1BU9A

Solution structure of p18-ink4c, 21 structures
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
168
structure length
168
Chain Sequence
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYCLIN-DEPENDENT KINASE 6 INHIBITOR)
publication title Tumor suppressor INK4: determination of the solution structure of p18INK4C and demonstration of the functional significance of loops in p18INK4C and p16INK4A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 38
structure length 168
sequence length 168
ec nomenclature
pdb deposition date 1998-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1bu9A00
2KBXA 1A5EA 1K3ZD 2ZGGA 4K5BA 3HRAA 3UI2A 4ZHBA 4DX1A 3V79K 1OY3D 3V2XA 2F8YA 1YMPA 3T8KA 4ZFHA 4J7WA 4YDYA 3UXGA 2XEHA 4CZ2D 4BSZB 5HS0A 3D9HA 4JB8P 5CERB 4U95D 4DUIA 4OAVB 2P2CP 2RFMA 3AAAC 4K5AB 1G3NB 3TWXA 3ZKJA 3W9GA 4DX5D 5AQ9A 5ITZF 2QYJA 3TWUA 4F6RD 1WDYA 2Y1LE 1SVXA 3V30A 4B93B 2NYJA 5D66A 2VGEA 1IKND 4YDWA 3NBNB 1D9SA 5EN5D 5FINA 4QFVA 1YCSB 3TWRA 5AN8A 1K1AA 2Y0BG 1UOHA 5ENSD 5HRYA 1YYHA 1BD8A 4O1PA 1BI8B 2F37A 3J5PA 5JMND 2V5QC 2ETAA 4GPMA 4CYMD 2XEEA 3B7BA 5EIDA 4C48B 4DRXE 1IHBA 5KWDA 1MX2A 3F6QA 2B0OE 3V2OA 4HB5A 3TWWA 1N11A 2L6BA 2BKKB 3TWVA 1K1BA 5CEAA 4U8YD 5AARA 3TWTA 4RLYA 1SW6A 2FO1E 4DX6D 3V31A 2J8SD 3NOGD 4G8KA 4HI9A 4BETA 5AAOA 1DC2A 3Q9UC 2V4HC 2HE0A 4QQIA 5BXOA 3HG0D 2BKGA 4UUCA 5CBNA 4HNAD 4O1OA 2ETBA 3DEOA 3IXEA 4LG6A 2F8XK 1N0RA 4Z68A 3UTMA 5CECB 5EYPF 3C5RA 2DZNA 3J5QB 4OAUC 3EHQA 5AQBA 5EYLA 3DEPA 4F1PA 4GMRA 1MYOA 3AJIA 4HRNA 3T9KA 4BERA 5AQ7A 1MJ0A 2JABA 3KEAA 5ENTD 5BXUA 2XZDG 2DVWA 5ENPD 3EU9A 4TUMA 1AWCB 2MYOA 4J8YA 4HI8A 4LNUD 4U96D 4N5QA 3NOCD 1IXVA 3W9FA 2AJAA 4LSZE 2ETCA 2XZTG 3LJNA 4HLLA 2DZOA 1BU9A 1WG0A 5ENQD 3TWQA 3Q9NC 1NFIE 5EILA 1QYMA 2DWZA 4HQDA 3B95A 4HBDA 3ZNGA 1TR4A 3TWSA 4BEPA 3JXJA 3ZUVB 4ATZD 5CBOA 3ZU7B 1OT8A 1BLXB 4DX2A 3EHRA 1MX6A 2QC9A 4O60A 5ENRD 1MX4A 2ZGDA 2XENA 1AP7A 3JUEA 2RFAA 4HRLA 4U8VD 2A5EA 4K5CA 4BESA 5JA4D 2KXPC 4G8LA 5KNHD 5CEDB 1BI7B 5AQAA 4DX7D 4A63B 1DCQA 1S70B 5HKPA 5KBAA 2PNNA 1N0QA 5FIOA 5ENOD 5EIBE 4HRMB 4NIKA 3SO8A 3JXIA 5KNGA
