;  1OCR E;  1FPP A;  4BY6 A;  2H6F A;  3L9T A;  2LXM A;  1NL4 A;  3ASO E;  1N94 A;  2DCP A;  1N0Q A;  2IY0 C;  3UPV A;  5EDS A;  1RW2 A;  3D9L A;  2OEV A;  3KAE A;  4C0M A;  3CVP A;  1S70 B;  2I1J A;  1HFA A;  3B7B A;  4KYO B;  4BWR A;  4BES A;  4ZFH A;  2RD0 A;  5LX8 A;  4DI4 A;  2ETB A;  4G23 A;  4UQY A;  2J4D A;  2GW1 A;  2V5Q C;  4EZK A;  4LSZ E;  1IYG A;  2RKK A;  3UM3 A;  4P29 A;  2I2O A;  4ACK A;  3UM2 A;  3SY2 A;  3PVL A;  2EIK E;  3EDT B;  4X8Q A;  5ENO D;  4JA7 A;  3ZHE A;  1OY3 D;  4F3V A;  5BV0 A;  5KJM A;  1JCS A;  4G8K A;  5FIN A;  2VQ2 A;  4KZC A;  1ZU2 A;  3ZNG A;  4K5C A;  5E76 A;  1E96 B;  4JB8 P;  3FH8 A;  4B93 B;  3I4G A;  5LFA A;  3DBS A;  3PEV B;  4OVU A;  4V3I A;  2VGX B;  4HLL A;  3TXN A;  2OVF A;  1EPU A;  4J8D A;  5FWQ A;  1PC2 A;  4GB9 A;  4BX9 A;  2Y1L E;  3AG4 E;  2L0T B;  1X5B A;  3O48 A;  2Y4T A;  3CHR A;  1D8E A;  1KT0 A;  2OCC E;  2UWJ G;  4HI9 A;  4C0E A;  1TNU A;  4L7T A;  3ABL E;  3Q78 A;  4J6I A;  2CFZ A;  2V5F A;  2L6B A;  4GA1 A;  1UW4 B;  2BTD A;  4WND A;  1MZC A;  1TJF A;  1TNO A;  2BED A;  3FTS A;  2GRP B;  4U0Z A;  5A6C A;  4GYO A;  4UWF A;  3FUK A;  2HO1 A;  3CLJ A;  1H6P A;  2PQN A;  5CCM A;  4DX6 D;  2YHC A;  4K03 A;  3FU0 A;  1MYO A;  1PY1 A;  3RU0 A;  1HZ4 A;  2H6I A;  3FUI A;  3CHQ A;  3PE3 A;  2WXL A;  3VLD A;  4ATZ D;  2VTB B;  4DI3 A;  4N2Q A;  4TXQ A;  4LUN U;  1DC2 A;  2NSZ A;  3MJW A;  3HHM A;  4G24 A;  3RJV A;  3KSQ A;  2BKK B;  4M7C A;  2VSN A;  2B6C A;  4N5Q A;  3TGO A;  4XKC A;  3OXL A;  2QYU A;  3PZD A;  3P2B A;  1S63 A;  4XKB A;  3IHY A;  3Q75 A;  3QDN A;  3Q7F A;  3Q7A A;  5HI7 A;  5ANR A;  2CFU A;  3V31 A;  4HRN A;  1K1B A;  2XGS A;  3FUJ A;  3QB2 A;  4GML A;  2ZXW E;  3FFL A;  1LTX A;  4ILI A;  4YVQ C;  1QQE A;  3FUE A;  2ZIR A;  1O1S A;  4RSY A;  1HE8 A;  5ENQ D;  2KZT B;  1LD7 A;  4CDN A;  4AM9 A;  2RFM A;  3JYS A;  4UI9 K;  1AWC B;  3OTN A;  4I1M A;  1JWF A;  2WXG A;  3NBN B;  3HXE A;  3PE4 A;  4J0U A;  3BU8 A;  2J9Q A;  3PDN A;  3HG0 D;  3KEA A;  4MBG A;  4L23 A;  1E8W A;  3FUN A;  5CER B;  3DSU A;  3I5P A;  5J08 A;  3PRZ A;  2UY1 A;  3EU5 A;  3E4B A;  3FU5 A;  3Q15 A;  3SFY A;  4JA9 A;  4FP7 A;  3VTX A;  5J90 A;  4U0S A;  4FC8 A;  1E8Z A;  5AAO A;  2R2L A;  2LUH A;  1H19 A;  4O1O A;  2WMN A;  3FTX A;  4H7Y A;  1ZB1 A;  4G2V A;  4PS8 A;  4U0U A;  4WWN A;  5AIJ A;  1OWL A;  3L17 A;  3V79 K;  3FDH A;  3UKU G;  4G25 A;  3C5R A;  3Q49 B;  3FUM A;  3LY8 A;  4Q94 A;  4PUC A;  4KVM A;  4OAU C;  4O1P A;  3Q79 A;  2C2L A;  3NZU A;  