5C2YA

Crystal structure of the saccharomyces cerevisiae rtr1 (regulator of transcription)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
SGMATIEDIKETALIPFQKHRQLSMHEAEVITLEIIGLLCDSECKDEKTLKYLGRFLTPDMYQDLVDERNLNKRCGYPLCGKSPERIRDPFSMNDTTKKFLLENNPYAYLSHYCSKFHFRCSQFYQVQLSDEALFARTGVHLFEDPEQDKHDIDFKVTLFEELLREKASEEDIKSLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Saccharomyces cerevisiae Rtr1 reveals an active site for an atypical phosphatase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords RNA polymerase II subunit B1 CTD phosphatase RTR1
total genus 62
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04181 RPAP2_Rtr1 Rtr1/RPAP2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.820 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c2yA00
4M3OA 4FC8A 5C2YA
chains in the Genus database with same CATH superfamily
3IXEA 5A23A 4B93B 2Y3AA 1BI7B 4Z68A 1UJKA 4TRQA 4EQFA 4GYYA 3N71A 3SQVA 5FQ6A 3EDTB 2PQNA 1PY1A 2R5SA 5LOZA 4ANXA 4AY5A 1EDUA 2XEEA 1K8KG 3NOGD 3FTSA 1BLXB 4F3VA 3LYAA 5KNGA 4V3IA 3C3RA 4I6JA 4DPRA 3PE3A 4GYOA 3S7FA 4BTBA 4U0SA 4GTVA 5CMYA 4HXIA 2IEJA 2IF4A 2XGMA 5LCWC 4LUNU 1IQRA 3FUJA 5T4YA 2VGEA 3J5QB 4ATZD 1JWFA 3RO2A 1NP7A 4FU3A 3R9MA 3PZ3A 3L54A 3CIAA 2XPIA 3AS4A 1AWCB 4CGVA 4TUMA 2VTBB 5EIDA 3FUFA 4FLBA 3FU3A 5KJKA 4HORA 4EZKA 3C98A 2HM8A 1RZ4A 2KCVA 4NIKA 5CHEE 3V79K 3U3WA 4RQIA 2X6KA 4MRUA 5CCMA 1HE8A 4UI9C 3PNLB 4BY6A 3DRAA 2J49A 4UQZA 3RKVA 4HOUA 2DIWA 1TNOA 3RSEG 1E90A 2I1KA 4I1AA 3R7QA 4I9EA 4WUYA 4A55A 3LY8A 2DZOA 2BKGA 1ELRA 3ZRHA 3FUHA 3F6QA 3PDNA 2WQHA 5FINA 4I9CA 2V4LA 3PZ4A 4PUCA 4U0ZA 5HS0A 1WG0A 2WXNA 2FBNA 2AJAA 1PC2A 3QJZA 1RW2A 4GU5A 1OWLA 2KCKA 3SGHA 4U8YD 3PH0C 1E8YA 5AJDA 2DZNA 3CHPA 3D9MA 4WWPA 1MQSA 4A3VA 1JPLA 3IHVA 4GTTA 5A7DB 3TJPA 2HR2A 4LRZA 4O6FA 5J08A 5D66A 1MX6A 3PEUB 3ZW3A 1NFIE 2FF4A 2P58C 4FJYA 5ENTD 3MEKA 4U8VD 3KD7A 3CGHA 1TN8A 4XX5A 1H6PA 3UIOC 3T5XA 4QQIA 4CZ2D 5FZSA 4WNEA 3DEPA 3CVWA 4HQDA 4HS2A 1QNFA 2F0YA 3ULEG 4TXQA 4U0UA 3AU4A 4AXHA 3ASNE 1FCHA 3OAWA 4JEHA 4L7TA 3RAUA 4NQ0A 1BU9A 3ZEFA 1D8DA 5AARA 3PUKA 4MBGA 4LERA 5FT9A 1WAO1 5CEDB 1HXIA 5JJTA 2VJ8A 4EPZA 3ONKA 4Y6CA 1DNPA 5JMND 2Y4TA 3UT8A 4AY6A 4GMLA 4BX8A 4FHJA 2AVPA 2LXLA 4G25A 1SQMA 4LNGA 1WY6A 1OCRE 2BUGA 3PREA 1UJJA 5EX0A 4ILGA 3TWSA 4DI3A 3ML8A 3TL5A 3I4RB 3KSQA 2FULA 4FC8A 4N2SA 4YDEA 3RIBA 4J8DA 2WXQA 4UWLA 3W9FA 3FH7A 3DBSA 4AM9A 4CDRA 3D3MA 3V30A 1O1RA 2FEZA 1G3NB 1HU3A 1N0QA 2L9BA 2OVFA 2ETBA 3MV3B 3Q7AA 3SBTB 5AAOA 5FZRA 5BV1A 5BV0A 2X6IA 1TNYA 2KXPC 4U07A 5D0QD 3EIQC 5FQ8A 4DK5A 2EQXA 3PVLA 2PZIA 2KC7A 1YA0A 2WXLA 5ANRA 4APFA 3KAEA 4Q69A 3HDXA 4TUUA 1Z3YA 4BWRA 1X81A 4N3AA 2V0PA 4DUIA 1IXVA 4GMRA 4TXPA 3JCKC 4URKA 1TYQG 2XEVA 4DX2A 2LNIA 3TWTA 3RO3A 3D9JA 2Y4UA 3DSWA 2P9NG 1FPPA 2J08A 4KVOA 3BQOA 2RG8A 3MKQB 3B7UX 3V2OA 1EPUA 4A1SA 2WXRA 5JHBA 1KPSB 4I6EA 5AYWD 3Q79A 4GTOA 2RKKA 4K0RA 3CKBA 2ZU6B 4DX5D 3ESLA 2BEDA 3PS6A 2WXIA 2IONA 2WXHA 4CYMD 1DCQA 4OAUC 4JL0A 1MZCA 2RFMA 3FTZA 1H0AA 4IYPA 2GRQB 4DX6D 5ENQD 2GW1A 2XGSA 4CCAA 2WXOA 4FHKA 3HIZA 4GTRA 5CRUA 4EZLA 3KS2A 3NZUA 1N11A 4MS6A 3D9KA 4GPKA 4JW1A 3C3QA 4ILIA 1H6KA 3TG4A 4G23A 3G2WA 3EJNA 1TEZA 5G04J 3QOUA 4U96D 2JLBA 4GPMA 4KMOA 3SO8A 2ZISA 3SI5A 3IHYA 3CR3A 4XE0A 1XGWA 4GB9A 4YDWA 1NZNA 5D2MC 4P29A 4BSZB 3WG7E 5HRYA 4HI8A 4ABNA 4A1GA 3URZA 2OEWA 3ZHEB 2LSVA 3VTYA 2LUHA 1JCRA 5G05C 2OV8A 1UW4B 4FA6A 3FEYA 2L0IA 1E7UA 4C48B 5KBAA 3CVYA 3UKUG 4HB5A 3RRMB 3Q9UC 1GW6A 4HLLA 2VSXE 4BTAA 5AQBA 2WXGA 3U9WA 1UN9A 3FUIA 5CCLA 2ZIRA 2YHCA 1TJCA 2IO2C 3SD5A 4UQXA 4DI4A 4LNUD 4YDYA 2OOEA 4DX1A 5CMWA 3FTUA 4FLHA 3DXKG 3UQ3A 3VTXA 3KSLA 3VLEA 4NURA 1U3CA 3G2TA 2I2OA 2WXJA 4CRWA 1MJ0A 2GROB 3FDHA 2ILRA 3C3OA 3D9IA 4ANWA 4GMJA 3HXBA 3ENEA 4ANVA 2LSUA 3D9HA 2ZGDA 2MOWA 3PEVB 4OAVB 1KZPA 1N4SA 3AG1E 4U95D 4ZHBA 4HI9A 4JHKA 3T9KA 1V55E 2VGYA 3G2SA 2GRLA 4G8LA 4HRMB 2P9LG 1D9SA 4UQYA 4W9RA 2X6FA 3NOCD 3QKYA 3QAQA 3ULYA 3TGOA 4YDOA 1V54E 4EBAA 4JHRA 1D8EA 3FH5A 4QFVA 1ZB1A 3ZKJA 3BG1B 3FUDA 1X5BA 3SFXA 5JJ7A 4AOFA 4KVMA 3I5PA 1U3DA 2WQ7A 2VYIA 4L2YA 3NB2A 3TWVA 3FTXA 1TJFA 5ENNA 5JA4D 4BERA 3LVQE 3MKQA 2I9CA 3EIJA 4K5CA 4XKBA 2V5FA 4U04A 3FP3A 4GZ6A 2ETAA 3ESKA 4TV3A 4XI9A 1K1BA 2F37A 5CECB 4F1SA 2XENA 3UXGA 3UKRG 3HVEB 2Y0BG 3ASOE 5CBOA 5BXUA 5G55A 5HQ8A 2DYRE 3NAWA 2IOLA 2B6CA 1TN7A 3LCAA 1AP7A 2YQ8A 2QYUA 5BNWA 1YMPA 3EU5A 1LD8A 2UY1A 3DEOA 3TWUA 4FADA 1S70B 2QC9A 3EHRA 3ZXSA 3ISMC 2XGOA 4UWKA 3CVXA 4MKTA 3B7TA 5HKPA 4WWNA 4ANUA 4E85A 4O1PA 2AXUA 1YCSB 3D9LA 4N3BA 3SNXA 3UM1A 3L82A 2I1JA 4BX9A 2KM4A 3CVQA 3ML9A 4M7CA 1KLXA 5EN5D 4XI0A 3L22A 3JYSA 3U64A 3KEAA 2P9SG 2PM6A 3AS8A 4O1OA 4HVBA 3ZVVA 3ZHEA 3LS8A 5G05J 2XRZA 2FO1E 4KZCA 5EIBE 