3ULQA

Crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
376
structure length
376
Chain Sequence
SSSSIGEKINEWYMYIRRFSIPDAEYLRREIKQELDQMEEDQDLHLYYSLMEFRHNLMLEYLEPLEKMRIEEQPRLSDLLLEIDKKQARLTGLLEYYFNFFRGMYELDQREYLSAIKFFKKAESKLIFVKDRIEKAEFFFKMSESYYYMKQTYFSMDYARQAYEIYKEHEAYNIRLLQCHSLFATNFLDLKQYEDAISHFQKAYSMAEAEKQPQLMGRTLYNIGLCKNSQSQYEDAIPYFKRAIAVFEESNILPSLPQAYFLITQIHYKLGKIDKAHEYHSKGMAYSQKAGDVIYLSEFEFLKSLYLSGPDEEAIQGFFDFLESKMLYADLEDFAIDVAKYYHERKNFQKASAYFLKVEQVRQLIQGGVSLYEIEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of response regulator inhibition by a bacterial anti-activator protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/transcription activator
total genus 160
structure length 376
sequence length 376
ec nomenclature ec 3.1.-.-:
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
A PF18801 RapH_N response regulator aspartate phosphatase H, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ulqA00
3JYSA 4GA1A 2FEZA 2FF4A 5ARGA 3PE4A 1NA3A 2IF4A 5A7DB 3Q5MA 4JA9A 4G2VA 4ABNA 5FJYA 3TAXA 3CK7A 4B94A 2PQNA 2Q7FA 4CGVA 2E2EA 1QQEA 3K9IA 4JL0A 4WNDA 4IN3B 1XNFA 4GZ6A 3LY7A 4G24A 3TG5A 4N2QA 2KCVA 4N3AA 4GYOA 1FCHA 3LYAA 2VQ2A 4KXKB 2UY1A 1KT0A 3RIBA 4YVQC 4EQFA 4ME2A 3CV0A 4G26A 2LSVA 3CK9A 4GA2A 3NF1A 5KJKA 2XGOA 4G1TA 5DBKA 2PZIA 2KCLA 4W9RA 3S7DA 2QFCA 3CVNA 2UWJG 5G05C 3PDNA 2PQRA 3CKBA 4GZ5A 2JLBA 3MKRA 3WXXA 4BTBA 1ELWA 5JJ6A 4N39A 3OXFA 3BEEA 5FT9A 2XPIA 5A6CA 3R9AB 2VSNA 4G25A 4HOQA 3S7JA 2WPVA 2C0MA 2XGMA 2VSYA 1ZBPA 4NQ0A 2KC7A 1PC2A 2WQHA 1HH8A 2FBNA 2KATA 2LSUA 4AM9A 3O48A 2PL2A 4GZ3A 4BWRA 3GZ1A 2VYIA 4GPKA 1YA0A 3MV2B 4J8FA 3RKVA 5ARFA 5KJLA 3ZHEA 4BT9A 5EX3A 1IYGA 3AS4A 3ZGQA 4H7YA 3CVLA 5FZQA 3OXGA 5KJNA 4NRHB 4BT8A 4I17A 4I9CA 4N3BA 3VTXA 3MV3B 3UPVA 2HYZA 2L6JA 4YNDA 5G05J 3VTYA 3N71A 4UI9J 3RO3A 3LY8A 3ZHEB 5C1DA 2FO7A 2Y4TA 3FFLA 4J8EA 3MEKA 5FZSA 4GYWA 5HI7A 2C0LA 3MA5A 3QOUA 3ASGA 3ZPJA 3GYZA 3LCAA 4U0SA 4U04A 4WNGA 4A1SA 3KD7A 3Q49B 4HOSA 2DBAA 4UQYA 4U0UA 4Y6CA 3CVQA 2MHKA 4UI9C 3UUXA 5DIZA 2HR2A 2NC9A 1WM5A 5BW8C 5AYWD 5JJ7A 5HQ8A 4YVOA 3CEQA 1P5QA 1QZ2A 1B89A 4WUYA 5EX0A 1A17A 4CDRA 2XCBA 4JHRA 3ASDA 3FP3A 3QWWA 3QWVA 3ULQA 4I2ZA 5BT1A 4KBQA 3ESKA 2LNIA 3AS8A 3ASFA 2C2LA 2BUGA 2R5SA 4RG9A 3Q15A 3CK8A 3U4TA 5LCWJ 2OOEA 4HORA 1NZNA 4N5CA 5D0QD 1KT1A 1KLXA 3ZFWA 3ASHA 4HOTA 3Q47B 3UQ3A 2I6HA 1NA0A 2YQ8A 3LPZA 4WNFA 3FWVA 3EDTB 1Y8MA 3RU0A 3RJVA 4J8DA 4UQXA 5CCMA 2VGYA 4XI9A 2FI7A 3OXLA 3QDNA 3S7BA 4U0ZA 2ONDA 1IHGA 4GYYA 3CVPA 5M72A 5LCWC 4WNEA 3KS2A 2IFUA 4GA0A 3GZ2A 4XIFA 4XI0A 4Y6WA 3S7FA 3QWPA 4F3VA 5D0OD 3URZA 5KJMA 3LKUA 3QKYA 3RO2A 3TG4A 1TJCA 2J9QA 1W3BA 3AS5A 4H7XA 4N2SA 2Y4UA 2KCKA 2XCCA 4I1AA 2XEVA 3CKCA 4LEUA 4JA7A 3SZ7A 2HO1A 4CGWA 2YHCA 5FTPA 2P58C 5G04J 4GCOA 4UQZA 2UY1B 3KAEA 3U3WA 1ZU2A 1E96B 1ELRA 4N3CA 4I9EA 3SF4A 4AY5A 4BTAA 1WAO1 2GW1A 3TGOA 2VGXA 4AY6A 1HXIA 5FZRA 4APOA 1OUVA 2XGSA 5CCLA 4RG6A 3E4BA 1HZ4A 4AIFA 3PE3A 3HYMB 4O6FA 4I2WA 3Q4AB 4KYOB 3ZN3A 5CHEE 5EKQD 2AVPA 2VGXB 5BNWA 5G04C 4HOUA 4G23A 5JJTA 2V5FA 3LY9A 3GW4A 3IEGA 4UI9K 4U07A 4J0UA 4GCNA
chains in the Genus database with same CATH superfamily
3FTUA 4GA1A 2AXUA 3PEUB 2FEZA 2FF4A 3UKUG 4CT4A 1OWLA 2WXLA 1NA3A 4A55A 1HG5A 1E90A 3CR3A 4ABNA 3FTXA 4Q94A 3CK7A 2XS1A 5FQ8A 4B94A 2PQNA 3Q7FA 2Q7FA 1N4SA 4ZFHA 4FHKA 1IQRA 1K3ZD 3DSVA 1QQEA 4IRUA 5ANLA 1NL4A 3K9IA 3OTNA 2OCCE 3AAAC 4EHMA 3ZUVB 3LY7A 2P2CP 4G24A 2QYJA 4N2QA 3NAWA 4HRMB 1TNOA 3UXGA 3HRAA 3ABKE 4KXKB 3AG1E 2I9CA 3ML9A 3V2XA 4G26A 4CCAA 2IO3C 1TNBA 4GA2A 3EHNA 3NBNB 4DX1A 5CBNA 4URKA 4GZCA 3I4GA 3ZRHA 3MX3A 4ANWA 4G1TA 4HQDA 2PZIA 3TWVA 4GZDA 2QFCA 3R7RA 2UWJG 1SW6A 4BY6A 4KVMA 1TYQG 5G05C 2ZU6B 2BF0X 1MQSA 3P2BA 4GZ5A 2JLBA 5AENA 2KBXA 5T3RA 4X8QA 5J08A 4HVBA 1OT8A 4HXIA 4BTBA 1G3NB 4G8KA 5ENTD 1ELWA 3MKQA 1TEZA 4GB9A 5JJ6A 4N39A 3FUFA 1N0QA 5FT9A 3CVVA 2XPIA 4FULA 1LD8A 3B95A 4OYSA 1BI8B 1E8XA 2OVFA 1TNYA 3UM0A 5FINA 1ZBPA 4GTTA 1Z5SC 4PS8A 3T8MA 2KC7A 1PC2A 4BSXA 2LSUA 4PS3A 2PL2A 4GZ3A 4LNBA 3GZ1A 4GPKA 4J8FA 4E6HA 3L54A 3RKVA 5KJLA 3RRMB 3ZHEA 4BT9A 1IYGA 4UWHA 4MRUA 3UMVA 1U3DA 4P29A 3T9KA 2IOLA 3OXGA 4E85A 4I6EA 4JEUA 2R17C 2V8SE 3FUMA 3MV3B 2L6JA 3Q9NC 3DEPA 5KCMA 1U2VG 3VTYA 3N71A 4UI9J 2EIJE 1OCRE 2GRNB 3LY8A 5C1DA 3JXIA 2EIME 4BETA 3NB2A 2ZGDA 3MEKA 2DZNA 3FDHA 3HVEB 1BPOA 4ANVA 2C0LA 3CSTA 3HXCA 2XZDG 4OVUA 1E8ZA 4FU3A 3FTYA 2DBAA 4ZHBA 4U0UA 4Y6CA 5FWQA 1UW4B 4GPMA 3LS8A 4UWFA 2RFAA 3L17A 2H6HA 3LXUX 4KVOA 3ASOE 5HKPA 5HQ8A 4YVOA 2M63A 1QZ2A 5CEAA 4WUYA 2GRMA 1S70B 3CIAA 4JEHA 4JHRA 3FP3A 3ZW3A 3QWWA 3QWVA 4OAUC 3ULQA 4I2ZA 3CHMA 4F6RD 5BV1A 2LNIA 5KNHD 1PY1A 3ASFA 2Y69E 2BUGA 4N5QA 5FQ7A 1EPUA 5LCWJ 4FHJA 4XE0A 3UM1A 1KLXA 1S64A 2BTDA 3LEWA 4JHKA 4PUCA 1SZAA 1X81A 4J7WA 2L0TB 3UQ3A 1NA0A 2GRQB 3APCA 4PS7A 2YQ8A 2BKKB 4PDXA 4F1PA 3LPZA 3FWVA 2RFMA 3FTZA 3L22A 4DLOA 3RU0A 2GRLA 1N4QA 5G55A 3PEVB 2DIWA 4I1MA 3RRNB 4RLYA 5EIBE 3TXMA 4UUCA 3QNKA 1Y6IA 4QFVA 2WQ7A 4U63A 3VLFA 5FQ6A 1EYHA 3EU9A 3KEAA 5ANRA 5CBOA 3L13A 2CHXA 3S7FA 5FIOA 4AXHA 1KZPA 3QJZA 3UM2A 3ZXPA 2GROB 4GTSA 2LAHA 1OXJA 4G11A 5EYLA 1TJCA 2J9QA 5BXUA 1W3BA 3AS5A 2Y4UA 3CKCA 1E7VA 1SVXA 4JA7A 3SZ7A 2KZTB 3SI5A 1NP7A 2AJAA 1N54A 4GCOA 3AG2E 2UY1B 1OCZE 3JCKC 2XENA 5EILA 5AQ7A 1U3CA 3PUJA 4I43A 2VGXA 2HM8A 2B0OE 1OUVA 4AEZC 4RG6A 1HFAA 3E4BA 5LP0A 4AIFA 3RRUA 2Y0BG 4MBGA 5T4YA 3T5VA 4U07A 4HS2A 4FC8A 