1BU9A

Solution structure of p18-ink4c, 21 structures
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
168
structure length
168
Chain Sequence
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords PROTEIN (CYCLIN-DEPENDENT KINASE 6 INHIBITOR)
publication title Tumor suppressor INK4: determination of the solution structure of p18INK4C and demonstration of the functional significance of loops in p18INK4C and p16INK4A.
pubmed doi rcsb
source organism Homo sapiens
total genus 38
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 1998-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1bu9A00
1SW6A 4TUMA 1DC2A 3JUEA 5EYLA 1N0QA 3B95A 4U96D 1IXVA 2ETCA 4QFVA 2VGEA 3HG0D 4OAUC 5ENRD 4U95D 1A5EA 1IKND 2F8YA 5HRYA 4BERA 1K1BA 3UXGA 3TWWA 4BSZB 4NIKA 4GPMA 4CYMD 3V31A 4K5CA 1N11A 4F1PA 5AN8A 3TWTA 2F8XK 3TWVA 3EHQA 4A63B 3V2OA 2BKGA 3TWRA 3F6QA 1K1AA 4ATZD 4C48B 5FIOA 5CEAA 3NBNB 3TWUA 5CBOA 1BU9A 2BKKB 1MYOA 3D9HA 5ENPD 2ETBA 2XZTG 4BETA 5AAOA 4F6RD 2MYOA 3SO8A 2ZGDA 4DX2A 1MX6A 4HNAD 4DX6D 2QC9A 1BI8B 5HKPA 5AQAA 5EIBE 4CZ2D 1WDYA 4DRXE 3JXIA 4ZFHA 4DX5D 2V5QC 4DUIA 2KBXA 5KBAA 3NOCD 5ITZF 4YDYA 3EU9A 3Q9NC 5BXOA 4LSZE 3ZU7B 5CEDB 2A5EA 3V79K 3JXJA 4HRNA 4K5AB 4U8VD 4DX7D 2FO1E 4HRLA 2QYJA 4HRMB 4G8KA 2XEEA 3AJIA 5JMND 5CERB 5AQ9A 2AJAA 3ZUVB 4DX1A 5D66A 1K3ZD 1S70B 3AAAC 2ZGGA 4HB5A 1AWCB 4HBDA 1BLXB 3KEAA 2Y0BG 1MX2A 1N0RA 1TR4A 1IHBA 3NOGD 2P2CP 2KXPC 5EILA 5FINA 4Z68A 4YDWA 4O1OA 2F37A 3DEOA 3V2XA 5EYPF 3W9GA 5ENTD 2RFMA 3J5PA 2HE0A 4HI8A 3TWXA 3EHRA 4B93B 1G3NB 5AQ7A 4BEPA 1OT8A 4J7WA 5BXUA 5ENOD 3UI2A 1YMPA 2JABA 2V4HC 5ENQD 1DCQA 4LNUD 5KNHD 5CBNA 2DZNA 4U8YD 3V30A 3J5QB 2DWZA 2RFAA 4GMRA 2DVWA 2DZOA 2XEHA 4K5BA 5EN5D 2L6BA 3TWSA 3DEPA 1NFIE 4ZHBA 5KWDA 1D9SA 1MX4A 1SVXA 2XENA 1MJ0A 5HS0A 4HQDA 4UUCA 2Y1LE 3ZNGA 2NYJA 3HRAA 5CECB 1YCSB 2ETAA 4O60A 1OY3D 1WG0A 3IXEA 4N5QA 5JA4D 4QQIA 4HI9A 4JB8P 3B7BA 5AQBA 4O1PA 5AARA 3W9FA 1BI7B 4LG6A 3LJNA 1UOHA 1BD8A 5ENSD 2J8SD 1AP7A 1YYHA 5EIDA 2B0OE 2PNNA 4RLYA 1QYMA 4HLLA 4G8LA 4J8YA 3TWQA 3C5RA 2XZDG 3Q9UC 4OAVB 4BESA 3ZKJA 3T9KA 3UTMA 5KNGA 3T8KA
chains in the Genus database with same CATH superfamily
1E8XA 4EECA 3CQGB 2FF4A 4KMOA 2VGEA 3L13A 3UUXA 4FADA 4TV3A 4CGVA 1S64A 3UT8A 5AN8A 2F8XK 4B89A 2OVFA 5LX8A 1PY1A 2DYSE 1N52A 1BU9A 2PM7A 1O1RA 4LNGA 5J90A 5AAOA 3ESLA 3DSXA 4DX6D 4A1GA 5CMYA 3TAXA 4EHMA 1OCCE 3ZYMA 2IY0C 4EBAA 4NQ0A 3QDNA 3HXBA 4JHKA 1QNFA 3NOCD 2J08A 1FCHA 3JXJA 3ZYLA 4HRMB 3ASFA 4YDOA 2AJAA 3ZUVB 4GA1A 3UM2A 2ZGGA 3LY8A 4UWLA 4JD2G 3DEOA 4L1BA 1N4QA 4JA7A 3J5PA 3FTZA 4G24A 5EX0A 5BXUA 3FFLA 1H6PA 2DZNA 2DWZA 1N4PA 1QQEA 2CFUA 4I6GA 2IO3C 4AXHA 1O1TA 2VSYA 2A5UA 1IQUA 3DSVA 3SHFA 2XRZA 3MV3B 3Q7AA 3W9FA 4LG6A 4XI9A 3ASDA 3ZN3A 2XQ0A 2OV8A 2FO7A 3QAQA 1A17A 4DLOA 3FUMA 4EBAG 3CK8A 4MBGA 3QK0A 4AEZC 2P58C 2XHEA 2F8YA 5HRYA 3CEQA 1SZAA 3UXGA 1FT1A 3C98A 2PM6A 4F1SA 3DXKG 3EHQA 4Y6WA 3VTYA 3TWRA 3Q15A 3PEUB 3D9HA 2XZTG 3QOUA 3SO8A 2C2LA 3FH5A 3MV2B 2OOEA 4I9EA 3UPVA 4CGWA 3S7BA 4HOTA 3SFZA 3QWPA 3CGHA 1OCZE 3P1UA 3Q5MA 3DSSA 4EPZA 4N39A 2P2CP 3D9LA 1HE8A 2QFCA 3AU4A 3GZ1A 3EHRA 2WMNA 1OWMA 2OCCE 3VLEA 2VSXE 4YNDA 3ZHEB 4LNUD 2Y69E 2IO2C 2RFAA 5C1DA 2DVWA 4U0UA 1D9SA 1HZ4A 2MOWA 3D9PA 4GZ3A 3SBTB 3S7JA 3ZNGA 4K03A 3AS5A 3ONLA 4TXQA 3ZFWA 4JB8P 2ZXWE 5KJLA 4I1AA 5BV1A 4J8SA 1UOHA 3PZ4A 3NZUA 2B0OE 3AG4E 4M3OA 4HOUA 1IXVA 3IKOB 3UKRG 4RG9A 4ACLA 2CG2A 2IOSA 3LDZA 1IQRA 4GTMA 4L2LA 2XPZA 4GB9A 3DXMG 5AJLA 3MKQA 2UY1B 2WXFA 2I9CA 5FQ6A 4TUUA 3AS8A 5AIJA 2MYOA 4UWHA 4JA9A 1H6OA 3Q75A 1QZ2A 3QNKA 2PQNA 1WAO1 4ZFHA 4IRUA 2X3MA 4GCNA 4C9BB 2AXVA 3LJ3A 4U8VD 1DVPA 4HVBA 4UWKA 3D9OA 4PDXA 3V2XA 1N94A 3JQ0A 3PRZA 4B94A 5T8IA 1E8ZA 1H19A 3RRNB 1Z5SC 3V30A 3KSLA 2P9SG 2WXLA 1ELRA 1MJ0A 1ELKA 5ANRA 