2J8S D;  3LCA A;  3ZYL A;  1LD8 A;  1MHQ A;  3W9F A;  2IEJ A;  2XQ0 A;  4I2Z A;  2MRI A;  4XZ4 A;  5DIZ A;  1YCS B;  2M63 A;  3D9J A;  5G55 A;  4CDM A;  2ZGD A;  1YYH A;  4Y6C A;  4YVO A;  1SA4 A;  4U8V D;  1HG2 A;  3L54 A;  1N54 A;  3J5P A;  4HLE A;  2P9I G;  3CEQ A;  2ETC A;  4I6E A;  3BG0 B;  3NF1 A;  4PDX A;  5FQ7 A;  3KSL A;  3ULQ A;  2E0I A;  3PNT B;  2BF0 X;  3FEY A;  4IRU A;  4U7E B;  3RRN B;  4JEH A;  2F0Y A;  4I6G A;  3IKO B;  3ESL A;  2LAI A;  1N95 A;  2JLB A;  4BEP A;  3T5X A;  4AY5 A;  3PS6 A;  5ARG A;  3EIQ C;  4GTP A;  2Y69 E;  3QNK A;  5JA4 D;  1NFI E;  3AU5 A;  1INZ A;  2QC9 A;  4N2S A;  3D9N A;  4CGW A;  3DSS A;  4MRU A;  1MQS A;  3T8K A;  3WXX A;  3E33 A;  4CRW A;  2V4H C;  3MV3 B;  1TJC A;  1TNY A;  2WVI A;  5D2M C;  4ANX A;  2C0L A;  2VSX E;  3U64 A;  1YMP A;  4MKT A;  3AG3 E;  4YDO A;  1P5Q A;  1DCQ A;  1FCH A;  3PZ1 A;  3CKB A;  3Q73 A;  2YHE A;  3QWV A;  4BT9 A;  1U3C A;  3D3M A;  2KM4 A;  2I9C A;  4BET A;  4CGV A;  3LY9 A;  2VGY A;  2WQ7 A;  2KXP C;  1H6K A;  4XIF A;  2LO6 A;  3QWP A;  3CQC B;  2WXN A;  3ONL A;  2R05 A;  5CEA A;  2VGX A;  3ASG A;  4GZD A;  3DEO A;  3LKU A;  2PL2 A;  3OXF A;  3FTV A;  2DZN A;  4JHJ A;  1FT1 A;  4CZ2 D;  4DJA A;  2XPZ A;  2P58 C;  1NI1 A;  4GZC A;  3N71 A;  2B0O E;  2ETA A;  4GMJ A;  3HXF A;  4EQF A;  4ANU A;  4G26 A;  3HYM B;  1WAO 1;  2CG3 A;  2XRZ A;  4ANV A;  4Z68 A;  5CMW A;  2VJ8 A;  4GMR A;  5CEC B;  2GRO B;  3E32 A;  3ZIM A;  5G05 C;  3S7D A;  5ARF A;  2X6F A;  4L2Y A;  1IQU A;  3LDZ A;  2PZI A;  3ISM C;  4GTS A;  2J49 A;  3FH7 A;  3RKV A;  5AQ9 A;  4HXI A;  2XZT G;  1V55 E;  3SGH A;  4C9B B;  5FJY A;  1JCQ A;  4UWH A;  5D66 A;  4GTV A;  4DRX E;  3CVV A;  1NP7 A;  3C3R A;  1XNF A;  4CCA A;  1QNF A;  2EQX A;  4B0Z A;  2XGM A;  4O6F A;  4IN3 B;  5JMN D;  4HRM B;  1NA0 A;  2L6J A;  4F1P A;  4JPS A;  4FA6 A;  3B7U X;  3U9W A;  1DNP A;  3ASD A;  3O4Z A;  2XGO A;  5LCW C;  4L9P A;  3DWL G;  3CVU A;  5BXO A;  1FVH A;  1FT2 A;  4BT8 A;  4HOR A;  3JUI A;  4GTO A;  1N0R A;  1OCC E;  4F6R D;  4DX2 A;  3UUX A;  3APD A;  3SQV A;  2GGF A;  3L13 A;  2R17 C;  3APC A;  3R9A B;  5AN8 A;  5CHE E;  2IU1 A;  3C3Q A;  5ITZ F;  4G1T A;  4AVX A;  5EYL A;  3J5Q B;  5G04 C;  4FJY A;  3U66 A;  3PRE A;  4GU5 A;  4GAA A;  2WXH A;  2EIN E;  2PNN A;  2EIJ E;  3UI2 A;  4HOQ A;  3CGH A;  5HS0 A;  5KJL A;  5ENN A;  4ACL A;  3RIB A;  5B1A E;  5BV1 A;  3DST A;  2XS1 A;  2E2E A;  4FHJ A;  4EZL A;  5KCM A;  1N4Q A;  1TNZ A;  2F8X K;  3SBT B;  2X38 A;  1WG0 A;  3GZ1 