chains in the Genus database with same CATH superfamily
5BV0A 1IQUA 3OXLA 1U2VG 4DLQA 3T8KA 4ANVA 1Y6IA 3RRNB 1E90A 3BUAA 4DUIA 3MV2B 2FI7A 3CK7A 3ZRHA 2OEWA 4YDEA 2AWIA 4IN3B 3APFA 2Y0BG 4YVQC 3PH0C 5ENSD 2X6FA 1KZPA 4G25A 4X8QA 4JA9A 1WAO1 3RAUA 4DLOA 1TN8A 5FJYA 1K1BA 4BETA 2Y4UA 3I4GA 1PY1A 4QQIA 2Q7FA 1S0PA 3LDZA 4HNAD 4FP7A 1N52A 2WMNA 4ME2A 1IYGA 4WAFA 2IQCA 1U3CA 3S2AA 5AQ7A 3B13A 1AWCB 4F3VA 2L0IA 3D9LA 3PS6A 3FEYA 3QB2A 2HM8A 3IHVA 3TWQA 2V4LA 2EIJE 5CMWA 3CVYA 5CBOA 3MYVA 1Z3YA 3CSFA 3HYMB 1MX6A 4NRHB 4GB9A 4AY5A 4G23A 3UX4A 2A5EA 3BU8A 3SFYA 4RG9A 4EZJA 2FBNA 3D9IA 3UI2A 4DX1A 3UM0A 1H6OA 1WM5A 4KVOA 2VYIA 2FO7A 4E6HA 4JD2G 1ZBPA 2A5UA 1N4QA 1IKND 2OCCE 3D3MA 1E8WA 3CHOA 3HHMA 1BI8B 5JMND 3FU3A 3FH5A 2KCVA 5KWDA 3HVEB 1EDUA 5CRVA 5AAOA 3CV0A 2HE0A 4EBAA 3E30A 2IY0C 4UUCA 3IXEA 1OWMA 4GMLA 3SZ7A 5CECB 3C5RA 1MYOA 3T9KA 2DBAA 4CDNA 4J6IA 3KEAA 5G04C 3EU9A 4L2LA 4AOFA 3T5XA 3LJNA 5KJKA 5FTPA 5EKQD 3LVRE 5BT1A 5FQ4A 4UQZA 1EPUA 3Q5MA 3KSQA 1RW2A 3ZNGA 3ZXSA 3ASNE 2GRPB 3NZUA 1Y8MA 4KT6B 2X6HA 2MRIA 5EX3A 1TN7A 3B7SA 1EF1C 3LYAA 3ML8A 4K5CA 1N4PA 1V55E 5G55A 3ASFA 4XZ4A 2KXPC 3I5PA 5ARGA 1S70B 3UT7A 5ENOD 4K03A 4WUYA 1O1RA 3JXIA 2DYRE 2P9SG 3DSWA 3E32A 3QOUA 1OCZE 5HS0A 3LY8A 3D9HA 1FT2A 3RIBA 2YINA 1OWNA 3LS8A 5G05C 3EDTB 3V30A 4AY6A 3ABLE 4XEIG 1O1TA 2L0TB 4I43A 3FU5A 1ZB1A 1YYHA 3FUHA 1E7UA 4GCOA 3TL5A 1XGWA 4NQ0A 3TXNA 3V31A 2J8SD 3NOGD 4NACA 3ASDA 4JHRA 2BKGA 3VLEA 3UT4A 3UTMA 4FLHA 1O5MA 5AJLA 2DZNA 5AQBA 3MJWA 4HRNA 2R5SA 3DXMG 3FUEA 2J08A 3EHMA 2WXOA 3FP3A 3G2WA 3KD7A 4LNUD 4U96D 3CVQA 1IXVA 2CHZA 2E0IA 2WXIA 3ABKE 2I1KA 1Z6TA 2WXQA 1TN6A 4FADA 1Z3XA 4I6JA 3CKCA 4FA6A 4U7EB 2PL2A 2HYZA 5DBKA 2P9KG 4XKBA 4DX7D 1JCQA 2XCCA 5HI7A 5KBAA 4HOQA 3RK6A 4XX5A 3MGBA 4UWGA 2HR2A 1HG5A 1SZ9A 1DVPA 3GZ2A 4JEUA 3PZ4A 4APOA 4B89A 2LAIA 4OAVB 2BTDA 2RFMA 2IO2C 3W9GA 1N9AA 2LO6A 3DPDA 3K9IA 1H2TC 