3Q78A 2A4ZA 1HG2A 5AQBA 3UX4A 4FLBA 5ARGA 1QBQA 1N4RA 3D9JA 4DI3A 3DRAA 2YNQA 3PH0C 3HIZA 4L23A 4JA9A 4DPRA 3EHMA 2ZIRA 4DX7D 4CGVA 1JCQA 3L6AA 3NQPA 4K03A 3B7RL 3MZLB 3ZYLA 4C0MA 2X6JA 1K1AA 1UG3A 2KCVA 4N3AA 1SA5A 1KPSB 1FCHA 3ABLE 1UJKA 3LVQE 3AG3E 4NACA 4ANUA 4YVQC 2VSOE 3EJNA 1YMPA 4YDEA 3FH5A 3ZKJA 2LSVA 1N95A 2BEDA 1MJ0A 5KJKA 2XGOA 3E33A 1WDYA 5DBKA 4EZKA 2WXMA 2KCLA 3FU6A 4W9RA 2H6GA 1KZOA 2H6FA 4U8HA 3HXBA 1V55E 3UIOC 3PDNA 4BSZB 3PZ3A 3ABME 4RQIA 3TWWA 2R59A 5CEDB 3EUVA 1DCQA 4U95D 5LOZA 2EQXA 3OXFA 3KSLA 2A5UA 2DYRE 3P1UA 4V3IA 5J90A 3DPDA 2VJ8A 4G25A 2QC9A 1LTXA 2C0MA 1JWGA 2XEHA 5AARA 3SD5A 2XGMA 1L5JA 2X6IA 3ULEG 3TXNA 2IEJA 5CRVA 4JXTA 3Q9UC 2FBNA 4AM9A 1QYMA 1MYOA 3ZIMA 1YYHA 1TJFA 3D9NA 4YDWA 1TNZA 4ACLA 5AQAA 1FT1A 4JC8A 5EX3A 3AS4A 3IXEA 2QY7A 2XPYA 3HVEA 5AN8A 2PM6A 4LERA 5A23A 3C98A 4GTOA 3ZNGA 3CHOA 4YNDA 3EHRA 4TXQA 3FUNA 5EDSA 2LXMA 2XEEA 3JXJA 5ENRD 3D9PA 1AP7A 1JCRA 3UINC 3SQVA 1LF8A 3L16A 4GYWA 2XS8A 5AJDA 5B3SE 3NZUA 3AG4E 2EILE 4U04A 3PUKA 4A1SA 4CDMA 3SNXA 3LVRE 4MS6A 4UQYA 4XX5A 1O5MA 2XRYA 4KMOA 2WMOA 1H6PA 3D9LA 2I2OA 2CG2A 3FH8A 4CRWA 2HR2A 1WM5A 5BW8C 5KWDA 3MGBA 4LNGA 3CEQA 1NFIE 2IU1A 5EX0A 4EZJA 1D8DA 3DPYA 4GU5A 3F6QA 1RW2A 2MYOA 3ASDA 2I1KA 2WXIA 3ENEA 2WXKA 2ILRA 4OVVA 3AS8A 2X6FA 3SY2A 1XGWA 4DX5D 3U4TA 2OOEA 3IBEA 5H7PA 1NZNA 5D0QD 3ZFWA 4DUIA 3ASHA 4HOTA 2P9LG 3Q47B 4EZLA 2I6HA 2V4LA 3ZYKA 2R2LA 3EDTB 1Y8MA 1HX8A 2AWIA 4C9BB 5CCMA 2H6IA 3OXLA 3QDNA 3DXKG 3I4RB 3PZ4A 3L9TA 3B7UX 3ASNE 4GYYA 4L9PA 3Q73A 3IHYA 2WXRA 3CQCB 1D8EA 3GZ2A 3UIPC 3E34A 1H2VC 3ZVVA 4UWGA 4F3VA 2NXPA 4TV3A 1TN8A 5IY5E 3URZA 4K5BA 3EHQA 4AV7A 2DYSE 3TG4A 4JZYA 5ITZF 2DZOA 4N2SA 1IQUA 2XCCA 4FP7A 2V5QC 4O1OA 3RAUA 4B8AA 2R05A 3B7SA 3DSTA 3G2TA 2YHCA 2JEKA 5JMND 5ENSD 2OV8A 4GTQA 4O1PA 2EIKE 2WXHA 3U3WA 1ZU2A 1E96B 1Z3YA 3FU5A 2XPZA 1O1SA 2JABA 4BTAA 4U8YD 1WY6A 2GW1A 3SFYA 3C3OA 1INZA 4TUMA 5FZRA 4Q96A 5CCLA 2I1JA 3ONKA 3HG0D 3HYMB 1UJJA 4O6FA 4BFRA 1X5BA 3B13A 5CMWA 3ZN3A 2J4DA 5G04C 4HOUA 2ETCA 2A5EA 2WQ6A 2V5FA 3LY9A 3GW4A 4GCNA 4B89A 4HFGA 4GMLA 5E75A 3ZXSA 3JYSA 2ETAA 2NSZA 3ZYQA 2IF4A 5A7DB 3D9HA 3R9MA 4G2VA 5FJYA 1TNUA 2KM4A 4XEIG 5CMYA 4B0ZA 3CLJA 2E2EA 4IN3B 4BX8A 1IXVA 5HS0A 3G2SA 4GZ6A 1S63A 2FO1E 3TWQA 4LSZE 3SO8A 3TG5A 3FTVA 3CHQA 4EBAG 2CFUA 4GYOA 4F53A 2VTBB 2VQ2A 1KT0A 4J8SA 5CRUA 4ME2A 1JCSA 2GGFA 3U64A 4CDNA 3APFA 4AOFA 1ELKA 3AU5A 3PZ1A 3CVWA 3I5PA 4IYPA 5CECB 4RVBA 3CVNA 4JD2G 1BU9A 3UT8A 2PNNA 4D10C 3GZSA 3CKBA 4U7EB 4HRLA 5T8IA 1HO8A 1IHBA 3W9GA 2NYJA 3MKRA 2CG3A 2F0YA 3WXXA 3DXMG 3MCXA 3CGHA 2J08A 3SBTB 3SGHA 3HHMA 3UTMA 1E8YA 5A6CA 4WWOA 2VSNA 5BUZA 4KZCA 5KNGA 1OWOA 2IONA 2VSYA 3R7QA 3TWUA 2FULA 3QK0A 4LUNU 3BU8A 5AIJA 1HH8A 4B93B 2KATA 3O48A 1JUQA 1K1BA 4FJYA 2VYIA 3NZSA 1YA0A 3MV2B 1TN6A 3PRZA 4WWNA 3FULA 5ARFA 5D66A 2OEVA 4H7YA 2J4BA 3CVLA 2WXQA 5KJNA 4I6JA 3V2OA 3G2WA 1H0AA 1EF1C 4I17A 5BV0A 2YHEA 3CQGB 4I9CA 4N3BA 3VTXA 3UPVA 2HYZA 1H2TC 5E76A 5G05J 3UKRG 3RO3A 4K5AB 4NURA 4XKCA 2FO7A 2P9SG 3FFLA 4G8LA 3ZEFA 5FZSA 3HXDA 2Y3AA 2XZTG 4A3TA 4J6IA 4BEPA 3FEXA 3MA5A 3EIJA 2LUHA 3ASGA 2QYUA 3LCAA 4M7CA 4L2YA 4WNGA 3LDZA 2IO2C 3FHEA 2R03A 3Q49B 4HOSA 1A5EA 3JUIA 1K8KG 3CVQA 3HXEA 3Q79A 3O4ZA 5DIZA 2DVWA 3UM3A 4FJZA 5AYWD 1MZCA 2EINE 2R02A 1OWPA 3PNTB 4MLPA 5C2YA 4AVXA 4LG6A 2WMNA 1B89A 2L6BA 1H6KA 1OCCE 2XCBA 3ONLA 5D2MC 2GRPB 1FVHA 2IQCA 1TN7A 4I1OB 4XKBA 3QB2A 4KBQA 1VDYA 3TWTA 4PH4B 3S2AA 2C2LA 2R5SA 3Q15A 3IKOB 3ESLA 1N4PA 2CHWA 4CYMD 4HORA 3V31A 4U8VD 3CVUA 2F8YA 4NIKA 4GMRA 3TWRA 3QARA 3DSSA 3U9WA 3TWSA 1H2UA 4UQXA 2VGYA 5KBAA 5AQ9A 3ULYA 3J5PA 3MJWA 3VLDA 2J49A 3APDA 1IHGA 3AJIA 3CVPA 5M72A 4FLHA 3KS2A 2XQ0A 1UN8A 1SA4A 2IFUA 3FUEA 4GA0A 4LNUD 1HE8A 4XI0A 4HRNA 4Y6WA 3D9KA 5D0OD 3LKUA 3QKYA 2J09A 4ILGA 4H7XA 2X3MA 3E30A 2XEVA 2IOSA 1O1RA 3C3QA 2HO1A 4JPSA 4DJAA 3NOGD 4U96D 3FU0A 4GMJA 4F7AA 4Z68A 2P58C 2AXVA 5G04J 1FVFA 2V0PA 3PZDA 1BLXB 4UQZA 4L1BA 1BD8A 4UWLA 4N3CA 4I9EA 5HRYA 3SF4A 4AY5A 1E7UA 2P9IG 5B1BE 3TGOA 4HLLA 4AY6A 1HXIA 4APOA 1Z3XA 3WG7E 1MHQA 2XGSA 4M3OA 3D9IA 2RG8A 1HZ4A 1E8WA 3BG0B 2ZISA 4HLEA 1RZ4A 4WWPA 5CHEE 5EKQD 2DWZA 2AVPA 2OVBA 3MYVA 3QC1A 5JJTA 4GTPA 1TR4A 3IEGA 4UI9K 4HI8A 1FPPA 2RKKA 2X6KA 2KXPC 4O60A 2LO6A 1SZ9A 3PE4A 3PNLB 1N9AA 3TWXA 2V4HC 3ZYMA 3Q5MA 4L7TA 3TAXA 2P9UG 4K5CA 2VTBA 4A3VA 3CHSA 3W9FA 5FQ4A 4A1GA 1V54E 4JL0A 4WAFA 2J8SD 4WNDA 1OCOE 1XNFA 2AW6A 4CZ2D 2WM9A 2KZTA 4GTMA 3FH7A 3LYAA 3B7BA 1FT2A 2UY1A 3RIBA 3HDXA 4JHJA 4EQFA 2LAIA 3CV0A 2F8XK 3CK9A 3ISMC 4OAVB 2L0IA 3V30A 1DC2A 3DBSA 1UN9A 3NF1A 4RSYA 3SBSA 1JWFA 5ENOD 5JA4D 1BI7B 1JPLA 1LD7A 5JHAA 4AP2A 1DVPA 1MX4A 4QQIA 1ZB1A 3S7DA 1N94A 3TJPA 3RK6A 5AJLA 5CERB 2F37A 3UT7A 3BG1B 3E32A 2PQRA 3LJNA 5B1AE 5AAOA 4JW1A 4KT6B 3FUIA 4K0RA 3DSWA 1Z6TA 3JQ0A 5G2NA 2J07A 3IV0A 4ANXA 3G2UA 4ACKA 3IHVA 4F1SA 2E0IA 3BEEA 1AWCB 3BUAA 4DI4A 3R9AB 2XHEA 4TXRA 4HOQA 4JVSA 2WPVA 1S0PA 3S7JA 3EU5A 3X2QE 4J8YA 4APFA 4NQ0A 2WXNA 3QAQA 3MKQB 2WQHA 3E37A 4AJWA 4B8CB 5BXOA 3EIQC 1HS6A 4Q69A 4BWRA 3JQ1A 3CSFA 2MOWA 3FEYA 3ZGQA 3JUEA 4TUUA 4BX9A 2P9KG 3PS6A 3FUJA 5FZQA 5JHBA 4EPZA 4NRHB 4BT8A 4EECA 3FUHA 1QNFA 2VSXE 2X38A 1SQMA 4ATGA 2P9PG 2GRRB 4DK5A 2HE0A 1WG0A 2CFZA 4HBDA 3ZHEB 4BERA 2Y4TA 4L2LA 3Q75A 4J8EA 3T8KA 2LXLA 3SHFA 4GTVA 5HI7A 3U66A 4FA6A 2BKGA 3DEOA 2RD0A 3FY4A 3QOUA 1Q2ZA 1N11A 3ZPJA 5ENPD 3GYZA 4GAAA 3L08A 4U0SA 3D3MA 3KD7A 3KSQA 3I3NA 