5C2YA

Crystal structure of the saccharomyces cerevisiae rtr1 (regulator of transcription)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
SGMATIEDIKETALIPFQKHRQLSMHEAEVITLEIIGLLCDSECKDEKTLKYLGRFLTPDMYQDLVDERNLNKRCGYPLCGKSPERIRDPFSMNDTTKKFLLENNPYAYLSHYCSKFHFRCSQFYQVQLSDEALFARTGVHLFEDPEQDKHDIDFKVTLFEELLREKASEEDIKSLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase II subunit B1 CTD phosphatase RTR1
publication title Structure of Saccharomyces cerevisiae Rtr1 reveals an active site for an atypical phosphatase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 62
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04181 RPAP2_Rtr1 Rtr1/RPAP2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.820 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c2yA00
5C2YA 4FC8A 4M3OA
chains in the Genus database with same CATH superfamily
3CKBA 3ZU7B 1H6KA 5FZRA 2KCKA 3DEOA 2ETAA 2VSNA 2QZAA 4HOSA 2HE0A 4U04A 1TNZA 5ENOD 3HXCA 1HFAA 4EPZA 1D9SA 5AQAA 1P5QA 3DWLG 1A5EA 2PL2A 4YNDA 3T8MA 3D9MA 1H6PA 3QC1A 5ARGA 4N5QA 1UOHA 3NZSA 3AG2E 5JMND 4UQZA 3L54A 2C0MA 1BI7B 2Y69E 3SFYA 4LERA 5BV0A 2KATA 3JQ0A 1ELKA 2VGEA 3D9OA 4WWPA 3ESKA 4LNGA 2CG2A 4GU5A 3CVPA 5BNWA 3PVLA 3EUVA 1E7UA 2YNQA 1E8ZA 2VTBA 4N39A 3KS2A 3LDZA 3IXEA 4JHJA 3RRUA 5A23A 5J08A 3HHMA 3ZXPA 4KZ0A 1N94A 1DCQA 2NYJA 5BXOA 2A4ZA 3EDTB 3UKRG 4B94A 2R02A 2IJGX 1EPUA 4G8LA 3DRAA 4O6FA 3MCXA 4I17A 4FA6A 4N3BA 2EIJE 4PS8A 4HXIA 4CGWA 3CK7A 2YHCA 3U64A 2AXUA 4N5CA 3FUDA 3FUEA 5AJDA 2ILRA 3SO8A 3C3QA 4I1AA 4WNDA 2OOEA 2VSOE 2QYJA 3CKCA 4J0UA 4YDEA 1AWCB 3LPZA 3Q78A 4AY6A 4I9EA 2LSVA 3UM3A 2LO6A 3ONLA 1QBQA 4ZHBA 1N95A 3U9WA 2J4DA 4B89A 4KT6B 4A1GA 4J8SA 3JUIA 4HOQA 3FU6A 4FHJA 1IQRA 3UT7A 1UJJA 3U3WA 4DI3A 4ANWA 2ZU6B 5LCWJ 2VJ8A 1E8XA 3PEUB 3JXJA 4APFA 2UWJG 2E0IA 3ENEA 2PM6A 1OWMA 3E37A 4I2ZA 3TG5A 4K5AB 5A6CA 4UWLA 1OT8A 3ASNE 1V54E 1FVHA 4GTTA 4OVVA 2R17C 3UX4A 1MHQA 2IO2C 1JCSA 3JQ1A 4AV7A 1NA3A 5CEAA 2M63A 4C48B 4GTMA 1ELWA 2ZIRA 5CCLA 2X6KA 3MJWA 4GCNA 3DPDA 5IY5E 5FINA 1WAO1 3ZVVA 5BUZA 1JWFA 2XEEA 3G2UA 3MV2B 4JC8A 2I1JA 4JVSA 2X6JA 1OY3D 2DCPA 3CHQA 3Q49B 5AQ9A 3V2XA 4MKTA 2CFUA 3PZ3A 3QARA 2VGXA 4HNAD 2AXZA 3Q79A 2XHEA 3T9KA 2XGMA 4JEHA 4F1SA 1H2TC 1KZPA 3MKRA 3UM1A 4N2SA 3Q7AA 3L08A 3CVUA 2H6FA 3ZGQA 3DSUA 3CV0A 4OYSA 3TJPA 1U3DA 2IY0C 3FTZA 4HBDA 4JHRA 1BPOA 3FEYA 4YDYA 2WQHA 5B1BE 3DPYA 5ENPD 3NOCD 4HI8A 5HI7A 4GTRA 2OEVA 5ANRA 4UI9C 4UQYA 4J7WA 4DX1A 3UPVA 1ZB1A 5LX8A 3CVYA 3CQCB 4EECA 5G05J 2XZDG 3ZNGA 1TJCA 1TNBA 3FDHA 2IQCA 3CSFA 4UUCA 3UM2A 5DBKA 1EF1C 3U66A 3SGHA 3KSQA 5JHAA 5CBOA 2XEVA 2CFZA 2RFMA 4EBAG 3VTYA 3TWWA 4JA9A 3IBEA 3ZRHA 4GPMA 2WVIA 4LSZE 3UIOC 2WM9A 3KD7A 2F37A 1YYHA 4MRUA 2WXNA 4CZ2D 5CECB 1D8EA 4I1OB 1HG5A 5LP0A 3Q9NC 3EHRA 4XX5A 2GRNB 1TR4A 4U0UA 5ANLA 1UW4B 3TAXA 2C0LA 4ILGA 1IHGA 2KC7A 5FTPA 5CRUA 5LCWC 4F3VA 3RO2A 2RKKA 1OWPA 3NAWA 5CCMA 1XNFA 3S7DA 2PZIA 4APOA 3CHOA 3ESLA 5AENA 4G25A 3FUJA 3T5VA 3GZ1A 3OXLA 1QQEA 3PEVB 2JEKA 3V31A 3CVNA 5CMWA 1OWOA 1SW6A 4LNUD 1U2VG 5FJYA 2FULA 2A5UA 5FQ6A 2YHEA 3S7FA 4CDNA 4TUMA 1TN7A 2F0YA 4HRMB 3AS4A 4TUUA 2J9QA 2FF4A 3E34A 3KEZA 5EILA 1Q2ZA 1OCCE 4NQ0A 4U96D 3FTVA 3PH0C 3DBSA 1O1SA 5EX3A 3N71A 4KVOA 3LS8A 1K3ZD 3ZYMA 2ZGGA 3E33A 2X6FA 1D8DA 2I9CA 3IHYA 1FCHA 1LD7A 4CGVA 1N4PA 2EIME 2Y4TA 3J5PA 4CEMA 1U3CA 2MOWA 3SI5A 2HR2A 5BXUA 4CDMA 3FTSA 5KJNA 3FUNA 4V3IA 4GYOA 4G8KA 4CCAA 5FZSA 2BEDA 4O1OA 3FUIA 2XCBA 3CR3A 4OAVB 3CHPA 4HOUA 2XGOA 2WXLA 2P2CP 3QNKA 5G55A 3CVXA 4LUNU 5FIOA 1JPLA 4KBQA 5G05C 4G26A 2KCVA 3RU0A 3OTNA 3HXFA 3HXEA 4F7AA 4I2WA 2OV8A 2WB2A 2XPZA 2H6IA 3ULYA 3Q47B 1PC2A 3PE3A 4GA2A 3FP3A 4HB5A 4RLYA 3UXGA 2ONDA 2CHXA 3DSXA 3FHEA 3C3RA 4BFRA 1OWLA 2L6JA 4Z68A 4K5CA 4DX7D 1Y8MA 2KBXA 4UWGA 4DI4A 3CVLA 4N3CA 4DJAA 4O1PA 2GRPB 2AXVA 4U0ZA 4GYYA 5B3SE 1FPPA 3X2QE 5AQ7A 4YVOA 5FZQA 3FH7A 5FQ4A 3SQVA 4URKA 2MHKA 1MX4A 2VYIA 4UWHA 2LUHA 4GTPA 4J8DA 1OCOE 2L9BA 4AXHA 2WMNA 1INZA 4GA1A 3FTXA 2WXJA 3P1UA 4WWOA 2GROB 4PH4B 3ASDA 3FU3A 2CHWA 3PE4A 4WUYA 2Y4UA 3CQGB 3L13A 2P9UG 3V2OA 2UY1B 3CLJA 5JHBA 3I5PA 3MV3B 1HF8A 2X3MA 2BKGA 3ZHEA 3HIZA 1IXVA 3NBNB 2XGSA 2XEHA 2XS1A 1H6OA 4J8FA 1HZ4A 4QFVA 3MYVA 4PS3A 1H2UA 3ZYKA 1TNUA 4MS6A 3G2VA 1ZBPA 4GYWA 2NXPA 4X8QA 4GA0A 4GCOA 4JXTA 3TWVA 3EHQA 4ACLA 3CHRA 4FU3A 4ANVA 1OCZE 2VGYA 1H19A 1OXJA 5E75A 3O48A 2Y0BG 4QQIA 4Y6WA 4GZ3A 3HVEB 3B13A 4B93B 4J6IA 4BEPA 5KWDA 4K0RA 1WY6A 4DLOA 1N11A 2P9NG 4B8AA 4J8EA 3FU5A 2F8YA 2WQ6A 3D9PA 1MJ0A 3E30A 4TXPA 1Z3XA 4M7CA 3NB2A 4L1BA 2BF0X 2FI7A 3GYZA 1G3NB 2BUGA 2QC9A 2XQ0A 4CDRA 4JB8P 1HE8A 1TNYA 4B0ZA 4E85A 4CYMD 3ZFWA 4I1MA 4HOTA 5KCMA 3GW4A 5AQBA 3ABME 1HXIA 4ACKA 3C98A 4BY6A 4HS2A 3B7TA 5CHEE 3VLDA 3HDXA 