1YCSB 3NQPA 4GYYA 4HI9A 5AQBA 1TNYA 5AARA 3RRMB 5FTPA 3Q4AB 4CDNA 2ZIRA 4HORA 2X6FA 2J8SD 4CDMA 1H2TC 3U66A 3SQVA 3C5RA 4N3AA 4OAVB 5CCMA 1SW6A 2MRIA 3VLDA 4YVQC 1S0PA 4TRQA 3HIZA 4KXKB 5B1AE 1P5QA 4GYWA 4CEMA 4BERA 4BSZB 5EDSA 3CHPA 4N2QA 2DYRE 2VTBB 3V2OA 2VYIA 2QY7A 3JUIA 3SZ7A 3I4GA 5CEAA 3N71A 3Q79A 4LRZA 5ENPD 3EUVA 1OUVA 3CVWA 3TL5A 1N4SA 4G2VA 4WUYA 1JWFA 2J4DA 1JUQA 3ZYKA 3Q9NC 3ZU7B 3ZYQA 2R59A 2R02A 4O6FA 2QYJA 4RG6A 5AQ9A 3KAEA 1ZBPA 5D66A 1NI1A 3ZGQA 1N0RA 5EILA 3LEWA 3X2QE 4C0MA 2GRNB 4GTTA 3FTVA 3DPDA 3FEYA 3ULEG 3ZXSA 2LUHA 1NFIE 3G2TA 1MX4A 1EPUA 3ONKA 3CKBA 3QARA 3O48A 2Y3AA 1SA5A 4MS6A 1VDYA 2XGMA 4GTVA 3UMVA 3ULYA 1X5BA 3DBSA 3CHSA 3C72A 3I3NA 3HVEB 2ZU6B 2XZDG 3C3OA 5EYLA 4BY6A 4IYPA 2KC7A 2L0IA 3PUJA 3FU0A 1UW4B 2NC9A 1E7UA 3TWWA 4XKCA 4ANUA 4PUCA 3CVQA 4F1PA 3L16A 4U63A 3ZW3A 5EX3A 2RD0A 4ATZD 4GTQA 3NBNB 4JPSA 3CKCA 3ENEA 3MCXA 2EIJE 2KCLA 2BUGA 2EILE 4FLBA 4ILGA 2LXLA 2X6KA 3E33A 4I1MA 3BU8A 2I1JA 3CVVA 4TXRA 4P29A 2VGXB 2AW6A 3UM3A 2IOLA 3CIAA 5CEDB 5FZSA 1EYHA 4HRLA 3GZSA 2WPVA 2J07A 4HBDA 1BLXB 1FT2A 4KVOA 4O1OA 2GRPB 3D3MA 4BEPA 5HI7A 3L08A 3SBSA 4APFA 2HR2A 2XEHA 4AVXA 4X8QA 4JZYA 3WXXA 3EIJA 3QB2A 4AM9A 4RQIA 2WXJA 2IEJA 3SNXA 3HYMB 1OCOE 1JPLA 1O1SA 4LUNU 3B7RL 3APCA 4V3IA 4PS7A 1HO8A 1B89A 2QYUA 5BUZA 2Y4TA 4PS8A 1OXJA 4RSYA 3ZKJA 2CHWA 2Q7FA 4MKTA 5JHBA 3B95A 1O5MA 2WQ6A 3PREA 3URZA 4AIFA 3PZDA 5BPPA 3ML9A 3PNTB 4GCOA 3LXUX 2RKKA 4R7LA 3PVLA 3TWVA 3PZ1A 1TN8A 1Z3XA 3LKUA 2BKKB 2YQ8A 4URKA 1KT0A 1HG5A 4DLQA 5J08A 1E7VA 4FULA 2H6GA 4CZ2D 2AXUA 3ESKA 2IONA 4YDYA 3EU9A 1E90A 2H6FA 3FY4A 2Y4UA 3QC1A 5B1BE 1K3ZD 2YHCA 4DI4A 3CLJA 3FULA 2I1KA 3ISMC 2RFMA 3L82A 3EIQC 3GW4A 5AJDA 4DJAA 1EF1C 4EZJA 2F0YA 3Q7FA 3TWSA 2LAIA 5EN5D 3BUAA 3FUDA 3RSEG 1NP7A 4O60A 5AYWD 1WG0A 5KJKA 3FWVA 5BV0A 3B7SA 3Q9UC 2AWIA 1XNFA 2MHKA 5FZRA 2R05A 2WXIA 4EQFA 4DI3A 4FJYA 1LD7A 4I9CA 2B6CA 2YINA 2KZTA 5ENNA 3LY7A 4C48B 5FQ4A 1MHQA 4D10C 4J0UA 2WB2A 3ML8A 3G2SA 3RO3A 3FDHA 4JXTA 5T4YA 3SFYA 2YNQA 2GRMA 4H7XA 3ASHA 5BXOA 3DSTA 2X6JA 3SF4A 4ATGA 2V8SE 4GMJA 4G8KA 3RAUA 4U8HA 4G11A 5LP0A 2IFUA 2XPYA 4CT4A 4B8CB 4WNGA 4HOQA 4YDWA 2GGFA 1D8EA 3PDNA 3Q73A 4APOA 4WNEA 2CFZA 3KSQA 1TNBA 2LO6A 2RG8A 2XPIA 3PH0C 4UQYA 3IBEA 1H2VC 5D0OD 5CBNA 2X38A 3J5QB 2WMOA 4GMRA 3LPZA 2FBNA 4KVMA 1V55E 1NA3A 3FU6A 1TNZA 5C2YA 3PE3A 4HLLA 4GYOA 4TUMA 2XCBA 4KZ0A 2E0IA 1N0QA 4KZCA 2PL2A 1N4RA 2WXGA 4A63B 3FTSA 3G2WA 1K1AA 2E2EA 2WXNA 5E76A 4CRWA 3MA5A 1TN7A 2BF0X 2C0LA 1OWLA 4F3VA 3P2BA 4XIFA 4BTBA 4L7TA 1DNPA 5IY5E 1WDYA 3QWWA 2LSVA 3NF1A 3L9TA 2X6HA 2EIME 2FO1E 4NRHB 3DSWA 2P9IG 4EZLA 3LVRE 3I4RB 2KXPC 5FINA 4JL0A 4UWGA 4Q94A 4BSXA 3U64A 2XEVA 5LOZA 3OXFA 3IEGA 5JJTA 4JEUA 5ENQD 4KT6B 1OWNA 3DEPA 3MJWA 2FI7A 3BQOA 4L23A 3PZ3A 2ETAA 4N5QA 4QQIA 3S7FA 1H6KA 4WWNA 1JCQA 4NACA 3CK9A 4AV7A 4J8YA 5JHAA 3UTMA 1HU3A 3Q49B 4I6EA 1GW6A 3HG0D 1RW2A 2LNIA 1UJJA 5H7PA 4BX9A 4K5CA 1MQSA 5JJ7A 1UG3A 3UM0A 2BKGA 2L6JA 3CHOA 4C0EA 3SFXA 5FIOA 2KM4A 2J09A 2EIKE 2ETBA 3WG7E 2XRYA 3ZXPA 4A3VA 5AQAA 5EIBE 3RK6A 3CSTA 5LFAA 5KBAA 3UKUG 3UX4A 3CHRA 2V4LA 1D8DA 1LF8A 1TNUA 5CERB 4DX1A 1AWCB 5CRUA 2XGOA 4U07A 1U3DA 2IJGX 2Y0BG 4J8FA 2F37A 3FUNA 1N9AA 2IF4A 4A1SA 2WXHA 5KNHD 3U4TA 2XS8A 3MGBA 3IHVA 1HX8A 3FH7A 4ANVA 3MYVA 3B7UX 5KCMA 1OY3D 1TJFA 4CT0A 1BI7B 1IHGA 2WQ7A 3FTWA 3QWVA 4YDEA 3CHQA 4B0ZA 3CVYA 3VLFA 4GU5A 3TWQA 5FQ8A 4FJZA 4L2YA 3D9IA 3EHMA 3T8KA 1DC2A 4QFVA 5G55A 1SA4A 4UQXA 2GRLA 5A7DB 2V5FA 3TWTA 1LTXA 3MZLB 4YVOA 2WXMA 3FUJA 3CR3A 5CCLA 2M63A 4FHKA 1Z6TA 2WXQA 1MX6A 2QC9A 3E30A 4JHJA 3ZEFA 3MKRA 4LERA 4FP7A 1Q2ZA 5ITZF 3ZIMA 3UINC 4XKBA 5DIZA 3AG1E 1TYQG 4W9RA 5ARFA 3RU0A 3AAAC 1TR4A 1NZNA 1NA0A 3ZHEA 2R17C 1HG2A 3FP3A 4HI8A 3TWXA 1JWGA 4B93B 5AQ7A 4AP2A 4Q69A 4G23A 1OT8A 4K0RA 