A;  3E34 A;  3U4T A;  2ZU6 B;  4OYS A;  3ZXP A;  1QBQ A;  3UM1 A;  3DXK G;  3IBE A;  4JL0 A;  2I6H A;  4BTB A;  1OCZ E;  2WXI A;  3ENE A;  1A17 A;  2MYO A;  3HXC A;  2XCB A;  1NA3 A;  1ZBP A;  3AS8 A;  1QYM A;  3PUJ A;  3ABM E;  3E30 A;  3TWX A;  2OVB A;  2GRN B;  2WXQ A;  4KBQ A;  3ZRH A;  3FU3 A;  1BI8 B;  4I6J A;  1OCO E;  2P9L G;  1B89 A;  1JCR A;  2XCC A;  5FQ4 A;  4ATG A;  3NOG D;  3L6A A;  3MKR A;  1K3Z D;  4G11 A;  3ZYK A;  4EBA A;  4IUL A;  3CR3 A;  1HF8 A;  5DBK A;  3GYZ A;  2F37 A;  1E7U A;  2QY7 A;  4BSZ B;  3KS2 A;  3PNL B;  5EYP F;  2Y0B G;  2KC7 A;  4LCT A;  2IFU A;  5FQ6 A;  4WUY A;  2WXK A;  3OXG A;  4HS2 A;  4TUU A;  2ZGG A;  3CSF A;  3TWS A;  1O1T A;  4JW1 A;  5ENR D;  4QFV A;  2P9S G;  3FUH A;  4ILG A;  3ZXS A;  3FP3 A;  3BUA A;  4NUR A;  1SA5 A;  3ZPJ A;  4EZJ A;  4E6H A;  4GZ6 A;  2FO7 A;  3UIN C;  3ABK E;  1TNB A;  2OV8 A;  3OAW A;  4BER A;  4RQI A;  4URK A;  3ZVV A;  2Y3A A;  2Y4U A;  3IEG A;  5AAR A;  3L82 A;  2WMO A;  3E37 A;  2Q7F A;  3SF4 A;  2P9P G;  1OWN A;  4WNF A;  5AQA A;  1H2V C;  4A1S A;  2XRY A;  3TG4 A;  3Q4A B;  4PS7 A;  3BEE A;  3Q9U C;  3JXI A;  3ZFW A;  5CRV A;  1MX4 A;  3VLE A;  1WDY A;  2IOS A;  5EX3 A;  3V2O A;  4I9C A;  3ZYQ A;  5BXU A;  3QAQ A;  4XE0 A;  4NIK A;  4N3A A;  5EID A;  2XS8 A;  4A55 A;  3CHO A;  4Q96 A;  3AS4 A;  3TG5 A;  2HE0 A;  3G2W A;  4GA2 A;  4TXR A;  3SO8 A;  3L16 A;  3G2S A;  3JCK C;  3LS8 A;  1SVX A;  3TWU A;  1LF8 A;  2CHX A;  5ENT D;  4LNU D;  3CKC A;  2QFC A;  4BSX A;  4GTM A;  1Y8M A;  4L2L A;  3Q9N C;  2CHW A;  4F1S A;  3AG2 E;  1HO8 A;  1O5M A;  1IXV A;  4C48 B;  5CBN A;  5CMY A;  4LEU A;  2EIM E;  4I17 A;  3EU9 A;  4NAC A;  5EX0 A;  1ELW A;  3HDX A;  3RO3 A;  1QZ2 A;  1SZA A;  3RRM B;  2DZO A;  4ILH B;  4TV3 A;  1H6O A;  4LER A;  1E90 A;  4K0R A;  2NYJ A;  3SHF A;  3Q47 B;  1X81 A;  1N9A A;  4UWG A;  2DVW A;  4DX7 D;  2PQR A;  1Z6T A;  1VDY A;  1OWM A;  4EPZ A;  2IJG X;  1BU9 A;  4GTQ A;  5KBA A;  4L1B A;  1TN6 A;  1FVF A;  2LSU A;  4FAD A;  2YQ8 A;  3ML9 A;  5FZQ A;  4CT4 A;  3SFZ A;  3LJN A;  2OEW A;  3RAU A;  2KAT A;  2VYI A;  3CQG B;  3UKR G;  4HOU A;  1OWO A;  1IHG A;  2P9N G;  1L5J A;  3LPZ A;  1K8K G;  1MJ0 A;  2LNI A;  3GZS A;  3SI5 A;  2FEZ A;  1D8D A;  4N5C A;  3QC1 A;  5IY5 E;  2WQ6 A;  4XEI G;  3B7T A;  5CED B;  3MKQ B;  2X6K A;  1TYQ G;  1TEZ A;  3CV0 A;  3UIO C;  4FU3 A;  5FZR A;  3SFX A;  5BNW A;  2KCV A;  1O1R A;  4WWO A;  3ZKJ A;  3LVQ E;  2XEH A;  2WXR A;  1HS6 A;  4ME2 A;  2IO2 C;  3S7F A;  2FBN A;  