1BU9A

Solution structure of p18-ink4c, 21 structures
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
168
structure length
168
Chain Sequence
b'MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYCLIN-DEPENDENT KINASE 6 INHIBITOR)
publication title Tumor suppressor INK4: determination of the solution structure of p18INK4C and demonstration of the functional significance of loops in p18INK4C and p16INK4A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 38
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 1998-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1bu9A00
4HBDA 2F8XK 1K1BA 4O1PA 4HRLA 2DVWA 3ZKJA 1MX6A 1QYMA 5ENSD 2B0OE 1NFIE 5FIOA 4YDWA 5HKPA 2MYOA 2V5QC 1DCQA 2V4HC 3J5QB 1SVXA 3F6QA 3JXIA 4HB5A 3TWXA 3TWQA 1K3ZD 5KNHD 1YMPA 3AJIA 2BKGA 1SW6A 4U96D 3ZUVB 4O1OA 5BXOA 5KWDA 5CERB 4BSZB 4DUIA 5EILA 1K1AA 4N5QA 4HNAD 5CEDB 5AN8A 1N11A 2Y0BG 4HLLA 4OAUC 1S70B 5AQBA 4K5AB 1G3NB 4HI9A 2HE0A 1MJ0A 1OY3D 3NOGD 2J8SD 4HRNA 4B93B 2F37A 3C5RA 5HS0A 5KNGA 5BXUA 1BU9A 1BD8A 1OT8A 4LG6A 4OAVB 4JB8P 4QQIA 4J8YA 3UXGA 4F1PA 4BETA 1BLXB 3DEOA 5CBOA 2ZGGA 3KEAA 1IXVA 5KBAA 4QFVA 4K5CA 1WDYA 2ETAA 4F6RD 5AQ9A 3AAAC 4DX1A 1YYHA 2QYJA 3TWRA 1N0RA 4NIKA 5EN5D 3V30A 2Y1LE 3EHRA 1D9SA 4ZHBA 5CEAA 3V2XA 5CBNA 3UI2A 2XEEA 1UOHA 2NYJA 2QC9A 2XENA 5EYPF 3W9FA 4G8KA 4BESA 3D9HA 5EYLA 3TWVA 1YCSB 2RFAA 1MX2A 4G8LA 1AWCB 3TWUA 1MX4A 3W9GA 4ATZD 2XZTG 3SO8A 3EHQA 5D66A 5CECB 4CZ2D 4GMRA 2DZOA 2KXPC 5FINA 1WG0A 1AP7A 4RLYA 3TWWA 5JMND 2ETCA 4TUMA 5ENTD 3Q9NC 5AARA 4YDYA 4K5BA 5AAOA 4BEPA 3T8KA 3DEPA 5ENRD 3V31A 4UUCA 4DX2A 4LSZE 5AQ7A 3B95A 1BI7B 4Z68A 3V79K 3IXEA 4DX6D 2VGEA 3T9KA 2DZNA 5AQAA 2L6BA 3EU9A 3JXJA 3UTMA 1IHBA 2XZDG 4U8VD 4DRXE 3NBNB 4GPMA 3TWTA 2ETBA 4HI8A 4J7WA 3Q9UC 1IKND 2AJAA 1BI8B 2BKKB 2PNNA 5EIDA 4DX7D 4ZFHA 2DWZA 4U95D 4HQDA 3B7BA 3HG0D 2FO1E 5ENQD 4C48B 5ITZF 5EIBE 4U8YD 3LJNA 1N0QA 4DX5D 2A5EA 4HRMB 2P2CP 3J5PA 5HRYA 1DC2A 3ZNGA 1A5EA 1TR4A 2JABA 3JUEA 3V2OA 2F8YA 4CYMD 4O60A 5JA4D 2XEHA 5ENOD 3ZU7B 5ENPD 3TWSA 3HRAA 2RFMA 4BERA 3NOCD 2ZGDA 2KBXA 4LNUD 4A63B 1MYOA
chains in the Genus database with same CATH superfamily
4NURA 4YDEA 4ATGA 2ZISA 3G2UA 4U96D 3D9JA 1K1AA 2Y0BG 1O1SA 4JHJA 4HI9A 4J8SA 2F37A 3L9TA 3TL5A 3U64A 3URZA 1E8ZA 3TAXA 1TN7A 4CCAA 3EIQC 5FQ4A 1S0PA 4WNDA 1ELWA 1KPSB 5FQ8A 2IF4A 3CK7A 2C2LA 2LO6A 3HIZA 4BESA 3D9MA 3CSFA 3SQVA 1OCOE 5EYLA 1HF8A 3GZSA 3DSVA 1FPPA 3APCA 2WXKA 4UWHA 3Q9NC 3T8KA 5AQ7A 3BG1B 4DJAA 5BV0A 3RKVA 2P9KG 1OWLA 2WXFA 5T4YA 2GGFA 3JYSA 3D9KA 2LXMA 5A7DB 3FU5A 2FF4A 1N52A 2R17C 4JXTA 1E8YA 3CVPA 2Y4TA 2I1KA 3V2OA 3LEWA 4U0UA 3KSQA 2P9SG 4EHMA 1TN8A 1N4QA 3RRUA 3LPZA 3FFLA 2VGXB 4G26A 4N3CA 5G2NA 4CRWA 4F1SA 1ELRA 3JXIA 1Z6TA 3PZ4A 4DK5A 4GTOA 3S7BA 4N5QA 5KJKA 3PUKA 1G3NB 3ZEFA 2Q7FA 2PQNA 4OAVB 3TG5A 3FH5A 3L13A 1SA5A 4L2LA 3JQ1A 1RW2A 5HQ8A 2ETAA 2X6HA 4DX1A 2X6FA 3PVLA 1MZCA 1EF1C 4KXKB 3AS8A 2NYJA 3TWVA 4JA9A 2XZTG 4W9RA 2E0IA 5A23A 4OVUA 3E33A 2KXPC 4RLYA 4TUMA 1TNBA 3CHQA 4AV7A 2WXGA 3Q75A 4LSZE 4BY6A 4RSYA 1A17A 4BSXA 3WXXA 3FH8A 3IHVA 4G23A 3QWWA 2GRNB 3FU3A 2BKKB 3FUHA 5AYWD 4YNDA 4U95D 3D9OA 2AW6A 3ASGA 4GA1A 2ZXWE 3CVLA 1TR4A 3C98A 5KJLA 2IY0C 3ZU7B 4GTQA 1FVHA 5DBKA 4FP7A 2RFMA 4ANVA 4A63B 3UMVA 4PDXA 3UM1A 4J8EA 4PUCA 4HOTA 2ZU6B 3NF1A 2DIWA 3S7FA 4EBAG 2EQXA 4HB5A 3ZUVB 3N71A 4FJZA 1X81A 1TNYA 2QYUA 4GAAA 1MJ0A 4C0MA 3PZ3A 2EILE 1OT8A 4GB9A 1NZNA 2ONDA 4UWKA 4CDNA 2MHKA 5B1BE 1NL4A 5C1DA 1OCZE 2QZAA 4FLHA 3AS4A 3NZSA 1KT1A 2EIJE 3MX3A 2QC9A 4FA6A 4N39A 1H0AA 3QC1A 3JQ0A 4GYYA 1TNUA 3CVNA 1AP7A 3TWWA 4IRUA 3HDXA 4GZ3A 1E7UA 4Z68A 3FTVA 4IN3B 2XZDG 3CV0A 3QOUA 4PS8A 1H2TC 3IV0A 2XPZA 4CEMA 5ENQD 5AENA 3FU6A 3EU5A 2E2EA 5BUZA 4F7AA 3E34A 4PH4B 2J4DA 4APFA 3HRAA 3NOCD 3PNTB 2IQCA 