4YDYA 2P9NG 4LCTA 2L9BA 2MHKA 4UI9C 3UUXA 1N52A 2NC9A 3D9MA 5BPPA 2WXFA 5JJ7A 3FUKA 2QZAA 1P5QA 3RSEG 3CVXA 2ZXWE 4KZ0A 1A17A 1YCSB 4CEMA 4CDRA 3BQOA 5LFAA 5BT1A 4A63B 3ESKA 3G2VA 1UOHA 3ZU7B 2AXZA 3VLEA 4C0EA 4CT0A 4DLQA 4RG9A 3CK8A 1IKND 1OY3D 4MKTA 4N5CA 1KT1A 3TL5A 3AU4A 3DWLG 4TRQA 4ILHB 3FU3A 4ILIA 4DX2A 2CHZA 1HU3A 3CHRA 4WNFA 5ENQD 4FADA 3UI2A 2X6HA 3DSXA 3PREA 3RJVA 4J8DA 2WVIA 3PZ2A 4I6GA 1EDUA 4XI9A 1H19A 2WB2A 2FI7A 3S7BA 4R7LA 1H6OA 2VGEA 2YINA 4U0ZA 3C5RA 2ONDA 1GW6A 2IY0C 2OEWA 3CVYA 5LCWC 3D9OA 4WNEA 1N0RA 4BESA 3B7TA 4XIFA 1O1TA 4LRZA 3QWPA 3NOCD 1PAQA 4DX6D 5KJMA 4UWKA 3UT4A 5EN5D 3RO2A 2DCPA 2WXPA 2PM7A 4XZ4A 1DCEA 2MRIA 2KCKA 5ENNA 3PVLA 4I1AA 1MX2A 2ZGGA 2ETBA 4LEUA 3ML8A 4YDOA 4HNAD 3C72A 4DRXE 3T5XA 2IJGX 5EYPF 3V79K 4CGWA 3LJ3A 4IULA 5FTPA 4JB8P 3L82A 2XRZA 3KAEA 3FUDA 1ELRA 4GTRA 4HI9A 4EBAA 1WAO1 3SFXA 1OWMA 1NI1A 2WXGA 4C48B 3C3RA 3Q7AA 1D9SA 3DSUA 3KEZA 4TXPA 2B6CA 1HF8A 4ATZD 3PE3A 5EIDA 1DNPA 1MX6A 3FTSA 5LX8A 4I2WA 2Y1LE 3Q4AB 3HXFA 4KYOB 1OWNA 3CHPA 4HB5A 3FTWA 5BNWA 2VGXB 2WXJA 3J5QB 3OAWA 3SFZA 4G23A 4J0UA 2WXOA
chains in the Genus database with same CATH topology
4B89A 2A4ZA 4HFGA 4GMLA 1HG2A 5E75A 3ZXSA 3FTUA 3JYSA 4FLBA 2X6KA 3UX4A 4GA1A 2AXUA 3PEUB 2LO6A 2FEZA 2NSZA 2FF4A 3ZYQA 5ARGA 4CT4A 1OWLA 3D9JA 2WXLA 4DI3A 1SZ9A 3PE4A 1NA3A 2IF4A 4A55A 5A7DB 1HG5A 3PNLB 2YNQA 1E90A 3PH0C 3HIZA 3Q5MA 4L7TA 3ZYMA 3CR3A 4L23A 4JA9A 4G2VA 3FTXA 4ABNA 4Q94A 5FJYA 3TAXA 4DPRA 3CK7A 3EHMA 5FQ8A 4B94A 2VTBA 4A3VA 2KM4A 2PQNA 2Q7FA 3CHSA 4CGVA 3L6AA 5CMYA 4FHKA 1IQRA 4B0ZA 5FQ4A 3CLJA 3NQPA 2E2EA 1QQEA 3B7RL 4IRUA 4K03A 5ANLA 4A1GA 3K9IA 4JL0A 4WAFA 3MZLB 4IN3B 4WNDA 5BV0A 4BX8A 1XNFA 3ZYLA 4C0MA 2AW6A 3OTNA 2WM9A 2X6JA 3G2SA 4GZ6A 2KZTA 3LY7A 1UG3A 4G24A 3TG5A 3FTVA 4N2QA 2KCVA 3CHQA 4N3AA 4EBAG 2CFUA 4GYOA 3FH7A 4F53A 1FCHA 2VTBB 3LYAA 1UJKA 2VQ2A 3LVQE 4KXKB 2UY1A 1KT0A 4J8SA 3RIBA 3HDXA 2I9CA 4NACA 4JHJA 4YVQC 4ANUA 4EQFA 2LAIA 2VSOE 3EJNA 3ML9A 4ME2A 3FH5A 3CV0A 4G26A 2LSVA 2GGFA 3CK9A 4CCAA 2L0IA 4GA2A 3EHNA 3DBSA 1UN9A 3NF1A 4RSYA 3SBSA 3U64A 1JWFA 4URKA 4GZCA 5KJKA 3I4GA 2XGOA 1JPLA 3ZRHA 4CDNA 3MX3A 3APFA 4G1TA 4AOFA 4ANWA 5JHAA 1ELKA 3AU5A 5DBKA 4AP2A 1DVPA 4EZKA 2WXMA 2PZIA 3CVWA 3I5PA 2KCLA 3FU6A 4IYPA 4W9RA 3S7DA 4GZDA 2QFCA 3CVNA 4RVBA 3TJPA 3R7RA 3RK6A 5AJLA 2UWJG 3UT8A 3UT7A 4U8HA 3BG1B 4BY6A 4KVMA 5G05C 3PDNA 2PQRA 4D10C 3GZSA 2ZU6B 3CKBA 2BF0X 1MQSA 3P2BA 4GZ5A 2JLBA 5T8IA 1HO8A 5AENA 1TEZA 5T3RA 4JW1A 4KT6B 3FUIA 4K0RA 5J08A 1Z6TA 3JQ0A 4HVBA 5G2NA 2J07A 3MKRA 2CG3A 3WXXA 2R59A 3IV0A 4HXIA 4BTBA 4ANXA 3MCXA 1ELWA 3CGHA 2J08A 3G2UA 3IHVA 3MKQA 4GB9A 5JJ6A 4N39A 5LOZA 2EQXA 3FUFA 3OXFA 4F1SA 3SBTB 3SGHA 2A5UA 3P1UA 4V3IA 2E0IA 5J90A 3BEEA 3HHMA 5FT9A 3CVVA 2XPIA 3DPDA 4FULA 1E8YA 4DI4A 5A6CA 3R9AB 4WWOA 2VSNA 4OYSA 2XHEA 5BUZA 2VJ8A 4G25A 4HOQA 2WPVA 1E8XA 1S0PA 1JWGA 2C0MA 4JVSA 2OVFA 4KZCA 3S7JA 1OWOA 3SD5A 2XGMA 2IONA 2VSYA 1ZBPA 3R7QA 1L5JA 4PS8A 2FULA 2X6IA 3T8MA 4APFA 4NQ0A 2WXNA 3TXNA 3QK0A 3QAQA 4LUNU 3MKQB 4JXTA 2KC7A 1PC2A 5AIJA 2WQHA 1HH8A 4BSXA 2FBNA 2KATA 2LSUA 4AM9A 4PS3A 3O48A 2PL2A 4AJWA 3ZIMA 4B8CB 1JUQA 3EIQC 1TJFA 4GZ3A 4FJYA 1HS6A 4Q69A 4BWRA 3D9NA 3GZ1A 2VYIA 3NZSA 1YA0A 4GPKA 3JQ1A 3CSFA 3MV2B 4J8FA 3PRZA 4WWNA 4ACLA 2MOWA 4E6HA 3FEYA 3L54A 3RKVA 3FULA 5ARFA 5KJLA 3RRMB 4JC8A 3ZHEA 4BT9A 5EX3A 1IYGA 4UWHA 3AS4A 3ZGQA 4MRUA 3UMVA 4TUUA 4BX9A 4H7YA 2J4BA 1U3DA 3CVLA 3PS6A 4P29A 3FUJA 2IOLA 2QY7A 5FZQA 4EPZA 5JHBA 2XPYA 2WXQA 3OXGA 3HVEA 5KJNA 4NRHB 2PM6A 4E85A 4LERA 4I6EA 4I6JA 4BT8A 4EECA 3G2WA 3FUHA 4JEUA 5A23A 1QNFA 1H0AA 2R17C 1EF1C 2V8SE 3FUMA 2VSXE 2X38A 1SQMA 3C98A 4I17A 2YHEA 3CQGB 4I9CA 4N3BA 3VTXA 3MV3B 4ATGA 2HYZA 2L6JA 3UPVA 3CHOA 1H2TC 4DK5A 5KCMA 4YNDA 5E76A 5G05J 3VTYA 3N71A 4UI9J 3RO3A 2CFZA 3LY8A 3FUNA 4NURA 3ZHEB 5C1DA 4XKCA 2FO7A 5EDSA 2Y4TA 4L2LA 3FFLA 3D9PA 3ZEFA 4J8EA 3MEKA 1LF8A 3L16A 3FDHA 3HVEB 5FZSA 3SHFA 1BPOA 4ANVA 2Y3AA 4GYWA 2C0LA 5HI7A 3U66A 3CSTA 4A3TA 4J6IA 4FA6A 4OVUA 2RD0A 3FEXA 3MA5A 3FY4A 3EIJA 3QOUA 5AJDA 3ASGA 3NZUA 3ZPJA 3GYZA 4GAAA 3LCAA 1E8ZA 3L08A 4U0SA 4L2YA 4U04A 3PUKA 3LDZA 3FHEA 4WNGA 4A1SA 4CDMA 3D3MA 3KD7A 3SNXA 3LVRE 3Q49B 4FU3A 4HOSA 3FTYA 4MS6A 3I3NA 2DBAA 4UQYA 4XX5A 3JUIA 4U0UA 4Y6CA 5FWQA 3CVQA 1UW4B 2XRYA 4KMOA 2WMOA 3LS8A 3D9LA 4LCTA 2I2OA 2L9BA 2MHKA 4UI9C 4UWFA 3UUXA 3O4ZA 2CG2A 3FH8A 5DIZA 4CRWA 1N52A 2HR2A 2NC9A 3D9MA 1WM5A 3L17A 5BW8C 5BPPA 4FJZA 3LXUX 5AYWD 4KVOA 2WXFA 3MGBA 5JJ7A 3FUKA 1OWPA 5HQ8A 3PNTB 4YVOA 2M63A 4MLPA 5C2YA 4AVXA 3CEQA 1P5QA 1QZ2A 2IU1A 1B89A 2WMNA 4KZ0A 4WUYA 5EX0A 2GRMA 1A17A 1H6KA 4EZJA 3CVXA 3CIAA 4CEMA 4JEHA 4CDRA 4GU5A 2XCBA 4JHRA 3ASDA 3ONLA 3FP3A 3ZW3A 2I1KA 3QWWA 3QWVA 2WXIA 3ENEA 1FVHA 2WXKA 2IQCA 4I1OB 2ILRA 5LFAA 4XKBA 3ULQA 4I2ZA 3CHMA 3QB2A 5BT1A 4OVVA 4KBQA 1VDYA 3ESKA 5BV1A 2LNIA 3AS8A 3G2VA 4PH4B 2AXZA 1PY1A 3ASFA 3S2AA 2X6FA 3VLEA 4C0EA 2C2LA 4CT0A 2BUGA 1XGWA 4DLQA 5FQ7A 2R5SA 4RG9A 3Q15A 3IKOB 3CK8A 3ESLA 3U4TA 1EPUA 2CHWA 4FHJA 2OOEA 3IBEA 4MKTA 5LCWJ 4HORA 4XE0A 1NZNA 4N5CA 5D0QD 1KT1A 1KLXA 3ZFWA 3ASHA 2BTDA 3AU4A 3TL5A 4HOTA 3LEWA 4JHKA 4PUCA 3CVUA 3Q47B 4TRQA 4ILHB 1SZAA 3FU3A 4EZLA 4ILIA 2L0TB 3UQ3A 3QARA 2I6HA 2CHZA 1NA0A 3APCA 1HU3A 2V4LA 2YQ8A 4PS7A 3CHRA 4PDXA 3ZYKA 3LPZA 4WNFA 3FWVA 3EDTB 4FADA 1Y8MA 3FTZA 1HX8A 3U9WA 3L22A 2X6HA 4DLOA 3RU0A 2AWIA 3PREA 3RJVA 4C9BB 4ACKA 2GRLA 1H2UA 2WVIA 