3ULQA

Crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
376
structure length
376
Chain Sequence
SSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRHNLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIYLSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQGGVSLYEIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of response regulator inhibition by a bacterial anti-activator protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/transcription activator
total genus 160
structure length 376
sequence length 376
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ulqA00
4GCOA 5KJKA 3CVNA 5JJ7A 3R9AB 3LY8A 4G1TA 5EX0A 1HZ4A 4N3CA 2XGMA 1QQEA 1HH8A 5G04C 5CCLA 3PE4A 3ULQA 3SZ7A 1PC2A 2JLBA 5HQ8A 3OXFA 1KT1A 2KCKA 3AS8A 3BEEA 4AM9A 4NRHB 4G26A 2VSYA 3QOUA 2WQHA 2UWJG 3AS4A 1FCHA 3CEQA 4UI9J 3UUXA 2XGSA 3U3WA 3LY7A 5EX3A 4W9RA 5JJTA 3ZN3A 3LKUA 3OXLA 4GYWA 2R5SA 2YQ8A 2XPIA 1XNFA 1KT0A 2VGYA 3K9IA 2DBAA 5A6CA 4RG6A 3TAXA 2KATA 5M72A 3ASGA 2Y4UA 3Q5MA 2VYIA 1TJCA 5FZRA 2PZIA 3ASDA 1OUVA 2I6HA 4YNDA 3MA5A 3CK9A 1ELWA 2V5FA 3TG5A 4XIFA 3RO3A 3IEGA 4GYOA 2KCVA 4O6FA 3GZ1A 2XCCA 2HR2A 1IHGA 3CVQA 4F3VA 4UI9K 2OOEA 4BTBA 4J8FA 5A7DB 5LCWJ 3VTYA 3SF4A 4G23A 3CVLA 2PQNA 4GZ3A 4GPKA 4BT9A 1QZ2A 3MV3B 1A17A 4LEUA 1WM5A 2XCBA 2KCLA 3CVPA 5FZQA 5ARFA 4G25A 3ESKA 2FF4A 1W3BA 2P58C 1ZBPA 3Q49B 4HOTA 4WNFA 4BT8A 4N2SA 2VGXA 3N71A 2PQRA 4GCNA 3MV2B 3RJVA 3FFLA 2LSVA 3LY9A 3JYSA 5BT1A 2WPVA 4Y6WA 4U0UA 3U4TA 3ZHEA 4HOUA 4JHRA 4I17A 3FWVA 1ZU2A 4UQZA 5FJYA 3GZ2A 2Y4TA 5G04J 3CKCA 4U07A 2HYZA 3QWWA 4AIFA 3KD7A 4CGWA 3RU0A 2LNIA 5CHEE 2C0LA 4WUYA 3QWVA 3PE3A 3O48A 2KC7A 2XGOA 2GW1A 4H7XA 5FTPA 4ME2A 4H7YA 5G05C 2FI7A 3ZPJA 4RG9A 5HI7A 4XI9A 2IFUA 3S7BA 3EDTB 4AY6A 1NA3A 2VQ2A 1B89A 3RKVA 4GA2A 5DBKA 2LSUA 2UY1B 1P5QA 4KXKB 4KBQA 2QFCA 4A1SA 4ABNA 2FBNA 4KYOB 3UPVA 5AYWD 2E2EA 2C0MA 3S7DA 4N3BA 5JJ6A 3AS5A 1NZNA 4GZ6A 4G2VA 4WNDA 5G05J 1WAO1 3Q47B 4J8EA 3CK8A 5DIZA 3ZFWA 3KAEA 4WNEA 4HOQA 4BTAA 5FT9A 3CK7A 5KJLA 1IYGA 4J0UA 5FZSA 3URZA 2ONDA 2VSNA 3MEKA 2NC9A 4HOSA 3MKRA 3WXXA 4B94A 2L6JA 3GW4A 2MHKA 3TG4A 4JL0A 3QDNA 5D0OD 4I9CA 4JA9A 2C2LA 3UQ3A 3QKYA 4N3AA 4AY5A 3GYZA 4UI9C 3RO2A 2YHCA 4UQXA 3OXGA 4I1AA 1ELRA 5EKQD 5BW8C 3KS2A 2Q7FA 3ASFA 4IN3B 4EQFA 4N2QA 4YVQC 2FEZA 3S7JA 4N5CA 1Y8MA 3E4BA 2IF4A 4G24A 4GA0A 3S7FA 1KLXA 2VGXB 1E96B 2HO1A 5KJNA 3LYAA 4U04A 5ARGA 3ZHEB 4CGVA 2XEVA 2UY1A 4GA1A 3CKBA 1NA0A 4Y6CA 4BWRA 2PL2A 4U0ZA 4JA7A 3RIBA 3QWPA 4GYYA 4I2ZA 3CV0A 3LCAA 5BNWA 3NF1A 4N39A 4U0SA 3PDNA 4UQYA 3Q15A 4APOA 3VTXA 4I9EA 4HORA 2BUGA 1YA0A 3ASHA 5LCWC 2FO7A 3HYMB 2J9QA 3TGOA 5KJMA 5D0QD 4NQ0A 4WNGA 2AVPA 4CDRA 4XI0A 5C1DA 3LPZA 3Q4AB 3ZGQA 4YVOA 4I2WA 4J8DA 1HXIA 4GZ5A 5CCMA 3FP3A
chains in the Genus database with same CATH superfamily
5AARA 3CIAA 2X38A 1OCOE 5JJ7A 3R9AB 5BV0A 3LY8A 2WXMA 3HRAA 2CHZA 1NL4A 4Q96A 3JXJA 4N3CA 4G8KA 4JEUA 3PUJA 3FUJA 3PE4A 3ULQA 2XQ0A 1LF8A 2WXFA 3OXFA 1KT1A 1N9AA 2KCKA 3BEEA 1IXVA 2BTDA 3HDXA 3W9GA 2OVBA 3PZ1A 1S64A 2VSYA 3QOUA 4K0RA 2PM6A 4LG6A 4K5AB 3FULA 1OWMA 3HVEB 1AWCB 5JHAA 2KZTB 2NYJA 3LJNA 4F7AA 5EIDA 5AENA 3BQOA 3B7BA 4GU5A 3LY7A 1N0QA 4GMLA 5JJTA 3FTYA 2XHEA 2XPZA 3LKUA 5E76A 4GYWA 2MOWA 2R5SA 3SNXA 2CFZA 3PREA 3CHRA 2Y4UA 2DWZA 2H6HA 3FTXA 3BG1B 4BEPA 4ANVA 3MYVA 2PZIA 4AEZC 1BLXB 4YNDA 3MA5A 1H0AA 1U3DA 3U9WA 3HXEA 3LEWA 1ELWA 4DJAA 2J4BA 3ASOE 3R9MA 3ZYMA 3E33A 4JEHA 3DPDA 4FULA 4HI9A 3SBTB 4F3VA 2CHXA 5LCWJ 3G2WA 1IKND 3DEOA 4IYPA 3MKQB 3S2AA 3CVLA 4G8LA 2DYSE 3PZ2A 4V3IA 5A23A 2KCLA 3CVPA 4DLQA 5FZQA 5ARFA 3RRUA 3FUEA 3LVQE 1HU3A 1HX8A 2MRIA 4CT4A 3ESKA 4LNBA 1IHBA 1Z3XA 2P9PG 3L54A 4HOTA 4WNFA 4BT8A 4DX7D 1O5MA 3BG0B 2PQRA 3TWWA 2DVWA 2LSVA 3AG2E 5BT1A 4Y6WA 1QNFA 5AQAA 2WXRA 3BUAA 3CSFA 4J8SA 4JHRA 3T9KA 3Q75A 3O4ZA 1BPOA 4UQZA 4B8CB 3FH7A 3APCA 5G04J 1HFAA 2P2CP 3KSQA 4U07A 3DSTA 4AOFA 2Y3AA 2DCPA 2JABA 3FDHA 2P9UG 1SA4A 4AXHA 3O48A 2XGOA 2I1JA 4C0EA 1TEZA 2AWIA 5G05C 4PH4B 4DRXE 2WXNA 3UTMA 3T5VA 1SA5A 3DEPA 4C48B 2IFUA 5D66A 4LNUD 2VQ2A 1N95A 2RG8A 2B0OE 2YNQA 5EN5D 4OAVB 4JVSA 4GA2A 2UY1B 1P5QA 4O1PA 5HRYA 4D10C 5G2NA 5ENQD 4AVXA 1X81A 3CQCB 3UPVA 2V4HC 3ZYQA 2E2EA 4YDWA 1QYMA 1K1BA 2EIME 4N3BA 3EHNA 1JWGA 3Q9NC 1TNYA 5G05J 1BI7B 3TL5A 1E8YA 2GGFA 4I1OB 3G2TA 4DX2A 4JW1A 3CVYA 2F8XK 2X6KA 2Y69E 4J0UA 2F8YA 1MZCA 1KPSB 5B3SE 3ASNE 1YCSB 3WXXA 3APFA 5AIJA 2A5UA 2L6JA 3CR3A 1INZA 3Q7AA 1Z3YA 3TG4A 4JL0A 4XEIG 5LFAA 4JA9A 2C2LA 3FU5A 2X6IA 3UQ3A 3CVWA 1K3ZD 2P9KG 4GMJA 3ULYA 1BU9A 3AG1E 4UI9C 4ACKA 5J90A 3RO2A 3B7SA 3B7RL 4UQXA 4I1AA 5BXOA 2LAIA 2M63A 4L23A 3FTWA 1TJFA 1N4SA 3DSSA 3RAUA 3D9IA 5LP0A 1E7UA 1Y8MA 3W9FA 3DXMG 4HRNA 3PEUB 1ELKA 4GA0A 2WXLA 5AAOA 3LYAA 1OT8A 3SBSA 2L9BA 3V31A 2XEVA 4I1MA 2P9NG 2RFMA 3CKBA 3IBEA 3QWPA 4GYYA 4I2ZA 3L9TA 4XZ4A 5BNWA 4MBGA 1X5BA 4L7TA 3VLDA 4N39A 4U0SA 3PDNA 4UQYA 5D2MC 3VTXA 4FHKA 3TXNA 4JB8P 4EZLA 2VTBA 3ABME 2FO7A 4CZ2D 3CVUA 4HRLA 2LXLA 3C5RA 1TN7A 5KNGA 3P1UA 3FUHA 1FT1A 4XI0A 2B6CA 2JEKA 1OCZE 4UUCA 3SFZA 5EYPF 4DPRA 4I2WA 3ZYKA 3L17A 3LJ3A 2CHWA 4XKCA 1N0RA 5ANLA 3UIOC 3FP3A 5KJKA 1MJ0A 3PZ4A 4WWOA 4YDOA 3J5PA 4MS6A 4M3OA 1EDUA 3UINC 4G1TA 5CCLA 1OWNA 4KVOA 1RZ4A 5ENPD 2JLBA 5HQ8A 3EHMA 2I2OA 4O1OA 5EYLA 3MZLB 3AS8A 5FIOA 1OWLA 3KSLA 1H6KA 5JHBA 3IHYA 3AAAC 5CBOA 2ZGGA 4J8YA 4YDYA 2LUHA 3MX3A 3UM1A 1FCHA 3PVLA 3CEQA 