3ULQA

Crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
376
structure length
376
Chain Sequence
b'SSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRHNLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIYLSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQGGVSLYEIEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of response regulator inhibition by a bacterial anti-activator protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/transcription activator
total genus 160
structure length 376
sequence length 376
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ulqA00
2VSYA 1WM5A 4YVQC 2FI7A 3RKVA 5HI7A 3PE4A 2JLBA 2IFUA 5G05J 2P58C 4NQ0A 3LY9A 5JJ7A 4G2VA 3WXXA 3OXGA 5LCWJ 4I2WA 4G24A 2FBNA 1PC2A 5FJYA 2OOEA 5KJNA 3QDNA 4UI9K 3R9AB 3QKYA 4F3VA 3AS8A 4G23A 3SZ7A 2XGMA 4AY5A 2LNIA 4KYOB 2C0LA 5FTPA 2ONDA 3ESKA 2GW1A 3FFLA 4ME2A 4CGWA 1ZBPA 3TG4A 3RIBA 1HZ4A 4I2ZA 1Y8MA 4N3BA 2Y4TA 1W3BA 3MA5A 2Q7FA 3CVQA 4UQXA 4AY6A 3SF4A 4J8EA 1KT1A 4KXKB 3LPZA 4GCNA 3ZGQA 2XCBA 5CHEE 3ZFWA 3ZHEB 5HQ8A 2LSUA 3ASHA 4XI0A 4N2QA 4GYOA 4O6FA 1FCHA 4JHRA 4LEUA 3ZN3A 4N3CA 2QFCA 3UUXA 2XEVA 5DIZA 2FEZA 2KCLA 4EQFA 5FT9A 3IEGA 4GA2A 2PL2A 4U04A 4HOUA 4GCOA 3ASFA 3MV3B 2NC9A 2XPIA 3GZ2A 1NZNA 4GPKA 4NRHB 2PZIA 4BT8A 3ZPJA 3TG5A 3TGOA 4BT9A 2KCVA 4BTBA 3CK8A 1B89A 4U0ZA 1XNFA 5A7DB 3VTXA 4H7YA 3LY8A 2XGSA 3QWVA 3EDTB 3Q47B 4HOTA 4HOQA 5BNWA 5ARFA 4IN3B 4WUYA 4GYYA 3KAEA 3OXFA 3AS4A 3ZHEA 4WNEA 5KJKA 4G26A 2KCKA 2VGYA 4A1SA 3CKCA 5G04C 4I9EA 2MHKA 2WPVA 3LCAA 3S7DA 5D0OD 4CDRA 4RG6A 4APOA 3FP3A 2WQHA 5JJ6A 2XGOA 4YVOA 4WNDA 2HYZA 1QQEA 4XI9A 5EX3A 2Y4UA 3CVLA 3QWWA 4XIFA 3UPVA 1E96B 4I17A 5FZQA 4BWRA 3VTYA 3RJVA 3HYMB 5G04J 1ZU2A 4GA0A 4N3AA 3O48A 1TJCA 3URZA 3S7JA 2L6JA 5CCMA 3Q5MA 2BUGA 3BEEA 5CCLA 3KD7A 4J8DA 4BTAA 3S7FA 3CVNA 4CGVA 2VGXB 4U07A 4N39A 3Q4AB 4GZ3A 2FF4A 4B94A 3CV0A 2I6HA 4WNFA 1P5QA 2HR2A 1QZ2A 2PQRA 4JL0A 1ELWA 1A17A 3OXLA 5D0QD 4H7XA 1ELRA 5DBKA 4WNGA 3ASGA 3CEQA 4HOSA 1KT0A 3CK9A 4UQZA 3CKBA 2R5SA 2C2LA 5BT1A 3CK7A 1WAO1 2XCCA 4GZ5A 2UY1B 3MKRA 5EKQD 4YNDA 4KBQA 5JJTA 4G25A 3LKUA 3NF1A 4UQYA 3Q15A 2VSNA 3RU0A 3GW4A 4GZ6A 2AVPA 3E4BA 3TAXA 4UI9C 3KS2A 1HXIA 2V5FA 3GZ1A 3UQ3A 3AS5A 2J9QA 4AM9A 2HO1A 5A6CA 2VGXA 2YQ8A 3MV2B 5FZSA 5KJLA 2DBAA 3PE3A 4I9CA 2E2EA 4GA1A 3JYSA 4U0UA 4JA9A 5BW8C 1NA3A 4AIFA 5EX0A 4UI9J 3S7BA 4Y6CA 4I1AA 3ASDA 5ARGA 5C1DA 3N71A 4J0UA 2UY1A 2VYIA 2FO7A 3QWPA 3CVPA 2KC7A 3RO3A 3Q49B 3U4TA 2PQNA 3FWVA 4Y6WA 2C0MA 4ABNA 4J8FA 4N5CA 3LY7A 4N2SA 3K9IA 3QOUA 2UWJG 3PDNA 2YHCA 5G05C 3LYAA 2VQ2A 5KJMA 2KATA 3GYZA 5AYWD 4G1TA 5M72A 5LCWC 3MEKA 3RO2A 1OUVA 4RG9A 4U0SA 1NA0A 1IHGA 1KLXA 1YA0A 1IYGA 4HORA 5FZRA 2IF4A 4JA7A 4W9RA 4GYWA 3U3WA 2LSVA 1HH8A 3ULQA
chains in the Genus database with same CATH superfamily
1YYHA 2VJ8A 2L6BA 3V79K 3PE4A 2JLBA 5CRVA 3KSQA 2CFZA 5G05J 2P58C 4MKTA 5LCWJ 4ANXA 2A5UA 3PS6A 5AQ9A 1NL4A 5ANLA 4URKA 5FJYA 2OOEA 1LTXA 1OCOE 3QDNA 4F3VA 3AS8A 3SZ7A 4AY5A 5ANRA 2XPZA 3U66A 3UT8A 3BG1B 3EHQA 2ONDA 2WXIA 3UX4A 4DK5A 4DX1A 3FFLA 3PZ2A 4ME2A 4D10C 1OCRE 3EHMA 1SW6A 4CGWA 3TG4A 3D9IA 2J49A 2J07A 2RG8A 1N94A 1HG5A 3R7RA 3SD5A 2QYJA 4GMLA 3UTMA 2GROB 4EZJA 1JCSA 4GTMA 3IHYA 4GMRA 4K0RA 4ATGA 1BD8A 1E8YA 3FEYA 3ZHEB 4AJWA 3HDXA 3U9WA 1N4SA 1MX4A 4UUCA 3ASHA 4N2QA 4R7LA 3FUFA 3FU0A 4U8HA 1N11A 2ILRA 4PUCA 1MZCA 5DIZA 2EQXA 3PNLB 4EQFA 3MX3A 4GA2A 4U04A 1U3CA 4GCOA 2Y3AA 2XEEA 4TXQA 3VLEA 4TXPA 4F7AA 2NXPA 3GZ2A 5J90A 4GPKA 2ZGGA 4NRHB 2WXJA 2R17C 3V2XA 3VTXA 5EN5D 4DX5D 4XKCA 4LNBA 1NP7A 5T3RA 4U7EB 4PS8A 3EDTB 3TWQA 3CHQA 4HOTA 3KEAA 3CQGB 3SY2A 4M7CA 3DSWA 3OTNA 2BKGA 4GYYA 2RKKA 2KXPC 4AP2A 3ZHEA 2P9SG 2QY7A 5D2MC 5CMWA 3FU6A 3AG4E 2VGYA 3ZU7B 3DXKG 3Q78A 4LNUD 3CKCA 3O4ZA 2WPVA 3CVXA 4UWFA 3S7DA 4CEMA 2WXNA 2OEWA 2BEDA 2YNQA 4YVOA 2HYZA 1TEZA 5CEAA 3CHSA 1TN6A 1BLXB 1E96B 4I17A 2XHEA 2XZDG 3P2BA 3ZW3A 4BWRA 5KCMA 5ITZF 3HYMB 3ML9A 1ZU2A 3DEOA 1OXJA 2WB2A 4GAAA 3S7JA 2J09A 1E8ZA 2YINA 3D9LA 3AJIA 3PZ3A 4J8DA 4BSZB 3CVNA 5AJLA 5CEDB 2FO1E 1G3NB 3AG2E 2P9UG 2HR2A 1QZ2A 1JUQA 3HXBA 2LUHA 3CSTA 1TJFA 2VTBB 1A17A 4HXIA 1INZA 2QZAA 5FWQA 4B8CB 2AWIA 3QC1A 4JXTA 2CHWA 2OEVA 3NBNB 3V31A 4HOSA 3SGHA 3W9FA 3D9PA 3ABME 2UY1B 3IHVA 2OV8A 1DCQA 3J5PA 3ML8A 5H7PA 1H6PA 4X8QA 4KBQA 4K5BA 3Q15A 2VSNA 3CVVA 4Q96A 1BI7B 2WMOA 2AVPA 3E4BA 3Q7AA 3T5XA 1RW2A 3TWTA 4JHKA 3EU9A 4BFRA 1N4QA 4AVXA 3D9NA 1L5JA 2IU1A 3PVLA 3R9MA 4FULA 1V55E 1ELKA 3ONLA 4HVBA 2LAIA 5CBOA 3IBEA 2E2EA 2VTBA 4U63A 4OAVB 4Y6CA 4LUNU 4B8AA 3NQPA 3ASDA 3JCKC 1HF8A 3JUIA 3N71A 4J0UA 2UY1A 2GRQB 2FO7A 2P2CP 3RO3A 3ASNE 2C0MA 3C72A 4OYSA 4XX5A 2RD0A 3UI2A 4N2SA 3QOUA 5G2NA 3MGBA 3PDNA 4DX7D 3ZYQA 4DJAA 3FUJA 3RRNB 5KNGA 1NA0A 1IHGA 2I1JA 4EZLA 4FLHA 3TWXA 3TWUA 4EBAA 3U64A 4W9RA 1HE8A 1UJKA 4L2LA 3TJPA 1E7UA 3AS4A 2ZGDA 3AU4A 4CCAA 4JHJA 3RKVA 2MOWA 4JD2G 1TN8A 5JJ7A 2PNNA 2IO3C 5AIJA 3L54A 3MJWA 3DPDA 1IKND 3CHRA 4XKBA 4GMJA 3RK6A 4UWGA 4XEIG 5KJNA 4UI9K 3L6AA 3MZLB 4G23A 1O5MA 1Z5SC 2C0LA 1OWLA 1ZB1A 2RFAA 4E6HA 2V4LA 4J7WA 3ESKA 1Z3YA 3AU5A 3UT4A 4ATZD 4A1GA 2YHEA 1ZBPA 3ABLE 5CRUA 1OWNA 2R03A 4ILGA 4I2ZA 2ETBA 1W3BA 3MA5A 3ZIMA 4GTVA 3JQ1A 1H2UA 4RLYA 2QC9A 3CVQA 1NFIE 2R02A 4J8EA 3CHMA 1QYMA 5EILA 1SZ9A 3T5VA 3G2TA 5KWDA 5CHEE 2ETAA 4RQIA 2LSUA 4XI0A 4HQDA 2XRZA 1SQMA 4LEUA 3UIPC 1FPPA 3DSSA 4N3CA 4EBAG 2WQ7A 