5C2YA

Crystal structure of the saccharomyces cerevisiae rtr1 (regulator of transcription)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
SGMATIEDIKETALIPFQKHRQLSMHEAEVITLEIIGLLCDSECKDEKTLKYLGRFLTPDMYQDLVDERNLNKRCGYPLCGKSPERIRDPFSMNDTTKKFLLENNPYAYLSHYCSKFHFRCSQFYQVQLSDEALFARTGVHLFEDPEQDKHDIDFKVTLFEELLREKASEEDIKSLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords RNA polymerase II subunit B1 CTD phosphatase RTR1
publication title Structure of Saccharomyces cerevisiae Rtr1 reveals an active site for an atypical phosphatase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 62
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04181 RPAP2_Rtr1 Rtr1/RPAP2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.820 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c2yA00
5C2YA 4FC8A 4M3OA
chains in the Genus database with same CATH superfamily
1V54E 1SZAA 3I3NA 4U63A 4IULA 2CFZA 1NA3A 4UWKA 4UQXA 3APFA 3FU5A 2GGFA 3ZYKA 3D9OA 4LNBA 5HKPA 2BUGA 1V55E 2ZXWE 3SQVA 1S64A 1TN6A 4CT0A 2YINA 3IEGA 3MEKA 5CHEE 4F7AA 3UXGA 4FADA 3PZ2A 4FA6A 3DSXA 4B8AA 5EIBE 3EHNA 5LFAA 3AS4A 1E8YA 4M3OA 1E8WA 3L82A 4F3VA 3ZHEB 2AXVA 3HYMB 1MZCA 4K03A 3PS6A 2F0YA 3S7JA 5AQAA 1EPUA 2ZISA 3B7BA 3DSSA 5E75A 3J5QB 3FTZA 4FC8A 2PM6A 1S63A 1UN8A 1IQUA 1DC2A 3D9HA 5BV0A 3T8KA 1U2VG 3QC1A 3TWSA 4GZCA 3LS8A 5CRVA 3FU0A 4DPRA 3DRAA 2XPZA 4DJAA 4C9BB 4ZFHA 2XQ0A 4LCTA 1H19A 3QWWA 1G3NB 4U8YD 4DX6D 3KD7A 2WXLA 3G2VA 2A5UA 2ZU6B 3EHRA 3MV3B 2V8SE 3OXLA 2RFAA 5EX3A 3HXDA 1BPOA 1WG0A 4JW1A 2FO1E 5A7DB 4GA2A 2LXMA 5BXOA 5FQ4A 2BTDA 4XIFA 5KNGA 3BEEA 5FJYA 4HVBA 1H6PA 1EF1C 4N2QA 1TJFA 3E33A 3LJ3A 2HYZA 3V2OA 2XRZA 3QB2A 4CGWA 4MBGA 3FUMA 5LOZA 3FHEA 1Y6IA 2OEVA 5LP0A 4BX9A 3AS8A 3DSUA 5EKQD 3FUKA 1OWNA 1KT0A 3Q73A 3U4TA 4H7YA 4WNEA 4N5QA 5JJ7A 1HF8A 1DCEA 4FP7A 4KXKB 4CGVA 1TJCA 3L54A 4OYSA 1NI1A 2F8YA 4AJWA 5M72A 2H6GA 1HE8A 1Y8MA 3HXFA 1FVHA 2DZNA 3FUJA 5DIZA 3VTYA 2UWJG 4Z68A 4GTSA 5CCLA 5C1DA 2Y1LE 3C98A 2KATA 2L0IA 3QKYA 3AG2E 4I9CA 4N39A 4A55A 3ULYA 3UQ3A 3B7RL 5KJLA 1XNFA 2L0TB 5AAOA 5KJKA 5ENTD 2VSNA 4F53A 2WQ7A 3X2QE 5CMWA 2XCBA 4PDXA 3NBNB 2GRQB 2F37A 3ZFWA 2WMNA 4MS6A 4U7EB 3L9TA 4CT4A 4BT9A 3ENEA 3FWVA 4AEZC 3CEQA 5AJLA 3D9MA 4AIFA 3ZN3A 2VTBB 4MKTA 1U3DA 4EPZA 3ESLA 5AQ9A 4GTOA 3CV0A 1E8XA 3CKCA 2UY1A 1OWLA 5FTPA 3UIOC 3R7RA 1NFIE 1YCSB 2KM4A 1E96B 1LF8A 4RSYA 1JWGA 2CFUA 3ZUVB 4EBAA 1N0RA 3CVQA 3HXBA 4YDYA 4AV7A 4J8EA 4LUNU 2EILE 1OWMA 5EILA 4O60A 3QNKA 1TN8A 1AP7A 5LCWJ 4JD2G 2XRYA 3LVQE 3L08A 4L1BA 1OCZE 2HO1A 3ASNE 1HG5A 2Y69E 3JUIA 4UUCA 4I2WA 3UM1A 3Q47B 4DLQA 1IYGA 1ZU2A 3IHVA 4DX7D 2AW6A 2B6CA 3TG5A 3TL5A 4UWLA 5CCMA 2IY0C 2IOSA 4BY6A 4J6IA 4G24A 3B7SA 4PUCA 4RG6A 2DZOA 1N9AA 3FUIA 4KZ0A 2ZGGA 2IFUA 4UQYA 2DVWA 3TAXA 3UM0A 4JL0A 2WXMA 2WB2A 1MYOA 2P9UG 3HXCA 4QFVA 4GZ6A 3FEXA 3Q49B 2WPVA 4WWNA 3PUJA 4YDWA 3OXFA 5CBNA 1IQRA 3JQ1A 1KT1A 1FT1A 3Q4AB 2P9NG 2R59A 1H6OA 2XGOA 2LSUA 4JA7A 2DCPA 3ASOE 2WXKA 3ZIMA 4TXRA 1PAQA 2XCCA 3I4GA 3GZ1A 4GB9A 2KZTA 3FUFA 5FWQA 3JXIA 2FEZA 4GTPA 5HRYA 3ZYMA 4L2YA 2V0PA 2BF0X 2C0MA 1E90A 1FPPA 3T8MA 4JHJA 1YMPA 3ABKE 3QARA 2M63A 2ZIRA 3BQOA 3L17A 3CK7A 2ETCA 4K5BA 1P5QA 3LVRE 4XKCA 1S70B 4WAFA 1WDYA 3ZNGA 1NA0A 1EYHA 3GW4A 5FZRA 3ZGQA 4B8CB 4BWRA 4ANUA 1BLXB 4PS7A 3KS2A 3EIJA 2XZDG 4A1GA 5ARGA 3UM2A 2V5FA 2J08A 5KWDA 4N3BA 3G2TA 3FH5A 2QYUA 2VSOE 2P9IG 3D9LA 3OTNA 3AG1E 4P29A 3R9MA 1JWFA 3ZXSA 4ANVA 5ENRD 3LDZA 2YHEA 4K5CA 3R9AB 3TXNA 4A3TA 4I1OB 3FFLA 4DI4A 4BESA 1RZ4A 3SZ7A 3EJNA 4FJYA 4DRXE 5J08A 3E32A 2KBXA 1Z3YA 2HE0A 4J7WA 1A17A 4DX5D 2WXQA 4HRLA 5EYLA 1DVPA 3B13A 3DWLG 1UW4B 2VGEA 2X6IA 2R17C 1OCCE 3FP3A 3CHPA 2J4BA 4GMRA 3CVXA 3CK9A 4JHKA 4U96D 3CVNA 3D9NA 3MZLB 3Q9UC 1QQEA 3CLJA 4A3VA 4U07A 4B0ZA 3PRZA 3LPZA 2EIKE 1NL4A 2MOWA 3QDNA 4BTAA 3SF4A 4C48B 3UPVA 3PZDA 4KBQA 4NIKA 3UM3A 2V4LA 4I6GA 3QWPA 3CHRA 2YNQA 3T5VA 2I1KA 3UUXA 2OVBA 4EHMA 3ZXPA 3SHFA 3AJIA 3NB2A 3R7QA 3CVVA 3P2BA 3ZPJA 2L6BA 2X3MA 5FINA 4HB5A 2MYOA 2XGSA 2LNIA 4YVQC 3Q9NC 2P2CP 4GTTA 4B93B 1E7VA 3TWTA 1MX4A 1JCSA 1GW6A 3JCKC 2KZTB 3L13A 2RG8A 2VTBA 3HG0D 3ASFA 4ANWA 4KVOA 1OWOA 3NOGD 2JLBA 1FT2A 1BI7B 1TNUA 4HOSA 5CECB 3C3OA 5H7PA 3VLDA 3U66A 3WXXA 4R7LA 3SY2A 5J90A 2LAHA 3RKVA 4N2SA 2DWZA 3HRAA 3ZEFA 2QC9A 2AXUA 3TWXA 3FTVA 2PL2A 2RFMA 3ABME 3TWVA 1N54A 3V31A 2X6FA 3E4BA 3TWRA 4QQIA 1H2UA 2QYJA 1KPSB 4J0UA 1HS6A 2MRIA 3VLEA 3LY8A 4Y6CA 4G8KA 4H7XA 1B89A 4BEPA 1TNBA 3LY7A 4HI8A 1LTXA 4WWPA 4OVUA 4C0MA 5G04C 3GZSA 3PREA 2LXLA 4ACLA 2AJAA 4TXQA 1UN9A 4BERA 2FBNA 1E8ZA 5FQ6A 2FO7A 2A4ZA 4GTQA 4BT8A 4KMOA 3RO2A 3ZRHA 4LRZA 2IONA 4RLYA 5ENNA 3DPDA 5CBOA 1KZOA 3PUKA 2WM9A 3MKRA 4I9EA 1EDUA 5EDSA 1KLXA 5B3SE 5C2YA 2GRRB 4JA9A 4HBDA 