1YMPA

The crystal structure of a partial mouse notch-1 ankyrin domain: repeats 4 through 7 preserve an ankyrin fold
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
131
structure length
131
Chain Sequence
RATDLDARMHDGTTPLILAARLALEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Notch 1 protein
publication title The crystal structure of a partial mouse Notch-1 ankyrin domain: repeats 4 through 7 preserve an ankyrin fold.
pubmed doi rcsb
source organism Mus musculus
total genus 41
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1ympA00
4LSZE 1MX4A 2P2CP 3V31A 4HI8A 3T8KA 4BERA 1N11A 4DX1A 3NOCD 3C5RA 1AWCB 1K3ZD 2DVWA 4HRNA 1DC2A 4QQIA 5AQ9A 4K5CA 2Y0BG 1BI8B 5BXOA 2KBXA 2QC9A 3LJNA 2VGEA 3IXEA 4F1PA 4G8LA 1UOHA 4U8VD 2XEEA 3TWTA 1YMPA 2JABA 3TWWA 1NFIE 4HRLA 4F6RD 5CEDB 3NBNB 4LNUD 5AN8A 5ENSD 2RFMA 4O1PA 1A5EA 3V79K 2V5QC 5FINA 5AQAA 4BSZB 1IHBA 1TR4A 4ATZD 3ZNGA 4ZHBA 4O60A 4A63B 3TWRA 3AJIA 2XZTG 4UUCA 4DRXE 4DUIA 3HG0D 4YDYA 2NYJA 5KNHD 1IKND 4HNAD 3EHQA 3UXGA 3TWQA 2ETAA 3W9GA 4DX5D 4K5AB 1YYHA 2KXPC 5ENTD 1BLXB 2F8YA 3NOGD 4HRMB 3DEPA 5EYPF 1MJ0A 4HB5A 3V2XA 5CECB 3Q9NC 4B93B 1N0QA 4Z68A 4HLLA 5AAOA 4DX7D 5CERB 5CBNA 3ZUVB 1K1BA 3SO8A 5ENOD 4O1OA 3UTMA 4ZFHA 2XZDG 5KWDA 1IXVA 1SVXA 3T9KA 5HS0A 1MYOA 5AQ7A 1MX6A 4DX6D 4OAVB 5ENPD 2F37A 5KBAA 2BKGA 2QYJA 1AP7A 4HQDA 4DX2A 2DZNA 3DEOA 2PNNA 3TWUA 4U95D 4U8YD 4OAUC 3TWXA 5ITZF 2ZGDA 3J5PA 1G3NB 3W9FA 3ZU7B 4GPMA 5JMND 2J8SD 3J5QB 4LG6A 2V4HC 2A5EA 3D9HA 4U96D 4J7WA 2ZGGA 4JB8P 5EIDA 4RLYA 1OY3D 3JXIA 4C48B 2B0OE 4GMRA 1OT8A 4J8YA 4QFVA 5AQBA 4BEPA 2HE0A 2F8XK 5KNGA 5JA4D 2XEHA 1BU9A 1BI7B 4NIKA 3TWVA 5BXUA 1D9SA 2ETBA 1QYMA 5EYLA 3EHRA 1N0RA 2Y1LE 4G8KA 4HBDA 2MYOA 2ETCA 3B7BA 4N5QA 3KEAA 3B95A 5CBOA 3F6QA 1S70B 1MX2A 1WG0A 3JXJA 3UI2A 5CEAA 3JUEA 3HRAA 2DWZA 1K1AA 3EU9A 4YDWA 5D66A 5AARA 3TWSA 4CZ2D 5EILA 2RFAA 5EN5D 4BETA 4CYMD 2FO1E 2DZOA 1BD8A 3V30A 1DCQA 4BESA 5HKPA 3ZKJA 2AJAA 1SW6A 3Q9UC 5FIOA 4HI9A 2XENA 4TUMA 1WDYA 2BKKB 2L6BA 5ENQD 3V2OA 5EIBE 5HRYA 5ENRD 3AAAC 4K5BA 1YCSB
chains in the Genus database with same CATH superfamily
4JC8A 3ULYA 3PNTB 4H7XA 1HE8A 4EBAG 2KBXA 3TGOA 3EU5A 5FTPA 4JZYA 5KCMA 5FQ6A 5A7DB 2HR2A 2R59A 4GTSA 4BWRA 1YA0A 3FUDA 5AENA 2GW1A 3TG5A 4WUYA 2IU1A 4OYSA 2XRYA 4U8HA 3DPDA 4ME2A 4UWHA 1MJ0A 3SFXA 3EHNA 2WPVA 5EX0A 2DCPA 4M3OA 1JUQA 5IY5E 3CLJA 3EJNA 3ABKE 4FHKA 3CSTA 3QWVA 3ZFWA 2XPZA 5ENPD 2IOLA 4EPZA 5T8IA 3SQVA 2QYJA 4HQDA 4A1SA 3MKRA 4GB9A 4U95D 2J8SD 3DBSA 2CHWA 1OCZE 4NIKA 4Q69A 3E4BA 1N4PA 1SA4A 5A6CA 3DSVA 3JUEA 2GRQB 1K1AA 3AG1E 3E34A 4BETA 3B7RL 5LX8A 3CKBA 3Q9UC 5EIBE 3IKOB 3ASNE 1YCSB 3ZHEB 3PZ4A 4L9PA 3Q15A 2WVIA 2I1JA 1DC2A 3ASHA 2KCLA 3KD7A 4AY6A 4L7TA 1PY1A 2IO3C 5JHBA 2EILE 5CMWA 3Q79A 1NFIE 1EPUA 5LOZA 3PZ2A 5KJMA 2WXIA 4EZKA 4ZHBA 4O60A 4DUIA 3RRMB 1Q2ZA 1Z3YA 3EHQA 1TJCA 3WG7E 2GRLA 4TV3A 3VLEA 5EYPF 5CECB 5B1BE 4KMOA 5BNWA 1E8YA 3AS8A 5ANRA 5CBNA 3ZUVB 3ML9A 3ISMC 3Q4AB 1GW6A 3ULEG 2XZDG 2LXMA 1TYQG 4A3VA 3C3OA 4IN3B 5C1DA 3DEOA 4U8YD 2P9UG 1FVHA 3Q47B 3FHEA 5G04C 2X6IA 1ZBPA 1OY3D 1FT1A 3QNKA 4BEPA 2HE0A 2F8XK 2XGSA 4XZ4A 3OXLA 5BXUA 3L13A 5HI7A 4HOUA 3PZDA 4F1SA 3KS2A 4G8KA 2ETCA 1OWNA 3IHYA 2GRMA 2BTDA 3KAEA 3ZHEA 3BQOA 1DCEA 2AXVA 3B13A 4I17A 1RW2A 4DK5A 4PS3A 5LCWC 4XIFA 5BW8C 3P2BA 3UT4A 4GA2A 4L1BA 5DIZA 4I2WA 3NOCD 3SZ7A 1O1RA 5KJLA 1INZA 3GW4A 4JEUA 3D9MA 2WXOA 2H6IA 2CFUA 3LJNA 3IXEA 1O5MA 5AYWD 5CCLA 5FJYA 4BSXA 3UMVA 4A63B 2ONDA 3HG0D 5KNHD 3ONKA 2EIME 2OVFA 4J8DA 3LDZA 4D10C 3NOGD 3V2XA 3CHSA 2R5SA 1E7VA 3UM3A 4DX7D 3LJ3A 4BT8A 5E75A 5FT9A 3VTYA 4KZCA 3UINC 3VLFA 1SVXA 3T9KA 3CVVA 1HO8A 2XRZA 1LF8A 4BFRA 2J49A 1E8WA 1FT2A 3CEQA 3ZU7B 4XEIG 3FULA 4A3TA 2A5EA 2R03A 3JXIA 2XHEA 1NL4A 5JA4D 1KT0A 1H2VC 4TXRA 4ACLA 