2XEVA 3LVQE 1S63A 4ILIA 2KCLA 2VGEA 3AG3E 5AN8A 3IEGA 1K8KG 1HFAA 5JHAA 2WXRA 4HLLA 3APCA 2WXFA 2WXHA 3Q7FA 4DLOA 4MLPA 3Q9NC 4AXHA 2PZIA 1PY1A 2XZTG 3LVRE 3ZPJA 2OCCE 4BT9A 3TWWA 4BTBA 4YDWA 1B89A 4U0ZA 2V5QC 4JEHA 5A7DB 2BKKB 2XENA 2B6CA 5EYPF 3QWVA 2V0PA 4ANUA 3UKUG 2M63A 2QYUA 1OCCE 3C98A 4HOQA 4ZFHA 1N4RA 3EHRA 4GTRA 3SFYA 5BXOA 4YDYA 1DCEA 4BEPA 2Y1LE 3HXFA 3DXMG 5KJKA 3HRAA 4GTSA 2IJGX 1N95A 2P9NG 2MHKA 4KVMA 4F1SA 2X38A 3TXMA 3C3OA 3L17A 1H19A 4DX2A 2XGOA 1MQSA 1H2TC 3NAWA 5EX3A 3D9OA 1JWGA 2VSXE 3UMVA 1FT2A 2A5EA 4Z68A 3QWWA 1HX8A 4XIFA 3UPVA 3FTUA 1KPSB 3D9HA 2H6FA 5FZQA 3DPYA 2J4DA 3CVYA 2JABA 5CBNA 3O48A 4JB8P 5BV0A 3UT7A 3SFXA 4FADA 2BF0X 4L2YA 4DLQA 3BEEA 5CCLA 2I2OA 3QB2A 4J8SA 2WXGA 1UG3A 4EHMA 5EYLA 4BTAA 1QNFA 2F8YA 3C3RA 2H6GA 1O1SA 3UM1A 3EIJA 2VGXB 1LD7A 4U07A 3UM2A 3FH7A 3CV0A 3I4RB 4CDNA 1P5QA 4U8VD 2PQRA 1TR4A 1ELWA 4UWKA 2GRMA 3OXLA 4H7XA 2P9IG 4OVUA 3LJ3A 2WXOA 1JWFA 5KBAA 3CEQA 3CHPA 3SI5A 4UQZA 2X6IA 4A55A 4NIKA 3B7RL 2XCCA 4LSZE 5EKQD 1H2VC 4G25A 3LKUA 4DRXE 3NF1A 3PZDA 3AAAC 1UN8A 3GW4A 4GZ6A 2AXVA 3FUMA 4GB9A 4UI9C 5FQ4A 1EYHA 1HXIA 1N54A 3PUKA 2A4ZA 2WXKA 4WWNA 1MJ0A 2H6IA 4MRUA 2I9CA 2HO1A 3E32A 2VGXA 3J5QB 5KJLA 2DBAA 3T8KA 3CLJA 3PE3A 4GA1A 3JYSA 4RVBA 2DVWA 5BW8C 1NA3A 4AIFA 4PS7A 5AJDA 2DCPA 4UI9J 1RZ4A 1H0AA 1SZAA 3FUHA 4FU3A 1XGWA 5C1DA 4RSYA 1UN9A 4CT4A 3FTXA 2KM4A 3ULEG 3LDZA 3QWPA 1N52A 2KC7A 3L82A 2GRLA 3Q49B 2H6HA 4UWLA 1MX6A 4Y6WA 4ABNA 3CHOA 3PRZA 4YDOA 4O60A 2J08A 2UWJG 2YHCA 5KJMA 5AYWD 3GYZA 4GTPA 4BETA 5M72A 1EPUA 2IY0C 1BPOA 5ENTD 1SA4A 5G55A 1OUVA 3TWVA 2OVFA 4U0SA 1KLXA 4YDEA 3FTYA 2KZTB 2NYJA 5HRYA 4DI4A 3ZUVB 2IF4A 3HVEB 4JPSA 2LAHA 3FU3A 3E30A 2GRNB 3U3WA 2LSVA 3ULQA 1DVPA 2VSYA 4YVQC 3EHNA 2FI7A 4J6IA 4L1BA 2IFUA 2X6KA 4LNGA 3TWSA 4NQ0A 4CZ2D 4G2VA 3WXXA 4A3TA 3V30A 4OVVA 4P29A 3RRMB 3MKQB 2EIME 4NURA 2FBNA 4MBGA 1PC2A 1EDUA 1TNOA 3R9AB 3QKYA 4L9PA 2XGMA 5ENOD 3B13A 3E33A 3D9KA 1TYQG 5LOZA 5FTPA 1N9AA 1OY3D 3BU8A 1UJJA 1HZ4A 1Z6TA 4JZYA 5E76A 2V8SE 1HU3A 1Y8MA 5ENPD 2Y4TA 4E85A 5J08A 2KZTA 1OWPA 3HVEA 4U95D 4Q69A 4AY6A 3SF4A 2BTDA 4KXKB 4GCNA 3ZGQA 2XCBA 3VLFA 5ENQD 4BSXA 5HQ8A 3CVUA 1TNYA 2LXMA 3W9GA 3DBSA 1FCHA 3MKQA 3CSFA 3QJZA 2QFCA 3UUXA 3G2SA 3LXUX 2LO6A 4F1PA 2PL2A 3FUNA 3HIZA 3ASFA 3FTSA 3I5PA 3NZSA 3TL5A 1NZNA 4FP7A 4BT8A 2L0TB 2EINE 3TGOA 3R7QA 3MYVA 2V4HC 4HI9A 5BPPA 1XNFA 3QARA 4H7YA 3G2WA 1X5BA 1FVFA 4AV7A 2XGSA 3Q75A 4TUMA 3Q79A 5BNWA 3L22A 3JXJA 5ARFA 4PDXA 5C2YA 3KAEA 3OXFA 3PZ1A 3DSUA 4I43A 4WNEA 5BV1A 4I6JA 4B0ZA 4K03A 5CECB 5G04C 3HHMA 4I9EA 3LCAA 2I1KA 2F8XK 3FEXA 5D0OD 4RG6A 2DYSE 4APOA 5JJ6A 5BUZA 4WNDA 2WVIA 1QQEA 2PM6A 3B7BA 5AAOA 3CVLA 5B3SE 3B7UX 3B7TA 1Z3XA 3D9JA 3NOCD 4A3VA 3VTYA 3RJVA 3HXEA 5G04J 4G8LA 1VDYA 3DEPA 4BERA 1OWOA 2L6JA 5CCMA 3ULYA 3Q5MA 4FHJA 4FJYA 2BUGA 1E8WA 1O1TA 1MHQA 1TNZA 1Q2ZA 3KSLA 3S7FA 5LFAA 4HRLA 4WAFA 1E90A 4CGVA 3Q4AB 1K1BA 4M3OA 3LJNA 4B94A 1X81A 4K5AB 3D9MA 4IYPA 5D0QD 4MS6A 5DBKA 1TNUA 4WNGA 3EIQC 1KT0A 2CFUA 4FA6A 5EIBE 4GPMA 4C48B 3CKBA 1TN7A 3T8MA 1AWCB 2R5SA 3B95A 2C2LA 2P9KG 4HBDA 5BT1A 3CK7A 4HNAD 5D66A 3P1UA 3ABKE 1PAQA 4U96D 1D9SA 4KMOA 5JJTA 4PS3A 4KVOA 3QAQA 1S0PA 5ENNA 3RU0A 1QBQA 3SFZA 2XRYA 4I6GA 2NSZA 1GW6A 4I6EA 3TAXA 2XS8A 5AQBA 2V5FA 2HM8A 3MCXA 2OVBA 3UM3A 4DUIA 3PH0C 3UQ3A 5AQAA 2ETCA 2J9QA 3LS8A 2EIJE 3D3MA 2DYRE 4IULA 3FUIA 4GZDA 1HO8A 1YMPA 4GTOA 5A6CA 2WXPA 1DC2A 3FUEA 4I9CA 4HRMB 5FQ8A 3PEVB 4U0UA 4JA9A 2IQCA 3C5RA 4EECA 5JMND 2L9BA 3ZEFA 3ZRHA 3L08A 4C9BB 3SHFA 4FC8A 5ARGA 4K5CA 4LG6A 2R59A 4LRZA 2AJAA 2X6HA 3CQCB 2VYIA 5EIDA 4LCTA 4ANVA 2E0IA 4L7TA 5E75A 3LEWA 2WQ6A 3U4TA 2IOSA 2PQNA 4FLBA 4F6RD 2P9LG 1MX2A 3S2AA 4FJZA 3ENEA 3K9IA 3I4GA 3V2OA 3LYAA 3FU5A 4TXRA 5AARA 4JVSA 1S70B 5T4YA 3EJNA 1IXVA 5CERB 3C3QA 3DSVA 5IY5E 1LF8A 1YA0A 1IYGA 3ASOE 3AG1E 1HH8A 5CMYA 1WG0A 2F0YA 2R05A 4HB5A 1WM5A 1OCZE 5HI7A 2XQ0A 1BI8B 4JW1A 2WXLA 2HE0A 3LY9A 3CVWA 3DRAA 3OXGA 3NZUA 4I2WA 3SQVA 4G24A 3ONKA 3PUJA 5AQ7A 4DX6D 2WXQA 3NB2A 2CG3A 2LNIA 3ZKJA 4KYOB 5FQ7A 3UM0A 2Y0BG 5HS0A 4GU5A 2AXUA 2XPYA 2GW1A 2DIWA 5FINA 1U2VG 3RIBA 5B1BE 3JQ0A 3FH8A 4N3BA 3HG0D 5ENRD 3RAUA 2ZIRA 2AW6A 2Q7FA 1YCSB 3QK0A 3ZYMA 3FHEA 4UQXA 4WWPA 1KT1A 2GRRB 2WMNA 3LPZA 4TV3A 1WDYA 3HXDA 3JUEA 1E7VA 2ZISA 3ZFWA 3X2QE 3CIAA 2JEKA 1NI1A 4JC8A 2MYOA 1HS6A 4GYOA 4O6FA 2AXZA 4HI8A 1JPLA 4JHRA 4CRWA 3BUAA 3ZN3A 4DI3A 2Y69E 3FDHA 3TWRA 4QQIA 2FEZA 4J8YA 5FT9A 5BXUA 3KEZA 1SA5A 3APFA 4HOUA 2XEHA 4CT0A 5A23A 4G8KA 1OT8A 3MV3B 2NC9A 2XPIA 3DSTA 3L16A 4HS2A 3FTVA 4XZ4A 2ZXWE 1LD8A 1U3DA 3TG5A 3QNKA 2KCVA 3CK8A 5EDSA 3LY8A 4EPZA 1EF1C 3EUVA 2P9PG 2XS1A 1H6KA 4JEUA 3ZYLA 3Q47B 3VLDA 3ZVVA 3PNTB 2GRPB 2GGFA 3IV0A 4IN3B 3BQOA 4O1PA 4WUYA 4FHKA 4C0EA 3PREA 3B7SA 4TRQA 4WWOA 2R2LA 4G26A 2KCKA 2PM7A 3Q9UC 5T8IA 4A1SA 4N5QA 1UW4B 2J4BA 3IKOB 3DWLG 4GTQA 2ZU6B 4CDRA 1Y6IA 3FP3A 4KT6B 2WQHA 1JCQA 3ESLA 2F37A 3DSXA 3T9KA 4APFA 4XI9A 3G2VA 5ENSD 3EU5A 5JA4D 2Y4UA 3BG0B 4NACA 4ACLA 4ILHB 4Q94A 5FQ6A 2IO2C 4GTTA 5B1AE 4ZHBA 4IRUA 4XE0A 1BU9A 2DZOA 2J8SD 3SNXA 2IOLA 4PH4B 4N3AA 4GA0A 4O1OA 1O1RA 4G11A 1TJCA 4LERA 2KBXA 3URZA 1MYOA 1OWMA 2FULA 3RSEG 3F6QA 3PZ4A 4ANWA 2RFMA 2CHXA 3KD7A 4GZCA 4HRNA 3OAWA 4BX9A 3SBSA 4N39A 3GZSA 4I1MA 4B89A 4GZ3A 2FF4A 4CYMD 2I6HA 4WNFA 4BY6A 4JL0A 3UKRG 3SBTB 4KZCA 1ELRA 3HXCA 3IXEA 1JCRA 3L13A 3ASGA 4A63B 1AP7A 2B0OE 