1YMPA 3RKVA 1PC2A 5KWDA 2L6BA 1YA0A 2Y1LE 3CV0A 1K8KG 1LD8A 3UT7A 3AG2E 1BPOA 4I17A 2VQ2A 4JHRA 5CMWA 3FTUA 3S2AA 1E8YA 1HF8A 2NXPA 1IKND 4TXPA 1UN8A 3Q47B 2UY1A 3GZ2A 1K1BA 5BT1A 3ABME 3FUKA 5FT9A 4CDRA 1WY6A 3LS8A 2BEDA 3FU5A 1E96B 3NB2A 4WNDA 5DBKA 4WNFA 2A4ZA 3MKQB 3JYSA 1JCRA 3FUEA 4ANWA 3JXIA 5G05C 4LCTA 4DUIA 3E37A 4HRNA 3G2UA 3FH8A 2KCKA 3QJZA 2IQCA 5E75A 2VSOE 2CHZA 3NZSA 4DK5A 3PS6A 2WQHA 4Q96A 5ARGA 3ASOE 2PQRA 3C3RA 5G05J 3FTYA 3T5XA 3KEZA 2GROB 3BEEA 3FUIA 1HH8A 2XENA 4U0SA 4GTPA 5CECB 4J8DA 3IXEA 5JA4D 4ABNA 3U9WA 2V0PA 4NURA 3PUKA 4N3BA 3FEXA 5EIDA 3OXLA 4GZDA 3T9KA 3OAWA 4M7CA 4MLPA 4ANXA 3FUHA 4OYSA 2VTBA 1X81A 3TJPA 3KD7A 3CVXA 2VSNA 3ABLE 4BX8A 4GPMA 3V31A 4I43A 2AXZA 5LCWC 1TNOA 5FJYA 1RZ4A 1MYOA 4WAFA 4AJWA 2LAHA 3NAWA 4LNBA 1BI8B 3R9AB 4WWPA 3CQCB 3CK7A 3VTXA 4HS2A 4AY6A 4DX5D 2V5QC 3U3WA 3AS4A 4CCAA 3TG5A 5D2MC 5A6CA 4DX7D 3AJIA 5LCWJ 3SY2A 1N54A 2WVIA 3CVUA 1FVFA 4Z68A 3W9GA 4KBQA 4GTOA 1N95A 2JABA 1HS6A 4XZ4A 4N2SA 2LSUA 5KJNA 4N5CA 1Z3YA 3HRAA 3HVEA 1OWPA 3AU5A 4A55A 4ILHB 4RVBA 3LJNA 4I2WA 2WXPA 2XCCA 4BESA 3TG4A 1TJCA 3ZVVA 3APDA 2R5SA 4GTRA 3EU5A 5ENRD 4A3TA 2P9LG 2GW1A 4BT9A 4CYMD 3ZRHA 5BW8C 2JLBA 2HYZA 3SGHA 1JCSA 5BNWA 2P9KG 1SQMA 4EZKA 1H0AA 3FTXA 3UT4A 2VGXA 2JEKA 5CRVA 4KYOB 4GZ5A 4AY5A 3MEKA 1S63A 4BTAA 2KATA 2KBXA 3ULQA 5FZQA 2HM8A 3EHNA 2A5EA 3V79K 1Y8MA 3TGOA 2XGSA 2WXOA 2EINE 4F53A 1S70B 3O4ZA 3APFA 4I2ZA 3D9JA 1TEZA 1IHBA 3Q78A 3DRAA 4GAAA 5EYPF 3ASGA 3EDTB 2HE0A 4U0ZA 1SZ9A 3UM1A 1KLXA 2DIWA 2HO1A 4F7AA 2ILRA 4J7WA 3BG1B 5ENOD 3UI2A 5JJ6A 4ACKA 4FLHA 3EJNA 4HXIA 1OWOA 2LXMA 2P9UG 4UUCA 3TXNA 5AENA 3CSFA 3PZ2A 3GYZA 4GA2A 2UWJG 5EKQD 2FEZA 1DCEA 4E6HA 4OVUA 4GMLA 3L54A 3R7RA 1W3BA 1AP7A 1QYMA 4G8LA 4GPKA 3LCAA 3DPYA 4JVSA 3DSUA 5CHEE 4UQZA 4WWOA 2FULA 2GRRB 2DCPA 4U7EB 2J4BA 2PZIA 3IHYA 2OEVA 3L17A 4XE0A 3HXCA 3D9NA 4I1OB 3QKYA 3E32A 4UI9K 5CBOA 3S7DA 3TXMA 2WXRA 1WM5A 3E34A 4BETA 3G2VA 3RO2A 1U3CA 4DX2A 1UN9A 4IULA 2I6HA 2VJ8A 3R7QA 4DRXE 3HDXA 4LSZE 4K5AB 1XGWA 2XEEA 5G2NA 2NSZA 2QZAA 4HB5A 3KEAA 1MX2A 4B8AA 3NOGD 3T5VA 4GTSA 4JEHA 4XI0A 5ENTD 2J9QA 3I5PA 4G25A 1G3NB 1KZOA 3D9MA 1DCQA 4E85A 1OCRE 4ZHBA 1H2UA 3CVLA 3HHMA 1EDUA 2NYJA 1INZA 3B7BA 1FVHA 2EQXA 3R9MA 2I2OA 3SD5A 4FU3A 4J8EA 4RLYA 4PH4B 3MX3A 5A23A 3ABKE 5KNGA 3CHMA 2ETCA 3LVQE 3KS2A 1FPPA 4U95D 4XX5A 2CG3A 2H6HA 4UI9C 4H7YA 4LEUA 4NIKA 4U04A 1N11A 3T8MA 1KPSB 4XEIG 3B13A 2OEWA 2H6IA 3DWLG 2KZTB 4G1TA 2ZGDA 4I6JA 1V54E 5HKPA 2YHEA 4HLEA 1UJKA 4UI9J 5HQ8A 5B3SE 4L9PA 2XS1A 3E4BA 5JMND 1U2VG 2C0MA 2CHXA 4FC8A 5M72A 4BWRA 4HOSA 3D9KA 3CVPA 4AOFA 3PE4A 1E8WA 4FHJA 2KCVA 5ANLA 3LY9A 4GA0A 4G26A 5FWQA 1KT1A 2V4HC 4GZCA 2L9BA 5G04C 1L5JA 4K5BA 4N3CA 3RJVA 3HXEA 1SVXA 2AVPA 5HS0A 3FU3A 2BTDA 1HXIA 3JCKC 3OXGA 4JW1A 3HXFA 4UWFA 2P9NG 3B7TA 4O1PA 1Y6IA 5T3RA 2DBAA 1YYHA 5D0QD 5G04J 1PAQA 3JUEA 2R03A 4U96D 2IU1A 2OVBA 1KZPA 4J6IA 1A5EA 4PS3A 4HFGA 1ZB1A 4JC8A 3OTNA 2J49A 3F6QA 3TWUA 3UIPC 4F6RD 2GRQB 3ASNE 4HNAD 3L22A 2ONDA 3RIBA 3UQ3A 3HXDA 3JQ1A 3LYAA 3UIOC 4ME2A 5KJMA 3BG0B 2ZISA 2WM9A 3FHEA 1HFAA 4BT8A 4BFRA 1TN6A 3ZPJA 3RRUA 3PNLB 1ZU2A 4IN3B 4MRUA 3SI5A 4FA6A 3K9IA 4U8YD 2R2LA 1ELWA 4OAUC 3C3QA 2DZOA 4OVVA 2X6IA 1MZCA 5FQ7A 4Y6CA 3FUFA 4HQDA 3PEVB 2VGYA 3AG3E 2L0TB 1QBQA 1NL4A 1IYGA 4ILIA 1BD8A 3L6AA 2WXKA 4GZ6A 5ENSD 2P9PG 2PNNA 3IV0A 4DPRA 3CVNA
chains in the Genus database with same CATH topology
