5C2YA

Crystal structure of the saccharomyces cerevisiae rtr1 (regulator of transcription)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
178
structure length
178
Chain Sequence
SGMATIEDIKETALIPFQKHRQLSMHEAEVITLEIIGLLCDSECKDEKTLKYLGRFLTPDMYQDLVDERNLNKRCGYPLCGKSPERIRDPFSMNDTTKKFLLENNPYAYLSHYCSKFHFRCSQFYQVQLSDEALFARTGVHLFEDPEQDKHDIDFKVTLFEELLREKASEEDIKSLIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Saccharomyces cerevisiae Rtr1 reveals an active site for an atypical phosphatase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords RNA polymerase II subunit B1 CTD phosphatase RTR1
total genus 62
structure length 178
sequence length 178
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2015-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04181 RPAP2_Rtr1 Rtr1/RPAP2 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.820 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5c2yA00
4FC8A 4M3OA 5C2YA
chains in the Genus database with same CATH superfamily
1DC2A 3VLFA 2VGXA 3EU5A 1JCRA 4IULA 4UQYA 1K3ZD 2GRPB 2J07A 1JWGA 2IO3C 5AQ9A 1H2TC 3RJVA 4OAVB 5CEAA 2WQHA 4MS6A 4EBAA 4CDRA 3FUJA 4LNGA 4MRUA 2VQ2A 5FTPA 4GZCA 3PNTB 3FUKA 2WXIA 4W9RA 4RG6A 2LXMA 4LERA 1IHGA 2J08A 4K5BA 3KSQA 2VGXB 4I17A 3HXFA 3GW4A 3I5PA 5AJDA 5CERB 3NOGD 5ARFA 2NSZA 3QKYA 5E76A 4ACLA 3OXFA 5EIBE 3VTYA 1LD8A 3S2AA 3C5RA 3DSSA 2RD0A 3DEPA 4U0SA 4YDWA 3FWVA 3ZGQA 3ZYKA 3JYSA 3IV0A 1HX8A 2XQ0A 3J5QB 1N54A 5FINA 3U66A 3Q4AB 3Q7AA 3JQ0A 3MZLB 3MCXA 3DXKG 2OEWA 3ZU7B 5BV0A 1D8DA 4UI9K 1NP7A 2X6FA 2XHEA 3HYMB 2E2EA 3D9LA 4CT0A 4UI9J 4KYOB 3UMVA 1NFIE 3CEQA 4BTAA 4CDNA 3SZ7A 2JEKA 3RO2A 1JWFA 3DSWA 1Z3YA 4XI9A 4BX8A 3B7RL 3PZ4A 2VTBA 1IYGA 4JXTA 1TJCA 1E7UA 3NBNB 5EN5D 2V5QC 3IEGA 3AG3E 3CVNA 4JD2G 3U9WA 3EHQA 3R7QA 4GCNA 3T8KA 2R2LA 3CHQA 3ULQA 1SVXA 1YYHA 4KT6B 5BUZA 4KZ0A 3U3WA 3DSUA 5ARGA 4JC8A 4HORA 3SI5A 1N4PA 2PNNA 4B8AA 1SA4A 2M63A 3RO3A 3HXDA 1N94A 3V79K 1EPUA 1QYMA 1TNZA 3D9NA 1UJKA 1YMPA 1SQMA 5KCMA 3UM0A 3QWVA 3PS6A 1D9SA 4BY6A 4CZ2D 1JCQA 4HXIA 1IXVA 4IN3B 2PQNA 4WWPA 1HG2A 4PS8A 1HU3A 5KJLA 1OXJA 2ETCA 2XPYA 2BKKB 2OOEA 3VLDA 1RZ4A 5HS0A 3MKQB 4I1AA 2V4HC 4G8LA 4LSZE 2AJAA 4V3IA 4YVOA 2ZIRA 3AAAC 4ANUA 1MX2A 4Q94A 5G05C 3R7RA 2IEJA 4EZKA 4WNDA 4ATGA 3FHEA 3ZRHA 2ZGGA 4XE0A 3S7JA 3TWXA 4AXHA 4EECA 4GMRA 4KBQA 3UT7A 2P9LG 4I6JA 3HDXA 3FUHA 4NURA 2J4BA 4HB5A 1DVPA 3DBSA 1WG0A 3NOCD 5BV1A 2JABA 3F6QA 4BETA 2P9SG 4AY5A 2J9QA 5A6CA 3IHVA 3PNLB 3G2TA 3LVRE 1S64A 4B94A 4G2VA 3FUIA 3D9PA 1OUVA 3ESKA 3FUDA 4OYSA 2FF4A 3ABLE 4CYMD 4U63A 4FA6A 2RFMA 4U8HA 1N4SA 3IBEA 2EIJE 5T4YA 4UI9C 4HI9A 3FTSA 2DYSE 4AY6A 2WXGA 2MYOA 4JPSA 4PUCA 5JHAA 2IY0C 1OCRE 1H6PA 4GU5A 5T8IA 4FHKA 4GTQA 3PUJA 4U96D 1OWLA 4HQDA 5ENSD 4JL0A 1OWNA 2WXFA 1LD7A 3CK9A 3L08A 3ZPJA 3SHFA 5KNGA 1JUQA 1RW2A 4PS7A 2XPIA 3UM3A 1EYHA 2KCVA 4MKTA 1U3DA 3PVLA 5AARA 3T9KA 4GMJA 4XIFA 3QC1A 3PDNA 3TWVA 4ANWA 2KXPC 3HXCA 5KJMA 4GA0A 3APDA 1E8WA 3O4ZA 3URZA 5HRYA 1ZB1A 1E8ZA 4EPZA 5AN8A 3Q75A 5IY5E 3L13A 4APOA 4L1BA 5LOZA 1OCZE 1N52A 4JVSA 4GTMA 4J8SA 4U7EB 4ILGA 5JJ7A 3ONLA 3FTVA 3ZIMA 1UW4B 1TN8A 2R5SA 3W9FA 4GTVA 3RRUA 4N2SA 4ZFHA 3CVLA 4JEHA 4Y6WA 3HVEB 2IO2C 4U0UA 4DLQA 1LTXA 4UWLA 2H6GA 2E0IA 1KPSB 3C98A 4GYYA 1NI1A 2QY7A 3CGHA 4LUNU 5EDSA 1JCSA 1Y6IA 4CGWA 1HXIA 4KVOA 3UM2A 4DRXE 2OCCE 2QYUA 1TNYA 2UWJG 1JPLA 3BU8A 3BG1B 4NACA 2WXKA 4IYPA 3APFA 4GA1A 4BFRA 4PS3A 2FEZA 2I9CA 2I6HA 5J90A 2WB2A 1N11A 2B0OE 3WG7E 3DSVA 4XKCA 4DUIA 2LSUA 1A5EA 2WXHA 5CECB 1MX6A 3B95A 1FPPA 1GW6A 1H2VC 2ZGDA 3FU6A 1E90A 3CVPA 4GTRA 2C0MA 4DX7D 5KWDA 2Y4TA 1FT1A 3C72A 4E85A 1FVHA 5H7PA 4LNUD 1ELWA 2H6HA 5B1AE 3UIPC 4NRHB 2CFZA 3TXMA 3TWWA 4N2QA 3D9IA 2J09A 2XS8A 3LS8A 3PZ3A 2J4DA 4DX2A 5ENOD 2LO6A 1OT8A 2KM4A 4FJYA 2OVFA 3SFZA 3L16A 2P2CP 4F1SA 1H6OA 2KZTB 3U4TA 4KMOA 4BTBA 2X6IA 3VLEA 3KD7A 2WXJA 2DZOA 3HVEA 1XGWA 1Z6TA 4AOFA 5BXUA 3FTZA 2VSNA 5C1DA 3IHYA 1Y8MA 5EYLA 5CRVA 3KSLA 3QNKA 3V30A 5KJNA 5JJTA 1OCOE 3MGBA 4FULA 4DI3A 4HRLA 4HLLA 4TUMA 2A5UA 3ONKA 2C0LA 3PZDA 2VGYA 1DCQA 3KAEA 1PC2A 4Z68A 4LG6A 2XEHA 3FULA 3LY7A 3FEYA 3CLJA 3Q49B 2ETAA 5AQAA 4I43A 3L54A 4I6EA 5HI7A 4GPKA 3FUEA 3D9HA 2AW6A 1IQUA 2NXPA 3CV0A 4G1TA 3DPDA 4YDOA 1DCEA 3ISMC 3ZXSA 3RU0A 3LXUX 4G8KA 1EF1C 3CSTA 5T3RA 4HOQA 5AQ7A 5EX3A 2DWZA 3ZVVA 5BPPA 3O48A 2L0IA 2F37A 1HZ4A 5HQ8A 3E32A 3GYZA 3ZYLA 5D66A 3KS2A 3CHRA 4HFGA 3MV3B 2Y4UA 3HHMA 3EUVA 3SFXA 3UX4A 2FULA 4AVXA 3P2BA 1Z5SC 4ME2A 4URKA 3L22A 2XEEA 3S7FA 3B7SA 3FTYA 3FH5A 3C3OA 4A3TA 3LY8A 3E4BA 2Y0BG 2RG8A 4ABNA 4C0MA 4JHJA 3UKUG 3ML8A 3B7BA 3LYAA 2MOWA 1BI8B 3ZHEA 4LEUA 5LCWJ 3G2WA 4MLPA 5LFAA 3TAXA 3ULYA 4HBDA 3UM1A 1O5MA 3CVQA 3TWSA 3V31A 4DLOA 3AU5A 3FY4A 4B93B 1X81A 1WAO1 3JXIA 