2RKKA 2LSVA 3DPYA 2F8XK 2XHEA 2WXRA 1NFIE 4YDWA 3SHFA 1HH8A 2MYOA 2YINA 3I4RB 1QZ2A 1UJJA 3ABLE 3RAUA 4XKBA 2IOLA 3Q4AB 3AJIA 3DSWA 3SF4A 2CHZA 3CR3A 1S70B 1PC2A 3CHOA 4ME2A 1W3BA 2X3MA 5HS0A 3CK9A 3CSTA 4BT8A 4E85A 4H7YA 4F53A 1H19A 3DEOA 4D10C 5AQ9A 1S63A 3ML8A 3FP3A 3UT8A 2WXQA 2R02A 4U07A 4B89A 2XEVA 3BQOA 2X38A 4GA0A 3PEUB 4EQFA 3QARA 1NA3A 3PNLB 2P9IG 5BV1A 4I9EA 5KJNA 3V79K 2J07A 3IXEA 4DX6D 3AG3E 1PAQA 2P9LG 1QQEA 2HM8A 3UQ3A 5D0QD 5EIDA 5EIBE 3CKCA 4YVOA 4DX5D 4HRMB 4H7XA 2GRQB 5FTPA 5ENPD 3CVYA 1IQUA 3LY7A 4WAFA 5HKPA 3ZXSA 1DCQA 3ULEG 1O1RA 4MLPA 1WAO1 3CHSA 3MJWA 4DUIA 1SQMA 4L9PA 2IO2C 4OAUC 3B7TA 2RD0A 5G05C 4B93B 5FZQA 3C5RA 4LUNU 3BU8A 2WM9A 3MKRA 3QNKA 3G2TA 4BFRA 1FVFA 4A1SA 2FULA 4K5CA 4LNGA 3TWRA 5EN5D 1D9SA 4G1TA 3PE4A 3D9HA 1S64A 3LVQE 1AWCB 3UUXA 3EHQA 1O1TA 1HZ4A 3RSEG 4URKA 3LY9A 2L6JA 3CVUA 3RJVA 4BEPA 5IY5E 1N4PA 3LCAA 3FULA 4G2VA 2R03A 3UT7A 2DZNA 4BTAA 2WXIA 3Q78A 4FC8A 1DCEA 4BTBA 2CG2A 4I17A 4A55A 3HHMA 4I1AA 4NQ0A 3L82A 2PNNA 2WQHA 2QFCA 1U2VG 3FUNA 4UWLA 5BW8C 5T8IA 3CKBA 3SY2A 3LYAA 4ILIA 3ZYQA 2P58C 4HLEA 3QWVA 2LXLA 4WWNA 4GZDA 2VJ8A 3SNXA 1MYOA 3EUVA 4U8HA 4O1PA 4HRLA 3FUKA 2OVBA 1UW4B 2B0OE 3TG4A 1N95A 5KNHD 4I6JA 5CERB 1N11A 3VLEA 2XCBA 5H7PA 4KBQA 4KYOB 1U3DA 2UY1A 1N9AA 1OWOA 3ZGQA 4O6FA 3ZHEB 4QFVA 3LS8A 4C0EA 1D8DA 3FH7A 1MHQA 1IHGA 2BEDA 3FHEA 4LRZA 5A6CA 2WXLA 4UQXA 4LNBA 3W9GA 4JVSA 1FT1A 3LJ3A 3SBTB 3MA5A 4GMRA 3C3QA 2WQ7A 2UWJG 5KJMA 1TNOA 3B95A 4I2ZA 3C3OA 1BI7B 1XNFA 1OCRE 3G2WA 1H6PA 3JXJA 4M7CA 4DI3A 2X6JA 3MZLB 4HI8A 4J7WA 2UY1B 3FU0A 4L1BA 3IBEA 3MCXA 2KZTA 3B7BA 4B94A 3CLJA 3ONKA 4U8YD 1GW6A 1SZ9A 2VGXA 3ISMC 2WXMA 3WG7E 3G2SA 4ANWA 2LNIA 3QAQA 3TWSA 3T8MA 2EIME 1OWPA 3SFYA 5ANLA 4PS3A 3MV3B 2AXUA 2Y4UA 5FQ6A 2XRYA 2NC9A 5AIJA 5LX8A 3ZRHA 5BXOA 5KWDA 3JUIA 4O1OA 1EDUA 5E76A 2Y69E 3KD7A 5EILA 2GRLA 3CQGB 3HXBA 4IYPA 5AQBA 4CT0A 2HE0A 4N3BA 3ASFA 4JD2G 4TXPA 5BXUA 2KZTB 4BX8A 3FTWA 1OWNA 5AJDA 2I1JA 4ACKA 3ZIMA 2FO7A 2J08A 2GW1A 5CRVA 4ANXA 4UWFA 5JMND 3CIAA 3ZXPA 5CMWA 5AARA 4CGWA 4JPSA 4XX5A 1MQSA 3UKUG 3S7JA 5EKQD 3NBNB 1UG3A 1U3CA 4GTRA 3Q9UC 2AJAA 3CVVA 4J0UA 2IFUA 1JPLA 2X6KA 3OXGA 5B1AE 5EX0A 2HYZA 4J8FA 2R59A 5JA4D 1H6OA 1LD7A 3L17A 4KVOA 2YQ8A 3ZKJA 5ENSD 5FJYA 4BWRA 2H6HA 1KT0A 1LD8A 4ABNA 3B7UX 2PZIA 4AIFA 2NSZA 3Q79A 4HNAD 2A4ZA 3P1UA 2DCPA 2P9PG 3ONLA 4RG9A 4UI9J 2PL2A 4EZLA 3AU4A 4FHJA 4I1OB 2F0YA 4F1PA 3UKRG 4I43A 3E4BA 2PQRA 1N0RA 3PZDA 4GMJA 3V2XA 2DBAA 4L2YA 5FZRA 2CHWA 1MX2A 2RFAA 5G55A 2WXOA 2GRRB 3IEGA 2QY7A 2MRIA 1WY6A 4G24A 4GTSA 1HG5A 2FBNA 3TXNA 2AXVA 2WXHA 4DRXE 2J49A 3CVWA 3CHRA 2J09A 3ENEA 3KAEA 1HG2A 2VGYA 4GTVA 4ILHB 3FY4A 4HFGA 2JABA 3MKQA 5ENNA 4O60A 1N94A 2XEHA 4PS7A 3GZ2A 3LDZA 4F3VA 4L23A 1HXIA 1TJFA 5EDSA 3ZN3A 3R9MA 4U04A 2DVWA 1MX6A 3U9WA 4MRUA 2L0TB 3J5QB 1K3ZD 1YMPA 4KT6B 5B3SE 2OEWA 2XS8A 3FUDA 3T5VA 3EIJA 4U0SA 2YHCA 4OYSA 4GTPA 3EHNA 2H6IA 4AP2A 4QQIA 4CGVA 3EJNA 2J4BA 3MKQB 3ASDA 5JJ7A 1HX8A 4ZHBA 5CEAA 3RU0A 2VSOE 5FT9A 3GZ1A 4E6HA 4AM9A 5EX3A 3FUJA 2ZIRA 5D2MC 1E7VA 2DZOA 5G04J 5ENTD 5G05J 4EBAA 4I1MA 4K5BA 4WWOA 3L54A 3HYMB 5FQ7A 2L6BA 3EU9A 4ANUA 4NRHB 4GPMA 4HXIA 2XS1A 5ARFA 4RVBA 1OCCE 1BPOA 1H2VC 2I6HA 3R9AB 1HFAA 2VQ2A 2X6IA 4WUYA 3J5PA 3PH0C 4JL0A 2WXNA 5ENOD 2VSYA 3UT4A 3C3RA 3PEVB 2IO3C 3APDA 3UPVA 2IJGX 2V8SE 3O4ZA 4BSZB 4ILGA 3LVRE 3NZUA 1WM5A 4MBGA 3CK8A 3ULYA 4CT4A 4K5AB 1KZPA 3SFZA 2YHEA 1IQRA 3D9LA 2WMOA 4JW1A 4FU3A 4KZCA 3NAWA 1INZA 2KM4A 4J8YA 3UXGA 1IYGA 2KATA 4FJYA 3VTXA 1WDYA 4GZCA 5CMYA 4XI9A 5LCWC 5JJTA 2IEJA 1TYQG 3TWUA 1V54E 2ILRA 5J08A 2ETCA 3RO3A 2XPYA 2CHXA 3ZW3A 3PREA 5ANRA 4EPZA 3ABKE 1JWFA 4XEIG 2Y3AA 4J8DA 3TWTA 4APOA 4ZFHA 3DBSA 4HOUA 3HG0D 3RRMB 4AJWA 2GROB 1DC2A 3HXFA 5D0OD 4AEZC 4GU5A 2F8YA 4LERA 4GTTA 4BERA 4XE0A 