1SW6A 4TUMA 1DC2A 3JUEA 5EYLA 1N0QA 3B95A 4U96D 1IXVA 2ETCA 4QFVA 2VGEA 3HG0D 4OAUC 5ENRD 4U95D 1A5EA 1IKND 2F8YA 5HRYA 4BERA 1K1BA 3UXGA 3TWWA 4BSZB 4NIKA 4GPMA 4CYMD 3V31A 4K5CA 1N11A 4F1PA 5AN8A 3TWTA 2F8XK 3TWVA 3EHQA 4A63B 3V2OA 2BKGA 3TWRA 3F6QA 1K1AA 4ATZD 4C48B 5FIOA 5CEAA 3NBNB 3TWUA 5CBOA 1BU9A 2BKKB 1MYOA 3D9HA 5ENPD 2ETBA 2XZTG 4BETA 5AAOA 4F6RD 2MYOA 3SO8A 2ZGDA 4DX2A 1MX6A 4HNAD 4DX6D 2QC9A 1BI8B 5HKPA 5AQAA 5EIBE 4CZ2D 1WDYA 4DRXE 3JXIA 4ZFHA 4DX5D 2V5QC 4DUIA 2KBXA 5KBAA 3NOCD 5ITZF 4YDYA 3EU9A 3Q9NC 5BXOA 4LSZE 3ZU7B 5CEDB 2A5EA 3V79K 3JXJA 4HRNA 4K5AB 4U8VD 4DX7D 2FO1E 4HRLA 2QYJA 4HRMB 4G8KA 2XEEA 3AJIA 5JMND 5CERB 5AQ9A 2AJAA 3ZUVB 4DX1A 5D66A 1K3ZD 1S70B 3AAAC 2ZGGA 4HB5A 1AWCB 4HBDA 1BLXB 3KEAA 2Y0BG 1MX2A 1N0RA 1TR4A 1IHBA 3NOGD 2P2CP 2KXPC 5EILA 5FINA 4Z68A 4YDWA 4O1OA 2F37A 3DEOA 3V2XA 5EYPF 3W9GA 5ENTD 2RFMA 3J5PA 2HE0A 4HI8A 3TWXA 3EHRA 4B93B 1G3NB 5AQ7A 4BEPA 1OT8A 4J7WA 5BXUA 5ENOD 3UI2A 1YMPA 2JABA 2V4HC 5ENQD 1DCQA 4LNUD 5KNHD 5CBNA 2DZNA 4U8YD 3V30A 3J5QB 2DWZA 2RFAA 4GMRA 2DVWA 2DZOA 2XEHA 4K5BA 5EN5D 2L6BA 3TWSA 3DEPA 1NFIE 4ZHBA 5KWDA 1D9SA 1MX4A 1SVXA 2XENA 1MJ0A 5HS0A 4HQDA 4UUCA 2Y1LE 3ZNGA 2NYJA 3HRAA 5CECB 1YCSB 2ETAA 4O60A 1OY3D 1WG0A 3IXEA 4N5QA 5JA4D 4QQIA 4HI9A 4JB8P 3B7BA 5AQBA 4O1PA 5AARA 3W9FA 1BI7B 4LG6A 3LJNA 1UOHA 1BD8A 5ENSD 2J8SD 1AP7A 1YYHA 5EIDA 2B0OE 2PNNA 4RLYA 1QYMA 4HLLA 4G8LA 4J8YA 3TWQA 3C5RA 2XZDG 3Q9UC 4OAVB 4BESA 3ZKJA 3T9KA 3UTMA 5KNGA 3T8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SW6 A;  4TUM A;  1DC2 A;  3JUE A;  5EYL A;  1N0Q A;  3B95 A;  4U96 D;  1IXV A;  2ETC A;  4QFV A;  2VGE A;  3HG0 D;  4OAU C;  5ENR D;  4U95 D;  1A5E A;  1IKN D;  2F8Y A;  5HRY A;  4BER A;  1K1B A;  3UXG A;  3TWW A;  4BSZ B;  4NIK A;  4GPM A;  4CYM D;  3V31 A;  4K5C A;  1N11 A;  4F1P A;  5AN8 A;  3TWT A;  2F8X K;  3TWV A;  3EHQ A;  4A63 B;  3V2O A;  2BKG A;  3TWR A;  3F6Q A;  1K1A A;  4ATZ D;  4C48 B;  5FIO A;  5CEA A;  3NBN B;  3TWU A;  5CBO A;  1BU9 A;  2BKK B;  1MYO A;  3D9H A;  5ENP D;  2ETB A;  2XZT G;  4BET A;  5AAO A;  4F6R D;  2MYO A;  3SO8 A;  2ZGD A;  4DX2 A;  1MX6 A;  4HNA D;  4DX6 D;  2QC9 A;  1BI8 B;  5HKP A;  5AQA A;  5EIB E;  4CZ2 D;  1WDY A;  4DRX E;  3JXI A;  4ZFH A;  4DX5 D;  2V5Q C;  4DUI A;  2KBX A;  5KBA A;  3NOC D;  5ITZ F;  4YDY A;  3EU9 A;  3Q9N C;  5BXO A;  4LSZ E;  3ZU7 B;  5CED B;  2A5E A;  3V79 K;  3JXJ A;  4HRN A;  4K5A B;  4U8V D;  4DX7 D;  2FO1 E;  4HRL A;  2QYJ A;  4HRM B;  4G8K A;  2XEE A;  3AJI A;  5JMN D;  5CER B;  5AQ9 A;  2AJA A;  3ZUV B;  4DX1 A;  5D66 A;  1K3Z D;  1S70 B;  3AAA C;  2ZGG A;  4HB5 A;  1AWC B;  4HBD A;  1BLX B;  3KEA A;  2Y0B G;  1MX2 A;  1N0R A;  1TR4 A;  1IHB A;  3NOG D;  2P2C P;  2KXP C;  5EIL A;  5FIN A;  4Z68 A;  4YDW A;  4O1O A;  2F37 A;  3DEO A;  3V2X A;  5EYP F;  3W9G A;  5ENT D;  2RFM A;  3J5P A;  2HE0 A;  4HI8 A;  3TWX A;  3EHR A;  4B93 B;  1G3N B;  5AQ7 A;  4BEP A;  1OT8 A;  4J7W A;  5BXU A;  5ENO D;  3UI2 A;  1YMP A;  2JAB A;  2V4H C;  5ENQ D;  1DCQ A;  4LNU D;  5KNH D;  5CBN A;  2DZN A;  4U8Y D;  3V30 A;  3J5Q B;  2DWZ A;  2RFA A;  4GMR A;  2DVW A;  2DZO A;  2XEH A;  4K5B A;  5EN5 D;  2L6B A;  3TWS A;  3DEP A;  1NFI E;  4ZHB A;  5KWD A;  1D9S A;  1MX4 A;  1SVX A;  2XEN A;  1MJ0 A;  5HS0 A;  4HQD A;  4UUC A;  2Y1L E;  3ZNG A;  2NYJ A;  3HRA A;  5CEC B;  1YCS B;  2ETA A;  4O60 A;  1OY3 D;  1WG0 A;  3IXE A;  4N5Q A;  5JA4 D;  4QQI A;  4HI9 A;  4JB8 P;  3B7B A;  5AQB A;  4O1P A;  5AAR A;  3W9F A;  1BI7 B;  4LG6 A;  3LJN A;  1UOH A;  1BD8 A;  5ENS D;  2J8S D;  1AP7 A;  1YYH A;  5EID A;  2B0O E;  2PNN A;  4RLY A;  1QYM A;  4HLL A;  4G8L A;  4J8Y A;  3TWQ A;  3C5R A;  2XZD G;  3Q9U C;  4OAV B;  4BES A;  3ZKJ A;  3T9K A;  3UTM A;  5KNG A;  3T8K A; 
#chains in the Genus database with same CATH topology