3NQPA 4FC8A 3E32A 1N0QA 4JD2G 3R7QA 4GTVA 4G2VA 5D2MC 3APDA 2V5QC 1RZ4A 2WXHA 4PUCA 1TEZA 2CHZA 4K5BA 3ML9A 3UMVA 3MKQB 4JL0A 2QY7A 3MZLB 4DPRA 4IRUA 3SY2A 3TWUA 2J09A 3NF1A 4AY5A 4KXKB 3TXNA 4C0MA 5CBNA 3UI2A 4IYPA 3BG0B 2VGXB 2LAHA 3IEGA 3EHNA 4U63A 3LY9A 3ZYQA 2L0IA 1LF8A 3AG4E 2WPVA 3SBSA 2CG3A 3PZDA 3PUJA 4WWNA 4XKBA 4J8YA 4ATZD 3PNLB 3CK9A 3JCKC 2LSUA 4A55A 3CHSA 3Q4AB 2VSXE 2FEZA 1O5MA 1N52A 1JUQA 5EYPF 3EIJA 2XENA 3I4GA 1E90A 2PQRA 3B7BA 3QKYA 3UM0A 2RG8A 3LCAA 1TJFA 3QWVA 3UT8A 5J90A 2J8SD 2IOLA 1XGWA 2PM7A 3C72A 3S2AA 3UUXA 2P9LG 3UIPC 3TGOA 4H7YA 3FTUA 2OCCE 5FQ7A 2GRLA 3OXGA 3ONKA 2QYUA 4U07A 5T4YA 2IO3C 1BLXB 4KYOB 3ULEG 4K03A 3BEEA 4FJZA 3SNXA 1SA5A 3ZXSA 4AP2A 3LVQE 2MYOA 4F1PA 3HXDA 3LVRE 1HX8A 5D0QD 2KZTB 3QB2A 3VLFA 4L2YA 4I9CA 3L17A 1K1AA 2B0OE 3O4ZA 1MX2A 5KBAA 1S64A 4GAAA 4L2LA 1KZOA 3SF4A 5H7PA 1X5BA 3CK8A 3FUHA 4Q94A 2LXLA 3OAWA 1B89A 4LCTA 1WM5A 4DK5A 5G2NA 3EU9A 3R9AB 3WXXA 1TN6A 1DNPA 2RD0A 1H2VC 2LXMA 1GW6A 4HRNA 1KLXA 2R5SA 3FTWA 1SZ9A 2Y3AA 3R9MA 4RG6A 3MEKA 4HI9A 2XRYA 1N54A 2V8SE 4JPSA 3D9KA 3FFLA 4N3AA 5BV1A 2IONA 3MA5A 3AAAC 4AVXA 4XE0A 3Q5MA 4HRLA 3CVWA 3VLEA 3WG7E 2LNIA 3HG0D 1DCEA 2KXPC 3B95A 2WXIA 4R7LA 1O1RA 3RSEG 3Q7FA 3P2BA 3DEPA 3PZ4A 4L9PA 4U0SA 5EDSA 4XI0A 2V4HC 5HS0A 4GB9A 4EZLA 4I6JA 3ASGA 1KT1A 3NZUA 1TNOA 2KCLA 3LYAA 5FQ8A 3ZPJA 1UN9A 2ETBA 1MZCA 5ENNA 4OVUA 3S7JA 1LTXA 3RKVA 1SQMA 3D9IA 3TWXA 3QDNA 3FTYA 2VSYA 3LXUX 3RO3A 2WMOA 4RQIA 5JA4D 4CT4A 4U95D 3CGHA 3R7RA 4B8CB 3BG1B 5EIBE 5EIDA 2FO1E 3ABLE 4JHKA 4EZJA 1VDYA 2J08A 3FWVA 3QOUA 2HO1A 1UJKA 2BTDA 4TV3A 5KNHD 3PRZA 4U8VD 3F6QA 3FH5A 3CHMA 2DYSE 2AVPA 5EYLA 2EIKE 4GTSA 3RAUA 2R59A 3ABKE 4FHKA 4BT9A 1YMPA 2WXRA 2XPYA 3PS6A 3D3MA 2WXQA 4LG6A 5HQ8A 4DUIA 3MGBA 5BW8C 4FADA 3C3OA 5ARFA 2WXPA 1N4QA 2B6CA 3GZSA 3SD5A 1JCRA 1S63A 3ZIMA 2NSZA 3FUFA 2IU1A 4ILHB 4KMOA 5BT1A 4W9RA 4XZ4A 3SFXA 2DZOA 4YDOA 4ME2A 2AWIA 2EILE 2DYRE 5B1AE 5G04J 3ZKJA 3G2TA 4TXRA 3DSSA 3ZHEB 4KZCA 3IV0A 5ENTD 4HVBA 1KT0A 3IKOB 4BSXA 2JLBA 3TXMA 1NZNA 3DSWA 2EINE 1W3BA 2OVFA 1QZ2A 5KJMA 4U8HA 2VTBB 4AIFA 4XI9A 3PZ1A 3Q73A 3ASHA 4GZ6A 3Q15A 4WAFA 3RIBA 3TG4A 5AJLA 1K8KG 4FP7A 3EHMA 2J4BA 1WG0A 3K9IA 3D9HA 2X6IA 1Z5SC 2HYZA 4FULA 1NFIE 1HS6A 3BUAA 4BSZB 3RRNB 2P9KG 2UY1A 3W9GA 3UTMA 3QK0A 2KM4A 3QWWA 5AAOA 2I6HA 2FO7A 4IN3B 4ZFHA 5HRYA 2ZGDA 3JXIA 4C0EA 2P9PG 5AARA 2XS8A 5LOZA 3JYSA 5LFAA 4HORA 3HYMB 3RJVA 4JEUA 2MRIA 3B7RL 4UI9J 2YINA 4LEUA 1AP7A 4ABNA 3JUEA 1IQUA 4DX5D 2PNNA 3PZ2A 5FT9A 3V79K 5C1DA 4FJYA 5E76A 3T5XA 4BESA 3HVEA 1EYHA 4A1SA 3FUMA 2A5EA 3EIQC 3LY8A 4GMJA 4D10C 3CIAA 4JW1A 3C5RA 5EX0A 5JJ7A 5KJKA 2OVBA 4NIKA 3BU8A 3EU5A 4XKCA 3U4TA 5HKPA 3ZYLA 1IKND 1ZU2A 3ML8A 4HQDA 3EJNA 3G2WA 4UI9K 4HLEA 1Z3YA 3QAQA 1E7VA 2XCCA 2XPIA 1O1TA 4I43A 1UN8A 2DBAA 5AN8A 4ATGA 4P29A 5KJLA 3DSTA 5JJTA 2ZXWE 1FT2A 1PY1A 1WDYA 4GZDA 3ZW3A 3NOGD 1UG3A 3ZUVB 1HG2A 3I4RB 2IFUA 3W9FA 2PQNA 2V0PA 5AIJA 2GGFA 1TYQG 5M72A 4AOFA 4BTBA 3DXMG 2DZNA 2Q7FA 3BQOA 4BETA 2OEWA 5JJ6A 5G04C 3HRAA 1A17A 4JA7A 1KPSB 3APCA 1E96B 1IHBA 3FEXA 2Y1LE 3AJIA 3MKQA 4MBGA 3B7SA 5D66A 1BI8B 3CVQA 4CRWA 4GZCA 4MLPA 2L0TB 3D9NA 4KVMA 3TWSA 3SHFA 2DIWA 4C9BB 2IOSA 5D0OD 1H0AA 3APFA 4BERA 1QYMA 3OXFA 1N9AA 1HU3A 1Y6IA 3UINC 2P9IG 1L5JA 3VTXA 4DX2A 4FLBA 3AU4A 3SFZA 2HM8A 2XZTG 5CMYA 4DX6D 5DIZA 4EBAA 3SBTB 3L16A 4DRXE 4XEIG 4XIFA 2J49A 3RRMB 3L22A 4BX8A 3PDNA 4RSYA 1NL4A 1OUVA 1QNFA 4L7TA 2AW6A 1S70B 3V30A 4JZYA 2XRZA 3LEWA 4YVQC 4HFGA 3Q9UC 4GMRA 2GRRB 5CEDB 2F8XK 2P9SG 3TWQA 2DWZA 3KAEA 4AJWA 3PNTB 4HLLA 5EN5D 3FUKA 4PDXA 3G2SA 1EDUA 2H6GA 3AS8A 3ZN3A 2WXMA 2J07A 1HO8A 2WQ7A 4YDWA 3Q75A 2ZISA 3LKUA 4ILIA 2WXKA 2VQ2A 4GZ5A 3I3NA 2L6BA 5BPPA 2R2LA 5C2YA 2X6HA 4WNEA 4GMLA 5EKQD 2AJAA 3KSLA 4Y6CA 2ETCA 4NRHB 2KZTA 2GW1A 3ZEFA 3B7UX 3LJNA 4PS7A 1E8YA 3FULA 2NC9A 2EQXA 3FU0A 5ENRD 4DLQA 2RFAA 5T3RA 4GTQA 3TWTA 3FH8A 4WNGA 1RW2A 5ENSD 1NI1A 5KNGA 3TL5A 4BT8A 5T8IA 3KEAA 2YQ8A 4G24A 2GRQB 1JCQA 4U7EB 1YCSB 4A3TA 4IULA 3AG1E 2R05A 1MX6A 3ASFA 1N4RA 2IF4A 2FBNA 1SZAA 2IEJA 4BX9A 5A7DB 3LY7A 2P58C 3DXKG 3UQ3A 4EZKA 3QWPA 4UQXA 4N2QA 3GZ2A 1TN8A 2I1KA 2DVWA 1K1BA 3UT4A 3SZ7A 3QJZA 4G1TA 1NP7A 2V4LA 3AU5A 4UWFA 4Q69A 3CVVA 1NA0A 3CEQA 3URZA 1BD8A 4WNFA 3L9TA 2WXOA 3ULQA 4U8YD 3T8KA 1YA0A 4NACA 1IYGA 1MYOA 4LNBA 4G23A 1X81A 4BTAA 3LJ3A 3L6AA 1E8WA 3ASOE 2WXFA 2I2OA 3UKUG 3AS5A 3PREA 1MQSA 4EHMA 2QFCA 4BWRA 2X38A 3L82A 4GPKA 4H7XA 4I6GA 5CERB 3RK6A 5ITZF 2GRMA 5AYWD 3MX3A 2LAIA 4I6EA 4ANUA 3IHVA 4ANXA 4TRQA 4G11A 3TWRA 4AEZC 3AG3E 4OAUC 4A63B 5CRVA 5FWQA 3ISMC 1S0PA 1Z6TA 4TXQA 1JWGA 1N0RA 3HXBA 3CSTA 3PUKA 4E6HA 1SA4A 3D9JA 5ENQD 1FVFA 4F6RD 2R03A 4O60A 2V5FA 1OCRE 4M3OA 4FLHA 1LD8A 1FT1A 4RG9A 2JABA 4RVBA 4A3VA 1ELRA 3D9LA 3E4BA 2WXGA 1HH8A 1OWNA 4NURA 2E2EA 4GTOA 1DC2A 4Q96A 3FY4A 1V55E 4AM9A 2H6HA 4EQFA 3J5QB 1PAQA 4LRZA 1BU9A 1DVPA 2C2LA 3S7BA 4CT0A 1N4SA 3DSVA 2BKKB 4UWKA 4L23A 1SVXA 4F53A