4J8DA 4I6GA 4UQXA 1EDUA 5CCMA 2VGYA 4XI9A 5G55A 1H19A 2WB2A 3PEVB 2DIWA 4I1MA 3RRNB 2FI7A 3OXLA 3MJWA 3QDNA 3S7BA 3TXMA 4R7LA 3VLDA 3QNKA 2YINA 4U0ZA 3I4RB 2ONDA 2J49A 3APDA 1IHGA 1GW6A 3B7UX 4GYYA 1Y6IA 3CVYA 4QFVA 2WQ7A 3CVPA 5M72A 4U63A 4FLHA 3VLFA 5LCWC 3D9OA 3IHYA 3KS2A 4WNEA 5FQ6A 2XQ0A 2WXRA 1EYHA 1UN8A 2IFUA 3CQCB 3FUEA 4GA0A 5ANRA 3GZ2A 3B7TA 4XIFA 1HE8A 4XI0A 3L13A 4Y6WA 3ZVVA 1H2VC 2CHXA 4LRZA 3S7FA 3QWPA 4UWGA 4F3VA 4AXHA 2NXPA 1PAQA 3QJZA 4TV3A 3D9KA 5D0OD 3URZA 5KJMA 4UWKA 3LKUA 3QKYA 2LAHA 4AV7A 3UT4A 3RO2A 2DCPA 2WXPA 2PM7A 3TG4A 4G11A 4XZ4A 1TJCA 2J09A 2J9QA 4JZYA 1W3BA 4ILGA 3AS5A 2MRIA 4H7XA 1IQUA 2X3MA 4N2SA 2Y4UA 2KCKA 2XCCA 5ENNA 3PVLA 2XEVA 4FP7A 2IOSA 4I1AA 3CKCA 1E7VA 3ML8A 4LEUA 4JA7A 4B8AA 3SZ7A 2IJGX 3B7SA 3T5XA 3G2TA 2KZTB 2HO1A 3SI5A 4JPSA 1NP7A 4DJAA 4CGWA 2YHCA 3LJ3A 4IULA 5FTPA 3FU0A 2JEKA 4GMJA 2OV8A 1N54A 4F7AA 2P58C 2AXVA 5G04J 2XRZA 1FVFA 2V0PA 3PZDA 4GCOA 4UQZA 2UY1B 2WXHA 3KAEA 3FUDA 4L1BA 3U3WA 1ZU2A 1E96B 1ELRA 4UWLA 1Z3YA 3FU5A 4I9EA 4N3CA 3JCKC 3SF4A 2XPZA 4AY5A 1E7UA 1U3CA 3PUJA 4BTAA 1WY6A 4EBAA 1WAO1 4I43A 2GW1A 3TGOA 1OWMA 2VGXA 4AY6A 1HXIA 2WXGA 1INZA 5FZRA 4APOA 2HM8A 1Z3XA 1OUVA 1MHQA 2XGSA 4AEZC 4M3OA 4Q96A 4RG6A 5CCLA 3D9IA 3KEZA 2RG8A 1HFAA 3E4BA 2I1JA 1HF8A 3ONKA 1HZ4A 5LP0A 4AIFA 3PE3A 1DNPA 3HYMB 1E8WA 3FTSA 3RRUA 3BG0B 1UJJA 4O6FA 4HLEA 4I2WA 4BFRA 5LX8A 3Q4AB 4WWPA 1X5BA 3B13A 4KYOB 5CMWA 1OWNA 3CHPA 3ZN3A 3FTWA 2J4DA 5CHEE 5EKQD 2AVPA 2VGXB 2WXJA 3OAWA 5BNWA 3SFZA 2OVBA 3MYVA 3QC1A 4HOUA 5G04C 2WQ6A 4G23A 5JJTA 2V5FA 5T4YA 3LY9A 3GW4A 3IEGA 4UI9K 3T5VA 4U07A 4HS2A 4FC8A 4J0UA 2WXOA 4GCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JYS A;  4GA1 A;  2FEZ A;  2FF4 A;  5ARG A;  3PE4 A;  1NA3 A;  2IF4 A;  5A7D B;  3Q5M A;  4JA9 A;  4G2V A;  4ABN A;  5FJY A;  3TAX A;  3CK7 A;  4B94 A;  2PQN A;  2Q7F A;  4CGV A;  2E2E A;  1QQE A;  3K9I A;  4JL0 A;  4WND A;  4IN3 B;  1XNF A;  4GZ6 A;  3LY7 A;  4G24 A;  3TG5 A;  4N2Q A;  2KCV A;  4N3A A;  4GYO A;  1FCH A;  3LYA A;  2VQ2 A;  4KXK B;  2UY1 A;  1KT0 A;  3RIB A;  4YVQ C;  4EQF A;  4ME2 A;  3CV0 A;  4G26 A;  2LSV A;  3CK9 A;  4GA2 A;  3NF1 A;  5KJK A;  2XGO A;  4G1T A;  5DBK A;  2PZI A;  2KCL A;  4W9R A;  3S7D A;  2QFC A;  3CVN A;  2UWJ G;  5G05 C;  3PDN A;  2PQR A;  3CKB A;  4GZ5 A;  2JLB A;  3MKR A;  3WXX A;  4BTB A;  1ELW A;  5JJ6 A;  4N39 A;  3OXF A;  3BEE A;  5FT9 A;  2XPI A;  5A6C A;  3R9A B;  2VSN A;  4G25 A;  4HOQ A;  3S7J A;  2WPV A;  2C0M A;  2XGM A;  2VSY A;  1ZBP A;  4NQ0 A;  2KC7 A;  1PC2 A;  2WQH A;  1HH8 A;  2FBN A;  2KAT A;  2LSU A;  4AM9 A;  3O48 A;  2PL2 A;  4GZ3 A;  4BWR A;  3GZ1 A;  2VYI A;  4GPK A;  1YA0 A;  3MV2 B;  4J8F A;  3RKV A;  5ARF A;  5KJL A;  3ZHE A;  4BT9 A;  5EX3 A;  1IYG A;  3AS4 A;  3ZGQ A;  4H7Y A;  3CVL A;  5FZQ A;  3OXG A;  5KJN A;  4NRH B;  4BT8 A;  4I17 A;  4I9C A;  4N3B A;  3VTX A;  3MV3 B;  3UPV A;  2HYZ A;  2L6J A;  4YND A;  5G05 J;  3VTY A;  3N71 A;  4UI9 J;  3RO3 A;  3LY8 A;  3ZHE B;  5C1D A;  2FO7 A;  2Y4T A;  3FFL A;  4J8E A;  3MEK A;  5FZS A;  4GYW A;  5HI7 A;  2C0L A;  3MA5 A;  3QOU A;  3ASG A;  3ZPJ A;  3GYZ A;  3LCA A;  4U0S A;  4U04 A;  4WNG A;  4A1S A;  3KD7 A;  3Q49 B;  4HOS A;  2DBA A;  4UQY A;  4U0U A;  4Y6C A;  3CVQ A;  2MHK A;  4UI9 C;  3UUX A;  5DIZ A;  2HR2 A;  2NC9 A;  1WM5 A;  5BW8 C;  5AYW D;  5JJ7 A;  5HQ8 A;  4YVO A;  3CEQ A;  1P5Q A;  1QZ2 A;  1B89 A;  4WUY A;  5EX0 A;  1A17 A;  4CDR A;  2XCB A;  4JHR A;  3ASD A;  3FP3 A;  3QWW A;  3QWV A;  3ULQ A;  4I2Z A;  5BT1 A;  4KBQ A;  3ESK A;  2LNI A;  3AS8 A;  3ASF A;  2C2L A;  2BUG A;  2R5S A;  4RG9 A;  3Q15 A;  3CK8 A;  3U4T A;  5LCW J;  2OOE A;  4HOR A;  1NZN A;  4N5C A;  5D0Q D;  1KT1 A;  1KLX A;  3ZFW A;  3ASH A;  4HOT A;  3Q47 B;  3UQ3 A;  2I6H A;  1NA0 A;  2YQ8 A;  3LPZ A;  4WNF A;  3FWV A;  3EDT B;  1Y8M A;  3RU0 A;  3RJV A;  4J8D A;  4UQX A;  5CCM A;  2VGY A;  4XI9 A;  2FI7 A;  3OXL A;  3QDN A;  3S7B A;  4U0Z A;  2OND A;  1IHG A;  4GYY A;  3CVP A;  5M72 A;  5LCW C;  4WNE A;  3KS2 A;  2IFU A;  4GA0 A;  3GZ2 A;  4XIF A;  4XI0 A;  4Y6W A;  3S7F A;  3QWP A;  4F3V A;  5D0O D;  3URZ A;  5KJM A;  3LKU A;  3QKY A;  3RO2 A;  3TG4 A;  1TJC A;  2J9Q A;  1W3B A;  3AS5 A;  4H7X A;  4N2S A;  2Y4U A;  2KCK A;  2XCC A;  4I1A A;  2XEV A;  3CKC A;  4LEU A;  4JA7 A;  3SZ7 A;  2HO1 A;  4CGW A;  2YHC A;  5FTP A;  2P58 C;  5G04 J;  4GCO A;  4UQZ A;  2UY1 B;  3KAE A;  3U3W A;  1ZU2 A;  1E96 B;  1ELR A;  4N3C A;  4I9E A;  3SF4 A;  4AY5 A;  4BTA A;  1WAO 1;  2GW1 A;  3TGO A;  2VGX A;  4AY6 A;  1HXI A;  5FZR A;  4APO A;  1OUV A;  2XGS A;  5CCL A;  4RG6 A;  3E4B A;  1HZ4 A;  4AIF A;  3PE3 A;  3HYM B;  4O6F A;  4I2W A;  3Q4A B;  4KYO B;  3ZN3 A;  5CHE E;  5EKQ D;  2AVP A;  2VGX B;  5BNW A;  5G04 C;  4HOU A;  4G23 A;  5JJT A;  2V5F A;  3LY9 A;  3GW4 A;  3IEG A;  4UI9 K;  4U07 A;  4J0U A;  4GCN A; 
#chains in the Genus database with same CATH topology