 1E8X A;  4EEC A;  3CQG B;  2FF4 A;  4KMO A;  2VGE A;  3L13 A;  3UUX A;  4FAD A;  4TV3 A;  4CGV A;  1S64 A;  3UT8 A;  5AN8 A;  2F8X K;  4B89 A;  2OVF A;  5LX8 A;  1PY1 A;  2DYS E;  1N52 A;  1BU9 A;  2PM7 A;  1O1R A;  4LNG A;  5J90 A;  5AAO A;  3ESL A;  3DSX A;  4DX6 D;  4A1G A;  5CMY A;  3TAX A;  4EHM A;  1OCC E;  3ZYM A;  2IY0 C;  4EBA A;  4NQ0 A;  3QDN A;  3HXB A;  4JHK A;  1QNF A;  3NOC D;  2J08 A;  1FCH A;  3JXJ A;  3ZYL A;  4HRM B;  3ASF A;  4YDO A;  2AJA A;  3ZUV B;  4GA1 A;  3UM2 A;  2ZGG A;  3LY8 A;  4UWL A;  4JD2 G;  3DEO A;  4L1B A;  1N4Q A;  4JA7 A;  3J5P A;  3FTZ A;  4G24 A;  5EX0 A;  5BXU A;  3FFL A;  1H6P A;  2DZN A;  2DWZ A;  1N4P A;  1QQE A;  2CFU A;  4I6G A;  2IO3 C;  4AXH A;  1O1T A;  2VSY A;  2A5U A;  1IQU A;  3DSV A;  3SHF A;  2XRZ A;  3MV3 B;  3Q7A A;  3W9F A;  4LG6 A;  4XI9 A;  3ASD A;  3ZN3 A;  2XQ0 A;  2OV8 A;  2FO7 A;  3QAQ A;  1A17 A;  4DLO A;  3FUM A;  4EBA G;  3CK8 A;  4MBG A;  3QK0 A;  4AEZ C;  2P58 C;  2XHE A;  2F8Y A;  5HRY A;  3CEQ A;  1SZA A;  3UXG A;  1FT1 A;  3C98 A;  2PM6 A;  4F1S A;  3DXK G;  3EHQ A;  4Y6W A;  3VTY A;  3TWR A;  3Q15 A;  3PEU B;  3D9H A;  2XZT G;  3QOU A;  3SO8 A;  2C2L A;  3FH5 A;  3MV2 B;  2OOE A;  4I9E A;  3UPV A;  4CGW A;  3S7B A;  4HOT A;  3SFZ A;  3QWP A;  3CGH A;  1OCZ E;  3P1U A;  3Q5M A;  3DSS A;  4EPZ A;  4N39 A;  2P2C P;  3D9L A;  1HE8 A;  2QFC A;  3AU4 A;  3GZ1 A;  3EHR A;  2WMN A;  1OWM A;  2OCC E;  3VLE A;  2VSX E;  4YND A;  3ZHE B;  4LNU D;  2Y69 E;  2IO2 C;  2RFA A;  5C1D A;  2DVW A;  4U0U A;  1D9S A;  1HZ4 A;  2MOW A;  3D9P A;  4GZ3 A;  3SBT B;  3S7J A;  3ZNG A;  4K03 A;  3AS5 A;  3ONL A;  4TXQ A;  3ZFW A;  4JB8 P;  2ZXW E;  5KJL A;  4I1A A;  5BV1 A;  4J8S A;  1UOH A;  3PZ4 A;  3NZU A;  2B0O E;  3AG4 E;  4M3O A;  4HOU A;  1IXV A;  3IKO B;  3UKR G;  4RG9 A;  4ACL A;  2CG2 A;  2IOS A;  3LDZ A;  1IQR A;  4GTM A;  4L2L A;  2XPZ A;  4GB9 A;  3DXM G;  5AJL A;  3MKQ A;  2UY1 B;  2WXF A;  2I9C A;  5FQ6 A;  4TUU A;  3AS8 A;  5AIJ A;  2MYO A;  4UWH A;  4JA9 A;  1H6O A;  3Q75 A;  1QZ2 A;  3QNK A;  2PQN A;  1WAO 1;  4ZFH A;  4IRU A;  2X3M A;  4GCN A;  4C9B B;  2AXV A;  3LJ3 A;  4U8V D;  1DVP A;  4HVB A;  4UWK A;  3D9O A;  4PDX A;  3V2X A;  1N94 A;  3JQ0 A;  3PRZ A;  4B94 A;  5T8I A;  1E8Z A;  1H19 A;  3RRN B;  1Z5S C;  3V30 A;  3KSL A;  2P9S G;  2WXL A;  1ELR A;  1MJ0 A;  1ELK A;  5ANR A;  1YCS B;  3NQP A;  4GYY A;  4HI9 A;  5AQB A;  1TNY A;  5AAR A;  3RRM B;  5FTP A;  3Q4A B;  4CDN A;  2ZIR A;  4HOR A;  2X6F A;  2J8S D;  4CDM A;  1H2T C;  3U66 A;  3SQV A;  3C5R A;  4N3A A;  4OAV B;  5CCM A;  1SW6 A;  2MRI A;  3VLD A;  4YVQ C;  1S0P A;  4TRQ A;  3HIZ A;  4KXK B;  5B1A E;  1P5Q A;  4GYW A;  4CEM A;  4BER A;  4BSZ B;  5EDS A;  3CHP A;  4N2Q A;  2DYR E;  2VTB B;  3V2O A;  2VYI A;  2QY7 A;  3JUI A;  3SZ7 A;  3I4G A;  5CEA A;  3N71 A;  3Q79 A;  4LRZ A;  5ENP D;  3EUV A;  1OUV A;  3CVW A;  3TL5 A;  1N4S A;  4G2V A;  4WUY A;  1JWF A;  2J4D A;  1JUQ A;  3ZYK A;  3Q9N C;  3ZU7 B;  3ZYQ A;  2R59 A;  2R02 A;  4O6F A;  2QYJ A;  4RG6 A;  5AQ9 A;  3KAE A;  1ZBP A;  5D66 A;  1NI1 A;  3ZGQ A;  1N0R A;  5EIL A;  3LEW A;  3X2Q E;  4C0M A;  2GRN B;  4GTT A;  3FTV A;  3DPD A;  3FEY A;  3ULE G;  3ZXS A;  2LUH A;  1NFI E;  3G2T A;  1MX4 A;  1EPU A;  3ONK A;  3CKB A;  3QAR A;  3O48 A;  2Y3A A;  1SA5 A;  4MS6 A;  1VDY A;  2XGM A;  4GTV A;  3UMV A;  3ULY A;  1X5B A;  3DBS A;  3CHS A;  3C72 A;  3I3N A;  3HVE B;  2ZU6 B;  2XZD G;  3C3O A;  5EYL A;  4BY6 A;  4IYP A;  2KC7 A;  2L0I A;  3PUJ A;  3FU0 A;  1UW4 B;  2NC9 A;  1E7U A;  3TWW A;  4XKC A;  4ANU A;  4PUC A;  3CVQ A;  4F1P A;  3L16 A;  4U63 A;  3ZW3 A;  5EX3 A;  2RD0 A;  4ATZ D;  4GTQ A;  3NBN B;  4JPS A;  3CKC A;  3ENE A;  3MCX A;  2EIJ E;  2KCL A;  2BUG A;  2EIL E;  4FLB A;  4ILG A;  2LXL A;  2X6K A;  3E33 A;  4I1M A;  3BU8 A;  2I1J A;  3CVV A;  4TXR A;  4P29 A;  2VGX B;  2AW6 A;  3UM3 A;  2IOL A;  3CIA A;  5CED B;  5FZS A;  1EYH A;  4HRL A;  3GZS A;  2WPV A;  2J07 A;  4HBD A;  1BLX B;  1FT2 A;  4KVO A;  4O1O A;  2GRP B;  3D3M A;  4BEP A;  5HI7 A;  3L08 A;  