3GYZA 3SHFA 4FJZA 4I6GA 3CVLA 1MX4A 2KZTB 1H6OA 5BW8C 1IYGA 2J4DA 2H6FA 5ANLA 2V5QC 5BUZA 1TNUA 3APCA 1PAQA 2LAHA 2J07A 1OXJA 4JHJA 3QB2A 2WMOA 4GYWA 3UM0A 2WQ6A 3NQPA 2NYJA 3FFLA 3LDZA 2YHEA 3E37A 2M63A 1Z5SC 1H2TC 3VLFA 3T5VA 3HXCA 3Q47B 4Q94A 4N3CA 4JA9A 2DYSE 4B8CB 3G2UA 4EHMA 3VLDA 3PZDA 2E0IA 4ACLA 4JPSA 4KT6B 2J4BA 4IRUA 3B95A 4OYSA 4JA7A 4XEIG 4CGWA 3FEXA 1E8WA 5G2NA 5ARGA 1YYHA 3LVRE 3ABKE 1E8ZA 2JEKA 2WPVA 3QNKA 3S7JA 1A5EA 3ZPJA 4HOQA 1KT1A 4BT9A 3IV0A 3CQCB 3L16A 5FQ4A 2XZTG 1O1SA 3Q73A 1BD8A 4IULA 3CK7A 1TR4A 3HG0D 1K1AA 3MV2B 3GZSA 2F8XK 3S7DA 4N5CA 3FH8A 2VQ2A 3QWWA 2R17C 3OTNA 4FP7A 3PRZA 3E33A 2BTDA 2P9PG 2NSZA 3ABME 4MLPA 3ZYMA 2VGXA 1MYOA 2E2EA 3FY4A 1B89A 3MJWA 2J8SD 3LJNA 1ELKA 1OWOA 5FJYA 3CSFA 3CQGB 4ME2A 4HOTA 3GW4A 4GA1A 5LX8A 1INZA 2UWJG 3BG0B 4G1TA 3B7RL 2WB2A 1HX8A 4I43A 3ZYQA 2CHWA 2V4HC 4GZDA 2X3MA 3FUKA 4RVBA 4K03A 3TWRA 4CDMA 3CSTA 4J8YA 3B7SA 3RRNB 4U7EB 4F1PA 3DSVA 2H6HA 2IY0C 2JABA 3UT7A 3AG4E 4HLEA 1N0RA 4A63B 2FI7A 2XPZA 4N39A 1JCQA 3L13A 1KT0A 2CFUA 2A5UA 4JB8P 1KZOA 4WWOA 5T3RA 3MCXA 2CFZA 5AN8A 4BSXA 3GZ1A 3OXLA 2KCLA 4Y6WA 3FUMA 1DCEA 3FU5A 4C0MA 4CT4A 4G2VA 2GRNB 4HFGA 3DXMG 5DIZA 3S7BA 2R02A 5T8IA 4J8EA 4UWFA 4GCOA 2XPYA 3B13A 1UG3A 3JXIA 1OT8A 3UIPC 3QWPA 3U66A 3QC1A 3NBNB 3L08A 1LF8A 4L23A 4APOA 4C9BB 2KATA 5EYPF 1N54A 2QYJA 3D9NA 3FTYA 5AQ9A 5ARFA 3CHSA 4H7YA 2R59A 4GTMA 2PL2A 2IFUA 2GRPB 3ZN3A 3RK6A 4ILHB 4XZ4A 4UUCA 2ZGGA 5LP0A 4KZ0A 1BI8B 2OCCE 2DVWA 2F8YA 2YINA 2EILE 2P2CP 3CK9A 4GA0A 3AS5A 2H6IA 4K5BA 2BF0X 1N4PA 4U63A 4G24A 3ZNGA 3DPYA 1OCCE 4YNDA 4ACKA 4HOSA 3ASFA 3Q9NC 5CRVA 5KJNA 1WM5A 3E4BA 1OWPA 4I2WA 2KZTA 5D0OD 5CEAA 4HRLA 4J0UA 4YVOA 3FWVA 3DWLG 4O60A 2GRRB 1SW6A 5B1AE 3CVPA 3UINC 3RU0A 2PM7A 4IN3B 5FIOA 3SY2A 3ZGQA 4KXKB 3D9PA 4RSYA 3E30A 2IJGX 4BT8A 2WVIA 3FTVA 1Z3XA 5BXOA 2DCPA 3E32A 3EUVA 3ASDA 3RRUA 3UT4A 1Q2ZA 3FU0A 4GAAA 4GA2A 5EKQD 5FZQA 4E6HA 4Q96A 3NF1A 3CKCA 4R7LA 4I1MA 3FU6A 2L6JA 3BUAA 4I1OB 4AP2A 5AJLA 1Y6IA 2LAIA 4UI9K 3JXJA 3TWWA 4DJAA 1LTXA 1HFAA 1NA0A 2HE0A 1W3BA 4AV7A 1NI1A 1OY3D 4I17A 2UY1B 1Z6TA 2WXMA 2XEHA 3ONLA 4AJWA 4OVUA 1HG5A 2AXVA 1EYHA 3CVVA 1LD7A 1TN6A 5FWQA 3DSUA 4RLYA 3HXDA 5KWDA 4J8FA 2VGXB 2ONDA 1E96B 3UM2A 2C2LA 3HVEA 2WXPA 4K5AB 4PS7A 3LEWA 4EZJA 3LPZA 2J9QA 3EHQA 5HI7A 5EDSA 4J7WA 5LCWJ 5B1BE 2XQ0A 3UMVA 5IY5E 1OCZE 1TNBA 5E75A 2GGFA 2P9IG 3MYVA 2HO1A 3G2VA 4JXTA 4BETA 4F53A 2FO7A 3ASHA 5B3SE 2GRMA 4CT0A 3L6AA 2Q7FA 4XKCA 5AENA 2XS1A 2NXPA 2X6HA 4ATGA 1E7VA 3HRAA 3NZSA 5FQ7A 4JEUA 2AWIA 1E8XA 3FHEA 2KBXA 1XNFA 4FULA 1MX2A 3E34A 3BU8A 1IQUA 5LFAA 1TNZA 4L1BA 3V2XA 2H6GA 2WMNA 3PNTB 4BFRA 4GZCA 3SZ7A 4PH4B 3TXNA 4HRNA 1DVPA 4BESA 4LNBA 3Q15A 4JC8A 4G8KA 1FVFA 5EILA 1OWMA 3PZ1A 3EHMA 5C2YA 1QBQA 3O4ZA 3MKRA 1SA4A 5FTPA 3QARA 3HXFA 3MGBA 3QDNA 4DX7D 2BKKB 4AIFA 2IO3C 5ITZF 1HO8A 3PZ2A 1NA3A 2X38A 4UWGA 2LO6A 1N95A 2WXKA 3TWXA 3T8MA 2QZAA 2L0TB 4KBQA 3W9GA 3TWQA 3LY7A 3CHMA 3SF4A 2CG3A 3ABLE 1N4RA 1N9AA 4KYOB 4HBDA 3OXGA 3OXFA 3FULA 4TXRA 5M72A 2XCCA 2DWZA 5CBNA 1SZAA 3MZLB 3FUEA 5CERB 1NL4A 2Y1LE 2XRYA 3EHNA 2ZXWE 2VTBA 3AU5A 4HNAD 3O48A 4G11A 4AVXA 1HH8A 3QWVA 3CLJA 3MA5A 3DSSA 2VSOE 3CEQA 5DBKA 3LKUA 5KJLA 1L5JA 3SFZA 1A17A 3ZXPA 3UX4A 3TXMA 3V31A 2CG2A 3SFYA 2EIME 2MYOA 3AG2E 4WNGA 4DRXE 4J6IA 3IEGA 2XHEA 2P9KG 1H2UA 2A5EA 3P1UA 3R7RA 4DLQA 5JJ6A 3CV0A 2CHXA 3CHOA 4JZYA 1IHGA 2YNQA 3Q4AB 3AAAC 3UUXA 3IKOB 3Q78A 1FT1A 2J09A 3JUEA 4EBAG 3UPVA 1JCSA 1U2VG 1OUVA 2MRIA 3FTWA 4U8HA 3TG5A 3L17A 4WAFA 5ENRD 2XCBA 2QFCA 2R05A 1FT2A 2C0LA 3PE4A 1BPOA 4WNFA 1QQEA 2EIKE 2WM9A 5AQAA 2AW6A 5H7PA 3FUNA 2MHKA 2RD0A 3C5RA 4PS8A 4AEZC 1ELWA 2R03A 3ULQA 4N2QA 4M3OA 2XS8A 4D10C 1O1TA 4YVQC 1OCOE 2OVBA 1ZU2A 3LJ3A 3HYMB 4XIFA 3RJVA 5ENOD 1IHBA 4CDNA 4PDXA 3ASGA 1HZ4A 4GTSA 4NACA 3ZYKA 1HS6A 1VDYA 3QK0A 1H19A 2AXZA 5BPPA 2CHZA 2OEVA 3ZFWA 1QYMA 3L9TA 3PUJA 1HG2A 1H2VC 3JQ1A 3UI2A 2DBAA 1DC2A 1N4QA 5KJMA 4LEUA 3ZYLA 2NC9A 4GZ5A 3UM3A 3APFA 2C0MA 3MX3A 3JUIA 4GZ3A 2B0OE 3Q7FA 4A3TA 4WNDA 2LXMA 4JD2G 2HYZA 3I3NA 2I6HA 1UOHA 1FVHA 2IU1A 1N52A 2VSNA 3CHQA 4L2LA 3Q75A 3DSTA 3HXEA 1S64A 2PQRA 3I4GA 3K9IA 4OVVA 4N5QA 1O5MA 4CEMA 3U4TA 4JVSA 4J8SA 5KCMA 5A6CA 3CVUA 3T8KA 3ZU7B 2R2LA 1S63A 4LG6A 3S2AA 3EU9A 2WXFA 1MHQA 3B7BA 4B89A 2EIJE 3IBEA 2RFAA 1P5QA 4GTQA 3LXUX 4ZFHA 4I2ZA 3KEZA 4H7XA 5E76A 4NRHB 4LSZE 1QZ2A 3Q5MA 3SBSA 1IKND 4GCNA 2IQCA 5ENSD 1N94A 3APDA 2A4ZA 3LY9A 3P2BA 3DSXA 1EF1C 1SVXA 4PS3A 3Q49B 3R9AB 3DPDA 4DLOA 1OWNA 3ZIMA 4B94A 1SA5A 5C1DA 1S0PA 2ETCA 1JUQA 1HF8A 4F6RD 3C72A 3CVNA 2XZDG 3ZUVB 2QY7A 4B8AA 4X8QA 1ZBPA 2V8SE 4RG9A 3J5PA 4LCTA 3X2QE 2Y69E 4L9PA 3JQ0A 5AQ7A 4RG6A 3BEEA 5EYLA 5G04C 3WXXA 3UTMA 2IOSA 3GZ2A 4G26A 3TAXA 3CHRA 3CK8A 1WDYA 5EX3A 5ENPD 5JHAA 2L6BA 1UN8A 4EECA 3HHMA 3AJIA 3D9OA 1SZ9A 5BT1A 2VSYA 3AG3E 5AIJA 2X6JA 4B0ZA 2PNNA 4C0EA 4UI9J 2EINE 5KNHD 5J90A 4UWHA 1Y8MA 4F7AA 2P9UG 1JWGA 1K3ZD 4GTPA 4BEPA