5AIJA 2EQXA 2Q7FA 1K1BA 3CSTA 1SVXA 1XGWA 1H2TC 3E34A 4ATGA 3Q15A 5ITZF 2I1JA 4BTBA 3EDTB 4UWFA 3C72A 4XX5A 4HOQA 5D66A 4CCAA 4EBAG 4DK5A 4CDMA 4DI3A 3RK6A 3CHSA 1OY3D 2L6JA 3CQCB 5T3RA 4GU5A 3PVLA 4I43A 3CHMA 4B94A 2GRPB 4EZJA 3HIZA 4MRUA 5LX8A 5G05C 3LY9A 5CRUA 3NF1A 4FLHA 3WG7E 1D8DA 1TEZA 3KEAA 1MX6A 3V2XA 3O4ZA 2J09A 2EINE 2VSXE 3P1UA 1OXJA 4UI9K 1JPLA 3SD5A 3CSFA 2XEVA 1IHGA 2XPIA 5HS0A 2PNNA 1OCRE 3D9IA 3HHMA 4L23A 2RKKA 4U95D 5KNHD 3F6QA 4Q94A 2X6HA 1N95A 2BEDA 4NACA 4EECA 4W9RA 3LXUX 1U3CA 5D2MC 3FTWA 5HI7A 2IOLA 5FQ7A 3D9JA 5AARA 4A63B 2VQ2A 1IXVA 4RVBA 2VYIA 2ZGDA 2CG3A 3CHOA 3L22A 2CG2A 1TNZA 2VSYA 3TGOA 4G11A 2H6FA 4GMLA 4FHJA 1HG2A 5CMYA 2I2OA 3G2SA 4IYPA 4GZ5A 4APOA 5A23A 1HU3A 1O1TA 2OVFA 2Y0BG 2BKKB 2GRLA 4CRWA 3RRNB 1K8KG 4HS2A 1IHBA 4GCOA 5CEAA 1H2VC 4JZYA 3RAUA 2J07A 2Y4UA 3E37A 4ACKA 3E30A 3U64A 4JB8P 1N0QA 4AY6A 3UKRG 3URZA 4F1SA 1HXIA 2H6HA 3FUHA 4Y6WA 4JEHA 4U0SA 2ONDA 2GW1A 4AY5A 4U04A 3D3MA 1NP7A 1Z3XA 2WMOA 3ZYQA 3AG3E 2WQHA 3MX3A 3EU9A 2ETBA 3RU0A 3BG0B 3Q5MA 4NRHB 5D0QD 3FTUA 3RSEG 3APCA 3CVUA 1OWPA 5ARFA 4LNUD 1HH8A 2XGMA 3FY4A 2FF4A 5BNWA 4UI9C 3VTXA 3J5PA 3PZ1A 3VLFA 4XI9A 3FUEA 2I6HA 3W9FA 1K3ZD 3ML9A 3ABLE 4E85A 2KXPC 2V5QC 4AP2A 1JUQA 4LG6A 1YYHA 2VGXB 4A1SA 3FH8A 3G2UA 5ENPD 3PEUB 2IU1A 1K1AA 4ZHBA 4YDEA 3T9KA 4HORA 3OAWA 3U9WA 3EIQC 4FLBA 1YA0A 1WY6A 5BXUA 4IRUA 2IEJA 5FZSA 1O5MA 3ZVVA 5HQ8A 4AOFA 4GA1A 2PQNA 1HO8A 4DX1A 3ASDA 4O6FA 3N71A 2J8SD 4X8QA 4EQFA 4O1OA 2XS8A 4OAVB 1N11A 2LSVA 3FU3A 4L7TA 3G2WA 4Q96A 5JA4D 2WXJA 1A5EA 4GZ3A 4AXHA 4NURA 2WXGA 3AG4E 1UOHA 1DNPA 3Q7FA 4LNGA 2XZTG 4APFA 3CVPA 3KSQA 5EX0A 4JVSA 3BG1B 2J9QA 4U8VD 3TXMA 3MA5A 3S2AA 1Q2ZA 5B1AE 3C5RA 2C2LA 4U0UA 2HM8A 2P9SG 4GTRA 5G2NA 4BFRA 3UIPC 2WVIA 4GYYA 3GZ2A 5JHAA 3FTXA 4J8DA 4LERA 3RRMB 2KCKA 4CDRA 2XEHA 5FIOA 3DSTA 5EIDA 1N4QA 3QK0A 1W3BA 4U0ZA 4WNDA 3EU5A 3DEOA 4TUUA 4FULA 3I4RB 3Q78A 4JC8A 3RO3A 2XHEA 2R05A 4F6RD 5ANRA 2R03A 2P9KG 1ZBPA 5AQ7A 5FQ8A 1Z5SC 1WM5A 3S7BA 3HDXA 1TN7A 2IO3C 4JPSA 4GAAA 3CGHA 2L9BA 3JUEA 1TYQG 2X38A 3B7UX 2Y4TA 4CZ2D 1O1SA 4TV3A 5EN5D 3UT4A 2OOEA 3TWWA 1O1RA 5KBAA 4LSZE 3HVEA 2A5EA 5BT1A 3ULQA 4RQIA 5G55A 5FT9A 3JYSA 5D0OD 2XENA 1BU9A 5B1BE 4I1AA 3MGBA 1H0AA 3SBSA 4ANXA 3AU5A 3RJVA 1UJJA 5AJDA 2PZIA 3SFZA 4HOTA 3NZSA 5E76A 4RG9A 2WXIA 2IF4A 2YHCA 2RD0A 4GTVA 4ME2A 1E7UA 1SQMA 2BKGA 1LD8A 5CEDB 4AVXA 4DX2A 3UT8A 4EZKA 3Q75A 1OUVA 4HLEA 5ENOD 3CR3A 4UQZA 3TWUA 2QFCA 1ZB1A 2FI7A 2JEKA 4NQ0A 3SFYA 5AN8A 4F1PA 2NSZA 3FDHA 5BV1A 4BSXA 2P9PG 5BW8C 1TNYA 2P9LG 1VDYA 4PS3A 2HR2A 4JHRA 3KEZA 3MCXA 3UX4A 4V3IA 3TG4A 3LJNA 2NC9A 2XEEA 4L2LA 5KCMA 4G26A 2KCVA 1LD7A 4JXTA 4KT6B 4L9PA 4HXIA 4XEIG 2GRNB 3ZW3A 3DBSA 4GYOA 1S0PA 4GYWA 3CIAA 3ONLA 1QZ2A 4TRQA 1KZPA 4HRNA 2AXZA 4D10C 2R2LA 1OCOE 3T5XA 4ILIA 1D9SA 2P58C 4HI9A 1MJ0A 1N4SA 5AQBA 2DYRE 3SI5A 2JABA 4WUYA 3NOCD 3FH7A 1TNOA 4Q69A 3PZ3A 3TJPA 5G04J 3FU6A 3CK8A 2CHWA 1N94A 3FTSA 3S7FA 2R02A 5AYWD 1BD8A 4GMJA 1ELWA 3DSVA 4WWOA 1QYMA 3ZKJA 2E2EA 5EYPF 3Q79A 3EHQA 4C0EA 5DBKA 5JJ6A 3CVYA 3IV0A 4DUIA 2VGXA 1FCHA 1H6KA 1MX2A 2KC7A 3IBEA 3PE3A 1NZNA 3UKUG 4EZLA 3QJZA 3DSWA 2PM7A 2IJGX 2X6KA 4FHKA 1RW2A 3HVEB 3PNLB 4HQDA 4UWGA 1SW6A 3GYZA 2CHXA 4CYMD 4OVVA 2NYJA 5T8IA 1ELRA 5T4YA 2DYSE 1BI8B 1N4RA 4HOUA 3DXMG 4GPKA 3SGHA 4XI0A 1JCQA 1JCRA 4BSZB 3AU4A 2QY7A 5LCWC 3CVWA 4J8FA 4N3AA 4FJZA 3I5PA 5G05J 3PZ4A 3EUVA 3LEWA 3MYVA 4KVMA 4UWHA 1WAO1 1OT8A 4KZCA 3FULA 4YDOA 2LAIA 3V79K 2IQCA 4HNAD 2R5SA 4CEMA 2WXPA 1MHQA 3DPYA 3S7DA 4DLOA 1SA4A 3LYAA 2LUHA 3O48A 2OCCE 5AENA 2LO6A 2B0OE 3SNXA 3AAAC 2MHKA 3KAEA 4ATZD 3C3RA 4AM9A 3NZUA 1HFAA 4K5AB 4HRMB 3JQ0A 4BX8A 3CQGB 3CVLA 2J49A 4FU3A 4J8YA 5JJTA 3L6AA 4N3CA 4HFGA 5CERB 4GCNA 4PH4B 2EIJE 3D9PA 5KJMA 3L16A 5FZQA 4E6HA 4IN3B 4J8SA 3MKQA 2AWIA 3UI2A 4I1MA 2J4DA 4JEUA 3ONKA 4OAUC 3PDNA 3FUDA 4I17A 2KCLA 1FVFA 1L5JA 3K9IA 3HXEA 1PY1A 3B7TA 3B95A 4G25A 4M7CA 4WNGA 4BETA 1UG3A 3FTYA 4GPMA 3ULEG 3SFXA 2E0IA 2NXPA 5ENSD 1X81A 3ISMC 3PE4A 2VJ8A 2OEWA 5BUZA 3NQPA 4TUMA 3NAWA 3UT7A 3DXKG 3ZYLA 2DBAA 3V30A 2FULA 5A6CA 2GROB 4XKBA 3MJWA 4KYOB 2WXHA 4O1PA 5JHBA 3IXEA 4I2ZA 2WXRA 5KJNA 2YQ8A 3PH0C 4XZ4A 3ZHEA 1HX8A 4URKA 5BPPA 4I6EA 3ESKA 3KSLA 2H6IA 2QZAA 2DIWA 4ABNA 3RIBA 3AS5A 2ILRA 2AVPA 3QOUA 2ETAA 3ASGA 1TR4A 3MV2B 4K0RA 4HLLA 3IKOB 3ASHA 4N5CA 4MLPA 3UMVA 5ANLA 1QNFA 5ENQD 4U8HA 4UI9J 3C3QA 3QAQA 1IKND 2GRMA 4G8LA 2WQ6A 3DEPA 5IY5E 2OV8A 1Z6TA 2WXFA 3U3WA 2VGYA 3IHYA 2Y3AA 3BU8A 4G2VA 4CDNA 4I6JA 2CHZA 4YNDA 2PQRA 3APDA 2UY1B 4LEUA 2XPYA 3LKUA 2WXNA 3D9KA 4XE0A 5JMND 1INZA 3Q7AA 3UTMA 3FUNA 4TXPA 4GZDA 3SBTB 4G23A 2V4HC 1N52A 3TWQA 1N4PA 3LCAA 3RRUA 3OXGA 1D8EA 4GTMA 1SA5A 3CHQA 3PNTB 1PC2A 2C0LA 4WNFA 4G1TA 1AWCB 2XS1A 4B89A 2EIME 4GA0A 1ELKA 2X6JA 3ML8A 1DCQA 4YVOA 2F8XK 1HZ4A 3CKBA 1X5BA 4ILGA 4ILHB 3QWVA 3SO8A 2WXOA 3FEYA 2I9CA 3PEVB 4PS8A 3MKQB 3EHMA 1SZ9A 3W9GA 3UINC 3JXJA 2IO2C 1MQSA 1QBQA 3ZU7B 1UJKA 3BUAA