4K03A 3W9GA 5JA4D 3CK8A 5BNWA 4CCAA 3FU0A 2I2OA 3LCAA 1S0PA 3MYVA 5KNHD 4F53A 4FLBA 4FHJA 4A1SA 1KZPA 4I2WA 5D0QD 4A1GA 4K5CA 4RSYA 4ANVA 3UUXA 4DJAA 1TEZA 3CVUA 1QZ2A 4UWFA 5AQBA 3ASNE 1N0QA 4H7YA 4R7LA 3E30A 2BUGA 2VSYA 2FI7A 1P5QA 5JJ6A 3UT4A 3Q47B 5HKPA 3JXJA 2AXVA 2L6JA 3UQ3A 4IRUA 3CHOA 2XENA 1MJ0A 3T5XA 3D3MA 3Q9UC 1TNUA 2X6KA 4H7XA 3SD5A 4GTTA 2WXMA 1Q2ZA 3B7UX 1V54E 4N39A 3KEZA 2VSOE 4JHRA 4DPRA 4C0EA 3HXBA 4Q69A 1QNFA 3E34A 4ILIA 3ASOE 4BSZB 2GRLA 4UUCA 3FP3A 3QOUA 4L2YA 3Q5MA 2GRNB 3D9JA 2LNIA 4CDMA 3UIOC 4U8YD 2ETBA 3NAWA 5J08A 1UOHA 4FC8A 2R05A 4ACKA 2CG2A 3VTXA 4DK5A 3TL5A 5CEDB 4N5QA 4K0RA 4RG9A 4DX1A 1IKND 3FU3A 4O1OA 4HNAD 2BF0X 4GZ6A 2AXUA 3TWQA 1YCSB 2VGEA 2WM9A 3FTXA 3AS4A 1OWMA 2XZTG 1O1SA 3QARA 4EHMA 4M3OA 2IOLA 1KLXA 2WXPA 3QAQA 3L17A 4XEIG 3ML9A 4TXRA 4KXKB 2FBNA 2WQ7A 2DCPA 3I4GA 3ZYMA 4U07A 3NZUA 3NF1A 4N3CA 1E7VA 1BD8A 2X6JA 5M72A 3ABME 2MHKA 3CVXA 4YVQC 3BEEA 4TUUA 3Q78A 2NYJA 5EKQD 1BLXB 5B3SE 2AVPA 5AAOA 3I4RB 1ELKA 2EINE 4RVBA 2XZDG 4TRQA 2RKKA 4XKBA 3FU5A 1H2UA 3FH7A 5BW8C 1TNOA 4DX6D 4F6RD 4A63B 3CHPA 3APCA 2XCCA 4OVVA 3CVVA 2R03A 1TYQG 3DPYA 5FT9A 1INZA 5BT1A 4JEUA 3R9AB 4CT4A 3FTWA 4JA7A 1MQSA 5AENA 3ESLA 2DIWA 4I9CA 4HOSA 3ZKJA 3TXNA 4ZHBA 4ILHB 3SQVA 5EX0A 3NB2A 3PZ1A 4I2ZA 4PDXA 3ZEFA 2J8SD 2HO1A 4N3BA 4WWNA 5FQ6A 4I1OB 5CBNA 1HFAA 4JB8P 4E6HA 1ZU2A 4LNBA 2R02A 4AEZC 2YINA 4HLEA 3Q9NC 3E37A 3CR3A 2YNQA 3ZYQA 3MJWA 3DWLG 3EHRA 1ELRA 2KCLA 3Q7FA 4J8YA 4WNEA 2F0YA 1X5BA 1L5JA 3MEKA 3P1UA 3AG2E 4C9BB 3SFYA 4TV3A 4LCTA 1DNPA 1MX4A 3UTMA 2OEVA 3CKCA 4X8QA 4BSXA 3C3QA 2HR2A 5JMND 3MKRA 1IQRA 3DRAA 4KVMA 1H19A 2CHWA 3ASGA 5LP0A 3DSTA 3EHMA 2P9PG 4BX9A 2IFUA 1UJJA 3TJPA 2LSVA 3N71A 4HOTA 4CEMA 1K1AA 3ZW3A 1HF8A 2VJ8A 3EIJA 1G3NB 2VYIA 4GTPA 2GRMA 1QQEA 2Q7FA 3CIAA 4JW1A 2NC9A 2IOSA 4WNGA 3FDHA 1N0RA 3L9TA 4I1MA 2VSXE 5ENRD 1SZ9A 5CMYA 2LXLA 2WMOA 5G05J 4J8DA 1QBQA 2PL2A 3WXXA 2KC7A 1FCHA 4JA9A 3S7BA 5ENQD 3CVYA 3FUNA 3JQ1A 3HIZA 1LF8A 3CSFA 3Q79A 4AV7A 1MYOA 1FT2A 3CKBA 3EDTB 3EHNA 2KBXA 3V2XA 2DBAA 4OAUC 5FIOA 4BERA 4JHKA 3ZN3A 3ASDA 4GPMA 4ATZD 2XS1A 2IU1A 4GAAA 2PQRA 5ANRA 2KCKA 3X2QE 3DXMG 3Q73A 2UY1A 4QQIA 3UKRG 4GTSA 3QJZA 3NZSA 5ENTD 3FUMA 4O6FA 3GZ2A 4YDYA 3EIQC 3ZNGA 1UG3A 3D9MA 3EJNA 4XI0A 3LKUA 4N3AA 1S70B 1H6KA 4B89A 4HVBA 5JHBA 4FADA 5CBOA 2J49A 4GZ3A 5DBKA 3RK6A 5CMWA 3JUIA 4UWHA 4J0UA 3BG0B 5DIZA 3E33A 1MZCA 4I9EA 2PM6A 4A3VA 1NA3A 2Y69E 3L6AA 4D10C 1VDYA 2YHEA 1KT1A 2P9KG 3D9OA 3I3NA 4JZYA 2WXLA 4L9PA 3CQCB 3AG4E 1S63A 5AYWD 2GW1A 2ZU6B 1N95A 3OXGA 2EILE 3EU9A 4XZ4A 2I1JA 3QDNA 2P9NG 4L2LA 5EIDA 3PREA 2YHCA 3U64A 5E75A 3ENEA 4TXQA 3T8MA 4GCOA 3PEUB 4N5CA 1N4RA 2DZNA 2OV8A 1TJFA 1UN9A 3AS5A 3IKOB 4J8EA 1HE8A 2X3MA 1XNFA 5CCLA 1TN7A 2EIKE 5D0OD 3R9MA 4RLYA 3TGOA 3G2VA 3BUAA 1K8KG 1AWCB 3G2SA 5EILA 3ASHA 5G04J 5G04C 2CFUA 4PH4B 3UXGA 3HRAA 1KT0A 3ZUVB 2HE0A 2ZISA 2ILRA 1U2VG 4U8VD 2L0TB 3SNXA 4FLHA 4HS2A 3JCKC 3RKVA 2R17C 3HXEA 4G26A 4AM9A 1SW6A 1WY6A 3BQOA 3RSEG 4J6IA 2ZXWE 1EDUA 1SA5A 3CVWA 4Y6CA 3ABKE 2BEDA 2EQXA 2WXOA 3GZSA 1WM5A 4BT8A 3B13A 5KBAA 2XGSA 4O60A 4DI4A 2DVWA 1PY1A 3UT8A 4EQFA 3PRZA 4HOUA 4J8FA 1KZOA 2L6BA 2F8XK 1O1TA 1AP7A 4KZCA 4GYOA 3QK0A 3ZHEB 5FZQA 2FO1E 1SZAA 3RAUA 4BWRA 4UWKA 4EBAG 4U95D 5CHEE 2LAHA 4B8CB 4L7TA 4UQZA 3AJIA 1OWOA 4YDEA 3T5VA 1NZNA 3B7TA 2GRRB 2CG3A 2I1KA 2A4ZA 5G2NA 4G24A 2P58C 3PEVB 2XRYA 5D2MC 5G55A 1E8XA 3LDZA 4GYWA 5FJYA 2JLBA 1UN8A 2IQCA 2WXRA 4J7WA 3ZXPA 5FQ8A 5ENNA 3AU4A 3K9IA 2XRZA 3KEAA 2QZAA 2GROB 4F1PA 4BESA 4U0ZA 4M7CA 4GA2A 4UWGA 4GZDA 1NL4A 4HRNA 1U3CA 4LRZA 5EYPF 2PZIA 4O1PA 2YQ8A 3MV2B 5B1BE 4FP7A 2IJGX 1W3BA 3LVQE 3SGHA 3CK7A 4YNDA 2WXQA 3V2OA 2FO7A 3TWRA 2EIME 3G2UA 2V4LA 4G11A 3OAWA 2WPVA 3PUKA 1PAQA 4HRMB 4WUYA 2HYZA 2P9UG 4G23A 3Q15A 5LCWC 5FQ4A 3UPVA 3JUEA 2WMNA 2KATA 4EZJA 2V8SE 2XCBA 2WXNA 2AWIA 3QWPA 3SF4A 3TG5A 3FTUA 1E8YA 2XEVA 4APFA 3C3RA 3OTNA 4NIKA 4BEPA 2H6FA 3FH8A 1B89A 3RRNB 4AP2A 1TN6A 4GB9A 3NQPA 4WNFA 5FWQA 2XPZA 2XGMA 3MX3A 1IHBA 2R59A 3TWTA 1E96B 1YA0A 3PH0C 3UI2A 3LY9A 3TWUA 2CHXA 2GGFA 3HG0D 3SY2A 4U04A 4CGVA 3SO8A 3CHSA 5ENPD 3GZ1A 3FUFA 4GMLA 3DSXA 2PM7A 1OWPA 5AIJA 4HI8A 4L23A 3OXLA 4GZ5A 5FZRA 4OVUA 1HG5A 5ANLA 2QC9A 4GTOA 2ONDA 2BKGA 3LEWA 5FQ7A 2BTDA 3AG1E 5KJKA 3DEOA 4TXPA 2X6HA 2OVBA 2XGOA 5C2YA 1N9AA 4AJWA 1BU9A 2LAIA 5BXOA 3ZFWA 2KZTA 3TG4A 1WDYA 5ITZF 3MKQA 1OCCE 5CCMA 1K1BA 2HM8A 3S7DA 4MBGA 4CRWA 2QYJA 5A23A 3AS8A 2WQ6A 4I6GA 4NQ0A 4XX5A 4RQIA 2F8YA 2V5FA 3SBTB 4A55A 4BT9A 1V55E 2DYRE 3QB2A 3CHMA 4UQXA 3PE4A 2GRQB 4Q96A 2P9IG 2IF4A 4C48B 4F7AA 3IXEA 1A17A 3D9KA 1H0AA 2WVIA 2Y3AA 4P29A 4FU3A 1O1RA 4WWOA 2L9BA 4AIFA 1D8EA 2RFAA 3L82A 1BPOA 3UINC 1Z3XA 2V0PA 2C2LA 5AJLA 1FVFA 2QFCA 1HO8A 1ZBPA 3PZ2A 2Y1LE 1TR4A 5LX8A 2A5EA 4QFVA 2VTBB 2IONA 4ANXA 4F3VA 2B6CA 3LPZA 3CQGB 5A7DB 4EZLA 4FJZA 4G25A 3ASFA 1OY3D 2CHZA 1TNBA 3RIBA 2UY1B 1HH8A 1NA0A 3LJ3A 3LJNA 2MRIA 3SBSA 1MHQA 2H6IA 3QWWA 1HS6A 3J5PA 3FEXA 2LUHA 2X38A 3MA5A 4WAFA 3RRMB 4K5AB 5FZSA 1N4QA 2AXZA 4B0ZA 3PE3A 5CRUA 4DX5D 1BI7B 3FFLA 3ULEG