chains in the Genus database with same CATH topology
4JA9A 1XNFA 4JL0A 4B8CB 4FULA 3G2UA 5A23A 2Y3AA 3PZDA 2E0IA 3VLDA 4ACLA 4JPSA 4KT6B 1UJKA 4TRQA 4EQFA 2J4BA 4GYYA 4IRUA 3FTZA 4OYSA 4JA7A 3N71A 1H0AA 1IQUA 4IYPA 5LFAA 4L1BA 2GW1A 3EDTB 5FQ6A 4CGWA 2PQNA 1PY1A 2R5SA 5LOZA 3FEXA 4ANXA 1E8WA 5G2NA 2XGSA 4CCAA 2WMNA 3PNTB 4BFRA 5ARGA 4AY5A 4GZCA 1EDUA 3LVRE 1E8ZA 2JEKA 3SZ7A 2WPVA 4PH4B 3TXNA 3FTSA 3QNKA 1DVPA 2WXOA 4FHKA 3HIZA 4F3VA 3LYAA 3Q15A 4JC8A 3S7JA 4V3IA 4EZLA 3ZPJA 1FVFA 4HOQA 1KT1A 3KS2A 3NZUA 1OWMA 4I6JA 3IV0A 5C2YA 3CQCB 3EHMA 3L16A 4BT9A 4MS6A 5FQ4A 4DPRA 3D9KA 4GPKA 3O4ZA 3MKRA 3PE3A 4GYOA 5FTPA 4JW1A 3QARA 3MGBA 3QDNA 3S7FA 4ILIA 4BTBA 4CDRA 1H6KA 3TG4A 4G23A 4AIFA 3G2WA 3EJNA 4U0SA 5CMYA 4HXIA 4IULA 3CK7A 1TEZA 5G04J 2IF4A 3MV2B 2XGMA 1HO8A 3QOUA 1NA3A 2X38A 3GZSA 4UWGA 5LCWC 2LO6A 2WXKA 4LUNU 1IQRA 3T8MA 2JLBA 2L0TB 3FUJA 4KBQA 3FH8A 4N5CA 2VQ2A 5T4YA 3QWWA 3S7DA 2R17C 3LY7A 4KMOA 3OTNA 4FP7A 3SI5A 3IHYA 3CHMA 3PRZA 3SF4A 3CR3A 2CG3A 2BTDA 4XE0A 1JWFA 1XGWA 2NSZA 4GB9A 4KYOB 1NP7A 4MLPA 3RO2A 4FU3A 3OXGA 1NZNA 3ZYMA 2VGXA 3OXFA 2E2EA 4P29A 3FULA 3FY4A 1B89A 3MJWA 5M72A 2XCCA 3L54A 1ELKA 3CIAA 1OWOA 2XPIA 3AS4A 5FJYA 4ABNA 1SZAA 3CSFA 4A1GA 3MZLB 3FUEA 3CQGB 4CGVA 4ME2A 4HOTA 3URZA 3ZHEB 2LSVA 3VTYA 3GW4A 4GA1A 2XRYA 3EHNA 2VTBB 5G05C 2VTBA 3AU5A 5LX8A 1INZA 2UWJG 3O48A 4G11A 3FUFA 4FLBA 3BG0B 3FU3A 2OV8A 4G1TA 5KJKA 1UW4B 4AVXA 4EZKA 3B7RL 4FA6A 1HX8A 4I43A 1HH8A 2WB2A 4HORA 3FEYA 3ZYQA 3QWVA 2CHWA 3C98A 3CLJA 2L0IA 3MA5A 2VSOE 3CEQA 2HM8A 4GZDA 1E7UA 2X3MA 3LKUA 5DBKA 5KJLA 3FUKA 3CVYA 4RVBA 1L5JA 3SFZA 1A17A 4K03A 3RRMB 3TXMA 3UX4A 4CDMA 1GW6A 2KCVA 2CG2A 3CSTA 2VSXE 5CHEE 4WNGA 4BTAA 3B7SA 4J6IA 2WXGA 3RRNB 3U3WA 3IEGA 2XHEA 1UN9A 3U9WA 2X6KA 4MRUA 3FUIA 5CCLA 5CCMA 1HE8A 3UT7A 2YHCA 1TJCA 3PNLB 4UI9C 1H2UA 3P1UA 3R7RA 3SD5A 4UQXA 4BY6A 4HLEA 4DLQA 2J49A 2FI7A 4UQZA 5JJ6A 3RKVA 3CV0A 4DI4A 2XPZA 4HOUA 2CHXA 2DIWA 3CHOA 2OOEA 4N39A 4JZYA 1E90A 2I1KA 1IHGA 2YNQA 3Q4AB 4I1AA 3R7QA 3IKOB 4I9EA 3FTUA 4FLHA 4WUYA 3UUXA 3L13A 4A55A 3LY8A 2J09A 4EBAG 1ELRA 3UQ3A 3UPVA 3VTXA 3ZRHA 3FUHA 1OUVA 3VLEA 1KT0A 2CFUA 2A5UA 4NURA 1U3CA 2MRIA 3G2TA 2I2OA 3FTWA 4U8HA 3PDNA 2WXJA 3TG5A 4WWOA 2WQHA 4I9CA 5T3RA 2V4LA 3MCXA 3L17A 4PUCA 4U0ZA 4WAFA 2CFZA 4CRWA 2XCBA 4BSXA 3GZ1A 3OXLA 2WXNA 2KCLA 2FBNA 3FDHA 2ILRA 2QFCA 3D9IA 4ANWA 4GMJA 3ENEA 1PC2A 2C0LA 3PE4A 4Y6WA 1BPOA 3FUMA 3FU5A 4ANVA 2LSUA 4WNFA 1QQEA 2MOWA 3PEVB 3QJZA 4GU5A 4C0MA 1OWLA 2KCKA 2WM9A 4CT4A 3SGHA 3PH0C 1E8YA 4G2VA 2AW6A 4HFGA 5AJDA 4JHKA 3FUNA 3CHPA 3D9MA 5DIZA 3S7BA 4WWPA 2MHKA 2RD0A 4J8EA 4PS8A 2VGYA 3G2SA 2GRLA 5T8IA 4AEZC 1MQSA 1ELWA 4A3VA 4UWFA 4UQYA 4W9RA 1JPLA 3ULQA 4N2QA 4GCOA 4M3OA 2X6FA 3IHVA 2XPYA 3B13A 5A7DB 4D10C 1UG3A 3TJPA 4YVQC 3QKYA 2HR2A 3QAQA 4LRZA 4O6FA 5J08A 3TGOA 2OVBA 3PEUB 1ZU2A 3ZW3A 3LJ3A 3QWPA 4EBAA 3QC1A 4JHRA 3U66A 3FH5A 3HYMB 3L08A 1LF8A 4XIFA 4L23A 3RJVA 2FF4A 4APOA 2P58C 4C9BB 4QFVA 4CDNA 4PDXA 3ASGA 1HZ4A 2KATA 3D9NA 1N54A 3BG1B 4FJYA 4NACA 3FUDA 3ZYKA 3FTYA 5ARFA 1X5BA 3MEKA 5JJ7A 3CHSA 1HS6A 1VDYA 4H7YA 3QK0A 1H19A 2AXZA 3KD7A 5BPPA 2CHZA 2R59A 4AOFA 2PL2A 2IFUA 3CGHA 4KVMA 3ZFWA 3I5PA 1U3DA 2WQ7A 2VYIA 3PUJA 4XX5A 3RK6A 3ZN3A 4ILHB 4XZ4A 1HG2A 4L2YA 1H2VC 3JQ1A 3T5XA 2DBAA 5KJMA 3FTXA 5LP0A 4LEUA 4KZ0A 3ZYLA 2NC9A 5FZSA 4GZ5A 4WNEA 3APFA 2C0MA 1TJFA 3MX3A 3JUIA 2YINA 5ENNA 3CVWA 4GZ3A 4HS2A 4A3TA 1QNFA 3LVQE 4WNDA 3MKQA 2I9CA 4U0UA 3EIJA 3AU4A 4AXHA 3CK9A 4GA0A 1FCHA 3OAWA 4JEHA 4L7TA 3AS5A 2HYZA 4NQ0A 2BF0X 3ZEFA 4XKBA 2V5FA 4U63A 4U04A 3I3NA 3FP3A 2I6HA 4G24A 4GZ6A 3ESKA 4TV3A 3PUKA 4XI9A 1FVHA 4YNDA 4ACKA 4HOSA 3ASFA 5KJNA 2IU1A 1WM5A 3E4BA 1N52A 1OWPA 4I2WA 2VSNA 4LERA 3CHQA 2KZTA 5FT9A 4F1SA 5D0OD 4L2LA 4J0UA 4YVOA 3FWVA 1WAO1 3HVEB 2PQRA 1HXIA 3I4GA 3K9IA 4OVVA 5JJTA 2VJ8A 4EPZA 4CEMA 5G55A 3CVPA 3ONKA 3RU0A 3U4TA 4Y6CA 4JVSA 5HQ8A 1DNPA 2PM7A 4IN3B 2Y4TA 4J8SA 5KCMA 3UT8A 3ZGQA 5A6CA 3CVUA 4KXKB 4AY6A 2IOLA 4GMLA 4BX8A 3D9PA 3LCAA 4FHJA 4RSYA 2AVPA 3S2AA 2YQ8A 2IJGX 4G25A 2WXFA 1SQMA 1MHQA 5BNWA 4B89A 1WY6A 4BT8A 2WVIA 3IBEA 3FTVA 2BUGA 3PREA 1P5QA 1UJJA 5EX0A 1Z3XA 3LXUX 4ILGA 4DI3A 4I2ZA 3KEZA 2DCPA 3ML8A 4H7XA 5E76A 4NRHB 2UY1A 3ASDA 3TL5A 3RRUA 3I4RB 4FADA 3FU0A 4GAAA 2FULA 5FZQA 4GA2A 5EKQD 3UT4A 4FC8A 1QZ2A 3ZXSA 4N2SA 3RIBA 3Q5MA 4E6HA 2XGOA 4Q96A 4UWKA 3SBSA 4GCNA 4J8DA 3CVXA 4MKTA 2IQCA 2WXQA 3NF1A 4UWLA 3FH7A 3APDA 3B7TA 3CKCA 3DBSA 2A4ZA 4WWNA 3LY9A 4AM9A 4R7LA 4I1MA 3FU6A 4ANUA 2L6JA 4I1OB 3P2BA 2AXUA 4AP2A 4E85A 3D3MA 