2GRMA 3DSXA 3DBSA 4KZCA 4HXIA 3U3WA 4I6GA 5EX3A 2QZAA 1H2UA 4XKBA 2KBXA 3ZN3A 2OEVA 2ZIRA 4PS8A 4YDEA 4KVMA 1NP7A 3LVRE 2XPIA 2GROB 3QAQA 1XNFA 3ZEFA 3TAXA 2KATA 3NQPA 3NZSA 1VDYA 2BEDA 4G11A 2H6IA 3ZKJA 5LOZA 2GRPB 1N52A 3P2BA 3EUVA 3D9KA 2F37A 3ZUVB 3ASDA 1OUVA 2I6HA 3CK9A 3RSEG 4GYOA 1S0PA 4O6FA 4U8HA 3GZ1A 5ENNA 4LSZE 3CHSA 3FU6A 1H19A 2YHEA 3SF4A 3NB2A 4G23A 4B0ZA 2CG2A 1KZPA 2DYRE 1EF1C 2XEHA 2PQNA 3T8KA 3I4GA 4GZ3A 4GPKA 4BT9A 1N94A 2WM9A 1QZ2A 4HNAD 3MV3B 1A17A 4LEUA 3L22A 4GTTA 3C3QA 1Q2ZA 3PS6A 1D8EA 4OAUC 1JCSA 3Q49B 4HI8A 5AN8A 3UI2A 2VGXA 5CEDB 3HVEA 5ENSD 4GCNA 3MV2B 4PS3A 2KZTA 4A1GA 3LY9A 3I3NA 2BF0X 4U0UA 3EHRA 4A3TA 3UX4A 4GPMA 4WWPA 4UWGA 2ETAA 3FUKA 3FWVA 1ZU2A 4CDNA 3AJIA 2WMOA 2HYZA 3QWWA 3UM3A 3RU0A 2C0LA 4FJZA 2RD0A 2R05A 3TWRA 2GW1A 3OAWA 5HKPA 4ME2A 3DPYA 4PDXA 3L6AA 3ZPJA 2IO2C 3C3OA 4TRQA 1FVHA 3JCKC 3S7BA 5AQ9A 4AY6A 3FEXA 3JQ0A 3RKVA 1G3NB 5DBKA 4OYSA 3FUFA 5T3RA 3EHQA 3ENEA 2FBNA 4DK5A 1OY3D 2WXOA 3T8MA 5AYWD 1XGWA 2VSOE 1YYHA 3S7DA 4BSXA 1UW4B 3AS5A 1NZNA 3MKQA 5BV1A 5G55A 2IOSA 4J8EA 3KAEA 3CHOA 4WNEA 4IULA 3FTUA 3ZU7B 4DI4A 1HE8A 4ILHB 3TWSA 3Q73A 3MCXA 1IYGA 3V2OA 3URZA 4AP2A 2KM4A 1QBQA 1UN8A 4JC8A 4WAFA 5CECB 4B8AA 1DCEA 4I9CA 3UXGA 5IY5E 3QKYA 4AY5A 2X6HA 3ABKE 1A5EA 1HG2A 3GYZA 3C72A 4F53A 3X2QE 2YHCA 3QARA 3OXGA 3C3RA 1UOHA 3ASFA 4IN3B 4EQFA 1U2VG 2FO1E 3AU5A 1JWFA 4GTSA 4YVQC 3EJNA 3G2VA 1DVPA 2FEZA 3S7JA 1JUQA 3E4BA 4RSYA 1KLXA 5LX8A 4HVBA 2GRNB 5EIBE 2H6FA 3Q7FA 3ZNGA 4CGVA 2UY1A 4Y6CA 4OVVA 4U0ZA 1MQSA 3IXEA 1DCQA 2Y1LE 3CV0A 1UJKA 2R02A 3NF1A 2LXMA 4N5QA 2FULA 4L9PA 1NI1A 3B95A 3Q15A 3APDA 4I9EA 4HORA 1AP7A 2BUGA 3ASHA 5CBNA 1Z5SC 3SHFA 2WXQA 1SW6A 3AU4A 3CVXA 3TGOA 1RW2A 1WY6A 5ENOD 5C2YA 1JPLA 4K03A 5CRUA 3HXBA 4DX5D 4YVOA 4TXPA 2DZOA 2R03A 3DSVA 4MLPA 1H6PA 2XRYA 3ESLA 3D9MA 4GZ5A 3JXIA 3FHEA 1HF8A 4GCOA 3UT4A 2H6GA 1S63A 4PUCA 1YMPA 2L6BA 3L82A 3CGHA 1HZ4A 3R7RA 2XGMA 1S70B 1QQEA 4UWHA 1ZB1A 4EHMA 1GW6A 3SZ7A 2WXHA 4ANWA 3L16A 4I43A 3ML8A 4NRHB 3AG3E 4G26A 4OVUA 2J08A 2J8SD 3PNTB 1N4RA 2IONA 3TWQA 4ACLA 4A55A 2WQHA 5BPPA 2UWJG 3AS4A 3FTSA 5BXUA 3CQGB 3ML9A 2XZDG 4A63B 4UI9J 3UUXA 5CERB 1O1SA 2VJ8A 1MYOA 4GB9A 1MX6A 4W9RA 3JUIA 3HIZA 2VSXE 2PNNA 3BU8A 3QNKA 4FJYA 2YQ8A 5EILA 4X8QA 4QFVA 1KT0A 2VGYA 2IY0C 3EU5A 1EPUA 4RG6A 3PRZA 5M72A 2VGEA 3ASGA 1O1TA 2X3MA 3QC1A 2L0IA 3B7UX 2VYIA 1TJCA 1V55E 3B13A 5FZRA 4K5CA 3SD5A 2WB2A 5FWQA 3RK6A 2DIWA 2V5FA 2LAHA 3TG5A 4XIFA 4GZDA 4Z68A 2R59A 2CG3A 2KCVA 4I6JA 2XCCA 5HS0A 3RRNB 4GMRA 2OOEA 4UI9K 4J8FA 4BTBA 4AV7A 3VTYA 1E8WA 2OV8A 1TNBA 2AW6A 4TXRA 3TWUA 5KBAA 4E85A 2ETBA 1MX4A 3AG4E 1OXJA 4HFGA 3UKUG 1WM5A 2XCBA 1SQMA 4RVBA 4FADA 3NOGD 3LXUX 4HQDA 2FF4A 4F1SA 1WDYA 3FFLA 3QJZA 3JYSA 2WPVA 3U4TA 3ZHEA 4HOUA 2A4ZA 3MGBA 3FUIA 2XEEA 1E7VA 3EIJA 3FU0A 2GRRB 4L2YA 3HXFA 4L1BA 2Y4TA 2EIJE 3FUDA 2WXKA 4FU3A 4C9BB 4CGWA 2OEWA 2LNIA 3TWXA 2EIKE 4KT6B 3PE3A 4BX8A 2EILE 4JPSA 4H7XA 4LNGA 2DZNA 3DSWA 2XZTG 3FTVA 5H7PA 4RG9A 2HM8A 1FT2A 2WQ6A 3EDTB 3KEAA 1V54E 1DC2A 1B89A 4DUIA 5KNHD 1IQRA 2LSUA 2Y0BG 4PS7A 4A3VA 1H6OA 1LD8A 3UM0A 1TN8A 4ABNA 1Z6TA 4KYOB 2P9LG 4DI3A 5T4YA 3RRMB 2C0MA 1O1RA 4GTPA 5J08A 5FINA 1K8KG 5B1AE 2GRQB 3PZ3A 4G2VA 3ISMC 3Q47B 5CMWA 2V5QC 3D9HA 3CK8A 2IQCA 5DIZA 3ZFWA 2I9CA 4HOQA 4BSZB 3TWTA 3EIQC 2XENA 5KJLA 4TUMA 3F6QA 2VSNA 3MEKA 2NC9A 2ZISA 4HOSA 4B94A 3PZDA 4DX1A 5FQ4A 2IOLA 1H2VC 2MHKA 4WWNA 2GRLA 5ITZF 3QDNA 1N11A 4FA6A 4JXTA 3ULEG 2AXZA 3TXMA 2QYUA 1JCQA 2BKGA 1TN6A 4K5BA 2IJGX 3PNLB 2XRZA 1ELRA 4BFRA 5EKQD 4B93B 3OTNA 5BW8C 3KS2A 3LDZA 3ONLA 4ATGA 4DLOA 2V4LA 3QB2A 4ANXA 3D9PA 2XPYA 3HG0D 4L2LA 4APFA 1SVXA 3D3MA 4N5CA 1FVFA 5CEAA 3S7FA 2VGXB 3HXCA 4TUUA 4ATZD 3V2XA 1E96B 5BUZA 2P9SG 4Q94A 2PL2A 4AJWA 1MHQA 1SZAA 5EDSA 3PH0C 3RIBA 4FLBA 3VLEA 3ZYLA 4GTVA 3LCAA 3HXDA 3SQVA 2J07A 3CHPA 4NACA 3CSTA 1K1AA 3J5QB 4CEMA 1D8DA 5LCWC 2QYJA 3HYMB 2J9QA 5AJLA 3FEYA 4B89A 1UG3A 5KJMA 5ENTD 4UWFA 4U96D 4XX5A 4EZJA 5C1DA 4LRZA 5E75A 4BY6A 4KMOA 2EQXA 3JQ1A 3SFXA 3Q4AB 3PUKA 3ZGQA 3R7QA 1HXIA 3DXKG 4JHKA 5FQ7A 3DSUA 4BETA 4CT0A 3FTZA 3CVNA 4NIKA 3HHMA 3E32A 1U3CA 5JA4D 3LS8A 2IU1A 5EX0A 4R7LA 2XS8A 3FY4A 3Q9UC 4U7EB 1HH8A 5G04C 3UIPC 1TR4A 4F6RD 1MX2A 3QK0A 1UJJA 3PEVB 1PC2A 3D9JA 1TNUA 4HS2A 4E6HA 1TNOA 5AQ7A 2OVFA 4HRMB 4GTMA 4AM9A 3VLFA 2HE0A 3FUMA 4JZYA 3C98A 4M7CA 5JMND 3Q79A 4J6IA 3CHMA 3UT8A 1HO8A 4GAAA 4ZHBA 1JCRA 1HS6A 2AXVA 2XGSA 4U8VD 2ILRA 4KZ0A 2EINE 4LCTA 3D9OA 3OXLA 2BKKB 4XE0A 2J09A 3SFYA 2V0PA 1N4QA 1PY1A 1IQUA 3E37A 3DRAA 2X6FA 3SGHA 3K9IA 2DBAA 5A6CA 4HLEA 2I1KA 2P9IG 5FQ8A 3CHQA 4HLLA 4U8YD 3V79K 4CYMD 3FH8A 2PM7A 3Q5MA 4NURA 3SI5A 2YINA 4GTOA 3ZXPA 4UWKA 4FLHA 3FH5A 4ANUA 1H2TC 3U66A 3RO3A 4I6EA 3IEGA 1NFIE 1TNZA 4TV3A 5KCMA 3ONKA 2HR2A 1E8XA 1IHGA 3CVQA 1WG0A 1OCCE 5A7DB 3ZW3A 2ZXWE 1OWOA 1OCRE 3ZVVA 4EZKA 3G2UA 4ZFHA 4FP7A 4JHJA 2V8SE 2J49A 4DX6D 3NAWA 1HG5A 2MYOA 4F1PA 1E8ZA 3WG7E 3SY2A 3SO8A 4C0MA 3NZUA 4EBAG 2F0YA 4BESA 5B1BE 3V30A 4CDMA 4G25A 3L13A 1W3BA 2P58C 2CFUA 2ETCA 1ZBPA 4QQIA 4N2SA 3N71A 4U63A 3RJVA 2WXPA 4ILIA 3U64A 3E34A 4LUNU 5AQBA 4I17A 2NXPA 5ANRA 5FJYA 2IO3C 3GZ2A 2KXPC 2J4DA 3CKCA 3TJPA 4AIFA 3KD7A 5CHEE 2AXUA 3G2SA 4WUYA 4O60A 3QWVA 3CVVA 1Y6IA 3E30A 4GTRA 2KC7A 1N4PA 5FTPA 1FPPA 4H7YA 2FI7A 1EYHA 5HI7A 4XI9A 1BD8A 1NA3A 3B7TA 4CCAA 4KXKB 4KBQA 5CMYA 2QFCA 4A1SA 3KEZA 2ZU6B 4IRUA 