3G2VA 4E6HA 4GCNA 3T5XA 4HORA 1D8DA 3U64A 3DPYA 1UW4B 3JQ0A 3C72A 3FWVA 4HI9A 5H7PA 3S7FA 4JEHA 2V8SE 3ABME 5D0QD 1MX4A 3DSWA 2C0MA 3ML8A 3MKQA 4MBGA 1ZB1A 3GZ1A 4L23A 3TL5A 4N39A 4IYPA 2WXLA 4JHKA 4Y6WA 2AXUA 3LY9A 3FTVA 1U3DA 5BV1A 1DVPA 5CEDB 1NA3A 5AN8A 3DRAA 2RFMA 2PQRA 3FDHA 1A5EA 3UIPC 3LKUA 1UJJA 4JPSA 4B89A 3UM2A 3SBSA 3ASDA 4JA7A 3TAXA 3FUEA 4LERA 3PVLA 4UWKA 4YDEA 3ESLA 3SHFA 5BPPA 2FEZA 1WAO1 3KSLA 2IF4A 3LEWA 3LCAA 3CGHA 2J09A 2XCCA 4I6JA 3L6AA 1H2UA 2XS8A 1E8XA 4TXPA 4DPRA 5ITZF 4PS7A 2V4HC 5EIDA 4ANXA 1Y6IA 4GA1A 4AV7A 5AQBA 1S63A 2ZIRA 4GTVA 2VSOE 3X2QE 2I6HA 5C2YA 4B0ZA 5G2NA 5AIJA 5EN5D 3NAWA 2X6KA 5FIOA 3PREA 3Q78A 1WDYA 4MRUA 3LYAA 4KVMA 2P9IG 4K5BA 2VQ2A 4BX8A 3CHQA 4N3CA 2VGXB 3DWLG 4I1AA 2OCCE 3D9LA 3FTSA 3TWTA 3SI5A 4Q94A 5FINA 4XI0A 4YVOA 1IHBA 1S64A 2XCBA 4DRXE 2MHKA 4HNAD 3TWQA 4GTMA 5ENTD 3D9IA 2LO6A 4YDOA 3Q73A 4I9EA 5AAOA 3RAUA 1KLXA 1TNUA 3OXGA 3ZYLA 5EDSA 4O1OA 2J4DA 5EX3A 4I9CA 2R2LA 4ILIA 1EYHA 3UUXA 2F37A 4F53A 3FY4A 3CHPA 1IHGA 3TWUA 3QWWA 4AP2A 2OEWA 2WXKA 5FZRA 1OT8A 3CVNA 2UY1B 4GZDA 4HFGA 1D9SA 2I2OA 4TUUA 1OXJA 4WNEA 2WB2A 5M72A 3JCKC 3FUHA 3NZSA 4YDWA 1TNOA 2OEVA 2X6FA 1K8KG 2DZOA 4BESA 3CK7A 2EIKE 1SW6A 4XKCA 2VGXA 4UWFA 4CDMA 4UQYA 3FEXA 3DSXA 4PS8A 4WWPA 3HXDA 1HG2A 1U2VG 5AJLA 4GYWA 3DSUA 4LEUA 4EZJA 4FC8A 3ESKA 3LXUX 1ELKA 1SA5A 2L0TB 2XGOA 4F6RD 3NBNB 3LY7A 3E32A 1SZAA 2YQ8A 4B94A 2AXZA 3HDXA 1IKND 3W9GA 3FUMA 2I1KA 3U9WA 3ASOE 2VJ8A 5FQ7A 4DLQA 4DI3A 1IQUA 3UT8A 2Y3AA 1IXVA 2XGMA 4GZ5A 3O48A 1MX6A 2A4ZA 3HYMB 3RJVA 2PL2A 4XE0A 2UY1A 4KT6B 4XKBA 1N4RA 5T3RA 3UT7A 4G25A 3B7TA 3J5QB 4N3BA 3Q5MA 2XPIA 1N4SA 2H6GA 4U96D 4I6GA 2ZGGA 1OWMA 3VTXA 4GMRA 1N94A 3DXMG 2ETBA 2MYOA 4JW1A 3FP3A 3JQ1A 4WNDA 1N4QA 4FJZA 5AARA 3SY2A 1KT1A 1BD8A 4GYOA 1DCQA 3RSEG 2AJAA 4OVVA 3AAAC 3FUKA 3C5RA 4DI4A 5B1AE 2F0YA 3DSTA 3I4GA 2A5UA 3CVQA 3R9AB 2VGEA 4U8VD 2ZXWE 1E7UA 4LNUD 4RSYA 2X38A 5AQAA 2XZTG 4N2SA 4GPKA 2P58C 3UKRG 4UI9K 3FH8A 4K5AB 2KXPC 4AVXA 3ZYQA 4B93B 3Q75A 4BTAA 3MV3B 3RU0A 3QJZA 3KEZA 3FTUA 4C0EA 3E30A 5HQ8A 1ELWA 1OCOE 4B8AA 3FU5A 4YVQC 2VTBB 4OVUA 4K03A 4IRUA 2M63A 5FQ4A 3L82A 3QARA 3FTXA 4J8YA 2Y4TA 1HF8A 4HBDA 3BUAA 3B7BA 1S70B 1MX2A 1JCSA 3UI2A 4WAFA 4P29A 2WQ7A 3EU9A 4CGWA 5BUZA 1O1SA 5CHEE 3V30A 5D0OD 2XPYA 4UWGA 3RIBA 2PM6A 1E8ZA 4HRNA 2OOEA 4JHRA 5AQ9A 4B8CB 4G26A 4ANWA 2WMOA 4HRLA 3V79K 1H6KA 5G04J 4BSZB 2VSYA 3N71A 3TWRA 2QYUA 3EUVA 2NYJA 2V0PA 2CHXA 3ZXSA 3QC1A 5FQ8A 1JCQA 5CERB 3S7BA 2VTBA 4CDRA 3SNXA 1UG3A 5J90A 3MKQB 5ENOD 3RRUA 5LCWJ 2IQCA 4DX6D 3CHRA 3CK8A 4I43A 3L22A 4GU5A 4HOTA 3PNLB 3Q7AA 2BF0X 3CHOA 2J9QA 2E0IA 2QFCA 1OUVA 4H7YA 3J5PA 3D9HA 1D8EA 4GMLA 3AG3E 4PH4B 4F3VA 2ZU6B 1E90A 4GZ3A 3EHRA 2IO2C 3MCXA 3R9MA 2RD0A 1LD8A 2RFAA 3QDNA 3GZ2A 5FZQA 3MYVA 2WQHA 4HLEA 2GROB 2WMNA 2XENA 3FUFA 3EIQC 3MZLB 1TJFA 2L9BA 1RZ4A 2LSVA 3TWVA 4LSZE 4R7LA 4HI8A 1N11A 2PZIA 4NRHB 2LSUA 2YHCA 2JEKA 3FU6A 4AIFA 5BXOA 4LRZA 3D9KA 5CCMA 2H6FA 1YMPA 4J8EA 2WM9A 4L2LA 3FTYA 4ATZD 3RKVA 3UX4A 3ZXPA 4UUCA 3PZ1A 3CIAA 3FH5A 3I5PA 2ETAA 2HO1A 2F8YA 4CGVA 2YINA 3ONLA 1B89A 3K9IA 1FPPA 4GTOA 4FA6A 1FVFA 3ZYMA 4JXTA 2FI7A 5BT1A 4FU3A 3SBTB 5HS0A 3PH0C 1XGWA 4AEZC 4LNBA 1PAQA 5JJ6A 4OAUC 5ARFA 1SQMA 2ZGDA 3EIJA 4A1GA 1UN9A 4GPMA 4NURA 4LG6A 3TG4A 5LFAA 3RO3A 4URKA 4RLYA 1P5QA 4C48B 2P9PG 3OTNA 4HOQA 4AOFA 2EINE 4O6FA 2Y69E 5EYLA 1ZU2A 3CVXA 3U66A 4ANVA 3F6QA 4ANUA 5LP0A 2OV8A 3HIZA 4CZ2D 2IY0C 4X8QA 2JLBA 1H2TC 4TUMA 4I2ZA 2XQ0A 2L6BA 3FU0A 3VLDA 2X6JA 2P2CP 3T8KA 2V5FA 2X3MA 3MX3A 2CFZA 4TRQA 1OCRE 3HVEB 3G2UA 2Q7FA 3ZNGA 3CVYA 2P9SG 2WXQA 1HZ4A 4A55A 3CK9A 4APOA 5G55A 3FU3A 3WXXA 3QWPA 3E37A 5EKQD 3OAWA 1N0QA 4HXIA 3HXCA 3L16A 1UJKA 3ASGA 2UWJG 4GYYA 4AJWA 4YNDA 2IEJA 3B7SA 4GTPA 2KCVA 1LTXA 3BEEA 3T8MA 2PM7A 