2KBXA 4AXHA 1KZOA 5KCMA 2V4HC 4Q94A 3ZHEA 4GMLA 2B6CA 3L08A 3QK0A 1OY3D 3D9IA 3Q7FA 2BUGA 2CFZA 3ASNE 4JB8P 3ASHA 1E8XA 1BLXB 1QNFA 2EIKE 1N4SA 5CBOA 1IXVA 5KBAA 1NA0A 4YDOA 4JEHA 2KC7A 3MEKA 2H6FA 4JHRA 3UI2A 4WNGA 3TXMA 3ESLA 5EYPF 2PM6A 4BX9A 3SO8A 5CECB 2CFUA 1B89A 4TRQA 3Q49B 3U3WA 3T5XA 2R2LA 3I3NA 3QDNA 1TEZA 4A1GA 2JLBA 2MOWA 1NP7A 3K9IA 4N2SA 2HO1A 1IKND 4Q69A 2DWZA 3CGHA 2FO1E 4EZKA 4JEUA 3L6AA 2WXJA 2A5EA 1YA0A 2OV8A 3L22A 3FWVA 1Z3XA 2WVIA 1O5MA 2OEVA 2ZGDA 4AVXA 1P5QA 4GCOA 3U66A 1SA4A 2AVPA 3DXKG 3TWXA 5ARGA 4DI4A 5LP0A 2KCVA 2JEKA 5AJLA 3RIBA 3NOGD 3S7DA 4BT9A 2KCLA 5KNGA 5BT1A 3PS6A 2FEZA 4RG6A 4XZ4A 2V5FA 1KLXA 1Z5SC 3BEEA 2ZGGA 3KEAA 3R7QA 2IONA 3PDNA 2V4LA 4A3TA 1EPUA 4OVVA 2QYJA 4X8QA 2Y1LE 2V0PA 5LOZA 4I9CA 3W9FA 3DSTA 4UI9K 2CG3A 1NI1A 3UINC 1TNZA 3ESKA 3FEYA 5FINA 5BNWA 1L5JA 1TJCA 4CDRA 2VSXE 4AY6A 5ENRD 4C9BB 4DX2A 4V3IA 3R7RA 4I6GA 4LCTA 5AQAA 4TV3A 4GTMA 2M63A 3OTNA 3I5PA 1N54A 4K0RA 4B0ZA 4N5CA 1A5EA 2I9CA 4UQYA 4HVBA 2OVFA 3D9NA 2P9NG 1ZBPA 4HS2A 1JCQA 1QYMA 1UJKA 3FUIA 5FIOA 2V5QC 5CRUA 3PRZA 4GPKA 4JHKA 2C0LA 3MGBA 3UM3A 3I4GA 4G11A 4HLLA 3UIOC 1QBQA 2XCCA 3PZ2A 3KS2A 2WXPA 4GYWA 5BPPA 1BU9A 5E75A 3ZPJA 2KCKA 1YYHA 4NIKA 4G25A 3AS5A 3RK6A 3CVXA 2XENA 4KMOA 4GZ5A 1MX4A 2R05A 2LSUA 3FTZA 4CZ2D 1Y8MA 1K8KG 1FT2A 3GYZA 1H2UA 2YNQA 3VLDA 3ZYLA 3UTMA 2RG8A 3CVQA 4IULA 3Q73A 4WNFA 3AU5A 3FEXA 2HR2A 1E90A 1XGWA 3RO2A 4EECA 1JCSA 5HRYA 3ZNGA 4XIFA 4CYMD 5LFAA 3FUEA 2BTDA 3UIPC 4GA2A 5T3RA 3E30A 3HXEA 4HORA 3NB2A 4ACLA 3BUAA 3D3MA 2H6GA 1LF8A 4GZ6A 1JUQA 4U63A 4MKTA 2IU1A 5CCLA 3HXCA 1SW6A 2LAIA 4JC8A 1PY1A 5AN8A 2PM7A 1FCHA 3ABME 4HRNA 1JCRA 1TN6A 3AG2E 2VTBA 4I6EA 2L0IA 3IHYA 1BD8A 4GCNA 1ELKA 3NQPA 4Y6CA 1N4RA 4BETA 3B7SA 3ULQA 1X5BA 2XGOA 4F6RD 3C72A 3V30A 3QWPA 5CBNA 1YCSB 1HE8A 4UQZA 1EYHA 2L9BA 4M3OA 4UI9C 2NXPA 3RRNB 3HXDA 4AY5A 4TUUA 1UN8A 3SI5A 3DSXA 3DXMG 2VTBB 2WPVA 3QJZA 4WNEA 3OXFA 4FULA 5LCWJ 1BI8B 3FUFA 1ZB1A 3Q15A 3CQCB 3MYVA 3LJNA 4B8AA 3QKYA 1ZU2A 4DLQA 2J9QA 3PE3A 5M72A 1SZAA 4GYOA 1JWGA 5CCMA 4FADA 5FZSA 3ZVVA 5JJ6A 2VYIA 2WQ6A 3CEQA 3CHMA 3SGHA 3ZYMA 3TWQA 4XKCA 2XPIA 3SZ7A 1DVPA 1HS6A 3E32A 3CHPA 1H6KA 3FTXA 2LUHA 1E96B 1OWMA 2IOSA 3KSLA 3DSSA 4I2WA 2OCCE 1RZ4A 5J90A 4LG6A 3P2BA 1VDYA 4HOSA 3FTSA 1Y6IA 4B8CB 2R5SA 1HU3A 3Q7AA 3S2AA 3SFXA 2BF0X 3AAAC 3EHRA 1E8WA 3ZYKA 2XEEA 1UOHA 3MV2B 2XGSA 4G8LA 5CHEE 5DIZA 3D9PA 4ATZD 3E37A 4HOQA 5D66A 2AXZA 5FWQA 3FUMA 4MS6A 4LEUA 1WG0A 1DNPA 3GW4A 3OAWA 2EINE 3TGOA 3DRAA 1V55E 4Y6WA 2DYSE 5AAOA 5JHBA 3EHMA 4L7TA 3DPDA 3IKOB 3FDHA 4U8VD 4JZYA 3O48A 3TJPA 3G2VA 2WB2A 4A3VA 3AG1E 3FTYA 4DX7D 4RQIA 1HO8A 4C48B 4UWGA 3FTUA 5ITZF 4U7EB 2XRZA 3DSUA 3SD5A 5HI7A 4CDMA 5G04C 2A5UA 2WMNA 4HBDA 1K1BA 4KZ0A 4TXQA 4JA7A 2FI7A 3LY8A 1SVXA 3F6QA 2BKGA 3Q5MA 5CEDB 1D8EA 3ZFWA 2C0MA 3HVEA 4AOFA 3KEZA 4TXRA 2J8SD 2GRPB 3APFA 5C2YA 1Z3YA 3JCKC 2VSNA 1OUVA 2DYRE 3Q47B 4N3AA 3DWLG 3B13A 4P29A 3ML9A 4K03A 4XI0A 3B7RL 2P9UG 3EDTB 3U4TA 2XQ0A 1OXJA 4J6IA 4G8KA 3QB2A 4EZJA 3LXUX 3PZ1A 3LKUA 2XGMA 4YDYA 3DEPA 4DPRA 3V31A 4UUCA 3HVEB 2VGEA 3T9KA 4R7LA 2GRMA 4WWPA 1IHBA 3UM2A 5JHAA 3VTYA 4FLBA 4N2QA 4YVQC 3VLFA 2I2OA 2ETBA 3PUJA 3OXLA 3ASOE 4U0ZA 3AG4E 4HQDA 4Q96A 3L16A 2LAHA 3UX4A 1UN9A 4FHKA 4DLOA 3UM0A 1N0QA 4KVMA 2P2CP 3JUEA 2OOEA 3X2QE 3BG0B 2AWIA 1Q2ZA 1LTXA 3SBSA 4LNUD 4NACA
chains in the Genus database with same CATH topology