chains in the Genus database with same CATH topology
2V0PA 2BF0X 2CG3A 3CHOA 4D10C 3L22A 2CG2A 2C0MA 3T5XA 1SZAA 4ILIA 1E90A 3I3NA 2VSYA 4IULA 4U63A 3TGOA 2CFZA 1NA3A 4UWKA 4UQXA 4G11A 2P58C 4GMLA 4FHJA 1HG2A 5CMYA 3APFA 3FU5A 2I2OA 2GGFA 3T8MA 3SI5A 3ZYKA 3D9OA 3G2SA 4JHJA 4IYPA 2BUGA 4WUYA 3QARA 4CT0A 4GZ5A 4APOA 2M63A 5A23A 2YINA 1HU3A 3IEGA 3L17A 3MEKA 3FH7A 4Q69A 5CHEE 4F7AA 3TJPA 3CK7A 5G04J 4FADA 2OVFA 3FU6A 3CK8A 2CHWA 1P5QA 3LVRE 2GRLA 4XKCA 4FA6A 4CRWA 4WAFA 3RRNB 4B8AA 3FTSA 1NA0A 1EYHA 3GW4A 3EHNA 5LFAA 5FZRA 3AS4A 3S7FA 1E8YA 5AYWD 4M3OA 3ZGQA 4B8CB 1E8WA 4GMJA 4BWRA 4HS2A 1ELWA 4ANUA 4WWOA 4PS7A 4F3VA 3KS2A 3EIJA 4GCOA 4A1GA 5ARGA 3ZHEB 2E2EA 2V5FA 2J08A 4N3BA 2AXVA 3HYMB 4C0EA 4K03A 5DBKA 5JJ6A 3CVYA 3G2TA 3IV0A 1H2VC 3FH5A 3PS6A 2VSOE 4JZYA 3S7JA 1EPUA 2VGXA 2J07A 3D9LA 1FCHA 1H6KA 2KC7A 5E75A 2Y4UA 3IBEA 3PE3A 3FTZA 3OTNA 1NZNA 4FC8A 2PM6A 4P29A 4ACKA 4EZLA 3QJZA 1UN8A 2PM7A 1IQUA 3U64A 1JWFA 3ZXSA 2IJGX 5BV0A 4ANVA 2X6KA 3LDZA 4AY6A 4FHKA 3QC1A 2YHEA 3HVEB 3PNLB 4GZCA 3R9AB 3TXNA 3URZA 4F1SA 1HXIA 4UWGA 3LS8A 3GYZA 3FU0A 4A3TA 4DPRA 3FUHA 4Y6WA 2CHXA 2XPZA 4I1OB 4JEHA 4C9BB 4DJAA 2XQ0A 3FFLA 4U0SA 2ONDA 4OVVA 2GW1A 4LCTA 4DI4A 4AY5A 4U04A 1H19A 3D3MA 1NP7A 1Z3XA 3QWWA 2WMOA 3ZYQA 3SZ7A 3EJNA 4FJYA 5J08A 5T8IA 2WQHA 3MX3A 1Z3YA 1ELRA 5T4YA 1A17A 3RU0A 3BG0B 3KD7A 3Q5MA 2WXLA 3G2VA 2A5UA 4NRHB 5D0QD 2ZU6B 2WXQA 1DVPA 3B13A 3FTUA 3MV3B 3APCA 1UW4B 4HOUA 3CVUA 2V8SE 1OWPA 3OXLA 2X6IA 4GPKA 5ARFA 2R17C 3SGHA 4XI0A 5EX3A 3FP3A 1BPOA 4JW1A 3AU4A 1HH8A 2XGMA 3FY4A 3CHPA 2FF4A 2J4BA 5BNWA 2QY7A 5LCWC 3CVXA 5A7DB 4UI9C 3VTXA 4J8FA 3CVWA 3CK9A 4GA2A 4JHKA 3VLFA 3CVNA 4XI9A 4N3AA 3FUEA 2I6HA 3ML9A 4FJZA 4E85A 3D9NA 3I5PA 3MZLB 5FQ4A 5G05J 4AP2A 1JUQA 2BTDA 3LEWA 1QQEA 3CLJA 4XIFA 3MYVA 2VGXB 4A1SA 3BEEA 3FH8A 3G2UA 5FJYA 4KVMA 3PEUB 2IU1A 4U07A 1WAO1 4UWHA 4A3VA 4B0ZA 4HVBA 1EF1C 3PRZA 4N2QA 4HORA 4KZCA 3FULA 3LPZA 1TJFA 2LAIA 3OAWA 3LJ3A 2HYZA 3U9WA 2IQCA 2XRZA 2R5SA 2MOWA 3QDNA 4BTAA 3SF4A 3EIQC 4FLBA 4CEMA 1YA0A 2WXPA 3UPVA 1WY6A 1MHQA 3S7DA 3PZDA 4KBQA 4DLOA 3QB2A 4IRUA 2V4LA 4CGWA 4I6GA 3QWPA 3CHRA 2YNQA 5FZSA 3FUMA 5LOZA 3ZVVA 3FHEA 3LYAA 5HQ8A 3T5VA 1Y6IA 4AOFA 3O48A 5AENA 2I1KA 3UUXA 5LP0A 2OVBA 2PQNA 4GA1A 1HO8A 2LO6A 4BX9A 3ASDA 3AS8A 4O6FA 3N71A 3SNXA 2MHKA 5EKQD 3SHFA 3KAEA 3FUKA 4EQFA 1OWNA 1KT0A 3U4TA 3R7QA 4AM9A 3CVVA 3P2BA 3ZPJA 2LSVA 2X3MA 3FU3A 4H7YA 4L7TA 4WNEA 3G2WA 3NZUA 1HFAA 4BX8A 3JQ0A 5JJ7A 3CQGB 1HF8A 2XGSA 4Q96A 2LNIA 3CVLA 4YVQC 4FP7A 2J49A 2WXJA 1E7VA 4FU3A 4KXKB 4CGVA 1GW6A 3JCKC 1TJCA 3L54A 2KZTB 3L13A 4OYSA 3L6AA 4GZ3A 5JJTA 4AJWA 2RG8A 4HFGA 4N3CA 4AXHA 2VTBA 5M72A 4NURA 2WXGA 4GCNA 1HE8A 1Y8MA 1FVHA 3ASFA 4PH4B 4ANWA 3D9PA 1OWOA 3FUJA 4KVOA 5DIZA 5KJMA 2JLBA 3VTYA 2UWJG 3L16A 5FZQA 1DNPA 4E6HA 4IN3B 5CCLA 4APFA 3CVPA 4J8SA 3MKQA 5C1DA 5EX0A 2AWIA 4HOSA 3C98A 2KATA 2L0IA 3BG1B 4JVSA 4I1MA 3QKYA 2J9QA 2J4DA 4JEUA 3ONKA 3TXMA 3MA5A 3S2AA 3PDNA 3VLDA 4I9CA 3FUDA 4N39A 4I17A 4A55A 3U66A 3WXXA 4R7LA 2KCLA 5J90A 1FVFA 1L5JA 2LAHA 3K9IA 3RKVA 3UQ3A 1PY1A 3B7RL 5KJLA 1XNFA 2C2LA 2L0TB 4N2SA 4U0UA 2HM8A 3B7TA 4G25A 4WNGA 5KJKA 3ZEFA 2VSNA 2AXUA 1UG3A 4F53A 3FTYA 3FTVA 2WQ7A 2PL2A 5G2NA 4BFRA 1N54A 5CMWA 2XCBA 2E0IA 4PDXA 2NXPA 2WVIA 3PE4A 4GYYA 3GZ2A 5JHAA 2X6FA 3FTXA 2VJ8A 3ZFWA 4J8DA 3E4BA 4LERA 3RRMB 2WMNA 2KCKA 5BUZA 4CDRA 1H2UA 4MS6A 3NQPA 4J0UA 4CT4A 4BT9A 3QK0A 3UT7A 3ENEA 1HS6A 2MRIA 3VLEA 3FWVA 3LY8A 4Y6CA 1W3BA 4U0ZA 3CEQA 4AEZC 3ZYLA 4WNDA 2DBAA 4H7XA 1B89A 2FULA 5AJLA 3D9MA 3LY7A 4AIFA 4TUUA 5A6CA 4WWPA 4FULA 4OVUA 4C0MA 4XKBA 3MJWA 3I4RB 4KYOB 3ZN3A 5G04C 3GZSA 3PREA 4JC8A 2VTBB 3RO3A 2WXHA 4MKTA 2XHEA 4ACLA 1U3DA 5JHBA 4EPZA 3ESLA 4I2ZA 2WXRA 3CV0A 2YQ8A 1E8XA 1UN9A 3PH0C 5ANRA 5KJNA 3CKCA 4XZ4A 2UY1A 1ZBPA 1OWLA 5FQ8A 2FBNA 5FTPA 3ZHEA 1E8ZA 1HX8A 4URKA 5BPPA 3R7RA 1WM5A 4I6EA 5FQ6A 3ESKA 3S7BA 2FO7A 3HDXA 2KM4A 2A4ZA 1E96B 2DIWA 1LF8A 4JPSA 4ABNA 4GAAA 3CGHA 4RSYA 3RIBA 4BT8A 4KMOA 3RO2A 3ZRHA 4LRZA 1JWGA 3AS5A 2L9BA 2ILRA 2IONA 2CFUA 2X38A 2AVPA 3B7UX 2Y4TA 3QOUA 3DPDA 5ENNA 4EBAA 3ASGA 3PUKA 2WM9A 3MV2B 4TV3A 3MKRA 4K0RA 4I9EA 1EDUA 5EDSA 3IKOB 1KLXA 3UT4A 2OOEA 3CVQA 5C2YA 4JA9A 4AV7A 3HVEA 3ASHA 4J8EA 4LUNU 5AIJA 4N5CA 1OWMA 5BT1A 2EQXA 4MLPA 3UMVA 5ANLA 2Q7FA 1QNFA 3QNKA 4U8HA 3ULQA 5LCWJ 2XRYA 4UI9J 3CSTA 3JYSA 5FT9A 5G55A 3LVQE 5D0OD 1XGWA 1H2TC 3L08A 4ATGA 4L1BA 3Q15A 2HO1A 3QAQA 1HG5A 2I1JA 3JUIA 4BTBA 4I1AA 3EDTB 2GRMA 4UWFA 3MGBA 2WQ6A 1H0AA 4I2WA 2OV8A 1Z6TA 3Q47B 