3D9LA 1Y6IA 5AJLA 2LAIA 4UI9K 4DJAA 2FEZA 4N3BA 1EF1C 1HFAA 3SNXA 1NA0A 1HU3A 2I1JA 4BX9A 1W3BA 2KM4A 4AV7A 4PS3A 3Q49B 3CVQA 3ML9A 3R9AB 3DPDA 2L9BA 4I17A 4DLOA 1KLXA 1OWNA 2OVFA 4XI0A 3L22A 2UY1B 3JYSA 3U64A 1Z6TA 3ZIMA 3MV3B 2WXMA 4B94A 3SBTB 3ONLA 5C1DA 5FZRA 4AJWA 5BV1A 5BV0A 2X6IA 2PM6A 1S0PA 4OVUA 1HG5A 4U07A 2AXVA 3AS8A 1JUQA 3EIQC 5D0QD 1HF8A 1EYHA 5FQ8A 4DK5A 4HVBA 3ZVVA 3ZHEA 3CVVA 2EQXA 3PVLA 3LS8A 2PZIA 2KC7A 5G05J 1YA0A 2XRZA 2WXLA 3CVNA 5ANRA 4APFA 3KAEA 5FWQA 5CMWA 4Q69A 4J8FA 3HDXA 2VGXB 4TUUA 2ONDA 2QY7A 1Z3YA 4KZCA 3GYZA 4BWRA 4B8AA 1E96B 3SHFA 2C2LA 3HVEA 2WXPA 4FJZA 4I6GA 4N3AA 2V0PA 1ZBPA 3CVLA 4PS7A 3LEWA 4EZJA 2V8SE 3LPZA 2KZTB 4RG9A 2J9QA 4LCTA 3JCKC 5BW8C 5HI7A 4URKA 1IYGA 2XEVA 2J4DA 5EDSA 2LNIA 3RO3A 3D9JA 2Y4UA 3JQ0A 4RG6A 5LCWJ 5ANLA 5BUZA 2J08A 3APCA 1PAQA 3BEEA 4KVOA 2LAHA 5G04C 2RG8A 3WXXA 2XQ0A 2J07A 3UMVA 3MKQB 3B7UX 2IOSA 4JHJA 3QB2A 2WMOA 4GYWA 1EPUA 4A1SA 2WXRA 2WQ6A 3GZ2A 5JHBA 4G26A 3TAXA 3CHRA 3CK8A 3NQPA 4I6EA 5AYWD 3FFLA 5E75A 5EX3A 3LDZA 4K0RA 2GGFA 3MYVA 3CKBA 2HO1A 2ZU6B 3G2VA 5JHAA 2YHEA 4JXTA 2M63A 1UN8A 4EECA 3HHMA 4F53A 3D9OA 1SZ9A 1H2TC 2FO7A 3VLFA 5BT1A 2VSYA 3ASHA 3T5VA 5AIJA 2X6JA 3ESLA 3PS6A 4B0ZA 2GRMA 3Q47B 4C0EA 4UI9J 4CT0A 2WXIA 2Q7FA 3L6AA 2IONA 2WXHA 4Q94A 4XKCA 5AENA 5J90A 2NXPA 4N3CA 4UWHA 2X6HA 1Y8MA 4ATGA 1E7VA 4F7AA 3NZSA 5FQ7A 1JWGA 4JEUA 2AWIA 1E8XA 3FHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M3O A;  4FC8 A;  5C2Y A; 
#chains in the Genus database with same CATH topology
 3IXE A;  5A23 A;  4B93 B;  2Y3A A;  1BI7 B;  4Z68 A;  1UJK A;  4TRQ A;  4EQF A;  4GYY A;  3N71 A;  3SQV A;  5FQ6 A;  3EDT B;  2PQN A;  1PY1 A;  2R5S A;  5LOZ A;  4ANX A;  4AY5 A;  1EDU A;  2XEE A;  1K8K G;  3NOG D;  3FTS A;  1BLX B;  4F3V A;  3LYA A;  5KNG A;  4V3I A;  3C3R A;  4I6J A;  4DPR A;  3PE3 A;  4GYO A;  3S7F A;  4BTB A;  4U0S A;  4GTV A;  5CMY A;  4HXI A;  2IEJ A;  2IF4 A;  2XGM A;  5LCW C;  4LUN U;  1IQR A;  3FUJ A;  5T4Y A;  2VGE A;  3J5Q B;  4ATZ D;  1JWF A;  3RO2 A;  1NP7 A;  4FU3 A;  3R9M A;  3PZ3 A;  3L54 A;  3CIA A;  2XPI A;  3AS4 A;  1AWC B;  4CGV A;  4TUM A;  2VTB B;  5EID A;  3FUF A;  4FLB A;  3FU3 A;  5KJK A;  4HOR A;  4EZK A;  3C98 A;  2HM8 A;  1RZ4 A;  2KCV A;  4NIK A;  5CHE E;  3V79 K;  3U3W A;  4RQI A;  2X6K A;  4MRU A;  5CCM A;  1HE8 A;  4UI9 C;  3PNL B;  4BY6 A;  3DRA A;  2J49 A;  4UQZ A;  3RKV A;  4HOU A;  2DIW A;  1TNO A;  3RSE G;  1E90 A;  2I1K A;  4I1A A;  3R7Q A;  4I9E A;  4WUY A;  4A55 A;  3LY8 A;  2DZO A;  2BKG A;  1ELR A;  3ZRH A;  3FUH A;  3F6Q A;  3PDN A;  2WQH A;  5FIN A;  4I9C A;  2V4L A;  3PZ4 A;  4PUC A;  4U0Z A;  5HS0 A;  1WG0 A;  2WXN A;  2FBN A;  2AJA A;  1PC2 A;  3QJZ A;  1RW2 A;  4GU5 A;  1OWL A;  2KCK A;  3SGH A;  4U8Y D;  3PH0 C;  1E8Y A;  5AJD A;  2DZN A;  3CHP A;  3D9M A;  4WWP A;  1MQS A;  4A3V A;  1JPL A;  3IHV A;  4GTT A;  5A7D B;  3TJP A;  2HR2 A;  4LRZ A;  4O6F A;  5J08 A;  5D66 A;  1MX6 A;  3PEU B;  3ZW3 A;  1NFI E;  2FF4 A;  2P58 C;  4FJY A;  5ENT D;  3MEK A;  4U8V D;  3KD7 A;  3CGH A;  1TN8 A;  4XX5 A;  1H6P A;  3UIO C;  3T5X A;  4QQI A;  4CZ2 D;  5FZS A;  4WNE A;  3DEP A;  3CVW A;  4HQD A;  4HS2 A;  1QNF A;  2F0Y A;  3ULE G;  4TXQ A;  4U0U A;  3AU4 A;  4AXH A;  3ASN E;  1FCH A;  3OAW A;  4JEH A;  4L7T A;  3RAU A;  4NQ0 A;  1BU9 A;  3ZEF A;  1D8D A;  5AAR A;  3PUK A;  4MBG A;  4LER A;  5FT9 A;  1WAO 1;  5CED B;  1HXI A;  5JJT A;  2VJ8 A;  4EPZ A;  3ONK A;  4Y6C A;  1DNP A;  5JMN D;  2Y4T A;  3UT8 A;  4AY6 A;  4GML A;  4BX8 A;  4FHJ A;  2AVP A;  2LXL A;  4G25 A;  1SQM A;  4LNG A;  1WY6 A;  1OCR E;  2BUG A;  3PRE A;  1UJJ A;  5EX0 A;  4ILG A;  3TWS A;  4DI3 A;  3ML8 A;  3TL5 A;  3I4R B;  3KSQ A;  2FUL A;  4FC8 A;  4N2S A;  4YDE A;  3RIB A;  4J8D A;  2WXQ A;  4UWL A;  3W9F A;  3FH7 A;  3DBS A;  4AM9 A;  4CDR A;  3D3M A;  3V30 A;  1O1R A;  2FEZ A;  1G3N B;  1HU3 A;  1N0Q A;  2L9B A;  2OVF A;  2ETB A;  3MV3 B;  3Q7A A;  3SBT B;  5AAO A;  5FZR A;  5BV1 A;  5BV0 A;  2X6I A;  1TNY A;  2KXP C;  4U07 A;  5D0Q D;  3EIQ C;  5FQ8 A;  4DK5 A;  2EQX A;  3PVL A;  2PZI A;  2KC7 A;  1YA0 A;  2WXL A;  5ANR A;  4APF A;  3KAE A;  4Q69 A;  3HDX A;  4TUU A;  1Z3Y A;  4BWR A;  1X81 A;  4N3A A;  2V0P A;  4DUI A;  1IXV A;  4GMR A;  4TXP A;  3JCK C;  4URK A;  1TYQ G;  2XEV A;  4DX2 A;  2LNI A;  3TWT A;  3RO3 A;  3D9J A;  2Y4U A;  3DSW A;  2P9N G;  1FPP A;  2J08 A;  4KVO A;  3BQO A;  2RG8 A;  3MKQ B;  3B7U X;  3V2O A;  1EPU A;  4A1S A;  2WXR A;  5JHB A;  1KPS B;  4I6E A;  5AYW D;  3Q79 A;  4GTO A;  2RKK A;  4K0R A;  3CKB A;  2ZU6 B;  4DX5 D;  3ESL A;  2BED A;  3PS6 A;  2WXI A;  2ION A;  2WXH A;  4CYM D;  1DCQ A;  4OAU C;  4JL0 A;  1MZC A;  