3ZRHA 5FQ6A 1KZOA 5JJ6A 4BERA 4EPZA 2R17C 2OCCE 3JUEA 4BX9A 1UN9A 2WQ7A 4GZ6A 1DNPA 4WNDA 2VTBB 3ZXSA 1WAO1 2IEJA 2XS1A 4BTAA 5FT9A 3CK7A 4JD2G 1LTXA 1L5JA 5FZSA 2ONDA 3ZIMA 4RQIA 2LO6A 3MKRA 1LD7A 4MKTA 5ENRD 4HBDA 3GW4A 2AJAA 4EECA 4EBAA 3UT7A 4MRUA 5D0OD 2RFAA 3NBNB 4HB5A 3FU3A 4N3AA 3UKRG 1BI8B 3DWLG 2WMNA 4FC8A 3NOCD 2WXIA 3L08A 4LERA 2WVIA 2Q7FA 4U95D 2A5EA 2QY7A 3IKOB 3IHVA 4N2QA 4P29A 2WXGA 1SZ9A 2IF4A 4G24A 2ZGDA 2R2LA 2HO1A 5KJNA 3UMVA 2X6JA 4U04A 5ARGA 3ZHEB 4Q69A 2RKKA 4GA1A 2QC9A 1NA0A 2WXJA 3EU9A 4BWRA 2L0TB 3GZSA 4URKA 4JA7A 3CLJA 4ILGA 5AJDA 1PAQA 3T5XA 1TYQG 4FHJA 3D9NA 3Q78A 3ABLE 5T8IA 4GTQA 3I5PA 4APOA 3I4RB 5CRVA 4GZCA 1OWPA 1YA0A 4CRWA 4J7WA 1N54A 3IV0A 5D0QD 4NQ0A 4WNGA 2AVPA 3FUNA 3TWVA 4CDRA 4TXQA 5KWDA 3LPZA 1E90A 2E0IA 1D9SA 4RLYA 3UM2A 3D9LA 2NSZA 3MJWA 4UWLA 4J8DA 5CCMA
chains in the Genus database with same CATH topology
3FHEA 1HF8A 4GCOA 3UT4A 5KJKA 3CIAA 4CT0A 2X38A 3FTZA 3CVNA 4WWOA 5JJ7A 3R9AB 4MS6A 4PUCA 5BV0A 3HHMA 1EDUA 3LY8A 2WXMA 4M3OA 1U3CA 3LS8A 4G1TA 2CHZA 4Q96A 2IU1A 5EX0A 4R7LA 3CGHA 1HZ4A 3R7RA 4N3CA 2XGMA 3FY4A 1QQEA 1HH8A 4UWHA 5G04C 5CCLA 1OWNA 4KVOA 4JEUA 3PUJA 1GW6A 3FUJA 3PE4A 3QK0A 1UJJA 3ULQA 3PEVB 3SZ7A 1PC2A 3D9JA 2JLBA 2WXHA 2XQ0A 1LF8A 4ANWA 2WXFA 5HQ8A 3OXFA 3EHMA 2I2OA 1KT1A 4HS2A 4E6HA 2KCKA 3MZLB 3AS8A 3L16A 4I43A 2OVFA 3BEEA 3ML8A 4AM9A 4NRHB 3VLFA 2BTDA 3HDXA 4G26A 4OVUA 2OVBA 2J08A 1OWLA 2VSYA 3QOUA 3PNTB 2IONA 4K0RA 3FUMA 4ACLA 2PM6A 4A55A 1H6KA 2WQHA 5BPPA 5JHBA 4JZYA 3C98A 2UWJG 3FULA 3IHYA 1OWMA 3AS4A 3HVEB 5JHAA 2KZTB 4J6IA 3FTSA 3CHMA 3MX3A 3CQGB 4F7AA 1FCHA 3PVLA 3UT8A 3CEQA 2GRMA 3ML9A 1HO8A 5AENA 3DBSA 4GAAA 4KZCA 4UI9J 3UUXA 1HS6A 2AXVA 2XGSA 4HXIA 4GU5A 3U3WA 2VJ8A 3LY7A 4I6GA 5EX3A 4GB9A 4W9RA 4GMLA 5JJTA 2ILRA 3FTYA 1H2UA 4XKBA 3JUIA 4KZ0A 2XHEA 3HIZA 3ZN3A 4LCTA 2XPZA 3D9OA 4PS8A 3LKUA 2VSXE 3OXLA 4KVMA 5E76A 3QNKA 4FJYA 4XE0A 2J09A 1NP7A 2V0PA 2MOWA 3LVRE 4GYWA 2R5SA 2YQ8A 2XPIA 3QAQA 1PY1A 1IQUA 1XNFA 4QFVA 3SNXA 2X6FA 3SGHA 3ZEFA 1KT0A 2VGYA 2CFZA 2DBAA 3K9IA 4HLEA 5A6CA 1EPUA 4RG6A 3PREA 3TAXA 2KATA 3PRZA 2I1KA 5M72A 3NQPA 5FQ8A 3CHRA 3NZSA 1VDYA 3ASGA 2Y4UA 3CHQA 4G11A 3FH8A 2PM7A 3FTXA 3Q5MA 4NURA 2X3MA 3QC1A 3SI5A 5LOZA 2YINA 2L0IA 3BG1B 1N52A 3B7UX 2VYIA 3P2BA 1TJCA 3B13A 3D9KA 4ANVA 3MYVA 5FZRA 2PZIA 3ASDA 4AEZC 1OUVA 2I6HA 4UWKA 3SD5A 4YNDA 2WB2A 4FLHA 3MA5A 5FWQA 1H0AA 3FH5A 1U3DA 3RK6A 3U9WA 2DIWA 3LEWA 3CK9A 4ANUA 1H2TC 1ELWA 2V5FA 3U66A 4DJAA 2LAHA 3TG5A 4XIFA 3RO3A 4GZDA 4I6EA 3IEGA 2J4BA 2R59A 2CG3A 3ZYMA 4GYOA 1S0PA 2KCVA 4I6JA 4JEHA 4O6FA 4U8HA 4TV3A 5KCMA 3DPDA 3GZ1A 2XCCA 4FULA 3ONKA 5ENNA 2HR2A 3CHSA 3SBTB 1E8XA 3RRNB 1IHGA 3CVQA 4F3VA 4UI9K 2OOEA 2CHXA 4J8FA 5A7DB 4BTBA 5LCWJ 4AV7A 3VTYA 3FU6A 3ZW3A 1H19A 2YHEA 3G2WA 1E8WA 1OWOA 3ZVVA 3SF4A 2OV8A 4G23A 3G2UA 4EZKA 4IYPA 3MKQB 2AW6A 2CG2A 3S2AA 4B0ZA 1EF1C 3CVLA 2PQNA 3I4GA 4FP7A 4JHJA 2V8SE 4GZ3A 4GPKA 2J49A 4BT9A 2WM9A 1QZ2A 4E85A 4V3IA 5A23A 4HFGA 3MV3B 1A17A 1HG5A 4LEUA 1E8ZA 3L22A 1WM5A 2XCBA 4C0MA 1SQMA 2KCLA 3CVPA 3NZUA 4EBAG 4DLQA 5FZQA 5ARFA 3RRUA 3FUEA 4RVBA 4FADA 3LVQE 1HU3A 1HX8A 2MRIA 3LXUX 4CDMA 3PS6A 3L13A 4G25A 4CT4A 3ESKA 2FF4A 1Z3XA 1W3BA 2P58C 4F1SA 2CFUA 1ZBPA 3L54A 3Q49B 4HOTA 4WNFA 4BT8A 4N2SA 2VGXA 3N71A 4U63A 3BG0B 3HVEA 2PQRA 4GCNA 3MV2B 4PS3A 3RJVA 2KZTA 2WXPA 3FFLA 3QJZA 4A1GA 2LSVA 3LY9A 3JYSA 5BT1A 2WPVA 3I3NA 4ILIA 4Y6WA 1QNFA 2BF0X 3U64A 4U0UA 4A3TA 2WXRA 3U4TA 3CSFA 3ZHEA 4HOUA 4LUNU 3UX4A 2A4ZA 3MGBA 4WWPA 4J8SA 3FUIA 4UWGA 4JHRA 4I17A 2NXPA 3FUKA 5ANRA 3FWVA 1E7VA 1ZU2A 3EIJA 3O4ZA 3FU0A 4CDNA 1BPOA 4UQZA 5FJYA 4L2YA 3FH7A 4B8CB 2WMOA 3APCA 3GZ2A 4L1BA 2Y4TA 5G04J 1HFAA 2J4DA 3CKCA 4U07A 3TJPA 2HYZA 3QWWA 4AIFA 3FUDA 2WXKA 4FU3A 3KD7A 4C9BB 4CGWA 3RU0A 2LNIA 5CHEE 4AOFA 2Y3AA 5EDSA 2AXUA 2DCPA 3FDHA 2C0LA 3G2SA 4WUYA 3QWVA 3CVVA 4FJZA 1Y6IA 4KT6B 2RD0A 3PE3A 4AXHA 3O48A 4BX8A 4JPSA 2KC7A 2XGOA 2I1JA 2GW1A 4H7XA 3OAWA 5FTPA 4ME2A 4C0EA 1TEZA 2AWIA 4H7YA 4PDXA 3L6AA 5G05C 2FI7A 4PH4B 3ZPJA 2WXNA 4TRQA 3FTVA 3T5VA 1EYHA 4RG9A 1FVHA 5HI7A 2HM8A 2WQ6A 3JCKC 4XI9A 2IFUA 3S7BA 3EDTB 4AY6A 1NA3A 2VQ2A 3FEXA 3JQ0A 2RG8A 2YNQA 1B89A 3RKVA 4JVSA 4GA2A 3B7TA 5DBKA 1IQRA 2LSUA 2UY1B 1P5QA 4PS7A 4CCAA 4OYSA 4KXKB 3FUFA 4KBQA 4A3VA 5CMYA 4D10C 5G2NA 5T3RA 4AVXA 2QFCA 3ENEA 3CQCB 3KEZA 4A1SA 4ABNA 2FBNA 2ZU6B 1Z6TA 4KYOB 4DK5A 4IRUA 2WXOA 3UPVA 3T8MA 3ZYQA 4DI3A 5T4YA 5AYWD 2E2EA 2C0MA 3RRMB 3ZRHA 1XGWA 2VSOE 5J08A 5FQ6A 3S7DA 4BSXA 4N3BA 5JJ6A 1UW4B 4EPZA 2R17C 3EHNA 4BX9A 1JWGA 3AS5A 1NZNA 1UN9A 2WQ7A 4GZ6A 1DNPA 4G2VA 3MKQA 4WNDA 5G05J 5G55A 5BV1A 3ZXSA 1WAO1 3Q47B 5CMWA 2IOSA 2VTBB 3TL5A 1E8YA 2GGFA 4I1OB 4J8EA 3CK8A 2IQCA 5DIZA 3ZFWA 3KAEA 3G2TA 3CHOA 4WNEA 2I9CA 4IULA 4HOQA 3FTUA 4BTAA 5FT9A 3CK7A 4DI4A 3EIQC 1HE8A 4ILHB 5KJLA 4JW1A 3CVYA 2X6KA 3MCXA 1IYGA 1L5JA 4J0UA 5FZSA 3URZA 2ONDA 2VSNA 2KM4A 3MEKA 4AP2A 1UN8A 2NC9A 3ZIMA 4HOSA 2LO6A 3MKRA 3WXXA 3APFA 4B94A 3PZDA 4MKTA 5AIJA 5FQ4A 2A5UA 2L6JA 3CR3A 2IOLA 4JC8A 3GW4A 1H2VC 4EECA 1INZA 2MHKA 4WAFA 1Z3YA 4WWNA 2GRLA 4B8AA 3TG4A 5FQ7A 4JL0A 4EBAA 3UT7A 4MRUA 3QDNA 5LFAA 5D0OD 4I9CA 4JA9A 4FA6A 2C2LA 3FU5A 2X6IA 3FU3A 3UQ3A 3CVWA 4JXTA 3QKYA 4N3AA 4AY5A 2X6HA 1HG2A 2AXZA 4GMJA 3TXMA 3GYZA 4UI9C 4ACKA 5J90A 3RO2A 4F53A 3B7SA 2WMNA 4FC8A 2YHCA 3B7RL 3QARA 2IJGX 4UQXA 2WXIA 3OXGA 3PNLB 4I1AA 1ELRA 