 3FTU A;  4GA1 A;  2AXU A;  3PEU B;  2FEZ A;  2FF4 A;  3UKU G;  4CT4 A;  1OWL A;  2WXL A;  1NA3 A;  4A55 A;  1HG5 A;  1E90 A;  3CR3 A;  4ABN A;  3FTX A;  4Q94 A;  3CK7 A;  2XS1 A;  5FQ8 A;  4B94 A;  2PQN A;  3Q7F A;  2Q7F A;  1N4S A;  4ZFH A;  4FHK A;  1IQR A;  1K3Z D;  3DSV A;  1QQE A;  4IRU A;  5ANL A;  1NL4 A;  3K9I A;  3OTN A;  2OCC E;  3AAA C;  4EHM A;  3ZUV B;  3LY7 A;  2P2C P;  4G24 A;  2QYJ A;  4N2Q A;  3NAW A;  4HRM B;  1TNO A;  3UXG A;  3HRA A;  3ABK E;  4KXK B;  3AG1 E;  2I9C A;  3ML9 A;  3V2X A;  4G26 A;  4CCA A;  2IO3 C;  1TNB A;  4GA2 A;  3EHN A;  3NBN B;  4DX1 A;  5CBN A;  4URK A;  4GZC A;  3I4G A;  3ZRH A;  3MX3 A;  4ANW A;  4G1T A;  4HQD A;  2PZI A;  3TWV A;  4GZD A;  2QFC A;  3R7R A;  2UWJ G;  1SW6 A;  4BY6 A;  4KVM A;  1TYQ G;  5G05 C;  2ZU6 B;  2BF0 X;  1MQS A;  3P2B A;  4GZ5 A;  2JLB A;  5AEN A;  2KBX A;  5T3R A;  4X8Q A;  5J08 A;  4HVB A;  1OT8 A;  4HXI A;  4BTB A;  1G3N B;  4G8K A;  5ENT D;  1ELW A;  3MKQ A;  1TEZ A;  4GB9 A;  5JJ6 A;  4N39 A;  3FUF A;  1N0Q A;  5FT9 A;  3CVV A;  2XPI A;  4FUL A;  1LD8 A;  3B95 A;  4OYS A;  1BI8 B;  1E8X A;  2OVF A;  1TNY A;  3UM0 A;  5FIN A;  1ZBP A;  4GTT A;  1Z5S C;  4PS8 A;  3T8M A;  2KC7 A;  1PC2 A;  4BSX A;  2LSU A;  4PS3 A;  2PL2 A;  4GZ3 A;  4LNB A;  3GZ1 A;  4GPK A;  4J8F A;  4E6H A;  3L54 A;  3RKV A;  5KJL A;  3RRM B;  3ZHE A;  4BT9 A;  1IYG A;  4UWH A;  4MRU A;  3UMV A;  1U3D A;  4P29 A;  3T9K A;  2IOL A;  3OXG A;  4E85 A;  4I6E A;  4JEU A;  2R17 C;  2V8S E;  3FUM A;  3MV3 B;  2L6J A;  3Q9N C;  3DEP A;  5KCM A;  1U2V G;  3VTY A;  3N71 A;  4UI9 J;  2EIJ E;  1OCR E;  2GRN B;  3LY8 A;  5C1D A;  3JXI A;  2EIM E;  4BET A;  3NB2 A;  2ZGD A;  3MEK A;  2DZN A;  3FDH A;  3HVE B;  1BPO A;  4ANV A;  2C0L A;  3CST A;  3HXC A;  2XZD G;  4OVU A;  1E8Z A;  4FU3 A;  3FTY A;  2DBA A;  4ZHB A;  4U0U A;  4Y6C A;  5FWQ A;  1UW4 B;  4GPM A;  3LS8 A;  4UWF A;  2RFA A;  3L17 A;  2H6H A;  3LXU X;  4KVO A;  3ASO E;  5HKP A;  5HQ8 A;  4YVO A;  2M63 A;  1QZ2 A;  5CEA A;  4WUY A;  2GRM A;  1S70 B;  3CIA A;  4JEH A;  4JHR A;  3FP3 A;  3ZW3 A;  3QWW A;  3QWV A;  4OAU C;  3ULQ A;  4I2Z A;  3CHM A;  4F6R D;  5BV1 A;  2LNI A;  5KNH D;  1PY1 A;  3ASF A;  2Y69 E;  2BUG A;  4N5Q A;  5FQ7 A;  1EPU A;  5LCW J;  4FHJ A;  4XE0 A;  3UM1 A;  1KLX A;  1S64 A;  2BTD A;  3LEW A;  4JHK A;  4PUC A;  1SZA A;  1X81 A;  4J7W A;  2L0T B;  3UQ3 A;  1NA0 A;  2GRQ B;  3APC A;  4PS7 A;  2YQ8 A;  2BKK B;  4PDX A;  4F1P A;  3LPZ A;  3FWV A;  2RFM A;  3FTZ A;  3L22 A;  4DLO A;  3RU0 A;  2GRL A;  1N4Q A;  5G55 A;  3PEV B;  2DIW A;  4I1M A;  3RRN B;  4RLY A;  5EIB E;  3TXM A;  4UUC A;  3QNK A;  1Y6I A;  4QFV A;  2WQ7 A;  4U63 A;  3VLF A;  5FQ6 A;  1EYH A;  3EU9 A;  3KEA A;  5ANR A;  5CBO A;  3L13 A;  2CHX A;  3S7F A;  5FIO A;  4AXH A;  1KZP A;  3QJZ A;  3UM2 A;  3ZXP A;  2GRO B;  4GTS A;  2LAH A;  1OXJ A;  4G11 A;  5EYL A;  1TJC A;  2J9Q A;  5BXU A;  1W3B A;  3AS5 A;  2Y4U A;  3CKC A;  1E7V A;  1SVX A;  4JA7 A;  3SZ7 A;  2KZT B;  3SI5 A;  1NP7 A;  2AJA A;  1N54 A;  4GCO A;  3AG2 E;  2UY1 B;  1OCZ E;  3JCK C;  2XEN A;  5EIL A;  5AQ7 A;  1U3C A;  3PUJ A;  4I43 A;  2VGX A;  2HM8 A;  2B0O E;  1OUV A;  4AEZ C;  4RG6 A;  1HFA A;  3E4B A;  5LP0 A;  4AIF A;  3RRU A;  2Y0B G;  4MBG A;  5T4Y A;  3T5V A;  4U07 A;  4HS2 A;  4FC8 A;  3Q78 A;  2A4Z A;  1HG2 A;  5AQB A;  3UX4 A;  4FLB A;  5ARG A;  1QBQ A;  1N4R A;  3D9J A;  4DI3 A;  3DRA A;  2YNQ A;  3PH0 C;  3HIZ A;  4L23 A;  4JA9 A;  4DPR A;  3EHM A;  2ZIR A;  4DX7 D;  4CGV A;  1JCQ A;  3L6A A;  3NQP A;  4K03 A;  3B7R L;  3MZL B;  3ZYL A;  4C0M A;  2X6J A;  1K1A A;  1UG3 A;  2KCV A;  4N3A A;  1SA5 A;  1KPS B;  1FCH A;  3ABL E;  1UJK A;  3LVQ E;  3AG3 E;  4NAC A;  4ANU A;  4YVQ C;  2VSO E;  3EJN A;  1YMP A;  4YDE A;  3FH5 A;  3ZKJ A;  2LSV A;  1N95 A;  2BED A;  1MJ0 A;  5KJK A;  2XGO A;  3E33 A;  1WDY A;  5DBK A;  4EZK A;  2WXM A;  2KCL A;  3FU6 A;  4W9R A;  2H6G A;  1KZO A;  2H6F A;  4U8H A;  3HXB A;  1V55 E;  3UIO C;  3PDN A;  4BSZ B;  3PZ3 A;  3ABM E;  4RQI A;  3TWW A;  2R59 A;  5CED B;  3EUV A;  1DCQ A;  4U95 D;  5LOZ A;  2EQX A;  3OXF A;  3KSL A;  2A5U A;  2DYR E;  3P1U A;  4V3I A;  5J90 A;  3DPD A;  2VJ8 A;  4G25 A;  2QC9 A;  1LTX A;  2C0M A;  1JWG A;  2XEH A;  5AAR A;  3SD5 A;  2XGM A;  1L5J A;  2X6I A;  3ULE G;  3TXN A;  2IEJ A;  5CRV A;  4JXT A;  3Q9U C;  2FBN A;  4AM9 A;  1QYM A;  1MYO A;  3ZIM A;  1YYH A;  1TJF A;  3D9N A;  4YDW A;  1TNZ A;  4ACL A;  5AQA A;  1FT1 A;  4JC8 A;  5EX3 A;  3AS4 A;  3IXE A;  2QY7 A;  2XPY A;  3HVE A;  5AN8 A;  2PM6 A;  4LER A;  5A23 A;  3C98 A;  4GTO A;  3ZNG A;  3CHO A;  4YND A;  3EHR A;  4TXQ A;  3FUN A;  5EDS A;  2LXM A;  2XEE A;  3JXJ A;  5ENR D;  3D9P A;  1AP7 A;  1JCR A;  3UIN C;  3SQV A;  1LF8 A;  3L16 A;  4GYW A;  2XS8 A;  5AJD A;  5B3S E;  3NZU A;  3AG4 E;  2EIL E;  4U04 A;  3PUK A;  4A1S A;  4CDM A;  3SNX A;  3LVR E;  4MS6 A;  4UQY A;  4XX5 A;  1O5M A;  2XRY A;  4KMO A;  2WMO A;  1H6P A;  3D9L A;  2I2O A;  2CG2 A;  3FH8 A;  4CRW A;  2HR2 A;  1WM5 A;  5BW8 C;  5KWD A;  3MGB A;  4LNG A;  3CEQ A;  1NFI E;  2IU1 A;  5EX0 A;  4EZJ A;  1D8D A;  3DPY A;  4GU5 A;  3F6Q A;  1RW2 A;  2MYO A;  3ASD A;  2I1K A;  2WXI A;  3ENE A;  2WXK A;  2ILR A;  4OVV A;  3AS8 A;  2X6F A;  3SY2 A;  1XGW A;  4DX5 D;  3U4T A;  2OOE A;  3IBE A;  5H7P A;  1NZN A;  5D0Q D;  3ZFW A;  4DUI A;  3ASH A;  4HOT A;  2P9L G;  3Q47 B;  4EZL A;  2I6H A;  2V4L A;  3ZYK A;  2R2L A;  3EDT B;  1Y8M A;  1HX8 A;  2AWI A;  4C9B B;  5CCM A;  2H6I A;  3OXL A;  3QDN A;  3DXK G;  3I4R B;  3PZ4 A;  3L9T A;  3B7U X;  3ASN E;  4GYY A;  4L9P A;  3Q73 A;  3IHY A;  2WXR A;  3CQC B;  1D8E A;  3GZ2 A;  3UIP C;  3E34 A;  1H2V C;  3ZVV A;  4UWG A;  4F3V A;  2NXP A;  4TV3 A;  1TN8 A;  5IY5 E;  3URZ A;  4K5B A;  3EHQ A;  4AV7 A;  2DYS E;  3TG4 