2RFM A;  3FTZ A;  1H0A A;  4IYP A;  2GRQ B;  4DX6 D;  5ENQ D;  2GW1 A;  2XGS A;  4CCA A;  2WXO A;  4FHK A;  3HIZ A;  4GTR A;  5CRU A;  4EZL A;  3KS2 A;  3NZU A;  1N11 A;  4MS6 A;  3D9K A;  4GPK A;  4JW1 A;  3C3Q A;  4ILI A;  1H6K A;  3TG4 A;  4G23 A;  3G2W A;  3EJN A;  1TEZ A;  5G04 J;  3QOU A;  4U96 D;  2JLB A;  4GPM A;  4KMO A;  3SO8 A;  2ZIS A;  3SI5 A;  3IHY A;  3CR3 A;  4XE0 A;  1XGW A;  4GB9 A;  4YDW A;  1NZN A;  5D2M C;  4P29 A;  4BSZ B;  3WG7 E;  5HRY A;  4HI8 A;  4ABN A;  4A1G A;  3URZ A;  2OEW A;  3ZHE B;  2LSV A;  3VTY A;  2LUH A;  1JCR A;  5G05 C;  2OV8 A;  1UW4 B;  4FA6 A;  3FEY A;  2L0I A;  1E7U A;  4C48 B;  5KBA A;  3CVY A;  3UKU G;  4HB5 A;  3RRM B;  3Q9U C;  1GW6 A;  4HLL A;  2VSX E;  4BTA A;  5AQB A;  2WXG A;  3U9W A;  1UN9 A;  3FUI A;  5CCL A;  2ZIR A;  2YHC A;  1TJC A;  2IO2 C;  3SD5 A;  4UQX A;  4DI4 A;  4LNU D;  4YDY A;  2OOE A;  4DX1 A;  5CMW A;  3FTU A;  4FLH A;  3DXK G;  3UQ3 A;  3VTX A;  3KSL A;  3VLE A;  4NUR A;  1U3C A;  3G2T A;  2I2O A;  2WXJ A;  4CRW A;  1MJ0 A;  2GRO B;  3FDH A;  2ILR A;  3C3O A;  3D9I A;  4ANW A;  4GMJ A;  3HXB A;  3ENE A;  4ANV A;  2LSU A;  3D9H A;  2ZGD A;  2MOW A;  3PEV B;  4OAV B;  1KZP A;  1N4S A;  3AG1 E;  4U95 D;  4ZHB A;  4HI9 A;  4JHK A;  3T9K A;  1V55 E;  2VGY A;  3G2S A;  2GRL A;  4G8L A;  4HRM B;  2P9L G;  1D9S A;  4UQY A;  4W9R A;  2X6F A;  3NOC D;  3QKY A;  3QAQ A;  3ULY A;  3TGO A;  4YDO A;  1V54 E;  4EBA A;  4JHR A;  1D8E A;  3FH5 A;  4QFV A;  1ZB1 A;  3ZKJ A;  3BG1 B;  3FUD A;  1X5B A;  3SFX A;  5JJ7 A;  4AOF A;  4KVM A;  3I5P A;  1U3D A;  2WQ7 A;  2VYI A;  4L2Y A;  3NB2 A;  3TWV A;  3FTX A;  1TJF A;  5ENN A;  5JA4 D;  4BER A;  3LVQ E;  3MKQ A;  2I9C A;  3EIJ A;  4K5C A;  4XKB A;  2V5F A;  4U04 A;  3FP3 A;  4GZ6 A;  2ETA A;  3ESK A;  4TV3 A;  4XI9 A;  1K1B A;  2F37 A;  5CEC B;  4F1S A;  2XEN A;  3UXG A;  3UKR G;  3HVE B;  2Y0B G;  3ASO E;  5CBO A;  5BXU A;  5G55 A;  5HQ8 A;  2DYR E;  3NAW A;  2IOL A;  2B6C A;  1TN7 A;  3LCA A;  1AP7 A;  2YQ8 A;  2QYU A;  5BNW A;  1YMP A;  3EU5 A;  1LD8 A;  2UY1 A;  3DEO A;  3TWU A;  4FAD A;  1S70 B;  2QC9 A;  3EHR A;  3ZXS A;  3ISM C;  2XGO A;  4UWK A;  3CVX A;  4MKT A;  3B7T A;  5HKP A;  4WWN A;  4ANU A;  4E85 A;  4O1P A;  2AXU A;  1YCS B;  3D9L A;  4N3B A;  3SNX A;  3UM1 A;  3L82 A;  2I1J A;  4BX9 A;  2KM4 A;  3CVQ A;  3ML9 A;  4M7C A;  1KLX A;  5EN5 D;  4XI0 A;  3L22 A;  3JYS A;  3U64 A;  3KEA A;  2P9S G;  2PM6 A;  3AS8 A;  4O1O A;  4HVB A;  3ZVV A;  3ZHE A;  3LS8 A;  5G05 J;  2XRZ A;  2FO1 E;  4KZC A;  5EIB E;  3GYZ A;  3SHF A;  4FJZ A;  4I6G A;  3CVL A;  1MX4 A;  2KZT B;  1H6O A;  5BW8 C;  1IYG A;  2J4D A;  2H6F A;  5ANL A;  2V5Q C;  5BUZ A;  1TNU A;  3APC A;  1PAQ A;  2LAH A;  2J07 A;  1OXJ A;  4JHJ A;  3QB2 A;  2WMO A;  4GYW A;  3UM0 A;  2WQ6 A;  3NQP A;  2NYJ A;  3FFL A;  3LDZ A;  2YHE A;  3E37 A;  2M63 A;  1Z5S C;  1H2T C;  3VLF A;  3T5V A;  3HXC A;  3Q47 B;  4Q94 A;  4N3C A;  4JA9 A;  2DYS E;  4B8C B;  3G2U A;  4EHM A;  3VLD A;  3PZD A;  2E0I A;  4ACL A;  4JPS A;  4KT6 B;  2J4B A;  4IRU A;  3B95 A;  4OYS A;  4JA7 A;  4XEI G;  4CGW A;  3FEX A;  1E8W A;  5G2N A;  5ARG A;  1YYH A;  3LVR E;  3ABK E;  1E8Z A;  2JEK A;  2WPV A;  3QNK A;  3S7J A;  1A5E A;  3ZPJ A;  4HOQ A;  1KT1 A;  4BT9 A;  3IV0 A;  3CQC B;  3L16 A;  5FQ4 A;  2XZT G;  1O1S A;  3Q73 A;  1BD8 A;  4IUL A;  3CK7 A;  1TR4 A;  3HG0 D;  1K1A A;  3MV2 B;  3GZS A;  2F8X K;  3S7D A;  4N5C A;  3FH8 A;  2VQ2 A;  3QWW A;  2R17 C;  3OTN A;  4FP7 A;  3PRZ A;  3E33 A;  2BTD A;  2P9P G;  2NSZ A;  3ABM E;  4MLP A;  3ZYM A;  2VGX A;  1MYO A;  2E2E A;  3FY4 A;  1B89 A;  3MJW A;  2J8S D;  3LJN A;  1ELK A;  1OWO A;  5FJY A;  3CSF A;  3CQG B;  4ME2 A;  4HOT A;  3GW4 A;  4GA1 A;  5LX8 A;  1INZ A;  2UWJ G;  3BG0 B;  4G1T A;  3B7R L;  2WB2 A;  1HX8 A;  4I43 A;  3ZYQ A;  2CHW A;  2V4H C;  4GZD A;  2X3M A;  3FUK A;  4RVB A;  4K03 A;  3TWR A;  4CDM A;  3CST A;  4J8Y A;  3B7S A;  3RRN B;  4U7E B;  4F1P A;  3DSV A;  2H6H A;  2IY0 C;  2JAB A;  3UT7 A;  3AG4 E;  4HLE A;  1N0R A;  4A63 B;  2FI7 A;  2XPZ A;  4N39 A;  1JCQ A;  3L13 A;  1KT0 A;  2CFU A;  2A5U A;  4JB8 P;  1KZO A;  4WWO A;  5T3R A;  3MCX A;  2CFZ A;  5AN8 A;  4BSX A;  3GZ1 A;  3OXL A;  2KCL A;  4Y6W A;  3FUM A;  1DCE A;  3FU5 A;  4C0M A;  4CT4 A;  4G2V A;  2GRN B;  4HFG A;  3DXM G;  5DIZ A;  3S7B A;  2R02 A;  5T8I A;  4J8E A;  4UWF A;  4GCO A;  2XPY A;  3B13 A;  1UG3 A;  3JXI A;  1OT8 A;  3UIP C;  3QWP A;  3U66 A;  3QC1 A;  3NBN B;  3L08 A;  1LF8 A;  4L23 A;  4APO A;  4C9B B;  2KAT A;  5EYP F;  1N54 A;  2QYJ A;  3D9N A;  3FTY A;  5AQ9 A;  5ARF A;  3CHS A;  4H7Y A;  2R59 A;  4GTM A;  2PL2 A;  2IFU A;  2GRP B;  3ZN3 A;  