2WXFA 3SBSA 4ANXA 4DLQA 3U3WA 1IYGA 2VGYA 3AU5A 1ZU2A 3IHVA 4XX5A 2AW6A 3RJVA 3IHYA 1UJJA 4HOQA 3TG5A 4CCAA 2Y3AA 5AJDA 4EBAG 2PZIA 4G2VA 3SFZA 4UWLA 3TL5A 4CDNA 4I6JA 4CDMA 4DI3A 4DK5A 3RK6A 3CHSA 5CCMA 2CHZA 4YNDA 2PQRA 2IOSA 3APDA 2L6JA 4HOTA 2UY1B 4BY6A 3NZSA 4LEUA 3CQCB 4J6IA 5E76A 2XPYA 4G24A 4RG9A 3B7SA 4PUCA 3LKUA 4RG6A 5T3RA 2WXNA 2WXIA 4GU5A 2IF4A 3PVLA 2YHCA 3D9KA 4I43A 2RD0A 3FUIA 4KZ0A 4XE0A 3CHMA 4B94A 1INZA 2IFUA 4UQYA 3TAXA 1QZ2A 4EZJA 3HIZA 3FUNA 4ME2A 4MRUA 1E7UA 1SQMA 5LX8A 5G05C 4JL0A 2WXMA 3LY9A 2WB2A 4GZDA 4AVXA 3NF1A 3SBTB 4FLHA 4G23A 4QFVA 3UT8A 4GZ6A 1N52A 1TEZA 3LCAA 3RRUA 3OXGA 3FEXA 4EZKA 3O4ZA 3Q49B 2J09A 1OUVA 4HLEA 2WPVA 2VSXE 3P1UA 4UI9K 3CR3A 4UQZA 4WWNA 1JPLA 3SD5A 3PUJA 2QFCA 2FI7A 2JEKA 3OXFA 3CSFA 4NQ0A 3CHQA 3PNTB 1PC2A 2C0LA 4WNFA 2NSZA 2XEVA 3FDHA 4G1TA 4W9RA 5BV1A 4B89A 1IQRA 4BSXA 1IHGA 2XPIA 4GA0A 3JQ1A 5BW8C 1KT1A 3Q4AB 2R59A 3D9IA 3HHMA 1VDYA 4PS3A 1ELKA 2X6JA 4L23A 3ML8A 2HR2A 4YVOA 4JHRA 1HZ4A 3CKBA 1X5BA 2XGOA 2LSUA 3KEZA 3MCXA 4ILGA 4ILHB 3UX4A 4V3IA 3TG4A 3QWVA 4JA7A 2NC9A 2WXOA 3FEYA 2DCPA 2I9CA 2WXKA 4L2LA 4Q94A 3PEVB 3ZIMA 2X6HA 4PS8A 5KCMA 3MKQB 4NACA 4G26A 1PAQA 4EECA 2KCVA 3EHMA 2XCCA 1SZ9A 3I4GA 3GZ1A 1U3CA 2KZTA 3LXUX 3FUFA 4GB9A 4JXTA 4KT6B 5FWQA 3FTWA 5HI7A 2IOLA 5FQ7A 3D9JA 4HXIA 3ZW3A 2FEZA 3DBSA 2VQ2A 4GYOA 1MQSA 1S0PA 4GYWA 3CIAA 1UJKA 4RVBA 3ONLA 2VYIA 4TRQA 2AXZA 3ZYMA 4L2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C2Y A;  4FC8 A;  4M3O A; 
#chains in the Genus database with same CATH topology
 1V54 E;  1SZA A;  3I3N A;  4U63 A;  4IUL A;  2CFZ A;  1NA3 A;  4UWK A;  4UQX A;  3APF A;  3FU5 A;  2GGF A;  3ZYK A;  3D9O A;  4LNB A;  5HKP A;  2BUG A;  1V55 E;  2ZXW E;  3SQV A;  1S64 A;  1TN6 A;  4CT0 A;  2YIN A;  3IEG A;  3MEK A;  5CHE E;  4F7A A;  3UXG A;  4FAD A;  3PZ2 A;  4FA6 A;  3DSX A;  4B8A A;  5EIB E;  3EHN A;  5LFA A;  3AS4 A;  1E8Y A;  4M3O A;  1E8W A;  3L82 A;  4F3V A;  3ZHE B;  2AXV A;  3HYM B;  1MZC A;  4K03 A;  3PS6 A;  2F0Y A;  3S7J A;  5AQA A;  1EPU A;  2ZIS A;  3B7B A;  3DSS A;  5E75 A;  3J5Q B;  3FTZ A;  4FC8 A;  2PM6 A;  1S63 A;  1UN8 A;  1IQU A;  1DC2 A;  3D9H A;  5BV0 A;  3T8K A;  1U2V G;  3QC1 A;  3TWS A;  4GZC A;  3LS8 A;  5CRV A;  3FU0 A;  4DPR A;  3DRA A;  2XPZ A;  4DJA A;  4C9B B;  4ZFH A;  2XQ0 A;  4LCT A;  1H19 A;  3QWW A;  1G3N B;  4U8Y D;  4DX6 D;  3KD7 A;  2WXL A;  3G2V A;  2A5U A;  2ZU6 B;  3EHR A;  3MV3 B;  2V8S E;  3OXL A;  2RFA A;  5EX3 A;  3HXD A;  1BPO A;  1WG0 A;  4JW1 A;  2FO1 E;  5A7D B;  4GA2 A;  2LXM A;  5BXO A;  5FQ4 A;  2BTD A;  4XIF A;  5KNG A;  3BEE A;  5FJY A;  4HVB A;  1H6P A;  1EF1 C;  4N2Q A;  1TJF A;  3E33 A;  3LJ3 A;  2HYZ A;  3V2O A;  2XRZ A;  3QB2 A;  4CGW A;  4MBG A;  3FUM A;  5LOZ A;  3FHE A;  1Y6I A;  2OEV A;  5LP0 A;  4BX9 A;  3AS8 A;  3DSU A;  5EKQ D;  3FUK A;  1OWN A;  1KT0 A;  3Q73 A;  3U4T A;  4H7Y A;  4WNE A;  4N5Q A;  5JJ7 A;  1HF8 A;  1DCE A;  4FP7 A;  4KXK B;  4CGV A;  1TJC A;  3L54 A;  4OYS A;  1NI1 A;  2F8Y A;  4AJW A;  5M72 A;  2H6G A;  1HE8 A;  1Y8M A;  3HXF A;  1FVH A;  2DZN A;  3FUJ A;  5DIZ A;  3VTY A;  2UWJ G;  4Z68 A;  4GTS A;  5CCL A;  5C1D A;  2Y1L E;  3C98 A;  2KAT A;  2L0I A;  3QKY A;  3AG2 E;  4I9C A;  4N39 A;  4A55 A;  3ULY A;  3UQ3 A;  3B7R L;  5KJL A;  1XNF A;  2L0T B;  5AAO A;  5KJK A;  5ENT D;  2VSN A;  4F53 A;  2WQ7 A;  3X2Q E;  5CMW A;  2XCB A;  4PDX A;  3NBN B;  2GRQ B;  2F37 A;  3ZFW A;  2WMN A;  4MS6 A;  4U7E B;  3L9T A;  4CT4 A;  4BT9 A;  3ENE A;  3FWV A;  4AEZ C;  3CEQ A;  5AJL A;  3D9M A;  4AIF A;  3ZN3 A;  2VTB B;  4MKT A;  1U3D A;  4EPZ A;  3ESL A;  5AQ9 A;  4GTO A;  3CV0 A;  1E8X A;  3CKC A;  2UY1 A;  1OWL A;  5FTP A;  3UIO C;  3R7R A;  1NFI E;  1YCS B;  2KM4 A;  1E96 B;  1LF8 A;  4RSY A;  1JWG A;  2CFU A;  3ZUV B;  4EBA A;  1N0R A;  3CVQ A;  3HXB A;  4YDY A;  4AV7 A;  4J8E A;  4LUN U;  2EIL E;  1OWM A;  5EIL A;  4O60 A;  3QNK A;  1TN8 A;  1AP7 A;  5LCW J;  4JD2 G;  2XRY A;  3LVQ E;  3L08 A;  4L1B A;  1OCZ E;  2HO1 A;  3ASN E;  1HG5 A;  2Y69 E;  3JUI A;  4UUC A;  4I2W A;  3UM1 A;  3Q47 B;  4DLQ A;  1IYG A;  1ZU2 A;  3IHV A;  4DX7 D;  2AW6 A;  2B6C A;  3TG5 A;  3TL5 A;  4UWL A;  5CCM A;  2IY0 C;  2IOS A;  4BY6 A;  4J6I A;  4G24 A;  3B7S A;  4PUC A;  4RG6 A;  2DZO A;  1N9A A;  3FUI A;  4KZ0 A;  2ZGG A;  2IFU A;  4UQY A;  2DVW A;  3TAX A;  3UM0 A;  4JL0 A;  2WXM A;  2WB2 A;  1MYO A;  2P9U G;  3HXC A;  4QFV A;  4GZ6 A;  3FEX A;  3Q49 B;  2WPV A;  4WWN A;  3PUJ A;  4YDW A;  3OXF A;  5CBN A;  1IQR A;  3JQ1 A;  1KT1 A;  1FT1 A;  3Q4A B;  2P9N G;  2R59 A;  1H6O A;  2XGO A;  2LSU A;  4JA7 A;  2DCP A;  3ASO E;  2WXK A;  3ZIM A;  4TXR A;  1PAQ A;  2XCC A;  3I4G A;  3GZ1 A;  