4I9E A;  3PEU B;  3ML8 A;  2V4L A;  5BT1 A;  1MX2 A;  4EBA G;  2BUG A;  3FTU A;  4DX1 A;  2L0I A;  4HB5 A;  3CVW A;  4RG9 A;  3FUD A;  3S7J A;  3URZ A;  5HKP A;  3FH5 A;  3FY4 A;  2WXP A;  4JXT A;  2H6H A;  2I1K A;  1E7V A;  3MZL B;  4J8E A;  1BLX B;  5FIO A;  4UQZ A;  1UN9 A;  3PZ2 A;  3R7Q A;  2L9B A;  3JXJ A;  5FZS A;  3FWV A;  1UN8 A;  3F6Q A;  3EHN A;  3D9H A;  3T8M A;  4G8L A;  3WG7 E;  2XHE A;  3D9K A;  3MEK A;  2WXJ A;  4ANW A;  3MCX A;  3KD7 A;  3QKY A;  4UWL A;  2GRR B;  3ZGQ A;  5LP0 A;  3I4R B;  3NAW A;  1H2T C;  4U63 A;  1IKN D;  2AJA A;  4RG6 A;  3Q5M A;  2HR2 A;  4IYP A;  4I1O B;  3CVQ A;  1NZN A;  1E8Y A;  4JVS A;  4FJZ A;  5KJK A;  2YNQ A;  4JHR A;  2DIW A;  2IQC A;  3C98 A;  3TJP A;  5KNH D;  2WQH A;  3TAX A;  3ASF A;  2DYR E;  2AXV A;  3UIP C;  3CK8 A;  4TUM A;  2MHK A;  1XGW A;  4B89 A;  3GW4 A;  3UT8 A;  3U3W A;  3S2A A;  5AJL A;  3HIZ A;  5T4Y A;  3P1U A;  2EIL E;  2NC9 A;  3EHQ A;  2DWZ A;  4W9R A;  1Y6I A;  4KVO A;  5M72 A;  2KCL A;  4HVB A;  2RG8 A;  3SZ7 A;  3V30 A;  2LSV A;  4YDY A;  3X2Q E;  4AIF A;  1IQR A;  2C0M A;  4U96 D;  1BD8 A;  4M3O A;  4CDR A;  3DXM G;  2J4B A;  4DLQ A;  1YA0 A;  4N39 A;  2VTB A;  3MV2 B;  3LEW A;  3DEP A;  4I2W A;  3DSX A;  1A5E A;  3G2V A;  3PUK A;  4TRQ A;  2GRQ B;  3AU4 A;  1BI7 B;  4AOF A;  1KLX A;  3ASN E;  3I3N A;  3NZS A;  2QZA A;  4A3T A;  5FTP A;  3PZ3 A;  3L08 A;  3ASH A;  5AQB A;  4U95 D;  3CVX A;  4LNG A;  5CRU A;  4DPR A;  4PH4 B;  3AAA C;  4F53 A;  3UMV A;  5G05 J;  1Z3Y A;  3HVE B;  1U3D A;  1DVP A;  5HRY A;  2DBA A;  5CCL A;  5T8I A;  3CVN A;  4JHK A;  3B95 A;  1KPS B;  2WXM A;  3ZW3 A;  4N3B A;  3HXB A;  2KZT A;  3IV0 A;  1ELR A;  5EIB E;  4NRH B;  3CK7 A;  2X3M A;  5EKQ D;  4J7W A;  2ILR A;  1H2U A;  3EHR A;  4A1G A;  4FLB A;  2AW6 A;  3TWW A;  4Q69 A;  3CIA A;  3L22 A;  3FU6 A;  1HX8 A;  5KWD A;  5EN5 D;  3ONK A;  1S64 A;  4JZY A;  2V8S E;  4H7X A;  3FTW A;  3R9M A;  5LCW J;  3QJZ A;  2QYJ A;  2J08 A;  5BPP A;  1JPL A;  4XI9 A;  1S0P A;  4APF A;  1G3N B;  1TR4 A;  4OVV A;  3TWT A;  4KT6 B;  3ULY A;  3FHE A;  1KZO A;  1UG3 A;  1PAQ A;  2R59 A;  4DK5 A;  3EJN A;  1JUQ A;  1EYH A;  4DX5 D;  2VGE A;  4J8Y A;  1Z5S C;  2GRL A;  4XX5 A;  1OXJ A;  5G04 J;  4ABN A;  4FLH A;  4KZ0 A;  4KMO A;  3JUE A;  2KCK A;  3BG1 B;  3R7R A;  5HQ8 A;  1AP7 A;  5C2Y A;  4FHK A;  1TN7 A;  3ULE G;  5JJ6 A;  2F8Y A;  4LNB A;  3DPY A;  4GTT A;  4KXK B;  3V2X A;  4PS3 A;  3D9P A;  1SZ9 A;  3UQ3 A;  3SD5 A;  3NOC D;  2XEE A;  2AXZ A;  1UOH A;  4HBD