4HBDA 2F8XK 1K1BA 4O1PA 4HRLA 2DVWA 3ZKJA 1MX6A 1QYMA 5ENSD 2B0OE 1NFIE 5FIOA 4YDWA 5HKPA 2MYOA 2V5QC 1DCQA 2V4HC 3J5QB 1SVXA 3F6QA 3JXIA 4HB5A 3TWXA 3TWQA 1K3ZD 5KNHD 1YMPA 3AJIA 2BKGA 1SW6A 4U96D 3ZUVB 4O1OA 5BXOA 5KWDA 5CERB 4BSZB 4DUIA 5EILA 1K1AA 4N5QA 4HNAD 5CEDB 5AN8A 1N11A 2Y0BG 4HLLA 4OAUC 1S70B 5AQBA 4K5AB 1G3NB 4HI9A 2HE0A 1MJ0A 1OY3D 3NOGD 2J8SD 4HRNA 4B93B 2F37A 3C5RA 5HS0A 5KNGA 5BXUA 1BU9A 1BD8A 1OT8A 4LG6A 4OAVB 4JB8P 4QQIA 4J8YA 3UXGA 4F1PA 4BETA 1BLXB 3DEOA 5CBOA 2ZGGA 3KEAA 1IXVA 5KBAA 4QFVA 4K5CA 1WDYA 2ETAA 4F6RD 5AQ9A 3AAAC 4DX1A 1YYHA 2QYJA 3TWRA 1N0RA 4NIKA 5EN5D 3V30A 2Y1LE 3EHRA 1D9SA 4ZHBA 5CEAA 3V2XA 5CBNA 3UI2A 2XEEA 1UOHA 2NYJA 2QC9A 2XENA 5EYPF 3W9FA 4G8KA 4BESA 3D9HA 5EYLA 3TWVA 1YCSB 2RFAA 1MX2A 4G8LA 1AWCB 3TWUA 1MX4A 3W9GA 4ATZD 2XZTG 3SO8A 3EHQA 5D66A 5CECB 4CZ2D 4GMRA 2DZOA 2KXPC 5FINA 1WG0A 1AP7A 4RLYA 3TWWA 5JMND 2ETCA 4TUMA 5ENTD 3Q9NC 5AARA 4YDYA 4K5BA 5AAOA 4BEPA 3T8KA 3DEPA 5ENRD 3V31A 4UUCA 4DX2A 4LSZE 5AQ7A 3B95A 1BI7B 4Z68A 3V79K 3IXEA 4DX6D 2VGEA 3T9KA 2DZNA 5AQAA 2L6BA 3EU9A 3JXJA 3UTMA 1IHBA 2XZDG 4U8VD 4DRXE 3NBNB 4GPMA 3TWTA 2ETBA 4HI8A 4J7WA 3Q9UC 1IKND 2AJAA 1BI8B 2BKKB 2PNNA 5EIDA 4DX7D 4ZFHA 2DWZA 4U95D 4HQDA 3B7BA 3HG0D 2FO1E 5ENQD 4C48B 5ITZF 5EIBE 4U8YD 3LJNA 1N0QA 4DX5D 2A5EA 4HRMB 2P2CP 3J5PA 5HRYA 1DC2A 3ZNGA 1A5EA 1TR4A 2JABA 3JUEA 3V2OA 2F8YA 4CYMD 4O60A 5JA4D 2XEHA 5ENOD 3ZU7B 5ENPD 3TWSA 3HRAA 2RFMA 4BERA 3NOCD 2ZGDA 2KBXA 4LNUD 4A63B 1MYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBD A;  2F8X K;  1K1B A;  4O1P A;  4HRL A;  2DVW A;  3ZKJ A;  1MX6 A;  1QYM A;  5ENS D;  2B0O E;  1NFI E;  5FIO A;  4YDW A;  5HKP A;  2MYO A;  2V5Q C;  1DCQ A;  2V4H C;  3J5Q B;  1SVX A;  3F6Q A;  3JXI A;  4HB5 A;  3TWX A;  3TWQ A;  1K3Z D;  5KNH D;  1YMP A;  3AJI A;  2BKG A;  1SW6 A;  4U96 D;  3ZUV B;  4O1O A;  5BXO A;  5KWD A;  5CER B;  4BSZ B;  4DUI A;  5EIL A;  1K1A A;  4N5Q A;  4HNA D;  5CED B;  5AN8 A;  1N11 A;  2Y0B G;  4HLL A;  4OAU C;  1S70 B;  5AQB A;  4K5A B;  1G3N B;  4HI9 A;  2HE0 A;  1MJ0 A;  1OY3 D;  3NOG D;  2J8S D;  4HRN A;  4B93 B;  2F37 A;  3C5R A;  5HS0 A;  5KNG A;  5BXU A;  1BU9 A;  1BD8 A;  1OT8 A;  4LG6 A;  4OAV B;  4JB8 P;  4QQI A;  4J8Y A;  3UXG A;  4F1P A;  4BET A;  1BLX B;  3DEO A;  5CBO A;  2ZGG A;  3KEA A;  1IXV A;  5KBA A;  4QFV A;  4K5C A;  1WDY A;  2ETA A;  4F6R D;  5AQ9 A;  3AAA C;  4DX1 A;  1YYH A;  2QYJ A;  3TWR A;  1N0R A;  4NIK A;  5EN5 D;  3V30 A;  2Y1L E;  3EHR A;  1D9S A;  4ZHB A;  5CEA A;  3V2X A;  5CBN A;  3UI2 A;  2XEE A;  1UOH A;  2NYJ A;  2QC9 A;  2XEN A;  5EYP F;  3W9F A;  4G8K A;  4BES A;  3D9H A;  5EYL A;  3TWV A;  1YCS B;  2RFA A;  1MX2 A;  4G8L A;  1AWC B;  3TWU A;  1MX4 A;  3W9G A;  4ATZ D;  2XZT G;  3SO8 A;  3EHQ A;  5D66 A;  5CEC B;  4CZ2 D;  4GMR A;  2DZO A;  2KXP C;  5FIN A;  1WG0 A;  1AP7 A;  4RLY A;  3TWW A;  5JMN D;  2ETC A;  4TUM A;  5ENT D;  3Q9N C;  5AAR A;  4YDY A;  4K5B A;  5AAO A;  4BEP A;  3T8K A;  3DEP A;  5ENR D;  3V31 A;  4UUC A;  4DX2 A;  4LSZ E;  5AQ7 A;  3B95 A;  1BI7 B;  4Z68 A;  3V79 K;  3IXE A;  4DX6 D;  2VGE A;  3T9K A;  2DZN A;  5AQA A;  2L6B A;  3EU9 A;  3JXJ A;  3UTM A;  1IHB A;  2XZD G;  4U8V D;  4DRX E;  3NBN B;  4GPM A;  3TWT A;  2ETB A;  4HI8 A;  4J7W A;  3Q9U C;  1IKN D;  2AJA A;  1BI8 B;  2BKK B;  2PNN A;  5EID A;  4DX7 D;  4ZFH A;  2DWZ A;  4U95 D;  4HQD A;  3B7B A;  3HG0 D;  2FO1 E;  5ENQ D;  4C48 B;  5ITZ F;  5EIB E;  4U8Y D;  3LJN A;  1N0Q A;  4DX5 D;  2A5E A;  4HRM B;  2P2C P;  3J5P A;  5HRY A;  1DC2 A;  3ZNG A;  1A5E A;  1TR4 A;  2JAB A;  3JUE A;  3V2O A;  2F8Y A;  4CYM D;  4O60 A;  5JA4 D;  2XEH A;  5ENO D;  3ZU7 B;  5ENP D;  3TWS A;  3HRA A;  2RFM A;  4BER A;  3NOC D;  2ZGD A;  2KBX A;  4LNU D;  4A63 B;  1MYO A; 
#chains in the Genus database with same CATH topology