4GB9 A;  2KZT A;  3FUF A;  5FWQ A;  3JXI A;  2FEZ A;  4GTP A;  5HRY A;  3ZYM A;  4L2Y A;  2V0P A;  2BF0 X;  2C0M A;  1E90 A;  1FPP A;  3T8M A;  4JHJ A;  1YMP A;  3ABK E;  3QAR A;  2M63 A;  2ZIR A;  3BQO A;  3L17 A;  3CK7 A;  2ETC A;  4K5B A;  1P5Q A;  3LVR E;  4XKC A;  1S70 B;  4WAF A;  1WDY A;  3ZNG A;  1NA0 A;  1EYH A;  3GW4 A;  5FZR A;  3ZGQ A;  4B8C B;  4BWR A;  4ANU A;  1BLX B;  4PS7 A;  3KS2 A;  3EIJ A;  2XZD G;  4A1G A;  5ARG A;  3UM2 A;  2V5F A;  2J08 A;  5KWD A;  4N3B A;  3G2T A;  3FH5 A;  2QYU A;  2VSO E;  2P9I G;  3D9L A;  3OTN A;  3AG1 E;  4P29 A;  3R9M A;  1JWF A;  3ZXS A;  4ANV A;  5ENR D;  3LDZ A;  2YHE A;  4K5C A;  3R9A B;  3TXN A;  4A3T A;  4I1O B;  3FFL A;  4DI4 A;  4BES A;  1RZ4 A;  3SZ7 A;  3EJN A;  4FJY A;  4DRX E;  5J08 A;  3E32 A;  2KBX A;  1Z3Y A;  2HE0 A;  4J7W A;  1A17 A;  4DX5 D;  2WXQ A;  4HRL A;  5EYL A;  1DVP A;  3B13 A;  3DWL G;  1UW4 B;  2VGE A;  2X6I A;  2R17 C;  1OCC E;  3FP3 A;  3CHP A;  2J4B A;  4GMR A;  3CVX A;  3CK9 A;  4JHK A;  4U96 D;  3CVN A;  3D9N A;  3MZL B;  3Q9U C;  1QQE A;  3CLJ A;  4A3V A;  4U07 A;  4B0Z A;  3PRZ A;  3LPZ A;  2EIK E;  1NL4 A;  2MOW A;  3QDN A;  4BTA A;  3SF4 A;  4C48 B;  3UPV A;  3PZD A;  4KBQ A;  4NIK A;  3UM3 A;  2V4L A;  4I6G A;  3QWP A;  3CHR A;  2YNQ A;  3T5V A;  2I1K A;  3UUX A;  2OVB A;  4EHM A;  3ZXP A;  3SHF A;  3AJI A;  3NB2 A;  3R7Q A;  3CVV A;  3P2B A;  3ZPJ A;  2L6B A;  2X3M A;  5FIN A;  4HB5 A;  2MYO A;  2XGS A;  2LNI A;  4YVQ C;  3Q9N C;  2P2C P;  4GTT A;  4B93 B;  1E7V A;  3TWT A;  1MX4 A;  1JCS A;  1GW6 A;  3JCK C;  2KZT B;  3L13 A;  2RG8 A;  2VTB A;  3HG0 D;  3ASF A;  4ANW A;  4KVO A;  1OWO A;  3NOG D;  2JLB A;  1FT2 A;  1BI7 B;  1TNU A;  4HOS A;  5CEC B;  3C3O A;  5H7P A;  3VLD A;  3U66 A;  3WXX A;  4R7L A;  3SY2 A;  5J90 A;  2LAH A;  3RKV A;  4N2S A;  2DWZ A;  3HRA A;  3ZEF A;  2QC9 A;  2AXU A;  3TWX A;  3FTV A;  2PL2 A;  2RFM A;  3ABM E;  3TWV A;  1N54 A;  3V31 A;  2X6F A;  3E4B A;  3TWR A;  4QQI A;  1H2U A;  2QYJ A;  1KPS B;  4J0U A;  1HS6 A;  2MRI A;  3VLE A;  3LY8 A;  4Y6C A;  4G8K A;  4H7X A;  1B89 A;  4BEP A;  1TNB A;  3LY7 A;  4HI8 A;  1LTX A;  4WWP A;  4OVU A;  4C0M A;  5G04 C;  3GZS A;  3PRE A;  2LXL A;  4ACL A;  2AJA A;  4TXQ A;  1UN9 A;  4BER A;  2FBN A;  1E8Z A;  5FQ6 A;  2FO7 A;  2A4Z A;  4GTQ A;  4BT8 A;  4KMO A;  3RO2 A;  3ZRH A;  4LRZ A;  2ION A;  4RLY A;  5ENN A;  3DPD A;  5CBO A;  1KZO A;  3PUK A;  2WM9 A;  3MKR A;  4I9E A;  1EDU A;  5EDS A;  1KLX A;  5B3S E;  5C2Y A;  2GRR B;  4JA9 A;  4HBD A;  5AIJ A;  2EQX A;  2Q7F A;  1K1B A;  3CST A;  1SVX A;  1XGW A;  1H2T C;  3E34 A;  4ATG A;  3Q15 A;  5ITZ F;  2I1J A;  4BTB A;  3EDT B;  4UWF A;  3C72 A;  4XX5 A;  4HOQ A;  5D66 A;  4CCA A;  4EBA G;  4DK5 A;  4CDM A;  4DI3 A;  3RK6 A;  3CHS A;  1OY3 D;  2L6J A;  3CQC B;  5T3R A;  4GU5 A;  3PVL A;  4I43 A;  3CHM A;  4B94 A;  2GRP B;  4EZJ A;  3HIZ A;  4MRU A;  5LX8 A;  5G05 C;  3LY9 A;  5CRU A;  3NF1 A;  4FLH A;  3WG7 E;  1D8D A;  1TEZ A;  3KEA A;  1MX6 A;  3V2X A;  3O4Z A;  2J09 A;  2EIN E;  2VSX E;  3P1U A;  1OXJ A;  4UI9 K;  1JPL A;  3SD5 A;  3CSF A;  2XEV A;  1IHG A;  2XPI A;  5HS0 A;  2PNN A;  1OCR E;  3D9I A;  3HHM A;  4L23 A;  2RKK A;  4U95 D;  5KNH D;  3F6Q A;  4Q94 A;  2X6H A;  1N95 A;  2BED A;  4NAC A;  4EEC A;  4W9R A;  3LXU X;  1U3C A;  5D2M C;  3FTW A;  5HI7 A;  2IOL A;  5FQ7 A;  3D9J A;  5AAR A;  4A63 B;  2VQ2 A;  1IXV A;  4RVB A;  2VYI A;  2ZGD A;  2CG3 A;  3CHO A;  3L22 A;  2CG2 A;  1TNZ A;  2VSY A;  3TGO A;  4G11 A;  2H6F A;  4GML A;  4FHJ A;  1HG2 A;  5CMY A;  2I2O A;  3G2S A;  4IYP A;  4GZ5 A;  4APO A;  5A23 A;  1HU3 A;  1O1T A;  2OVF A;  2Y0B G;  2BKK B;  2GRL A;  4CRW A;  3RRN B;  1K8K G;  4HS2 A;  1IHB A;  4GCO A;  5CEA A;  1H2V C;  4JZY A;  3RAU A;  2J07 A;  2Y4U A;  3E37 A;  4ACK A;  3E30 A;  3U64 A;  4JB8 P;  1N0Q A;  4AY6 A;  3UKR G;  3URZ A;  4F1S A;  1HXI A;  2H6H A;  3FUH A;  4Y6W A;  4JEH A;  4U0S A;  2OND A;  2GW1 A;  4AY5 A;  4U04 A;  3D3M A;  1NP7 A;  1Z3X A;  2WMO A;  3ZYQ A;  3AG3 E;  2WQH A;  3MX3 A;  3EU9 A;  2ETB A;  3RU0 A;  3BG0 B;  3Q5M A;  4NRH B;  5D0Q D;  3FTU A;  3RSE G;  3APC A;  3CVU A;  1OWP A;  5ARF A;  4LNU D;  1HH8 A;  2XGM A;  3FY4 A;  2FF4 A;  5BNW A;  4UI9 C;  3VTX A;  3J5P A;  3PZ1 A;  3VLF A;  4XI9 A;  3FUE A;  2I6H A;  3W9F A;  1K3Z D;  3ML9 A;  3ABL E;  4E85 A;  2KXP C;  2V5Q C;  4AP2 A;  1JUQ A;  4LG6 A;  1YYH A;  2VGX B;  4A1S A;  3FH8 A;  3G2U A;  5ENP D;  3PEU B;  2IU1 A;  1K1A A;  4ZHB A;  4YDE A;  3T9K A;  4HOR A;  3OAW A;  3U9W A;  3EIQ C;  4FLB A;  1YA0 A;  1WY6 A;  5BXU A;  4IRU A;  2IEJ A;  5FZS A;  1O5M A;  3ZVV A;  5HQ8 A;  4AOF A;  4GA1 A;  2PQN A;  1HO8 A;  4DX1 