A;  2X6H A;  4JD2 G;  3MKQ A;  2P2C P;  1Z3X A;  5B3S E;  2HM8 A;  2IO3 C;  1Q2Z A;  4I43 A;  1SW6 A;  3IXE A;  4UWK A;  1DCE A;  5BUZ A;  3K9I A;  3G2T A;  2WM9 A;  3C72 A;  4U07 A;  4A3V A;  4GYW A;  5KNG A;  3W9G A;  1UJK A;  3RK6 A;  5KJN A;  3GZ2 A;  1OT8 A;  3DSV A;  2WPV A;  3CHM A;  3D9M A;  4HNA D;  3APF A;  2OND A;  2AWI A;  4BX8 A;  1N4R A;  2IOL A;  3QWW A;  2LXL A;  3FUF A;  2P9U G;  1JWG A;  3RSE G;  4A63 B;  3UT4 A;  3JQ1 A;  4YDW A;  4CT0 A;  2PM7 A;  4HRL A;  4CYM D;  2XEN A;  3RRU A;  2X6J A;  2P9K G;  1KT1 A;  1TN8 A;  1OUV A;  2VSO E;  2A5E A;  1H0A A;  1WM5 A;  4B94 A;  4QQI A;  3ZHE B;  1N52 A;  4NQ0 A;  3ZN3 A;  4GA0 A;  2XPY A;  3PZ4 A;  4UQX A;  4F7A A;  2A5U A;  3DRA A;  4RVB A;  3C3O A;  3LXU X;  2HYZ A;  1OWP A;  2XPI A;  4YDE A;  3B13 A;  4YND A;  3LY7 A;  3UXG A;  2GRM A;  4GPM A;  3AG1 E;  4MS6 A;  3EUV A;  4LRZ A;  5G2N A;  2WXF A;  5LOZ A;  1RZ4 A;  2XEV A;  2NXP A;  2OOE A;  4APO A;  5AJD A;  2XZD G;  1SQM A;  1U2V G;  3HRA A;  5FQ8 A;  3FTY A;  1D9S A;  4GCO A;  4EHM A;  3TWQ A;  2WB2 A;  5BW8 C;  4BFR A;  1HU3 A;  4UUC A;  3KEZ A;  4LG6 A;  3UM0 A;  2ION A;  2BKG A;  2VSY A;  4AEZ C;  5ANL A;  5AEN A;  2A4Z A;  3FTZ A;  3QK0 A;  1N11 A;  3ZUV B;  1W3B A;  3SNX A; 
#chains in the Genus database with same CATH homology
 3FUJ A;  3GW4 A;  2LAH A;  3UT8 A;  3U3W A;  3QB2 A;  3RO2 A;  3S2A A;  5AJL A;  3HIZ A;  3IHV A;  2X6I A;  5T4Y A;  3IBE A;  3MGB A;  3P1U A;  4GML A;  4JL0 A;  2I6H A;  4BTB A;  2NC9 A;  3B7S A;  4BTA A;  3FFL A;  2WXI A;  4W9R A;  1Y6I A;  3ENE A;  1A17 A;  3SBS A;  4ILI A;  4YVQ C;  4KVO A;  2XCB A;  1QQE A;  5M72 A;  2KCL A;  4HVB A;  1NA3 A;  2RG8 A;  1ZBP A;  3SZ7 A;  2LSV A;  3AS8 A;  3FUE A;  3B7R L;  4RSY A;  1HE8 A;  4GCN A;  4AIF A;  4MLP A;  3HVE A;  1IQR A;  2KZT B;  3PUJ A;  2C0M A;  4CDN A;  4AJW A;  1HXI A;  5A7D B;  4AM9 A;  4UI9 C;  4M3O A;  4CDR A;  1E8X A;  3JYS A;  2J4B A;  3PH0 C;  3NQP A;  4UI9 K;  4DLQ A;  3OTN A;  1YA0 A;  4I1M A;  4N39 A;  2VTB A;  1JWF A;  2WXG A;  3MV2 B;  2OVB A;  4B8C B;  4KBQ A;  2WXQ A;  3ZRH A;  3FU3 A;  3LEW A;  4I6J A;  3ZYM A;  3PE4 A;  3G2U A;  1B89 A;  4J0U A;  2J9Q A;  3PDN A;  4I2W A;  2XCC A;  5FQ4 A;  4ATG A;  3L6A A;  1UJJ A;  4JC8 A;  3G2V A;  3PUK A;  3MKR A;  4TRQ A;  4L23 A;  1GW6 A;  4G11 A;  3AU4 A;  3ZYK A;  4IUL A;  2FUL A;  3CR3 A;  4AOF A;  1E8W A;  4EBA A;  1HF8 A;  3FUN A;  5DBK A;  4AY6 A;  3GYZ A;  1KLX A;  1WY6 A;  1E7U A;  3I3N A;  3FUL A;  2QY7 A;  1EDU A;  3NZS A;  