3D9MA 4GTRA 3NBNB 5EN5D 2R03A 1FPPA 3FHEA 3ONLA 2FF4A 2GGFA 1B89A 2QY7A 4GPMA 5EIDA 1MX2A 3DRAA 3DSSA 3TWTA 4FJZA 1U3DA 5FZRA 2KCLA 2DCPA 4Z68A 2Y3AA 2LXLA 4B94A 4PUCA 3DSVA 4GMRA 3AJIA 2PM7A 3L22A 2XZDG 2VSXE 3BEEA 1TJCA 4HLLA 3CQGB 1YA0A 2J4DA 2AXUA 3AG2E 1HH8A 4CT0A 3JXJA 1HG2A 4E85A 4J8FA 2LNIA 3ZYKA 4AEZC 3DSUA 3OTNA 2IOLA 1X5BA 3ESKA 4YVOA 2C0LA 4HOUA 4ANXA 4J8EA 1TEZA 4Q69A 4A63B 2WQ6A 2OV8A 4RG6A 4B8CB 3BG1B 2PNNA 4APFA 1H2UA 4XKCA 2KBXA 4K5BA 3PZ3A 3SD5A 3FTUA 4DX5D 2WXLA 2X6KA 4YDOA 3CK8A 3FEXA 2ZIRA 3TWUA 4GAAA 3CR3A 3E34A 3FTWA 4PS7A 3ULEG 5AN8A 4WWOA 1H19A 1K8KG 4I1MA 3ULYA 3PUKA 4GZ5A 4G26A 4I6EA 4LERA 4FC8A 3ZEFA 3ASHA 2BKKB 2FO1E 1PC2A 3HG0D 4W9RA 1JCSA 4Y6WA 5D0OD 1N95A 1H6KA 2XGMA 3LKUA 1PAQA 2KCKA 3QWWA 5ENPD 2XPYA 2KC7A 3N71A 3CQCB 4HI8A 5B1AE 3W9FA 3MZLB 3T5VA 2ETCA 2DZOA 4N2SA 3IHYA 5IY5E 4G2VA 4AVXA 1V54E 3MX3A 3UM1A 3UINC 5C1DA 4JW1A 3QK0A 4G11A 4RSYA 3MKRA 1OUVA 3HDXA 4GTTA 3QWVA 5LOZA 1OWPA 3QC1A 5HKPA 3QAQA 2XEVA 4I17A 2M63A 2XS1A 3HXBA 1K3ZD 4GTSA 4H7XA 2I6HA 4TRQA 1TJFA 4ACKA 5BPPA 3JYSA 4GTVA 4A1SA 3MKQB 1DNPA 1UN9A 3SFXA 3CHRA 1TNZA 1NL4A 2WXJA 1UOHA 1P5QA 4BT8A 2F37A 4DI3A 2UY1B 4BX8A 1IHBA 1NA0A 1OWLA 4FU3A 3F6QA 5JJ6A 2ZXWE 3TWVA 4BTBA 3CGHA 2OOEA 2F8XK 1N0RA 4LUNU 4D10C 1S64A 4UI9J 1MHQA 3HVEA 1E8YA 3EJNA 1SA4A 4LSZE 1XNFA 5T3RA 2J09A 1NFIE 2R05A 4G1TA 1RZ4A 3DBSA 3ZUVB 2EQXA 2NXPA 3SNXA 3CIAA 2J49A 1AP7A 3ASGA 3JUEA 3G2SA 3CVLA 1BI7B 3U66A 2MOWA 4A3TA 2WXRA 4XIFA 5FQ7A 1D8DA 5KNGA 1FT1A 1UJKA 2F8YA 3G2UA 3X2QE 2ILRA 2QYUA 3AS8A 4LEUA 4RVBA 1TNYA 3CEQA 1TNUA 3CHMA 3OXFA 3S7FA 1JWGA 4OYSA 4EZKA 3TAXA 4DRXE 4RQIA 4CCAA 5FT9A 1ELWA 4OVVA 3DWLG 4KMOA 3FU0A 2QZAA 2PQRA 5T4YA 4HVBA 1ELRA 3R9MA 4FHJA 4PS8A 3HXFA 5BV1A 3DEPA 4TUMA 4FLBA 2MYOA 4I1AA 4ANWA 4CEMA 3DSTA 1LF8A 4AP2A 4BFRA 1BU9A 2WVIA 5EILA 1QYMA 4HQDA 3MEKA 3T8MA 4ATZD 3ZU7B 3LY9A 2OVBA 2IFUA 1JWFA 3R7RA 2ZGDA 4GZDA 5D2MC 4F7AA 1SZAA 3GW4A 3SI5A 3GYZA 5FWQA 4GTOA 1LD7A 5CHEE 3UIOC 3ZHEB 2ZISA 1N4SA 3URZA 1KT1A 