2XRZA 4BFRA 2LAIA 2M63A 3L08A 5EKQD 3OTNA 4LERA 4L23A 5BW8C 2WVIA 3FTWA 3KS2A 3LDZA 2Q7FA 3ONLA 4ATGA 1TJFA 4DLOA 3ASFA 4IN3B 4EQFA 2V4LA 3QB2A 3AU5A 2QY7A 3IKOB 1JWFA 4ANXA 3D9IA 3D9PA 3IHVA 4N2QA 2XPYA 4YVQC 5LP0A 4L2LA 3EJNA 3G2VA 1DVPA 2FEZA 4APFA 3D3MA 3S7JA 4P29A 1E7UA 4N5CA 1Y8MA 2WXGA 1FVFA 1JUQA 1SZ9A 3PEUB 1ELKA 3E4BA 2IF4A 4G24A 4GA0A 3S7FA 4RSYA 1KLXA 2VGXB 2WXLA 5LX8A 4HVBA 4TUUA 1E96B 2HO1A 5KJNA 5BUZA 3LYAA 3SBSA 2X6JA 4U04A 3UMVA 5ARGA 4Q94A 2L9BA 3ZHEB 4CGVA 2XEVA 4Q69A 2UY1A 4GA1A 4I1MA 3CKBA 1NA0A 2WXJA 4Y6CA 4BWRA 2PL2A 2L0TB 4OVVA 4AJWA 1MHQA 3GZSA 3IBEA 4U0ZA 4JA7A 4URKA 1SZAA 3CLJA 3PH0C 4ILGA 5AJDA 1MQSA 1PAQA 3QWPA 3RIBA 3T5XA 4FLBA 3VLEA 4GYYA 4FHJA 4I2ZA 3ZYLA 3CV0A 3LCAA 3D9NA 1UJKA 4XZ4A 5BNWA 2J07A 1X5BA 3CHPA 3NF1A 2FULA 4L7TA 3VLDA 5T8IA 4NACA 3CSTA 4N39A 3I5PA 4U0SA 3PDNA 4UQYA 3Q15A 3APDA 4APOA 3I4RB 3VTXA 4GZCA 4I9EA 1OWPA 4FHKA 4HORA 4CEMA 2BUGA 1YA0A 3TXNA 3ASHA 5LCWC 4EZLA 2VTBA 4CRWA 2FO7A 1N54A 3IV0A 3SHFA 2WXQA 2J9QA 3HYMB 5AJLA 3CVUA 3AU4A 3FEYA 4B89A 1UG3A 3CVXA 3TGOA 3P1UA 5KJMA 5D0QD 4UWFA 4NQ0A 4WNGA 1WY6A 3FUHA 2AVPA 3FUNA 4XX5A 4EZJA 4CDRA 4XI0A 5C1DA 4LRZA 2JEKA 5E75A 5C2YA 1JPLA 3LPZA 4BY6A 1E90A 4K03A 2E0IA 4KMOA 2EQXA 3SFZA 4DPRA 3JQ1A 3D9LA 2NSZA 3MJWA 3Q4AB 3PUKA 3ZGQA 4UWLA 4I2WA 4J8DA 4YVOA 3ZYKA 3L17A 3LJ3A 3R7QA 1HXIA 2CHWA 4MLPA 4XKCA 4JHKA 5ANLA 2XRYA 3ESLA 3D9MA 4GZ5A 5CCMA 3FP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GCO A;  5KJK A;  3CVN A;  5JJ7 A;  3R9A B;  3LY8 A;  4G1T A;  5EX0 A;  1HZ4 A;  4N3C A;  2XGM A;  1QQE A;  1HH8 A;  5G04 C;  5CCL A;  3PE4 A;  3ULQ A;  3SZ7 A;  1PC2 A;  2JLB A;  5HQ8 A;  3OXF A;  1KT1 A;  2KCK A;  3AS8 A;  3BEE A;  4AM9 A;  4NRH B;  4G26 A;  2VSY A;  3QOU A;  2WQH A;  2UWJ G;  3AS4 A;  1FCH A;  3CEQ A;  4UI9 J;  3UUX A;  2XGS A;  3U3W A;  3LY7 A;  5EX3 A;  4W9R A;  5JJT A;  3ZN3 A;  3LKU A;  3OXL A;  4GYW A;  2R5S A;  2YQ8 A;  2XPI A;  1XNF A;  1KT0 A;  2VGY A;  3K9I A;  2DBA A;  5A6C A;  4RG6 A;  3TAX A;  2KAT A;  5M72 A;  3ASG A;  2Y4U A;  3Q5M A;  2VYI A;  1TJC A;  5FZR A;  2PZI A;  3ASD A;  1OUV A;  2I6H A;  4YND A;  3MA5 A;  3CK9 A;  1ELW A;  2V5F A;  3TG5 A;  4XIF A;  3RO3 A;  3IEG A;  4GYO A;  2KCV A;  4O6F A;  3GZ1 A;  2XCC A;  2HR2 A;  1IHG A;  3CVQ A;  4F3V A;  4UI9 K;  2OOE A;  4BTB A;  4J8F A;  5A7D B;  5LCW J;  3VTY A;  3SF4 A;  4G23 A;  3CVL A;  2PQN A;  4GZ3 A;  4GPK A;  4BT9 A;  1QZ2 A;  3MV3 B;  1A17 A;  4LEU A;  1WM5 A;  2XCB A;  2KCL A;  3CVP A;  5FZQ A;  5ARF A;  4G25 A;  3ESK A;  2FF4 A;  1W3B A;  2P58 C;  1ZBP A;  3Q49 B;  4HOT A;  4WNF A;  4BT8 A;  4N2S A;  2VGX A;  3N71 A;  2PQR A;  4GCN A;  3MV2 B;  3RJV A;  3FFL A;  2LSV A;  3LY9 A;  3JYS A;  5BT1 A;  2WPV A;  4Y6W A;  4U0U A;  3U4T A;  3ZHE A;  4HOU A;  4JHR A;  4I17 A;  3FWV A;  1ZU2 A;  4UQZ A;  5FJY A;  3GZ2 A;  2Y4T A;  5G04 J;  3CKC A;  4U07 A;  2HYZ A;  3QWW A;  4AIF A;  3KD7 A;  4CGW A;  3RU0 A;  2LNI A;  5CHE E;  2C0L A;  4WUY A;  3QWV A;  3PE3 A;  3O48 A;  2KC7 A;  2XGO A;  2GW1 A;  4H7X A;  5FTP A;  4ME2 A;  4H7Y A;  5G05 C;  2FI7 A;  3ZPJ A;  4RG9 A;  5HI7 A;  4XI9 A;  2IFU A;  3S7B A;  3EDT B;  4AY6 A;  1NA3 A;  2VQ2 A;  1B89 A;  3RKV A;  4GA2 A;  5DBK A;  2LSU A;  2UY1 B;  1P5Q A;  4KXK B;  4KBQ A;  2QFC A;  4A1S A;  4ABN A;  2FBN A;  4KYO B;  3UPV A;  5AYW D;  2E2E A;  2C0M A;  3S7D A;  4N3B A;  5JJ6 A;  3AS5 A;  1NZN A;  4GZ6 A;  4G2V A;  4WND A;  5G05 J;  1WAO 1;  3Q47 B;  4J8E A;  3CK8 A;  5DIZ A;  3ZFW A;  3KAE A;  4WNE A;  4HOQ A;  4BTA A;  5FT9 A;  3CK7 A;  5KJL A;  1IYG A;  4J0U A;  5FZS A;  3URZ A;  2OND A;  2VSN A;  3MEK A;  2NC9 A;  4HOS A;  3MKR A;  3WXX A;  4B94 A;  2L6J A;  3GW4 A;  2MHK A;  3TG4 A;  4JL0 A;  3QDN A;  5D0O D;  4I9C A;  4JA9 A;  2C2L A;  3UQ3 A;  3QKY A;  4N3A A;  4AY5 A;  3GYZ A;  4UI9 C;  3RO2 A;  2YHC A;  4UQX A;  3OXG A;  4I1A A;  1ELR A;  5EKQ D;  5BW8 C;  3KS2 A;  2Q7F A;  3ASF A;  4IN3 B;  4EQF A;  4N2Q A;  4YVQ C;  2FEZ A;  3S7J A;  4N5C A;  1Y8M A;  3E4B A;  2IF4 A;  4G24 A;  4GA0 A;  3S7F A;  1KLX A;  2VGX B;  1E96 B;  2HO1 A;  5KJN A;  3LYA A;  4U04 A;  5ARG A;  3ZHE B;  4CGV A;  2XEV A;  2UY1 A;  4GA1 A;  3CKB A;  1NA0 A;  4Y6C A;  4BWR A;  2PL2 A;  4U0Z A;  4JA7 A;  3RIB A;  3QWP A;  4GYY A;  4I2Z A;  3CV0 A;  3LCA A;  5BNW A;  3NF1 A;  4N39 A;  4U0S A;  3PDN A;  4UQY A;  3Q15 A;  4APO A;  3VTX A;  4I9E A;  4HOR A;  2BUG A;  1YA0 A;  3ASH A;  5LCW C;  2FO7 A;  3HYM B;  2J9Q A;  3TGO A;  5KJM A;  5D0Q D;  4NQ0 A;  4WNG A;  2AVP A;  4CDR A;  4XI0 A;  5C1D A;  3LPZ A;  3Q4A B;  3ZGQ A;  4YVO A;  4I2W A;  4J8D A;  1HXI A;  4GZ5 A;  5CCM A;  3FP3 A; 
#chains in the Genus database with same CATH topology