4B8A A;  2AVP A;  3I5P A;  2MOW A;  4A3T A;  5J08 A;  3KS2 A;  3PNL B;  3PRZ A;  5FTP A;  2UY1 A;  4FUL A;  3E4B A;  2KC7 A;  4JEU A;  1ELK A;  3FU5 A;  3Q15 A;  4GPK A;  3L08 A;  3ASH A;  4LCT A;  4JA9 A;  2IFU A;  5FQ6 A;  4WUY A;  4FP7 A;  3VTX A;  2WXK A;  3CVL A;  5J90 A;  3OXG A;  3CVX A;  4HS2 A;  4U0S A;  4DPR A;  4FC8 A;  4PH4 B;  4TUU A;  1E8Z A;  2PM6 A;  3CSF A;  2YIN A;  3TL5 A;  4F53 A;  5E75 A;  4JW1 A;  4QFV A;  3FUH A;  4ILG A;  1H19 A;  3QAR A;  3UMV A;  5G05 J;  3ZXS A;  1Z3Y A;  2WMN A;  3FTX A;  3UT7 A;  2FF4 A;  2JEK A;  2V0P A;  5D0Q D;  3HVE B;  3FP3 A;  4H7Y A;  1U3D A;  1DVP A;  4NUR A;  2DBA A;  5CCL A;  4E85 A;  3MYV A;  5T8I A;  3CVN A;  4G2V A;  4JHK A;  4GZ3 A;  4PS8 A;  4U0U A;  4WWN A;  5AYW D;  2WXM A;  3ZPJ A;  3TXM A;  3ZW3 A;  5AIJ A;  1OWL A;  3L17 A;  4WNG A;  4DLO A;  4EEC A;  4EZJ A;  4U8H A;  4N3B A;  3FDH A;  4E6H A;  4GZ6 A;  2WXO A;  2FO7 A;  3MA5 A;  2KZT A;  4G25 A;  4J8F A;  3Q49 B;  3FUM A;  3LY8 A;  4Q94 A;  4PUC A;  2IF4 A;  3IV0 A;  1ELR A;  4HOT A;  2OV8 A;  3OAW A;  1EF1 C;  4KVM A;  4I1A A;  4NRH B;  3CK7 A;  2C2L A;  4Y6W A;  4URK A;  3ZVV A;  3NZU A;  2Y3A A;  2Y4U A;  1BPO A;  2X3M A;  5EKQ D;  4D10 C;  3LCA A;  2ILR A;  3ZYL A;  1H2U A;  3IEG A;  1MHQ A;  3ESK A;  2UY1 B;  2XQ0 A;  4I2Z A;  4UI9 J;  2WMO A;  4U04 A;  2MRI A;  4XZ4 A;  5DIZ A;  2Q7F A;  4FLB A;  2M63 A;  3SF4 A;  4A1G A;  1OWN A;  3D9J A;  3CHP A;  4WNF A;  5G55 A;  3ZEF A;  2AW6 A;  4CDM A;  3CVY A;  4YVO A;  4Y6C A;  5T3R A;  5JJ7 A;  4R7L A;  4Q69 A;  1H2V C;  2J09 A;  4A1S A;  1HG2 A;  3L54 A;  1N54 A;  2XRY A;  4HLE A;  3TG4 A;  3Q4A B;  3UX4 A;  3ZN3 A;  3CIA A;  3CEQ A;  4PS7 A;  3L22 A;  4XI0 A;  3FU6 A;  1HX8 A;  3FEX A;  3BEE A;  2CHZ A;  4I6E A;  3ZFW A;  3ONK A;  3LYA A;  4JZY A;  3EHM A;  3BG0 B;  2V8S E;  3VLE A;  3NF1 A;  2IOS A;  5EX3 A;  4H7X A;  4PDX A;  5FQ7 A;  3ULQ A;  2E0I A;  4AV7 A;  3AS5 A;  3FTW A;  3PNT B;  2BF0 X;  3FEY A;  4I9C A;  3ZYQ A;  4WAF A;  5LCW J;  2CG2 A;  3QAQ A;  4XE0 A;  4IRU A;  3QJZ A;  4N3A A;  3LJ3 A;  5JHA A;  2J08 A;  5BPP A;  1JPL A;  4XI9 A;  4A55 A;  3RRN B;  4JEH A;  1S0P A;  3LVR E;  4APF A;  2J07 A;  4I6G A;  3IKO B;  3CHO A;  3ESL A;  2LAI A;  2JLB A;  3AS4 A;  4Q96 A;  4OVV A;  3T5X A;  4AY5 A;  3TG5 A;  3PS6 A;  3G2W A;  3DPD A;  4GA2 A;  5ARG A;  3EIQ C;  4GYY A;  4KT6 B;  3L16 A;  5A23 A;  3FHE A;  3EIJ A;  1UG3 A;  3G2S A;  1PAQ A;  2R59 A;  3JCK C;  4WNE A;  5C1D A;  4DK5 A;  3LS8 A;  3EJN A;  5FT9 A;  3QNK