3SHFA 1O1SA 5LCWJ 3Q78A 1H2VC 2IJGX 3UXGA 1IHGA 4AXHA 3TWXA 3D9PA 1OCCE 3CHPA 1E8ZA 4ABNA 3ML9A 1ELKA 4K0RA 4IULA 5J90A 2YHEA 3ISMC 1W3BA 4PDXA 3UIPC 2AVPA 3D9JA 4UWLA 2XRZA 5A7DB 4DPRA 3V2OA 4F1SA 3QNKA 3ZPJA 4RLYA 3HIZA 3ASOE 1HX8A 3ZYMA 4DJAA 1EYHA 3JUIA 4L2YA 2RG8A 5CRUA 4N3CA 2ETBA 4JHJA 2WXMA 3ZW3A 1WY6A 3J5QB 4Y6CA 4HOSA 3UM2A 4BERA 4U07A 1MJ0A 2P9NG 4BTAA 4BX9A 4LNGA 1LD8A 1L5JA 2VSYA 3L9TA 2J9QA 4MS6A 1Q2ZA 4UWHA 3QWPA 3O48A 4JPSA 1QQEA 3IV0A 5E75A 3ZN3A 4JZYA 4L9PA 4IRUA 1BLXB 3PE3A 3PZDA 2XCBA 3PRZA 3Q7AA 1MX4A 3CK9A 3L54A 4DK5A 4KYOB 3QDNA 5AENA 1KT0A 2WPVA 3LCAA 1OCOE 4CGVA 5AIJA 2ZGGA 2EIME 3FUIA 4MBGA 1UG3A 4ZFHA 2CG2A 4J7WA 1GW6A 5J08A 3UPVA 2LUHA 4GZCA 2BEDA 1WDYA 3CLJA 1SVXA 2NYJA 2ONDA 1HE8A 3J5PA 4TXRA 2R59A 3FUFA 3ZGQA 4XI9A 4I9CA 4UQYA 3FUKA 1SQMA 3C98A 3LXUX 1UW4B 2X3MA 3JQ1A 4JVSA 5CBNA 4Q96A 2P9PG 4GA1A 5CCMA 4LRZA 3ZIMA 2XHEA 2B6CA 2WXFA 4KVMA 4J8YA 4U0ZA 1QBQA 1H6PA 2AJAA 2CFZA 3Q7FA 1E96B 5ENQD 2CG3A 1TNOA 4JEHA 2DWZA 3TG5A 4HBDA 2YQ8A 2NC9A 2WXNA 5FZQA 4EPZA 4EQFA 3PUJA 2WQ7A 4O60A 5BUZA 4CT4A 3CVUA 3PNLB 3NF1A 1N54A 4ILHB 3R7QA 4YNDA 4WWPA 5KNHD 4JXTA 5AQAA 3FUMA 4NIKA 5EDSA 4BY6A 1HS6A 3S7JA 3KAEA 2JEKA 1A17A 2XEHA 2F0YA 3C3RA 3MCXA 2QFCA 2IEJA 2MHKA 2CHWA 1LTXA 2QYJA 4F6RD 3D9NA 1E7VA 3Q4AB 4UWKA 2CHXA 4QFVA 1K1AA 1UN8A 3PZ2A 4GMJA 3WG7E 4A55A 1HFAA 1ZU2A 2R17C 3L16A 1TNBA 5HQ8A 2OVFA 4HB5A 3B7UX 3MKQA 1BPOA 4OAUC 4C9BB 2I2OA 4GZ6A 4GYOA 1VDYA 1X81A 3FTSA 3PEUB 5FZSA 2VSNA 4N39A 5G04J 5JHBA 2UY1A 2VSOE 2RD0A 2HO1A 3UKRG 2VQ2A 4F53A 4HORA 5ENTD 4B8AA 1N4RA 2H6IA 4N5QA 4L23A 3RO3A 2LAHA 4MRUA 1WG0A 3Q47B 3FUDA 3APCA 3NAWA 3B95A 4ILIA 3SBSA 4DX2A 2BF0X 3L82A 3ZFWA 4TXQA 4AM9A 3TG4A 4M3OA 5CEDB 2VJ8A 4CDRA 5FIOA 3LVQE 4HRMB 3ZXPA 4AIFA 3L6AA 3I3NA 2LSVA 4ZHBA 3L13A 4MLPA 1OY3D 1YMPA 5G05J 5KJNA 3I4RB 3AS5A 3PVLA 3UUXA 2P2CP 3Q15A 3OAWA 2IF4A 3D9OA 2EINE 5ARFA 3DPYA 4KXKB 5FQ6A 4O1PA 3RRUA 3TXMA 1HF8A 3O4ZA 4U04A 2J4BA 3B7BA 2WMOA 4HLEA 5C2YA 4UWFA 3EIJA 2XPIA 4L1BA 3VLFA 