 5AAR A;  3CIA A;  2X38 A;  1OCO E;  5JJ7 A;  3R9A B;  5BV0 A;  3LY8 A;  2WXM A;  3HRA A;  2CHZ A;  1NL4 A;  4Q96 A;  3JXJ A;  4N3C A;  4G8K A;  4JEU A;  3PUJ A;  3FUJ A;  3PE4 A;  3ULQ A;  2XQ0 A;  1LF8 A;  2WXF A;  3OXF A;  1KT1 A;  1N9A A;  2KCK A;  3BEE A;  1IXV A;  2BTD A;  3HDX A;  3W9G A;  2OVB A;  3PZ1 A;  1S64 A;  2VSY A;  3QOU A;  4K0R A;  2PM6 A;  4LG6 A;  4K5A B;  3FUL A;  1OWM A;  3HVE B;  1AWC B;  5JHA A;  2KZT B;  2NYJ A;  3LJN A;  4F7A A;  5EID A;  5AEN A;  3BQO A;  3B7B A;  4GU5 A;  3LY7 A;  1N0Q A;  4GML A;  5JJT A;  3FTY A;  2XHE A;  2XPZ A;  3LKU A;  5E76 A;  4GYW A;  2MOW A;  2R5S A;  3SNX A;  2CFZ A;  3PRE A;  3CHR A;  2Y4U A;  2DWZ A;  2H6H A;  3FTX A;  3BG1 B;  4BEP A;  4ANV A;  3MYV A;  2PZI A;  4AEZ C;  1BLX B;  4YND A;  3MA5 A;  1H0A A;  1U3D A;  3U9W A;  3HXE A;  3LEW A;  1ELW A;  4DJA A;  2J4B A;  3ASO E;  3R9M A;  3ZYM A;  3E33 A;  4JEH A;  3DPD A;  4FUL A;  4HI9 A;  3SBT B;  4F3V A;  2CHX A;  5LCW J;  3G2W A;  1IKN D;  3DEO A;  4IYP A;  3MKQ B;  3S2A A;  3CVL A;  4G8L A;  2DYS E;  3PZ2 A;  4V3I A;  5A23 A;  2KCL A;  3CVP A;  4DLQ A;  5FZQ A;  5ARF A;  3RRU A;  3FUE A;  3LVQ E;  1HU3 A;  1HX8 A;  2MRI A;  4CT4 A;  3ESK A;  4LNB A;  1IHB A;  1Z3X A;  2P9P G;  3L54 A;  4HOT A;  4WNF A;  4BT8 A;  4DX7 D;  1O5M A;  3BG0 B;  2PQR A;  3TWW A;  2DVW A;  2LSV A;  3AG2 E;  5BT1 A;  4Y6W A;  1QNF A;  5AQA A;  2WXR A;  3BUA A;  3CSF A;  4J8S A;  4JHR A;  3T9K A;  3Q75 A;  3O4Z A;  1BPO A;  4UQZ A;  4B8C B;  3FH7 A;  3APC A;  5G04 J;  1HFA A;  2P2C P;  3KSQ A;  4U07 A;  3DST A;  4AOF A;  2Y3A A;  2DCP A;  2JAB A;  3FDH A;  2P9U G;  1SA4 A;  4AXH A;  3O48 A;  2XGO A;  2I1J A;  4C0E A;  1TEZ A;  2AWI A;  5G05 C;  4PH4 B;  4DRX E;  2WXN A;  3UTM A;  3T5V A;  1SA5 A;  3DEP A;  4C48 B;  2IFU A;  5D66 A;  4LNU D;  2VQ2 A;  1N95 A;  2RG8 A;  2B0O E;  2YNQ A;  5EN5 D;  4OAV B;  4JVS A;  4GA2 A;  2UY1 B;  1P5Q A;  4O1P A;  5HRY A;  4D10 C;  5G2N A;  5ENQ D;  4AVX A;  1X81 A;  3CQC B;  3UPV A;  2V4H C;  3ZYQ A;  2E2E A;  4YDW A;  1QYM A;  1K1B A;  2EIM E;  4N3B A;  3EHN A;  1JWG A;  3Q9N C;  1TNY A;  5G05 J;  1BI7 B;  3TL5 A;  1E8Y A;  2GGF A;  4I1O B;  3G2T A;  4DX2 A;  4JW1 A;  3CVY A;  2F8X K;  2X6K A;  2Y69 E;  4J0U A;  2F8Y A;  1MZC A;  1KPS B;  5B3S E;  3ASN E;  1YCS B;  3WXX A;  3APF A;  5AIJ A;  2A5U A;  2L6J A;  3CR3 A;  1INZ A;  3Q7A A;  1Z3Y A;  3TG4 A;  4JL0 A;  4XEI G;  5LFA A;  4JA9 A;  2C2L A;  3FU5 A;  2X6I A;  3UQ3 A;  3CVW A;  1K3Z D;  2P9K G;  4GMJ A;  3ULY A;  1BU9 A;  3AG1 E;  4UI9 C;  4ACK A;  5J90 A;  3RO2 A;  3B7S A;  3B7R L;  4UQX A;  4I1A A;  5BXO A;  2LAI A;  2M63 A;  4L23 A;  3FTW A;  1TJF A;  1N4S A;  3DSS A;  3RAU A;  3D9I A;  5LP0 A;  1E7U A;  1Y8M A;  3W9F A;  3DXM G;  4HRN A;  3PEU B;  1ELK A;  4GA0 A;  2WXL A;  5AAO A;  3LYA A;  1OT8 A;  3SBS A;  2L9B A;  3V31 A;  2XEV A;  4I1M A;  2P9N G;  2RFM A;  3CKB A;  3IBE A;  3QWP A;  4GYY A;  4I2Z A;  3L9T A;  4XZ4 A;  5BNW A;  4MBG A;  1X5B A;  4L7T A;  3VLD A;  4N39 A;  4U0S A;  3PDN A;  4UQY A;  5D2M C;  3VTX A;  4FHK A;  3TXN A;  4JB8 P;  4EZL A;  2VTB A;  3ABM E;  2FO7 A;  4CZ2 D;  3CVU A;  4HRL A;  2LXL A;  3C5R A;  1TN7 A;  5KNG A;  3P1U A;  3FUH A;  1FT1 A;  4XI0 A;  2B6C A;  2JEK A;  1OCZ E;  4UUC A;  3SFZ A;  5EYP F;  4DPR A;  4I2W A;  3ZYK A;  3L17 A;  3LJ3 A;  2CHW A;  4XKC A;  1N0R A;  5ANL A;  3UIO C;  3FP3 A;  5KJK A;  1MJ0 A;  3PZ4 A;  4WWO A;  4YDO A;  3J5P A;  4MS6 A;  4M3O A;  1EDU A;  3UIN C;  4G1T A;  5CCL A;  1OWN A;  4KVO A;  1RZ4 A;  5ENP D;  2JLB A;  5HQ8 A;  3EHM A;  2I2O A;  4O1O A;  5EYL A;  3MZL B;  3AS8 A;  5FIO A;  1OWL A;  3KSL A;  1H6K A;  5JHB A;  3IHY A;  3AAA C;  5CBO A;  2ZGG A;  4J8Y A;  4YDY A;  2LUH A;  3MX3 A;  3UM1 A;  1FCH A;  3PVL A;  3CEQ A;  2GRM A;  3DSX A;  3DBS A;  4KZC A;  4HXI A;  3U3W A;  4I6G A;  5EX3 A;  2QZA A;  1H2U A;  4XKB A;  2KBX A;  3ZN3 A;  2OEV A;  2ZIR A;  4PS8 A;  4YDE A;  4KVM A;  1NP7 A;  3LVR E;  2XPI A;  2GRO B;  3QAQ A;  1XNF A;  3ZEF A;  3TAX A;  2KAT A;  3NQP A;  3NZS A;  1VDY A;  2BED A;  4G11 A;  2H6I A;  3ZKJ A;  5LOZ A;  2GRP B;  1N52 A;  3P2B A;  3EUV A;  3D9K A;  2F37 A;  3ZUV B;  3ASD A;  1OUV A;  2I6H A;  3CK9 A;  3RSE G;  4GYO A;  1S0P A;  4O6F A;  4U8H A;  3GZ1 A;  5ENN A;  4LSZ E;  3CHS A;  3FU6 A;  1H19 A;  2YHE A;  3SF4 A;  3NB2 A;  4G23 A;  4B0Z A;  2CG2 A;  1KZP A;  2DYR E;  1EF1 C;  2XEH A;  2PQN A;  3T8K A;  3I4G A;  4GZ3 A;  4GPK A;  4BT9 A;  1N94 A;  2WM9 A;  1QZ2 A;  4HNA D;  3MV3 B;  1A17 A;  4LEU A;  3L22 A;  4GTT A;  3C3Q A;  1Q2Z A;  3PS6 A;  1D8E A;  4OAU C;  1JCS A;  3Q49 B;  4HI8 A;  5AN8 A;  3UI2 A;  2VGX A;  5CED B;  3HVE A;  5ENS D;  4GCN A;  3MV2 B;  4PS3 A;  2KZT A;  4A1G A;  3LY9 A;  3I3N A;  2BF0 X;  4U0U A;  3EHR A;  4A3T A;  3UX4 A;  4GPM A;  4WWP A;  4UWG A;  2ETA A;  3FUK A;  3FWV A;  1ZU2 A;  4CDN A;  3AJI A;  2WMO A;  2HYZ A;  3QWW A;  3UM3 A;  3RU0 A;  2C0L A;  4FJZ A;  2RD0 A;  2R05 A;  3TWR A;  2GW1 A;  3OAW A;  5HKP A;  4ME2 A;  3DPY A;  4PDX A;  3L6A A;  3ZPJ A;  2IO2 C;  3C3O A;  4TRQ A;  1FVH A;  3JCK C;  3S7B A;  5AQ9 A;  4AY6 A;  3FEX A;  3JQ0 A;  3RKV A;  1G3N B;  5DBK A;  4OYS A;  3FUF A;  5T3R A;  3EHQ A;  3ENE A;  2FBN A;  4DK5 A;  1OY3 D;  2WXO A;  3T8M A;  5AYW D;  1XGW A;  2VSO E;  1YYH A;  3S7D A;  4BSX A;  1UW4 B;  3AS5 A;  1NZN A;  3MKQ A;  5BV1 A;  5G55 A;  2IOS A;  4J8E A;  3KAE A;  3CHO A;  4WNE A;  4IUL A;  3FTU A;  3ZU7 B;  4DI4 A;  1HE8 A;  4ILH B;  3TWS A;  3Q73 A;  3MCX A;  1IYG A;  3V2O A;  3URZ A;  4AP2 A;  2KM4 A;  1QBQ A;  1UN8 A;  4JC8 A;  4WAF A;  5CEC B;  4B8A A;  1DCE A;  4I9C A;  3UXG A;  5IY5 E;  3QKY A;  4AY5 A;  2X6H A;  3ABK E;  1A5E A;  1HG2 A;  3GYZ A;  3C72 A;  4F53 A;  3X2Q E;  2YHC A;  3QAR A;  3OXG A;  3C3R A;  1UOH A;  3ASF A;  4IN3 B;  4EQF A;  1U2V G;  2FO1 E;  3AU5 A;  1JWF A;  4GTS A;  4YVQ C;  3EJN A;  3G2V A;  1DVP A;  2FEZ A;  3S7J A;  1JUQ A;  3E4B