1HX8A 1N54A 3URZA 3G2WA 1JWFA 1OWOA 2BKGA 2FULA 3BG1B 5JMND 2VSXE 1N52A 2KCKA 5BV0A 3UQ3A 3G2SA 3AU5A 4J6IA 1TEZA 2IJGX 1HU3A 3CVPA 3MV2B 4JL0A 1Z6TA 4MLPA 4KXKB 3BU8A 2VYIA 5A23A 2Y4UA 5JJTA 4N2QA 4N5CA 2J07A 4DX1A 1FCHA 3HVEA 1LD7A 2DVWA 4UI9C 3FTZA 2DYSE 4K5CA 1BI8B 3IHVA 3PEVB 4J8SA 2WXHA 1X5BA 4ACKA 2V4LA 2EQXA 1DNPA 4MKTA 3UM0A 1OWLA 3RK6A 3Q7FA 1TN7A 5G05C 2J08A 4FJYA 3SO8A 5KJKA 3S7DA 4AM9A 3D3MA 3D9NA 4WNFA 4HVBA 4C9BB 3UIOC 2WXRA 4E85A 4FADA 2H6HA 5J08A 2DZNA 2L6JA 3APCA 3NF1A 4J0UA 2KZTB 2MOWA 3AS5A 3SGHA 4UWLA 2LAHA 4N5QA 3I4RB 3ZYKA 1XNFA 1L5JA 1O1TA 4J8FA 1HXIA 3IBEA 4AY5A 5FWQA 2BKKB 4U63A 3FFLA 3AU4A 4BERA 4I1OB 3CVLA 3TJPA 3MJWA 2AWIA 4F7AA 2YHEA 2WXJA 3BG0B 2R17C 3GZSA 4FP7A 3SFYA 5CRVA 4Q96A 4GAAA 3ZN3A 4ATGA 3ZPJA 3ZW3A 3AG4E 1KPSB 3AG2E 4KYOB 2IONA 1N95A 1E96B 3U4TA 4EBAA 4CEMA 3FEYA 3UXGA 3S2AA 4DX5D 2FF4A 2AVPA 1HS6A 2P9KG 2IFUA 3HXEA 1HG5A 1V54E 3R7QA 1K1BA 3SD5A 2ILRA 3MA5A 2XEVA 3PDNA 3UPVA 4GTQA 2WXNA 4CCAA 4UQZA 2KZTA 1MYOA 1OCCE 5KJNA 3ZVVA 1H0AA 5KBAA 1Z5SC 3NB2A 3QK0A 4FLHA 3W9FA 5B3SE 3LVRE 4FHJA 1TNZA 3EHMA 4JB8P 1BPOA 4Y6CA 1JCRA 3HXBA 2Y1LE 4G1TA 2GRRB 2DYRE 1OWPA 3JXJA 3C3RA 4G24A 3FH7A 3PE4A 2DBAA 3ZKJA 4U0SA 3CVWA 5ENQD 4LCTA 4U7EB 3PUJA 2GRPB 1K3ZD 3U3WA 2CHZA 4CT4A 4DLOA 3ASFA 3MGBA 2Y0BG 4EECA 3NQPA 4F1PA 4G8LA 4U0ZA 5ENSD 4O1PA 1U3CA 3ULQA 1TR4A 1MZCA 4YDYA 3FUNA 1BLXB 3QB2A 2CG2A 3MEKA 1HFAA 1TN8A 2VGYA 2FBNA 4W9RA 4UQXA 4LUNU 2C2LA 5DBKA 4GZ6A 1HH8A 5T4YA 3TWXA 4WWOA 1G3NB 4AXHA 4HOSA 3APFA 5JHAA 3AS4A 3RO2A 2ZISA 3L08A 2RKKA 3B95A 4JVSA 4I6EA 2E2EA 2R05A 5CRUA 1QZ2A 5D2MC 1KZOA 3V2OA 3KSQA 4ILGA 4EQFA 4RQIA 3QKYA 4HLLA 2C0LA 4PDXA 4U07A 4K0RA 4BTBA 3PEUB 3HHMA 4ILHB 4JD2G 1UOHA 4BT9A 2JABA 3TWWA 3ZGQA 3PE3A 2RG8A 3ZIMA 1NA0A 3QOUA 4FLBA 3L9TA 4EZLA 4G2VA 4WNGA 3LVQE 3D9OA 3Q9NC 2GRNB 2HYZA 4RG9A 3B7UX 3D9PA 4GCOA 2J4BA 1W3BA 5AQ7A 1WM5A 1A17A 4OAVB 2KM4A 4G11A 4FULA 4C0MA 1AP7A 2P9NG 4DX2A 2PQNA 3CQGB 4M7CA 3CKCA 1N9AA 4U0UA 3LS8A 4J7WA 1IQRA 2BEDA 5KNGA 3CV0A 2EIJE 2XEHA 3ZEFA 4DJAA 3Q49B 1ELRA 1N0RA 3IEGA 4V3IA 2GGFA 5E76A 3KEAA 1QQEA 5CBOA 4GTTA 2KC7A 2WXGA 1QNFA 2DWZA 1H6OA 4KVOA 2FO1E 5HKPA 2MRIA 2WXFA 2LNIA 4GZCA 5HRYA 1MQSA 4TXQA 3V31A 2NSZA 3NZUA 1AWCB 2WQ6A 1KZPA 4HS2A 2NXPA 2AW6A 3L54A 2OVBA 2P9LG 2XEEA 4GMJA 2V5QC 3TXMA 2HM8A 3L17A 4JHJA 2YNQA 1PC2A 3AJIA 2LUHA 4JA9A 3DEPA 4HB5A 4XI9A 2LAIA 4Z68A 3PUKA 4U04A 2IOSA 4EHMA 4BY6A 4GA0A 3I3NA 5KWDA 3CQCB 1TNYA 3DXKG 4LNGA 3FUJA 4NACA 4L2YA 3C3QA 4CRWA 1TNBA 3CR3A 5JJ7A 2B6CA 4BX9A 2B0OE 3LY8A 2WXPA 5ENNA 3R7RA 1QYMA 1V55E 4I1MA 3CVUA 3ABLE 5CEAA 3DSSA 5D66A 3TWSA 4NQ0A 3JYSA 5EILA 4CYMD 2WXMA 4PUCA 3D9JA 3PS6A 5ENRD 1NP7A 4CDNA 3QAQA 3T5VA 3RRNB 1QBQA 1NI1A 3CSFA 2I9CA 4ABNA 2FO7A 2DIWA 4QQIA 2BUGA 3EDTB 2QC9A 2NC9A 3ZRHA 1TN6A 3OXFA 4CT0A 4RG6A 2X6HA 4MS6A 1UN8A 2XS1A 4G23A 4KZ0A 3SF4A 3FUIA 4KBQA 5FZSA 3ENEA 1JWGA 2R02A 2L0IA 1YYHA 2QY7A 1SZ9A 2KATA 3C98A 4HRMB 3PZ3A 1VDYA 3APDA 4GTRA 1WY6A 3G2TA 1H6PA 3UTMA 4ZFHA 3UKUG 1JPLA 1Z3XA 3CHMA 3FTWA 5ARGA 2LXLA 3S7JA 3UM1A 3IV0A 2PNNA 4UI9J 4XX5A 2VSNA 2CG3A 2QZAA 5CMYA 1EF1C 1H19A 4QFVA 1BU9A 1BI7B 1MHQA 1Y8MA 3E33A 1X81A 3LPZA 5ANLA 1EDUA 3PRZA 1WG0A 4RVBA 3HRAA 4WWNA 1IYGA 3HXFA 3SFZA 1S0PA 1NZNA 5AJDA 3GYZA 4APFA 3P1UA 3JUIA 3O4ZA 4N3AA 3TXNA 5G05J 4IULA
chains in the Genus database with same CATH topology