5AARA 1SW6A 3APDA 5BNWA 3U9WA 4LG6A 5EX0A 1MQSA 3FTYA 5G2NA 4C0MA 3ONKA 3FH7A 5KCMA 2LSUA 3AU4A 4GTPA 4EZLA 3C72A 3AS4A 1OT8A 2R02A 2X6IA 2QC9A 5ENRD 3ABME 3FDHA 3U3WA 4GTQA 4GA0A 3RJVA 4PS3A 4BESA 4V3IA 4KBQA 3FUNA 3UM3A 1DCQA 1KZOA 2PZIA 1A5EA 2YNQA 3QARA 2GRQB 3PDNA 3UT8A 4CZ2D 2XGOA 4JB8P 4TXPA 2I9CA 3ZHEA 4B93B 2VGEA 3LPZA 2P9LG 3TJPA 5FINA 3RU0A 4CDMA 2P9UG 2WM9A 4H7YA 4ILGA 2V5QC 3PZ1A 2XEEA 4DI4A 3C3OA 3L08A 2P58C 2KZTB 4G8KA 4HI9A 2R2LA 2X6JA 3CVVA 5KJMA 4O1OA 2C0MA 4B0ZA 3NZSA 1OWOA 2XQ0A 2PM6A 3DSXA 1TYQG 3PEVB 2XS8A 2DVWA 3AG4E 3LEWA 3CVWA 3FUJA 3U64A 3NOCD 2H6GA 4OVUA 2XRYA 4U0SA 3P2BA 3FWVA 4GCNA 3TWSA 2KATA 3ZVVA 2NSZA 5JJTA 4GA2A 3VLDA 2DYSE 5ANLA 1DCEA 3PREA 3VTYA 2LXMA 3RRMB 3CVXA 5D0QD 3EU5A 3RKVA 3KS2A 1N0QA 2RKKA 1KLXA 1OCRE 3BG0B 3WXXA 3UMVA 1HZ4A 3U4TA 2C2LA 4BSZB 4ANUA 3D9KA 4U95D 4M7CA 3AAAC 3GZSA 3RO2A 2Y1LE 1FVFA 1N94A 4J8SA 5A6CA 1D9SA 4I2ZA 3B7RL 4A3VA 3VTXA 2GRLA 1KPSB 4C48B 3IBEA 3RSEG 2B0OE 3TWWA 2L6BA 3KEZA 4U8YD 5B1BE 4GZ3A 4BT9A 2IOSA 5BXOA 3UKUG 4TV3A 2E2EA 3QKYA 4I1OB 4WNGA 4F1PA 4TUUA 4Q94A 2A4ZA 4LCTA 1NP7A 4KZCA 3Q75A 2IU1A 4HOTA 5CMYA 4L7TA 3AG3E 3TGOA 3KSLA 4A1GA 1JCRA 5M72A 1TR4A 4GTMA 2WB2A 2X38A 2H6FA 3S7BA 1HU3A 2GRNB 3QJZA 4IYPA 5T8IA 2VGXA 4FHKA 3UQ3A 4J8DA 3SGHA 4R7LA 2XGSA 1Z5SC 3FU6A 4FULA 4AJWA 1OXJA 3SO8A 4XI0A 1DC2A 4JHKA 5B3SE 4GPKA 1QNFA 4K5AB 1G3NB 3ZKJA 5AQ9A 1UJJA 5ITZF 4XE0A 4BWRA 2IONA 4HFGA 3TWRA 3HXEA 4I6GA 4P29A 2FULA 4CYMD 2WXGA 3ZYLA 3EUVA 3SY2A 3PE4A 3FTZA 1N11A 4WNFA 2VTBA 5CEAA 4DX6D 3Q9UC 2V4HC 4G24A 5CCLA 4ACLA 2GROB 2ZU6B 5DIZA 5A23A 4N2QA 2EILE 5EYPF 4I2WA 2UWJG 5EYLA 3E37A 3LY7A 4EECA 3Q79A 1FVHA 5ENNA 1HXIA 4JA7A 2CFUA 2GRMA 4UI9C 4ATGA 3HXCA 2XZTG 3FTXA 4GYYA 3SFZA 3G2VA 3SF4A 4CGWA 2WXHA 2XENA 4GYWA 1NA3A 4HRLA 5FQ8A 5JA4D 2Y4TA 1E8XA 4GU5A 2VGXB 3S7DA 3AG1E 3HXDA 3V79K 1JPLA 3V2XA 4YDYA 2L6JA 5CERB 5E76A 5D66A 4U63A 4LNBA 5JJ7A 1BD8A 2ETAA 1S63A 4PH4B 1NI1A 1FCHA 1IQRA 4O6FA 3MA5A 3ZYQA 4EBAG 5ANRA 2VTBB 4N3BA 2IO3C 3GZ1A 