A;  4RSY A;  1KLX A;  5LX8 A;  4HVB A;  2GRN B;  5EIB E;  2H6F A;  3Q7F A;  3ZNG A;  4CGV A;  2UY1 A;  4Y6C A;  4OVV A;  4U0Z A;  1MQS A;  3IXE A;  1DCQ A;  2Y1L E;  3CV0 A;  1UJK A;  2R02 A;  3NF1 A;  2LXM A;  4N5Q A;  2FUL A;  4L9P A;  1NI1 A;  3B95 A;  3Q15 A;  3APD A;  4I9E A;  4HOR A;  1AP7 A;  2BUG A;  3ASH A;  5CBN A;  1Z5S C;  3SHF A;  2WXQ A;  1SW6 A;  3AU4 A;  3CVX A;  3TGO A;  1RW2 A;  1WY6 A;  5ENO D;  5C2Y A;  1JPL A;  4K03 A;  5CRU A;  3HXB A;  4DX5 D;  4YVO A;  4TXP A;  2DZO A;  2R03 A;  3DSV A;  4MLP A;  1H6P A;  2XRY A;  3ESL A;  3D9M A;  4GZ5 A;  3JXI A;  3FHE A;  1HF8 A;  4GCO A;  3UT4 A;  2H6G A;  1S63 A;  4PUC A;  1YMP A;  2L6B A;  3L82 A;  3CGH A;  1HZ4 A;  3R7R A;  2XGM A;  1S70 B;  1QQE A;  4UWH A;  1ZB1 A;  4EHM A;  1GW6 A;  3SZ7 A;  2WXH A;  4ANW A;  3L16 A;  4I43 A;  3ML8 A;  4NRH B;  3AG3 E;  4G26 A;  4OVU A;  2J08 A;  2J8S D;  3PNT B;  1N4R A;  2ION A;  3TWQ A;  4ACL A;  4A55 A;  2WQH A;  5BPP A;  2UWJ G;  3AS4 A;  3FTS A;  5BXU A;  3CQG B;  3ML9 A;  2XZD G;  4A63 B;  4UI9 J;  3UUX A;  5CER B;  1O1S A;  2VJ8 A;  1MYO A;  4GB9 A;  1MX6 A;  4W9R A;  3JUI A;  3HIZ A;  2VSX E;  2PNN A;  3BU8 A;  3QNK A;  4FJY A;  2YQ8 A;  5EIL A;  4X8Q A;  4QFV A;  1KT0 A;  2VGY A;  2IY0 C;  3EU5 A;  1EPU A;  4RG6 A;  3PRZ A;  5M72 A;  2VGE A;  3ASG A;  1O1T A;  2X3M A;  3QC1 A;  2L0I A;  3B7U X;  2VYI A;  1TJC A;  1V55 E;  3B13 A;  5FZR A;  4K5C A;  3SD5 A;  2WB2 A;  5FWQ A;  3RK6 A;  2DIW A;  2V5F A;  2LAH A;  3TG5 A;  4XIF A;  4GZD A;  4Z68 A;  2R59 A;  2CG3 A;  2KCV A;  4I6J A;  2XCC A;  5HS0 A;  3RRN B;  4GMR A;  2OOE A;  4UI9 K;  4J8F A;  4BTB A;  4AV7 A;  3VTY A;  1E8W A;  2OV8 A;  1TNB A;  2AW6 A;  4TXR A;  3TWU A;  5KBA A;  4E85 A;  2ETB A;  1MX4 A;  3AG4 E;  1OXJ A;  4HFG A;  3UKU G;  1WM5 A;  2XCB A;  1SQM A;  4RVB A;  4FAD A;  3NOG D;  3LXU X;  4HQD A;  2FF4 A;  4F1S A;  1WDY A;  3FFL A;  3QJZ A;  3JYS A;  2WPV A;  3U4T A;  3ZHE A;  4HOU A;  2A4Z A;  3MGB A;  3FUI A;  2XEE A;  1E7V A;  3EIJ A;  3FU0 A;  2GRR B;  4L2Y A;  3HXF A;  4L1B A;  2Y4T A;  2EIJ E;  3FUD A;  2WXK A;  4FU3 A;  4C9B B;  4CGW A;  2OEW A;  2LNI A;  3TWX A;  2EIK E;  4KT6 B;  3PE3 A;  4BX8 A;  2EIL E;  4JPS A;  4H7X A;  4LNG A;  2DZN A;  3DSW A;  2XZT G;  3FTV A;  5H7P A;  4RG9 A;  2HM8 A;  1FT2 A;  2WQ6 A;  3EDT B;  3KEA A;  1V54 E;  1DC2 A;  1B89 A;  4DUI A;  5KNH D;  1IQR A;  2LSU A;  2Y0B G;  4PS7 A;  4A3V A;  1H6O A;  1LD8 A;  3UM0 A;  1TN8 A;  4ABN A;  1Z6T A;  4KYO B;  2P9L G;  4DI3 A;  5T4Y A;  3RRM B;  2C0M A;  1O1R A;  4GTP A;  5J08 A;  5FIN A;  1K8K G;  5B1A E;  2GRQ B;  3PZ3 A;  4G2V A;  3ISM C;  3Q47 B;  5CMW A;  2V5Q C;  3D9H A;  3CK8 A;  2IQC A;  5DIZ A;  3ZFW A;  2I9C A;  4HOQ A;  4BSZ B;  3TWT A;  3EIQ C;  2XEN A;  5KJL A;  4TUM A;  3F6Q A;  2VSN A;  3MEK A;  2NC9 A;  2ZIS A;  4HOS A;  4B94 A;  3PZD A;  4DX1 A;  5FQ4 A;  2IOL A;  1H2V C;  2MHK A;  4WWN A;  2GRL A;  5ITZ F;  3QDN A;  1N11 A;  4FA6 A;  4JXT A;  3ULE G;  2AXZ A;  3TXM A;  2QYU A;  1JCQ A;  2BKG A;  1TN6 A;  4K5B A;  2IJG X;  3PNL B;  2XRZ A;  1ELR A;  4BFR A;  5EKQ D;  4B93 B;  3OTN A;  5BW8 C;  3KS2 A;  3LDZ A;  3ONL A;  4ATG A;  4DLO A;  2V4L A;  3QB2 A;  4ANX A;  3D9P A;  2XPY A;  3HG0 D;  4L2L A;  4APF A;  1SVX A;  3D3M A;  4N5C A;  1FVF A;  5CEA A;  3S7F A;  2VGX B;  3HXC A;  4TUU A;  4ATZ D;  3V2X A;  1E96 B;  5BUZ A;  2P9S G;  4Q94 A;  2PL2 A;  4AJW A;  1MHQ A;  1SZA A;  5EDS A;  3PH0 C;  3RIB A;  4FLB A;  3VLE A;  3ZYL A;  4GTV A;  3LCA A;  3HXD A;  3SQV A;  2J07 A;  3CHP A;  4NAC A;  3CST A;  1K1A A;  3J5Q B;  4CEM A;  1D8D A;  5LCW C;  2QYJ A;  3HYM B;  2J9Q A;  5AJL A;  3FEY A;  4B89 A;  1UG3 A;  5KJM A;  5ENT D;  4UWF A;  4U96 D;  4XX5 A;  4EZJ A;  5C1D A;  4LRZ A;  5E75 A;  4BY6 A;  4KMO A;  2EQX A;  3JQ1 A;  3SFX A;  3Q4A B;  3PUK A;  3ZGQ A;  3R7Q A;  1HXI A;  3DXK G;  4JHK A;  5FQ7 A;  3DSU A;  4BET A;  4CT0 A;  3FTZ A;  3CVN A;  4NIK A;  3HHM A;  3E32 A;  1U3C A;  5JA4 D;  3LS8 A;  2IU1 A;  5EX0 A;  4R7L A;  2XS8 A;  3FY4 A;  3Q9U C;  4U7E B;  1HH8 A;  5G04 C;  3UIP C;  1TR4 A;  4F6R D;  1MX2 A;  3QK0 A;  1UJJ A;  3PEV B;  1PC2 A;  3D9J A;  1TNU A;  4HS2 A;  4E6H A;  1TNO A;  5AQ7 A;  2OVF A;  4HRM B;  4GTM A;  4AM9 A;  3VLF A;  2HE0 A;  3FUM A;  4JZY A;  3C98 A;  4M7C A;  5JMN D;  3Q79 A;  4J6I A;  3CHM A;  3UT8 A;  1HO8 A;  4GAA A;  4ZHB A;  1JCR A;  1HS6 A;  2AXV A;  2XGS A;  4U8V D;  2ILR A;  4KZ0 A;  2EIN E;  4LCT A;  3D9O A;  3OXL A;  2BKK B;  4XE0 A;  2J09 A;  3SFY A;  2V0P A;  1N4Q A;  1PY1 A;  1IQU A;  3E37 A;  3DRA A;  2X6F A;  3SGH A;  3K9I A;  2DBA A;  5A6C A;  4HLE A;  2I1K A;  2P9I G;  5FQ8 A;  3CHQ A;  4HLL A;  4U8Y D;  3V79 K;  4CYM D;  3FH8 A;  2PM7 A;  3Q5M A;  4NUR A;  3SI5 A;  2YIN A;  4GTO A;  3ZXP A;  4UWK A;  4FLH A;  3FH5 A;  4ANU A;  1H2T C;  3U66 A;  3RO3 A;  4I6E A;  3IEG A;  1NFI E;  1TNZ A;  4TV3 A;  5KCM A;  3ONK A;  2HR2 A;  1E8X A;  1IHG A;  3CVQ A;  1WG0 A;  1OCC E;  5A7D B;  3ZW3 A;  2ZXW E;  1OWO A;  1OCR E;  3ZVV A;  4EZK A;  3G2U A;  4ZFH A;  4FP7 A;  4JHJ A;  2V8S E;  2J49 A;  4DX6 D;  3NAW A;  1HG5 A;  2MYO A;  4F1P A;  1E8Z A;  3WG7 E;  3SY2 A;  3SO8 A;  4C0M A;  3NZU A;  4EBA G;  2F0Y A;  4BES A;  5B1B E;  3V30 A;  4CDM A;  4G25 A;  3L13 A;  1W3B A;  2P58 C;  2CFU A;  2ETC A;  1ZBP A;  