4LSZE 1MX4A 2P2CP 3V31A 4HI8A 3T8KA 4BERA 1N11A 4DX1A 3NOCD 3C5RA 1AWCB 1K3ZD 2DVWA 4HRNA 1DC2A 4QQIA 5AQ9A 4K5CA 2Y0BG 1BI8B 5BXOA 2KBXA 2QC9A 3LJNA 2VGEA 3IXEA 4F1PA 4G8LA 1UOHA 4U8VD 2XEEA 3TWTA 1YMPA 2JABA 3TWWA 1NFIE 4HRLA 4F6RD 5CEDB 3NBNB 4LNUD 5AN8A 5ENSD 2RFMA 4O1PA 1A5EA 3V79K 2V5QC 5FINA 5AQAA 4BSZB 1IHBA 1TR4A 4ATZD 3ZNGA 4ZHBA 4O60A 4A63B 3TWRA 3AJIA 2XZTG 4UUCA 4DRXE 4DUIA 3HG0D 4YDYA 2NYJA 5KNHD 1IKND 4HNAD 3EHQA 3UXGA 3TWQA 2ETAA 3W9GA 4DX5D 4K5AB 1YYHA 2KXPC 5ENTD 1BLXB 2F8YA 3NOGD 4HRMB 3DEPA 5EYPF 1MJ0A 4HB5A 3V2XA 5CECB 3Q9NC 4B93B 1N0QA 4Z68A 4HLLA 5AAOA 4DX7D 5CERB 5CBNA 3ZUVB 1K1BA 3SO8A 5ENOD 4O1OA 3UTMA 4ZFHA 2XZDG 5KWDA 1IXVA 1SVXA 3T9KA 5HS0A 1MYOA 5AQ7A 1MX6A 4DX6D 4OAVB 5ENPD 2F37A 5KBAA 2BKGA 2QYJA 1AP7A 4HQDA 4DX2A 2DZNA 3DEOA 2PNNA 3TWUA 4U95D 4U8YD 4OAUC 3TWXA 5ITZF 2ZGDA 3J5PA 1G3NB 3W9FA 3ZU7B 4GPMA 5JMND 2J8SD 3J5QB 4LG6A 2V4HC 2A5EA 3D9HA 4U96D 4J7WA 2ZGGA 4JB8P 5EIDA 4RLYA 1OY3D 3JXIA 4C48B 2B0OE 4GMRA 1OT8A 4J8YA 4QFVA 5AQBA 4BEPA 2HE0A 2F8XK 5KNGA 5JA4D 2XEHA 1BU9A 1BI7B 4NIKA 3TWVA 5BXUA 1D9SA 2ETBA 1QYMA 5EYLA 3EHRA 1N0RA 2Y1LE 4G8KA 4HBDA 2MYOA 2ETCA 3B7BA 4N5QA 3KEAA 3B95A 5CBOA 3F6QA 1S70B 1MX2A 1WG0A 3JXJA 3UI2A 5CEAA 3JUEA 3HRAA 2DWZA 1K1AA 3EU9A 4YDWA 5D66A 5AARA 3TWSA 4CZ2D 5EILA 2RFAA 5EN5D 4BETA 4CYMD 2FO1E 2DZOA 1BD8A 3V30A 1DCQA 4BESA 5HKPA 3ZKJA 2AJAA 1SW6A 3Q9UC 5FIOA 4HI9A 2XENA 4TUMA 1WDYA 2BKKB 2L6BA 5ENQD 3V2OA 5EIBE 5HRYA 5ENRD 3AAAC 4K5BA 1YCSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LSZ E;  1MX4 A;  2P2C P;  3V31 A;  4HI8 A;  3T8K A;  4BER A;  1N11 A;  4DX1 A;  3NOC D;  3C5R A;  1AWC B;  1K3Z D;  2DVW A;  4HRN A;  1DC2 A;  4QQI A;  5AQ9 A;  4K5C A;  2Y0B G;  1BI8 B;  5BXO A;  2KBX A;  2QC9 A;  3LJN A;  2VGE A;  3IXE A;  4F1P A;  4G8L A;  1UOH A;  4U8V D;  2XEE A;  3TWT A;  1YMP A;  2JAB A;  3TWW A;  1NFI E;  4HRL A;  4F6R D;  5CED B;  3NBN B;  4LNU D;  5AN8 A;  5ENS D;  2RFM A;  4O1P A;  1A5E A;  3V79 K;  2V5Q C;  5FIN A;  5AQA A;  4BSZ B;  1IHB A;  1TR4 A;  4ATZ D;  3ZNG A;  4ZHB A;  4O60 A;  4A63 B;  3TWR A;  3AJI A;  2XZT G;  4UUC A;  4DRX E;  4DUI A;  3HG0 D;  4YDY A;  2NYJ A;  5KNH D;  1IKN D;  4HNA D;  3EHQ A;  3UXG A;  3TWQ A;  2ETA A;  3W9G A;  4DX5 D;  4K5A B;  1YYH A;  2KXP C;  5ENT D;  1BLX B;  2F8Y A;  3NOG D;  4HRM B;  3DEP A;  5EYP F;  1MJ0 A;  4HB5 A;  3V2X A;  5CEC B;  3Q9N C;  4B93 B;  1N0Q A;  4Z68 A;  4HLL A;  5AAO A;  4DX7 D;  5CER B;  5CBN A;  3ZUV B;  1K1B A;  3SO8 A;  5ENO D;  4O1O A;  3UTM A;  4ZFH A;  2XZD G;  5KWD A;  1IXV A;  1SVX A;  3T9K A;  5HS0 A;  1MYO A;  5AQ7 A;  1MX6 A;  4DX6 D;  4OAV B;  5ENP D;  2F37 A;  5KBA A;  2BKG A;  2QYJ A;  1AP7 A;  4HQD A;  4DX2 A;  2DZN A;  3DEO A;  2PNN A;  3TWU A;  4U95 D;  4U8Y D;  4OAU C;  3TWX A;  5ITZ F;  2ZGD A;  3J5P A;  1G3N B;  3W9F A;  3ZU7 B;  4GPM A;  5JMN D;  2J8S D;  3J5Q B;  4LG6 A;  2V4H C;  2A5E A;  3D9H A;  4U96 D;  4J7W A;  2ZGG A;  4JB8 P;  5EID A;  4RLY A;  1OY3 D;  3JXI A;  4C48 B;  2B0O E;  4GMR A;  1OT8 A;  4J8Y A;  4QFV A;  5AQB A;  4BEP A;  2HE0 A;  2F8X K;  5KNG A;  5JA4 D;  2XEH A;  1BU9 A;  1BI7 B;  4NIK A;  3TWV A;  5BXU A;  1D9S A;  2ETB A;  1QYM A;  5EYL A;  3EHR A;  1N0R A;  2Y1L E;  4G8K A;  4HBD A;  2MYO A;  2ETC A;  3B7B A;  4N5Q A;  3KEA A;  3B95 A;  5CBO A;  3F6Q A;  1S70 B;  1MX2 A;  1WG0 A;  3JXJ A;  3UI2 A;  5CEA A;  3JUE A;  3HRA A;  2DWZ A;  1K1A A;  3EU9 A;  4YDW A;  5D66 A;  5AAR A;  3TWS A;  4CZ2 D;  5EIL A;  2RFA A;  5EN5 D;  4BET A;  4CYM D;  2FO1 E;  2DZO A;  1BD8 A;  3V30 A;  1DCQ A;  4BES A;  5HKP A;  3ZKJ A;  2AJA A;  1SW6 A;  3Q9U C;  5FIO A;  4HI9 A;  2XEN A;  4TUM A;  1WDY A;  2BKK B;  2L6B A;  5ENQ D;  3V2O A;  5EIB E;  5HRY A;  5ENR D;  3AAA C;  4K5B A;  1YCS B; 
#chains in the Genus database with same CATH topology