3CK9A 1N0QA 3FH5A 1A5EA 3SO8A 2X3MA 1WAO1 3Q73A 4GZ5A 3ISMC 2WXMA 3MKRA 2DZNA 4YNDA 1WY6A 3JXIA 4HFGA 4QFVA 2MRIA 3UINC 2IEJA 4UQYA 1V54E 4OAUC 3FY4A 2IONA 1FVHA 3KS2A 1H6OA 4BESA 3GZ1A 2CG2A 1TNBA 3PEUB 1K3ZD 4UWHA 1SVXA 3AS5A 3UIOC 2X6FA 5LX8A 4AM9A 2EIKE 3FTWA 2YQ8A 3MV2B 5FZSA 1S64A 4F53A 1HG2A 3RRUA 3FTZA 1D8EA 5EX0A 4ACKA 2L0IA 3S7BA 1IQRA 1E8XA 1FT1A 1DNPA 3ZNGA 4BX8A 4I1AA 3FUDA 4TUUA 1K1AA 4EZKA 1IQUA 4DPRA 1KZOA 1N0RA 5AENA 2CHZA 1IHBA 3E34A 4AOFA 3CVPA 3ZYKA 3UXGA 3FWVA 3WG7E 4J8FA 4U8YD 3ZXPA 4N5CA 3LY7A 2LXLA 1D8DA 3FULA 3CGHA 3I3NA 5G05C 3CR3A 2VQ2A 3FUKA 2DWZA 2KATA 5FIOA 1UOHA 3NOGD 4I1OB 4G1TA 4AEZC 3L9TA 4V3IA 5LCWC 2X6JA 1KZPA 3MEKA 4HLEA 3RO2A 4CDMA 4RG9A 5LP0A 4KZ0A 5JHBA 5HKPA 4B93B 2VSOE 2WM9A 4HORA 5FZRA 4C0MA 1N4PA 2EILE 4JA7A 3E37A 3ZXSA 5KNHD 3APDA 4GYWA 3G2UA 3TXNA 4L23A
chains in the Genus database with same CATH topology
1DVPA 2VSYA 3AU4A 1WM5A 2VJ8A 4JHJA 4YVQC 4CCAA 3EHNA 2FI7A 3RKVA 4J6IA 4L1BA 5HI7A 3PE4A 2JLBA 2XQ0A 2IFUA 2CFZA 4JW1A 5DBKA 5G05J 2P58C 2WXLA 2X6KA 2MOWA 4NQ0A 4MKTA 3LY9A 5JJ7A 4G2VA 3CVWA 3WXXA 4A3TA 3OXGA 5LCWJ 4OVVA 4P29A 4ANXA 3RRMB 5AIJA 3MKQB 3L54A 2A5UA 3MJWA 3NZUA 3PS6A 4I2WA 3DPDA 4G24A 3ONKA 2FBNA 4NURA 3CHRA 4XKBA 1PC2A 4GMJA 5ANLA 3PUJA 3RK6A 1EDUA 4UWGA 4URKA 5FJYA 2OOEA 5KJNA 3QDNA 4UI9K 3L6AA 3R9AB 3QKYA 4F3VA 3AS8A 3MZLB 4G23A 2WXQA 3SZ7A 2XGMA 4AY5A 5ANRA 2XPZA 2CG3A 2LNIA 3B13A 3U66A 3D9KA 3UT8A 4KYOB 2C0LA 1OWLA 5FQ7A 5LOZA 3BG1B 4E6HA 5FTPA 2V4LA 4GU5A 2ONDA 3ESKA 1Z3YA 2XPYA 2AXUA 2WXIA 3UX4A 2GW1A 4DK5A 2DIWA 3AU5A 3FFLA 4ME2A 4D10C 3UT4A 3EHMA 4A1GA 4CGWA 2YHEA 1ZBPA 3TG4A 1UJJA 1HZ4A 3RIBA 3D9IA 1OWNA 1Z6TA 4JZYA 2J49A 3JQ0A 4ILGA 5E76A 3FH8A 4I2ZA 2J07A 2RG8A 1HU3A 1Y8MA 2V8SE 1HG5A 2Y4TA 4N3BA 4E85A 1W3BA 3MA5A 3R7RA 3SD5A 3ZIMA 2KZTA 4GMLA 5J08A 1OWPA 2AW6A 2Q7FA 3HVEA 3JQ1A 1H2UA 4Q69A 3QK0A 3ZYMA 4EZJA 3FHEA 3CVQA 4UQXA 4WWPA 4AY6A 4J8EA 3SF4A 2BTDA 1KT1A 3CHMA 2WMNA 4KXKB 3IHYA 4K0RA 3LPZA 4TV3A 4ATGA 1SZ9A 3T5VA 1E7VA 1E8YA 4GCNA 3ZGQA 2XCBA 3G2TA 3VLFA 4BSXA 3FEYA 5CHEE 3ZFWA 3ZHEB 5HQ8A 4AJWA 3HDXA 3CVUA 3U9WA 3CIAA 2JEKA 2LSUA 3DBSA 3ASHA 4JC8A 4XI0A 4N2QA 4R7LA 1HS6A 4GYOA 4O6FA 1FCHA 2AXZA 3FUFA 2XRZA 1JPLA 3MKQA 1SQMA 4JHRA 4CRWA 4LEUA 3FU0A 3CSFA 3ZN3A 3QJZA 4U8HA 4N3CA 4DI3A 4EBAG 2ILRA 4PUCA 3FDHA 2QFCA 2WQ7A 3UUXA 2XEVA 3LVQE 5DIZA 2EQXA 3G2SA 3LXUX 4ILIA 2FEZA 2KCLA 2LO6A 3PNLB 4EQFA 3MX3A 5FT9A 3IEGA 4GA2A 2PL2A 4U04A 3KEZA 4HOUA 3APFA 1U3CA 3FUNA 4GCOA 4CT0A 2Y3AA 1HFAA 5A23A 5JHAA 2WXRA 3APCA 3HIZA 3ASFA 3FTSA 3I5PA 2WXFA 3MV3B 2NC9A 2WXHA 2XPIA 3NZSA 3VLEA 4DLOA 4F7AA 2NXPA 3L16A 4HS2A 3FTVA 3GZ2A 1NZNA 4MLPA 3TL5A 4AXHA 4XZ4A 5J90A 4GPKA 4FP7A 2PZIA 4NRHB 4BT8A 1PY1A 2L0TB 3LVRE 1U3DA 3ZPJA 2WXJA 3TG5A 3TGOA 4BT9A 2R17C 3QNKA 2KCVA 3R7QA 4BTBA 3CK8A 5EDSA 3MYVA 1B89A 4U0ZA 4JEHA 5BPPA 1XNFA 5A7DB 3VTXA 3QARA 4H7YA 3G2WA 4XKCA 3LY8A 1X5BA 1NP7A 4EPZA 1EF1C 1FVFA 4AV7A 2XGSA 1H6KA 3QWVA 5T3RA 4JEUA 4PS8A 2V0PA 3ZYLA 4ANUA 3EDTB 3CHQA 2M63A 3Q47B 4HOTA 3VLDA 3ZVVA 3C98A 3PNTB 3CQGB 4HOQA 5BNWA 3L22A 2GGFA 3IV0A 5ARFA 4IN3B 4PDXA 4WUYA 3OTNA 5C2YA 4GYYA 4FHKA 4C0EA 3KAEA 3OXFA 4AP2A 3PREA 3ZHEA 3B7SA 4I43A 4WNEA 5BV1A 4TRQA 2QY7A 4WWOA 4I6JA 5KJKA 4G26A 5CMWA 2KCKA 3FU6A 2IJGX 2PM7A 2VGYA 4K03A 4B0ZA 5T8IA 4A1SA 3CKCA 3O4ZA 5G04C 3ULQA 3HHMA 4I9EA 2MHKA 1UW4B 2J4BA 2WPVA 3LCAA 4KVMA 4F1SA 3CVXA 4UWFA 3IKOB 2I1KA 3S7DA 4CEMA 2X38A 2WXNA 2ZU6B 3FEXA 4RG6A 1Y6IA 5D0OD 3TXMA 4CDRA 3L17A 4APOA 3FP3A 1H19A 4KT6B 2WQHA 5JJ6A 2XGOA 2YNQA 3ESLA 1MQSA 5BUZA 4YVOA 1H2TC 4WNDA 2HYZA 2WVIA 1QQEA 4APFA 4XI9A 5EX3A 3G2VA 3D9OA 1JWGA 2VSXE 2PM6A 1TEZA 3UMVA 3CHSA 2Y4UA 3BG0B 3CVLA 3QWWA 4NACA 1HX8A 4XIFA 4ACLA 4ILHB 3B7UX 4Q94A 5FQ6A 3UPVA 3B7TA 1E96B 4I17A 2XHEA 3FTUA 1Z3XA 3P2BA 3ZW3A 5FZQA 3D9JA 4A3VA 2J4DA 4BWRA 4IRUA 4XE0A 3VTYA 3CVYA 5KCMA 3RJVA 3SNXA 2IOLA 3HYMB 4PH4B 5G04J 3ML9A 1ZU2A 4GA0A 4N3AA 1VDYA 4G11A 3O48A 2WB2A 1TJCA 4LERA 4GAAA 5BV0A 3UT7A 3URZA 3S7JA 1OWOA 4FADA 2BF0X 2L6JA 5CCMA 4L2YA 1OWMA 2FULA 3Q5MA 4FHJA 4FJYA 2BUGA 3BEEA 4DLQA 1E8WA 2J09A 5CCLA 1E8ZA 2I2OA 1MHQA 3QB2A 4ANWA 4J8SA 2YINA 2CHXA 2WXGA 3KD7A 1UG3A 3D9LA 4J8DA 4BTAA 3S7FA 5LFAA 4WAFA 1E90A 1QNFA 4GZCA 3OAWA 3CVNA 4BX9A 5AJLA 3SBSA 4CGVA 3EIJA 2VGXB 4U07A 4N39A 3Q4AB 3GZSA 4I1MA 4B89A 4M3OA 4GZ3A 2FF4A 3FH7A 3CV0A 3I4RB 4B94A 2I6HA 4WNFA 1P5QA 3D9MA 4CDNA 4BY6A 2HR2A 1QZ2A 1JUQA 2PQRA 4JL0A 1ELWA 3CSTA 1TJFA 2VTBB 4IYPA 1A17A 4UWKA 4HXIA 1INZA 3SBTB 4KZCA 2GRMA 3OXLA 4H7XA 5D0QD 5FWQA 1ELRA 4B8CB 3LJ3A 4MS6A 2AWIA 4OVUA 2WXOA 1JWFA 3L13A 3QC1A 4JXTA 3ASGA 4WNGA 3CEQA 2CHWA 3EIQC 4HOSA 1KT0A 3CHPA 2CFUA 4FA6A 3SGHA 3SI5A 3CK9A 4UQZA 3CKBA 3FH5A 3T8MA 2R5SA 2C2LA 2X6IA 4A55A 5BT1A 3B7RL 3D9PA 2X3MA 3CK7A 1WAO1 2XCCA 4GZ5A 2UY1B 3IHVA 2WXMA 3P1UA 2OV8A 3MKRA 5EKQD 1PAQA 3ML8A 4KMOA 4YNDA 1H2VC 1WY6A 4KBQA 4G25A 5JJTA 4PS3A 4HFGA 3QAQA 1S0PA 4KVOA 2MRIA 4QFVA 5ENNA 3LKUA 3NF1A 3PZDA 4UQYA 3Q15A 1UN8A 2VSNA 3RU0A 3GW4A 3SFZA 2XRYA 2AXVA 4GZ6A 3CVVA 4I6GA 2NSZA 4Q96A 1GW6A 2WMOA 2AVPA 3E4BA 4I6EA 3FY4A 3T5XA 3TAXA 3FUMA 4GB9A 2IONA 1FVHA 4UI9C 3KS2A 4JHKA 5FQ4A 1EYHA 1HXIA 1N54A 2V5FA 2HM8A 3PUKA 2WXKA 2A4ZA 3MCXA 2OVBA 3GZ1A 2CG2A 4WWNA 3PH0C 3UQ3A 3PEUB 4BFRA 4UWHA 4AVXA 4MRUA 3AS5A 2J9QA 3D9NA 2X6FA 3D3MA 3LS8A 1L5JA 2I9CA 2IU1A 5LX8A 3PVLA 4IULA 4AM9A 3FUIA 