chains in the Genus database with same CATH topology
3CKBA 3UUXA 1H6KA 5FZRA 2KCKA 3G2WA 4NQ0A 4UI9K 4HLEA 1Z3YA 3QAQA 2VSNA 3TGOA 1E7VA 3FTVA 2XCCA 2XPIA 3PH0C 3DBSA 4I43A 4HOSA 4H7YA 3FTUA 1UN8A 2GRLA 3N71A 4KVOA 3OXGA 5EX3A 5FQ7A 3LS8A 3ONKA 4U07A 2DBAA 4U04A 5T4YA 4KYOB 4K03A 1HFAA 4EPZA 1P5QA 3BEEA 4FJZA 3SNXA 2PL2A 4ATGA 4YNDA 4P29A 3ZYMA 3ZXSA 4AP2A 3T8MA 5JJTA 5KJLA 3LVQE 2X6FA 3D9MA 2I9CA 3IHYA 1PY1A 1FCHA 3QC1A 5ARGA 4GZDA 3LVRE 4CGVA 1HX8A 3ZW3A 3NZSA 1UG3A 4UQZA 3L54A 5D0QD 2KZTB 2Y4TA 2C0MA 3QB2A 1U3CA 4CEMA 3VLFA 4LERA 4L2YA 1HG2A 4I9CA 5BV0A 3L17A 2KATA 3I4RB 2IFUA 2MOWA 3JQ0A 3O4ZA 3SI5A 1ELKA 2HR2A 2V0PA 2PQNA 3D9OA 4WWPA 5AIJA 4GAAA 4CDMA 2GGFA 3FTSA 3ESKA 4L2LA 5M72A 3SF4A 2CG2A 4AOFA 4BTBA 5KJNA 4GU5A 3CVPA 1X5BA 3FUNA 2Q7FA 4GYOA 3CK8A 3PVLA 4V3IA 5BNWA 3FUHA 4Q94A 4CCAA 5FZSA 3OAWA 1E7UA 1B89A 2YNQA 3FUIA 1E8ZA 4LCTA 5JJ6A 2XCBA 3CR3A 5G04C 3CHPA 1WM5A 4DK5A 5G2NA 3R9AB 1A17A 4HOUA 4JA7A 3WXXA 2VTBA 2XGOA 3APCA 1E96B 2WXLA 3QNKA 1DNPA 2RD0A 3FEXA 1H2VC 5G55A 1GW6A 3CVXA 3MKQA 1KLXA 4LUNU 1JPLA 2R5SA 4KBQA 5G05C 3FTWA 4N39A 3KS2A 3B7SA 3LDZA 1SZ9A 2Y3AA 2KCVA 4G26A 4JHJA 3RRUA 3RU0A 3OTNA 4RG6A 5A23A 5J08A 3HHMA 3MEKA 4KZ0A 4F7AA 4I2WA 2OV8A 2WB2A 2XRYA 2XPZA 2A4ZA 3EDTB 1N54A 2V8SE 3CVQA 4JPSA 4CRWA 4B94A 3D9KA 2IJGX 3Q47B 1EPUA 4GZCA 1PC2A 4MLPA 3FFLA 4N3AA 5BV1A 4O6FA 3PE3A 2IONA 3MCXA 4GA2A 2L0TB 4I17A 4FA6A 3FP3A 3D9NA 4KVMA 4N3BA 3MA5A 4PS8A 4AVXA 4HXIA 3SHFA 4CGWA 3CK7A 4XE0A 3Q5MA 2YHCA 3U64A 2DIWA 2ONDA 3CVWA 2CHXA 2AXUA 4N5CA 4C9BB 3VLEA 2IOSA 5D0OD 4AJWA 3FUDA 1H0AA 3FUEA 2LNIA 3FHEA 3APFA 5AJDA 2ILRA 4I1AA 4WNDA 4BFRA 2WXIA 4R7LA 1OWLA 2L6JA 3OXFA 1HU3A 1Y6IA 2OOEA 1Y8MA 4UWGA 4DI4A 2VSOE 1L5JA 3P2BA 3CKCA 4J0UA 3VTXA 3CVLA 4N3CA 4U0SA 4FLBA 4DJAA 3AU4A 5EDSA 3SFZA 2AXVA 3LPZA 4XI0A 4AY6A 4I9EA 4U0ZA 2HM8A 5CMYA 4GYYA 4GB9A 2LSVA 4I6JA 4EZLA 3ASGA 5DIZA 4YVOA 5FZQA 4EBAA 3SBTB 3FH7A 5FQ4A 1KT1A 3NZUA 4URKA 2LO6A 2KCLA 2MHKA 3LYAA 3L16A 3ONLA 5FQ8A 3ZPJA 2VYIA 4UWHA 1UN9A 4XIFA 2J49A 3U9WA 2J4DA 4B89A 3RRMB 4J8DA 4KT6B 3L22A 2L9BA 4AXHA 2WMNA 4BX8A 3PDNA 4J8SA 4A1GA 1INZA 4GA1A 4RSYA 5ENNA 3FTXA 1OUVA 1QNFA 2WXJA 3JUIA 3P1UA 4OVUA 4HOQA 3S7JA 3FU6A 4WWOA 3RKVA 4L7TA 2AW6A 4FHJA 1SQMA 4PH4B 3ASDA 3D9IA 4JZYA 2XRZA 3FU3A 3LEWA 4YVQC 3QDNA 4HFGA 1IQRA 2CHWA 3PE4A 3UT7A 1UJJA 3U3WA 4DI3A 3FTYA 4WUYA 2VSYA 3LXUX 3RO3A 4ANWA 2Y4UA 2ZU6B 5LCWJ 2WMOA 3CQGB 2VJ8A 1E8XA 3L13A 3PEUB 4CT4A 2UY1B 2UWJG 3CLJA 4APFA 5JHBA 2E0IA 3I5PA 3ENEA 3KAEA 2PM6A 3PNTB 1OWMA 3FUKA 3G2SA 4PDXA 3MV3B 4I2ZA 1HF8A 3CGHA 3R7RA 3TG5A 3BG1B 4B8CB 5A6CA 1EDUA 2X3MA 4UWLA 3ZHEA 3AS8A 3ZN3A 2WXMA 4JHKA 2J07A 1HO8A 4EZJA 1VDYA 3HIZA 2WQ7A 2J08A 3FWVA 3LKUA 3QOUA 4ILIA 1FVHA 2XGSA 4OVVA 2R17C 3UX4A 2WXKA 4J8FA 1MHQA 1HZ4A 2HO1A 4QFVA 2VQ2A 3JQ1A 4AV7A 1NA3A 3MYVA 1UJKA 4GZ5A 2BTDA 4PS3A 1H2UA 4TV3A 3I3NA 2M63A 3PRZA 3ZYKA 5BPPA 3FH5A 3CHMA 1ELWA 2X6HA 5C2YA 2AVPA 4MS6A 3G2VA 1ZBPA 4GYWA 4WNEA 5CCLA 4GMLA 2X6KA 3MJWA 4GCNA 5EKQD 2NXPA 3DPDA 4GA0A 4GCOA 2R59A 4JXTA 4FHKA 4NRHB 4Y6CA 2KZTA 1WAO1 2GW1A 3ZVVA 3ZEFA 5BUZA 1JWFA 3G2UA 3CHRA 3MV2B 4ACLA 4BT9A 4FU3A 3B7UX 4PS7A 1E8YA 2WXRA 4JC8A 2I1JA 3FULA 4ANVA 2XPYA 4JVSA 2VGYA 1H19A 2NC9A 3D3MA 3PS6A 3O48A 2WXQA 5E75A 4Y6WA 2X6JA 2DCPA 4GZ3A 2EQXA 5HQ8A 3FU0A 3HVEB 3CHQA 3MGBA 5BW8C 3B13A 4FADA 3Q49B 4J6IA 4MKTA 5ARFA 2CFUA 2WXPA 4DLQA 4K0RA 5T3RA 1WY6A 3QARA 2VGXA 4DLOA 2AXZA 3FH8A 4WNGA 4B8AA 4J8EA 2XHEA 3GZSA 2XGMA 4JEHA 3SD5A 3FU5A 4F1SA 2WQ6A 1H2TC 3ZIMA 3D9PA 3MKRA 4BT8A 3TL5A 4N2SA 3L08A 2NSZA 3CVUA 3ZGQA 3FUFA 5T8IA 1Z3XA 2IU1A 2YQ8A 4G24A 4ILHB 4L1BA 3CV0A 4A3TA 4IULA 2BF0X 1U3DA 2FI7A 3FTZA 4OYSA 4KMOA 3GYZA 3ASFA 3TJPA 2IF4A 5BT1A 2BUGA 2FBNA 1SZAA 4W9RA 4BX9A 2XQ0A 4JHRA 4CDRA 5A7DB 1BPOA 3LY7A 4XZ4A 2P58C 1HE8A 3FEYA 3UQ3A 4B0ZA 4EZKA 2WQHA 3QWPA 4UQXA 4N2QA 4E85A 4ME2A 3GZ2A 2I1KA 2AWIA 3ZFWA 4I1MA 4HOTA 5KCMA 3GW4A 1HXIA 5HI7A 5G04J 3SZ7A 3UT4A 4ACKA 5ANRA 3QJZA 4UI9C 4UQYA 4G1TA 3C98A 4BY6A 3G2TA 4HS2A 3B7TA 3ZHEB 4KZCA 5CHEE 1NP7A 3IV0A 3VLDA 3UPVA 2V4LA 3AU5A 4UWFA 4Q69A 5LX8A 3HDXA 3CVYA 3CVVA 3CQCB 1NA0A 3NQPA 4FC8A 4EECA 4HVBA 1KT0A 3IKOB 3CEQA 5G05J 3URZA 2JLBA 4BSXA 1TJCA 3FDHA 3TXMA 4WNFA 2IQCA 3CSFA 3R7QA 2WXOA 4G2VA 1NZNA 3ULQA 5DBKA 1EF1C 3APDA 1YA0A 4NACA 3U66A 3SGHA 5JHAA 2WXHA 2CFZA 2XEVA 1W3BA 2OVFA 4EBAG 1IYGA 4G23A 1QZ2A 3VTYA 4PUCA 4BTAA 3LJ3A 3L6AA 1TEZA 5KJMA 4U8HA 2VTBB 1E8WA 4AIFA 2WXFA 2I2OA 2CHZA 4XI9A 3ML9A 3ASHA 4GZ6A 3UMVA 3MKQB 3Q15A 3IBEA 4JA9A 4WAFA 