A;  3ASD A;  4O6F A;  3N71 A;  2J8S D;  4X8Q A;  4EQF A;  4O1O A;  2XS8 A;  4OAV B;  1N11 A;  2LSV A;  3FU3 A;  4L7T A;  3G2W A;  4Q96 A;  5JA4 D;  2WXJ A;  1A5E A;  4GZ3 A;  4AXH A;  4NUR A;  2WXG A;  3AG4 E;  1UOH A;  1DNP A;  3Q7F A;  4LNG A;  2XZT G;  4APF A;  3CVP A;  3KSQ A;  5EX0 A;  4JVS A;  3BG1 B;  2J9Q A;  4U8V D;  3TXM A;  3MA5 A;  3S2A A;  1Q2Z A;  5B1A E;  3C5R A;  2C2L A;  4U0U A;  2HM8 A;  2P9S G;  4GTR A;  5G2N A;  4BFR A;  3UIP C;  2WVI A;  4GYY A;  3GZ2 A;  5JHA A;  3FTX A;  4J8D A;  4LER A;  3RRM B;  2KCK A;  4CDR A;  2XEH A;  5FIO A;  3DST A;  5EID A;  1N4Q A;  3QK0 A;  1W3B A;  4U0Z A;  4WND A;  3EU5 A;  3DEO A;  4TUU A;  4FUL A;  3I4R B;  3Q78 A;  4JC8 A;  3RO3 A;  2XHE A;  2R05 A;  4F6R D;  5ANR A;  2R03 A;  2P9K G;  1ZBP A;  5AQ7 A;  5FQ8 A;  1Z5S C;  1WM5 A;  3S7B A;  3HDX A;  1TN7 A;  2IO3 C;  4JPS A;  4GAA A;  3CGH A;  2L9B A;  3JUE A;  1TYQ G;  2X38 A;  3B7U X;  2Y4T A;  4CZ2 D;  1O1S A;  4TV3 A;  5EN5 D;  3UT4 A;  2OOE A;  3TWW A;  1O1R A;  5KBA A;  4LSZ E;  3HVE A;  2A5E A;  5BT1 A;  3ULQ A;  4RQI A;  5G55 A;  5FT9 A;  3JYS A;  5D0O D;  2XEN A;  1BU9 A;  5B1B E;  4I1A A;  3MGB A;  1H0A A;  3SBS A;  4ANX A;  3AU5 A;  3RJV A;  1UJJ A;  5AJD A;  2PZI A;  3SFZ A;  4HOT A;  3NZS A;  5E76 A;  4RG9 A;  2WXI A;  2IF4 A;  2YHC A;  2RD0 A;  4GTV A;  4ME2 A;  1E7U A;  1SQM A;  2BKG A;  1LD8 A;  5CED B;  4AVX A;  4DX2 A;  3UT8 A;  4EZK A;  3Q75 A;  1OUV A;  4HLE A;  5ENO D;  3CR3 A;  4UQZ A;  3TWU A;  2QFC A;  1ZB1 A;  2FI7 A;  2JEK A;  4NQ0 A;  3SFY A;  5AN8 A;  4F1P A;  2NSZ A;  3FDH A;  5BV1 A;  4BSX A;  2P9P G;  5BW8 C;  1TNY A;  2P9L G;  1VDY A;  4PS3 A;  2HR2 A;  4JHR A;  3KEZ A;  3MCX A;  3UX4 A;  4V3I A;  3TG4 A;  3LJN A;  2NC9 A;  2XEE A;  4L2L A;  5KCM A;  4G26 A;  2KCV A;  1LD7 A;  4JXT A;  4KT6 B;  4L9P A;  4HXI A;  4XEI G;  2GRN B;  3ZW3 A;  3DBS A;  4GYO A;  1S0P A;  4GYW A;  3CIA A;  3ONL A;  1QZ2 A;  4TRQ A;  1KZP A;  4HRN A;  2AXZ A;  4D10 C;  2R2L A;  1OCO E;  3T5X A;  4ILI A;  1D9S A;  2P58 C;  4HI9 A;  1MJ0 A;  1N4S A;  5AQB A;  2DYR E;  3SI5 A;  2JAB A;  4WUY A;  3NOC D;  3FH7 A;  1TNO A;  4Q69 A;  3PZ3 A;  3TJP A;  5G04 J;  3FU6 A;  3CK8 A;  2CHW A;  1N94 A;  3FTS A;  3S7F A;  2R02 A;  5AYW D;  1BD8 A;  4GMJ A;  1ELW A;  3DSV A;  4WWO A;  1QYM A;  3ZKJ A;  2E2E A;  5EYP F;  3Q79 A;  3EHQ A;  4C0E A;  5DBK A;  5JJ6 A;  3CVY A;  3IV0 A;  4DUI A;  2VGX A;  1FCH A;  1H6K A;  1MX2 A;  2KC7 A;  3IBE A;  3PE3 A;  1NZN A;  3UKU G;  4EZL A;  3QJZ A;  3DSW A;  2PM7 A;  2IJG X;  2X6K A;  4FHK A;  1RW2 A;  3HVE B;  3PNL B;  4HQD A;  4UWG A;  1SW6 A;  3GYZ A;  2CHX A;  4CYM D;  4OVV A;  2NYJ A;  5T8I A;  1ELR A;  5T4Y A;  2DYS E;  1BI8 B;  1N4R A;  4HOU A;  3DXM G;  4GPK A;  3SGH A;  4XI0 A;  1JCQ A;  1JCR A;  4BSZ B;  3AU4 A;  2QY7 A;  5LCW C;  3CVW A;  4J8F A;  4N3A A;  4FJZ A;  3I5P A;  5G05 J;  3PZ4 A;  3EUV A;  3LEW A;  3MYV A;  4KVM A;  4UWH A;  1WAO 1;  1OT8 A;  4KZC A;  3FUL A;  4YDO A;  2LAI A;  3V79 K;  2IQC A;  4HNA D;  2R5S A;  4CEM A;  2WXP A;  1MHQ A;  3DPY A;  3S7D A;  4DLO A;  1SA4 A;  3LYA A;  2LUH A;  3O48 A;  2OCC E;  5AEN A;  2LO6 A;  2B0O E;  3SNX A;  3AAA C;  2MHK A;  3KAE A;  4ATZ D;  3C3R A;  4AM9 A;  3NZU A;  1HFA A;  4K5A B;  4HRM B;  3JQ0 A;  4BX8 A;  3CQG B;  3CVL A;  2J49 A;  4FU3 A;  4J8Y A;  5JJT A;  3L6A A;  4N3C A;  4HFG A;  5CER B;  4GCN A;  4PH4 B;  2EIJ E;  3D9P A;  5KJM A;  3L16 A;  5FZQ A;  4E6H A;  4IN3 B;  4J8S A;  3MKQ A;  2AWI A;  3UI2 A;  4I1M A;  2J4D A;  4JEU A;  3ONK A;  4OAU C;  3PDN A;  3FUD A;  4I17 A;  2KCL A;  1FVF A;  1L5J A;  3K9I A;  3HXE A;  1PY1 A;  3B7T A;  3B95 A;  4G25 A;  4M7C A;  4WNG A;  4BET A;  1UG3 A;  3FTY A;  4GPM A;  3ULE G;  3SFX A;  2E0I A;  2NXP A;  5ENS D;  1X81 A;  3ISM C;  3PE4 A;  2VJ8 A;  2OEW A;  5BUZ A;  3NQP A;  4TUM A;  3NAW A;  3UT7 A;  3DXK G;  3ZYL A;  2DBA A;  3V30 A;  2FUL A;  5A6C A;  2GRO B;  4XKB A;  3MJW A;  4KYO B;  2WXH A;  4O1P A;  5JHB A;  3IXE A;  4I2Z A;  2WXR A;  5KJN A;  2YQ8 A;  3PH0 C;  4XZ4 A;  3ZHE A;  1HX8 A;  4URK A;  5BPP A;  4I6E A;  3ESK A;  3KSL A;  2H6I A;  2QZA A;  2DIW A;  4ABN A;  3RIB A;  3AS5 A;  2ILR A;  2AVP A;  3QOU A;  2ETA A;  3ASG A;  1TR4 A;  3MV2 B;  4K0R A;  4HLL A;  3IKO B;  3ASH A;  4N5C A;  4MLP A;  3UMV A;  5ANL A;  1QNF A;  5ENQ D;  4U8H A;  4UI9 J;  3C3Q A;  3QAQ A;  1IKN D;  2GRM A;  4G8L A;  2WQ6 A;  3DEP A;  5IY5 E;  2OV8 A;  1Z6T A;  2WXF A;  3U3W A;  2VGY A;  3IHY A;  2Y3A A;  3BU8 A;  4G2V A;  4CDN A;  4I6J A;  2CHZ A;  4YND A;  2PQR A;  3APD A;  2UY1 B;  4LEU A;  2XPY A;  3LKU A;  2WXN A;  3D9K A;  4XE0 A;  5JMN D;  1INZ A;  3Q7A A;  3UTM A;  3FUN A;  4TXP A;  4GZD A;  3SBT B;  4G23 A;  2V4H C;  1N52 A;  3TWQ A;  1N4P A;  3LCA A;  3RRU A;  3OXG A;  1D8E A;  4GTM A;  1SA5 A;  3CHQ A;  3PNT B;  1PC2 A;  2C0L A;  4WNF A;  4G1T A;  1AWC B;  2XS1 A;  4B89 A;  2EIM E;  4GA0 A;  1ELK A;  2X6J A;  3ML8 A;  1DCQ A;  4YVO A;  2F8X K;  1HZ4 A;  3CKB A;  1X5B A;  4ILG A;  4ILH B;  3QWV A;  3SO8 A;  2WXO A;  3FEY A;  2I9C A;  3PEV B;  4PS8 A;  3MKQ B;  3EHM A;  1SZ9 A;  3W9G A;  3UIN C;  3JXJ A;  2IO2 C;  1MQS A;  1QBQ A;  3ZU7 B;  1UJK A;  3BUA A; 