chains in the Genus database with same CATH topology
3BG1B 4NACA 3VLFA 2VGXA 3FU3A 3G2SA 2WXKA 4IYPA 3ASHA 4IULA 4UQYA 5G04J 5G04C 2CFUA 2BF0X 3APFA 4GA1A 4GZ6A 2J07A 1JWGA 4PH4B 4PS3A 2AXUA 4BFRA 2FEZA 2I9CA 1KT0A 2WM9A 3FTXA 3AS4A 2ILRA 2I6HA 1OWMA 2L0TB 5J90A 3SNXA 1H2TC 3QARA 4FLHA 2WB2A 4M3OA 2IOLA 1KLXA 2WXPA 3QAQA 3RJVA 4XKCA 3L17A 2LSUA 2WQHA 4HS2A 4MS6A 3ML9A 4CDRA 4EBAA 3JCKC 2WXHA 3FUJA 4KXKB 4MRUA 3RKVA 2FBNA 2WQ7A 2VQ2A 2R17C 5FTPA 4GZCA 2DCPA 3I4GA 3PNTB 3FUKA 2WXIA 4W9RA 4G26A 4AM9A 4RG6A 3ZYMA 1GW6A 1WY6A 1H2VC 3FU6A 1E90A 3CVPA 4J6IA 4U07A 2C0MA 1IHGA 2J08A 4LERA 1EDUA 3NZUA 2VGXB 4I17A 2Y4TA 3NF1A 4N3CA 1E7VA 3CVWA 4Y6CA 3GW4A 3I5PA 2X6JA 4E85A 1FVHA 5AJDA 2EQXA 5M72A 1ELWA 2WXOA 3GZSA 1WM5A 2MHKA 3CVXA 4YVQC 5ARFA 4NRHB 4BT8A 3BEEA 4TUUA 2CFZA 2NSZA 3TXMA 3QKYA 3B13A 5E76A 5EKQD 3OXFA 4ACLA 4N2QA 3D9IA 2J09A 2XGSA 2AVPA 3I4RB 3LS8A 4DI4A 1ELKA 1PY1A 2J4DA 3UT8A 4RVBA 2LO6A 3VTYA 4TRQA 4EQFA 3S2AA 4XKBA 2KM4A 3FU5A 3PRZA 1H2UA 4FJYA 3FH7A 5BW8C 2RD0A 2OVFA 4U0SA 3SFZA 4HOUA 3L16A 4F1SA 3FWVA 3CHPA 4J8FA 3ZGQA 3APCA 3IV0A 3JYSA 3ZYKA 2KZTB 3U4TA 3TGOA 1HX8A 2XQ0A 1N54A 2XCCA 4KMOA 4OVVA 3U66A 3CVVA 4KZCA 4GYOA 4BTBA 3Q4AB 2X6IA 3QK0A 5FT9A 3VLEA 3KD7A 3JQ0A 3ZHEB 5FZQA 3MZLB 1INZA 5BT1A 1SZAA 2WXJA 4JEUA 3MCXA 3R9AB 4BWRA 4CT4A 4UWKA 3FTWA 3HVEA 4JA7A 4EBAG 5BV0A 1XGWA 1MQSA 5AENA 3ESLA 5CHEE 1Z6TA 2LAHA 4UI9K 4AOFA 4B8CB 1NP7A 3FTZA 2DIWA 2VSNA 2X6FA 4I9CA 4L7TA 2XHEA 3HYMB 2E2EA 4UQZA 3TXNA 3D9LA 4CT0A 5C1DA 3IHYA 1Y8MA 4UI9J 4ILHB 4KYOB 1OWOA 3UMVA 5EX0A 3CEQA 4BTAA 4CDNA 3SZ7A 2JEKA 4I2ZA 3QNKA 3T5VA 5KJNA 5JJTA 4PDXA 3ZEFA 3MGBA 2HO1A 4N3BA 4FULA 4DI3A 4WWNA 3RO2A 5FQ6A 1NZNA 2A5UA 1JWFA 3ONKA 3B7TA 4I1OB 1Z3YA 2C0LA 3PZDA 4XI9A 4BX8A 2CG3A 1HFAA 3B7RL 2VGYA 2I1KA 2VTBA 1IYGA 2A4ZA 4JXTA 5G2NA 4E6HA 4G24A 1ZU2A 3KAEA 1PC2A 1TJCA 2P58C 1E7UA 3PEVB 4AEZC 2YINA 2XRYA 4HLEA 3FULA 3LY7A 3IEGA 1E8XA 5G55A 3CVNA 3FEYA 3CR3A 3CLJA 3LDZA 2JLBA 3Q49B 4GYWA 5FJYA 3U9WA 2YNQA 3R7QA 1UN8A 2IQCA 3ZYQA 3MJWA 2WXRA 4GCNA 4I43A 5FQ8A 1ELRA 3CHQA 2KCLA 3L54A 5ENNA 3ULQA 3AU4A 3K9IA 4I6EA 4KT6B 4WNEA 4KZ0A 5BUZA 2XRZA 3U3WA 5HI7A 1X5BA 1L5JA 3MEKA 5ARGA 4JC8A 4GPKA 4HORA 3P1UA 3SI5A 4U0ZA 3FUEA 4B8AA 4GA2A 2AW6A 2M63A 4UWGA 3RO3A 1IQUA 4C9BB 4TV3A 2NXPA 1EPUA 3CV0A 4GZDA 3D9NA 4LCTA 1UJKA 3DPDA 4G1TA 1SQMA 1U3CA 4LRZA 5KCMA 3ZXSA 3RU0A 1DNPA 2PZIA 3LXUX 3QWVA 3PS6A 2YQ8A 1EF1C 4BY6A 3CKCA 3CSTA 5T3RA 4HOQA 4BSXA 3MV2B 4FP7A 4HXIA 2IJGX 1W3BA 3LVQE 3SGHA 4IN3B 2HR2A 2PQNA 3MKRA 3CK7A 4YNDA 4WWPA 1IQRA 1HG2A 2WXQA 4PS8A 5EX3A 1HU3A 4KVMA 2FO7A 1H19A 5KJLA 2XPYA 2CHWA 3ASGA 4G11A 3G2UA 2V4LA 5LP0A 3OAWA 2WPVA 3ZVVA 3EHMA 5BPPA 2OOEA 3O48A 2L0IA 3PUKA 1HZ4A 3VLDA 1PAQA 2IFUA 4BX9A 5HQ8A 3ZYLA 3GYZA 4WUYA 1UJJA 3KS2A 3MKQB 3TJPA 2HYZA 2LSVA 3CHRA 4HFGA 4I1AA 4G23A 3MV3B 3N71A 4V3IA 2Y4UA 3Q15A 3HHMA 5LCWC 4HOTA 4CEMA 4YVOA 5FQ4A 4ANUA 3UPVA 3UX4A 2WMNA 3ZW3A 2FULA 4AVXA 4Q94A 1HF8A 2VJ8A 5G05C 2KATA 4EZJA 3EIJA 3R7RA 2VYIA 2V8SE 3P2BA 2XCBA 2GRMA 2WXNA 4EZKA 2AWIA 4ME2A 3QWPA 3SF4A 4WNDA 4ATGA 3TG5A 4URKA 1QQEA 3FHEA 3L22A 3ZRHA 3S7FA 2Q7FA 3B7SA 3CIAA 3FTUA 3FTYA 1E8YA 4JW1A 3FH5A 2XEVA 4A3TA 4APFA 2NC9A 2IOSA 3LY8A 4WNGA 3FDHA 3OTNA 3E4BA 4XE0A 3S7JA 2RG8A 4ABNA 4I1MA 2VSXE 4AXHA 3FH8A 4C0MA 1SZ9A 4JHJA 4EECA 1B89A 3ML8A 3RRNB 4KBQA 3UT7A 4AP2A 5CMYA 3LYAA 2MOWA 4GB9A 4I6JA 3NQPA 4WNFA 3HDXA 3ZHEA 4LEUA 2XPZA 5FWQA 2XGMA 5LCWJ 3FUHA 3MX3A 3G2WA 2WMOA 4NURA 2R59A 4MLPA 2J4BA 1DVPA 1E96B 3DBSA 5G05J 1YA0A 3PH0C 4J8DA 5LFAA 2PL2A 3TAXA 3LY9A 3WXXA 2CHXA 2GGFA 2KC7A 1FCHA 4JA9A 5BV1A 4U04A 3S7BA 4CGVA 3CVYA 3CHSA 3FUNA 3GZ1A 4AY5A 3FUFA 4GMLA 3JQ1A 2PM7A 3CVQA 1OWPA 2J9QA 5A6CA 3IHVA 3PNLB 3HIZA 5AIJA 3G2TA 3LVRE 4B94A 4G2VA 4DLOA 3FUIA 3AU5A 3D9PA 3FY4A 1OUVA 3ESKA 3FUDA 4OYSA 1LF8A 2FF4A 1WAO1 3CSFA 4K03A 4L23A 3OXLA 4GZ5A 5FZRA 4OVUA 4AV7A 4U63A 1HG5A 3CK8A 4FA6A 4U8HA 5ANLA 5BNWA 3IBEA 5T4YA 4UI9C 3FTSA 3CKBA 2ONDA 4AY6A 3LEWA 3EDTB 5FQ7A 4CCAA 2BTDA 3EHNA 5KJKA 2WXGA 3FU0A 2I2OA 2DBAA 3LCAA 2X6HA 4JPSA 4PUCA 2OVBA 5JHAA 2XGOA 1S0PA 4JHKA 5C2YA 3ZN3A 3MYVA 3ASDA 4F53A 4GU5A 4FLBA 4FHJA 4A1SA 2LAIA 4I2WA 4AJWA 5D0QD 3ZFWA 2IU1A 2KZTA 4GAAA 5T8IA 2PQRA 4FHKA 5ANRA 3PUJA 2KCKA 1OWLA 3TG4A 4A1GA 4RSYA 3MKQA 4JL0A 4ANVA 3UUXA 5CCMA 1OWNA 2HM8A 4DJAA 2UY1A 1TEZA 2WXFA 3S7DA 3CK9A 3L08A 3ZPJA 3CVUA 3SHFA 1JUQA 4PS7A 2XPIA 3QJZA 4CRWA 1EYHA 2KCVA 3NZSA 1QZ2A 