 4JC8 A;  3ULY A;  3PNT B;  4H7X A;  1HE8 A;  4EBA G;  2KBX A;  3TGO A;  3EU5 A;  5FTP A;  4JZY A;  5KCM A;  5FQ6 A;  5A7D B;  2HR2 A;  2R59 A;  4GTS A;  4BWR A;  1YA0 A;  3FUD A;  5AEN A;  2GW1 A;  3TG5 A;  4WUY A;  2IU1 A;  4OYS A;  2XRY A;  4U8H A;  3DPD A;  4ME2 A;  4UWH A;  1MJ0 A;  3SFX A;  3EHN A;  2WPV A;  5EX0 A;  2DCP A;  4M3O A;  1JUQ A;  5IY5 E;  3CLJ A;  3EJN A;  3ABK E;  4FHK A;  3CST A;  3QWV A;  3ZFW A;  2XPZ A;  5ENP D;  2IOL A;  4EPZ A;  5T8I A;  3SQV A;  2QYJ A;  4HQD A;  4A1S A;  3MKR A;  4GB9 A;  4U95 D;  2J8S D;  3DBS A;  2CHW A;  1OCZ E;  4NIK A;  4Q69 A;  3E4B A;  1N4P A;  1SA4 A;  5A6C A;  3DSV A;  3JUE A;  2GRQ B;  1K1A A;  3AG1 E;  3E34 A;  4BET A;  3B7R L;  5LX8 A;  3CKB A;  3Q9U C;  5EIB E;  3IKO B;  3ASN E;  1YCS B;  3ZHE B;  3PZ4 A;  4L9P A;  3Q15 A;  2WVI A;  2I1J A;  1DC2 A;  3ASH A;  2KCL A;  3KD7 A;  4AY6 A;  4L7T A;  1PY1 A;  2IO3 C;  5JHB A;  2EIL E;  5CMW A;  3Q79 A;  1NFI E;  1EPU A;  5LOZ A;  3PZ2 A;  5KJM A;  2WXI A;  4EZK A;  4ZHB A;  4O60 A;  4DUI A;  3RRM B;  1Q2Z A;  1Z3Y A;  3EHQ A;  1TJC A;  3WG7 E;  2GRL A;  4TV3 A;  3VLE A;  5EYP F;  5CEC B;  5B1B E;  4KMO A;  5BNW A;  1E8Y A;  3AS8 A;  5ANR A;  5CBN A;  3ZUV B;  3ML9 A;  3ISM C;  3Q4A B;  1GW6 A;  3ULE G;  2XZD G;  2LXM A;  1TYQ G;  4A3V A;  3C3O A;  4IN3 B;  5C1D A;  3DEO A;  4U8Y D;  2P9U G;  1FVH A;  3Q47 B;  3FHE A;  5G04 C;  2X6I A;  1ZBP A;  1OY3 D;  1FT1 A;  3QNK A;  4BEP A;  2HE0 A;  2F8X K;  2XGS A;  4XZ4 A;  3OXL A;  5BXU A;  3L13 A;  5HI7 A;  4HOU A;  3PZD A;  4F1S A;  3KS2 A;  4G8K A;  2ETC A;  1OWN A;  3IHY A;  2GRM A;  2BTD A;  3KAE A;  3ZHE A;  3BQO A;  1DCE A;  2AXV A;  3B13 A;  4I17 A;  1RW2 A;  4DK5 A;  4PS3 A;  5LCW C;  4XIF A;  5BW8 C;  3P2B A;  3UT4 A;  4GA2 A;  4L1B A;  5DIZ A;  4I2W A;  3NOC D;  3SZ7 A;  1O1R A;  5KJL A;  1INZ A;  3GW4 A;  4JEU A;  3D9M A;  2WXO A;  2H6I A;  2CFU A;  3LJN A;  3IXE A;  1O5M A;  5AYW D;  5CCL A;  5FJY A;  4BSX A;  3UMV A;  4A63 B;  2OND A;  3HG0 D;  5KNH D;  3ONK A;  2EIM E;  2OVF A;  4J8D A;  3LDZ A;  4D10 C;  3NOG D;  3V2X A;  3CHS A;  2R5S A;  1E7V A;  3UM3 A;  4DX7 D;  3LJ3 A;  4BT8 A;  5E75 A;  5FT9 A;  3VTY A;  4KZC A;  3UIN C;  3VLF A;  1SVX A;  3T9K A;  3CVV A;  1HO8 A;  2XRZ A;  1LF8 A;  4BFR A;  2J49 A;  1E8W A;  1FT2 A;  3CEQ A;  3ZU7 B;  4XEI G;  3FUL A;  4A3T A;  2A5E A;  2R03 A;  3JXI A;  2XHE A;  1NL4 A;  5JA4 D;  1KT0 A;  1H2V C;  4TXR A;  4ACL A;  3G2V A;  4E6H A;  4GCN A;  3T5X A;  4HOR A;  1D8D A;  3U64 A;  3DPY A;  1UW4 B;  3JQ0 A;  3C72 A;  3FWV A;  4HI9 A;  5H7P A;  3S7F A;  4JEH A;  2V8S E;  3ABM E;  5D0Q D;  1MX4 A;  3DSW A;  2C0M A;  3ML8 A;  3MKQ A;  4MBG A;  1ZB1 A;  3GZ1 A;  4L23 A;  3TL5 A;  4N39 A;  4IYP A;  2WXL A;  4JHK A;  4Y6W A;  2AXU A;  3LY9 A;  3FTV A;  1U3D A;  5BV1 A;  1DVP A;  5CED B;  1NA3 A;  5AN8 A;  3DRA A;  2RFM A;  2PQR A;  3FDH A;  1A5E A;  3UIP C;  3LKU A;  1UJJ A;  4JPS A;  4B89 A;  3UM2 A;  3SBS A;  3ASD A;  4JA7 A;  3TAX A;  3FUE A;  4LER A;  3PVL A;  4UWK A;  4YDE A;  3ESL A;  3SHF A;  5BPP A;  2FEZ A;  1WAO 1;  3KSL A;  2IF4 A;  3LEW A;  3LCA A;  3CGH A;  2J09 A;  2XCC A;  4I6J A;  3L6A A;  1H2U A;  2XS8 A;  1E8X A;  4TXP A;  4DPR A;  5ITZ F;  4PS7 A;  2V4H C;  5EID A;  4ANX A;  1Y6I A;  4GA1 A;  4AV7 A;  5AQB A;  1S63 A;  2ZIR A;  4GTV A;  2VSO E;  3X2Q E;  2I6H A;  5C2Y A;  4B0Z A;  5G2N A;  5AIJ A;  5EN5 D;  3NAW A;  2X6K A;  5FIO A;  3PRE A;  3Q78 A;  1WDY A;  4MRU A;  3LYA A;  4KVM A;  2P9I G;  4K5B A;  2VQ2 A;  4BX8 A;  3CHQ A;  4N3C A;  2VGX B;  3DWL G;  4I1A A;  2OCC E;  3D9L A;  3FTS A;  3TWT A;  3SI5 A;  4Q94 A;  5FIN A;  4XI0 A;  4YVO A;  1IHB A;  1S64 A;  2XCB A;  4DRX E;  2MHK A;  4HNA D;  3TWQ A;  4GTM A;  5ENT D;  3D9I A;  2LO6 A;  4YDO A;  3Q73 A;  4I9E A;  5AAO A;  3RAU A;  1KLX A;  1TNU A;  3OXG A;  3ZYL A;  5EDS A;  4O1O A;  2J4D A;  5EX3 A;  4I9C A;  2R2L A;  4ILI A;  1EYH A;  3UUX A;  2F37 A;  4F53 A;  3FY4 A;  3CHP A;  1IHG A;  3TWU A;  3QWW A;  4AP2 A;  2OEW A;  2WXK A;  5FZR A;  1OT8 A;  3CVN A;  2UY1 B;  4GZD A;  4HFG A;  1D9S A;  