#chains in the Genus database with same CATH homology
 2V0P A;  2BF0 X;  2CG3 A;  3CHO A;  4D10 C;  3L22 A;  2CG2 A;  2C0M A;  3T5X A;  1SZA A;  4ILI A;  1E90 A;  3I3N A;  2VSY A;  4IUL A;  4U63 A;  3TGO A;  2CFZ A;  1NA3 A;  4UWK A;  4UQX A;  4G11 A;  2P58 C;  4GML A;  4FHJ A;  1HG2 A;  5CMY A;  3APF A;  3FU5 A;  2I2O A;  2GGF A;  3T8M A;  3SI5 A;  3ZYK A;  3D9O A;  3G2S A;  4JHJ A;  4IYP A;  2BUG A;  4WUY A;  3QAR A;  4CT0 A;  4GZ5 A;  4APO A;  2M63 A;  5A23 A;  2YIN A;  1HU3 A;  3IEG A;  3L17 A;  3MEK A;  3FH7 A;  4Q69 A;  5CHE E;  4F7A A;  3TJP A;  3CK7 A;  5G04 J;  4FAD A;  2OVF A;  3FU6 A;  3CK8 A;  2CHW A;  1P5Q A;  3LVR E;  2GRL A;  4XKC A;  4FA6 A;  4CRW A;  4WAF A;  3RRN B;  4B8A A;  3FTS A;  1NA0 A;  1EYH A;  3GW4 A;  3EHN A;  5LFA A;  5FZR A;  3AS4 A;  3S7F A;  1E8Y A;  5AYW D;  4M3O A;  3ZGQ A;  4B8C B;  1E8W A;  4GMJ A;  4BWR A;  4HS2 A;  1ELW A;  4ANU A;  4WWO A;  4PS7 A;  4F3V A;  3KS2 A;  3EIJ A;  4GCO A;  4A1G A;  5ARG A;  3ZHE B;  2E2E A;  2V5F A;  2J08 A;  4N3B A;  2AXV A;  3HYM B;  4C0E A;  4K03 A;  5DBK A;  5JJ6 A;  3CVY A;  3G2T A;  3IV0 A;  1H2V C;  3FH5 A;  3PS6 A;  2VSO E;  4JZY A;  3S7J A;  1EPU A;  2VGX A;  2J07 A;  3D9L A;  1FCH A;  1H6K A;  2KC7 A;  5E75 A;  2Y4U A;  3IBE A;  3PE3 A;  3FTZ A;  3OTN A;  1NZN A;  4FC8 A;  2PM6 A;  4P29 A;  4ACK A;  4EZL A;  3QJZ A;  1UN8 A;  2PM7 A;  1IQU A;  3U64 A;  1JWF A;  3ZXS A;  2IJG X;  5BV0 A;  4ANV A;  2X6K A;  3LDZ A;  4AY6 A;  4FHK A;  3QC1 A;  2YHE A;  3HVE B;  3PNL B;  4GZC A;  3R9A B;  3TXN A;  3URZ A;  4F1S A;  1HXI A;  4UWG A;  3LS8 A;  3GYZ A;  3FU0 A;  4A3T A;  4DPR A;  3FUH A;  4Y6W A;  2CHX A;  2XPZ A;  4I1O B;  4JEH A;  4C9B B;  4DJA A;  2XQ0 A;  3FFL A;  4U0S A;  2OND A;  4OVV A;  2GW1 A;  4LCT A;  4DI4 A;  4AY5 A;  4U04 A;  1H19 A;  3D3M A;  1NP7 A;  1Z3X A;  3QWW A;  2WMO A;  3ZYQ A;  3SZ7 A;  3EJN A;  4FJY A;  5J08 A;  5T8I A;  2WQH A;  3MX3 A;  1Z3Y A;  1ELR A;  5T4Y A;  1A17 A;  3RU0 A;  3BG0 B;  3KD7 A;  3Q5M A;  2WXL A;  3G2V A;  2A5U A;  4NRH B;  5D0Q D;  2ZU6 B;  2WXQ A;  1DVP A;  3B13 A;  3FTU A;  3MV3 B;  3APC A;  1UW4 B;  4HOU A;  3CVU A;  2V8S E;  1OWP A;  3OXL A;  2X6I A;  4GPK A;  5ARF A;  2R17 C;  3SGH A;  4XI0 A;  5EX3 A;  3FP3 A;  1BPO A;  4JW1 A;  3AU4 A;  1HH8 A;  2XGM A;  3FY4 A;  3CHP A;  2FF4 A;  2J4B A;  5BNW A;  2QY7 A;  5LCW C;  3CVX A;  5A7D B;  4UI9 C;  3VTX A;  4J8F A;  3CVW A;  3CK9 A;  4GA2 A;  4JHK A;  3VLF A;  3CVN A;  4XI9 A;  4N3A A;  3FUE A;  2I6H A;  3ML9 A;  4FJZ A;  4E85 A;  3D9N A;  3I5P A;  3MZL B;  5FQ4 A;  5G05 J;  4AP2 A;  1JUQ A;  2BTD A;  3LEW A;  1QQE A;  3CLJ A;  4XIF A;  3MYV A;  2VGX B;  4A1S A;  3BEE A;  3FH8 A;  3G2U A;  5FJY A;  4KVM A;  3PEU B;  2IU1 A;  4U07 A;  1WAO 1;  4UWH A;  4A3V A;  4B0Z A;  4HVB A;  1EF1 C;  3PRZ A;  4N2Q A;  4HOR A;  4KZC A;  3FUL A;  3LPZ A;  1TJF A;  2LAI A;  3OAW A;  3LJ3 A;  2HYZ A;  3U9W A;  2IQC A;  2XRZ A;  2R5S A;  2MOW A;  3QDN A;  4BTA A;  3SF4 A;  3EIQ C;  4FLB A;  4CEM A;  1YA0 A;  2WXP A;  3UPV A;  1WY6 A;  1MHQ A;  3S7D A;  3PZD A;  4KBQ A;  4DLO A;  3QB2 A;  4IRU A;  2V4L A;  4CGW A;  4I6G A;  3QWP A;  3CHR A;  2YNQ A;  5FZS A;  3FUM A;  5LOZ A;  3ZVV A;  3FHE A;  3LYA A;  5HQ8 A;  3T5V A;  1Y6I A;  4AOF A;  3O48 A;  5AEN A;  2I1K A;  3UUX A;  5LP0 A;  2OVB A;  2PQN A;  4GA1 A;  1HO8 A;  2LO6 A;  4BX9 A;  3ASD A;  3AS8 A;  4O6F A;  3N71 A;  3SNX A;  2MHK A;  5EKQ D;  3SHF A;  3KAE A;  3FUK A;  4EQF A;  1OWN A;  1KT0 A;  3U4T A;  3R7Q A;  4AM9 A;  3CVV A;  3P2B A;  3ZPJ A;  2LSV A;  2X3M A;  3FU3 A;  4H7Y A;  4L7T A;  4WNE A;  3G2W A;  3NZU A;  1HFA A;  4BX8 A;  3JQ0 A;  5JJ7 A;  3CQG B;  1HF8 A;  2XGS A;  4Q96 A;  2LNI A;  3CVL A;  4YVQ C;  4FP7 A;  2J49 A;  2WXJ A;  1E7V A;  4FU3 A;  4KXK B;  4CGV A;  1GW6 A;  3JCK C;  1TJC A;  3L54 A;  2KZT B;  3L13 A;  4OYS A;  3L6A A;  4GZ3 A;  5JJT A;  4AJW A;  2RG8 A;  4HFG A;  4N3C A;  4AXH A;  2VTB A;  5M72 A;  4NUR A;  2WXG A;  4GCN A;  1HE8 A;  1Y8M A;  1FVH A;  3ASF A;  4PH4 B;  4ANW A;  3D9P A;  1OWO A;  3FUJ A;  4KVO A;  5DIZ A;  5KJM A;  2JLB A;  3VTY A;  2UWJ G;  3L16 A;  5FZQ A;  1DNP A;  4E6H A;  4IN3 B;  5CCL A;  