3RIBA 3AS5A 3ZRHA 4JL0A 3PREA 3TG4A 2QY7A 5AJLA 3MZLB 2WVIA 1MQSA 4DPRA 4IRUA 4FP7A 2QFCA 3EHMA 2WM9A 3KD7A 4BWRA 2J4BA 3K9IA 2X38A 2J09A 2X6IA 3NF1A 4GPKA 2HYZA 4FULA 4AY5A 4KXKB 3TXNA 1HS6A 4MRUA 4C0MA 4H7XA 2WXNA 3RRNB 4IYPA 2UY1A 3BG0B 3QK0A 2KM4A 4I1OB 1HG5A 4I6GA 3QWWA 5LP0A 3RK6A 2VGXB 2I6HA 2FO7A 4IN3B 2GRMA 5AYWD 2LAHA 3IEGA 3MX3A 3EHNA 2LAIA 4I6EA 4U63A 4XX5A 3IHVA 3LY9A 3ZYQA 4ANUA 2L0IA 4ANXA 4TRQA 4U0UA 5ANLA 4C0EA 1LF8A 1UW4B 3TAXA 4G11A 2C0LA 2WPVA 4ILGA 3SBSA 4AEZC 2CG3A 1IHGA 2KC7A 3JYSA 3PZDA 5FTPA 5LOZA 5LFAA 3HYMB 4HORA 5FWQA 3PUJA 5LCWC 3RJVA 4F3VA 1S0PA 1Z6TA 4WWNA 4XKBA 3RO2A 1OWPA 1JWGA 3PNLB 4JEUA 5CCMA 2MRIA 3B7RL 4UI9J 2YINA 3CK9A 3JCKC 1XNFA 2LSUA 4A55A 3CSTA 3PUKA 4LEUA 4E6HA 3CHSA 3Q4AB 3S7DA 2PZIA 4APOA 2VSXE 2FEZA 3CHOA 3D9JA 3ESLA 4ABNA 5AENA 1IQUA 4G25A 1FVFA 1N52A 3FUJA 3T5VA 3GZ1A 3OXLA 1QQEA 3PEVB 1JUQA 2JEKA 2V5FA 3CVNA 3EIJA 5FT9A 4M3OA 4FLHA 5CMWA 4RG9A 5C1DA 3I4GA 1OWOA 4RVBA 1E90A 4FJYA 2PQRA 5E76A 4A3VA 1ELRA 3D9LA 3E4BA 3QKYA 3T5XA 2RG8A 5FJYA 2WXGA 3HVEA 1EYHA 1HH8A 2FULA 1OWNA 4NURA 4A1SA 2E2EA 3FUMA 2A5UA 3LCAA 3EIQC 4GMJA 3LY8A 1TJFA 4Q96A 3FY4A 4D10C 3QWVA 4AM9A 5FQ6A 3CIAA 2YHEA 3S7FA 3UT8A 4JW1A 4EQFA 4CDNA 1PAQA 5EX0A 5JJ7A 5KJKA 2OVBA 4LRZA 5J90A 1DVPA 2C2LA 3S7BA 4TUUA 3AS4A 2IOLA 2J9QA 4XKCA 3U4TA 4CT0A 2FF4A 1XGWA 2PM7A 4UWKA 4L23A 3ZYLA 3KEZA 1ZU2A 3ML8A 4F53A 3EJNA 3S2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2Y A;  4FC8 A;  4M3O A; 
#chains in the Genus database with same CATH topology
 3CKB A;  3ZU7 B;  1H6K A;  5FZR A;  2KCK A;  3DEO A;  2ETA A;  2VSN A;  2QZA A;  4HOS A;  2HE0 A;  4U04 A;  1TNZ A;  5ENO D;  3HXC A;  1HFA A;  4EPZ A;  1D9S A;  5AQA A;  1P5Q A;  3DWL G;  1A5E A;  2PL2 A;  4YND A;  3T8M A;  3D9M A;  1H6P A;  3QC1 A;  5ARG A;  4N5Q A;  1UOH A;  3NZS A;  3AG2 E;  5JMN D;  4UQZ A;  3L54 A;  2C0M A;  1BI7 B;  2Y69 E;  3SFY A;  4LER A;  5BV0 A;  2KAT A;  3JQ0 A;  1ELK A;  2VGE A;  3D9O A;  4WWP A;  3ESK A;  4LNG A;  2CG2 A;  4GU5 A;  3CVP A;  5BNW A;  3PVL A;  3EUV A;  1E7U A;  2YNQ A;  1E8Z A;  2VTB A;  4N39 A;  3KS2 A;  3LDZ A;  3IXE A;  4JHJ A;  3RRU A;  5A23 A;  5J08 A;  3HHM A;  3ZXP A;  4KZ0 A;  1N94 A;  1DCQ A;  2NYJ A;  5BXO A;  2A4Z A;  3EDT B;  3UKR G;  4B94 A;  2R02 A;  2IJG X;  1EPU A;  4G8L A;  3DRA A;  4O6F A;  3MCX A;  4I17 A;  4FA6 A;  4N3B A;  2EIJ E;  4PS8 A;  4HXI A;  4CGW A;  3CK7 A;  2YHC A;  3U64 A;  2AXU A;  4N5C A;  3FUD A;  3FUE A;  5AJD A;  2ILR A;  3SO8 A;  3C3Q A;  4I1A A;  4WND A;  2OOE A;  2VSO E;  2QYJ A;  3CKC A;  4J0U A;  4YDE A;  1AWC B;  3LPZ A;  3Q78 A;  4AY6 A;  4I9E A;  2LSV A;  3UM3 A;  2LO6 A;  3ONL A;  1QBQ A;  4ZHB A;  1N95 A;  3U9W A;  2J4D A;  4B89 A;  4KT6 B;  4A1G A;  4J8S A;  3JUI A;  4HOQ A;  3FU6 A;  4FHJ A;  1IQR A;  3UT7 A;  1UJJ A;  3U3W A;  4DI3 A;  4ANW A;  2ZU6 B;  5LCW J;  2VJ8 A;  1E8X A;  3PEU B;  3JXJ A;  4APF A;  2UWJ G;  2E0I A;  3ENE A;  2PM6 A;  1OWM A;  3E37 A;  4I2Z A;  3TG5 A;  4K5A B;  5A6C A;  4UWL A;  1OT8 A;  3ASN E;  1V54 E;  1FVH A;  4GTT A;  4OVV A;  2R17 C;  3UX4 A;  1MHQ A;  2IO2 C;  1JCS A;  3JQ1 A;  4AV7 A;  1NA3 A;  5CEA A;  2M63 A;  4C48 B;  4GTM A;  1ELW A;  2ZIR A;  5CCL A;  2X6K A;  3MJW A;  4GCN A;  3DPD A;  5IY5 E;  5FIN A;  1WAO 1;  3ZVV A;  5BUZ A;  1JWF A;  2XEE A;  3G2U A;  3MV2 B;  4JC8 A;  2I1J A;  4JVS A;  2X6J A;  1OY3 D;  2DCP A;  3CHQ A;  3Q49 B;  5AQ9 A;  3V2X A;  4MKT A;  2CFU A;  3PZ3 A;  3QAR A;  2VGX A;  4HNA D;  2AXZ A;  3Q79 A;  2XHE A;  3T9K A;  2XGM A;  4JEH A;  4F1S A;  1H2T C;  1KZP A;  3MKR A;  3UM1 A;  4N2S A;  3Q7A A;  3L08 A;  3CVU A;  2H6F A;  3ZGQ A;  3DSU A;  3CV0 A;  4OYS A;  3TJP A;  1U3D A;  2IY0 C;  3FTZ A;  4HBD A;  4JHR A;  1BPO A;  3FEY A;  4YDY A;  2WQH A;  5B1B E;  3DPY A;  5ENP D;  3NOC D;  4HI8 A;  5HI7 A;  4GTR A;  2OEV A;  5ANR A;  4UI9 C;  4UQY A;  4J7W A;  4DX1 A;  3UPV A;  1ZB1 A;  5LX8 A;  3CVY A;  3CQC B;  4EEC A;  5G05 J;  2XZD G;  3ZNG A;  1TJC A;  1TNB A;  3FDH A;  2IQC A;  3CSF A;  4UUC A;  3UM2 A;  5DBK A;  1EF1 C;  3U66 A;  3SGH A;  3KSQ A;  5JHA A;  5CBO A;  2XEV A;  2CFZ A;  2RFM A;  4EBA G;  3VTY A;  3TWW A;  4JA9 A;  3IBE A;  3ZRH A;  4GPM A;  2WVI A;  4LSZ E;  3UIO C;  2WM9 A;  3KD7 A;  2F37 A;  1YYH A;  4MRU A;  2WXN A;  4CZ2 D;  5CEC B;  1D8E A;  4I1O B;  1HG5 A;  5LP0 A;  3Q9N C;  3EHR A;  4XX5 A;  2GRN B;  1TR4 A;  4U0U A;  5ANL A;  1UW4 B;  3TAX A;  2C0L A;  4ILG A;  1IHG A;  2KC7 A;  5FTP A;  5CRU A;  5LCW C;  4F3V A;  3RO2 A;  2RKK A;  1OWP A;  3NAW A;  5CCM A;  1XNF A;  3S7D A;  2PZI A;  4APO A;  3CHO A;  3ESL A;  5AEN A;  4G25 A;  3FUJ A;  3T5V A;  3GZ1 A;  3OXL A;  1QQE A;  3PEV B;  2JEK A;  