A;  4JZY A;  5ITZ F;  2DZO A;  4N2S A;  1IQU A;  2XCC A;  4FP7 A;  2V5Q C;  4O1O A;  3RAU A;  4B8A A;  2R05 A;  3B7S A;  3DST A;  3G2T A;  2YHC A;  2JEK A;  5JMN D;  5ENS D;  2OV8 A;  4GTQ A;  4O1P A;  2EIK E;  2WXH A;  3U3W A;  1ZU2 A;  1E96 B;  1Z3Y A;  3FU5 A;  2XPZ A;  1O1S A;  2JAB A;  4BTA A;  4U8Y D;  1WY6 A;  2GW1 A;  3SFY A;  3C3O A;  1INZ A;  4TUM A;  5FZR A;  4Q96 A;  5CCL A;  2I1J A;  3ONK A;  3HG0 D;  3HYM B;  1UJJ A;  4O6F A;  4BFR A;  1X5B A;  3B13 A;  5CMW A;  3ZN3 A;  2J4D A;  5G04 C;  4HOU A;  2ETC A;  2A5E A;  2WQ6 A;  2V5F A;  3LY9 A;  3GW4 A;  4GCN A;  4B89 A;  4HFG A;  4GML A;  5E75 A;  3ZXS A;  3JYS A;  2ETA A;  2NSZ A;  3ZYQ A;  2IF4 A;  5A7D B;  3D9H A;  3R9M A;  4G2V A;  5FJY A;  1TNU A;  2KM4 A;  4XEI G;  5CMY A;  4B0Z A;  3CLJ A;  2E2E A;  4IN3 B;  4BX8 A;  1IXV A;  5HS0 A;  3G2S A;  4GZ6 A;  1S63 A;  2FO1 E;  3TWQ A;  4LSZ E;  3SO8 A;  3TG5 A;  3FTV A;  3CHQ A;  4EBA G;  2CFU A;  4GYO A;  4F53 A;  2VTB B;  2VQ2 A;  1KT0 A;  4J8S A;  5CRU A;  4ME2 A;  1JCS A;  2GGF A;  3U64 A;  4CDN A;  3APF A;  4AOF A;  1ELK A;  3AU5 A;  3PZ1 A;  3CVW A;  3I5P A;  4IYP A;  5CEC B;  4RVB A;  3CVN A;  4JD2 G;  1BU9 A;  3UT8 A;  2PNN A;  4D10 C;  3GZS A;  3CKB A;  4U7E B;  4HRL A;  5T8I A;  1HO8 A;  1IHB A;  3W9G A;  2NYJ A;  3MKR A;  2CG3 A;  2F0Y A;  3WXX A;  3DXM G;  3MCX A;  3CGH A;  2J08 A;  3SBT B;  3SGH A;  3HHM A;  3UTM A;  1E8Y A;  5A6C A;  4WWO A;  2VSN A;  5BUZ A;  4KZC A;  5KNG A;  1OWO A;  2ION A;  2VSY A;  3R7Q A;  3TWU A;  2FUL A;  3QK0 A;  4LUN U;  3BU8 A;  5AIJ A;  1HH8 A;  4B93 B;  2KAT A;  3O48 A;  1JUQ A;  1K1B A;  4FJY A;  2VYI A;  3NZS A;  1YA0 A;  3MV2 B;  1TN6 A;  3PRZ A;  4WWN A;  3FUL A;  5ARF A;  5D66 A;  2OEV A;  4H7Y A;  2J4B A;  3CVL A;  2WXQ A;  5KJN A;  4I6J A;  3V2O A;  3G2W A;  1H0A A;  1EF1 C;  4I17 A;  5BV0 A;  2YHE A;  3CQG B;  4I9C A;  4N3B A;  3VTX A;  3UPV A;  2HYZ A;  1H2T C;  5E76 A;  5G05 J;  3UKR G;  3RO3 A;  4K5A B;  4NUR A;  4XKC A;  2FO7 A;  2P9S G;  3FFL A;  4G8L A;  3ZEF A;  5FZS A;  3HXD A;  2Y3A A;  2XZT G;  4A3T A;  4J6I A;  4BEP A;  3FEX A;  3MA5 A;  3EIJ A;  2LUH A;  3ASG A;  2QYU A;  3LCA A;  4M7C A;  4L2Y A;  4WNG A;  3LDZ A;  2IO2 C;  3FHE A;  2R03 A;  3Q49 B;  4HOS A;  1A5E A;  3JUI A;  1K8K G;  3CVQ A;  3HXE A;  3Q79 A;  3O4Z A;  5DIZ A;  2DVW A;  3UM3 A;  4FJZ A;  5AYW D;  1MZC A;  2EIN E;  2R02 A;  1OWP A;  3PNT B;  4MLP A;  5C2Y A;  4AVX A;  4LG6 A;  2WMN A;  1B89 A;  2L6B A;  1H6K A;  1OCC E;  2XCB A;  3ONL A;  5D2M C;  2GRP B;  1FVH A;  2IQC A;  1TN7 A;  4I1O B;  4XKB A;  3QB2 A;  4KBQ A;  1VDY A;  3TWT A;  4PH4 B;  3S2A A;  2C2L A;  2R5S A;  3Q15 A;  3IKO B;  3ESL A;  1N4P A;  2CHW A;  4CYM D;  4HOR A;  3V31 A;  4U8V D;  3CVU A;  2F8Y A;  4NIK A;  4GMR A;  3TWR A;  3QAR A;  3DSS A;  3U9W A;  3TWS A;  1H2U A;  4UQX A;  2VGY A;  5KBA A;  5AQ9 A;  3ULY A;  3J5P A;  3MJW A;  3VLD A;  2J49 A;  3APD A;  1IHG A;  3AJI A;  3CVP A;  5M72 A;  4FLH A;  3KS2 A;  2XQ0 A;  1UN8 A;  1SA4 A;  2IFU A;  3FUE A;  4GA0 A;  4LNU D;  1HE8 A;  4XI0 A;  4HRN A;  4Y6W A;  3D9K A;  5D0O D;  3LKU A;  3QKY A;  2J09 A;  4ILG A;  4H7X A;  2X3M A;  3E30 A;  2XEV A;  2IOS A;  1O1R A;  3C3Q A;  2HO1 A;  4JPS A;  4DJA A;  3NOG D;  4U96 D;  3FU0 A;  4GMJ A;  4F7A A;  4Z68 A;  2P58 C;  2AXV A;  5G04 J;  1FVF A;  2V0P A;  3PZD A;  1BLX B;  4UQZ A;  4L1B A;  1BD8 A;  4UWL A;  4N3C A;  4I9E A;  5HRY A;  3SF4 A;  4AY5 A;  1E7U A;  2P9I G;  5B1B E;  3TGO A;  4HLL A;  4AY6 A;  1HXI A;  4APO A;  1Z3X A;  3WG7 E;  1MHQ A;  2XGS A;  4M3O A;  3D9I A;  2RG8 A;  1HZ4 A;  1E8W A;  3BG0 B;  2ZIS A;  4HLE A;  1RZ4 A;  4WWP A;  5CHE E;  5EKQ D;  2DWZ A;  2AVP A;  2OVB A;  3MYV A;  3QC1 A;  5JJT A;  4GTP A;  1TR4 A;  3IEG A;  4UI9 K;  4HI8 A;  1FPP A;  2RKK A;  2X6K A;  2KXP C;  4O60 A;  2LO6 A;  1SZ9 A;  3PE4 A;  3PNL B;  1N9A A;  3TWX A;  2V4H C;  3ZYM A;  3Q5M A;  4L7T A;  3TAX A;  2P9U G;  4K5C A;  2VTB A;  4A3V A;  3CHS A;  3W9F A;  5FQ4 A;  4A1G A;  1V54 E;  4JL0 A;  4WAF A;  2J8S D;  4WND A;  1OCO E;  1XNF A;  2AW6 A;  4CZ2 D;  2WM9 A;  2KZT A;  4GTM A;  3FH7 A;  3LYA A;  3B7B A;  1FT2 A;  2UY1 A;  3RIB A;  3HDX A;  4JHJ A;  4EQF A;  2LAI A;  3CV0 A;  2F8X K;  3CK9 A;  3ISM C;  4OAV B;  2L0I A;  3V30 A;  1DC2 A;  3DBS A;  1UN9 A;  3NF1 A;  4RSY A;  3SBS A;  1JWF A;  5ENO D;  5JA4 D;  1BI7 B;  1JPL A;  1LD7 A;  5JHA A;  4AP2 A;  1DVP A;  1MX4 A;  4QQI A;  1ZB1 A;  3S7D A;  1N94 A;  3TJP A;  3RK6 A;  5AJL A;  5CER B;  2F37 A;  3UT7 A;  3BG1 B;  3E32 A;  2PQR A;  3LJN A;  5B1A E;  5AAO A;  4JW1 A;  4KT6 B;  3FUI A;  4K0R A;  3DSW A;  1Z6T A;  3JQ0 A;  5G2N A;  2J07 A;  3IV0 A;  4ANX A;  3G2U A;  4ACK A;  3IHV A;  4F1S A;  2E0I A;  3BEE A;  1AWC B;  3BUA A;  4DI4 A;  3R9A B;  2XHE A;  4TXR A;  4HOQ A;  4JVS A;  2WPV A;  1S0P A;  3S7J A;  3EU5 A;  3X2Q E;  4J8Y A;  4APF A;  4NQ0 A;  2WXN A;  3QAQ A;  3MKQ B;  2WQH A;  3E37 A;  4AJW A;  4B8C B;  5BXO A;  3EIQ C;  1HS6 A;  4Q69 A;  4BWR A;  3JQ1 A;  3CSF A;  2MOW A;  3FEY A;  3ZGQ A;  3JUE A;  4TUU A;  4BX9 A;  2P9K G;  3PS6 A;  3FUJ A;  5FZQ A;  5JHB A;  4EPZ A;  4NRH B;  4BT8 A;  4EEC A;  3FUH A;  1QNF A;  2VSX E;  2X38 A;  1SQM A;  4ATG A;  2P9P G;  2GRR B;  4DK5 A;  2HE0 A;  1WG0 A;  2CFZ A;  4HBD A;  3ZHE B;  4BER A;  2Y4T A;  4L2L A;  3Q75 A;  4J8E A;  3T8K A;  2LXL A;  3SHF A;  