3SBS A;  4APF A;  2HR2 A;  2XEH A;  4AVX A;  4X8Q A;  4JZY A;  3WXX A;  3EIJ A;  3QB2 A;  4AM9 A;  4RQI A;  2WXJ A;  2IEJ A;  3SNX A;  3HYM B;  1OCO E;  1JPL A;  1O1S A;  4LUN U;  3B7R L;  3APC A;  4V3I A;  4PS7 A;  1HO8 A;  1B89 A;  2QYU A;  5BUZ A;  2Y4T A;  4PS8 A;  1OXJ A;  4RSY A;  3ZKJ A;  2CHW A;  2Q7F A;  4MKT A;  5JHB A;  3B95 A;  1O5M A;  2WQ6 A;  3PRE A;  3URZ A;  4AIF A;  3PZD A;  5BPP A;  3ML9 A;  3PNT B;  4GCO A;  3LXU X;  2RKK A;  4R7L A;  3PVL A;  3TWV A;  3PZ1 A;  1TN8 A;  1Z3X A;  3LKU A;  2BKK B;  2YQ8 A;  4URK A;  1KT0 A;  1HG5 A;  4DLQ A;  5J08 A;  1E7V A;  4FUL A;  2H6G A;  4CZ2 D;  2AXU A;  3ESK A;  2ION A;  4YDY A;  3EU9 A;  1E90 A;  2H6F A;  3FY4 A;  2Y4U A;  3QC1 A;  5B1B E;  1K3Z D;  2YHC A;  4DI4 A;  3CLJ A;  3FUL A;  2I1K A;  3ISM C;  2RFM A;  3L82 A;  3EIQ C;  3GW4 A;  5AJD A;  4DJA A;  1EF1 C;  4EZJ A;  2F0Y A;  3Q7F A;  3TWS A;  2LAI A;  5EN5 D;  3BUA A;  3FUD A;  3RSE G;  1NP7 A;  4O60 A;  5AYW D;  1WG0 A;  5KJK A;  3FWV A;  5BV0 A;  3B7S A;  3Q9U C;  2AWI A;  1XNF A;  2MHK A;  5FZR A;  2R05 A;  2WXI A;  4EQF A;  4DI3 A;  4FJY A;  1LD7 A;  4I9C A;  2B6C A;  2YIN A;  2KZT A;  5ENN A;  3LY7 A;  4C48 B;  5FQ4 A;  1MHQ A;  4D10 C;  4J0U A;  2WB2 A;  3ML8 A;  3G2S A;  3RO3 A;  3FDH A;  4JXT A;  5T4Y A;  3SFY A;  2YNQ A;  2GRM A;  4H7X A;  3ASH A;  5BXO A;  3DST A;  2X6J A;  3SF4 A;  4ATG A;  2V8S E;  4GMJ A;  4G8K A;  3RAU A;  4U8H A;  4G11 A;  5LP0 A;  2IFU A;  2XPY A;  4CT4 A;  4B8C B;  4WNG A;  4HOQ A;  4YDW A;  2GGF A;  1D8E A;  3PDN A;  3Q73 A;  4APO A;  4WNE A;  2CFZ A;  3KSQ A;  1TNB A;  2LO6 A;  2RG8 A;  2XPI A;  3PH0 C;  4UQY A;  3IBE A;  1H2V C;  5D0O D;  5CBN A;  2X38 A;  3J5Q B;  2WMO A;  4GMR A;  3LPZ A;  2FBN A;  4KVM A;  1V55 E;  1NA3 A;  3FU6 A;  1TNZ A;  5C2Y A;  3PE3 A;  4HLL A;  4GYO A;  4TUM A;  2XCB A;  4KZ0 A;  2E0I A;  1N0Q A;  4KZC A;  2PL2 A;  1N4R A;  2WXG A;  4A63 B;  3FTS A;  3G2W A;  1K1A A;  2E2E A;  2WXN A;  5E76 A;  4CRW A;  3MA5 A;  1TN7 A;  2BF0 X;  2C0L A;  1OWL A;  4F3V A;  3P2B A;  4XIF A;  4BTB A;  4L7T A;  1DNP A;  5IY5 E;  1WDY A;  3QWW A;  2LSV A;  3NF1 A;  3L9T A;  2X6H A;  2EIM E;  2FO1 E;  4NRH B;  3DSW A;  2P9I G;  4EZL A;  3LVR E;  3I4R B;  2KXP C;  5FIN A;  4JL0 A;  4UWG A;  4Q94 A;  4BSX A;  3U64 A;  2XEV A;  5LOZ A;  3OXF A;  3IEG A;  5JJT A;  4JEU A;  5ENQ D;  4KT6 B;  1OWN A;  3DEP A;  3MJW A;  2FI7 A;  3BQO A;  4L23 A;  3PZ3 A;  2ETA A;  4N5Q A;  4QQI A;  3S7F A;  1H6K A;  4WWN A;  1JCQ A;  4NAC A;  3CK9 A;  4AV7 A;  4J8Y A;  5JHA A;  3UTM A;  1HU3 A;  3Q49 B;  4I6E A;  1GW6 A;  3HG0 D;  1RW2 A;  2LNI A;  1UJJ A;  5H7P A;  4BX9 A;  4K5C A;  1MQS A;  5JJ7 A;  1UG3 A;  3UM0 A;  2BKG A;  2L6J A;  3CHO A;  4C0E A;  3SFX A;  5FIO A;  2KM4 A;  2J09 A;  2EIK E;  2ETB A;  3WG7 E;  2XRY A;  3ZXP A;  4A3V A;  5AQA A;  5EIB E;  3RK6 A;  3CST A;  5LFA A;  5KBA A;  3UKU G;  3UX4 A;  3CHR A;  2V4L A;  1D8D A;  1LF8 A;  1TNU A;  5CER B;  4DX1 A;  1AWC B;  5CRU A;  2XGO A;  4U07 A;  1U3D A;  2IJG X;  2Y0B G;  4J8F A;  2F37 A;  3FUN A;  1N9A A;  2IF4 A;  4A1S A;  2WXH A;  5KNH D;  3U4T A;  2XS8 A;  3MGB A;  3IHV A;  1HX8 A;  3FH7 A;  4ANV A;  3MYV A;  3B7U X;  5KCM A;  1OY3 D;  1TJF A;  4CT0 A;  1BI7 B;  1IHG A;  2WQ7 A;  3FTW A;  3QWV A;  4YDE A;  3CHQ A;  4B0Z A;  3CVY A;  3VLF A;  4GU5 A;  3TWQ A;  5FQ8 A;  4FJZ A;  4L2Y A;  3D9I A;  3EHM A;  3T8K A;  1DC2 A;  4QFV A;  5G55 A;  1SA4 A;  4UQX A;  2GRL A;  5A7D B;  2V5F A;  3TWT A;  1LTX A;  3MZL B;  4YVO A;  2WXM A;  3FUJ A;  3CR3 A;  5CCL A;  2M63 A;  4FHK A;  1Z6T A;  2WXQ A;  1MX6 A;  2QC9 A;  3E30 A;  4JHJ A;  3ZEF A;  3MKR A;  4LER A;  4FP7 A;  1Q2Z A;  5ITZ F;  3ZIM A;  3UIN C;  4XKB A;  5DIZ A;  3AG1 E;  1TYQ G;  4W9R A;  5ARF