3V31 A;  3CVN A;  5CMW A;  1OWO A;  1SW6 A;  4LNU D;  1U2V G;  5FJY A;  2FUL A;  2A5U A;  5FQ6 A;  2YHE A;  3S7F A;  4CDN A;  4TUM A;  1TN7 A;  2F0Y A;  4HRM B;  3AS4 A;  4TUU A;  2J9Q A;  2FF4 A;  3E34 A;  3KEZ A;  5EIL A;  1Q2Z A;  1OCC E;  4NQ0 A;  4U96 D;  3FTV A;  3PH0 C;  3DBS A;  1O1S A;  5EX3 A;  3N71 A;  4KVO A;  3LS8 A;  1K3Z D;  3ZYM A;  2ZGG A;  3E33 A;  2X6F A;  1D8D A;  2I9C A;  3IHY A;  1FCH A;  1LD7 A;  4CGV A;  1N4P A;  2EIM E;  2Y4T A;  3J5P A;  4CEM A;  1U3C A;  2MOW A;  3SI5 A;  2HR2 A;  5BXU A;  4CDM A;  3FTS A;  5KJN A;  3FUN A;  4V3I A;  4GYO A;  4G8K A;  4CCA A;  5FZS A;  2BED A;  4O1O A;  3FUI A;  2XCB A;  3CR3 A;  4OAV B;  3CHP A;  4HOU A;  2XGO A;  2WXL A;  2P2C P;  3QNK A;  5G55 A;  3CVX A;  4LUN U;  5FIO A;  1JPL A;  4KBQ A;  5G05 C;  4G26 A;  2KCV A;  3RU0 A;  3OTN A;  3HXF A;  3HXE A;  4F7A A;  4I2W A;  2OV8 A;  2WB2 A;  2XPZ A;  2H6I A;  3ULY A;  3Q47 B;  1PC2 A;  3PE3 A;  4GA2 A;  3FP3 A;  4HB5 A;  4RLY A;  3UXG A;  2OND A;  2CHX A;  3DSX A;  3FHE A;  3C3R A;  4BFR A;  1OWL A;  2L6J A;  4Z68 A;  4K5C A;  4DX7 D;  1Y8M A;  2KBX A;  4UWG A;  4DI4 A;  3CVL A;  4N3C A;  4DJA A;  4O1P A;  2GRP B;  2AXV A;  4U0Z A;  4GYY A;  5B3S E;  1FPP A;  3X2Q E;  5AQ7 A;  4YVO A;  5FZQ A;  3FH7 A;  5FQ4 A;  3SQV A;  4URK A;  2MHK A;  1MX4 A;  2VYI A;  4UWH A;  2LUH A;  4GTP A;  4J8D A;  1OCO E;  2L9B A;  4AXH A;  2WMN A;  1INZ A;  4GA1 A;  3FTX A;  2WXJ A;  3P1U A;  4WWO A;  2GRO B;  4PH4 B;  3ASD A;  3FU3 A;  2CHW A;  3PE4 A;  4WUY A;  2Y4U A;  3CQG B;  3L13 A;  2P9U G;  3V2O A;  2UY1 B;  3CLJ A;  5JHB A;  3I5P A;  3MV3 B;  1HF8 A;  2X3M A;  2BKG A;  3ZHE A;  3HIZ A;  1IXV A;  3NBN B;  2XGS A;  2XEH A;  2XS1 A;  1H6O A;  4J8F A;  1HZ4 A;  4QFV A;  3MYV A;  4PS3 A;  1H2U A;  3ZYK A;  1TNU A;  4MS6 A;  3G2V A;  1ZBP A;  4GYW A;  2NXP A;  4X8Q A;  4GA0 A;  4GCO A;  4JXT A;  3TWV A;  3EHQ A;  4ACL A;  3CHR A;  4FU3 A;  4ANV A;  1OCZ E;  2VGY A;  1H19 A;  1OXJ A;  5E75 A;  3O48 A;  2Y0B G;  4QQI A;  4Y6W A;  4GZ3 A;  3HVE B;  3B13 A;  4B93 B;  4J6I A;  4BEP A;  5KWD A;  4K0R A;  1WY6 A;  4DLO A;  1N11 A;  2P9N G;  4B8A A;  4J8E A;  3FU5 A;  2F8Y A;  2WQ6 A;  3D9P A;  1MJ0 A;  3E30 A;  4TXP A;  1Z3X A;  4M7C A;  3NB2 A;  4L1B A;  2BF0 X;  2FI7 A;  3GYZ A;  1G3N B;  2BUG A;  2QC9 A;  2XQ0 A;  4CDR A;  4JB8 P;  1HE8 A;  1TNY A;  4B0Z A;  4E85 A;  4CYM D;  3ZFW A;  4I1M A;  4HOT A;  5KCM A;  3GW4 A;  5AQB A;  3ABM E;  1HXI A;  4ACK A;  3C98 A;  4BY6 A;  4HS2 A;  3B7T A;  5CHE E;  3VLD A;  3HDX A;  3NQP A;  4FC8 A;  3E32 A;  1N0Q A;  4JD2 G;  3R7Q A;  4GTV A;  4G2V A;  5D2M C;  3APD A;  2V5Q C;  1RZ4 A;  2WXH A;  4PUC A;  1TEZ A;  2CHZ A;  4K5B A;  3ML9 A;  3UMV A;  3MKQ B;  4JL0 A;  2QY7 A;  3MZL B;  4DPR A;  4IRU A;  3SY2 A;  3TWU A;  2J09 A;  3NF1 A;  4AY5 A;  4KXK B;  3TXN A;  4C0M A;  5CBN A;  3UI2 A;  4IYP A;  3BG0 B;  2VGX B;  2LAH A;  3IEG A;  3EHN A;  4U63 A;  3LY9 A;  3ZYQ A;  2L0I A;  1LF8 A;  3AG4 E;  2WPV A;  3SBS A;  2CG3 A;  3PZD A;  3PUJ A;  4WWN A;  4XKB A;  4J8Y A;  4ATZ D;  3PNL B;  3CK9 A;  3JCK C;  2LSU A;  4A55 A;  3CHS A;  3Q4A B;  2VSX E;  2FEZ A;  1O5M A;  1N52 A;  1JUQ A;  5EYP F;  3EIJ A;  2XEN A;  3I4G A;  1E90 A;  2PQR A;  3B7B A;  3QKY A;  3UM0 A;  2RG8 A;  3LCA A;  1TJF A;  3QWV A;  3UT8 A;  5J90 A;  2J8S D;  2IOL A;  1XGW A;  2PM7 A;  3C72 A;  3S2A A;  3UUX A;  2P9L G;  3UIP C;  3TGO A;  4H7Y A;  3FTU A;  2OCC E;  5FQ7 A;  2GRL A;  3OXG A;  3ONK A;  2QYU A;  4U07 A;  5T4Y A;  2IO3 C;  1BLX B;  4KYO B;  3ULE G;  4K03 A;  3BEE A;  4FJZ A;  3SNX A;  1SA5 A;  3ZXS A;  4AP2 A;  3LVQ E;  2MYO A;  4F1P A;  3HXD A;  3LVR E;  1HX8 A;  5D0Q D;  2KZT B;  3QB2 A;  3VLF A;  4L2Y A;  4I9C A;  3L17 A;  1K1A A;  2B0O E;  3O4Z A;  1MX2 A;  5KBA A;  1S64 A;  4GAA A;  4L2L A;  1KZO A;  3SF4 A;  5H7P A;  1X5B A;  3CK8 A;  3FUH A;  4Q94 A;  2LXL A;  3OAW A;  1B89 A;  4LCT A;  1WM5 A;  4DK5 A;  5G2N A;  3EU9 A;  3R9A B;  3WXX A;  1TN6 A;  1DNP A;  2RD0 A;  1H2V C;  2LXM A;  1GW6 A;  4HRN A;  1KLX A;  2R5S A;  3FTW A;  1SZ9 A;  2Y3A A;  3R9M A;  4RG6 A;  3MEK A;  4HI9 A;  2XRY A;  1N54 A;  2V8S E;  4JPS A;  3D9K A;  3FFL A;  4N3A A;  5BV1 A;  2ION A;  3MA5 A;  3AAA C;  4AVX A;  4XE0 A;  3Q5M A;  4HRL A;  3CVW A;  3VLE A;  3WG7 E;  2LNI A;  3HG0 D;  1DCE A;  2KXP C;  3B95 A;  2WXI A;  4R7L A;  1O1R A;  3RSE G;  3Q7F A;  3P2B A;  3DEP A;  3PZ4 A;  4L9P A;  4U0S A;  5EDS A;  4XI0 A;  2V4H C;  5HS0 A;  4GB9 A;  4EZL A;  4I6J A;  3ASG A;  1KT1 A;  3NZU A;  1TNO A;  2KCL A;  3LYA A;  5FQ8 A;  3ZPJ A;  1UN9 A;  2ETB A;  1MZC A;  5ENN A;  4OVU A;  3S7J A;  1LTX A;  3RKV A;  1SQM A;  3D9I A;  3TWX A;  3QDN A;  