2I2O A;  4TUU A;  1OXJ A;  4WNE A;  2WB2 A;  5M72 A;  3JCK C;  3FUH A;  3NZS A;  4YDW A;  1TNO A;  2OEV A;  2X6F A;  1K8K G;  2DZO A;  4BES A;  3CK7 A;  2EIK E;  1SW6 A;  4XKC A;  2VGX A;  4UWF A;  4CDM A;  4UQY A;  3FEX A;  3DSX A;  4PS8 A;  4WWP A;  3HXD A;  1HG2 A;  1U2V G;  5AJL A;  4GYW A;  3DSU A;  4LEU A;  4EZJ A;  4FC8 A;  3ESK A;  3LXU X;  1ELK A;  1SA5 A;  2L0T B;  2XGO A;  4F6R D;  3NBN B;  3LY7 A;  3E32 A;  1SZA A;  2YQ8 A;  4B94 A;  2AXZ A;  3HDX A;  1IKN D;  3W9G A;  3FUM A;  2I1K A;  3U9W A;  3ASO E;  2VJ8 A;  5FQ7 A;  4DLQ A;  4DI3 A;  1IQU A;  3UT8 A;  2Y3A A;  1IXV A;  2XGM A;  4GZ5 A;  3O48 A;  1MX6 A;  2A4Z A;  3HYM B;  3RJV A;  2PL2 A;  4XE0 A;  2UY1 A;  4KT6 B;  4XKB A;  1N4R A;  5T3R A;  3UT7 A;  4G25 A;  3B7T A;  3J5Q B;  4N3B A;  3Q5M A;  2XPI A;  1N4S A;  2H6G A;  4U96 D;  4I6G A;  2ZGG A;  1OWM A;  3VTX A;  4GMR A;  1N94 A;  3DXM G;  2ETB A;  2MYO A;  4JW1 A;  3FP3 A;  3JQ1 A;  4WND A;  1N4Q A;  4FJZ A;  5AAR A;  3SY2 A;  1KT1 A;  1BD8 A;  4GYO A;  1DCQ A;  3RSE G;  2AJA A;  4OVV A;  3AAA C;  3FUK A;  3C5R A;  4DI4 A;  5B1A E;  2F0Y A;  3DST A;  3I4G A;  2A5U A;  3CVQ A;  3R9A B;  2VGE A;  4U8V D;  2ZXW E;  1E7U A;  4LNU D;  4RSY A;  2X38 A;  5AQA A;  2XZT G;  4N2S A;  4GPK A;  2P58 C;  3UKR G;  4UI9 K;  3FH8 A;  4K5A B;  2KXP C;  4AVX A;  3ZYQ A;  4B93 B;  3Q75 A;  4BTA A;  3MV3 B;  3RU0 A;  3QJZ A;  3KEZ A;  3FTU A;  4C0E A;  3E30 A;  5HQ8 A;  1ELW A;  1OCO E;  4B8A A;  3FU5 A;  4YVQ C;  2VTB B;  4OVU A;  4K03 A;  4IRU A;  2M63 A;  5FQ4 A;  3L82 A;  3QAR A;  3FTX A;  4J8Y A;  2Y4T A;  1HF8 A;  4HBD A;  3BUA A;  3B7B A;  1S70 B;  1MX2 A;  1JCS A;  3UI2 A;  4WAF A;  4P29 A;  2WQ7 A;  3EU9 A;  4CGW A;  5BUZ A;  1O1S A;  5CHE E;  3V30 A;  5D0O D;  2XPY A;  4UWG A;  3RIB A;  2PM6 A;  1E8Z A;  4HRN A;  2OOE A;  4JHR A;  5AQ9 A;  4B8C B;  4G26 A;  4ANW A;  2WMO A;  4HRL A;  3V79 K;  1H6K A;  5G04 J;  4BSZ B;  2VSY A;  3N71 A;  3TWR A;  2QYU A;  3EUV A;  2NYJ A;  2V0P A;  2CHX A;  3ZXS A;  3QC1 A;  5FQ8 A;  1JCQ A;  5CER B;  3S7B A;  2VTB A;  4CDR A;  3SNX A;  1UG3 A;  5J90 A;  3MKQ B;  5ENO D;  3RRU A;  5LCW J;  2IQC A;  4DX6 D;  3CHR A;  3CK8 A;  4I43 A;  3L22 A;  4GU5 A;  4HOT A;  3PNL B;  3Q7A A;  2BF0 X;  3CHO A;  2J9Q A;  2E0I A;  2QFC A;  1OUV A;  4H7Y A;  3J5P A;  3D9H A;  1D8E A;  4GML A;  3AG3 E;  4PH4 B;  4F3V A;  2ZU6 B;  1E90 A;  4GZ3 A;  3EHR A;  2IO2 C;  3MCX A;  3R9M A;  2RD0 A;  1LD8 A;  2RFA A;  3QDN A;  3GZ2 A;  5FZQ A;  3MYV A;  2WQH A;  4HLE A;  2GRO B;  2WMN A;  2XEN A;  3FUF A;  3EIQ C;  3MZL B;  1TJF A;  2L9B A;  1RZ4 A;  2LSV A;  3TWV A;  4LSZ E;  4R7L A;  4HI8 A;  1N11 A;  2PZI A;  4NRH B;  2LSU A;  2YHC A;  2JEK A;  3FU6 A;  4AIF A;  5BXO A;  4LRZ A;  3D9K A;  5CCM A;  2H6F A;  1YMP A;  4J8E A;  2WM9 A;  4L2L A;  3FTY A;  4ATZ D;  3RKV A;  3UX4 A;  3ZXP A;  4UUC A;  3PZ1 A;  3CIA A;  3FH5 A;  3I5P A;  2ETA A;  2HO1 A;  2F8Y A;  4CGV A;  2YIN A;  3ONL A;  1B89 A;  3K9I A;  1FPP A;  4GTO A;  4FA6 A;  1FVF A;  3ZYM A;  4JXT A;  2FI7 A;  5BT1 A;  4FU3 A;  3SBT B;  5HS0 A;  3PH0 C;  1XGW A;  4AEZ C;  4LNB A;  1PAQ A;  5JJ6 A;  4OAU C;  5ARF A;  1SQM A;  2ZGD A;  3EIJ A;  4A1G A;  1UN9 A;  4GPM A;  4NUR A;  4LG6 A;  3TG4 A;  5LFA A;  3RO3 A;  4URK A;  4RLY A;  1P5Q A;  4C48 B;  2P9P G;  3OTN A;  4HOQ A;  4AOF A;  2EIN E;  4O6F A;  2Y69 E;  5EYL A;  1ZU2 A;  3CVX A;  3U66 A;  4ANV A;  3F6Q A;  4ANU A;  5LP0 A;  2OV8 A;  3HIZ A;  4CZ2 D;  2IY0 C;  4X8Q A;  2JLB A;  1H2T C;  4TUM A;  4I2Z A;  2XQ0 A;  2L6B A;  3FU0 A;  3VLD A;  2X6J A;  2P2C P;  3T8K A;  2V5F A;  2X3M A;  3MX3 A;  2CFZ A;  4TRQ A;  1OCR E;  3HVE B;  3G2U A;  2Q7F A;  3ZNG A;  3CVY A;  2P9S G;  2WXQ A;  1HZ4 A;  4A55 A;  3CK9 A;  4APO A;  