4APF A;  3CVP A;  4J8S A;  3MKQ A;  5C1D A;  5EX0 A;  2AWI A;  4HOS A;  3C98 A;  2KAT A;  2L0I A;  3BG1 B;  4JVS A;  4I1M A;  3QKY A;  2J9Q A;  2J4D A;  4JEU A;  3ONK A;  3TXM A;  3MA5 A;  3S2A A;  3PDN A;  3VLD A;  4I9C A;  3FUD A;  4N39 A;  4I17 A;  4A55 A;  3U66 A;  3WXX A;  4R7L A;  2KCL A;  5J90 A;  1FVF A;  1L5J A;  2LAH A;  3K9I A;  3RKV A;  3UQ3 A;  1PY1 A;  3B7R L;  5KJL A;  1XNF A;  2C2L A;  2L0T B;  4N2S A;  4U0U A;  2HM8 A;  3B7T A;  4G25 A;  4WNG A;  5KJK A;  3ZEF A;  2VSN A;  2AXU A;  1UG3 A;  4F53 A;  3FTY A;  3FTV A;  2WQ7 A;  2PL2 A;  5G2N A;  4BFR A;  1N54 A;  5CMW A;  2XCB A;  2E0I A;  4PDX A;  2NXP A;  2WVI A;  3PE4 A;  4GYY A;  3GZ2 A;  5JHA A;  2X6F A;  3FTX A;  2VJ8 A;  3ZFW A;  4J8D A;  3E4B A;  4LER A;  3RRM B;  2WMN A;  2KCK A;  5BUZ A;  4CDR A;  1H2U A;  4MS6 A;  3NQP A;  4J0U A;  4CT4 A;  4BT9 A;  3QK0 A;  3UT7 A;  3ENE A;  1HS6 A;  2MRI A;  3VLE A;  3FWV A;  3LY8 A;  4Y6C A;  1W3B A;  4U0Z A;  3CEQ A;  4AEZ C;  3ZYL A;  4WND A;  2DBA A;  4H7X A;  1B89 A;  2FUL A;  5AJL A;  3D9M A;  3LY7 A;  4AIF A;  4TUU A;  5A6C A;  4WWP A;  4FUL A;  4OVU A;  4C0M A;  4XKB A;  3MJW A;  3I4R B;  4KYO B;  3ZN3 A;  5G04 C;  3GZS A;  3PRE A;  4JC8 A;  2VTB B;  3RO3 A;  2WXH A;  4MKT A;  2XHE A;  4ACL A;  1U3D A;  5JHB A;  4EPZ A;  3ESL A;  4I2Z A;  2WXR A;  3CV0 A;  2YQ8 A;  1E8X A;  1UN9 A;  3PH0 C;  5ANR A;  5KJN A;  3CKC A;  4XZ4 A;  2UY1 A;  1ZBP A;  1OWL A;  5FQ8 A;  2FBN A;  5FTP A;  3ZHE A;  1E8Z A;  1HX8 A;  4URK A;  5BPP A;  3R7R A;  1WM5 A;  4I6E A;  5FQ6 A;  3ESK A;  3S7B A;  2FO7 A;  3HDX A;  2KM4 A;  2A4Z A;  1E96 B;  2DIW A;  1LF8 A;  4JPS A;  4ABN A;  4GAA A;  3CGH A;  4RSY A;  3RIB A;  4BT8 A;  4KMO A;  3RO2 A;  3ZRH A;  4LRZ A;  1JWG A;  3AS5 A;  2L9B A;  2ILR A;  2ION A;  2CFU A;  2X38 A;  2AVP A;  3B7U X;  2Y4T A;  3QOU A;  3DPD A;  5ENN A;  4EBA A;  3ASG A;  3PUK A;  2WM9 A;  3MV2 B;  4TV3 A;  3MKR A;  4K0R A;  4I9E A;  1EDU A;  5EDS A;  3IKO B;  1KLX A;  3UT4 A;  2OOE A;  3CVQ A;  5C2Y A;  4JA9 A;  4AV7 A;  3HVE A;  3ASH A;  4J8E A;  4LUN U;  5AIJ A;  4N5C A;  1OWM A;  5BT1 A;  2EQX A;  4MLP A;  3UMV A;  5ANL A;  2Q7F A;  1QNF A;  3QNK A;  4U8H A;  3ULQ A;  5LCW J;  2XRY A;  4UI9 J;  3CST A;  3JYS A;  5FT9 A;  5G55 A;  3LVQ E;  5D0O D;  1XGW A;  1H2T C;  3L08 A;  4ATG A;  4L1B A;  3Q15 A;  2HO1 A;  3QAQ A;  1HG5 A;  2I1J A;  3JUI A;  4BTB A;  4I1A A;  3EDT B;  2GRM A;  4UWF A;  3MGB A;  2WQ6 A;  1H0A A;  4I2W A;  2OV8 A;  1Z6T A;  3Q47 B;  2WXF A;  3SBS A;  4ANX A;  4DLQ A;  3U3W A;  1IYG A;  2VGY A;  3AU5 A;  1ZU2 A;  3IHV A;  4XX5 A;  2AW6 A;  3RJV A;  3IHY A;  1UJJ A;  4HOQ A;  3TG5 A;  4CCA A;  2Y3A A;  5AJD A;  4EBA G;  2PZI A;  4G2V A;  3SFZ A;  4UWL A;  3TL5 A;  4CDN A;  4I6J A;  4CDM A;  4DI3 A;  4DK5 A;  3RK6 A;  3CHS A;  5CCM A;  2CHZ A;  4YND A;  2PQR A;  2IOS A;  3APD A;  2L6J A;  4HOT A;  2UY1 B;  4BY6 A;  3NZS A;  4LEU A;  3CQC B;  4J6I A;  5E76 A;  2XPY A;  4G24 A;  4RG9 A;  3B7S A;  4PUC A;  3LKU A;  4RG6 A;  5T3R A;  2WXN A;  2WXI A;  4GU5 A;  2IF4 A;  3PVL A;  2YHC A;  3D9K A;  4I43 A;  2RD0 A;  3FUI A;  4KZ0 A;  4XE0 A;  3CHM A;  4B94 A;  1INZ A;  2IFU A;  4UQY A;  3TAX A;  1QZ2 A;  4EZJ A;  3HIZ A;  3FUN A;  4ME2 A;  4MRU A;  1E7U A;  1SQM A;  5LX8 A;  5G05 C;  4JL0 A;  2WXM A;  3LY9 A;  2WB2 A;  4GZD A;  4AVX A;  3NF1 A;  3SBT B;  4FLH A;  4G23 A;  4QFV A;  3UT8 A;  4GZ6 A;  1N52 A;  1TEZ A;  3LCA A;  3RRU A;  3OXG A;  3FEX A;  4EZK A;  3O4Z A;  3Q49 B;  2J09 A;  1OUV A;  4HLE A;  2WPV A;  2VSX E;  3P1U A;  4UI9 K;  3CR3 A;  4UQZ A;  4WWN A;  1JPL A;  3SD5 A;  3PUJ A;  2QFC A;  2FI7 A;  2JEK A;  3OXF A;  3CSF A;  4NQ0 A;  3CHQ A;  3PNT B;  1PC2 A;  2C0L A;  4WNF A;  2NSZ A;  2XEV A;  3FDH A;  4G1T A;  4W9R A;  5BV1 A;  4B89 A;  1IQR A;  4BSX A;  1IHG A;  2XPI A;  4GA0 A;  3JQ1 A;  5BW8 C;  1KT1 A;  3Q4A B;  2R59 A;  3D9I A;  3HHM A;  1VDY A;  4PS3 A;  1ELK A;  2X6J A;  4L23 A;  3ML8 A;  2HR2 A;  4YVO A;  4JHR A;  1HZ4 A;  3CKB A;  1X5B A;  2XGO A;  2LSU A;  3KEZ A;  3MCX A;  4ILG A;  4ILH B;  3UX4 A;  4V3I A;  3TG4 A;  3QWV A;  4JA7 A;  2NC9 A;  2WXO A;  3FEY A;  2DCP A;  2I9C A;  2WXK A;  4L2L A;  4Q94 A;  3PEV B;  3ZIM A;  2X6H A;  4PS8 A;  5KCM A;  3MKQ B;  4NAC A;  4G26 A;  1PAQ A;  4EEC A;  2KCV A;  3EHM A;  2XCC A;  1SZ9 A;  3I4G A;  3GZ1 A;  1U3C A;  2KZT A;  3LXU X;  3FUF A;  4GB9 A;  4JXT A;  4KT6 B;  5FWQ A;  3FTW A;  5HI7 A;  2IOL A;  5FQ7 A;  3D9J A;  4HXI A;  3ZW3 A;  2FEZ A;  3DBS A;  2VQ2 A;  4GYO A;  1MQS A;  1S0P A;  4GYW A;  3CIA A;  1UJK A;  4RVB A;  3ONL A;  2VYI A;  4TRQ A;  2AXZ A;  3ZYM A;  4L2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...