4UWFA 3FUMA 4MKTA 4O6FA 5A23A 3AS8A 2WQ6A 4I6GA 4NQ0A 4XX5A 1U3DA 3PVLA 3GZ2A 4H7YA 4GMJA 4R7LA 2V5FA 3SBTB 4A55A 3EIQC 4BT9A 1UG3A 2BUGA 2VSYA 4XIFA 3QC1A 3D9MA 3PDNA 3QB2A 2FI7A 3EJNA 4ANWA 3CHMA 5KJMA 4XI0A 3LKUA 1P5QA 4N3AA 5JJ6A 4GA0A 3APDA 4UQXA 3UT4A 3PE4A 1E8WA 3O4ZA 4Q96A 3URZA 1H6KA 3Q47B 4B89A 4HOSA 2IF4A 4F7AA 2AXVA 2L6JA 3UQ3A 4IRUA 4HVBA 1A17A 3CHOA 3D9KA 1E8ZA 1H0AA 2WVIA 2Y3AA 4P29A 4EPZA 4FADA 5JHBA 3T5XA 2J49A 3D3MA 4FU3A 4GZ3A 5DBKA 4WWOA 3RK6A 2L9BA 4AIFA 3L13A 4APOA 4L1BA 2X6KA 5LOZA 4H7XA 3SD5A 1BPOA 1N52A 4JVSA 5CMWA 2WXMA 3JUIA 4J8SA 3B7UX 1Z3XA 4UWHA 4ILGA 5JJ7A 3ONLA 3BG0B 3FTVA 4J0UA 2V0PA 4N39A 2C2LA 5DIZA 5AJLA 1FVFA 2QFCA 1HO8A 2VSOE 3KEZA 1ZBPA 4I9EA 4JHRA 3ZIMA 2PM6A 4A3VA 4C0EA 4DPRA 1NA3A 1UW4B 5LX8A 4QFVA 3L6AA 4D10C 2VTBB 4Q69A 2R5SA 2IONA 1VDYA 4ANXA 1QNFA 4F3VA 2YHEA 3RRUA 4N2SA 1KT1A 3LPZA 3CVLA 3CQGB 4JEHA 5A7DB 3D9OA 4Y6WA 3HVEB 3I3NA 4JZYA 4EZLA 2WXLA 3CQCB 4ILIA 4FJZA 4G25A 4U0UA 4DLQA 2GRLA 3ASFA 2GW1A 3FP3A 2ZU6B 5AYWD 2CHZA 3OXGA 3RIBA 4UWLA 3QOUA 4L2YA 2UY1B 3Q5MA 3D9JA 4XZ4A 2I1JA 3QDNA 2E0IA 1HH8A 1NA0A 3LJ3A 4L2LA 2MRIA 3PREA 2LNIA 2YHCA 3U64A 5E75A 3ENEA 3SBSA 4CDMA 1MHQA 3QWWA 3T8MA 1HS6A 3C98A 3FEXA 4GCOA 4GYYA 3PEUB 2QY7A 3CGHA 5J08A 4N5CA 4FC8A 4LUNU 2OV8A 1TJFA 1UN9A 3AS5A 5EDSA 3IKOB 4J8EA 1HE8A 4ACKA 2X38A 2CG2A 3MA5A 3VTXA 1Y6IA 4WAFA 3RRMB 4CGWA 1HXIA 2X3MA 1XNFA 4KVOA 4DK5A 5FZSA 5CCLA 3TL5A 2AXZA 4B0ZA 3PE3A 5D0OD 2UWJG 1JPLA 4K0RA 3FFLA 3G2VA 4RG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FC8 A;  4M3O A;  5C2Y A; 
#chains in the Genus database with same CATH topology
 1DC2 A;  3VLF A;  2VGX A;  3EU5 A;  1JCR A;  4IUL A;  4UQY A;  1K3Z D;  2GRP B;  2J07 A;  1JWG A;  2IO3 C;  5AQ9 A;  1H2T C;  3RJV A;  4OAV B;  5CEA A;  2WQH A;  4MS6 A;  4EBA A;  4CDR A;  3FUJ A;  4LNG A;  4MRU A;  2VQ2 A;  5FTP A;  4GZC A;  3PNT B;  3FUK A;  2WXI A;  4W9R A;  4RG6 A;  2LXM A;  4LER A;  1IHG A;  2J08 A;  4K5B A;  3KSQ A;  2VGX B;  4I17 A;  3HXF A;  3GW4 A;  3I5P A;  5AJD A;  5CER B;  3NOG D;  5ARF A;  2NSZ A;  3QKY A;  5E76 A;  4ACL A;  3OXF A;  5EIB E;  3VTY A;  1LD8 A;  3S2A A;  3C5R A;  3DSS A;  2RD0 A;  3DEP A;  4U0S A;  4YDW A;  3FWV A;  3ZGQ A;  3ZYK A;  3JYS A;  3IV0 A;  1HX8 A;  2XQ0 A;  3J5Q B;  1N54 A;  5FIN A;  3U66 A;  3Q4A B;  3Q7A A;  3JQ0 A;  3MZL B;  3MCX A;  3DXK G;  2OEW A;  3ZU7 B;  5BV0 A;  1D8D A;  4UI9 K;  1NP7 A;  2X6F A;  2XHE A;  3HYM B;  2E2E A;  3D9L A;  4CT0 A;  4UI9 J;  4KYO B;  3UMV A;  1NFI E;  3CEQ A;  4BTA A;  4CDN A;  3SZ7 A;  2JEK A;  3RO2 A;  1JWF A;  3DSW A;  1Z3Y A;  4XI9 A;  4BX8 A;  3B7R L;  3PZ4 A;  2VTB A;  1IYG A;  4JXT A;  1TJC A;  1E7U A;  3NBN B;  5EN5 D;  2V5Q C;  3IEG A;  3AG3 E;  3CVN A;  4JD2 G;  3U9W A;  3EHQ A;  3R7Q A;  4GCN A;  3T8K A;  2R2L A;  3CHQ A;  3ULQ A;  1SVX A;  1YYH A;  4KT6 B;  5BUZ A;  4KZ0 A;  3U3W A;  3DSU A;  5ARG A;  4JC8 A;  4HOR A;  3SI5 A;  1N4P A;  2PNN A;  4B8A A;  1SA4 A;  2M63 A;  3RO3 A;  3HXD A;  1N94 A;  3V79 K;  1EPU A;  1QYM A;  1TNZ A;  3D9N A;  1UJK A;  1YMP A;  1SQM A;  5KCM A;  3UM0 A;  3QWV A;  3PS6 A;  1D9S A;  4BY6 A;  4CZ2 D;  1JCQ A;  4HXI A;  1IXV A;  4IN3 B;  2PQN A;  4WWP A;  1HG2 A;  4PS8 A;  1HU3 A;  5KJL A;  1OXJ A;  2ETC A;  2XPY A;  2BKK B;  2OOE A;  3VLD A;  1RZ4 A;  5HS0 A;  3MKQ B;  4I1A A;  2V4H C;  4G8L A;  4LSZ E;  2AJA A;  4V3I A;  4YVO A;  2ZIR A;  3AAA C;  4ANU A;  1MX2 A;  4Q94 A;  5G05 C;  3R7R A;  2IEJ A;  4EZK A;  4WND A;  4ATG A;  3FHE A;  3ZRH A;  2ZGG A;  4XE0 A;  3S7J A;  3TWX A;  4AXH A;  4EEC A;  4GMR A;  4KBQ A;  3UT7 A;  2P9L G;  4I6J A;  3HDX A;  3FUH A;  4NUR A;  2J4B A;  4HB5 A;  1DVP A;  3DBS A;  1WG0 A;  3NOC D;  5BV1 A;  2JAB A;  3F6Q A;  4BET A;  2P9S G;  4AY5 A;  2J9Q A;  5A6C A;  3IHV A;  3PNL B;  3G2T A;  3LVR E;  1S64 A;  4B94 A;  4G2V A;  3FUI A;  3D9P A;  1OUV A;  3ESK A;  3FUD A;  4OYS A;  2FF4 A;  3ABL E;  4CYM D;  4U63 A;  4FA6 A;  2RFM A;  4U8H A;  1N4S A;  3IBE A;  2EIJ E;  5T4Y A;  4UI9 C;  4HI9 A;  3FTS A;  2DYS E;  4AY6 A;  2WXG A;  2MYO A;  4JPS A;  4PUC A;  5JHA A;  2IY0 C;  1OCR E;  1H6P A;  4GU5 A;  5T8I A;  4FHK A;  4GTQ A;  3PUJ A;  4U96 D;  1OWL A;  4HQD A;  5ENS D;  4JL0 A;  1OWN A;  2WXF A;  1LD7 A;  3CK9 A;  3L08 A;  3ZPJ A;  3SHF A;  5KNG A;  1JUQ A;  1RW2 A;  4PS7 A;  2XPI A;  3UM3 A;  1EYH A;  2KCV A;  4MKT A;  1U3D A;  3PVL A;  5AAR A;  3T9K A;  4GMJ A;  4XIF A;  3QC1 A;  3PDN A;  3TWV A;  4ANW A;  2KXP C;  3HXC A;  5KJM A;  4GA0 A;  3APD A;  1E8W A;  3O4Z A;  3URZ A;  5HRY A;  1ZB1 A;  1E8Z A;  4EPZ A;  5AN8 A;  3Q75 A;  5IY5 E;  3L13 A;  4APO A;  4L1B A;  5LOZ A;  1OCZ E;  1N52 A;  4JVS A;  4GTM A;  4J8S A;  4U7E B;  4ILG A;  