3RK6 A;  4ILH B;  4XZ4 A;  4UUC A;  2ZGG A;  5LP0 A;  4KZ0 A;  1BI8 B;  2OCC E;  2DVW A;  2F8Y A;  2YIN A;  2EIL E;  2P2C P;  3CK9 A;  4GA0 A;  3AS5 A;  2H6I A;  4K5B A;  2BF0 X;  1N4P A;  4U63 A;  4G24 A;  3ZNG A;  3DPY A;  1OCC E;  4YND A;  4ACK A;  4HOS A;  3ASF A;  3Q9N C;  5CRV A;  5KJN A;  1WM5 A;  3E4B A;  1OWP A;  4I2W A;  2KZT A;  5D0O D;  5CEA A;  4HRL A;  4J0U A;  4YVO A;  3FWV A;  3DWL G;  4O60 A;  2GRR B;  1SW6 A;  5B1A E;  3CVP A;  3UIN C;  3RU0 A;  2PM7 A;  4IN3 B;  5FIO A;  3SY2 A;  3ZGQ A;  4KXK B;  3D9P A;  4RSY A;  3E30 A;  2IJG X;  4BT8 A;  2WVI A;  3FTV A;  1Z3X A;  5BXO A;  2DCP A;  3E32 A;  3EUV A;  3ASD A;  3RRU A;  3UT4 A;  1Q2Z A;  3FU0 A;  4GAA A;  4GA2 A;  5EKQ D;  5FZQ A;  4E6H A;  4Q96 A;  3NF1 A;  3CKC A;  4R7L A;  4I1M A;  3FU6 A;  2L6J A;  3BUA A;  4I1O B;  4AP2 A;  5AJL A;  1Y6I A;  2LAI A;  4UI9 K;  3JXJ A;  3TWW A;  4DJA A;  1LTX A;  1HFA A;  1NA0 A;  2HE0 A;  1W3B A;  4AV7 A;  1NI1 A;  1OY3 D;  4I17 A;  2UY1 B;  1Z6T A;  2WXM A;  2XEH A;  3ONL A;  4AJW A;  4OVU A;  1HG5 A;  2AXV A;  1EYH A;  3CVV A;  1LD7 A;  1TN6 A;  5FWQ A;  3DSU A;  4RLY A;  3HXD A;  5KWD A;  4J8F A;  2VGX B;  2OND A;  1E96 B;  3UM2 A;  2C2L A;  3HVE A;  2WXP A;  4K5A B;  4PS7 A;  3LEW A;  4EZJ A;  3LPZ A;  2J9Q A;  3EHQ A;  5HI7 A;  5EDS A;  4J7W A;  5LCW J;  5B1B E;  2XQ0 A;  3UMV A;  5IY5 E;  1OCZ E;  1TNB A;  5E75 A;  2GGF A;  2P9I G;  3MYV A;  2HO1 A;  3G2V A;  4JXT A;  4BET A;  4F53 A;  2FO7 A;  3ASH A;  5B3S E;  2GRM A;  4CT0 A;  3L6A A;  2Q7F A;  4XKC A;  5AEN A;  2XS1 A;  2NXP A;  2X6H A;  4ATG A;  1E7V A;  3HRA A;  3NZS A;  5FQ7 A;  4JEU A;  2AWI A;  1E8X A;  3FHE A;  2KBX A;  1XNF A;  4FUL A;  1MX2 A;  3E34 A;  3BU8 A;  1IQU A;  5LFA A;  1TNZ A;  4L1B A;  3V2X A;  2H6G A;  2WMN A;  3PNT B;  4BFR A;  4GZC A;  3SZ7 A;  4PH4 B;  3TXN A;  4HRN A;  1DVP A;  4BES A;  4LNB A;  3Q15 A;  4JC8 A;  4G8K A;  1FVF A;  5EIL A;  1OWM A;  3PZ1 A;  3EHM A;  5C2Y A;  1QBQ A;  3O4Z A;  3MKR A;  1SA4 A;  5FTP A;  3QAR A;  3HXF A;  3MGB A;  3QDN A;  4DX7 D;  2BKK B;  4AIF A;  2IO3 C;  5ITZ F;  1HO8 A;  3PZ2 A;  1NA3 A;  2X38 A;  4UWG A;  2LO6 A;  1N95 A;  2WXK A;  3TWX A;  3T8M A;  2QZA A;  2L0T B;  4KBQ A;  3W9G A;  3TWQ A;  3LY7 A;  3CHM A;  3SF4 A;  2CG3 A;  3ABL E;  1N4R A;  1N9A A;  4KYO B;  4HBD A;  3OXG A;  3OXF A;  3FUL A;  4TXR A;  5M72 A;  2XCC A;  2DWZ A;  5CBN A;  1SZA A;  3MZL B;  3FUE A;  5CER B;  1NL4 A;  2Y1L E;  2XRY A;  3EHN A;  2ZXW E;  2VTB A;  3AU5 A;  4HNA D;  3O48 A;  4G11 A;  4AVX A;  1HH8 A;  3QWV A;  3CLJ A;  3MA5 A;  3DSS A;  2VSO E;  3CEQ A;  5DBK A;  3LKU A;  5KJL A;  1L5J A;  3SFZ A;  1A17 A;  3ZXP A;  3UX4 A;  3TXM A;  3V31 A;  2CG2 A;  3SFY A;  2EIM E;  2MYO A;  3AG2 E;  4WNG A;  4DRX E;  4J6I A;  3IEG A;  2XHE A;  2P9K G;  1H2U A;  2A5E A;  3P1U A;  3R7R A;  4DLQ A;  5JJ6 A;  3CV0 A;  2CHX A;  3CHO A;  4JZY A;  1IHG A;  2YNQ A;  3Q4A B;  3AAA C;  3UUX A;  3IKO B;  3Q78 A;  1FT1 A;  2J09 A;  3JUE A;  4EBA G;  3UPV A;  1JCS A;  1U2V G;  1OUV A;  2MRI A;  3FTW A;  4U8H A;  3TG5 A;  3L17 A;  4WAF A;  5ENR D;  2XCB A;  2QFC A;  2R05 A;  1FT2 A;  2C0L A;  3PE4 A;  1BPO A;  4WNF A;  1QQE A;  2EIK E;  2WM9 A;  5AQA A;  2AW6 A;  5H7P A;  3FUN A;  2MHK A;  2RD0 A;  3C5R A;  4PS8 A;  4AEZ C;  1ELW A;  2R03 A;  3ULQ A;  4N2Q A;  4M3O A;  2XS8 A;  4D10 C;  1O1T A;  4YVQ C;  1OCO E;  2OVB A;  1ZU2 A;  3LJ3 A;  3HYM B;  4XIF A;  3RJV A;  5ENO D;  1IHB A;  4CDN A;  4PDX A;  3ASG A;  1HZ4 A;  4GTS A;  4NAC A;  3ZYK A;  1HS6 A;  1VDY A;  3QK0 A;  1H19 A;  2AXZ A;  5BPP A;  2CHZ A;  2OEV A;  3ZFW A;  1QYM A;  3L9T A;  3PUJ A;  1HG2 A;  1H2V C;  3JQ1 A;  3UI2 A;  2DBA A;  1DC2 A;  1N4Q A;  5KJM A;  4LEU A;  3ZYL A;  2NC9 A;  4GZ5 A;  3UM3 A;  3APF A;  2C0M A;  3MX3 A;  3JUI A;  4GZ3 A;  2B0O E;  3Q7F A;  4A3T A;  4WND A;  2LXM A;  4JD2 G;  2HYZ A;  3I3N A;  2I6H A;  1UOH A;  1FVH A;  2IU1 A;  1N52 A;  2VSN A;  3CHQ A;  4L2L A;  3Q75 A;  3DST A;  3HXE A;  1S64 A;  2PQR A;  3I4G A;  3K9I A;  4OVV A;  4N5Q A;  1O5M A;  4CEM A;  3U4T A;  4JVS A;  4J8S A;  5KCM A;  5A6C A;  3CVU A;  3T8K A;  3ZU7 B;  2R2L A;  1S63 A;  4LG6 A;  3S2A A;  3EU9 A;  2WXF A;  1MHQ A;  3B7B A;  4B89 A;  2EIJ E;  3IBE A;  2RFA A;  1P5Q A;  4GTQ A;  3LXU X;  4ZFH A;  4I2Z A;  3KEZ A;  4H7X A;  5E76 A;  4NRH B;  4LSZ E;  1QZ2 A;  3Q5M A;  3SBS A;  1IKN D;  4GCN A;  2IQC A;  5ENS D;  1N94 A;  3APD A;  2A4Z A;  3LY9 A;  3P2B A;  3DSX A;  1EF1 C;  1SVX A;  4PS3 A;  3Q49 B;  3R9A B;  3DPD A;  4DLO A;  1OWN A;  3ZIM A;  4B94 A;  1SA5 A;  5C1D A;  1S0P A;  2ETC A;  1JUQ A;  1HF8 A;  4F6R D;  3C72 A;  3CVN A;  2XZD G;  3ZUV B;  2QY7 A;  4B8A A;  4X8Q A;  1ZBP A;  2V8S E;  4RG9 A;  3J5P A;  4LCT A;  3X2Q E;  2Y69 E;  4L9P A;  3JQ0 A;  5AQ7 A;  4RG6 A;  3BEE A;  5EYL A;  5G04 C;  3WXX A;  3UTM A;  2IOS A;  3GZ2 A;  4G26 A;  3TAX A;  3CHR A;  3CK8 A;  1WDY A;  5EX3 A;  5ENP D;  5JHA A;  2L6B A;  1UN8 A;  4EEC A;  3HHM A;  3AJI A;  3D9O A;  1SZ9 A;  5BT1 A;  2VSY A;  3AG3 E;  5AIJ A;  2X6J A;  4B0Z A;  2PNN A;  4C0E A;  4UI9 J;  2EIN E;  5KNH D;  5J90 A;  4UWH A;  1Y8M A;  4F7A A;  2P9U G;  1JWG A;  1K3Z D;  4GTP A;  4BEP A; 