A;  1JUQ A;  3MX3 A;  3CHS A;  1LF8 A;  2R5S A;  2CHX A;  1EYH A;  4J8S A;  3D9I A;  3AU5 A;  5D0O D;  1INZ A;  3CKC A;  4N2S A;  2QFC A;  4BSX A;  3D9N A;  4N3C A;  4CGW A;  1Y8M A;  2FI7 A;  4L2L A;  4AP2 A;  5JJT A;  3CK9 A;  4MRU A;  4XX5 A;  2GRL A;  3VTY A;  2CHW A;  4F1S A;  5G04 J;  1MQS A;  3CST A;  3VLF A;  1HO8 A;  3JQ0 A;  3WXX A;  5CMY A;  4LEU A;  4GZ5 A;  4CEM A;  4CRW A;  3MV3 B;  4HFG A;  4ABN A;  1TJC A;  1HG5 A;  2WVI A;  3D9O A;  4FLH A;  4KZ0 A;  4ANX A;  2C0L A;  4WWP A;  2VSX E;  4KMO A;  3U64 A;  3S7B A;  4MKT A;  4I17 A;  5JHB A;  3QOU A;  3T5V A;  4NAC A;  2KCK A;  5EX0 A;  1ELW A;  2AXU A;  1P5Q A;  4AXH A;  3HDX A;  1HH8 A;  3BG1 B;  3R7R A;  3RO3 A;  5HQ8 A;  1QZ2 A;  5C2Y A;  4HOS A;  1FCH A;  1SZA A;  4BY6 A;  3CKB A;  2YHE A;  4FHK A;  3QWV A;  2DCP A;  4BT9 A;  3UPV A;  3RRM B;  5EDS A;  1U3C A;  3D3M A;  3D9L A;  2KM4 A;  5JJ6 A;  2I9C A;  3KAE A;  4C0M A;  3CVP A;  4ILH B;  4TV3 A;  4LER A;  4CGV A;  1E90 A;  4K0R A;  3LY9 A;  2VGY A;  2I1J A;  3SHF A;  1HFA A;  3Q47 B;  2WQ7 A;  4KXK B;  4PS3 A;  4UWG A;  3D9P A;  1SZ9 A;  2PQR A;  4KYO B;  1Z6T A;  3SD5 A;  1VDY A;  1OWM A;  1H6K A;  3UQ3 A;  4BWR A;  4XIF A;  4EPZ A;  2AXZ A;  2RD0 A;  2LO6 A;  3QWP A;  2IJG X;  3CQC B;  2WXN A;  5LX8 A;  4DI4 A;  3ONL A;  2VGX A;  3ASG A;  2X6H A;  4G23 A;  4L1B A;  4GZD A;  4UQY A;  3LKU A;  3MKQ A;  2PL2 A;  3OXF A;  1Z3X A;  3FTV A;  2J4D A;  4JHJ A;  2GW1 A;  4DJA A;  2HM8 A;  4EZK A;  2XPZ A;  4I43 A;  2P58 C;  1FVF A;  4GZC A;  1IYG A;  2LSU A;  3N71 A;  4UWK A;  4P29 A;  4FAD A;  5BUZ A;  2YQ8 A;  3K9I A;  3G2T A;  4GMJ A;  3ML9 A;  5FZQ A;  4ANU A;  4EQF A;  4CT4 A;  4G26 A;  3HYM B;  3SFZ A;  2WM9 A;  1WAO 1;  2I2O A;  4U07 A;  4ACK A;  2CG3 A;  4A3V A;  2XRZ A;  4ANV A;  5CMW A;  4GYW A;  2KAT A;  2VYI A;  3CQG B;  3PVL A;  2VJ8 A;  4HOU A;  3EDT B;  1OWO A;  1UJK A;  3RK6 A;  1IHG A;  3LPZ A;  1L5J A;  4JA7 A;  5G05 C;  3ZIM A;  5KJN A;  3S7D A;  5ARF A;  2X6F A;  3GZ2 A;  4L2Y A;  3ZHE A;  1IQU A;  4F3V A;  5BV0 A;  5KJM A;  2WPV A;  2LNI A;  3CHM A;  3GZS A;  3LDZ A;  2PZI A;  2VQ2 A;  4KZC A;  3D9M A;  3SI5 A;  1ZU2 A;  3APF A;  2FEZ A;  5E76 A;  2OND A;  1E96 B;  3FH8 A;  5LFA A;  3I4G A;  2AWI A;  3DBS A;  4N5C A;  4BX8 A;  3PEV B;  4OVU A;  2IOL A;  3QWW A;  2J49 A;  4V3I A;  3FUF A;  3QC1 A;  2WQ6 A;  2VGX B;  3FH7 A;  3RKV A;  3B7T A;  1JWG A;  3UT4 A;  3MKQ B;  3TXN A;  2OVF A;  3JQ1 A;  4HXI A;  1EPU A;  4CT0 A;  4J8D A;  5FWQ A;  2X6K A;  1PC2 A;  