 4NUR A;  4YDE A;  4ATG A;  2ZIS A;  3G2U A;  4U96 D;  3D9J A;  1K1A A;  2Y0B G;  1O1S A;  4JHJ A;  4HI9 A;  4J8S A;  2F37 A;  3L9T A;  3TL5 A;  3U64 A;  3URZ A;  1E8Z A;  3TAX A;  1TN7 A;  4CCA A;  3EIQ C;  5FQ4 A;  1S0P A;  4WND A;  1ELW A;  1KPS B;  5FQ8 A;  2IF4 A;  3CK7 A;  2C2L A;  2LO6 A;  3HIZ A;  4BES A;  3D9M A;  3CSF A;  3SQV A;  1OCO E;  5EYL A;  1HF8 A;  3GZS A;  3DSV A;  1FPP A;  3APC A;  2WXK A;  4UWH A;  3Q9N C;  3T8K A;  5AQ7 A;  3BG1 B;  4DJA A;  5BV0 A;  3RKV A;  2P9K G;  1OWL A;  2WXF A;  5T4Y A;  2GGF A;  3JYS A;  3D9K A;  2LXM A;  5A7D B;  3FU5 A;  2FF4 A;  1N52 A;  2R17 C;  4JXT A;  1E8Y A;  3CVP A;  2Y4T A;  2I1K A;  3V2O A;  3LEW A;  4U0U A;  3KSQ A;  2P9S G;  4EHM A;  1TN8 A;  1N4Q A;  3RRU A;  3LPZ A;  3FFL A;  2VGX B;  4G26 A;  4N3C A;  5G2N A;  4CRW A;  4F1S A;  1ELR A;  3JXI A;  1Z6T A;  3PZ4 A;  4DK5 A;  4GTO A;  3S7B A;  4N5Q A;  5KJK A;  3PUK A;  1G3N B;  3ZEF A;  2Q7F A;  2PQN A;  4OAV B;  3TG5 A;  3FH5 A;  3L13 A;  1SA5 A;  4L2L A;  3JQ1 A;  1RW2 A;  5HQ8 A;  2ETA A;  2X6H A;  4DX1 A;  2X6F A;  3PVL A;  1MZC A;  1EF1 C;  4KXK B;  3AS8 A;  2NYJ A;  3TWV A;  4JA9 A;  2XZT G;  4W9R A;  2E0I A;  5A23 A;  4OVU A;  3E33 A;  2KXP C;  4RLY A;  4TUM A;  1TNB A;  3CHQ A;  4AV7 A;  2WXG A;  3Q75 A;  4LSZ E;  4BY6 A;  4RSY A;  1A17 A;  4BSX A;  3WXX A;  3FH8 A;  3IHV A;  4G23 A;  3QWW A;  2GRN B;  3FU3 A;  2BKK B;  3FUH A;  5AYW D;  4YND A;  4U95 D;  3D9O A;  2AW6 A;  3ASG A;  4GA1 A;  2ZXW E;  3CVL A;  1TR4 A;  3C98 A;  5KJL A;  2IY0 C;  3ZU7 B;  4GTQ A;  1FVH A;  5DBK A;  4FP7 A;  2RFM A;  4ANV A;  4A63 B;  3UMV A;  4PDX A;  3UM1 A;  4J8E A;  4PUC A;  4HOT A;  2ZU6 B;  3NF1 A;  2DIW A;  3S7F A;  4EBA G;  2EQX A;  4HB5 A;  3ZUV B;  3N71 A;  4FJZ A;  1X81 A;  1TNY A;  2QYU A;  4GAA A;  1MJ0 A;  4C0M A;  3PZ3 A;  2EIL E;  1OT8 A;  4GB9 A;  1NZN A;  2OND A;  4UWK A;  4CDN A;  2MHK A;  5B1B E;  1NL4 A;  5C1D A;  1OCZ E;  2QZA A;  4FLH A;  3AS4 A;  3NZS A;  1KT1 A;  2EIJ E;  3MX3 A;  2QC9 A;  4FA6 A;  4N39 A;  1H0A A;  3QC1 A;  3JQ0 A;  4GYY A;  1TNU A;  3CVN A;  1AP7 A;  3TWW A;  4IRU A;  3HDX A;  4GZ3 A;  1E7U A;  4Z68 A;  3FTV A;  4IN3 B;  2XZD G;  3CV0 A;  3QOU A;  4PS8 A;  1H2T C;  3IV0 A;  2XPZ A;  4CEM A;  5ENQ D;  5AEN A;  3FU6 A;  3EU5 A;  2E2E A;  5BUZ A;  4F7A A;  3E34 A;  4PH4 B;  2J4D A;  4APF A;  3HRA A;  3NOC D;  3PNT B;  2IQC A;  2RKK A;  2LSV A;  3DPY A;  2F8X K;  2XHE A;  2WXR A;  1NFI E;  4YDW A;  3SHF A;  1HH8 A;  2MYO A;  2YIN A;  3I4R B;  1QZ2 A;  1UJJ A;  3ABL E;  3RAU A;  4XKB A;  2IOL A;  3Q4A B;  3AJI A;  3DSW A;  3SF4 A;  2CHZ A;  3CR3 A;  1S70 B;  1PC2 A;  3CHO A;  4ME2 A;  1W3B A;  2X3M A;  5HS0 A;  3CK9 A;  3CST A;  4BT8 A;  4E85 A;  4H7Y A;  4F53 A;  1H19 A;  3DEO A;  4D10 C;  5AQ9 A;  1S63 A;  3ML8 A;  3FP3 A;  3UT8 A;  2WXQ A;  2R02 A;  4U07 A;  4B89 A;  2XEV A;  3BQO A;  2X38 A;  4GA0 A;  3PEU B;  4EQF A;  3QAR A;  1NA3 A;  3PNL B;  2P9I G;  5BV1 A;  4I9E A;  5KJN A;  3V79 K;  2J07 A;  3IXE A;  4DX6 D;  3AG3 E;  1PAQ A;  2P9L G;  1QQE A;  2HM8 A;  3UQ3 A;  5D0Q D;  5EID A;  5EIB E;  3CKC A;  4YVO A;  4DX5 D;  4HRM B;  4H7X A;  2GRQ B;  5FTP A;  5ENP D;  3CVY A;  1IQU A;  3LY7 A;  4WAF A;  5HKP A;  3ZXS A;  1DCQ A;  3ULE G;  1O1R A;  4MLP A;  1WAO 1;  3CHS A;  3MJW A;  4DUI A;  1SQM A;  4L9P A;  2IO2 C;  4OAU C;  3B7T A;  2RD0 A;  5G05 C;  4B93 B;  5FZQ A;  3C5R A;  4LUN U;  3BU8 A;  2WM9 A;  3MKR A;  3QNK A;  3G2T A;  4BFR A;  1FVF A;  4A1S A;  2FUL A;  4K5C A;  4LNG A;  3TWR A;  5EN5 D;  1D9S A;  4G1T A;  3PE4 A;  3D9H A;  1S64 A;  3LVQ E;  1AWC B;  3UUX A;  3EHQ A;  1O1T A;  1HZ4 A;  3RSE G;  4URK A;  3LY9 A;  2L6J A;  3CVU A;  3RJV A;  4BEP A;  5IY5 E;  1N4P A;  3LCA A;  3FUL A;  4G2V A;  2R03 A;  3UT7 A;  2DZN A;  4BTA A;  2WXI A;  3Q78 A;  4FC8 A;  1DCE A;  4BTB A;  2CG2 A;  4I17 A;  4A55 A;  3HHM A;  4I1A A;  4NQ0 A;  3L82 A;  2PNN A;  2WQH A;  2QFC A;  1U2V G;  3FUN A;  4UWL A;  5BW8 C;  5T8I A;  3CKB A;  3SY2 A;  3LYA A;  4ILI A;  3ZYQ A;  2P58 C;  4HLE A;  3QWV A;  2LXL A;  4WWN A;  4GZD