5G55 A;  3FU3 A;  3WXX A;  3QWP A;  3E37 A;  5EKQ D;  3OAW A;  1N0Q A;  4HXI A;  3HXC A;  3L16 A;  1UJK A;  3ASG A;  2UWJ G;  4GYY A;  4AJW A;  4YND A;  2IEJ A;  3B7S A;  4GTP A;  2KCV A;  1LTX A;  3BEE A;  3T8M A;  2PM7 A;  1HX8 A;  1N54 A;  3URZ A;  3G2W A;  1JWF A;  1OWO A;  2BKG A;  2FUL A;  3BG1 B;  5JMN D;  2VSX E;  1N52 A;  2KCK A;  5BV0 A;  3UQ3 A;  3G2S A;  3AU5 A;  4J6I A;  1TEZ A;  2IJG X;  1HU3 A;  3CVP A;  3MV2 B;  4JL0 A;  1Z6T A;  4MLP A;  4KXK B;  3BU8 A;  2VYI A;  5A23 A;  2Y4U A;  5JJT A;  4N2Q A;  4N5C A;  2J07 A;  4DX1 A;  1FCH A;  3HVE A;  1LD7 A;  2DVW A;  4UI9 C;  3FTZ A;  2DYS E;  4K5C A;  1BI8 B;  3IHV A;  3PEV B;  4J8S A;  2WXH A;  1X5B A;  4ACK A;  2V4L A;  2EQX A;  1DNP A;  4MKT A;  3UM0 A;  1OWL A;  3RK6 A;  3Q7F A;  1TN7 A;  5G05 C;  2J08 A;  4FJY A;  3SO8 A;  5KJK A;  3S7D A;  4AM9 A;  3D3M A;  3D9N A;  4WNF A;  4HVB A;  4C9B B;  3UIO C;  2WXR A;  4E85 A;  4FAD A;  2H6H A;  5J08 A;  2DZN A;  2L6J A;  3APC A;  3NF1 A;  4J0U A;  2KZT B;  2MOW A;  3AS5 A;  3SGH A;  4UWL A;  2LAH A;  4N5Q A;  3I4R B;  3ZYK A;  1XNF A;  1L5J A;  1O1T A;  4J8F A;  1HXI A;  3IBE A;  4AY5 A;  5FWQ A;  2BKK B;  4U63 A;  3FFL A;  3AU4 A;  4BER A;  4I1O B;  3CVL A;  3TJP A;  3MJW A;  2AWI A;  4F7A A;  2YHE A;  2WXJ A;  3BG0 B;  2R17 C;  3GZS A;  4FP7 A;  3SFY A;  5CRV A;  4Q96 A;  4GAA A;  3ZN3 A;  4ATG A;  3ZPJ A;  3ZW3 A;  3AG4 E;  1KPS B;  3AG2 E;  4KYO B;  2ION A;  1N95 A;  1E96 B;  3U4T A;  4EBA A;  4CEM A;  3FEY A;  3UXG A;  3S2A A;  4DX5 D;  2FF4 A;  2AVP A;  1HS6 A;  2P9K G;  2IFU A;  3HXE A;  1HG5 A;  1V54 E;  3R7Q A;  1K1B A;  3SD5 A;  2ILR A;  3MA5 A;  2XEV A;  3PDN A;  3UPV A;  4GTQ A;  2WXN A;  4CCA A;  4UQZ A;  2KZT A;  1MYO A;  1OCC E;  5KJN A;  3ZVV A;  1H0A A;  5KBA A;  1Z5S C;  3NB2 A;  3QK0 A;  4FLH A;  3W9F A;  5B3S E;  3LVR E;  4FHJ A;  1TNZ A;  3EHM A;  4JB8 P;  1BPO A;  4Y6C A;  1JCR A;  3HXB A;  2Y1L E;  4G1T A;  2GRR B;  2DYR E;  1OWP A;  3JXJ A;  3C3R A;  4G24 A;  3FH7 A;  3PE4 A;  2DBA A;  3ZKJ A;  4U0S A;  3CVW A;  5ENQ D;  4LCT A;  4U7E B;  3PUJ A;  2GRP B;  1K3Z D;  3U3W A;  2CHZ A;  4CT4 A;  4DLO A;  3ASF A;  3MGB A;  2Y0B G;  4EEC A;  3NQP A;  4F1P A;  4G8L A;  4U0Z A;  5ENS D;  4O1P A;  1U3C A;  3ULQ A;  1TR4 A;  1MZC A;  4YDY A;  3FUN A;  1BLX B;  3QB2 A;  2CG2 A;  3MEK A;  1HFA A;  1TN8 A;  2VGY A;  2FBN A;  4W9R A;  4UQX A;  4LUN U;  2C2L A;  5DBK A;  4GZ6 A;  1HH8 A;  5T4Y A;  3TWX A;  4WWO A;  1G3N B;  4AXH A;  4HOS A;  3APF A;  5JHA A;  3AS4 A;  3RO2 A;  2ZIS A;  3L08 A;  2RKK A;  3B95 A;  4JVS A;  4I6E A;  2E2E A;  2R05 A;  5CRU A;  1QZ2 A;  5D2M C;  1KZO A;  3V2O A;  3KSQ A;  4ILG A;  4EQF A;  4RQI A;  3QKY A;  4HLL A;  2C0L A;  4PDX A;  4U07 A;  4K0R A;  4BTB A;  3PEU B;  3HHM A;  4ILH B;  4JD2 G;  1UOH A;  4BT9 A;  2JAB A;  3TWW A;  3ZGQ A;  3PE3 A;  2RG8 A;  3ZIM A;  1NA0 A;  3QOU A;  4FLB A;  3L9T A;  4EZL A;  4G2V A;  4WNG A;  3LVQ E;  3D9O A;  3Q9N C;  2GRN B;  2HYZ A;  4RG9 A;  3B7U X;  3D9P A;  4GCO A;  2J4B A;  1W3B A;  5AQ7 A;  1WM5 A;  1A17 A;  4OAV B;  2KM4 A;  4G11 A;  4FUL A;  4C0M A;  1AP7 A;  2P9N G;  4DX2 A;  2PQN A;  3CQG B;  4M7C A;  3CKC A;  1N9A A;  4U0U A;  3LS8 A;  4J7W A;  1IQR A;  2BED A;  5KNG A;  3CV0 A;  2EIJ E;  2XEH A;  3ZEF A;  4DJA A;  3Q49 B;  1ELR A;  1N0R A;  3IEG A;  4V3I A;  2GGF A;  5E76 A;  3KEA A;  1QQE A;  5CBO A;  4GTT A;  2KC7 A;  2WXG A;  1QNF A;  2DWZ A;  1H6O A;  4KVO A;  2FO1 E;  5HKP A;  2MRI A;  2WXF A;  2LNI A;  4GZC A;  5HRY A;  1MQS A;  4TXQ A;  3V31 A;  2NSZ A;  3NZU A;  1AWC B;  2WQ6 A;  1KZP A;  4HS2 A;  2NXP A;  2AW6 A;  3L54 A;  2OVB A;  2P9L G;  2XEE A;  4GMJ A;  2V5Q C;  3TXM A;  2HM8 A;  3L17 A;  4JHJ A;  2YNQ A;  1PC2 A;  3AJI A;  2LUH A;  