2HO1A 4FULA 4GZDA 1HO8A 1ELKA 5A6CA 3FTWA 2WXPA 3ONLA 2VGXA 2YQ8A 3MV2B 5FZSA 5KJLA 2DBAA 4HVBA 3FUEA 2LAIA 3CLJA 3PE3A 4I9CA 3IBEA 5FQ8A 2E2EA 4GA1A 3JYSA 3PEVB 4F53A 4U0UA 4RVBA 1HG2A 3RRUA 4JA9A 2VTBA 5BW8C 4U63A 2IQCA 1NA3A 4AIFA 3FTZA 4PS7A 5AJDA 5EX0A 4ACKA 2DCPA 4UI9J 4EECA 2L0IA 2L9BA 3S7BA 1IQRA 4Y6CA 3ZEFA 1E8XA 4LUNU 3ZRHA 1DNPA 4B8AA 4BX8A 4I1AA 3NQPA 1H0AA 3L08A 3ASDA 3FUDA 1SZAA 3FUHA 4C9BB 4TUUA 3SHFA 3JCKC 1HF8A 4FC8A 4FU3A 5ARGA 4EZKA 1XGWA 1IQUA 5C1DA 2R59A 4DPRA 4RSYA 3JUIA 1UN9A 2X6HA 3N71A 4J0UA 2CHZA 2UY1A 3CQCB 4LRZA 3FTXA 2VYIA 4CT4A 2KM4A 4LCTA 4ANVA 2FO7A 2E0IA 3LDZA 3QWPA 4L7TA 4AOFA 3CVPA 3ZYKA 1N52A 2KC7A 5E75A 2GRLA 3RO3A 3Q49B 3LEWA 2WQ6A 3U4TA 2IOSA 2PQNA 4UWLA 3FWVA 4FLBA 4Y6WA 2C0MA 4OYSA 4ABNA 3CHOA 4J8FA 3PRZA 2RD0A 4XX5A 4N5CA 3LY7A 3S2AA 4FJZA 3ENEA 4N2SA 2J08A 3K9IA 3QOUA 5G2NA 3I4GA 3MGBA 2UWJG 3PDNA 3FULA 3CGHA 3I3NA 2YHCA 5G05C 3CR3A 3LYAA 2VQ2A 3FUKA 2KATA 3GYZA 5AYWD 5KJMA 3FU5A 4I1OB 3ZYQA 4G1TA 4AEZC 5M72A 4DJAA 4V3IA 3FUJA 1EPUA 4JVSA 5LCWC 1BPOA 5T4YA 2X6JA 3MEKA 4HLEA 5G55A 3RO2A 1OUVA 3RRNB 4CDMA 3EJNA 2OVFA 4RG9A 5LP0A 4KZ0A 5JHBA 4U0SA 1NA0A 1IHGA 2I1JA 1LF8A 4EZLA 1KLXA 1YA0A 2VSOE 1IYGA 2WM9A 4FLHA 3FTYA 2KZTB 4HORA 5AENA 5FZRA 4C0MA 4DI4A 2IF4A 3HVEB 4JPSA 4JA7A 2LAHA 3FU3A 4EBAA 3U64A 4W9RA 3ZXSA 1HE8A 3APDA 4GYWA 3G2UA 3TXNA 1UJKA 4L2LA 3U3WA 3TJPA 2LSVA 1HH8A 4L23A 5CMYA 1E7UA 3AS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSY A;  1WM5 A;  4YVQ C;  2FI7 A;  3RKV A;  5HI7 A;  3PE4 A;  2JLB A;  2IFU A;  5G05 J;  2P58 C;  4NQ0 A;  3LY9 A;  5JJ7 A;  4G2V A;  3WXX A;  3OXG A;  5LCW J;  4I2W A;  4G24 A;  2FBN A;  1PC2 A;  5FJY A;  2OOE A;  5KJN A;  3QDN A;  4UI9 K;  3R9A B;  3QKY A;  4F3V A;  3AS8 A;  4G23 A;  3SZ7 A;  2XGM A;  4AY5 A;  2LNI A;  4KYO B;  2C0L A;  5FTP A;  2OND A;  3ESK A;  2GW1 A;  3FFL A;  4ME2 A;  4CGW A;  1ZBP A;  3TG4 A;  3RIB A;  1HZ4 A;  4I2Z A;  1Y8M A;  4N3B A;  2Y4T A;  1W3B A;  3MA5 A;  2Q7F A;  3CVQ A;  4UQX A;  4AY6 A;  3SF4 A;  4J8E A;  1KT1 A;  4KXK B;  3LPZ A;  4GCN A;  3ZGQ A;  2XCB A;  5CHE E;  3ZFW A;  3ZHE B;  5HQ8 A;  2LSU A;  3ASH A;  4XI0 A;  4N2Q A;  4GYO A;  4O6F A;  1FCH A;  4JHR A;  4LEU A;  3ZN3 A;  4N3C A;  2QFC A;  3UUX A;  2XEV A;  5DIZ A;  2FEZ A;  2KCL A;  4EQF A;  5FT9 A;  3IEG A;  4GA2 A;  2PL2 A;  4U04 A;  4HOU A;  4GCO A;  3ASF A;  3MV3 B;  2NC9 A;  2XPI A;  3GZ2 A;  1NZN A;  4GPK A;  4NRH B;  2PZI A;  4BT8 A;  3ZPJ A;  3TG5 A;  3TGO A;  4BT9 A;  2KCV A;  4BTB A;  3CK8 A;  1B89 A;  4U0Z A;  1XNF A;  5A7D B;  3VTX A;  4H7Y A;  3LY8 A;  2XGS A;  3QWV A;  3EDT B;  3Q47 B;  4HOT A;  4HOQ A;  5BNW A;  5ARF A;  4IN3 B;  4WUY A;  4GYY A;  3KAE A;  3OXF A;  3AS4 A;  3ZHE A;  4WNE A;  5KJK A;  4G26 A;  2KCK A;  2VGY A;  4A1S A;  3CKC A;  5G04 C;  4I9E A;  2MHK A;  2WPV A;  3LCA A;  3S7D A;  5D0O D;  4CDR A;  4RG6 A;  4APO A;  3FP3 A;  2WQH A;  5JJ6 A;  2XGO A;  4YVO A;  4WND A;  2HYZ A;  1QQE A;  4XI9 A;  5EX3 A;  2Y4U A;  3CVL A;  3QWW A;  4XIF A;  3UPV A;  1E96 B;  4I17 A;  5FZQ A;  4BWR A;  3VTY A;  3RJV A;  3HYM B;  5G04 J;  1ZU2 A;  4GA0 A;  4N3A A;  3O48 A;  1TJC A;  3URZ A;  3S7J A;  2L6J A;  5CCM A;  3Q5M A;  2BUG A;  3BEE A;  5CCL A;  3KD7 A;  4J8D A;  4BTA A;  3S7F A;  3CVN A;  4CGV A;  2VGX B;  4U07 A;  4N39 A;  3Q4A B;  4GZ3 A;  2FF4 A;  4B94 A;  3CV0 A;  2I6H A;  4WNF A;  1P5Q A;  2HR2 A;  1QZ2 A;  2PQR A;  4JL0 A;  1ELW A;  1A17 A;  3OXL A;  5D0Q D;  4H7X A;  1ELR A;  5DBK A;  4WNG A;  3ASG A;  3CEQ A;  4HOS A;  1KT0 A;  3CK9 A;  4UQZ A;  3CKB A;  2R5S A;  2C2L A;  5BT1 A;  3CK7 A;  1WAO 1;  2XCC A;  4GZ5 A;  2UY1 B;  3MKR A;  5EKQ D;  4YND A;  4KBQ A;  5JJT A;  4G25 A;  3LKU A;  3NF1 A;  4UQY A;  3Q15 A;  2VSN A;  3RU0 A;  3GW4 A;  4GZ6 A;  2AVP A;  3E4B A;  3TAX A;  4UI9 C;  3KS2 A;  1HXI A;  2V5F A;  3GZ1 A;  3UQ3 A;  3AS5 A;  2J9Q A;  4AM9 A;  2HO1 A;  5A6C A;  2VGX A;  2YQ8 A;  3MV2 B;  5FZS A;  5KJL A;  2DBA A;  3PE3 A;  4I9C A;  2E2E A;  4GA1 A;  3JYS A;  4U0U A;  4JA9 A;  5BW8 C;  1NA3 A;  4AIF A;  5EX0 A;  4UI9 J;  3S7B A;  4Y6C A;  4I1A A;  3ASD A;  5ARG A;  5C1D A;  3N71 A;  4J0U A;  2UY1 A;  2VYI A;  2FO7 A;  3QWP A;  3CVP A;  2KC7 A;  3RO3 A;  3Q49 B;  3U4T A;  2PQN A;  3FWV A;  4Y6W A;  2C0M A;  4ABN A;  4J8F A;  4N5C A;  3LY7 A;  4N2S A;  3K9I A;  3QOU A;  2UWJ G;  3PDN A;  2YHC A;  5G05 C;  3LYA A;  2VQ2 A;  5KJM A;  2KAT A;  3GYZ A;  5AYW D;  4G1T A;  5M72 A;  5LCW C;  3MEK A;  3RO2 A;  1OUV A;  4RG9 A;  4U0S A;  1NA0 A;  1IHG A;  1KLX A;  1YA0 A;  1IYG A;  4HOR A;  5FZR A;  2IF4 A;  4JA7 A;  4W9R A;  4GYW A;  3U3W A;  2LSV A;  1HH8 A;  3ULQ A; 
#chains in the Genus database with same CATH topology