A;  2VJ8 A;  3SNX A;  1MYO A;  3EUV A;  4U8H A;  4O1P A;  4HRL A;  3FUK A;  2OVB A;  1UW4 B;  2B0O E;  3TG4 A;  1N95 A;  5KNH D;  4I6J A;  5CER B;  1N11 A;  3VLE A;  2XCB A;  5H7P A;  4KBQ A;  4KYO B;  1U3D A;  2UY1 A;  1N9A A;  1OWO A;  3ZGQ A;  4O6F A;  3ZHE B;  4QFV A;  3LS8 A;  4C0E A;  1D8D A;  3FH7 A;  1MHQ A;  1IHG A;  2BED A;  3FHE A;  4LRZ A;  5A6C A;  2WXL A;  4UQX A;  4LNB A;  3W9G A;  4JVS A;  1FT1 A;  3LJ3 A;  3SBT B;  3MA5 A;  4GMR A;  3C3Q A;  2WQ7 A;  2UWJ G;  5KJM A;  1TNO A;  3B95 A;  4I2Z A;  3C3O A;  1BI7 B;  1XNF A;  1OCR E;  3G2W A;  1H6P A;  3JXJ A;  4M7C A;  4DI3 A;  2X6J A;  3MZL B;  4HI8 A;  4J7W A;  2UY1 B;  3FU0 A;  4L1B A;  3IBE A;  3MCX A;  2KZT A;  3B7B A;  4B94 A;  3CLJ A;  3ONK A;  4U8Y D;  1GW6 A;  1SZ9 A;  2VGX A;  3ISM C;  2WXM A;  3WG7 E;  3G2S A;  4ANW A;  2LNI A;  3QAQ A;  3TWS A;  3T8M A;  2EIM E;  1OWP A;  3SFY A;  5ANL A;  4PS3 A;  3MV3 B;  2AXU A;  2Y4U A;  5FQ6 A;  2XRY A;  2NC9 A;  5AIJ A;  5LX8 A;  3ZRH A;  5BXO A;  5KWD A;  3JUI A;  4O1O A;  1EDU A;  5E76 A;  2Y69 E;  3KD7 A;  5EIL A;  2GRL A;  3CQG B;  3HXB A;  4IYP A;  5AQB A;  4CT0 A;  2HE0 A;  4N3B A;  3ASF A;  4JD2 G;  4TXP A;  5BXU A;  2KZT B;  4BX8 A;  3FTW A;  1OWN A;  5AJD A;  2I1J A;  4ACK A;  3ZIM A;  2FO7 A;  2J08 A;  2GW1 A;  5CRV A;  4ANX A;  4UWF A;  5JMN D;  3CIA A;  3ZXP A;  5CMW A;  5AAR A;  4CGW A;  4JPS A;  4XX5 A;  1MQS A;  3UKU G;  3S7J A;  5EKQ D;  3NBN B;  1UG3 A;  1U3C A;  4GTR A;  3Q9U C;  2AJA A;  3CVV A;  4J0U A;  2IFU A;  1JPL A;  2X6K A;  3OXG A;  5B1A E;  5EX0 A;  2HYZ A;  4J8F A;  2R59 A;  5JA4 D;  1H6O A;  1LD7 A;  3L17 A;  4KVO A;  2YQ8 A;  3ZKJ A;  5ENS D;  5FJY A;  4BWR A;  2H6H A;  1KT0 A;  1LD8 A;  4ABN A;  3B7U X;  2PZI A;  4AIF A;  2NSZ A;  3Q79 A;  4HNA D;  2A4Z A;  3P1U A;  2DCP A;  2P9P G;  3ONL A;  4RG9 A;  4UI9 J;  2PL2 A;  4EZL A;  3AU4 A;  4FHJ A;  4I1O B;  2F0Y A;  4F1P A;  3UKR G;  4I43 A;  3E4B A;  2PQR A;  1N0R A;  3PZD A;  4GMJ A;  3V2X A;  2DBA A;  4L2Y A;  5FZR A;  2CHW A;  1MX2 A;  2RFA A;  5G55 A;  2WXO A;  2GRR B;  3IEG A;  2QY7 A;  2MRI A;  1WY6 A;  4G24 A;  4GTS A;  1HG5 A;  2FBN A;  3TXN A;  2AXV A;  2WXH A;  4DRX E;  2J49 A;  3CVW A;  3CHR A;  2J09 A;  3ENE A;  3KAE A;  1HG2 A;  2VGY A;  4GTV A;  4ILH B;  3FY4 A;  4HFG A;  2JAB A;  3MKQ A;  5ENN A;  4O60 A;  1N94 A;  2XEH A;  4PS7 A;  3GZ2 A;  3LDZ A;  4F3V A;  4L23 A;  1HXI A;  1TJF A;  5EDS A;  3ZN3 A;  3R9M A;  4U04 A;  2DVW A;  1MX6 A;  3U9W A;  4MRU A;  2L0T B;  3J5Q B;  1K3Z D;  1YMP A;  4KT6 B;  5B3S E;  2OEW A;  2XS8 A;  3FUD A;  3T5V A;  3EIJ A;  4U0S A;  2YHC A;  4OYS A;  4GTP A;  3EHN A;  2H6I A;  4AP2 A;  4QQI A;  4CGV A;  3EJN A;  2J4B A;  3MKQ B;  3ASD A;  5JJ7 A;  1HX8 A;  4ZHB A;  5CEA A;  3RU0 A;  2VSO E;  5FT9 A;  3GZ1 A;  4E6H A;  4AM9 A;  5EX3 A;  3FUJ A;  2ZIR A;  5D2M C;  1E7V A;  2DZO A;  5G04 J;  5ENT D;  5G05 J;  4EBA A;  4I1M A;  4K5B A;  4WWO A;  3L54 A;  3HYM B;  5FQ7 A;  2L6B A;  3EU9 A;  4ANU A;  4NRH B;  4GPM A;  4HXI A;  2XS1 A;  5ARF A;  4RVB A;  1OCC E;  1BPO A;  1H2V C;  2I6H A;  3R9A B;  1HFA A;  2VQ2 A;  2X6I A;  4WUY A;  3J5P A;  3PH0 C;  4JL0 A;  2WXN A;  5ENO D;  2VSY A;  3UT4 A;  3C3R A;  3PEV B;  2IO3 C;  3APD A;  3UPV A;  2IJG X;  2V8S E;  3O4Z A;  4BSZ B;  4ILG A;  3LVR E;  3NZU A;  1WM5 A;  4MBG A;  3CK8 A;  3ULY A;  4CT4 A;  4K5A B;  1KZP A;  3SFZ A;  2YHE A;  1IQR A;  3D9L A;  2WMO A;  4JW1 A;  4FU3 A;  4KZC A;  3NAW A;  1INZ A;  2KM4 A;  4J8Y A;  3UXG A;  1IYG A;  2KAT A;  4FJY A;  3VTX A;  1WDY A;  4GZC A;  5CMY A;  4XI9 A;  5LCW C;  5JJT A;  2IEJ A;  1TYQ G;  3TWU A;  1V54 E;  2ILR A;  5J08 A;  2ETC A;  3RO3 A;  2XPY A;  2CHX A;  3ZW3 A;  3PRE A;  5ANR A;  4EPZ A;  3ABK E;  1JWF A;  4XEI G;  