5JJ7 A;  3ONL A;  3FTV A;  3ZIM A;  1UW4 B;  1TN8 A;  2R5S A;  3W9F A;  4GTV A;  3RRU A;  4N2S A;  4ZFH A;  3CVL A;  4JEH A;  4Y6W A;  3HVE B;  2IO2 C;  4U0U A;  4DLQ A;  1LTX A;  4UWL A;  2H6G A;  2E0I A;  1KPS B;  3C98 A;  4GYY A;  1NI1 A;  2QY7 A;  3CGH A;  4LUN U;  5EDS A;  1JCS A;  1Y6I A;  4CGW A;  1HXI A;  4KVO A;  3UM2 A;  4DRX E;  2OCC E;  2QYU A;  1TNY A;  2UWJ G;  1JPL A;  3BU8 A;  3BG1 B;  4NAC A;  2WXK A;  4IYP A;  3APF A;  4GA1 A;  4BFR A;  4PS3 A;  2FEZ A;  2I9C A;  2I6H A;  5J90 A;  2WB2 A;  1N11 A;  2B0O E;  3WG7 E;  3DSV A;  4XKC A;  4DUI A;  2LSU A;  1A5E A;  2WXH A;  5CEC B;  1MX6 A;  3B95 A;  1FPP A;  1GW6 A;  1H2V C;  2ZGD A;  3FU6 A;  1E90 A;  3CVP A;  4GTR A;  2C0M A;  4DX7 D;  5KWD A;  2Y4T A;  1FT1 A;  3C72 A;  4E85 A;  1FVH A;  5H7P A;  4LNU D;  1ELW A;  2H6H A;  5B1A E;  3UIP C;  4NRH B;  2CFZ A;  3TXM A;  3TWW A;  4N2Q A;  3D9I A;  2J09 A;  2XS8 A;  3LS8 A;  3PZ3 A;  2J4D A;  4DX2 A;  5ENO D;  2LO6 A;  1OT8 A;  2KM4 A;  4FJY A;  2OVF A;  3SFZ A;  3L16 A;  2P2C P;  4F1S A;  1H6O A;  2KZT B;  3U4T A;  4KMO A;  4BTB A;  2X6I A;  3VLE A;  3KD7 A;  2WXJ A;  2DZO A;  3HVE A;  1XGW A;  1Z6T A;  4AOF A;  5BXU A;  3FTZ A;  2VSN A;  5C1D A;  3IHY A;  1Y8M A;  5EYL A;  5CRV A;  3KSL A;  3QNK A;  3V30 A;  5KJN A;  5JJT A;  1OCO E;  3MGB A;  4FUL A;  4DI3 A;  4HRL A;  4HLL A;  4TUM A;  2A5U A;  3ONK A;  2C0L A;  3PZD A;  2VGY A;  1DCQ A;  3KAE A;  1PC2 A;  4Z68 A;  4LG6 A;  2XEH A;  3FUL A;  3LY7 A;  3FEY A;  3CLJ A;  3Q49 B;  2ETA A;  5AQA A;  4I43 A;  3L54 A;  4I6E A;  5HI7 A;  4GPK A;  3FUE A;  3D9H A;  2AW6 A;  1IQU A;  2NXP A;  3CV0 A;  4G1T A;  3DPD A;  4YDO A;  1DCE A;  3ISM C;  3ZXS A;  3RU0 A;  3LXU X;  4G8K A;  1EF1 C;  3CST A;  5T3R A;  4HOQ A;  5AQ7 A;  5EX3 A;  2DWZ A;  3ZVV A;  5BPP A;  3O48 A;  2L0I A;  2F37 A;  1HZ4 A;  5HQ8 A;  3E32 A;  3GYZ A;  3ZYL A;  5D66 A;  3KS2 A;  3CHR A;  4HFG A;  3MV3 B;  2Y4U A;  3HHM A;  3EUV A;  3SFX A;  3UX4 A;  2FUL A;  4AVX A;  3P2B A;  1Z5S C;  4ME2 A;  4URK A;  3L22 A;  2XEE A;  3S7F A;  3B7S A;  3FTY A;  3FH5 A;  3C3O A;  4A3T A;  3LY8 A;  3E4B A;  2Y0B G;  2RG8 A;  4ABN A;  4C0M A;  4JHJ A;  3UKU G;  3ML8 A;  3B7B A;  3LYA A;  2MOW A;  1BI8 B;  3ZHE A;  4LEU A;  5LCW J;  3G2W A;  4MLP A;  5LFA A;  3TAX A;  3ULY A;  4HBD A;  3UM1 A;  1O5M A;  3CVQ A;  3TWS A;  3V31 A;  4DLO A;  3AU5 A;  3FY4 A;  4B93 B;  1X81 A;  1WAO 1;  3JXI A;  4K03 A;  3W9G A;  5JA4 D;  3CK8 A;  5BNW A;  4CCA A;  3FU0 A;  2I2O A;  3LCA A;  1S0P A;  3MYV A;  5KNH D;  4F53 A;  4FLB A;  4FHJ A;  4A1S A;  1KZP A;  4I2W A;  5D0Q D;  4A1G A;  4K5C A;  4RSY A;  4ANV A;  3UUX A;  4DJA A;  1TEZ A;  3CVU A;  1QZ2 A;  4UWF A;  5AQB A;  3ASN E;  1N0Q A;  4H7Y A;  4R7L A;  3E30 A;  2BUG A;  2VSY A;  2FI7 A;  1P5Q A;  5JJ6 A;  3UT4 A;  3Q47 B;  5HKP A;  3JXJ A;  2AXV A;  2L6J A;  3UQ3 A;  4IRU A;  3CHO A;  2XEN A;  1MJ0 A;  3T5X A;  3D3M A;  3Q9U C;  1TNU A;  2X6K A;  4H7X A;  3SD5 A;  4GTT A;  2WXM A;  1Q2Z A;  3B7U X;  1V54 E;  4N39 A;  3KEZ A;  2VSO E;  4JHR A;  4DPR A;  4C0E A;  3HXB A;  4Q69 A;  1QNF A;  3E34 A;  4ILI A;  3ASO E;  4BSZ B;  2GRL A;  4UUC A;  3FP3 A;  3QOU A;  4L2Y A;  3Q5M A;  2GRN B;  3D9J A;  2LNI A;  4CDM A;  3UIO C;  4U8Y D;  2ETB A;  3NAW A;  5J08 A;  1UOH A;  4FC8 A;  2R05 A;  4ACK A;  2CG2 A;  3VTX A;  4DK5 A;  3TL5 A;  5CED B;  4N5Q A;  4K0R A;  4RG9 A;  4DX1 A;  1IKN D;  3FU3 A;  4O1O A;  4HNA D;  2BF0 X;  4GZ6 A;  2AXU A;  3TWQ A;  1YCS B;  2VGE A;  2WM9 A;  3FTX A;  3AS4 A;  1OWM A;  2XZT G;  1O1S A;  3QAR A;  4EHM A;  4M3O A;  2IOL A;  1KLX A;  2WXP A;  3QAQ A;  3L17 A;  4XEI G;  3ML9 A;  4TXR A;  4KXK B;  2FBN A;  2WQ7 A;  2DCP A;  3I4G A;  3ZYM A;  4U07 A;  3NZU A;  3NF1 A;  4N3C A;  1E7V A;  1BD8 A;  2X6J A;  5M72 A;  3ABM E;  2MHK A;  3CVX A;  4YVQ C;  3BEE A;  4TUU A;  3Q78 A;  2NYJ A;  5EKQ D;  1BLX B;  5B3S E;  2AVP A;  5AAO A;  3I4R B;  1ELK A;  2EIN E;  4RVB A;  2XZD G;  4TRQ A;  2RKK A;  4XKB A;  3FU5 A;  1H2U A;  3FH7 A;  5BW8 C;  1TNO A;  4DX6 D;  4F6R D;  4A63 B;  3CHP A;  3APC A;  2XCC A;  4OVV A;  3CVV A;  2R03 A;  1TYQ G;  3DPY A;  5FT9 A;  1INZ A;  5BT1 A;  4JEU A;  3R9A B;  4CT4 A;  3FTW A;  4JA7 A;  1MQS A;  5AEN A;  3ESL A;  2DIW A;  4I9C A;  4HOS A;  3ZKJ A;  3TXN A;  4ZHB A;  4ILH B;  3SQV A;  5EX0 A;  3NB2 A;  3PZ1 A;  4I2Z A;  4PDX A;  3ZEF A;  2J8S D;  2HO1 A;  4N3B A;  4WWN A;  5FQ6 A;  4I1O B;  5CBN A;  1HFA A;  4JB8 P;  4E6H A;  1ZU2 A;  4LNB A;  2R02 A;  4AEZ C;  2YIN A;  4HLE A;  3Q9N C;  3E37 A;  3CR3 A;  2YNQ A;  3ZYQ A;  3MJW A;  3DWL G;  3EHR A;  1ELR A;  2KCL A;  3Q7F A;  4J8Y A;  4WNE A;  2F0Y A;  1X5B A;  1L5J A;  3MEK A;  3P1U A;  3AG2 E;  