#chains in the Genus database with same CATH homology
 4JA9 A;  1XNF A;  4JL0 A;  4B8C B;  4FUL A;  3G2U A;  5A23 A;  2Y3A A;  3PZD A;  2E0I A;  3VLD A;  4ACL A;  4JPS A;  4KT6 B;  1UJK A;  4TRQ A;  4EQF A;  2J4B A;  4GYY A;  4IRU A;  3FTZ A;  4OYS A;  4JA7 A;  3N71 A;  1H0A A;  1IQU A;  4IYP A;  5LFA A;  4L1B A;  2GW1 A;  3EDT B;  5FQ6 A;  4CGW A;  2PQN A;  1PY1 A;  2R5S A;  5LOZ A;  3FEX A;  4ANX A;  1E8W A;  5G2N A;  2XGS A;  4CCA A;  2WMN A;  3PNT B;  4BFR A;  5ARG A;  4AY5 A;  4GZC A;  1EDU A;  3LVR E;  1E8Z A;  2JEK A;  3SZ7 A;  2WPV A;  4PH4 B;  3TXN A;  3FTS A;  3QNK A;  1DVP A;  2WXO A;  4FHK A;  3HIZ A;  4F3V A;  3LYA A;  3Q15 A;  4JC8 A;  3S7J A;  4V3I A;  4EZL A;  3ZPJ A;  1FVF A;  4HOQ A;  1KT1 A;  3KS2 A;  3NZU A;  1OWM A;  4I6J A;  3IV0 A;  5C2Y A;  3CQC B;  3EHM A;  3L16 A;  4BT9 A;  4MS6 A;  5FQ4 A;  4DPR A;  3D9K A;  4GPK A;  3O4Z A;  3MKR A;  3PE3 A;  4GYO A;  5FTP A;  4JW1 A;  3QAR A;  3MGB A;  3QDN A;  3S7F A;  4ILI A;  4BTB A;  4CDR A;  1H6K A;  3TG4 A;  4G23 A;  4AIF A;  3G2W A;  3EJN A;  4U0S A;  5CMY A;  4HXI A;  4IUL A;  3CK7 A;  1TEZ A;  5G04 J;  2IF4 A;  3MV2 B;  2XGM A;  1HO8 A;  3QOU A;  1NA3 A;  2X38 A;  3GZS A;  4UWG A;  5LCW C;  2LO6 A;  2WXK A;  4LUN U;  1IQR A;  3T8M A;  2JLB A;  2L0T B;  3FUJ A;  4KBQ A;  3FH8 A;  4N5C A;  2VQ2 A;  5T4Y A;  3QWW A;  3S7D A;  2R17 C;  3LY7 A;  4KMO A;  3OTN A;  4FP7 A;  3SI5 A;  3IHY A;  3CHM A;  3PRZ A;  3SF4 A;  3CR3 A;  2CG3 A;  2BTD A;  4XE0 A;  1JWF A;  1XGW A;  2NSZ A;  4GB9 A;  4KYO B;  1NP7 A;  4MLP A;  3RO2 A;  4FU3 A;  3OXG A;  1NZN A;  3ZYM A;  2VGX A;  3OXF A;  2E2E A;  4P29 A;  3FUL A;  3FY4 A;  1B89 A;  3MJW A;  5M72 A;  2XCC A;  3L54 A;  1ELK A;  3CIA A;  1OWO A;  2XPI A;  3AS4 A;  5FJY A;  4ABN A;  1SZA A;  3CSF A;  4A1G A;  3MZL B;  3FUE A;  3CQG B;  4CGV A;  4ME2 A;  4HOT A;  3URZ A;  3ZHE B;  2LSV A;  3VTY A;  3GW4 A;  4GA1 A;  2XRY A;  3EHN A;  2VTB B;  5G05 C;  2VTB A;  3AU5 A;  5LX8 A;  1INZ A;  2UWJ G;  3O48 A;  4G11 A;  3FUF A;  4FLB A;  3BG0 B;  3FU3 A;  2OV8 A;  4G1T A;  5KJK A;  1UW4 B;  4AVX A;  4EZK A;  3B7R L;  4FA6 A;  1HX8 A;  4I43 A;  1HH8 A;  2WB2 A;  4HOR A;  3FEY A;  3ZYQ A;  3QWV A;  2CHW A;  3C98 A;  3CLJ A;  2L0I A;  3MA5 A;  2VSO E;  3CEQ A;  2HM8 A;  4GZD A;  1E7U A;  2X3M A;  3LKU A;  5DBK A;  5KJL A;  3FUK A;  3CVY A;  4RVB A;  1L5J A;  3SFZ A;  1A17 A;  4K03 A;  3RRM B;  3TXM A;  3UX4 A;  4CDM A;  1GW6 A;  2KCV A;  2CG2 A;  3CST A;  2VSX E;  5CHE E;  4WNG A;  4BTA A;  3B7S A;  4J6I A;  2WXG A;  3RRN B;  3U3W A;  3IEG A;  2XHE A;  1UN9 A;  3U9W A;  2X6K A;  4MRU A;  3FUI A;  5CCL A;  5CCM A;  1HE8 A;  3UT7 A;  2YHC A;  1TJC A;  3PNL B;  4UI9 C;  1H2U A;  3P1U A;  3R7R A;  3SD5 A;  4UQX A;  4BY6 A;  4HLE A;  4DLQ A;  2J49 A;  2FI7 A;  4UQZ A;  5JJ6 A;  3RKV A;  3CV0 A;  4DI4 A;  2XPZ A;  4HOU A;  2CHX A;  2DIW A;  3CHO A;  2OOE A;  4N39 A;  4JZY A;  1E90 A;  2I1K A;  1IHG A;  2YNQ A;  3Q4A B;  4I1A A;  3R7Q A;  3IKO B;  4I9E A;  3FTU A;  4FLH A;  4WUY A;  3UUX A;  3L13 A;  4A55 A;  3LY8 A;  2J09 A;  4EBA G;  1ELR A;  3UQ3 A;  3UPV A;  3VTX A;  3ZRH A;  3FUH A;  1OUV A;  3VLE A;  1KT0 A;  2CFU A;  2A5U A;  4NUR A;  1U3C A;  2MRI A;  3G2T A;  2I2O A;  3FTW A;  4U8H A;  3PDN A;  2WXJ A;  3TG5 A;  4WWO A;  2WQH A;  4I9C A;  5T3R A;  2V4L A;  3MCX A;  3L17 A;  4PUC A;  4U0Z A;  4WAF A;  2CFZ A;  4CRW A;  2XCB A;  4BSX A;  3GZ1 A;  3OXL A;  2WXN A;  2KCL A;  2FBN A;  3FDH A;  2ILR A;  2QFC A;  3D9I A;  4ANW A;  4GMJ A;  3ENE A;  1PC2 A;  2C0L A;  3PE4 A;  4Y6W A;  1BPO A;  3FUM A;  3FU5 A;  4ANV A;  2LSU A;  4WNF A;  1QQE A;  2MOW A;  3PEV B;  3QJZ A;  4GU5 A;  4C0M A;  1OWL A;  2KCK A;  2WM9 A;  4CT4 A;  3SGH A;  3PH0 C;  1E8Y A;  4G2V A;  2AW6 A;  4HFG A;  5AJD A;  4JHK A;  3FUN A;  3CHP A;  3D9M A;  5DIZ A;  3S7B A;  4WWP A;  2MHK A;  2RD0 A;  4J8E A;  4PS8 A;  2VGY A;  3G2S A;  2GRL A;  5T8I A;  4AEZ C;  1MQS A;  1ELW A;  4A3V A;  4UWF A;  4UQY A;  4W9R A;  1JPL A;  3ULQ A;  4N2Q A;  4GCO A;  4M3O A;  2X6F A;  3IHV A;  2XPY A;  3B13 A;  5A7D B;  4D10 C;  1UG3 A;  3TJP A;  4YVQ C;  3QKY A;  2HR2 A;  3QAQ A;  4LRZ A;  4O6F A;  5J08 A;  3TGO