2Y3A A;  4J8D A;  3TWT A;  4APO A;  4ZFH A;  3DBS A;  4HOU A;  3HG0 D;  3RRM B;  4AJW A;  2GRO B;  1DC2 A;  3HXF A;  5D0O D;  4AEZ C;  4GU5 A;  2F8Y A;  4LER A;  4GTT A;  4BER A;  4XE0 A;  2KBX A;  4AXH A;  1KZO A;  5KCM A;  2V4H C;  4Q94 A;  3ZHE A;  4GML A;  2B6C A;  3L08 A;  3QK0 A;  1OY3 D;  3D9I A;  3Q7F A;  2BUG A;  2CFZ A;  3ASN E;  4JB8 P;  3ASH A;  1E8X A;  1BLX B;  1QNF A;  2EIK E;  1N4S A;  5CBO A;  1IXV A;  5KBA A;  1NA0 A;  4YDO A;  4JEH A;  2KC7 A;  3MEK A;  2H6F A;  4JHR A;  3UI2 A;  4WNG A;  3TXM A;  3ESL A;  5EYP F;  2PM6 A;  4BX9 A;  3SO8 A;  5CEC B;  2CFU A;  1B89 A;  4TRQ A;  3Q49 B;  3U3W A;  3T5X A;  2R2L A;  3I3N A;  3QDN A;  1TEZ A;  4A1G A;  2JLB A;  2MOW A;  1NP7 A;  3K9I A;  4N2S A;  2HO1 A;  1IKN D;  4Q69 A;  2DWZ A;  3CGH A;  2FO1 E;  4EZK A;  4JEU A;  3L6A A;  2WXJ A;  2A5E A;  1YA0 A;  2OV8 A;  3L22 A;  3FWV A;  1Z3X A;  2WVI A;  1O5M A;  2OEV A;  2ZGD A;  4AVX A;  1P5Q A;  4GCO A;  3U66 A;  1SA4 A;  2AVP A;  3DXK G;  3TWX A;  5ARG A;  4DI4 A;  5LP0 A;  2KCV A;  2JEK A;  5AJL A;  3RIB A;  3NOG D;  3S7D A;  4BT9 A;  2KCL A;  5KNG A;  5BT1 A;  3PS6 A;  2FEZ A;  4RG6 A;  4XZ4 A;  2V5F A;  1KLX A;  1Z5S C;  3BEE A;  2ZGG A;  3KEA A;  3R7Q A;  2ION A;  3PDN A;  2V4L A;  4A3T A;  1EPU A;  4OVV A;  2QYJ A;  4X8Q A;  2Y1L E;  2V0P A;  5LOZ A;  4I9C A;  3W9F A;  3DST A;  4UI9 K;  2CG3 A;  1NI1 A;  3UIN C;  1TNZ A;  3ESK A;  3FEY A;  5FIN A;  5BNW A;  1L5J A;  1TJC A;  4CDR A;  2VSX E;  4AY6 A;  5ENR D;  4C9B B;  4DX2 A;  4V3I A;  3R7R A;  4I6G A;  4LCT A;  5AQA A;  4TV3 A;  4GTM A;  2M63 A;  3OTN A;  3I5P A;  1N54 A;  4K0R A;  4B0Z A;  4N5C A;  1A5E A;  2I9C A;  4UQY A;  4HVB A;  2OVF A;  3D9N A;  2P9N G;  1ZBP A;  4HS2 A;  1JCQ A;  1QYM A;  1UJK A;  3FUI A;  5FIO A;  2V5Q C;  5CRU A;  3PRZ A;  4GPK A;  4JHK A;  2C0L A;  3MGB A;  3UM3 A;  3I4G A;  4G11 A;  4HLL A;  3UIO C;  1QBQ A;  2XCC A;  3PZ2 A;  3KS2 A;  2WXP A;  4GYW A;  5BPP A;  1BU9 A;  5E75 A;  3ZPJ A;  2KCK A;  1YYH A;  4NIK A;  4G25 A;  3AS5 A;  3RK6 A;  3CVX A;  2XEN A;  4KMO A;  4GZ5 A;  1MX4 A;  2R05 A;  2LSU A;  3FTZ A;  4CZ2 D;  1Y8M A;  1K8K G;  1FT2 A;  3GYZ A;  1H2U A;  2YNQ A;  3VLD A;  3ZYL A;  3UTM A;  2RG8 A;  3CVQ A;  4IUL A;  3Q73 A;  4WNF A;  3AU5 A;  3FEX A;  2HR2 A;  1E90 A;  1XGW A;  3RO2 A;  4EEC A;  1JCS A;  5HRY A;  3ZNG A;  4XIF A;  4CYM D;  5LFA A;  3FUE A;  2BTD A;  3UIP C;  4GA2 A;  5T3R A;  3E30 A;  3HXE A;  4HOR A;  3NB2 A;  4ACL A;  3BUA A;  3D3M A;  2H6G A;  1LF8 A;  4GZ6 A;  1JUQ A;  4U63 A;  4MKT A;  2IU1 A;  5CCL A;  3HXC A;  1SW6 A;  2LAI A;  4JC8 A;  1PY1 A;  5AN8 A;  2PM7 A;  1FCH A;  3ABM E;  4HRN A;  1JCR A;  1TN6 A;  3AG2 E;  2VTB A;  4I6E A;  2L0I A;  3IHY A;  1BD8 A;  4GCN A;  1ELK A;  3NQP A;  4Y6C A;  1N4R A;  4BET A;  3B7S A;  3ULQ A;  1X5B A;  2XGO A;  4F6R D;  3C72 A;  3V30 A;  3QWP A;  5CBN A;  1YCS B;  1HE8 A;  4UQZ A;  1EYH A;  2L9B A;  4M3O A;  4UI9 C;  2NXP A;  3RRN B;  3HXD A;  4AY5 A;  4TUU A;  1UN8 A;  3SI5 A;  3DSX A;  3DXM G;  2VTB B;  2WPV A;  3QJZ A;  4WNE A;  3OXF A;  4FUL A;  5LCW J;  1BI8 B;  3FUF A;  1ZB1 A;  3Q15 A;  3CQC B;  3MYV A;  3LJN A;  4B8A A;  3QKY A;  1ZU2 A;  4DLQ A;  2J9Q A;  3PE3 A;  5M72 A;  1SZA A;  4GYO A;  1JWG A;  5CCM A;  4FAD A;  5FZS A;  3ZVV A;  5JJ6 A;  2VYI A;  2WQ6 A;  3CEQ A;  3CHM A;  3SGH A;  3ZYM A;  3TWQ A;  4XKC A;  2XPI A;  3SZ7 A;  1DVP A;  1HS6 A;  3E32 A;  3CHP A;  1H6K A;  3FTX A;  2LUH A;  1E96 B;  1OWM A;  2IOS A;  3KSL A;  3DSS A;  4I2W A;  2OCC E;  1RZ4 A;  5J90 A;  4LG6 A;  3P2B A;  1VDY A;  4HOS A;  3FTS A;  1Y6I A;  4B8C B;  2R5S A;  1HU3 A;  3Q7A A;  3S2A A;  3SFX A;  2BF0 X;  3AAA C;  3EHR A;  1E8W A;  3ZYK A;  2XEE A;  1UOH A;  3MV2 B;  2XGS A;  4G8L A;  5CHE