4QQI A;  4N2S A;  3N71 A;  4U63 A;  3RJV A;  2WXP A;  4ILI A;  3U64 A;  3E34 A;  4LUN U;  5AQB A;  4I17 A;  2NXP A;  5ANR A;  5FJY A;  2IO3 C;  3GZ2 A;  2KXP C;  2J4D A;  3CKC A;  3TJP A;  4AIF A;  3KD7 A;  5CHE E;  2AXU A;  3G2S A;  4WUY A;  4O60 A;  3QWV A;  3CVV A;  1Y6I A;  3E30 A;  4GTR A;  2KC7 A;  1N4P A;  5FTP A;  1FPP A;  4H7Y A;  2FI7 A;  1EYH A;  5HI7 A;  4XI9 A;  1BD8 A;  1NA3 A;  3B7T A;  4CCA A;  4KXK B;  4KBQ A;  5CMY A;  2QFC A;  4A1S A;  3KEZ A;  2ZU6 B;  4IRU A;  3ZRH A;  5FQ6 A;  1KZO A;  5JJ6 A;  4BER A;  4EPZ A;  2R17 C;  2OCC E;  3JUE A;  4BX9 A;  1UN9 A;  2WQ7 A;  4GZ6 A;  1DNP A;  4WND A;  2VTB B;  3ZXS A;  1WAO 1;  2IEJ A;  2XS1 A;  4BTA A;  5FT9 A;  3CK7 A;  4JD2 G;  1LTX A;  1L5J A;  5FZS A;  2OND A;  3ZIM A;  4RQI A;  2LO6 A;  3MKR A;  1LD7 A;  4MKT A;  5ENR D;  4HBD A;  3GW4 A;  2AJA A;  4EEC A;  4EBA A;  3UT7 A;  4MRU A;  5D0O D;  2RFA A;  3NBN B;  4HB5 A;  3FU3 A;  4N3A A;  3UKR G;  1BI8 B;  3DWL G;  2WMN A;  4FC8 A;  3NOC D;  2WXI A;  3L08 A;  4LER A;  2WVI A;  2Q7F A;  4U95 D;  2A5E A;  2QY7 A;  3IKO B;  3IHV A;  4N2Q A;  4P29 A;  2WXG A;  1SZ9 A;  2IF4 A;  4G24 A;  2ZGD A;  2R2L A;  2HO1 A;  5KJN A;  3UMV A;  2X6J A;  4U04 A;  5ARG A;  3ZHE B;  4Q69 A;  2RKK A;  4GA1 A;  2QC9 A;  1NA0 A;  2WXJ A;  3EU9 A;  4BWR A;  2L0T B;  3GZS A;  4URK A;  4JA7 A;  3CLJ A;  4ILG A;  5AJD A;  1PAQ A;  3T5X A;  1TYQ G;  4FHJ A;  3D9N A;  3Q78 A;  3ABL E;  5T8I A;  4GTQ A;  3I5P A;  4APO A;  3I4R B;  5CRV A;  4GZC A;  1OWP A;  1YA0 A;  4CRW A;  4J7W A;  1N54 A;  3IV0 A;  5D0Q D;  4NQ0 A;  4WNG A;  2AVP A;  3FUN A;  3TWV A;  4CDR A;  4TXQ A;  5KWD A;  3LPZ A;  1E90 A;  2E0I A;  1D9S A;  4RLY A;  3UM2 A;  3D9L A;  2NSZ A;  3MJW A;  4UWL A;  4J8D A;  5CCM A; 
#chains in the Genus database with same CATH homology
 3FHE A;  1HF8 A;  4GCO A;  3UT4 A;  5KJK A;  3CIA A;  4CT0 A;  2X38 A;  3FTZ A;  3CVN A;  4WWO A;  5JJ7 A;  3R9A B;  4MS6 A;  4PUC A;  5BV0 A;  3HHM A;  1EDU A;  3LY8 A;  2WXM A;  4M3O A;  1U3C A;  3LS8 A;  4G1T A;  2CHZ A;  4Q96 A;  2IU1 A;  5EX0 A;  4R7L A;  3CGH A;  1HZ4 A;  3R7R A;  4N3C A;  2XGM A;  3FY4 A;  1QQE A;  1HH8 A;  4UWH A;  5G04 C;  5CCL A;  1OWN A;  4KVO A;  4JEU A;  3PUJ A;  1GW6 A;  3FUJ A;  3PE4 A;  3QK0 A;  1UJJ A;  3ULQ A;  3PEV B;  3SZ7 A;  1PC2 A;  3D9J A;  2JLB A;  2WXH A;  2XQ0 A;  1LF8 A;  4ANW A;  2WXF A;  5HQ8 A;  3OXF A;  3EHM A;  2I2O A;  1KT1 A;  4HS2 A;  4E6H A;  2KCK A;  3MZL B;  3AS8 A;  3L16 A;  4I43 A;  2OVF A;  3BEE A;  3ML8 A;  4AM9 A;  4NRH B;  3VLF A;  2BTD A;  3HDX A;  4G26 A;  4OVU A;  2OVB A;  2J08 A;  1OWL A;  2VSY A;  3QOU A;  3PNT B;  2ION A;  4K0R A;  3FUM A;  4ACL A;  2PM6 A;  4A55 A;  1H6K A;  2WQH A;  5BPP A;  5JHB A;  4JZY A;  3C98 A;  2UWJ G;  3FUL A;  3IHY A;  1OWM A;  3AS4 A;  3HVE B;  5JHA A;  2KZT B;  4J6I A;  3FTS A;  3CHM A;  3MX3 A;  3CQG B;  4F7A A;  1FCH A;  3PVL A;  3UT8 A;  3CEQ A;  2GRM A;  3ML9 A;  1HO8 A;  5AEN A;  3DBS A;  4GAA A;  4KZC A;  4UI9 J;  3UUX A;  1HS6 A;  2AXV A;  2XGS A;  4HXI A;  4GU5 A;  3U3W A;  2VJ8 A;  3LY7 A;  4I6G A;  5EX3 A;  4GB9 A;  4W9R A;  4GML A;  5JJT A;  2ILR A;  3FTY A;  1H2U A;  4XKB A;  3JUI A;  4KZ0 A;  2XHE A;  3HIZ A;  3ZN3 A;  4LCT A;  2XPZ A;  3D9O A;  4PS8 A;  3LKU A;  2VSX E;  3OXL A;  4KVM A;  5E76 A;  3QNK A;  4FJY A;  4XE0 A;  2J09 A;  1NP7 A;  2V0P A;  2MOW A;  3LVR E;  4GYW A;  2R5S A;  2YQ8 A;  2XPI A;  3QAQ A;  1PY1 A;  1IQU A;  1XNF A;  4QFV A;  3SNX A;  2X6F A;  3SGH A;  3ZEF A;  1KT0 A;  2VGY A;  2CFZ A;  2DBA A;  3K9I A;  4HLE A;  5A6C A;  1EPU A;  4RG6 A;  3PRE A;  3TAX A;  2KAT A;  3PRZ A;  2I1K A;  5M72 A;  3NQP A;  5FQ8 A;  3CHR A;  3NZS A;  1VDY A;  3ASG A;  2Y4U A;  3CHQ A;  4G11 A;  3FH8 A;  2PM7 A;  3FTX A;  3Q5M A;  4NUR A;  2X3M A;  3QC1 A;  3SI5 A;  5LOZ A;  2YIN A;  2L0I A;  3BG1 B;  1N52 A;  3B7U X;  2VYI A;  3P2B A;  1TJC A;  3B13 A;  3D9K A;  4ANV A;  3MYV A;  5FZR A;  2PZI A;  3ASD A;  4AEZ C;  1OUV A;  2I6H A;  4UWK A;  3SD5 A;  4YND A;  2WB2 A;  4FLH A;  3MA5 A;  5FWQ A;  1H0A A;  3FH5 A;  1U3D A;  3RK6 A;  3U9W A;  2DIW A;  3LEW A;  3CK9 A;  4ANU A;  1H2T C;  1ELW A;  2V5F A;  3U66 A;  4DJA A;  2LAH A;  3TG5 A;  4XIF A;  3RO3 A;  4GZD A;  4I6E A;  3IEG A;  2J4B A;  2R59 A;  2CG3 A;  3ZYM A;  4GYO A;  1S0P A;  2KCV A;  4I6J A;  4JEH A;  4O6F A;  4U8H A;  4TV3 A;  5KCM A;  3DPD A;  3GZ1 A;  2XCC A;  4FUL A;  3ONK A;  5ENN A;  2HR2 A;  3CHS A;  3SBT B;  1E8X A;  3RRN B;  1IHG A;  3CVQ A;  4F3V A;  4UI9 K;  2OOE A;  2CHX A;  4J8F A;  5A7D B;  4BTB A;  5LCW J;  4AV7 A;  3VTY A;  3FU6 A;  3ZW3 A;  1H19 A;  2YHE A;  3G2W A;  1E8W A;  1OWO A;  3ZVV A;  3SF4 A;  2OV8 A;  4G23 A;  3G2U A;  4EZK A;  4IYP A;  3MKQ B;  2AW6 A;  2CG2 A;  3S2A A;  4B0Z A;  1EF1 C;  3CVL A;  2PQN A;  3I4G A;  4FP7 A;  4JHJ A;  2V8S E;  4GZ3 A;  4GPK A;  2J49 A;  4BT9 A;  2WM9 A;  1QZ2 A;  4E85 A;  4V3I A;  5A23 A;  4HFG A;  3MV3 B;  1A17 A;  1HG5 A;  4LEU A;  1E8Z A;  3L22 A;  1WM5 A;  2XCB A;  4C0M A;  1SQM A;  2KCL A;  3CVP A;  3NZU A;  4EBA G;  4DLQ A;  5FZQ A;  5ARF A;  3RRU A;  3FUE A;  4RVB A;  4FAD A;  3LVQ E;  1HU3 A;  1HX8 A;  2MRI A;  3LXU X;  4CDM A;  3PS6 A;  3L13 A;  4G25 A;  4CT4 A;  3ESK A;  2FF4 A;  1Z3X A;  1W3B A;  2P58 C;  4F1S A;  2CFU A;  1ZBP A;  3L54 A;  3Q49 B;  4HOT A;  