 1YYH A;  2VJ8 A;  2L6B A;  3V79 K;  3PE4 A;  2JLB A;  5CRV A;  3KSQ A;  2CFZ A;  5G05 J;  2P58 C;  4MKT A;  5LCW J;  4ANX A;  2A5U A;  3PS6 A;  5AQ9 A;  1NL4 A;  5ANL A;  4URK A;  5FJY A;  2OOE A;  1LTX A;  1OCO E;  3QDN A;  4F3V A;  3AS8 A;  3SZ7 A;  4AY5 A;  5ANR A;  2XPZ A;  3U66 A;  3UT8 A;  3BG1 B;  3EHQ A;  2OND A;  2WXI A;  3UX4 A;  4DK5 A;  4DX1 A;  3FFL A;  3PZ2 A;  4ME2 A;  4D10 C;  1OCR E;  3EHM A;  1SW6 A;  4CGW A;  3TG4 A;  3D9I A;  2J49 A;  2J07 A;  2RG8 A;  1N94 A;  1HG5 A;  3R7R A;  3SD5 A;  2QYJ A;  4GML A;  3UTM A;  2GRO B;  4EZJ A;  1JCS A;  4GTM A;  3IHY A;  4GMR A;  4K0R A;  4ATG A;  1BD8 A;  1E8Y A;  3FEY A;  3ZHE B;  4AJW A;  3HDX A;  3U9W A;  1N4S A;  1MX4 A;  4UUC A;  3ASH A;  4N2Q A;  4R7L A;  3FUF A;  3FU0 A;  4U8H A;  1N11 A;  2ILR A;  4PUC A;  1MZC A;  5DIZ A;  2EQX A;  3PNL B;  4EQF A;  3MX3 A;  4GA2 A;  4U04 A;  1U3C A;  4GCO A;  2Y3A A;  2XEE A;  4TXQ A;  3VLE A;  4TXP A;  4F7A A;  2NXP A;  3GZ2 A;  5J90 A;  4GPK A;  2ZGG A;  4NRH B;  2WXJ A;  2R17 C;  3V2X A;  3VTX A;  5EN5 D;  4DX5 D;  4XKC A;  4LNB A;  1NP7 A;  5T3R A;  4U7E B;  4PS8 A;  3EDT B;  3TWQ A;  3CHQ A;  4HOT A;  3KEA A;  3CQG B;  3SY2 A;  4M7C A;  3DSW A;  3OTN A;  2BKG A;  4GYY A;  2RKK A;  2KXP C;  4AP2 A;  3ZHE A;  2P9S G;  2QY7 A;  5D2M C;  5CMW A;  3FU6 A;  3AG4 E;  2VGY A;  3ZU7 B;  3DXK G;  3Q78 A;  4LNU D;  3CKC A;  3O4Z A;  2WPV A;  3CVX A;  4UWF A;  3S7D A;  4CEM A;  2WXN A;  2OEW A;  2BED A;  2YNQ A;  4YVO A;  2HYZ A;  1TEZ A;  5CEA A;  3CHS A;  1TN6 A;  1BLX B;  1E96 B;  4I17 A;  2XHE A;  2XZD G;  3P2B A;  3ZW3 A;  4BWR A;  5KCM A;  5ITZ F;  3HYM B;  3ML9 A;  1ZU2 A;  3DEO A;  1OXJ A;  2WB2 A;  4GAA A;  3S7J A;  2J09 A;  1E8Z A;  2YIN A;  3D9L A;  3AJI A;  3PZ3 A;  4J8D A;  4BSZ B;  3CVN A;  5AJL A;  5CED B;  2FO1 E;  1G3N B;  3AG2 E;  2P9U G;  2HR2 A;  1QZ2 A;  1JUQ A;  3HXB A;  2LUH A;  3CST A;  1TJF A;  2VTB B;  1A17 A;  4HXI A;  1INZ A;  2QZA A;  5FWQ A;  4B8C B;  2AWI A;  3QC1 A;  4JXT A;  2CHW A;  2OEV A;  3NBN B;  3V31 A;  4HOS A;  3SGH A;  3W9F A;  3D9P A;  3ABM E;  2UY1 B;  3IHV A;  2OV8 A;  1DCQ A;  3J5P A;  3ML8 A;  5H7P A;  1H6P A;  4X8Q A;  4KBQ A;  4K5B A;  3Q15 A;  2VSN A;  3CVV A;  4Q96 A;  1BI7 B;  2WMO A;  2AVP A;  3E4B A;  3Q7A A;  3T5X A;  1RW2 A;  3TWT A;  4JHK A;  3EU9 A;  4BFR A;  1N4Q A;  4AVX A;  3D9N A;  1L5J A;  2IU1 A;  3PVL A;  3R9M A;  4FUL A;  1V55 E;  1ELK A;  3ONL A;  4HVB A;  2LAI A;  5CBO A;  3IBE A;  2E2E A;  2VTB A;  4U63 A;  4OAV B;  4Y6C A;  4LUN U;  4B8A A;  3NQP A;  3ASD A;  3JCK C;  1HF8 A;  3JUI A;  3N71 A;  4J0U A;  2UY1 A;  2GRQ B;  2FO7 A;  2P2C P;  3RO3 A;  3ASN E;  2C0M A;  3C72 A;  4OYS A;  4XX5 A;  2RD0 A;  3UI2 A;  4N2S A;  3QOU A;  5G2N A;  3MGB A;  3PDN A;  4DX7 D;  3ZYQ A;  4DJA A;  3FUJ A;  3RRN B;  5KNG A;  1NA0 A;  1IHG A;  2I1J A;  4EZL A;  4FLH A;  3TWX A;  3TWU A;  4EBA A;  3U64 A;  4W9R A;  1HE8 A;  1UJK A;  4L2L A;  3TJP A;  1E7U A;  3AS4 A;  2ZGD A;  3AU4 A;  4CCA A;  4JHJ A;  3RKV A;  2MOW A;  4JD2 G;  1TN8 A;  5JJ7 A;  2PNN A;  2IO3 C;  5AIJ A;  3L54 A;  3MJW A;  3DPD A;  1IKN D;  3CHR A;  4XKB A;  4GMJ A;  3RK6 A;  4UWG A;  4XEI G;  5KJN A;  4UI9 K;  3L6A A;  3MZL B;  4G23 A;  1O5M A;  1Z5S C;  2C0L A;  1OWL A;  1ZB1 A;  2RFA A;  4E6H A;  2V4L A;  4J7W A;  3ESK A;  1Z3Y A;  3AU5 A;  3UT4 A;  4ATZ D;  4A1G A;  2YHE A;  1ZBP A;  3ABL E;  5CRU A;  1OWN A;  2R03 A;  4ILG A;  4I2Z A;  2ETB A;  1W3B A;  3MA5 A;  3ZIM A;  4GTV A;  3JQ1 A;  1H2U A;  4RLY A;  2QC9 A;  3CVQ A;  1NFI E;  2R02 A;  4J8E A;  3CHM A;  1QYM A;  5EIL A;  1SZ9 A;  3T5V A;  3G2T A;  5KWD A;  5CHE E;  2ETA A;  4RQI A;  2LSU A;  4XI0 A;  4HQD A;  2XRZ A;  1SQM A;  4LEU A;  3UIP C;  1FPP A;  3DSS A;  4N3C A;  4EBA G;  2WQ7 A;  2XEV A;  3LVQ E;  1S63 A;  4ILI A;  2KCL A;  2VGE A;  3AG3 E;  5AN8 A;  3IEG A;  1K8K G;  1HFA A;  5JHA A;  2WXR A;  4HLL A;  3APC A;  2WXF A;  2WXH A;  3Q7F A;  4DLO A;  4MLP A;  3Q9N C;  4AXH A;  2PZI A;  1PY1 A;  2XZT G;  3LVR E;  3ZPJ A;  2OCC E;  4BT9 A;  3TWW A;  4BTB A;  4YDW A;  1B89 A;  4U0Z A;  2V5Q C;  4JEH A;  5A7D B;  2BKK B;  2XEN A;  2B6C A;  5EYP F;  3QWV A;  2V0P A;  4ANU A;  3UKU G;  2M63 A;  2QYU A;  1OCC E;  3C98 A;  4HOQ A;  4ZFH A;  1N4R A;  3EHR A;  4GTR A;  3SFY A;  5BXO A;  4YDY A;  1DCE A;  4BEP A;  2Y1L E;  3HXF A;  3DXM G;  5KJK A;  3HRA A;  4GTS A;  2IJG X;  1N95 A;  2P9N G;  2MHK A;  4KVM A;  4F1S A;  2X38 A;  3TXM A;  3C3O A;  3L17 A;  1H19 A;  4DX2 A;  2XGO A;  1MQS A;  1H2T C;  3NAW A;  5EX3 A;  3D9O A;  1JWG A;  2VSX E;  3UMV A;  1FT2 A;  2A5E A;  4Z68 A;  3QWW A;  1HX8 A;  4XIF A;  3UPV A;  3FTU A;  1KPS B;  3D9H A;  2H6F A;  5FZQ A;  3DPY A;  2J4D A;  3CVY A;  2JAB A;  5CBN A;  3O48 A;  4JB8 P;  5BV0 A;  3UT7 A;  3SFX A;  4FAD A;  2BF0 X;  4L2Y A;  4DLQ A;  3BEE A;  5CCL A;  2I2O A;  3QB2 A;  4J8S A;  2WXG A;  1UG3 A;  4EHM A;  5EYL A;  4BTA A;  1QNF A;  2F8Y A;  3C3R A;  2H6G A;  1O1S A;  3UM1 A;  3EIJ A;  2VGX B;  1LD7 A;  4U07 A;  3UM2 A;  3FH7 A;  3CV0 A;  3I4R B;  4CDN A;  1P5Q A;  4U8V D;  2PQR A;  1TR4 A;  1ELW A;  4UWK A;  2GRM A;  3OXL A;  4H7X A;  2P9I G;  4OVU A;  3LJ3 A;  2WXO A;  1JWF A;  5KBA A;  3CEQ A;  3CHP A;  3SI5 A;  4UQZ A;  2X6I A;  4A55 A;  4NIK A;  3B7R L;  2XCC A;  4LSZ E;  5EKQ D;  1H2V C;  4G25 A;  3LKU A;  4DRX E;  3NF1 A;  3PZD A;  3AAA C;  1UN8 A;  3GW4 A;  4GZ6 A;  2AXV A;  3FUM A;  4GB9 A;  4UI9 C;  5FQ4 A;  1EYH A;  1HXI A;  1N54 A;  3PUK A;  2A4Z A;  2WXK A;  4WWN A;  1MJ0 A;  2H6I A;  4MRU A;  2I9C A;  2HO1 A;  3E32 A;  2VGX A;  3J5Q B;  5KJL A;  2DBA A;  3T8K A;  3CLJ A;  3PE3 A;  4GA1 A;  3JYS A;  4RVB A;  2DVW A;  5BW8 C;  1NA3 A;  4AIF A;  4PS7 A;  5AJD A;  2DCP A;  4UI9 J;  1RZ4 A;  1H0A A;  1SZA A;  3FUH A;  4FU3 A;  1XGW A;  5C1D A;  4RSY A;  1UN9 A;  4CT4 A;  3FTX A;  2KM4 A;  3ULE G;  3LDZ A;  3QWP A;  1N52 A;  2KC7 A;  3L82 A;  2GRL A;  3Q49 B;  2H6H A;  4UWL