4GTV A;  5HI7 A;  3U66 A;  4FA6 A;  2BKG A;  3DEO A;  2RD0 A;  3FY4 A;  3QOU A;  1Q2Z A;  1N11 A;  3ZPJ A;  5ENP D;  3GYZ A;  4GAA A;  3L08 A;  4U0S A;  3D3M A;  3KD7 A;  3KSQ A;  3I3N A;  4YDY A;  2P9N G;  4LCT A;  2L9B A;  2MHK A;  4UI9 C;  3UUX A;  1N52 A;  2NC9 A;  3D9M A;  5BPP A;  2WXF A;  5JJ7 A;  3FUK A;  2QZA A;  1P5Q A;  3RSE G;  3CVX A;  2ZXW E;  4KZ0 A;  1A17 A;  1YCS B;  4CEM A;  4CDR A;  3BQO A;  5LFA A;  5BT1 A;  4A63 B;  3ESK A;  3G2V A;  1UOH A;  3ZU7 B;  2AXZ A;  3VLE A;  4C0E A;  4CT0 A;  4DLQ A;  4RG9 A;  3CK8 A;  1IKN D;  1OY3 D;  4MKT A;  4N5C A;  1KT1 A;  3TL5 A;  3AU4 A;  3DWL G;  4TRQ A;  4ILH B;  3FU3 A;  4ILI A;  4DX2 A;  2CHZ A;  1HU3 A;  3CHR A;  4WNF A;  5ENQ D;  4FAD A;  3UI2 A;  2X6H A;  3DSX A;  3PRE A;  3RJV A;  4J8D A;  2WVI A;  3PZ2 A;  4I6G A;  1EDU A;  4XI9 A;  1H19 A;  2WB2 A;  2FI7 A;  3S7B A;  4R7L A;  1H6O A;  2VGE A;  2YIN A;  4U0Z A;  3C5R A;  2OND A;  1GW6 A;  2IY0 C;  2OEW A;  3CVY A;  5LCW C;  3D9O A;  4WNE A;  1N0R A;  4BES A;  3B7T A;  4XIF A;  1O1T A;  4LRZ A;  3QWP A;  3NOC D;  1PAQ A;  4DX6 D;  5KJM A;  4UWK A;  3UT4 A;  5EN5 D;  3RO2 A;  2DCP A;  2WXP A;  2PM7 A;  4XZ4 A;  1DCE A;  2MRI A;  2KCK A;  5ENN A;  3PVL A;  4I1A A;  1MX2 A;  2ZGG A;  2ETB A;  4LEU A;  3ML8 A;  4YDO A;  4HNA D;  3C72 A;  4DRX E;  3T5X A;  2IJG X;  5EYP F;  3V79 K;  4CGW A;  3LJ3 A;  4IUL A;  5FTP A;  4JB8 P;  3L82 A;  2XRZ A;  3KAE A;  3FUD A;  1ELR A;  4GTR A;  4HI9 A;  4EBA A;  1WAO 1;  3SFX A;  1OWM A;  1NI1 A;  2WXG A;  4C48 B;  3C3R A;  3Q7A A;  1D9S A;  3DSU A;  3KEZ A;  4TXP A;  2B6C A;  1HF8 A;  4ATZ D;  3PE3 A;  5EID A;  1DNP A;  1MX6 A;  3FTS A;  5LX8 A;  4I2W A;  2Y1L E;  3Q4A B;  3HXF A;  4KYO B;  1OWN A;  3CHP A;  4HB5 A;  3FTW A;  5BNW A;  2VGX B;  2WXJ A;  3J5Q B;  3OAW A;  3SFZ A;  4G23 A;  4J0U A;  2WXO A; 
#chains in the Genus database with same CATH homology
 4B89 A;  2A4Z A;  4HFG A;  4GML A;  1HG2 A;  5E75 A;  3ZXS A;  3FTU A;  3JYS A;  4FLB A;  2X6K A;  3UX4 A;  4GA1 A;  2AXU A;  3PEU B;  2LO6 A;  2FEZ A;  2NSZ A;  2FF4 A;  3ZYQ A;  5ARG A;  4CT4 A;  1OWL A;  3D9J A;  2WXL A;  4DI3 A;  1SZ9 A;  3PE4 A;  1NA3 A;  2IF4 A;  4A55 A;  5A7D B;  1HG5 A;  3PNL B;  2YNQ A;  1E90 A;  3PH0 C;  3HIZ A;  3Q5M A;  4L7T A;  3ZYM A;  3CR3 A;  4L23 A;  4JA9 A;  4G2V A;  3FTX A;  4ABN A;  4Q94 A;  5FJY A;  3TAX A;  4DPR A;  3CK7 A;  3EHM A;  5FQ8 A;  4B94 A;  2VTB A;  4A3V A;  2KM4 A;  2PQN A;  2Q7F A;  3CHS A;  4CGV A;  3L6A A;  5CMY A;  4FHK A;  1IQR A;  4B0Z A;  5FQ4 A;  3CLJ A;  3NQP A;  2E2E A;  1QQE A;  3B7R L;  4IRU A;  4K03 A;  5ANL A;  4A1G A;  3K9I A;  4JL0 A;  4WAF A;  3MZL B;  4IN3 B;  4WND A;  5BV0 A;  4BX8 A;  1XNF A;  3ZYL A;  4C0M A;  2AW6 A;  3OTN A;  2WM9 A;  2X6J A;  3G2S A;  4GZ6 A;  2KZT A;  3LY7 A;  1UG3 A;  4G24 A;  3TG5 A;  3FTV A;  4N2Q A;  2KCV A;  3CHQ A;  4N3A A;  4EBA G;  2CFU A;  4GYO A;  3FH7 A;  4F53 A;  1FCH A;  2VTB B;  3LYA A;  1UJK A;  2VQ2 A;  3LVQ E;  4KXK B;  2UY1 A;  1KT0 A;  4J8S A;  3RIB A;  3HDX A;  2I9C A;  4NAC A;  4JHJ A;  4YVQ C;  4ANU A;  4EQF A;  2LAI A;  2VSO E;  3EJN A;  3ML9 A;  4ME2 A;  3FH5 A;  3CV0 A;  4G26 A;  2LSV A;  2GGF A;  3CK9 A;  4CCA A;  2L0I A;  4GA2 A;  3EHN A;  3DBS A;  1UN9 A;  3NF1 A;  4RSY A;  3SBS A;  3U64 A;  1JWF A;  4URK A;  4GZC A;  5KJK A;  3I4G A;  2XGO A;  1JPL A;  3ZRH A;  4CDN A;  3MX3 A;  3APF A;  4G1T A;  4AOF A;  4ANW A;  5JHA A;  1ELK A;  3AU5 A;  5DBK A;  4AP2 A;  1DVP A;  4EZK A;  2WXM A;  2PZI A;  3CVW A;  3I5P A;  2KCL A;  3FU6 A;  4IYP A;  4W9R A;  3S7D A;  4GZD A;  2QFC A;  3CVN A;  4RVB A;  3TJP A;  3R7R A;  3RK6 A;  5AJL A;  2UWJ G;  3UT8 A;  3UT7 A;  4U8H A;  3BG1 B;  4BY6 A;  4KVM A;  5G05 C;  3PDN A;  2PQR A;  4D10 C;  3GZS A;  2ZU6 B;  3CKB A;  2BF0 X;  1MQS A;  3P2B A;  4GZ5 A;  2JLB A;  5T8I A;  1HO8 A;  5AEN A;  1TEZ A;  5T3R A;  4JW1 A;  4KT6 B;  3FUI A;  4K0R A;  5J08 A;  1Z6T A;  3JQ0 A;  4HVB A;  5G2N A;  2J07 A;  3MKR A;  2CG3 A;  3WXX A;  2R59 A;  3IV0 A;  4HXI A;  4BTB A;  4ANX A;  3MCX A;  1ELW A;  3CGH A;  2J08 A;  3G2U A;  3IHV A;  3MKQ A;  4GB9 A;  5JJ6 A;  4N39 A;  5LOZ A;  2EQX A;  3FUF A;  3OXF A;  4F1S A;  3SBT B;  3SGH A;  2A5U A;  3P1U A;  4V3I A;  2E0I A;  5J90 A;  3BEE A;  3HHM A;  5FT9 A;  3CVV A;  2XPI A;  3DPD A;  4FUL A;  1E8Y A;  4DI4 A;  5A6C A;  3R9A B;  4WWO A;  2VSN A;  4OYS A;  2XHE A;  5BUZ A;  2VJ8 A;  4G25 A;  4HOQ A;  2WPV A;  1E8X A;  1S0P A;  1JWG A;  2C0M A;  4JVS A;  2OVF A;  4KZC A;  3S7J A;  1OWO A;  3SD5 A;  2XGM A;  2ION A;  2VSY A;  1ZBP A;  3R7Q A;  1L5J A;  4PS8 A;  2FUL A;  2X6I A;  3T8M A;  4APF A;  4NQ0 A;  2WXN A;  3TXN A;  3QK0 A;  3QAQ A;  4LUN U;  3MKQ B;  4JXT A;  2KC7 A;  1PC2 A;  5AIJ A;  2WQH A;  1HH8 A;  4BSX A;  2FBN A;  2KAT A;  2LSU A;  4AM9 A;  4PS3 A;  3O48 A;  2PL2 A;  4AJW A;  3ZIM A;  4B8C B;  1JUQ A;  3EIQ C;  1TJF A;  4GZ3 A;  4FJY A;  1HS6 A;  4Q69 A;  4BWR A;  3D9N A;  3GZ1 A;  2VYI A;  3NZS A;  1YA0 A;  4GPK A;  3JQ1 A;  3CSF A;  3MV2 B;  4J8F A;  3PRZ A;  4WWN A;  4ACL A;  2MOW A;  4E6H A;  3FEY A;  3L54 A;  3RKV A;  3FUL A;  5ARF A;  5KJL A;  3RRM B;  4JC8 A;  3ZHE A;  4BT9 A;  5EX3 A;  1IYG A;  4UWH A;  3AS4 A;  3ZGQ A;  4MRU A;  3UMV A;  4TUU A;  4BX9 A;  4H7Y A;  2J4B A;  1U3D A;  3CVL A;  3PS6 A;  4P29 A;  3FUJ A;  2IOL A;  2QY7 A;  5FZQ A;  4EPZ A;  