4C9B B;  3SFY A;  4TV3 A;  4LCT A;  1DNP A;  1MX4 A;  3UTM A;  2OEV A;  3CKC A;  4X8Q A;  4BSX A;  3C3Q A;  2HR2 A;  5JMN D;  3MKR A;  1IQR A;  3DRA A;  4KVM A;  1H19 A;  2CHW A;  3ASG A;  5LP0 A;  3DST A;  3EHM A;  2P9P G;  4BX9 A;  2IFU A;  1UJJ A;  3TJP A;  2LSV A;  3N71 A;  4HOT A;  4CEM A;  1K1A A;  3ZW3 A;  1HF8 A;  2VJ8 A;  3EIJ A;  1G3N B;  2VYI A;  4GTP A;  2GRM A;  1QQE A;  2Q7F A;  3CIA A;  4JW1 A;  2NC9 A;  2IOS A;  4WNG A;  3FDH A;  1N0R A;  3L9T A;  4I1M A;  2VSX E;  5ENR D;  1SZ9 A;  5CMY A;  2LXL A;  2WMO A;  5G05 J;  4J8D A;  1QBQ A;  2PL2 A;  3WXX A;  2KC7 A;  1FCH A;  4JA9 A;  3S7B A;  5ENQ D;  3CVY A;  3FUN A;  3JQ1 A;  3HIZ A;  1LF8 A;  3CSF A;  3Q79 A;  4AV7 A;  1MYO A;  1FT2 A;  3CKB A;  3EDT B;  3EHN A;  2KBX A;  3V2X A;  2DBA A;  4OAU C;  5FIO A;  4BER A;  4JHK A;  3ZN3 A;  3ASD A;  4GPM A;  4ATZ D;  2XS1 A;  2IU1 A;  4GAA A;  2PQR A;  5ANR A;  2KCK A;  3X2Q E;  3DXM G;  3Q73 A;  2UY1 A;  4QQI A;  3UKR G;  4GTS A;  3QJZ A;  3NZS A;  5ENT D;  3FUM A;  4O6F A;  3GZ2 A;  4YDY A;  3EIQ C;  3ZNG A;  1UG3 A;  3D9M A;  3EJN A;  4XI0 A;  3LKU A;  4N3A A;  1S70 B;  1H6K A;  4B89 A;  4HVB A;  5JHB A;  4FAD A;  5CBO A;  2J49 A;  4GZ3 A;  5DBK A;  3RK6 A;  5CMW A;  3JUI A;  4UWH A;  4J0U A;  3BG0 B;  5DIZ A;  3E33 A;  1MZC A;  4I9E A;  2PM6 A;  4A3V A;  1NA3 A;  2Y69 E;  3L6A A;  4D10 C;  1VDY A;  2YHE A;  1KT1 A;  2P9K G;  3D9O A;  3I3N A;  4JZY A;  2WXL A;  4L9P A;  3CQC B;  3AG4 E;  1S63 A;  5AYW D;  2GW1 A;  2ZU6 B;  1N95 A;  3OXG A;  2EIL E;  3EU9 A;  4XZ4 A;  2I1J A;  3QDN A;  2P9N G;  4L2L A;  5EID A;  3PRE A;  2YHC A;  3U64 A;  5E75 A;  3ENE A;  4TXQ A;  3T8M A;  4GCO A;  3PEU B;  4N5C A;  1N4R A;  2DZN A;  2OV8 A;  1TJF A;  1UN9 A;  3AS5 A;  3IKO B;  4J8E A;  1HE8 A;  2X3M A;  1XNF A;  5CCL A;  1TN7 A;  2EIK E;  5D0O D;  3R9M A;  4RLY A;  3TGO A;  3G2V A;  3BUA A;  1K8K G;  1AWC B;  3G2S A;  5EIL A;  3ASH A;  5G04 J;  5G04 C;  2CFU A;  4PH4 B;  3UXG A;  3HRA A;  1KT0 A;  3ZUV B;  2HE0 A;  2ZIS A;  2ILR A;  1U2V G;  4U8V D;  2L0T B;  3SNX A;  4FLH A;  4HS2 A;  3JCK C;  3RKV A;  2R17 C;  3HXE A;  4G26 A;  4AM9 A;  1SW6 A;  1WY6 A;  3BQO A;  3RSE G;  4J6I A;  2ZXW E;  1EDU A;  1SA5 A;  3CVW A;  4Y6C A;  3ABK E;  2BED A;  2EQX A;  2WXO A;  3GZS A;  1WM5 A;  4BT8 A;  3B13 A;  5KBA A;  2XGS A;  4O60 A;  4DI4 A;  2DVW A;  1PY1 A;  3UT8 A;  4EQF A;  3PRZ A;  4HOU A;  4J8F A;  1KZO A;  2L6B A;  2F8X K;  1O1T A;  1AP7 A;  4KZC A;  4GYO A;  3QK0 A;  3ZHE B;  5FZQ A;  2FO1 E;  1SZA A;  3RAU A;  4BWR A;  4UWK A;  4EBA G;  4U95 D;  5CHE E;  2LAH A;  4B8C B;  4L7T A;  4UQZ A;  3AJI A;  1OWO A;  4YDE A;  3T5V A;  1NZN A;  3B7T A;  2GRR B;  2CG3 A;  2I1K A;  2A4Z A;  5G2N A;  4G24 A;  2P58 C;  3PEV B;  2XRY A;  5D2M C;  5G55 A;  1E8X A;  3LDZ A;  4GYW A;  5FJY A;  2JLB A;  1UN8 A;  2IQC A;  2WXR A;  4J7W A;  3ZXP A;  5FQ8 A;  5ENN A;  3AU4 A;  3K9I A;  2XRZ A;  3KEA A;  2QZA A;  2GRO B;  4F1P A;  4BES A;  4U0Z A;  4M7C A;  4GA2 A;  4UWG A;  4GZD A;  1NL4 A;  4HRN A;  1U3C A;  4LRZ A;  5EYP F;  2PZI A;  4O1P A;  2YQ8 A;  3MV2 B;  5B1B E;  4FP7 A;  2IJG X;  1W3B A;  3LVQ E;  3SGH A;  3CK7 A;  4YND A;  2WXQ A;  3V2O A;  2FO7 A;  3TWR A;  2EIM E;  3G2U A;  2V4L A;  4G11 A;  3OAW A;  2WPV A;  3PUK A;  1PAQ A;  4HRM B;  4WUY A;  2HYZ A;  2P9U G;  4G23 A;  3Q15 A;  5LCW C;  5FQ4 A;  3UPV A;  3JUE A;  2WMN A;  2KAT A;  4EZJ A;  2V8S E;  2XCB A;  2WXN A;  2AWI A;  3QWP A;  3SF4 A;  3TG5 A;  3FTU A;  1E8Y A;  2XEV A;  4APF A;  3C3R A;  3OTN A;  4NIK A;  4BEP A;  2H6F A;  3FH8 A;  1B89 A;  3RRN B;  4AP2 A;  1TN6 A;  4GB9 A;  3NQP A;  4WNF A;  5FWQ A;  2XPZ A;  2XGM A;  3MX3 A;  1IHB A;  2R59 A;  3TWT A;  1E96 B;  1YA0 A;  3PH0 C;  3UI2 A;  3LY9 A;  3TWU A;  2CHX A;  2GGF A;  3HG0 D;  3SY2 A;  4U04 A;  4CGV A;  3SO8 A;  3CHS A;  5ENP D;  3GZ1 A;  3FUF A;  4GML A;  3DSX A;  2PM7 A;  1OWP A;  5AIJ A;  4HI8 A;  4L23 A;  3OXL A;  4GZ5 A;  5FZR A;  4OVU A;  1HG5 A;  5ANL A;  2QC9 A;  4GTO A;  2OND A;  2BKG A;  3LEW A;  5FQ7 A;  2BTD A;  3AG1 E;  5KJK A;  3DEO A;  4TXP A;  2X6H A;  2OVB A;  2XGO A;  5C2Y A;  1N9A A;  4AJW A;  1BU9 A;  2LAI A;  5BXO A;  3ZFW A;  2KZT A;  3TG4 A;  1WDY A;  5ITZ F;  3MKQ A;  1OCC E;  5CCM A;  1K1B A;  2HM8 A;  3S7D A;  4MBG A;  4CRW A;  2QYJ A;  5A23 A;  3AS8 A;  2WQ6 A;  4I6G A;  4NQ0 A;  4XX5 A;  4RQI A;  2F8Y A;  2V5F A;  3SBT B;  4A55 A;  4BT9 A;  1V55 E;  2DYR E;  3QB2 A;  3CHM A;  4UQX A;  3PE4 A;  2GRQ B;  4Q96 A;  2P9I G;  2IF4 A;  4C48 B;  4F7A A;  3IXE A;  1A17 A;  3D9K A;  1H0A A;  2WVI A;  2Y3A A;  4P29 A;  4FU3 A;  1O1R A;  4WWO A;  2L9B A;  4AIF A;  1D8E A;  2RFA A;  3L82 A;  1BPO A;  3UIN C;  1Z3X A;  2V0P A;  2C2L A;  5AJL A;  1FVF A;  2QFC A;  1HO8 A;  1ZBP A;  3PZ2 A;  2Y1L E;  1TR4 A;  5LX8 A;  2A5E A;  4QFV A;  2VTB B;  2ION A;  4ANX A;  4F3V A;  2B6C A;  3LPZ A;  3CQG B;  5A7D B;  4EZL A;  4FJZ A;  4G25 A;  3ASF A;  1OY3 D;  2CHZ A;  1TNB A;  3RIB A;  2UY1 B;  1HH8 A;  1NA0 A;  3LJ3 A;  3LJN A;  2MRI A;  3SBS A;  1MHQ A;  2H6I A;  3QWW A;  1HS6 A;  3J5P A;  3FEX A;  2LUH A;  2X38 A;  3MA5 A;  4WAF A;  3RRM B;  4K5A B;  5FZS A;  1N4Q A;  2AXZ A;  4B0Z A;  3PE3 A;  5CRU A;  4DX5 D;  1BI7 B;  3FFL A;  3ULE G; 