A;  1MX6 A;  4Y6W A;  4ABN A;  3CHO A;  3PRZ A;  4YDO A;  4O60 A;  2J08 A;  2UWJ G;  2YHC A;  5KJM A;  5AYW D;  3GYZ A;  4GTP A;  4BET A;  5M72 A;  1EPU A;  2IY0 C;  1BPO A;  5ENT D;  1SA4 A;  5G55 A;  1OUV A;  3TWV A;  2OVF A;  4U0S A;  1KLX A;  4YDE A;  3FTY A;  2KZT B;  2NYJ A;  5HRY A;  4DI4 A;  3ZUV B;  2IF4 A;  3HVE B;  4JPS A;  2LAH A;  3FU3 A;  3E30 A;  2GRN B;  3U3W A;  2LSV A;  3ULQ A;  1DVP A;  2VSY A;  4YVQ C;  3EHN A;  2FI7 A;  4J6I A;  4L1B A;  2IFU A;  2X6K A;  4LNG A;  3TWS A;  4NQ0 A;  4CZ2 D;  4G2V A;  3WXX A;  4A3T A;  3V30 A;  4OVV A;  4P29 A;  3RRM B;  3MKQ B;  2EIM E;  4NUR A;  2FBN A;  4MBG A;  1PC2 A;  1EDU A;  1TNO A;  3R9A B;  3QKY A;  4L9P A;  2XGM A;  5ENO D;  3B13 A;  3E33 A;  3D9K A;  1TYQ G;  5LOZ A;  5FTP A;  1N9A A;  1OY3 D;  3BU8 A;  1UJJ A;  1HZ4 A;  1Z6T A;  4JZY A;  5E76 A;  2V8S E;  1HU3 A;  1Y8M A;  5ENP D;  2Y4T A;  4E85 A;  5J08 A;  2KZT A;  1OWP A;  3HVE A;  4U95 D;  4Q69 A;  4AY6 A;  3SF4 A;  2BTD A;  4KXK B;  4GCN A;  3ZGQ A;  2XCB A;  3VLF A;  5ENQ D;  4BSX A;  5HQ8 A;  3CVU A;  1TNY A;  2LXM A;  3W9G A;  3DBS A;  1FCH A;  3MKQ A;  3CSF A;  3QJZ A;  2QFC A;  3UUX A;  3G2S A;  3LXU X;  2LO6 A;  4F1P A;  2PL2 A;  3FUN A;  3HIZ A;  3ASF A;  3FTS A;  3I5P A;  3NZS A;  3TL5 A;  1NZN A;  4FP7 A;  4BT8 A;  2L0T B;  2EIN E;  3TGO A;  3R7Q A;  3MYV A;  2V4H C;  4HI9 A;  5BPP A;  1XNF A;  3QAR A;  4H7Y A;  3G2W A;  1X5B A;  1FVF A;  4AV7 A;  2XGS A;  3Q75 A;  4TUM A;  3Q79 A;  5BNW A;  3L22 A;  3JXJ A;  5ARF A;  4PDX A;  5C2Y A;  3KAE A;  3OXF A;  3PZ1 A;  3DSU A;  4I43 A;  4WNE A;  5BV1 A;  4I6J A;  4B0Z A;  4K03 A;  5CEC B;  5G04 C;  3HHM A;  4I9E A;  3LCA A;  2I1K A;  2F8X K;  3FEX A;  5D0O D;  4RG6 A;  2DYS E;  4APO A;  5JJ6 A;  5BUZ A;  4WND A;  2WVI A;  1QQE A;  2PM6 A;  3B7B A;  5AAO A;  3CVL A;  5B3S E;  3B7U X;  3B7T A;  1Z3X A;  3D9J A;  3NOC D;  4A3V A;  3VTY A;  3RJV A;  3HXE A;  5G04 J;  4G8L A;  1VDY A;  3DEP A;  4BER A;  1OWO A;  2L6J A;  5CCM A;  3ULY A;  3Q5M A;  4FHJ A;  4FJY A;  2BUG A;  1E8W A;  1O1T A;  1MHQ A;  1TNZ A;  1Q2Z A;  3KSL A;  3S7F A;  5LFA A;  4HRL A;  4WAF A;  1E90 A;  4CGV A;  3Q4A B;  1K1B A;  4M3O A;  3LJN A;  4B94 A;  1X81 A;  4K5A B;  3D9M A;  4IYP A;  5D0Q D;  4MS6 A;  5DBK A;  1TNU A;  4WNG A;  3EIQ C;  1KT0 A;  2CFU A;  4FA6 A;  5EIB E;  4GPM A;  4C48 B;  3CKB A;  1TN7 A;  3T8M A;  1AWC B;  2R5S A;  3B95 A;  2C2L A;  2P9K G;  4HBD A;  5BT1 A;  3CK7 A;  4HNA D;  5D66 A;  3P1U A;  3ABK E;  1PAQ A;  4U96 D;  1D9S A;  4KMO A;  5JJT A;  4PS3 A;  4KVO A;  3QAQ A;  1S0P A;  5ENN A;  3RU0 A;  1QBQ A;  3SFZ A;  2XRY A;  4I6G A;  2NSZ A;  1GW6 A;  4I6E A;  3TAX A;  2XS8 A;  5AQB A;  2V5F A;  2HM8 A;  3MCX A;  2OVB A;  3UM3 A;  4DUI A;  3PH0 C;  3UQ3 A;  5AQA A;  2ETC A;  2J9Q A;  3LS8 A;  2EIJ E;  3D3M A;  2DYR E;  4IUL A;  3FUI A;  4GZD A;  1HO8 A;  1YMP A;  4GTO A;  5A6C A;  2WXP A;  1DC2 A;  3FUE A;  4I9C A;  4HRM B;  5FQ8 A;  3PEV B;  4U0U A;  4JA9 A;  2IQC A;  3C5R A;  4EEC A;  5JMN D;  2L9B A;  3ZEF A;  3ZRH A;  3L08 A;  4C9B B;  3SHF A;  4FC8 A;  5ARG A;  4K5C A;  4LG6 A;  2R59 A;  4LRZ A;  2AJA A;  2X6H A;  3CQC B;  2VYI A;  5EID A;  4LCT A;  4ANV A;  2E0I A;  4L7T A;  5E75 A;  3LEW A;  2WQ6 A;  3U4T A;  2IOS A;  2PQN A;  4FLB A;  4F6R D;  2P9L G;  1MX2 A;  3S2A A;  4FJZ A;  3ENE A;  3K9I A;  3I4G A;  3V2O A;  3LYA A;  3FU5 A;  4TXR A;  5AAR A;  4JVS A;  1S70 B;  5T4Y A;  3EJN A;  1IXV A;  5CER B;  3C3Q A;  3DSV A;  5IY5 E;  1LF8 A;  1YA0 A;  1IYG A;  3ASO E;  3AG1 E;  1HH8 A;  5CMY A;  1WG0 A;  2F0Y A;  2R05 A;  4HB5 A;  1WM5 A;  1OCZ E;  5HI7 A;  2XQ0 A;  1BI8 B;  4JW1 A;  2WXL A;  2HE0 A;  3LY9 A;  3CVW A;  3DRA A;  3OXG A;  3NZU A;  4I2W A;  3SQV A;  4G24 A;  3ONK A;  3PUJ A;  5AQ7 A;  4DX6 D;  2WXQ A;  3NB2 A;  2CG3 A;  2LNI A;  3ZKJ A;  4KYO B;  5FQ7 A;  3UM0 A;  2Y0B G;  5HS0 A;  4GU5 A;  2AXU A;  2XPY A;  2GW1 A;  2DIW A;  5FIN A;  1U2V G;  3RIB A;  5B1B E;  3JQ0 A;  3FH8 A;  4N3B A;  3HG0 D;  5ENR D;  3RAU A;  2ZIR A;  2AW6 A;  2Q7F A;  1YCS B;  3QK0 A;  3ZYM A;  3FHE A;  4UQX A;  4WWP A;  1KT1 A;  2GRR B;  2WMN A;  3LPZ A;  4TV3 A;  1WDY A;  3HXD A;  3JUE A;  1E7V A;  2ZIS A;  3ZFW A;  3X2Q E;  3CIA A;  2JEK A;  1NI1 A;  4JC8 A;  2MYO A;  1HS6 A;  4GYO A;  4O6F A;  2AXZ A;  4HI8 A;  1JPL A;  4JHR A;  4CRW A;  3BUA A;  3ZN3 A;  4DI3 A;  2Y69 E;  3FDH A;  3TWR A;  4QQI A;  2FEZ A;  4J8Y A;  5FT9 A;  5BXU A;  3KEZ A;  1SA5 A;  3APF A;  4HOU A;  2XEH A;  4CT0 A;  5A23 A;  4G8K A;  1OT8 A;  3MV3 B;  2NC9 A;  2XPI A;  3DST A;  3L16 A;  4HS2 A;  3FTV A;  4XZ4 A;  2ZXW E;  1LD8 A;  1U3D A;  3TG5 A;  3QNK A;  2KCV A;  3CK8 A;  5EDS A;  3LY8 A;  4EPZ A;  1EF1 C;  3EUV A;  2P9P G;  2XS1 A;  1H6K A;  4JEU A;  3ZYL A;  3Q47 B;  3VLD A;  3ZVV A;  3PNT B;  2GRP B;  2GGF A;  3IV0 A;  4IN3 B;  3BQO A;  4O1P A;  4WUY A;  4FHK A;  4C0E A;  3PRE A;  3B7S A;  4TRQ A;  4WWO A;  2R2L A;  4G26 A;  2KCK A;  2PM7 A;  3Q9U C;  5T8I A;  4A1S A;  4N5Q A;  1UW4 B;  2J4B A;  3IKO B;  3DWL G;  4GTQ A;  2ZU6 B;  4CDR A;  1Y6I A;  3FP3 A;  4KT6 B;  2WQH A;  1JCQ A;  3ESL A;  2F37 A;  3DSX A;  3T9K A;  4APF A;  4XI9 A;  3G2V A;  5ENS D;  3EU5 A;  5JA4 D;  2Y4U A;  3BG0 B;  4NAC A;  4ACL A;  4ILH B;  4Q94 A;  5FQ6 A;  2IO2 C;  4GTT A;  5B1A E;  4ZHB A;  4IRU A;  