A;  3RU0 A;  3AAA C;  1TR4 A;  1NZN A;  1NA0 A;  3ZHE A;  2R17 C;  1HG2 A;  3FP3 A;  4HI8 A;  3TWX A;  1JWG A;  4B93 B;  5AQ7 A;  4AP2 A;  4Q69 A;  4G23 A;  1OT8 A;  4K0R A;  1YMP A;  3RKV A;  1PC2 A;  5KWD A;  2L6B A;  1YA0 A;  2Y1L E;  3CV0 A;  1K8K G;  1LD8 A;  3UT7 A;  3AG2 E;  1BPO A;  4I17 A;  2VQ2 A;  4JHR A;  5CMW A;  3FTU A;  3S2A A;  1E8Y A;  1HF8 A;  2NXP A;  1IKN D;  4TXP A;  1UN8 A;  3Q47 B;  2UY1 A;  3GZ2 A;  1K1B A;  5BT1 A;  3ABM E;  3FUK A;  5FT9 A;  4CDR A;  1WY6 A;  3LS8 A;  2BED A;  3FU5 A;  1E96 B;  3NB2 A;  4WND A;  5DBK A;  4WNF A;  2A4Z A;  3MKQ B;  3JYS A;  1JCR A;  3FUE A;  4ANW A;  3JXI A;  5G05 C;  4LCT A;  4DUI A;  3E37 A;  4HRN A;  3G2U A;  3FH8 A;  2KCK A;  3QJZ A;  2IQC A;  5E75 A;  2VSO E;  2CHZ A;  3NZS A;  4DK5 A;  3PS6 A;  2WQH A;  4Q96 A;  5ARG A;  3ASO E;  2PQR A;  3C3R A;  5G05 J;  3FTY A;  3T5X A;  3KEZ A;  2GRO B;  3BEE A;  3FUI A;  1HH8 A;  2XEN A;  4U0S A;  4GTP A;  5CEC B;  4J8D A;  3IXE A;  5JA4 D;  4ABN A;  3U9W A;  2V0P A;  4NUR A;  3PUK A;  4N3B A;  3FEX A;  5EID A;  3OXL A;  4GZD A;  3T9K A;  3OAW A;  4M7C A;  4MLP A;  4ANX A;  3FUH A;  4OYS A;  2VTB A;  1X81 A;  3TJP A;  3KD7 A;  3CVX A;  2VSN A;  3ABL E;  4BX8 A;  4GPM A;  3V31 A;  4I43 A;  2AXZ A;  5LCW C;  1TNO A;  5FJY A;  1RZ4 A;  1MYO A;  4WAF A;  4AJW A;  2LAH A;  3NAW A;  4LNB A;  1BI8 B;  3R9A B;  4WWP A;  3CQC B;  3CK7 A;  3VTX A;  4HS2 A;  4AY6 A;  4DX5 D;  2V5Q C;  3U3W A;  3AS4 A;  4CCA A;  3TG5 A;  5D2M C;  5A6C A;  4DX7 D;  3AJI A;  5LCW J;  3SY2 A;  1N54 A;  2WVI A;  3CVU A;  1FVF A;  4Z68 A;  3W9G A;  4KBQ A;  4GTO A;  1N95 A;  2JAB A;  1HS6 A;  4XZ4 A;  4N2S A;  2LSU A;  5KJN A;  4N5C A;  1Z3Y A;  3HRA A;  3HVE A;  1OWP A;  3AU5 A;  4A55 A;  4ILH B;  4RVB A;  3LJN A;  4I2W A;  2WXP A;  2XCC A;  4BES A;  3TG4 A;  1TJC A;  3ZVV A;  3APD A;  2R5S A;  4GTR A;  3EU5 A;  5ENR D;  4A3T A;  2P9L G;  2GW1 A;  4BT9 A;  4CYM D;  3ZRH A;  5BW8 C;  2JLB A;  2HYZ A;  3SGH A;  1JCS A;  5BNW A;  2P9K G;  1SQM A;  4EZK A;  1H0A A;  3FTX A;  3UT4 A;  2VGX A;  2JEK A;  5CRV A;  4KYO B;  4GZ5 A;  4AY5 A;  3MEK A;  1S63 A;  4BTA A;  2KAT A;  2KBX A;  3ULQ A;  5FZQ A;  2HM8 A;  3EHN A;  2A5E A;  3V79 K;  1Y8M A;  3TGO A;  2XGS A;  2WXO A;  2EIN E;  4F53 A;  1S70 B;  3O4Z A;  3APF A;  4I2Z A;  3D9J A;  1TEZ A;  1IHB A;  3Q78 A;  3DRA A;  4GAA A;  5EYP F;  3ASG A;  3EDT B;  2HE0 A;  4U0Z A;  1SZ9 A;  3UM1 A;  1KLX A;  2DIW A;  2HO1 A;  4F7A A;  2ILR A;  4J7W A;  3BG1 B;  5ENO D;  3UI2 A;  5JJ6 A;  4ACK A;  4FLH A;  3EJN A;  4HXI A;  1OWO A;  2LXM A;  2P9U G;  4UUC A;  3TXN A;  5AEN A;  3CSF A;  3PZ2 A;  3GYZ A;  4GA2 A;  2UWJ G;  5EKQ D;  2FEZ A;  1DCE A;  4E6H A;  4OVU A;  4GML A;  3L54 A;  3R7R A;  1W3B A;  1AP7 A;  1QYM A;  4G8L A;  4GPK A;  3LCA A;  3DPY A;  4JVS A;  3DSU A;  5CHE E;  4UQZ A;  4WWO A;  2FUL A;  2GRR B;  2DCP A;  4U7E B;  2J4B A;  2PZI A;  3IHY A;  2OEV A;  3L17 A;  4XE0 A;  3HXC A;  3D9N A;  4I1O B;  3QKY A;  3E32 A;  4UI9 K;  5CBO A;  3S7D A;  3TXM A;  2WXR A;  1WM5 A;  3E34 A;  4BET A;  3G2V A;  3RO2 A;  1U3C A;  4DX2 A;  1UN9 A;  4IUL A;  2I6H A;  2VJ8 A;  3R7Q A;  4DRX E;  3HDX A;  4LSZ E;  4K5A B;  1XGW A;  2XEE A;  5G2N A;  2NSZ A;  2QZA A;  4HB5 A;  3KEA A;  1MX2 A;  4B8A A;  3NOG D;  3T5V A;  4GTS A;  4JEH A;  4XI0 A;  5ENT D;  2J9Q A;  3I5P A;  4G25 A;  1G3N B;  1KZO A;  3D9M A;  1DCQ A;  4E85 A;  1OCR E;  4ZHB A;  1H2U A;  3CVL A;  3HHM A;  1EDU A;  2NYJ A;  1INZ A;  3B7B A;  1FVH A;  2EQX A;  3R9M A;  2I2O A;  3SD5 A;  4FU3 A;  4J8E A;  4RLY A;  4PH4 B;  3MX3 A;  5A23 A;  3ABK E;  5KNG A;  3CHM A;  2ETC A;  3LVQ E;  3KS2 A;  1FPP A;  4U95 D;  4XX5 A;  2CG3 A;  2H6H A;  4UI9 C;  4H7Y A;  4LEU A;  4NIK A;  4U04 A;  1N11 A;  