A;  2OVB A;  3PEU B;  1ZU2 A;  3ZW3 A;  3LJ3 A;  3QWP A;  4EBA A;  3QC1 A;  4JHR A;  3U66 A;  3FH5 A;  3HYM B;  3L08 A;  1LF8 A;  4XIF A;  4L23 A;  3RJV A;  2FF4 A;  4APO A;  2P58 C;  4C9B B;  4QFV A;  4CDN A;  4PDX A;  3ASG A;  1HZ4 A;  2KAT A;  3D9N A;  1N54 A;  3BG1 B;  4FJY A;  4NAC A;  3FUD A;  3ZYK A;  3FTY A;  5ARF A;  1X5B A;  3MEK A;  5JJ7 A;  3CHS A;  1HS6 A;  1VDY A;  4H7Y A;  3QK0 A;  1H19 A;  2AXZ A;  3KD7 A;  5BPP A;  2CHZ A;  2R59 A;  4AOF A;  2PL2 A;  2IFU A;  3CGH A;  4KVM A;  3ZFW A;  3I5P A;  1U3D A;  2WQ7 A;  2VYI A;  3PUJ A;  4XX5 A;  3RK6 A;  3ZN3 A;  4ILH B;  4XZ4 A;  1HG2 A;  4L2Y A;  1H2V C;  3JQ1 A;  3T5X A;  2DBA A;  5KJM A;  3FTX A;  5LP0 A;  4LEU A;  4KZ0 A;  3ZYL A;  2NC9 A;  5FZS A;  4GZ5 A;  4WNE A;  3APF A;  2C0M A;  1TJF A;  3MX3 A;  3JUI A;  2YIN A;  5ENN A;  3CVW A;  4GZ3 A;  4HS2 A;  4A3T A;  1QNF A;  3LVQ E;  4WND A;  3MKQ A;  2I9C A;  4U0U A;  3EIJ A;  3AU4 A;  4AXH A;  3CK9 A;  4GA0 A;  1FCH A;  3OAW A;  4JEH A;  4L7T A;  3AS5 A;  2HYZ A;  4NQ0 A;  2BF0 X;  3ZEF A;  4XKB A;  2V5F A;  4U63 A;  4U04 A;  3I3N A;  3FP3 A;  2I6H A;  4G24 A;  4GZ6 A;  3ESK A;  4TV3 A;  3PUK A;  4XI9 A;  1FVH A;  4YND A;  4ACK A;  4HOS A;  3ASF A;  5KJN A;  2IU1 A;  1WM5 A;  3E4B A;  1N52 A;  1OWP A;  4I2W A;  2VSN A;  4LER A;  3CHQ A;  2KZT A;  5FT9 A;  4F1S A;  5D0O D;  4L2L A;  4J0U A;  4YVO A;  3FWV A;  1WAO 1;  3HVE B;  2PQR A;  1HXI A;  3I4G A;  3K9I A;  4OVV A;  5JJT A;  2VJ8 A;  4EPZ A;  4CEM A;  5G55 A;  3CVP A;  3ONK A;  3RU0 A;  3U4T A;  4Y6C A;  4JVS A;  5HQ8 A;  1DNP A;  2PM7 A;  4IN3 B;  2Y4T A;  4J8S A;  5KCM A;  3UT8 A;  3ZGQ A;  5A6C A;  3CVU A;  4KXK B;  4AY6 A;  2IOL A;  4GML A;  4BX8 A;  3D9P A;  3LCA A;  4FHJ A;  4RSY A;  2AVP A;  3S2A A;  2YQ8 A;  2IJG X;  4G25 A;  2WXF A;  1SQM A;  1MHQ A;  5BNW A;  4B89 A;  1WY6 A;  4BT8 A;  2WVI A;  3IBE A;  3FTV A;  2BUG A;  3PRE A;  1P5Q A;  1UJJ A;  5EX0 A;  1Z3X A;  3LXU X;  4ILG A;  4DI3 A;  4I2Z A;  3KEZ A;  2DCP A;  3ML8 A;  4H7X A;  5E76 A;  4NRH B;  2UY1 A;  3ASD A;  3TL5 A;  3RRU A;  3I4R B;  4FAD A;  3FU0 A;  4GAA A;  2FUL A;  5FZQ A;  4GA2 A;  5EKQ D;  3UT4 A;  4FC8 A;  1QZ2 A;  3ZXS A;  4N2S A;  3RIB A;  3Q5M A;  4E6H A;  2XGO A;  4Q96 A;  4UWK A;  3SBS A;  4GCN A;  4J8D A;  3CVX A;  4MKT A;  2IQC A;  2WXQ A;  3NF1 A;  4UWL A;  3FH7 A;  3APD A;  3B7T A;  3CKC A;  3DBS A;  2A4Z A;  4WWN A;  3LY9 A;  4AM9 A;  4R7L A;  4I1M A;  3FU6 A;  4ANU A;  2L6J A;  4I1O B;  3P2B A;  2AXU A;  4AP2 A;  4E85 A;  3D3M A;  3D9L A;  1Y6I A;  5AJL A;  2LAI A;  4UI9 K;  4DJA A;  2FEZ A;  4N3B A;  1EF1 C;  1HFA A;  3SNX A;  1NA0 A;  1HU3 A;  2I1J A;  4BX9 A;  1W3B A;  2KM4 A;  4AV7 A;  4PS3 A;  3Q49 B;  3CVQ A;  3ML9 A;  3R9A B;  3DPD A;  2L9B A;  4I17 A;  4DLO A;  1KLX A;  1OWN A;  2OVF A;  4XI0 A;  3L22 A;  2UY1 B;  3JYS A;  3U64 A;  1Z6T A;  3ZIM A;  3MV3 B;  2WXM A;  4B94 A;  3SBT B;  3ONL A;  5C1D A;  5FZR A;  4AJW A;  5BV1 A;  5BV0 A;  2X6I A;  2PM6 A;  1S0P A;  4OVU A;  1HG5 A;  4U07 A;  2AXV A;  3AS8 A;  1JUQ A;  3EIQ C;  5D0Q D;  1HF8 A;  1EYH A;  5FQ8 A;  4DK5 A;  4HVB A;  3ZVV A;  3ZHE A;  3CVV A;  2EQX A;  3PVL A;  3LS8 A;  2PZI A;  2KC7 A;  5G05 J;  1YA0 A;  2XRZ A;  2WXL A;  3CVN A;  5ANR A;  4APF A;  3KAE A;  5FWQ A;  5CMW A;  4Q69 A;  4J8F A;  3HDX A;  2VGX B;  4TUU A;  2OND A;  2QY7 A;  1Z3Y A;  4KZC A;  3GYZ A;  4BWR A;  4B8A A;  1E96 B;  3SHF A;  2C2L A;  3HVE A;  2WXP A;  4FJZ A;  4I6G A;  4N3A A;  2V0P A;  1ZBP A;  3CVL A;  4PS7 A;  3LEW A;  4EZJ A;  2V8S E;  3LPZ A;  2KZT B;  4RG9 A;  2J9Q A;  4LCT A;  3JCK C;  5BW8 C;  5HI7 A;  4URK A;  1IYG A;  2XEV A;  2J4D A;  5EDS A;  2LNI A;  3RO3 A;  3D9J A;  2Y4U A;  3JQ0 A;  4RG6 A;  5LCW J;  5ANL A;  5BUZ A;  2J08 A;  3APC A;  1PAQ A;  3BEE A;  4KVO A;  2LAH A;  5G04 C;  2RG8 A;  3WXX A;  2XQ0 A;  2J07 A;  3UMV A;  3MKQ B;  3B7U X;  2IOS A;  4JHJ A;  3QB2 A;  2WMO A;  4GYW A;  1EPU A;  4A1S A;  2WXR A;  2WQ6 A;  3GZ2 A;  5JHB A;  4G26 A;  3TAX A;  3CHR A;  3CK8 A;  3NQP A;  4I6E A;  5AYW D;  3FFL A;  5E75 A;  5EX3 A;  3LDZ A;  4K0R A;  2GGF A;  3MYV A;  3CKB A;  2HO1 A;  2ZU6 B;  3G2V A;  5JHA A;  2YHE A;  4JXT A;  2M63 A;  1UN8 A;  4EEC A;  3HHM A;  4F53 A;  3D9O A;  1SZ9 A;  1H2T C;  2FO7 A;  3VLF A;  5BT1 A;  2VSY A;  3ASH A;  3T5V A;  5AIJ A;  2X6J A;  3ESL A;  3PS6 A;  4B0Z A;  2GRM A;  3Q47 B;  4C0E A;  4UI9 J;  4CT0 A;  2WXI A;  2Q7F A;  3L6A A;  2ION A;  2WXH A;  4Q94 A;  4XKC A;  5AEN A;  5J90 A;  2NXP A;  4N3C A;  4UWH A;  2X6H A;  1Y8M A;  4ATG A;  1E7V A;  4F7A A;  3NZS A;  5FQ7 A;  1JWG A;  4JEU A;  2AWI A;  1E8X A;  3FHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...