3EHQA 2JABA 5BXUA 3JQ0A 4WWNA 2H6HA 3R9AB 3OXGA 3FH8A 3NB2A 2I1JA 4UQXA 3ULQA 4WNEA 3Q9NC 2V8SE 3FY4A 4KZ0A 4MKTA 2WXKA 4BEPA 1MZCA 2XPZA 5LFAA 3EHRA 3EHNA 3Q49B 4URKA 1D8EA 5LX8A 2AW6A 3FULA 2VGYA 5AYWD 3G2TA 2RFAA 2FEZA 3EIQC 4HXIA 4EHMA 3ESLA 2AXZA 5LP0A 3HRAA 2Y69E 4N5CA 3B7TA 2AXVA 2OEVA 3CVPA 5JHAA 3FFLA 3CHQA 4JC8A 2GRRB 5H7PA 5LCWC 4U0UA 1QZ2A 2L9BA 4WNDA 2P9IG 3IEGA 4YDWA 3CHSA 1YCSB 3BQOA 5HRYA 4BSXA 5KJLA 5BW8C 1INZA 3E4BA 4C0EA 3AU5A 4UI9K 2DIWA 4U8HA 3FTVA 3E33A 4I9EA 4CRWA 2JLBA 3P1UA 4JL0A 5AJDA 3DEOA 3Q73A 4AV7A 3CSTA 2WQHA 2KM4A 2BUGA 2GW1A 3C3QA 4FJYA 1JUQA 2V5FA 2KZTA 4N3AA 2EIKE 4NURA 2J07A 3DXKG 2PQNA 4J0UA 3ENEA 2YHCA 1NZNA 3IKOB 3LJ3A 3SQVA 2V0PA 1SA5A 2WXPA 3NQPA 3CKBA 3PNTB 3JCKC 4HS2A 3MV3B 4U8VD 1H0AA 3L17A 4G8LA 1HO8A 5EIBE 3CVNA 3SBTB
chains in the Genus database with same CATH topology
2KBXA 1A5EA 1K3ZD 2ZGGA 4K5BA 3HRAA 3UI2A 4ZHBA 4DX1A 3V79K 1OY3D 3V2XA 2F8YA 1YMPA 3T8KA 4ZFHA 4J7WA 4YDYA 3UXGA 2XEHA 4CZ2D 4BSZB 5HS0A 3D9HA 4JB8P 5CERB 4U95D 4DUIA 4OAVB 2P2CP 2RFMA 3AAAC 4K5AB 1G3NB 3TWXA 3ZKJA 3W9GA 4DX5D 5AQ9A 5ITZF 2QYJA 3TWUA 4F6RD 1WDYA 2Y1LE 1SVXA 3V30A 4B93B 2NYJA 5D66A 2VGEA 1IKND 4YDWA 3NBNB 1D9SA 5EN5D 5FINA 4QFVA 1YCSB 3TWRA 5AN8A 1K1AA 2Y0BG 1UOHA 5ENSD 5HRYA 1YYHA 1BD8A 4O1PA 1BI8B 2F37A 3J5PA 5JMND 2V5QC 2ETAA 4GPMA 4CYMD 2XEEA 3B7BA 5EIDA 4C48B 4DRXE 1IHBA 5KWDA 1MX2A 3F6QA 2B0OE 3V2OA 4HB5A 3TWWA 1N11A 2L6BA 2BKKB 3TWVA 1K1BA 5CEAA 4U8YD 5AARA 3TWTA 4RLYA 1SW6A 2FO1E 4DX6D 3V31A 2J8SD 3NOGD 4G8KA 4HI9A 4BETA 5AAOA 1DC2A 3Q9UC 2V4HC 2HE0A 4QQIA 5BXOA 3HG0D 2BKGA 4UUCA 5CBNA 4HNAD 4O1OA 2ETBA 3DEOA 3IXEA 4LG6A 2F8XK 1N0RA 4Z68A 3UTMA 5CECB 5EYPF 3C5RA 2DZNA 3J5QB 4OAUC 3EHQA 5AQBA 5EYLA 3DEPA 4F1PA 4GMRA 1MYOA 3AJIA 4HRNA 3T9KA 4BERA 5AQ7A 1MJ0A 2JABA 3KEAA 5ENTD 5BXUA 2XZDG 2DVWA 5ENPD 3EU9A 4TUMA 1AWCB 2MYOA 4J8YA 4HI8A 4LNUD 4U96D 4N5QA 3NOCD 1IXVA 3W9FA 2AJAA 4LSZE 2ETCA 2XZTG 3LJNA 4HLLA 2DZOA 1BU9A 1WG0A 5ENQD 3TWQA 3Q9NC 1NFIE 5EILA 1QYMA 2DWZA 