1TEZ A;  3CV0 A;  3SGH A;  4C9B B;  4GB9 A;  5FJY A;  4FU3 A;  5FZR A;  5BNW A;  2PM7 A;  2KCV A;  4BX9 A;  2L0T B;  4WWO A;  1X5B A;  4UWH A;  3O48 A;  3LVQ E;  2Y4T A;  3CHR A;  2WXR A;  3CVV A;  1NP7 A;  1HS6 A;  4ME2 A;  1KT0 A;  1XNF A;  3RRU A;  4CCA A;  2UWJ G;  2X6J A;  3S7F A;  1QNF A;  1KT1 A;  2FBN A;  2EQX A;  4B0Z A;  2XGM A;  4C0E A;  3U66 A;  4I9E A;  3PEU B;  3ML8 A;  2V4L A;  5BT1 A;  4EBA G;  2BUG A;  4O6F A;  3FTU A;  4IN3 B;  1OUV A;  2L0I A;  4L7T A;  2VSO E;  3CVW A;  1H0A A;  4RG9 A;  3FUD A;  3S7J A;  1WM5 A;  4B94 A;  1NA0 A;  2L6J A;  3URZ A;  3ZHE B;  4JPS A;  4J6I A;  1N52 A;  2CFZ A;  3FH5 A;  2V5F A;  4FA6 A;  4GA1 A;  3B7U X;  1UW4 B;  2BTD A;  4WND A;  3FY4 A;  4NQ0 A;  1DNP A;  3ASD A;  4GA0 A;  2XPY A;  3O4Z A;  2WXP A;  2XGO A;  4UQX A;  3U9W A;  4JXT A;  4F7A A;  5LCW C;  2A5U A;  1TJF A;  3CVU A;  3FTS A;  4RVB A;  4U0Z A;  5A6C A;  2I1K A;  4GYO A;  3LXU X;  1E7V A;  3MZL B;  1FVH A;  4J8E A;  3FUK A;  4UWF A;  4UQZ A;  4BT8 A;  1UN9 A;  2HO1 A;  2HYZ A;  1OWP A;  3CLJ A;  4HOR A;  2XPI A;  3JUI A;  2L9B A;  3R7Q A;  5FZS A;  3B13 A;  4YND A;  3LY7 A;  2PQN A;  3FWV A;  2GRM A;  5CCM A;  2YHC A;  4K03 A;  1UN8 A;  4MS6 A;  3FU0 A;  3EHN A;  1PY1 A;  3RU0 A;  1HZ4 A;  3T8M A;  2XHE A;  4LRZ A;  5G2N A;  2WXF A;  3D9K A;  3MEK A;  5LOZ A;  3FUI A;  3APD A;  3CHQ A;  2WXJ A;  3UUX A;  2GGF A;  2XEV A;  4ANW A;  2NXP A;  3PE3 A;  2WXL A;  3L13 A;  3MCX A;  2OOE A;  3KD7 A;  3VLD A;  4APO A;  2R17 C;  3APC A;  3QKY A;  4UWL A;  5AJD A;  3R9A B;  4DI3 A;  2VTB B;  5CHE E;  3ZGQ A;  4N2Q A;  2IU1 A;  4LUN U;  3I4R B;  5LP0 A;  4G1T A;  4AVX A;  5G04 C;  4FJY A;  2NSZ A;  1H2T C;  3HHM A;  3MJW A;  3PRE A;  4GU5 A;  4U63 A;  4GAA A;  1SQM A;  4RG6 A;  2WXH A;  4G24 A;  3RJV A;  5FQ8 A;  3Q5M A;  2HR2 A;  3FTY A;  4IYP A;  2VSN A;  4HOQ A;  3CGH A;  3CVQ A;  4I1O B;  1NZN A;  1E8Y A;  4GCO A;  4JVS A;  5KJL A;  4FJZ A;  5ENN A;  4ACL A;  4XKC A;  2YNQ A;  3RIB A;  5KJK A;  3TGO A;  5BV1 A;  2WB2 A;  4JHR A;  2DIW A;  2E2E A;  5BW8 C;  2IQC A;  3C98 A;  4FHJ A;  4BFR A;  3OXL A;  4EZL A;  1HU3 A;  3PZD A;  3P2B A;  3KEZ A;  5KCM A;  3TJP A;  2WQH A;  4XKB A;  3IHY A;  3TAX A;  2ION A;  3ASF A;  2VSY A;  4AEZ C;  2AXV A;  3QDN A;  5ANL A;  3SBT B;  5AEN A;  2A4Z A;  2X38 A;  3CK8 A;  3FTZ A;  3QK0 A;  5HI7 A;  3GZ1 A;  2MHK A;  5ANR A;  1XGW A;  3U4T A;  1W3B A;  2CFU A;  3SNX A;  2ZU6 B;  4OYS A;  4B89 A;  2XGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...