4XE0 A;  1BU9 A;  2DZO A;  2J8S D;  3SNX A;  2IOL A;  4PH4 B;  4N3A A;  4GA0 A;  4O1O A;  1O1R A;  4G11 A;  1TJC A;  4LER A;  2KBX A;  3URZ A;  1MYO A;  1OWM A;  2FUL A;  3RSE G;  3F6Q A;  3PZ4 A;  4ANW A;  2RFM A;  2CHX A;  3KD7 A;  4GZC A;  4HRN A;  3OAW A;  4BX9 A;  3SBS A;  4N39 A;  3GZS A;  4I1M A;  4B89 A;  4GZ3 A;  2FF4 A;  4CYM D;  2I6H A;  4WNF A;  4BY6 A;  4JL0 A;  3UKR G;  3SBT B;  4KZC A;  1ELR A;  3HXC A;  3IXE A;  1JCR A;  3L13 A;  3ASG A;  4A63 B;  1AP7 A;  2B0O E;  3CK9 A;  1N0Q A;  3FH5 A;  1A5E A;  3SO8 A;  2X3M A;  1WAO 1;  3Q73 A;  4GZ5 A;  3ISM C;  2WXM A;  3MKR A;  2DZN A;  4YND A;  1WY6 A;  3JXI A;  4HFG A;  4QFV A;  2MRI A;  3UIN C;  2IEJ A;  4UQY A;  1V54 E;  4OAU C;  3FY4 A;  2ION A;  1FVH A;  3KS2 A;  1H6O A;  4BES A;  3GZ1 A;  2CG2 A;  1TNB A;  3PEU B;  1K3Z D;  4UWH A;  1SVX A;  3AS5 A;  3UIO C;  2X6F A;  5LX8 A;  4AM9 A;  2EIK E;  3FTW A;  2YQ8 A;  3MV2 B;  5FZS A;  1S64 A;  4F53 A;  1HG2 A;  3RRU A;  3FTZ A;  1D8E A;  5EX0 A;  4ACK A;  2L0I A;  3S7B A;  1IQR A;  1E8X A;  1FT1 A;  1DNP A;  3ZNG A;  4BX8 A;  4I1A A;  3FUD A;  4TUU A;  1K1A A;  4EZK A;  1IQU A;  4DPR A;  1KZO A;  1N0R A;  5AEN A;  2CHZ A;  1IHB A;  3E34 A;  4AOF A;  3CVP A;  3ZYK A;  3UXG A;  3FWV A;  3WG7 E;  4J8F A;  4U8Y D;  3ZXP A;  4N5C A;  3LY7 A;  2LXL A;  1D8D A;  3FUL A;  3CGH A;  3I3N A;  5G05 C;  3CR3 A;  2VQ2 A;  3FUK A;  2DWZ A;  2KAT A;  5FIO A;  1UOH A;  3NOG D;  4I1O B;  4G1T A;  4AEZ C;  3L9T A;  4V3I A;  5LCW C;  2X6J A;  1KZP A;  3MEK A;  4HLE A;  3RO2 A;  4CDM A;  4RG9 A;  5LP0 A;  4KZ0 A;  5JHB A;  5HKP A;  4B93 B;  2VSO E;  2WM9 A;  4HOR A;  5FZR A;  4C0M A;  1N4P A;  2EIL E;  4JA7 A;  3E37 A;  3ZXS A;  5KNH D;  3APD A;  4GYW A;  3G2U A;  3TXN A;  4L23 A; 
#chains in the Genus database with same CATH homology
 1DVP A;  2VSY A;  3AU4 A;  1WM5 A;  2VJ8 A;  4JHJ A;  4YVQ C;  4CCA A;  3EHN A;  2FI7 A;  3RKV A;  4J6I A;  4L1B A;  5HI7 A;  3PE4 A;  2JLB A;  2XQ0 A;  2IFU A;  2CFZ A;  4JW1 A;  5DBK A;  5G05 J;  2P58 C;  2WXL A;  2X6K A;  2MOW A;  4NQ0 A;  4MKT A;  3LY9 A;  5JJ7 A;  4G2V A;  3CVW A;  3WXX A;  4A3T A;  3OXG A;  5LCW J;  4OVV A;  4P29 A;  4ANX A;  3RRM B;  5AIJ A;  3MKQ B;  3L54 A;  2A5U A;  3MJW A;  3NZU A;  3PS6 A;  4I2W A;  3DPD A;  4G24 A;  3ONK A;  2FBN A;  4NUR A;  3CHR A;  4XKB A;  1PC2 A;  4GMJ A;  5ANL A;  3PUJ A;  3RK6 A;  1EDU A;  4UWG A;  4URK A;  5FJY A;  2OOE A;  5KJN A;  3QDN A;  4UI9 K;  3L6A A;  3R9A B;  3QKY A;  4F3V A;  3AS8 A;  3MZL B;  4G23 A;  2WXQ A;  3SZ7 A;  2XGM A;  4AY5 A;  5ANR A;  2XPZ A;  2CG3 A;  2LNI A;  3B13 A;  3U66 A;  3D9K A;  3UT8 A;  4KYO B;  2C0L A;  1OWL A;  5FQ7 A;  5LOZ A;  3BG1 B;  4E6H A;  5FTP A;  2V4L A;  4GU5 A;  2OND A;  3ESK A;  1Z3Y A;  2XPY A;  2AXU A;  2WXI A;  3UX4 A;  2GW1 A;  4DK5 A;  2DIW A;  3AU5 A;  3FFL A;  4ME2 A;  4D10 C;  3UT4 A;  3EHM A;  4A1G A;  4CGW A;  2YHE A;  1ZBP A;  3TG4 A;  1UJJ A;  1HZ4 A;  3RIB A;  3D9I A;  1OWN A;  1Z6T A;  4JZY A;  2J49 A;  3JQ0 A;  4ILG A;  5E76 A;  3FH8 A;  4I2Z A;  2J07 A;  2RG8 A;  1HU3 A;  1Y8M A;  2V8S E;  1HG5 A;  2Y4T A;  4N3B A;  4E85 A;  1W3B A;  3MA5 A;  3R7R A;  3SD5 A;  3ZIM A;  2KZT A;  4GML A;  5J08 A;  1OWP A;  2AW6 A;  2Q7F A;  3HVE A;  3JQ1 A;  1H2U A;  4Q69 A;  3QK0 A;  3ZYM A;  4EZJ A;  3FHE A;  3CVQ A;  4UQX A;  4WWP A;  4AY6 A;  4J8E A;  3SF4 A;  2BTD A;  1KT1 A;  3CHM A;  2WMN A;  4KXK B;  3IHY A;  4K0R A;  3LPZ A;  4TV3 A;  4ATG A;  1SZ9 A;  3T5V A;  1E7V A;  1E8Y A;  4GCN A;  3ZGQ A;  2XCB A;  3G2T A;  3VLF A;  4BSX A;  3FEY A;  5CHE E;  3ZFW A;  3ZHE B;  5HQ8 A;  4AJW A;  3HDX A;  3CVU A;  3U9W A;  3CIA A;  2JEK A;  2LSU A;  3DBS A;  3ASH A;  4JC8 A;  4XI0 A;  4N2Q A;  4R7L A;  1HS6 A;  4GYO A;  4O6F A;  1FCH A;  2AXZ A;  3FUF A;  2XRZ A;  1JPL A;  3MKQ A;  1SQM A;  4JHR A;  4CRW A;  4LEU A;  3FU0 A;  3CSF A;  3ZN3 A;  3QJZ A;  4U8H A;  4N3C A;  4DI3 A;  4EBA G;  2ILR A;  4PUC A;  3FDH A;  2QFC A;  2WQ7 A;  3UUX A;  2XEV A;  3LVQ E;  5DIZ A;  2EQX A;  3G2S A;  3LXU X;  4ILI A;  2FEZ A;  2KCL A;  2LO6 A;  3PNL B;  4EQF A;  3MX3 A;  5FT9 A;  3IEG A;  4GA2 A;  2PL2 A;  4U04 A;  3KEZ A;  4HOU A;  3APF A;  1U3C A;  3FUN A;  4GCO A;  4CT0 A;  2Y3A A;  1HFA A;  5A23 A;  5JHA A;  2WXR A;  3APC A;  3HIZ A;  3ASF A;  3FTS A;  3I5P A;  2WXF A;  3MV3 B;  2NC9 A;  2WXH A;  2XPI A;  3NZS A;  3VLE A;  4DLO A;  4F7A A;  2NXP A;  3L16 A;  4HS2 A;  3FTV A;  3GZ2 A;  1NZN A;  4MLP A;  3TL5 A;  4AXH A;  4XZ4 A;  5J90 A;  4GPK A;  4FP7 A;  2PZI A;  4NRH B;  4BT8 A;  1PY1 A;  2L0T B;  3LVR E;  1U3D A;  3ZPJ A;  2WXJ A;  3TG5 A;  3TGO A;  4BT9 A;  2R17 C;  3QNK A;  2KCV A;  3R7Q A;  4BTB A;  3CK8 A;  5EDS A;  3MYV A;  1B89 A;  4U0Z A;  4JEH A;  5BPP A;  1XNF A;  5A7D B;  3VTX A;  3QAR A;  4H7Y A;  3G2W A;  4XKC A;  3LY8 A;  1X5B A;  1NP7 A;  4EPZ A;  1EF1 C;  1FVF A;  4AV7 A;  2XGS A;  1H6K A;  3QWV A;  5T3R A;  4JEU A;  4PS8 A;  2V0P A;  3ZYL A;  4ANU A;  3EDT B;  3CHQ A;  2M63 A;  3Q47 B;  4HOT A;  3VLD A;  3ZVV A;  3C98 A;  3PNT B;  3CQG B;  4HOQ A;  5BNW A;  3L22 A;  2GGF A;  3IV0 A;  5ARF A;  4IN3 B;  4PDX A;  4WUY A;  3OTN A;  5C2Y A;  4GYY A;  4FHK A;  4C0E A;  3KAE A;  3OXF A;  4AP2 A;  3PRE A;  3ZHE A;  3B7S A;  4I43 A;  4WNE A;  5BV1 A;  4TRQ A;  2QY7 A;  4WWO A;  4I6J A;  5KJK A;  4G26 A;  