4HQDA 3B95A 4HBDA 3ZNGA 1TR4A 3TWSA 4BEPA 3JXJA 3ZUVB 4ATZD 5CBOA 3ZU7B 1OT8A 1BLXB 4DX2A 3EHRA 1MX6A 2QC9A 4O60A 5ENRD 1MX4A 2ZGDA 2XENA 1AP7A 3JUEA 2RFAA 4HRLA 4U8VD 2A5EA 4K5CA 4BESA 5JA4D 2KXPC 4G8LA 5KNHD 5CEDB 1BI7B 5AQAA 4DX7D 4A63B 1DCQA 1S70B 5HKPA 5KBAA 2PNNA 1N0QA 5FIOA 5ENOD 5EIBE 4HRMB 4NIKA 3SO8A 3JXIA 5KNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBX A;  1A5E A;  1K3Z D;  2ZGG A;  4K5B A;  3HRA A;  3UI2 A;  4ZHB A;  4DX1 A;  3V79 K;  1OY3 D;  3V2X A;  2F8Y A;  1YMP A;  3T8K A;  4ZFH A;  4J7W A;  4YDY A;  3UXG A;  2XEH A;  4CZ2 D;  4BSZ B;  5HS0 A;  3D9H A;  4JB8 P;  5CER B;  4U95 D;  4DUI A;  4OAV B;  2P2C P;  2RFM A;  3AAA C;  4K5A B;  1G3N B;  3TWX A;  3ZKJ A;  3W9G A;  4DX5 D;  5AQ9 A;  5ITZ F;  2QYJ A;  3TWU A;  4F6R D;  1WDY A;  2Y1L E;  1SVX A;  3V30 A;  4B93 B;  2NYJ A;  5D66 A;  2VGE A;  1IKN D;  4YDW A;  3NBN B;  1D9S A;  5EN5 D;  5FIN A;  4QFV A;  1YCS B;  3TWR A;  5AN8 A;  1K1A A;  2Y0B G;  1UOH A;  5ENS D;  5HRY A;  1YYH A;  1BD8 A;  4O1P A;  1BI8 B;  2F37 A;  3J5P A;  5JMN D;  2V5Q C;  2ETA A;  4GPM A;  4CYM D;  2XEE A;  3B7B A;  5EID A;  4C48 B;  4DRX E;  1IHB A;  5KWD A;  1MX2 A;  3F6Q A;  2B0O E;  3V2O A;  4HB5 A;  3TWW A;  1N11 A;  2L6B A;  2BKK B;  3TWV A;  1K1B A;  5CEA A;  4U8Y D;  5AAR A;  3TWT A;  4RLY A;  1SW6 A;  2FO1 E;  4DX6 D;  3V31 A;  2J8S D;  3NOG D;  4G8K A;  4HI9 A;  4BET A;  5AAO A;  1DC2 A;  3Q9U C;  2V4H C;  2HE0 A;  4QQI A;  5BXO A;  3HG0 D;  2BKG A;  4UUC A;  5CBN A;  4HNA D;  4O1O A;  2ETB A;  3DEO A;  3IXE A;  4LG6 A;  2F8X K;  1N0R A;  4Z68 A;  3UTM A;  5CEC B;  5EYP F;  3C5R A;  2DZN A;  3J5Q B;  4OAU C;  3EHQ A;  5AQB A;  5EYL A;  3DEP A;  4F1P A;  4GMR A;  1MYO A;  3AJI A;  4HRN A;  3T9K A;  4BER A;  5AQ7 A;  1MJ0 A;  2JAB A;  3KEA A;  5ENT D;  5BXU A;  2XZD G;  2DVW A;  5ENP D;  3EU9 A;  4TUM A;  1AWC B;  2MYO A;  4J8Y A;  4HI8 A;  4LNU D;  4U96 D;  4N5Q A;  3NOC D;  1IXV A;  3W9F A;  2AJA A;  4LSZ E;  2ETC A;  2XZT G;  3LJN A;  4HLL