3T8M A;  1KPS B;  4XEI G;  3B13 A;  2OEW A;  2H6I A;  3DWL G;  2KZT B;  4G1T A;  2ZGD A;  4I6J A;  1V54 E;  5HKP A;  2YHE A;  4HLE A;  1UJK A;  4UI9 J;  5HQ8 A;  5B3S E;  4L9P A;  2XS1 A;  3E4B A;  5JMN D;  1U2V G;  2C0M A;  2CHX A;  4FC8 A;  5M72 A;  4BWR A;  4HOS A;  3D9K A;  3CVP A;  4AOF A;  3PE4 A;  1E8W A;  4FHJ A;  2KCV A;  5ANL A;  3LY9 A;  4GA0 A;  4G26 A;  5FWQ A;  1KT1 A;  2V4H C;  4GZC A;  2L9B A;  5G04 C;  1L5J A;  4K5B A;  4N3C A;  3RJV A;  3HXE A;  1SVX A;  2AVP A;  5HS0 A;  3FU3 A;  2BTD A;  1HXI A;  3JCK C;  3OXG A;  4JW1 A;  3HXF A;  4UWF A;  2P9N G;  3B7T A;  4O1P A;  1Y6I A;  5T3R A;  2DBA A;  1YYH A;  5D0Q D;  5G04 J;  1PAQ A;  3JUE A;  2R03 A;  4U96 D;  2IU1 A;  2OVB A;  1KZP A;  4J6I A;  1A5E A;  4PS3 A;  4HFG A;  1ZB1 A;  4JC8 A;  3OTN A;  2J49 A;  3F6Q A;  3TWU A;  3UIP C;  4F6R D;  2GRQ B;  3ASN E;  4HNA D;  3L22 A;  2OND A;  3RIB A;  3UQ3 A;  3HXD A;  3JQ1 A;  3LYA A;  3UIO C;  4ME2 A;  5KJM A;  3BG0 B;  2ZIS A;  2WM9 A;  3FHE A;  1HFA A;  4BT8 A;  4BFR A;  1TN6 A;  3ZPJ A;  3RRU A;  3PNL B;  1ZU2 A;  4IN3 B;  4MRU A;  3SI5 A;  4FA6 A;  3K9I A;  4U8Y D;  2R2L A;  1ELW A;  4OAU C;  3C3Q A;  2DZO A;  4OVV A;  2X6I A;  1MZC A;  5FQ7 A;  4Y6C A;  3FUF A;  4HQD A;  3PEV B;  2VGY A;  3AG3 E;  2L0T B;  1QBQ A;  1NL4 A;  1IYG A;  4ILI A;  1BD8 A;  3L6A A;  2WXK A;  4GZ6 A;  5ENS D;  2P9P G;  2PNN A;  3IV0 A;  4DPR A;  3CVN A; 
#chains in the Genus database with same CATH homology
 1SW6 A;  4TUM A;  1DC2 A;  3JUE A;  5EYL A;  1N0Q A;  3B95 A;  4U96 D;  1IXV A;  2ETC A;  4QFV A;  2VGE A;  3HG0 D;  4OAU C;  5ENR D;  4U95 D;  1A5E A;  1IKN D;  2F8Y A;  5HRY A;  4BER A;  1K1B A;  3UXG A;  3TWW A;  4BSZ B;  4NIK A;  4GPM A;  4CYM D;  3V31 A;  4K5C A;  1N11 A;  4F1P A;  5AN8 A;  3TWT A;  2F8X K;  3TWV A;  3EHQ A;  4A63 B;  3V2O A;  2BKG A;  3TWR A;  3F6Q A;  1K1A A;  4ATZ D;  4C48 B;  5FIO A;  5CEA A;  3NBN B;  3TWU A;  5CBO A;  1BU9 A;  2BKK B;  1MYO A;  3D9H A;  5ENP D;  2ETB A;  2XZT G;  4BET A;  5AAO A;  4F6R D;  2MYO A;  3SO8 A;  2ZGD A;  4DX2 A;  1MX6 A;  4HNA D;  4DX6 D;  2QC9 A;  1BI8 B;  5HKP A;  5AQA A;  5EIB E;  4CZ2 D;  1WDY A;  4DRX E;  3JXI A;  4ZFH A;  4DX5 D;  2V5Q C;  4DUI A;  2KBX A;  5KBA A;  3NOC D;  5ITZ F;  4YDY A;  3EU9 A;  3Q9N C;  5BXO A;  4LSZ E;  3ZU7 B;  5CED B;  2A5E A;  3V79 K;  3JXJ A;  4HRN A;  4K5A B;  4U8V D;  4DX7 D;  2FO1 E;  4HRL A;  2QYJ A;  4HRM B;  4G8K A;  2XEE A;  3AJI A;  5JMN D;  5CER B;  5AQ9 A;  2AJA A;  3ZUV B;  4DX1 A;  5D66 A;  1K3Z D;  1S70 B;  3AAA C;  2ZGG A;  4HB5 A;  1AWC B;  4HBD A;  1BLX B;  3KEA A;  2Y0B G;  1MX2 A;  1N0R A;  1TR4 A;  1IHB A;  3NOG D;  2P2C P;  2KXP C;  5EIL A;  5FIN A;  4Z68 A;  4YDW A;  4O1O A;  2F37 A;  3DEO A;  3V2X A;  5EYP F;  3W9G A;  5ENT D;  2RFM A;  3J5P A;  2HE0 A;  4HI8 A;  3TWX A;  3EHR A;  4B93 B;  1G3N B;  5AQ7 A;  4BEP A;  1OT8 A;  4J7W A;  5BXU A;  5ENO D;  3UI2 A;  1YMP A;  2JAB A;  2V4H C;  5ENQ D;  1DCQ A;  4LNU D;  5KNH D;  5CBN A;  2DZN A;  4U8Y D;  3V30 A;  3J5Q B;  2DWZ A;  2RFA A;  4GMR A;  2DVW A;  2DZO A;  2XEH A;  4K5B A;  5EN5 D;  2L6B A;  3TWS A;  3DEP A;  1NFI E;  4ZHB A;  5KWD A;  1D9S A;  1MX4 A;  1SVX A;  2XEN A;  1MJ0 A;  5HS0 A;  4HQD A;  4UUC A;  2Y1L E;  3ZNG A;  2NYJ A;  3HRA A;  5CEC B;  1YCS B;  2ETA A;  4O60 A;  1OY3 D;  1WG0 A;  3IXE A;  4N5Q A;  5JA4 D;  4QQI A;  4HI9 A;  4JB8 P;  3B7B A;  5AQB A;  4O1P A;  5AAR A;  3W9F A;  1BI7 B;  4LG6 A;  3LJN A;  1UOH A;  1BD8 A;  5ENS D;  2J8S D;  1AP7 A;  1YYH A;  5EID A;  2B0O E;  2PNN A;  4RLY A;  1QYM A;  4HLL A;  4G8L A;  4J8Y A;  3TWQ A;  3C5R A;  2XZD G;  3Q9U C;  4OAV B;  4BES A;  3ZKJ A;  3T9K A;  3UTM A;  5KNG A;  3T8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...