4WNF A;  4BT8 A;  4N2S A;  2VGX A;  3N71 A;  4U63 A;  3BG0 B;  3HVE A;  2PQR A;  4GCN A;  3MV2 B;  4PS3 A;  3RJV A;  2KZT A;  2WXP A;  3FFL A;  3QJZ A;  4A1G A;  2LSV A;  3LY9 A;  3JYS A;  5BT1 A;  2WPV A;  3I3N A;  4ILI A;  4Y6W A;  1QNF A;  2BF0 X;  3U64 A;  4U0U A;  4A3T A;  2WXR A;  3U4T A;  3CSF A;  3ZHE A;  4HOU A;  4LUN U;  3UX4 A;  2A4Z A;  3MGB A;  4WWP A;  4J8S A;  3FUI A;  4UWG A;  4JHR A;  4I17 A;  2NXP A;  3FUK A;  5ANR A;  3FWV A;  1E7V A;  1ZU2 A;  3EIJ A;  3O4Z A;  3FU0 A;  4CDN A;  1BPO A;  4UQZ A;  5FJY A;  4L2Y A;  3FH7 A;  4B8C B;  2WMO A;  3APC A;  3GZ2 A;  4L1B A;  2Y4T A;  5G04 J;  1HFA A;  2J4D A;  3CKC A;  4U07 A;  3TJP A;  2HYZ A;  3QWW A;  4AIF A;  3FUD A;  2WXK A;  4FU3 A;  3KD7 A;  4C9B B;  4CGW A;  3RU0 A;  2LNI A;  5CHE E;  4AOF A;  2Y3A A;  5EDS A;  2AXU A;  2DCP A;  3FDH A;  2C0L A;  3G2S A;  4WUY A;  3QWV A;  3CVV A;  4FJZ A;  1Y6I A;  4KT6 B;  2RD0 A;  3PE3 A;  4AXH A;  3O48 A;  4BX8 A;  4JPS A;  2KC7 A;  2XGO A;  2I1J A;  2GW1 A;  4H7X A;  3OAW A;  5FTP A;  4ME2 A;  4C0E A;  1TEZ A;  2AWI A;  4H7Y A;  4PDX A;  3L6A A;  5G05 C;  2FI7 A;  4PH4 B;  3ZPJ A;  2WXN A;  4TRQ A;  3FTV A;  3T5V A;  1EYH A;  4RG9 A;  1FVH A;  5HI7 A;  2HM8 A;  2WQ6 A;  3JCK C;  4XI9 A;  2IFU A;  3S7B A;  3EDT B;  4AY6 A;  1NA3 A;  2VQ2 A;  3FEX A;  3JQ0 A;  2RG8 A;  2YNQ A;  1B89 A;  3RKV A;  4JVS A;  4GA2 A;  3B7T A;  5DBK A;  1IQR A;  2LSU A;  2UY1 B;  1P5Q A;  4PS7 A;  4CCA A;  4OYS A;  4KXK B;  3FUF A;  4KBQ A;  4A3V A;  5CMY A;  4D10 C;  5G2N A;  5T3R A;  4AVX A;  2QFC A;  3ENE A;  3CQC B;  3KEZ A;  4A1S A;  4ABN A;  2FBN A;  2ZU6 B;  1Z6T A;  4KYO B;  4DK5 A;  4IRU A;  2WXO A;  3UPV A;  3T8M A;  3ZYQ A;  4DI3 A;  5T4Y A;  5AYW D;  2E2E A;  2C0M A;  3RRM B;  3ZRH A;  1XGW A;  2VSO E;  5J08 A;  5FQ6 A;  3S7D A;  4BSX A;  4N3B A;  5JJ6 A;  1UW4 B;  4EPZ A;  2R17 C;  3EHN A;  4BX9 A;  1JWG A;  3AS5 A;  1NZN A;  1UN9 A;  2WQ7 A;  4GZ6 A;  1DNP A;  4G2V A;  3MKQ A;  4WND A;  5G05 J;  5G55 A;  5BV1 A;  3ZXS A;  1WAO 1;  3Q47 B;  5CMW A;  2IOS A;  2VTB B;  3TL5 A;  1E8Y A;  2GGF A;  4I1O B;  4J8E A;  3CK8 A;  2IQC A;  5DIZ A;  3ZFW A;  3KAE A;  3G2T A;  3CHO A;  4WNE A;  2I9C A;  4IUL A;  4HOQ A;  3FTU A;  4BTA A;  5FT9 A;  3CK7 A;  4DI4 A;  3EIQ C;  1HE8 A;  4ILH B;  5KJL A;  4JW1 A;  3CVY A;  2X6K A;  3MCX A;  1IYG A;  1L5J A;  4J0U A;  5FZS A;  3URZ A;  2OND A;  2VSN A;  2KM4 A;  3MEK A;  4AP2 A;  1UN8 A;  2NC9 A;  3ZIM A;  4HOS A;  2LO6 A;  3MKR A;  3WXX A;  3APF A;  4B94 A;  3PZD A;  4MKT A;  5AIJ A;  5FQ4 A;  2A5U A;  2L6J A;  3CR3 A;  2IOL A;  4JC8 A;  3GW4 A;  1H2V C;  4EEC A;  1INZ A;  2MHK A;  4WAF A;  1Z3Y A;  4WWN A;  2GRL A;  4B8A A;  3TG4 A;  5FQ7 A;  4JL0 A;  4EBA A;  3UT7 A;  4MRU A;  3QDN A;  5LFA A;  5D0O D;  4I9C A;  4JA9 A;  4FA6 A;  2C2L A;  3FU5 A;  2X6I A;  3FU3 A;  3UQ3 A;  3CVW A;  4JXT A;  3QKY A;  4N3A A;  4AY5 A;  2X6H A;  1HG2 A;  2AXZ A;  4GMJ A;  3TXM A;  3GYZ A;  4UI9 C;  4ACK A;  5J90 A;  3RO2 A;  4F53 A;  3B7S A;  2WMN A;  4FC8 A;  2YHC A;  3B7R L;  3QAR A;  2IJG X;  4UQX A;  2WXI A;  3OXG A;  3PNL B;  4I1A A;  1ELR A;  2XRZ A;  4BFR A;  2LAI A;  2M63 A;  3L08 A;  5EKQ D;  3OTN A;  4LER A;  4L23 A;  5BW8 C;  2WVI A;  3FTW A;  3KS2 A;  3LDZ A;  2Q7F A;  3ONL A;  4ATG A;  1TJF A;  4DLO A;  3ASF A;  4IN3 B;  4EQF A;  2V4L A;  3QB2 A;  3AU5 A;  2QY7 A;  3IKO B;  1JWF A;  4ANX A;  3D9I A;  3D9P A;  3IHV A;  4N2Q A;  2XPY A;  4YVQ C;  5LP0 A;  4L2L A;  3EJN A;  3G2V A;  1DVP A;  2FEZ A;  4APF A;  3D3M A;  3S7J A;  4P29 A;  1E7U A;  4N5C A;  1Y8M A;  2WXG A;  1FVF A;  1JUQ A;  1SZ9 A;  3PEU B;  1ELK A;  3E4B A;  2IF4 A;  4G24 A;  4GA0 A;  3S7F A;  4RSY A;  1KLX A;  2VGX B;  2WXL A;  5LX8 A;  4HVB A;  4TUU A;  1E96 B;  2HO1 A;  5KJN A;  5BUZ A;  3LYA A;  3SBS A;  2X6J A;  4U04 A;  3UMV A;  5ARG A;  4Q94 A;  2L9B A;  3ZHE B;  4CGV A;  2XEV A;  4Q69 A;  2UY1 A;  4GA1 A;  4I1M A;  3CKB A;  1NA0 A;  2WXJ A;  4Y6C A;  4BWR A;  2PL2 A;  2L0T B;  4OVV A;  4AJW A;  1MHQ A;  3GZS A;  3IBE A;  4U0Z A;  4JA7 A;  4URK A;  1SZA A;  3CLJ A;  3PH0 C;  4ILG A;  5AJD A;  1MQS A;  1PAQ A;  3QWP A;  3RIB A;  3T5X A;  4FLB A;  3VLE A;  4GYY A;  4FHJ A;  4I2Z A;  3ZYL A;  3CV0 A;  3LCA A;  3D9N A;  1UJK A;  4XZ4 A;  5BNW A;  2J07 A;  1X5B A;  3CHP A;  3NF1 A;  2FUL A;  4L7T A;  3VLD A;  5T8I A;  4NAC A;  3CST A;  4N39 A;  3I5P A;  4U0S A;  3PDN A;  4UQY A;  3Q15 A;  3APD A;  4APO A;  3I4R B;  3VTX A;  4GZC A;  4I9E A;  1OWP A;  4FHK A;  4HOR A;  4CEM A;  2BUG A;  1YA0 A;  3TXN A;  3ASH A;  5LCW C;  4EZL A;  2VTB A;  4CRW A;  2FO7 A;  1N54 A;  3IV0 A;  3SHF A;  2WXQ A;  2J9Q A;  3HYM B;  5AJL A;  3CVU A;  3AU4 A;  3FEY A;  4B89 A;  1UG3 A;  3CVX A;  3TGO A;  3P1U A;  5KJM A;  5D0Q D;  4UWF A;  4NQ0 A;  4WNG A;  1WY6 A;  3FUH A;  2AVP A;  3FUN A;  4XX5 A;  4EZJ A;  4CDR A;  4XI0 A;  5C1D A;  4LRZ A;  2JEK A;  5E75 A;  5C2Y A;  1JPL A;  3LPZ A;  4BY6 A;  1E90 A;  4K03 A;  2E0I A;  4KMO A;  2EQX A;  3SFZ A;  4DPR A;  3JQ1 A;  3D9L A;  2NSZ A;  3MJW A;  3Q4A B;  3PUK A;  3ZGQ A;  4UWL A;  4I2W A;  4J8D A;  4YVO A;  3ZYK A;  3L17 A;  3LJ3 A;  3R7Q A;  1HXI A;  2CHW A;  4MLP A;  4XKC A;  4JHK A;  5ANL A;  2XRY A;  3ESL A;  3D9M A;  4GZ5 A;  5CCM A;  3FP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...