3FTY A;  2VSY A;  3LXU X;  3RO3 A;  2WMO A;  4RQI A;  5JA4 D;  4CT4 A;  4U95 D;  3CGH A;  3R7R A;  4B8C B;  3BG1 B;  5EIB E;  5EID A;  2FO1 E;  3ABL E;  4JHK A;  4EZJ A;  1VDY A;  2J08 A;  3FWV A;  3QOU A;  2HO1 A;  1UJK A;  2BTD A;  4TV3 A;  5KNH D;  3PRZ A;  4U8V D;  3F6Q A;  3FH5 A;  3CHM A;  2DYS E;  2AVP A;  5EYL A;  2EIK E;  4GTS A;  3RAU A;  2R59 A;  3ABK E;  4FHK A;  4BT9 A;  1YMP A;  2WXR A;  2XPY A;  3PS6 A;  3D3M A;  2WXQ A;  4LG6 A;  5HQ8 A;  4DUI A;  3MGB A;  5BW8 C;  4FAD A;  3C3O A;  5ARF A;  2WXP A;  1N4Q A;  2B6C A;  3GZS A;  3SD5 A;  1JCR A;  1S63 A;  3ZIM A;  2NSZ A;  3FUF A;  2IU1 A;  4ILH B;  4KMO A;  5BT1 A;  4W9R A;  4XZ4 A;  3SFX A;  2DZO A;  4YDO A;  4ME2 A;  2AWI A;  2EIL E;  2DYR E;  5B1A E;  5G04 J;  3ZKJ A;  3G2T A;  4TXR A;  3DSS A;  3ZHE B;  4KZC A;  3IV0 A;  5ENT D;  4HVB A;  1KT0 A;  3IKO B;  4BSX A;  2JLB A;  3TXM A;  1NZN A;  3DSW A;  2EIN E;  1W3B A;  2OVF A;  1QZ2 A;  5KJM A;  4U8H A;  2VTB B;  4AIF A;  4XI9 A;  3PZ1 A;  3Q73 A;  3ASH A;  4GZ6 A;  3Q15 A;  4WAF A;  3RIB A;  3TG4 A;  5AJL A;  1K8K G;  4FP7 A;  3EHM A;  2J4B A;  1WG0 A;  3K9I A;  3D9H A;  2X6I A;  1Z5S C;  2HYZ A;  4FUL A;  1NFI E;  1HS6 A;  3BUA A;  4BSZ B;  3RRN B;  2P9K G;  2UY1 A;  3W9G A;  3UTM A;  3QK0 A;  2KM4 A;  3QWW A;  5AAO A;  2I6H A;  2FO7 A;  4IN3 B;  4ZFH A;  5HRY A;  2ZGD A;  3JXI A;  4C0E A;  2P9P G;  5AAR A;  2XS8 A;  5LOZ A;  3JYS A;  5LFA A;  4HOR A;  3HYM B;  3RJV A;  4JEU A;  2MRI A;  3B7R L;  4UI9 J;  2YIN A;  4LEU A;  1AP7 A;  4ABN A;  3JUE A;  1IQU A;  4DX5 D;  2PNN A;  3PZ2 A;  5FT9 A;  3V79 K;  5C1D A;  4FJY A;  5E76 A;  3T5X A;  4BES A;  3HVE A;  1EYH A;  4A1S A;  3FUM A;  2A5E A;  3EIQ C;  3LY8 A;  4GMJ A;  4D10 C;  3CIA A;  4JW1 A;  3C5R A;  5EX0 A;  5JJ7 A;  5KJK A;  2OVB A;  4NIK A;  3BU8 A;  3EU5 A;  4XKC A;  3U4T A;  5HKP A;  3ZYL A;  1IKN D;  1ZU2 A;  3ML8 A;  4HQD A;  3EJN A;  3G2W A;  4UI9 K;  4HLE A;  1Z3Y A;  3QAQ A;  1E7V A;  2XCC A;  2XPI A;  1O1T A;  4I43 A;  1UN8 A;  2DBA A;  5AN8 A;  4ATG A;  4P29 A;  5KJL A;  3DST A;  5JJT A;  2ZXW E;  1FT2 A;  1PY1 A;  1WDY A;  4GZD A;  3ZW3 A;  3NOG D;  1UG3 A;  3ZUV B;  1HG2 A;  3I4R B;  2IFU A;  3W9F A;  2PQN A;  2V0P A;  5AIJ A;  2GGF A;  1TYQ G;  5M72 A;  4AOF A;  4BTB A;  3DXM G;  2DZN A;  2Q7F A;  3BQO A;  4BET A;  2OEW A;  5JJ6 A;  5G04 C;  3HRA A;  1A17 A;  4JA7 A;  1KPS B;  3APC A;  1E96 B;  1IHB A;  3FEX A;  2Y1L E;  3AJI A;  3MKQ A;  4MBG A;  3B7S A;  5D66 A;  1BI8 B;  3CVQ A;  4CRW A;  4GZC A;  4MLP A;  2L0T B;  3D9N A;  4KVM A;  3TWS A;  3SHF A;  2DIW A;  4C9B B;  2IOS A;  5D0O D;  1H0A A;  3APF A;  4BER A;  1QYM A;  3OXF A;  1N9A A;  1HU3 A;  1Y6I A;  3UIN C;  2P9I G;  1L5J A;  3VTX A;  4DX2 A;  4FLB A;  3AU4 A;  3SFZ A;  2HM8 A;  2XZT G;  5CMY A;  4DX6 D;  5DIZ A;  4EBA A;  3SBT B;  3L16 A;  4DRX E;  4XEI G;  4XIF A;  2J49 A;  3RRM B;  3L22 A;  4BX8 A;  3PDN A;  4RSY A;  1NL4 A;  1OUV A;  1QNF A;  4L7T A;  2AW6 A;  1S70 B;  3V30 A;  4JZY A;  2XRZ A;  3LEW A;  4YVQ C;  4HFG A;  3Q9U C;  4GMR A;  2GRR B;  5CED B;  2F8X K;  2P9S G;  3TWQ A;  2DWZ A;  3KAE A;  4AJW A;  3PNT B;  4HLL A;  5EN5 D;  3FUK A;  4PDX A;  3G2S A;  1EDU A;  2H6G A;  3AS8 A;  3ZN3 A;  2WXM A;  2J07 A;  1HO8 A;  2WQ7 A;  4YDW A;  3Q75 A;  2ZIS A;  3LKU A;  4ILI A;  2WXK A;  2VQ2 A;  4GZ5 A;  3I3N A;  2L6B A;  5BPP A;  2R2L A;  5C2Y A;  2X6H A;  4WNE A;  4GML A;  5EKQ D;  2AJA A;  3KSL A;  4Y6C A;  2ETC A;  4NRH B;  2KZT A;  2GW1 A;  3ZEF A;  3B7U X;  3LJN A;  4PS7 A;  1E8Y A;  3FUL A;  2NC9 A;  2EQX A;  3FU0 A;  5ENR D;  4DLQ A;  2RFA A;  5T3R A;  4GTQ A;  3TWT A;  3FH8 A;  4WNG A;  1RW2 A;  5ENS D;  1NI1 A;  5KNG A;  3TL5 A;  4BT8 A;  5T8I A;  3KEA A;  2YQ8 A;  4G24 A;  2GRQ B;  1JCQ A;  4U7E B;  1YCS B;  4A3T A;  4IUL A;  3AG1 E;  2R05 A;  1MX6 A;  3ASF A;  1N4R A;  2IF4 A;  2FBN A;  1SZA A;  2IEJ A;  4BX9 A;  5A7D B;  3LY7 A;  2P58 C;  3DXK G;  3UQ3 A;  4EZK A;  3QWP A;  4UQX A;  4N2Q A;  3GZ2 A;  1TN8 A;  2I1K A;  2DVW A;  1K1B A;  3UT4 A;  3SZ7 A;  3QJZ A;  4G1T A;  1NP7 A;  2V4L A;  3AU5 A;  4UWF A;  4Q69 A;  3CVV A;  1NA0 A;  3CEQ A;  3URZ A;  1BD8 A;  4WNF A;  3L9T A;  2WXO A;  3ULQ A;  4U8Y D;  3T8K A;  1YA0 A;  4NAC A;  1IYG A;  1MYO A;  4LNB A;  4G23 A;  1X81 A;  4BTA A;  3LJ3 A;  3L6A A;  1E8W A;  3ASO E;  2WXF A;  2I2O A;  3UKU G;  3AS5 A;  3PRE A;  1MQS A;  4EHM A;  2QFC A;  4BWR A;  2X38 A;  3L82 A;  4GPK A;  4H7X A;  4I6G A;  5CER B;  3RK6 A;  5ITZ F;  2GRM A;  5AYW D;  3MX3 A;  2LAI A;  4I6E A;  4ANU A;  3IHV A;  4ANX A;  4TRQ A;  4G11 A;  3TWR A;  4AEZ C;  3AG3 E;  4OAU C;  4A63 B;  5CRV A;  5FWQ A;  3ISM C;  1S0P A;  1Z6T A;  4TXQ A;  1JWG A;  1N0R A;  3HXB A;  3CST A;  3PUK A;  4E6H A;  1SA4 A;  3D9J A;  5ENQ D;  1FVF A;  4F6R D;  2R03 A;  4O60 A;  2V5F A;  1OCR E;  4M3O A;  4FLH A;  1LD8 A;  1FT1 A;  4RG9 A;  2JAB A;  4RVB A;  4A3V A;  1ELR A;  3D9L A;  3E4B A;  2WXG A;  1HH8 A;  1OWN A;  4NUR A;  2E2E A;  4GTO A;  1DC2 A;  4Q96 A;  3FY4 A;  1V55 E;  4AM9 A;  2H6H A;  4EQF A;  3J5Q B;  1PAQ A;  4LRZ A;  1BU9 A;  1DVP A;  2C2L A;  3S7B A;  4CT0 A;  1N4S A;  3DSV A;  2BKK B;  4UWK A;  4L23 A;  1SVX A;  4F53 A; 