#chains in the Genus database with same CATH homology
 3BG1 B;  4NAC A;  3VLF A;  2VGX A;  3FU3 A;  3G2S A;  2WXK A;  4IYP A;  3ASH A;  4IUL A;  4UQY A;  5G04 J;  5G04 C;  2CFU A;  2BF0 X;  3APF A;  4GA1 A;  4GZ6 A;  2J07 A;  1JWG A;  4PH4 B;  4PS3 A;  2AXU A;  4BFR A;  2FEZ A;  2I9C A;  1KT0 A;  2WM9 A;  3FTX A;  3AS4 A;  2ILR A;  2I6H A;  1OWM A;  2L0T B;  5J90 A;  3SNX A;  1H2T C;  3QAR A;  4FLH A;  2WB2 A;  4M3O A;  2IOL A;  1KLX A;  2WXP A;  3QAQ A;  3RJV A;  4XKC A;  3L17 A;  2LSU A;  2WQH A;  4HS2 A;  4MS6 A;  3ML9 A;  4CDR A;  4EBA A;  3JCK C;  2WXH A;  3FUJ A;  4KXK B;  4MRU A;  3RKV A;  2FBN A;  2WQ7 A;  2VQ2 A;  2R17 C;  5FTP A;  4GZC A;  2DCP A;  3I4G A;  3PNT B;  3FUK A;  2WXI A;  4W9R A;  4G26 A;  4AM9 A;  4RG6 A;  3ZYM A;  1GW6 A;  1WY6 A;  1H2V C;  3FU6 A;  1E90 A;  3CVP A;  4J6I A;  4U07 A;  2C0M A;  1IHG A;  2J08 A;  4LER A;  1EDU A;  3NZU A;  2VGX B;  4I17 A;  2Y4T A;  3NF1 A;  4N3C A;  1E7V A;  3CVW A;  4Y6C A;  3GW4 A;  3I5P A;  2X6J A;  4E85 A;  1FVH A;  5AJD A;  2EQX A;  5M72 A;  1ELW A;  2WXO A;  3GZS A;  1WM5 A;  2MHK A;  3CVX A;  4YVQ C;  5ARF A;  4NRH B;  4BT8 A;  3BEE A;  4TUU A;  2CFZ A;  2NSZ A;  3TXM A;  3QKY A;  3B13 A;  5E76 A;  5EKQ D;  3OXF A;  4ACL A;  4N2Q A;  3D9I A;  2J09 A;  2XGS A;  2AVP A;  3I4R B;  3LS8 A;  4DI4 A;  1ELK A;  1PY1 A;  2J4D A;  3UT8 A;  4RVB A;  2LO6 A;  3VTY A;  4TRQ A;  4EQF A;  3S2A A;  4XKB A;  2KM4 A;  3FU5 A;  3PRZ A;  1H2U A;  4FJY A;  3FH7 A;  5BW8 C;  2RD0 A;  2OVF A;  4U0S A;  3SFZ A;  4HOU A;  3L16 A;  4F1S A;  3FWV A;  3CHP A;  4J8F A;  3ZGQ A;  3APC A;  3IV0 A;  3JYS A;  3ZYK A;  2KZT B;  3U4T A;  3TGO A;  1HX8 A;  2XQ0 A;  1N54 A;  2XCC A;  4KMO A;  4OVV A;  3U66 A;  3CVV A;  4KZC A;  4GYO A;  4BTB A;  3Q4A B;  2X6I A;  3QK0 A;  5FT9 A;  3VLE A;  3KD7 A;  3JQ0 A;  3ZHE B;  5FZQ A;  3MZL B;  1INZ A;  5BT1 A;  1SZA A;  2WXJ A;  4JEU A;  3MCX A;  3R9A B;  4BWR A;  4CT4 A;  4UWK A;  3FTW A;  3HVE A;  4JA7 A;  4EBA G;  5BV0 A;  1XGW A;  1MQS A;  5AEN A;  3ESL A;  5CHE E;  1Z6T A;  2LAH A;  4UI9 K;  4AOF A;  4B8C B;  1NP7 A;  3FTZ A;  2DIW A;  2VSN A;  2X6F A;  4I9C A;  4L7T A;  2XHE A;  3HYM B;  2E2E A;  4UQZ A;  3TXN A;  3D9L A;  4CT0 A;  5C1D A;  3IHY A;  1Y8M A;  4UI9 J;  4ILH B;  4KYO B;  1OWO A;  3UMV A;  5EX0 A;  3CEQ A;  4BTA A;  4CDN A;  3SZ7 A;  2JEK A;  4I2Z A;  3QNK A;  3T5V A;  5KJN A;  5JJT A;  4PDX A;  3ZEF A;  3MGB A;  2HO1 A;  4N3B A;  4FUL A;  4DI3 A;  4WWN A;  3RO2 A;  5FQ6 A;  1NZN A;  2A5U A;  1JWF A;  3ONK A;  3B7T A;  4I1O B;  1Z3Y A;  2C0L A;  3PZD A;  4XI9 A;  4BX8 A;  2CG3 A;  1HFA A;  3B7R L;  2VGY A;  2I1K A;  2VTB A;  1IYG A;  2A4Z A;  4JXT A;  5G2N A;  4E6H A;  4G24 A;  1ZU2 A;  3KAE A;  1PC2 A;  1TJC A;  2P58 C;  1E7U A;  3PEV B;  4AEZ C;  2YIN A;  2XRY A;  4HLE A;  3FUL A;  3LY7 A;  3IEG A;  1E8X A;  5G55 A;  3CVN A;  3FEY A;  3CR3 A;  3CLJ A;  3LDZ A;  2JLB A;  3Q49 B;  4GYW A;  5FJY A;  3U9W A;  2YNQ A;  3R7Q A;  1UN8 A;  2IQC A;  3ZYQ A;  3MJW A;  2WXR A;  4GCN A;  4I43 A;  5FQ8 A;  1ELR A;  3CHQ A;  2KCL A;  3L54 A;  5ENN A;  3ULQ A;  3AU4 A;  3K9I A;  4I6E A;  4KT6 B;  4WNE A;  4KZ0 A;  5BUZ A;  2XRZ A;  3U3W A;  5HI7 A;  1X5B A;  1L5J A;  3MEK A;  5ARG A;  4JC8 A;  4GPK A;  4HOR A;  3P1U A;  3SI5 A;  4U0Z A;  3FUE A;  4B8A A;  4GA2 A;  2AW6 A;  2M63 A;  4UWG A;  3RO3 A;  1IQU A;  4C9B B;  4TV3 A;  2NXP A;  1EPU A;  3CV0 A;  4GZD A;  3D9N A;  4LCT A;  1UJK A;  3DPD A;  4G1T A;  1SQM A;  1U3C A;  4LRZ A;  5KCM A;  3ZXS A;  3RU0 A;  1DNP A;  2PZI A;  3LXU X;  3QWV A;  3PS6 A;  2YQ8 A;  1EF1 C;  4BY6 A;  3CKC A;  3CST A;  5T3R A;  4HOQ A;  4BSX A;  3MV2 B;  4FP7 A;  4HXI A;  2IJG X;  1W3B A;  3LVQ E;  3SGH A;  4IN3 B;  2HR2 A;  2PQN A;  3MKR A;  3CK7 A;  4YND A;  4WWP A;  1IQR A;  1HG2 A;  2WXQ A;  4PS8 A;  5EX3 A;  1HU3 A;  4KVM A;  2FO7 A;  1H19 A;  5KJL A;  2XPY A;  2CHW A;  3ASG A;  4G11 A;  3G2U A;  2V4L A;  5LP0 A;  3OAW A;  2WPV A;  3ZVV A;  3EHM A;  5BPP A;  2OOE A;  3O48 A;  2L0I A;  3PUK A;  1HZ4 A;  3VLD A;  1PAQ A;  2IFU A;  4BX9 A;  5HQ8 A;  3ZYL A;  3GYZ A;  4WUY A;  1UJJ A;  3KS2 A;  3MKQ B;  3TJP A;  2HYZ A;  2LSV