5CMW A;  2KCK A;  3FU6 A;  2IJG X;  2PM7 A;  2VGY A;  4K03 A;  4B0Z A;  5T8I A;  4A1S A;  3CKC A;  3O4Z A;  5G04 C;  3ULQ A;  3HHM A;  4I9E A;  2MHK A;  1UW4 B;  2J4B A;  2WPV A;  3LCA A;  4KVM A;  4F1S A;  3CVX A;  4UWF A;  3IKO B;  2I1K A;  3S7D A;  4CEM A;  2X38 A;  2WXN A;  2ZU6 B;  3FEX A;  4RG6 A;  1Y6I A;  5D0O D;  3TXM A;  4CDR A;  3L17 A;  4APO A;  3FP3 A;  1H19 A;  4KT6 B;  2WQH A;  5JJ6 A;  2XGO A;  2YNQ A;  3ESL A;  1MQS A;  5BUZ A;  4YVO A;  1H2T C;  4WND A;  2HYZ A;  2WVI A;  1QQE A;  4APF A;  4XI9 A;  5EX3 A;  3G2V A;  3D9O A;  1JWG A;  2VSX E;  2PM6 A;  1TEZ A;  3UMV A;  3CHS A;  2Y4U A;  3BG0 B;  3CVL A;  3QWW A;  4NAC A;  1HX8 A;  4XIF A;  4ACL A;  4ILH B;  3B7U X;  4Q94 A;  5FQ6 A;  3UPV A;  3B7T A;  1E96 B;  4I17 A;  2XHE A;  3FTU A;  1Z3X A;  3P2B A;  3ZW3 A;  5FZQ A;  3D9J A;  4A3V A;  2J4D A;  4BWR A;  4IRU A;  4XE0 A;  3VTY A;  3CVY A;  5KCM A;  3RJV A;  3SNX A;  2IOL A;  3HYM B;  4PH4 B;  5G04 J;  3ML9 A;  1ZU2 A;  4GA0 A;  4N3A A;  1VDY A;  4G11 A;  3O48 A;  2WB2 A;  1TJC A;  4LER A;  4GAA A;  5BV0 A;  3UT7 A;  3URZ A;  3S7J A;  1OWO A;  4FAD A;  2BF0 X;  2L6J A;  5CCM A;  4L2Y A;  1OWM A;  2FUL A;  3Q5M A;  4FHJ A;  4FJY A;  2BUG A;  3BEE A;  4DLQ A;  1E8W A;  2J09 A;  5CCL A;  1E8Z A;  2I2O A;  1MHQ A;  3QB2 A;  4ANW A;  4J8S A;  2YIN A;  2CHX A;  2WXG A;  3KD7 A;  1UG3 A;  3D9L A;  4J8D A;  4BTA A;  3S7F A;  5LFA A;  4WAF A;  1E90 A;  1QNF A;  4GZC A;  3OAW A;  3CVN A;  4BX9 A;  5AJL A;  3SBS A;  4CGV A;  3EIJ A;  2VGX B;  4U07 A;  4N39 A;  3Q4A B;  3GZS A;  4I1M A;  4B89 A;  4M3O A;  4GZ3 A;  2FF4 A;  3FH7 A;  3CV0 A;  3I4R B;  4B94 A;  2I6H A;  4WNF A;  1P5Q A;  3D9M A;  4CDN A;  4BY6 A;  2HR2 A;  1QZ2 A;  1JUQ A;  2PQR A;  4JL0 A;  1ELW A;  3CST A;  1TJF A;  2VTB B;  4IYP A;  1A17 A;  4UWK A;  4HXI A;  1INZ A;  3SBT B;  4KZC A;  2GRM A;  3OXL A;  4H7X A;  5D0Q D;  5FWQ A;  1ELR A;  4B8C B;  3LJ3 A;  4MS6 A;  2AWI A;  4OVU A;  2WXO A;  1JWF A;  3L13 A;  3QC1 A;  4JXT A;  3ASG A;  4WNG A;  3CEQ A;  2CHW A;  3EIQ C;  4HOS A;  1KT0 A;  3CHP A;  2CFU A;  4FA6 A;  3SGH A;  3SI5 A;  3CK9 A;  4UQZ A;  3CKB A;  3FH5 A;  3T8M A;  2R5S A;  2C2L A;  2X6I A;  4A55 A;  5BT1 A;  3B7R L;  3D9P A;  2X3M A;  3CK7 A;  1WAO 1;  2XCC A;  4GZ5 A;  2UY1 B;  3IHV A;  2WXM A;  3P1U A;  2OV8 A;  3MKR A;  5EKQ D;  1PAQ A;  3ML8 A;  4KMO A;  4YND A;  1H2V C;  1WY6 A;  4KBQ A;  4G25 A;  5JJT A;  4PS3 A;  4HFG A;  3QAQ A;  1S0P A;  4KVO A;  2MRI A;  4QFV A;  5ENN A;  3LKU A;  3NF1 A;  3PZD A;  4UQY A;  3Q15 A;  1UN8 A;  2VSN A;  3RU0 A;  3GW4 A;  3SFZ A;  2XRY A;  2AXV A;  4GZ6 A;  3CVV A;  4I6G A;  2NSZ A;  4Q96 A;  1GW6 A;  2WMO A;  2AVP A;  3E4B A;  4I6E A;  3FY4 A;  3T5X A;  3TAX A;  3FUM A;  4GB9 A;  2ION A;  1FVH A;  4UI9 C;  3KS2 A;  4JHK A;  5FQ4 A;  1EYH A;  1HXI A;  1N54 A;  2V5F A;  2HM8 A;  3PUK A;  2WXK A;  2A4Z A;  3MCX A;  2OVB A;  3GZ1 A;  2CG2 A;  4WWN A;  3PH0 C;  3UQ3 A;  3PEU B;  4BFR A;  4UWH A;  4AVX A;  4MRU A;  3AS5 A;  2J9Q A;  3D9N A;  2X6F A;  3D3M A;  3LS8 A;  1L5J A;  2I9C A;  2IU1 A;  5LX8 A;  3PVL A;  4IUL A;  4AM9 A;  3FUI A;  2HO1 A;  4FUL A;  4GZD A;  1HO8 A;  1ELK A;  5A6C A;  3FTW A;  2WXP A;  3ONL A;  2VGX A;  2YQ8 A;  3MV2 B;  5FZS A;  5KJL A;  2DBA A;  4HVB A;  3FUE A;  2LAI A;  3CLJ A;  3PE3 A;  4I9C A;  3IBE A;  5FQ8 A;  2E2E A;  4GA1 A;  3JYS A;  3PEV B;  4F53 A;  4U0U A;  4RVB A;  1HG2 A;  3RRU A;  4JA9 A;  2VTB A;  5BW8 C;  4U63 A;  2IQC A;  1NA3 A;  4AIF A;  3FTZ A;  4PS7 A;  5AJD A;  5EX0 A;  4ACK A;  2DCP A;  4UI9 J;  4EEC A;  2L0I A;  2L9B A;  3S7B A;  1IQR A;  4Y6C A;  3ZEF A;  1E8X A;  4LUN U;  3ZRH A;  1DNP A;  4B8A A;  4BX8 A;  4I1A A;  3NQP A;  1H0A A;  3L08 A;  3ASD A;  3FUD A;  1SZA A;  3FUH A;  4C9B B;  4TUU A;  3SHF A;  3JCK C;  1HF8 A;  4FC8 A;  4FU3 A;  5ARG A;  4EZK A;  1XGW A;  1IQU A;  5C1D A;  2R59 A;  4DPR A;  4RSY A;  3JUI A;  1UN9 A;  2X6H A;  3N71 A;  4J0U A;  2CHZ A;  2UY1 A;  3CQC B;  4LRZ A;  3FTX A;  2VYI A;  4CT4 A;  2KM4 A;  4LCT A;  4ANV A;  2FO7 A;  2E0I A;  3LDZ A;  3QWP A;  4L7T A;  4AOF A;  3CVP A;  3ZYK A;  1N52 A;  2KC7 A;  5E75 A;  2GRL A;  3RO3 A;  3Q49 B;  3LEW A;  2WQ6 A;  3U4T A;  2IOS A;  2PQN A;  4UWL A;  3FWV A;  4FLB A;  4Y6W A;  2C0M A;  4OYS A;  4ABN A;  3CHO A;  4J8F A;  3PRZ A;  2RD0 A;  4XX5 A;  4N5C A;  3LY7 A;  3S2A A;  4FJZ A;  3ENE A;  4N2S A;  2J08 A;  3K9I A;  3QOU A;  5G2N A;  3I4G A;  3MGB A;  2UWJ G;  3PDN A;  3FUL A;  3CGH A;  3I3N A;  2YHC A;  5G05 C;  3CR3 A;  3LYA A;  2VQ2 A;  3FUK A;  2KAT A;  3GYZ A;  5AYW D;  5KJM A;  3FU5 A;  4I1O B;  3ZYQ A;  4G1T A;  4AEZ C;  5M72 A;  4DJA A;  4V3I A;  3FUJ A;  1EPU A;  4JVS A;  5LCW C;  1BPO A;  5T4Y A;  2X6J A;  3MEK A;  4HLE A;  5G55 A;  3RO2 A;  1OUV A;  3RRN B;  4CDM A;  3EJN A;  2OVF A;  4RG9 A;  5LP0 A;  4KZ0 A;  5JHB A;  4U0S A;  1NA0 A;  1IHG A;  2I1J A;  1LF8 A;  4EZL A;  1KLX A;  1YA0 A;  2VSO E;  1IYG A;  2WM9 A;  4FLH A;  3FTY A;  2KZT B;  4HOR A;  5AEN A;  5FZR A;  4C0M A;  4DI4 A;  2IF4 A;  3HVE B;  4JPS A;  4JA7 A;  2LAH A;  3FU3 A;  4EBA A;  3U64 A;  4W9R A;  3ZXS A;  1HE8 A;  3APD A;  4GYW A;  3G2U A;  3TXN A;  1UJK A;  4L2L A;  3U3W A;  3TJP A;  2LSV A;  1HH8 A;  4L23 A;  5CMY A;  1E7U A;  3AS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...