#chains in the Genus database with same CATH homology
 3CKB A;  3UUX A;  1H6K A;  5FZR A;  2KCK A;  3G2W A;  4NQ0 A;  4UI9 K;  4HLE A;  1Z3Y A;  3QAQ A;  2VSN A;  3TGO A;  1E7V A;  3FTV A;  2XCC A;  2XPI A;  3PH0 C;  3DBS A;  4I43 A;  4HOS A;  4H7Y A;  3FTU A;  1UN8 A;  2GRL A;  3N71 A;  4KVO A;  3OXG A;  5EX3 A;  5FQ7 A;  3LS8 A;  3ONK A;  4U07 A;  2DBA A;  4U04 A;  5T4Y A;  4KYO B;  4K03 A;  1HFA A;  4EPZ A;  1P5Q A;  3BEE A;  4FJZ A;  3SNX A;  2PL2 A;  4ATG A;  4YND A;  4P29 A;  3ZYM A;  3ZXS A;  4AP2 A;  3T8M A;  5JJT A;  5KJL A;  3LVQ E;  2X6F A;  3D9M A;  2I9C A;  3IHY A;  1PY1 A;  1FCH A;  3QC1 A;  5ARG A;  4GZD A;  3LVR E;  4CGV A;  1HX8 A;  3ZW3 A;  3NZS A;  1UG3 A;  4UQZ A;  3L54 A;  5D0Q D;  2KZT B;  2Y4T A;  2C0M A;  3QB2 A;  1U3C A;  4CEM A;  3VLF A;  4LER A;  4L2Y A;  1HG2 A;  4I9C A;  5BV0 A;  3L17 A;  2KAT A;  3I4R B;  2IFU A;  2MOW A;  3JQ0 A;  3O4Z A;  3SI5 A;  1ELK A;  2HR2 A;  2V0P A;  2PQN A;  3D9O A;  4WWP A;  5AIJ A;  4GAA A;  4CDM A;  2GGF A;  3FTS A;  3ESK A;  4L2L A;  5M72 A;  3SF4 A;  2CG2 A;  4AOF A;  4BTB A;  5KJN A;  4GU5 A;  3CVP A;  1X5B A;  3FUN A;  2Q7F A;  4GYO A;  3CK8 A;  3PVL A;  4V3I A;  5BNW A;  3FUH A;  4Q94 A;  4CCA A;  5FZS A;  3OAW A;  1E7U A;  1B89 A;  2YNQ A;  3FUI A;  1E8Z A;  4LCT A;  5JJ6 A;  2XCB A;  3CR3 A;  5G04 C;  3CHP A;  1WM5 A;  4DK5 A;  5G2N A;  3R9A B;  1A17 A;  4HOU A;  4JA7 A;  3WXX A;  2VTB A;  2XGO A;  3APC A;  1E96 B;  2WXL A;  3QNK A;  1DNP A;  2RD0 A;  3FEX A;  1H2V C;  5G55 A;  1GW6 A;  3CVX A;  3MKQ A;  1KLX A;  4LUN U;  1JPL A;  2R5S A;  4KBQ A;  5G05 C;  3FTW A;  4N39 A;  3KS2 A;  3B7S A;  3LDZ A;  1SZ9 A;  2Y3A A;  2KCV A;  4G26 A;  4JHJ A;  3RRU A;  3RU0 A;  3OTN A;  4RG6 A;  5A23 A;  5J08 A;  3HHM A;  3MEK A;  4KZ0 A;  4F7A A;  4I2W A;  2OV8 A;  2WB2 A;  2XRY A;  2XPZ A;  2A4Z A;  3EDT B;  1N54 A;  2V8S E;  3CVQ A;  4JPS A;  4CRW A;  4B94 A;  3D9K A;  2IJG X;  3Q47 B;  1EPU A;  4GZC A;  1PC2 A;  4MLP A;  3FFL A;  4N3A A;  5BV1 A;  4O6F A;  3PE3 A;  2ION A;  3MCX A;  4GA2 A;  2L0T B;  4I17 A;  4FA6 A;  3FP3 A;  3D9N A;  4KVM A;  4N3B A;  3MA5 A;  4PS8 A;  4AVX A;  4HXI A;  3SHF A;  4CGW A;  3CK7 A;  4XE0 A;  3Q5M A;  2YHC A;  3U64 A;  2DIW A;  2OND A;  3CVW A;  2CHX A;  2AXU A;  4N5C A;  4C9B B;  3VLE A;  2IOS A;  5D0O D;  4AJW A;  3FUD A;  1H0A A;  3FUE A;  2LNI A;  3FHE A;  3APF A;  5AJD A;  2ILR A;  4I1A A;  4WND A;  4BFR A;  2WXI A;  4R7L A;  1OWL A;  2L6J A;  3OXF A;  1HU3 A;  1Y6I A;  2OOE A;  1Y8M A;  4UWG A;  4DI4 A;  2VSO E;  1L5J A;  3P2B A;  3CKC A;  4J0U A;  3VTX A;  3CVL A;  4N3C A;  4U0S A;  4FLB A;  4DJA A;  3AU4 A;  5EDS A;  3SFZ A;  2AXV A;  3LPZ A;  4XI0 A;  4AY6 A;  4I9E A;  4U0Z A;  2HM8 A;  5CMY A;  4GYY A;  4GB9 A;  2LSV A;  4I6J A;  4EZL A;  3ASG A;  5DIZ A;  4YVO A;  5FZQ A;  4EBA A;  3SBT B;  3FH7 A;  5FQ4 A;  1KT1 A;  3NZU A;  4URK A;  2LO6 A;  2KCL A;  2MHK A;  3LYA A;  3L16 A;  3ONL A;  5FQ8 A;  3ZPJ A;  2VYI A;  4UWH A;  1UN9 A;  4XIF A;  2J49 A;  3U9W A;  2J4D A;  4B89 A;  3RRM B;  4J8D A;  4KT6 B;  3L22 A;  2L9B A;  4AXH A;  2WMN A;  4BX8 A;  3PDN A;  4J8S A;  4A1G A;  1INZ A;  4GA1 A;  4RSY A;  5ENN A;  3FTX A;  1OUV A;  1QNF A;  2WXJ A;  3JUI A;  3P1U A;  4OVU A;  4HOQ A;  3S7J A;  3FU6 A;  4WWO A;  3RKV A;  4L7T A;  2AW6 A;  4FHJ A;  1SQM A;  4PH4 B;  3ASD A;  3D9I A;  4JZY A;  2XRZ A;  3FU3 A;  3LEW A;  4YVQ C;  3QDN A;  4HFG A;  1IQR A;  2CHW A;  3PE4 A;  3UT7 A;  1UJJ A;  3U3W A;  4DI3 A;  3FTY A;  4WUY A;  2VSY A;  3LXU X;  3RO3 A;  4ANW A;  2Y4U A;  2ZU6 B;  5LCW J;  2WMO A;  3CQG B;  2VJ8 A;  1E8X A;  3L13 A;  3PEU B;  4CT4 A;  2UY1 B;  2UWJ G;  3CLJ A;  4APF A;  5JHB A;  2E0I A;  3I5P A;  3ENE A;  3KAE A;  2PM6 A;  3PNT B;  1OWM A;  3FUK A;  3G2S A;  4PDX A;  3MV3 B;  4I2Z A;  1HF8 A;  3CGH A;  3R7R A;  3TG5 A;  3BG1 B;  4B8C B;  5A6C A;  1EDU A;  2X3M A;  4UWL A;  3ZHE A;  3AS8 A;  3ZN3 A;  2WXM A;  4JHK A;  2J07 A;  1HO8 A;  4EZJ A;  1VDY A;  3HIZ A;  2WQ7 A;  2J08 A;  3FWV A;  3LKU A;  3QOU A;  4ILI A;  1FVH A;  2XGS A;  4OVV A;  2R17 C;  3UX4 A;  2WXK A;  4J8F A;  1MHQ A;  1HZ4 A;  2HO1 A;  4QFV A;  2VQ2 A;  3JQ1 A;  4AV7 A;  1NA3 