5JHB A;  2XPY A;  2WXQ A;  3OXG A;  3HVE A;  5KJN A;  4NRH B;  2PM6 A;  4E85 A;  4LER A;  4I6E A;  4I6J A;  4BT8 A;  4EEC A;  3G2W A;  3FUH A;  4JEU A;  5A23 A;  1QNF A;  1H0A A;  2R17 C;  1EF1 C;  2V8S E;  3FUM A;  2VSX E;  2X38 A;  1SQM A;  3C98 A;  4I17 A;  2YHE A;  3CQG B;  4I9C A;  4N3B A;  3VTX A;  3MV3 B;  4ATG A;  2HYZ A;  2L6J A;  3UPV A;  3CHO A;  1H2T C;  4DK5 A;  5KCM A;  4YND A;  5E76 A;  5G05 J;  3VTY A;  3N71 A;  4UI9 J;  3RO3 A;  2CFZ A;  3LY8 A;  3FUN A;  4NUR A;  3ZHE B;  5C1D A;  4XKC A;  2FO7 A;  5EDS A;  2Y4T A;  4L2L A;  3FFL A;  3D9P A;  3ZEF A;  4J8E A;  3MEK A;  1LF8 A;  3L16 A;  3FDH A;  3HVE B;  5FZS A;  3SHF A;  1BPO A;  4ANV A;  2Y3A A;  4GYW A;  2C0L A;  5HI7 A;  3U66 A;  3CST A;  4A3T A;  4J6I A;  4FA6 A;  4OVU A;  2RD0 A;  3FEX A;  3MA5 A;  3FY4 A;  3EIJ A;  3QOU A;  5AJD A;  3ASG A;  3NZU A;  3ZPJ A;  3GYZ A;  4GAA A;  3LCA A;  1E8Z A;  3L08 A;  4U0S A;  4L2Y A;  4U04 A;  3PUK A;  3LDZ A;  3FHE A;  4WNG A;  4A1S A;  4CDM A;  3D3M A;  3KD7 A;  3SNX A;  3LVR E;  3Q49 B;  4FU3 A;  4HOS A;  3FTY A;  4MS6 A;  3I3N A;  2DBA A;  4UQY A;  4XX5 A;  3JUI A;  4U0U A;  4Y6C A;  5FWQ A;  3CVQ A;  1UW4 B;  2XRY A;  4KMO A;  2WMO A;  3LS8 A;  3D9L A;  4LCT A;  2I2O A;  2L9B A;  2MHK A;  4UI9 C;  4UWF A;  3UUX A;  3O4Z A;  2CG2 A;  3FH8 A;  5DIZ A;  4CRW A;  1N52 A;  2HR2 A;  2NC9 A;  3D9M A;  1WM5 A;  3L17 A;  5BW8 C;  5BPP A;  4FJZ A;  3LXU X;  5AYW D;  4KVO A;  2WXF A;  3MGB A;  5JJ7 A;  3FUK A;  1OWP A;  5HQ8 A;  3PNT B;  4YVO A;  2M63 A;  4MLP A;  5C2Y A;  4AVX A;  3CEQ A;  1P5Q A;  1QZ2 A;  2IU1 A;  1B89 A;  2WMN A;  4KZ0 A;  4WUY A;  5EX0 A;  2GRM A;  1A17 A;  1H6K A;  4EZJ A;  3CVX A;  3CIA A;  4CEM A;  4JEH A;  4CDR A;  4GU5 A;  2XCB A;  4JHR A;  3ASD A;  3ONL A;  3FP3 A;  3ZW3 A;  2I1K A;  3QWW A;  3QWV A;  2WXI A;  3ENE A;  1FVH A;  2WXK A;  2IQC A;  4I1O B;  2ILR A;  5LFA A;  4XKB A;  3ULQ A;  4I2Z A;  3CHM A;  3QB2 A;  5BT1 A;  4OVV A;  4KBQ A;  1VDY A;  3ESK A;  5BV1 A;  2LNI A;  3AS8 A;  3G2V A;  4PH4 B;  2AXZ A;  1PY1 A;  3ASF A;  3S2A A;  2X6F A;  3VLE A;  4C0E A;  2C2L A;  4CT0 A;  2BUG A;  1XGW A;  4DLQ A;  5FQ7 A;  2R5S A;  4RG9 A;  3Q15 A;  3IKO B;  3CK8 A;  3ESL A;  3U4T A;  1EPU A;  2CHW A;  4FHJ A;  2OOE A;  3IBE A;  4MKT A;  5LCW J;  4HOR A;  4XE0 A;  1NZN A;  4N5C A;  5D0Q D;  1KT1 A;  1KLX A;  3ZFW A;  3ASH A;  2BTD A;  3AU4 A;  3TL5 A;  4HOT A;  3LEW A;  4JHK A;  4PUC A;  3CVU A;  3Q47 B;  4TRQ A;  4ILH B;  1SZA A;  3FU3 A;  4EZL A;  4ILI A;  2L0T B;  3UQ3 A;  3QAR A;  2I6H A;  2CHZ A;  1NA0 A;  3APC A;  1HU3 A;  2V4L A;  2YQ8 A;  4PS7 A;  3CHR A;  4PDX A;  3ZYK A;  3LPZ A;  4WNF A;  3FWV A;  3EDT B;  4FAD A;  1Y8M A;  3FTZ A;  1HX8 A;  3U9W A;  3L22 A;  2X6H A;  4DLO A;  3RU0 A;  2AWI A;  3PRE A;  3RJV A;  4C9B B;  4ACK A;  2GRL A;  1H2U A;  2WVI A;  4J8D A;  4I6G A;  4UQX A;  1EDU A;  5CCM A;  2VGY A;  4XI9 A;  5G55 A;  1H19 A;  2WB2 A;  3PEV B;  2DIW A;  4I1M A;  3RRN B;  2FI7 A;  3OXL A;  3MJW A;  3QDN A;  3S7B A;  3TXM A;  4R7L A;  3VLD A;  3QNK A;  2YIN A;  4U0Z A;  3I4R B;  2OND A;  2J49 A;  3APD A;  1IHG A;  1GW6 A;  3B7U X;  4GYY A;  1Y6I A;  3CVY A;  4QFV A;  2WQ7 A;  3CVP A;  5M72 A;  4U63 A;  4FLH A;  3VLF A;  5LCW C;  3D9O A;  3IHY A;  3KS2 A;  4WNE A;  5FQ6 A;  2XQ0 A;  2WXR A;  1EYH A;  1UN8 A;  2IFU A;  3CQC B;  3FUE A;  4GA0 A;  5ANR A;  3GZ2 A;  3B7T A;  4XIF A;  1HE8 A;  4XI0 A;  3L13 A;  4Y6W A;  3ZVV A;  1H2V C;  2CHX A;  4LRZ A;  3S7F A;  3QWP A;  4UWG A;  4F3V A;  4AXH A;  2NXP A;  1PAQ A;  3QJZ A;  4TV3 A;  3D9K A;  5D0O D;  3URZ A;  5KJM A;  4UWK A;  3LKU A;  3QKY A;  2LAH A;  4AV7 A;  3UT4 A;  3RO2 A;  2DCP A;  2WXP A;  2PM7 A;  3TG4 A;  4G11 A;  4XZ4 A;  1TJC A;  2J09 A;  2J9Q A;  4JZY A;  1W3B A;  4ILG A;  3AS5 A;  2MRI A;  4H7X A;  1IQU A;  2X3M A;  4N2S A;  2Y4U A;  2KCK A;  2XCC A;  5ENN A;  3PVL A;  2XEV A;  4FP7 A;  2IOS A;  4I1A A;  3CKC A;  1E7V A;  3ML8 A;  4LEU A;  4JA7 A;  4B8A A;  3SZ7 A;  2IJG X;  3B7S A;  3T5X A;  3G2T A;  2KZT B;  2HO1 A;  3SI5 A;  4JPS A;  1NP7 A;  4DJA A;  4CGW A;  2YHC A;  3LJ3 A;  4IUL A;  5FTP A;  3FU0 A;  2JEK A;  4GMJ A;  2OV8 A;  1N54 A;  4F7A A;  2P58 C;  2AXV A;  5G04 J;  2XRZ A;  1FVF A;  2V0P A;  3PZD A;  4GCO A;  4UQZ A;  2UY1 B;  2WXH A;  3KAE A;  3FUD A;  4L1B A;  3U3W A;  1ZU2 A;  1E96 B;  1ELR A;  4UWL A;  1Z3Y A;  3FU5 A;  4I9E A;  4N3C A;  3JCK C;  3SF4 A;  2XPZ A;  4AY5 A;  1E7U A;  1U3C A;  3PUJ A;  4BTA A;  1WY6 A;  4EBA A;  1WAO 1;  4I43 A;  2GW1 A;  3TGO A;  1OWM A;  2VGX A;  4AY6 A;  1HXI A;  2WXG A;  1INZ A;  5FZR A;  4APO A;  2HM8 A;  1Z3X A;  1OUV A;  1MHQ A;  2XGS A;  4AEZ C;  4M3O A;  4Q96 A;  4RG6 A;  5CCL A;  3D9I A;  3KEZ A;  2RG8 A;  1HFA A;  3E4B A;  2I1J A;  1HF8 A;  3ONK A;  1HZ4 A;  5LP0 A;  4AIF A;  3PE3 A;  1DNP A;  3HYM B;  1E8W A;  3FTS A;  3RRU A;  3BG0 B;  1UJJ A;  4O6F A;  4HLE A;  4I2W A;  4BFR A;  5LX8 A;  3Q4A B;  4WWP A;  1X5B A;  3B13 A;  4KYO B;  5CMW A;  1OWN A;  3CHP A;  3ZN3 A;  3FTW A;  2J4D A;  5CHE E;  5EKQ D;  2AVP A;  2VGX B;  2WXJ A;  3OAW A;  5BNW A;  3SFZ A;  2OVB A;  3MYV A;  3QC1 A;  4HOU A;  5G04 C;  2WQ6 A;  4G23 A;  5JJT A;  2V5F A;  5T4Y A;  3LY9 A;  3GW4 A;  3IEG A;  4UI9 K;  3T5V A;  4U07 A;  4HS2 A;  4FC8 A;  4J0U A;  2WXO A;  4GCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...