A;  3CHR A;  4HFG A;  4I1A A;  4G23 A;  3MV3 B;  3N71 A;  4V3I A;  2Y4U A;  3Q15 A;  3HHM A;  5LCW C;  4HOT A;  4CEM A;  4YVO A;  5FQ4 A;  4ANU A;  3UPV A;  3UX4 A;  2WMN A;  3ZW3 A;  2FUL A;  4AVX A;  4Q94 A;  1HF8 A;  2VJ8 A;  5G05 C;  2KAT A;  4EZJ A;  3EIJ A;  3R7R A;  2VYI A;  2V8S E;  3P2B A;  2XCB A;  2GRM A;  2WXN A;  4EZK A;  2AWI A;  4ME2 A;  3QWP A;  3SF4 A;  4WND A;  4ATG A;  3TG5 A;  4URK A;  1QQE A;  3FHE A;  3L22 A;  3ZRH A;  3S7F A;  2Q7F A;  3B7S A;  3CIA A;  3FTU A;  3FTY A;  1E8Y A;  4JW1 A;  3FH5 A;  2XEV A;  4A3T A;  4APF A;  2NC9 A;  2IOS A;  3LY8 A;  4WNG A;  3FDH A;  3OTN A;  3E4B A;  4XE0 A;  3S7J A;  2RG8 A;  4ABN A;  4I1M A;  2VSX E;  4AXH A;  3FH8 A;  4C0M A;  1SZ9 A;  4JHJ A;  4EEC A;  1B89 A;  3ML8 A;  3RRN B;  4KBQ A;  3UT7 A;  4AP2 A;  5CMY A;  3LYA A;  2MOW A;  4GB9 A;  4I6J A;  3NQP A;  4WNF A;  3HDX A;  3ZHE A;  4LEU A;  2XPZ A;  5FWQ A;  2XGM A;  5LCW J;  3FUH A;  3MX3 A;  3G2W A;  2WMO A;  4NUR A;  2R59 A;  4MLP A;  2J4B A;  1DVP A;  1E96 B;  3DBS A;  5G05 J;  1YA0 A;  3PH0 C;  4J8D A;  5LFA A;  2PL2 A;  3TAX A;  3LY9 A;  3WXX A;  2CHX A;  2GGF A;  2KC7 A;  1FCH A;  4JA9 A;  5BV1 A;  4U04 A;  3S7B A;  4CGV A;  3CVY A;  3CHS A;  3FUN A;  3GZ1 A;  4AY5 A;  3FUF A;  4GML A;  3JQ1 A;  2PM7 A;  3CVQ A;  1OWP A;  2J9Q A;  5A6C A;  3IHV A;  3PNL B;  3HIZ A;  5AIJ A;  3G2T A;  3LVR E;  4B94 A;  4G2V A;  4DLO A;  3FUI A;  3AU5 A;  3D9P A;  3FY4 A;  1OUV A;  3ESK A;  3FUD A;  4OYS A;  1LF8 A;  2FF4 A;  1WAO 1;  3CSF A;  4K03 A;  4L23 A;  3OXL A;  4GZ5 A;  5FZR A;  4OVU A;  4AV7 A;  4U63 A;  1HG5 A;  3CK8 A;  4FA6 A;  4U8H A;  5ANL A;  5BNW A;  3IBE A;  5T4Y A;  4UI9 C;  3FTS A;  3CKB A;  2OND A;  4AY6 A;  3LEW A;  3EDT B;  5FQ7 A;  4CCA A;  2BTD A;  3EHN A;  5KJK A;  2WXG A;  3FU0 A;  2I2O A;  2DBA A;  3LCA A;  2X6H A;  4JPS A;  4PUC A;  2OVB A;  5JHA A;  2XGO A;  1S0P A;  4JHK A;  5C2Y A;  3ZN3 A;  3MYV A;  3ASD A;  4F53 A;  4GU5 A;  4FLB A;  4FHJ A;  4A1S A;  2LAI A;  4I2W A;  4AJW A;  5D0Q D;  3ZFW A;  2IU1 A;  2KZT A;  4GAA A;  5T8I A;  2PQR A;  4FHK A;  5ANR A;  3PUJ A;  2KCK A;  1OWL A;  3TG4 A;  4A1G A;  4RSY A;  3MKQ A;  4JL0 A;  4ANV A;  3UUX A;  5CCM A;  1OWN A;  2HM8 A;  4DJA A;  2UY1 A;  1TEZ A;  2WXF A;  3S7D A;  3CK9 A;  3L08 A;  3ZPJ A;  3CVU A;  3SHF A;  1JUQ A;  4PS7 A;  2XPI A;  3QJZ A;  4CRW A;  1EYH A;  2KCV A;  3NZS A;  1QZ2 A;  4UWF A;  3FUM A;  4MKT A;  4O6F A;  5A23 A;  3AS8 A;  2WQ6 A;  4I6G A;  4NQ0 A;  4XX5 A;  1U3D A;  3PVL A;  3GZ2 A;  4H7Y A;  4GMJ A;  4R7L A;  2V5F A;  3SBT B;  4A55 A;  3EIQ C;  4BT9 A;  1UG3 A;  2BUG A;  2VSY A;  4XIF A;  3QC1 A;  3D9M A;  3PDN A;  3QB2 A;  2FI7 A;  3EJN A;  4ANW A;  3CHM A;  5KJM A;  4XI0 A;  3LKU A;  1P5Q A;  4N3A A;  5JJ6 A;  4GA0 A;  3APD A;  4UQX A;  3UT4 A;  3PE4 A;  1E8W A;  3O4Z A;  4Q96 A;  3URZ A;  1H6K A;  3Q47 B;  4B89 A;  4HOS A;  2IF4 A;  4F7A A;  2AXV A;  2L6J A;  3UQ3 A;  4IRU A;  4HVB A;  1A17 A;  3CHO A;  3D9K A;  1E8Z A;  1H0A A;  2WVI A;  2Y3A A;  4P29 A;  4EPZ A;  4FAD A;  5JHB A;  3T5X A;  2J49 A;  3D3M A;  4FU3 A;  4GZ3 A;  5DBK A;  4WWO A;  3RK6 A;  2L9B A;  4AIF A;  3L13 A;  4APO A;  4L1B A;  2X6K A;  5LOZ A;  4H7X A;  3SD5 A;  1BPO A;  1N52 A;  4JVS A;  5CMW A;  2WXM A;  3JUI A;  4J8S A;  3B7U X;  1Z3X A;  4UWH A;  4ILG A;  5JJ7 A;  3ONL A;  3BG0 B;  3FTV A;  4J0U A;  2V0P A;  4N39 A;  2C2L A;  5DIZ A;  5AJL A;  1FVF A;  2QFC A;  1HO8 A;  2VSO E;  3KEZ A;  1ZBP A;  4I9E A;  4JHR A;  3ZIM A;  2PM6 A;  4A3V A;  4C0E A;  4DPR A;  1NA3 A;  1UW4 B;  5LX8 A;  4QFV A;  3L6A A;  4D10 C;  2VTB B;  4Q69 A;  2R5S A;  2ION A;  1VDY A;  4ANX A;  1QNF A;  4F3V A;  2YHE A;  3RRU A;  4N2S A;  1KT1 A;  3LPZ A;  3CVL A;  3CQG B;  4JEH A;  5A7D B;  3D9O A;  4Y6W A;  3HVE B;  3I3N A;  4JZY A;  4EZL A;  2WXL A;  3CQC B;  4ILI A;  4FJZ A;  4G25 A;  4U0U A;  4DLQ A;  2GRL A;  3ASF A;  2GW1 A;  3FP3 A;  2ZU6 B;  5AYW D;  2CHZ A;  3OXG A;  3RIB A;  4UWL A;  3QOU A;  4L2Y A;  2UY1 B;  3Q5M A;  3D9J A;  4XZ4 A;  2I1J A;  3QDN A;  2E0I A;  1HH8 A;  1NA0 A;  3LJ3 A;  4L2L A;  2MRI A;  3PRE A;  2LNI A;  2YHC A;  3U64 A;  5E75 A;  3ENE A;  3SBS A;  4CDM A;  1MHQ A;  3QWW A;  3T8M A;  1HS6 A;  3C98 A;  3FEX A;  4GCO A;  4GYY A;  3PEU B;  2QY7 A;  3CGH A;  5J08 A;  4N5C A;  4FC8 A;  4LUN U;  2OV8 A;  1TJF A;  1UN9 A;  3AS5 A;  5EDS A;  3IKO B;  4J8E A;  1HE8 A;  4ACK A;  2X38 A;  2CG2 A;  3MA5 A;  3VTX A;  1Y6I A;  4WAF A;  3RRM B;  4CGW A;  1HXI A;  2X3M A;  1XNF A;  4KVO A;  4DK5 A;  5FZS A;  5CCL A;  3TL5 A;  2AXZ A;  4B0Z A;  3PE3 A;  5D0O D;  2UWJ G;  1JPL A;  4K0R A;  3FFL A;  3G2V A;  4RG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...