E;  5DIZ A;  3D9P A;  4ATZ D;  3E37 A;  4HOQ A;  5D66 A;  2AXZ A;  5FWQ A;  3FUM A;  4MS6 A;  4LEU A;  1WG0 A;  1DNP A;  3GW4 A;  3OAW A;  2EIN E;  3TGO A;  3DRA A;  1V55 E;  4Y6W A;  2DYS E;  5AAO A;  5JHB A;  3EHM A;  4L7T A;  3DPD A;  3IKO B;  3FDH A;  4U8V D;  4JZY A;  3O48 A;  3TJP A;  3G2V A;  2WB2 A;  4A3V A;  3AG1 E;  3FTY A;  4DX7 D;  4RQI A;  1HO8 A;  4C48 B;  4UWG A;  3FTU A;  5ITZ F;  4U7E B;  2XRZ A;  3DSU A;  3SD5 A;  5HI7 A;  4CDM A;  5G04 C;  2A5U A;  2WMN A;  4HBD A;  1K1B A;  4KZ0 A;  4TXQ A;  4JA7 A;  2FI7 A;  3LY8 A;  1SVX A;  3F6Q A;  2BKG A;  3Q5M A;  5CED B;  1D8E A;  3ZFW A;  2C0M A;  3HVE A;  4AOF A;  3KEZ A;  4TXR A;  2J8S D;  2GRP B;  3APF A;  5C2Y A;  1Z3Y A;  3JCK C;  2VSN A;  1OUV A;  2DYR E;  3Q47 B;  4N3A A;  3DWL G;  3B13 A;  4P29 A;  3ML9 A;  4K03 A;  4XI0 A;  3B7R L;  2P9U G;  3EDT B;  3U4T A;  2XQ0 A;  1OXJ A;  4J6I A;  4G8K A;  3QB2 A;  4EZJ A;  3LXU X;  3PZ1 A;  3LKU A;  2XGM A;  4YDY A;  3DEP A;  4DPR A;  3V31 A;  4UUC A;  3HVE B;  2VGE A;  3T9K A;  4R7L A;  2GRM A;  4WWP A;  1IHB A;  3UM2 A;  5JHA A;  3VTY A;  4FLB A;  4N2Q A;  4YVQ C;  3VLF A;  2I2O A;  2ETB A;  3PUJ A;  3OXL A;  3ASO E;  4U0Z A;  3AG4 E;  4HQD A;  4Q96 A;  3L16 A;  2LAH A;  3UX4 A;  1UN9 A;  4FHK A;  4DLO A;  3UM0 A;  1N0Q A;  4KVM A;  2P2C P;  3JUE A;  2OOE A;  3X2Q E;  3BG0 B;  2AWI A;  1Q2Z A;  1LTX A;  3SBS A;  4LNU D;  4NAC A; 
#chains in the Genus database with same CATH homology
 4HBD A;  2F8X K;  1K1B A;  4O1P A;  4HRL A;  2DVW A;  3ZKJ A;  1MX6 A;  1QYM A;  5ENS D;  2B0O E;  1NFI E;  5FIO A;  4YDW A;  5HKP A;  2MYO A;  2V5Q C;  1DCQ A;  2V4H C;  3J5Q B;  1SVX A;  3F6Q A;  3JXI A;  4HB5 A;  3TWX A;  3TWQ A;  1K3Z D;  5KNH D;  1YMP A;  3AJI A;  2BKG A;  1SW6 A;  4U96 D;  3ZUV B;  4O1O A;  5BXO A;  5KWD A;  5CER B;  4BSZ B;  4DUI A;  5EIL A;  1K1A A;  4N5Q A;  4HNA D;  5CED B;  5AN8 A;  1N11 A;  2Y0B G;  4HLL A;  4OAU C;  1S70 B;  5AQB A;  4K5A B;  1G3N B;  4HI9 A;  2HE0 A;  1MJ0 A;  1OY3 D;  3NOG D;  2J8S D;  4HRN A;  4B93 B;  2F37 A;  3C5R A;  5HS0 A;  5KNG A;  5BXU A;  1BU9 A;  1BD8 A;  1OT8 A;  4LG6 A;  4OAV B;  4JB8 P;  4QQI A;  4J8Y A;  3UXG A;  4F1P A;  4BET A;  1BLX B;  3DEO A;  5CBO A;  2ZGG A;  3KEA A;  1IXV A;  5KBA A;  4QFV A;  4K5C A;  1WDY A;  2ETA A;  4F6R D;  5AQ9 A;  3AAA C;  4DX1 A;  1YYH A;  2QYJ A;  3TWR A;  1N0R A;  4NIK A;  5EN5 D;  3V30 A;  2Y1L E;  3EHR A;  1D9S A;  4ZHB A;  5CEA A;  3V2X A;  5CBN A;  3UI2 A;  2XEE A;  1UOH A;  2NYJ A;  2QC9 A;  2XEN A;  5EYP F;  3W9F A;  4G8K A;  4BES A;  3D9H A;  5EYL A;  3TWV A;  1YCS B;  2RFA A;  1MX2 A;  4G8L A;  1AWC B;  3TWU A;  1MX4 A;  3W9G A;  4ATZ D;  2XZT G;  3SO8 A;  3EHQ A;  5D66 A;  5CEC B;  4CZ2 D;  4GMR A;  2DZO A;  2KXP C;  5FIN A;  1WG0 A;  1AP7 A;  4RLY A;  3TWW A;  5JMN D;  2ETC A;  4TUM A;  5ENT D;  3Q9N C;  5AAR A;  4YDY A;  4K5B A;  5AAO A;  4BEP A;  3T8K A;  3DEP A;  5ENR D;  3V31 A;  4UUC A;  4DX2 A;  4LSZ E;  5AQ7 A;  3B95 A;  1BI7 B;  4Z68 A;  3V79 K;  3IXE A;  4DX6 D;  2VGE A;  3T9K A;  2DZN A;  5AQA A;  2L6B A;  3EU9 A;  3JXJ A;  3UTM A;  1IHB A;  2XZD G;  4U8V D;  4DRX E;  3NBN B;  4GPM A;  3TWT A;  2ETB A;  4HI8 A;  4J7W A;  3Q9U C;  1IKN D;  2AJA A;  1BI8 B;  2BKK B;  2PNN A;  5EID A;  4DX7 D;  4ZFH A;  2DWZ A;  4U95 D;  4HQD A;  3B7B A;  3HG0 D;  2FO1 E;  5ENQ D;  4C48 B;  5ITZ F;  5EIB E;  4U8Y D;  3LJN A;  1N0Q A;  4DX5 D;  2A5E A;  4HRM B;  2P2C P;  3J5P A;  5HRY A;  1DC2 A;  3ZNG A;  1A5E A;  1TR4 A;  2JAB A;  3JUE A;  3V2O A;  2F8Y A;  4CYM D;  4O60 A;  5JA4 D;  2XEH A;  5ENO D;  3ZU7 B;  5ENP D;  3TWS A;  3HRA A;  2RFM A;  4BER A;  3NOC D;  2ZGD A;  2KBX A;  4LNU D;  4A63 B;  1MYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...