A;  3MYV A;  1UJK A;  4GZ5 A;  2BTD A;  4PS3 A;  1H2U A;  4TV3 A;  3I3N A;  2M63 A;  3PRZ A;  3ZYK A;  5BPP A;  3FH5 A;  3CHM A;  1ELW A;  2X6H A;  5C2Y A;  2AVP A;  4MS6 A;  3G2V A;  1ZBP A;  4GYW A;  4WNE A;  5CCL A;  4GML A;  2X6K A;  3MJW A;  4GCN A;  5EKQ D;  2NXP A;  3DPD A;  4GA0 A;  4GCO A;  2R59 A;  4JXT A;  4FHK A;  4NRH B;  4Y6C A;  2KZT A;  1WAO 1;  2GW1 A;  3ZVV A;  3ZEF A;  5BUZ A;  1JWF A;  3G2U A;  3CHR A;  3MV2 B;  4ACL A;  4BT9 A;  4FU3 A;  3B7U X;  4PS7 A;  1E8Y A;  2WXR A;  4JC8 A;  2I1J A;  3FUL A;  4ANV A;  2XPY A;  4JVS A;  2VGY A;  1H19 A;  2NC9 A;  3D3M A;  3PS6 A;  3O48 A;  2WXQ A;  5E75 A;  4Y6W A;  2X6J A;  2DCP A;  4GZ3 A;  2EQX A;  5HQ8 A;  3FU0 A;  3HVE B;  3CHQ A;  3MGB A;  5BW8 C;  3B13 A;  4FAD A;  3Q49 B;  4J6I A;  4MKT A;  5ARF A;  2CFU A;  2WXP A;  4DLQ A;  4K0R A;  5T3R A;  1WY6 A;  3QAR A;  2VGX A;  4DLO A;  2AXZ A;  3FH8 A;  4WNG A;  4B8A A;  4J8E A;  2XHE A;  3GZS A;  2XGM A;  4JEH A;  3SD5 A;  3FU5 A;  4F1S A;  2WQ6 A;  1H2T C;  3ZIM A;  3D9P A;  3MKR A;  4BT8 A;  3TL5 A;  4N2S A;  3L08 A;  2NSZ A;  3CVU A;  3ZGQ A;  3FUF A;  5T8I A;  1Z3X A;  2IU1 A;  2YQ8 A;  4G24 A;  4ILH B;  4L1B A;  3CV0 A;  4A3T A;  4IUL A;  2BF0 X;  1U3D A;  2FI7 A;  3FTZ A;  4OYS A;  4KMO A;  3GYZ A;  3ASF A;  3TJP A;  2IF4 A;  5BT1 A;  2BUG A;  2FBN A;  1SZA A;  4W9R A;  4BX9 A;  2XQ0 A;  4JHR A;  4CDR A;  5A7D B;  1BPO A;  3LY7 A;  4XZ4 A;  2P58 C;  1HE8 A;  3FEY A;  3UQ3 A;  4B0Z A;  4EZK A;  2WQH A;  3QWP A;  4UQX A;  4N2Q A;  4E85 A;  4ME2 A;  3GZ2 A;  2I1K A;  2AWI A;  3ZFW A;  4I1M A;  4HOT A;  5KCM A;  3GW4 A;  1HXI A;  5HI7 A;  5G04 J;  3SZ7 A;  3UT4 A;  4ACK A;  5ANR A;  3QJZ A;  4UI9 C;  4UQY A;  4G1T A;  3C98 A;  4BY6 A;  3G2T A;  4HS2 A;  3B7T A;  3ZHE B;  4KZC A;  5CHE E;  1NP7 A;  3IV0 A;  3VLD A;  3UPV A;  2V4L A;  3AU5 A;  4UWF A;  4Q69 A;  5LX8 A;  3HDX A;  3CVY A;  3CVV A;  3CQC B;  1NA0 A;  3NQP A;  4FC8 A;  4EEC A;  4HVB A;  1KT0 A;  3IKO B;  3CEQ A;  5G05 J;  3URZ A;  2JLB A;  4BSX A;  1TJC A;  3FDH A;  3TXM A;  4WNF A;  2IQC A;  3CSF A;  3R7Q A;  2WXO A;  4G2V A;  1NZN A;  3ULQ A;  5DBK A;  1EF1 C;  3APD A;  1YA0 A;  4NAC A;  3U66 A;  3SGH A;  5JHA A;  2WXH A;  2CFZ A;  2XEV A;  1W3B A;  2OVF A;  4EBA G;  1IYG A;  4G23 A;  1QZ2 A;  3VTY A;  4PUC A;  4BTA A;  3LJ3 A;  3L6A A;  1TEZ A;  5KJM A;  4U8H A;  2VTB B;  1E8W A;  4AIF A;  2WXF A;  2I2O A;  2CHZ A;  4XI9 A;  3ML9 A;  3ASH A;  4GZ6 A;  3UMV A;  3MKQ B;  3Q15 A;  3IBE A;  4JA9 A;  4WAF A;  3RIB A;  3AS5 A;  3ZRH A;  4JL0 A;  3PRE A;  3TG4 A;  2QY7 A;  5AJL A;  3MZL B;  2WVI A;  1MQS A;  4DPR A;  4IRU A;  4FP7 A;  2QFC A;  3EHM A;  2WM9 A;  3KD7 A;  4BWR A;  2J4B A;  3K9I A;  2X38 A;  2J09 A;  2X6I A;  3NF1 A;  4GPK A;  2HYZ A;  4FUL A;  4AY5 A;  4KXK B;  3TXN A;  1HS6 A;  4MRU A;  4C0M A;  4H7X A;  2WXN A;  3RRN B;  4IYP A;  2UY1 A;  3BG0 B;  3QK0 A;  2KM4 A;  4I1O B;  1HG5 A;  4I6G A;  3QWW A;  5LP0 A;  3RK6 A;  2VGX B;  2I6H A;  2FO7 A;  4IN3 B;  2GRM A;  5AYW D;  2LAH A;  3IEG A;  3MX3 A;  3EHN A;  2LAI A;  4I6E A;  4U63 A;  4XX5 A;  3IHV A;  3LY9 A;  3ZYQ A;  4ANU A;  2L0I A;  4ANX A;  4TRQ A;  4U0U A;  5ANL A;  4C0E A;  1LF8 A;  1UW4 B;  3TAX A;  4G11 A;  2C0L A;  2WPV A;  4ILG A;  3SBS A;  4AEZ C;  2CG3 A;  1IHG A;  2KC7 A;  3JYS A;  3PZD A;  5FTP A;  5LOZ A;  5LFA A;  3HYM B;  4HOR A;  5FWQ A;  3PUJ A;  5LCW C;  3RJV A;  4F3V A;  1S0P A;  1Z6T A;  4WWN A;  4XKB A;  3RO2 A;  1OWP A;  1JWG A;  3PNL B;  4JEU A;  5CCM A;  2MRI A;  3B7R L;  4UI9 J;  2YIN A;  3CK9 A;  3JCK C;  1XNF A;  2LSU A;  4A55 A;  3CST A;  3PUK A;  4LEU A;  4E6H A;  3CHS A;  3Q4A B;  3S7D A;  2PZI A;  4APO A;  2VSX E;  2FEZ A;  3CHO A;  3D9J A;  3ESL A;  4ABN A;  5AEN A;  1IQU A;  4G25 A;  1FVF A;  1N52 A;  3FUJ A;  3T5V A;  3GZ1 A;  3OXL A;  1QQE A;  3PEV B;  1JUQ A;  2JEK A;  2V5F A;  3CVN A;  3EIJ A;  5FT9 A;  4M3O A;  4FLH A;  5CMW A;  4RG9 A;  5C1D A;  3I4G A;  1OWO A;  4RVB A;  1E90 A;  4FJY A;  2PQR A;  5E76 A;  4A3V A;  1ELR A;  3D9L A;  3E4B A;  3QKY A;  3T5X A;  2RG8 A;  5FJY A;  2WXG A;  3HVE A;  1EYH A;  1HH8 A;  2FUL A;  1OWN A;  4NUR A;  4A1S A;  2E2E A;  3FUM A;  2A5U A;  3LCA A;  3EIQ C;  4GMJ A;  3LY8 A;  1TJF A;  4Q96 A;  3FY4 A;  4D10 C;  3QWV A;  4AM9 A;  5FQ6 A;  3CIA A;  2YHE A;  3S7F A;  3UT8 A;  4JW1 A;  4EQF A;  4CDN A;  1PAQ A;  5EX0 A;  5JJ7 A;  5KJK A;  2OVB A;  4LRZ A;  5J90 A;  1DVP A;  2C2L A;  3S7B A;  4TUU A;  3AS4 A;  2IOL A;  2J9Q A;  4XKC A;  3U4T A;  4CT0 A;  2FF4 A;  1XGW A;  2PM7 A;  4UWK A;  4L23 A;  3ZYL A;  3KEZ A;  1ZU2 A;  3ML8 A;  4F53 A;  3EJN A;  3S2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...