4JA9 A;  3DEP A;  4HB5 A;  4XI9 A;  2LAI A;  4Z68 A;  3PUK A;  4U04 A;  2IOS A;  4EHM A;  4BY6 A;  4GA0 A;  3I3N A;  5KWD A;  3CQC B;  1TNY A;  3DXK G;  4LNG A;  3FUJ A;  4NAC A;  4L2Y A;  3C3Q A;  4CRW A;  1TNB A;  3CR3 A;  5JJ7 A;  2B6C A;  4BX9 A;  2B0O E;  3LY8 A;  2WXP A;  5ENN A;  3R7R A;  1QYM A;  1V55 E;  4I1M A;  3CVU A;  3ABL E;  5CEA A;  3DSS A;  5D66 A;  3TWS A;  4NQ0 A;  3JYS A;  5EIL A;  4CYM D;  2WXM A;  4PUC A;  3D9J A;  3PS6 A;  5ENR D;  1NP7 A;  4CDN A;  3QAQ A;  3T5V A;  3RRN B;  1QBQ A;  1NI1 A;  3CSF A;  2I9C A;  4ABN A;  2FO7 A;  2DIW A;  4QQI A;  2BUG A;  3EDT B;  2QC9 A;  2NC9 A;  3ZRH A;  1TN6 A;  3OXF A;  4CT0 A;  4RG6 A;  2X6H A;  4MS6 A;  1UN8 A;  2XS1 A;  4G23 A;  4KZ0 A;  3SF4 A;  3FUI A;  4KBQ A;  5FZS A;  3ENE A;  1JWG A;  2R02 A;  2L0I A;  1YYH A;  2QY7 A;  1SZ9 A;  2KAT A;  3C98 A;  4HRM B;  3PZ3 A;  1VDY A;  3APD A;  4GTR A;  1WY6 A;  3G2T A;  1H6P A;  3UTM A;  4ZFH A;  3UKU G;  1JPL A;  1Z3X A;  3CHM A;  3FTW A;  5ARG A;  2LXL A;  3S7J A;  3UM1 A;  3IV0 A;  2PNN A;  4UI9 J;  4XX5 A;  2VSN A;  2CG3 A;  2QZA A;  5CMY A;  1EF1 C;  1H19 A;  4QFV A;  1BU9 A;  1BI7 B;  1MHQ A;  1Y8M A;  3E33 A;  1X81 A;  3LPZ A;  5ANL A;  1EDU A;  3PRZ A;  1WG0 A;  4RVB A;  3HRA A;  4WWN A;  1IYG A;  3HXF A;  3SFZ A;  1S0P A;  1NZN A;  5AJD A;  3GYZ A;  4APF A;  3P1U A;  3JUI A;  3O4Z A;  4N3A A;  3TXN A;  5G05 J;  4IUL A; 
#chains in the Genus database with same CATH homology
 4LSZ E;  1MX4 A;  2P2C P;  3V31 A;  4HI8 A;  3T8K A;  4BER A;  1N11 A;  4DX1 A;  3NOC D;  3C5R A;  1AWC B;  1K3Z D;  2DVW A;  4HRN A;  1DC2 A;  4QQI A;  5AQ9 A;  4K5C A;  2Y0B G;  1BI8 B;  5BXO A;  2KBX A;  2QC9 A;  3LJN A;  2VGE A;  3IXE A;  4F1P A;  4G8L A;  1UOH A;  4U8V D;  2XEE A;  3TWT A;  1YMP A;  2JAB A;  3TWW A;  1NFI E;  4HRL A;  4F6R D;  5CED B;  3NBN B;  4LNU D;  5AN8 A;  5ENS D;  2RFM A;  4O1P A;  1A5E A;  3V79 K;  2V5Q C;  5FIN A;  5AQA A;  4BSZ B;  1IHB A;  1TR4 A;  4ATZ D;  3ZNG A;  4ZHB A;  4O60 A;  4A63 B;  3TWR A;  3AJI A;  2XZT G;  4UUC A;  4DRX E;  4DUI A;  3HG0 D;  4YDY A;  2NYJ A;  5KNH D;  1IKN D;  4HNA D;  3EHQ A;  3UXG A;  3TWQ A;  2ETA A;  3W9G A;  4DX5 D;  4K5A B;  1YYH A;  2KXP C;  5ENT D;  1BLX B;  2F8Y A;  3NOG D;  4HRM B;  3DEP A;  5EYP F;  1MJ0 A;  4HB5 A;  3V2X A;  5CEC B;  3Q9N C;  4B93 B;  1N0Q A;  4Z68 A;  4HLL A;  5AAO A;  4DX7 D;  5CER B;  5CBN A;  3ZUV B;  1K1B A;  3SO8 A;  5ENO D;  4O1O A;  3UTM A;  4ZFH A;  2XZD G;  5KWD A;  1IXV A;  1SVX A;  3T9K A;  5HS0 A;  1MYO A;  5AQ7 A;  1MX6 A;  4DX6 D;  4OAV B;  5ENP D;  2F37 A;  5KBA A;  2BKG A;  2QYJ A;  1AP7 A;  4HQD A;  4DX2 A;  2DZN A;  3DEO A;  2PNN A;  3TWU A;  4U95 D;  4U8Y D;  4OAU C;  3TWX A;  5ITZ F;  2ZGD A;  3J5P A;  1G3N B;  3W9F A;  3ZU7 B;  4GPM A;  5JMN D;  2J8S D;  3J5Q B;  4LG6 A;  2V4H C;  2A5E A;  3D9H A;  4U96 D;  4J7W A;  2ZGG A;  4JB8 P;  5EID A;  4RLY A;  1OY3 D;  3JXI A;  4C48 B;  2B0O E;  4GMR A;  1OT8 A;  4J8Y A;  4QFV A;  5AQB A;  4BEP A;  2HE0 A;  2F8X K;  5KNG A;  5JA4 D;  2XEH A;  1BU9 A;  1BI7 B;  4NIK A;  3TWV A;  5BXU A;  1D9S A;  2ETB A;  1QYM A;  5EYL A;  3EHR A;  1N0R A;  2Y1L E;  4G8K A;  4HBD A;  2MYO A;  2ETC A;  3B7B A;  4N5Q A;  3KEA A;  3B95 A;  5CBO A;  3F6Q A;  1S70 B;  1MX2 A;  1WG0 A;  3JXJ A;  3UI2 A;  5CEA A;  3JUE A;  3HRA A;  2DWZ A;  1K1A A;  3EU9 A;  4YDW A;  5D66 A;  5AAR A;  3TWS A;  4CZ2 D;  5EIL A;  2RFA A;  5EN5 D;  4BET A;  4CYM D;  2FO1 E;  2DZO A;  1BD8 A;  3V30 A;  1DCQ A;  4BES A;  5HKP A;  3ZKJ A;  2AJA A;  1SW6 A;  3Q9U C;  5FIO A;  4HI9 A;  2XEN A;  4TUM A;  1WDY A;  2BKK B;  2L6B A;  5ENQ D;  3V2O A;  5EIB E;  5HRY A;  5ENR D;  3AAA C;  4K5B A;  1YCS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...