A;  2DZO A;  1BU9 A;  1WG0 A;  5ENQ D;  3TWQ A;  3Q9N C;  1NFI E;  5EIL A;  1QYM A;  2DWZ A;  4HQD A;  3B95 A;  4HBD A;  3ZNG A;  1TR4 A;  3TWS A;  4BEP A;  3JXJ A;  3ZUV B;  4ATZ D;  5CBO A;  3ZU7 B;  1OT8 A;  1BLX B;  4DX2 A;  3EHR A;  1MX6 A;  2QC9 A;  4O60 A;  5ENR D;  1MX4 A;  2ZGD A;  2XEN A;  1AP7 A;  3JUE A;  2RFA A;  4HRL A;  4U8V D;  2A5E A;  4K5C A;  4BES A;  5JA4 D;  2KXP C;  4G8L A;  5KNH D;  5CED B;  1BI7 B;  5AQA A;  4DX7 D;  4A63 B;  1DCQ A;  1S70 B;  5HKP A;  5KBA A;  2PNN A;  1N0Q A;  5FIO A;  5ENO D;  5EIB E;  4HRM B;  4NIK A;  3SO8 A;  3JXI A;  5KNG A; 
#chains in the Genus database with same CATH topology
 5BV0 A;  1IQU A;  3OXL A;  1U2V G;  4DLQ A;  3T8K A;  4ANV A;  1Y6I A;  3RRN B;  1E90 A;  3BUA A;  4DUI A;  3MV2 B;  2FI7 A;  3CK7 A;  3ZRH A;  2OEW A;  4YDE A;  2AWI A;  4IN3 B;  3APF A;  2Y0B G;  4YVQ C;  3PH0 C;  5ENS D;  2X6F A;  1KZP A;  4G25 A;  4X8Q A;  4JA9 A;  1WAO 1;  3RAU A;  4DLO A;  1TN8 A;  5FJY A;  1K1B A;  4BET A;  2Y4U A;  3I4G A;  1PY1 A;  4QQI A;  2Q7F A;  1S0P A;  3LDZ A;  4HNA D;  4FP7 A;  1N52 A;  2WMN A;  4ME2 A;  1IYG A;  4WAF A;  2IQC A;  1U3C A;  3S2A A;  5AQ7 A;  3B13 A;  1AWC B;  4F3V A;  2L0I A;  3D9L A;  3PS6 A;  3FEY A;  3QB2 A;  2HM8 A;  3IHV A;  3TWQ A;  2V4L A;  2EIJ E;  5CMW A;  3CVY A;  5CBO A;  3MYV A;  1Z3Y A;  3CSF A;  3HYM B;  1MX6 A;  4NRH B;  4GB9 A;  4AY5 A;  4G23 A;  3UX4 A;  2A5E A;  3BU8 A;  3SFY A;  4RG9 A;  4EZJ A;  2FBN A;  3D9I A;  3UI2 A;  4DX1 A;  3UM0 A;  1H6O A;  1WM5 A;  4KVO A;  2VYI A;  2FO7 A;  4E6H A;  4JD2 G;  1ZBP A;  2A5U A;  1N4Q A;  1IKN D;  2OCC E;  3D3M A;  1E8W A;  3CHO A;  3HHM A;  1BI8 B;  5JMN D;  3FU3 A;  3FH5 A;  2KCV A;  5KWD A;  3HVE B;  1EDU A;  5CRV A;  5AAO A;  3CV0 A;  2HE0 A;  4EBA A;  3E30 A;  2IY0 C;  4UUC A;  3IXE A;  1OWM A;  4GML A;  3SZ7 A;  5CEC B;  3C5R A;  1MYO A;  3T9K A;  2DBA A;  4CDN A;  4J6I A;  3KEA A;  5G04 C;  3EU9 A;  4L2L A;  4AOF A;  3T5X A;  3LJN A;  5KJK A;  5FTP A;  5EKQ D;  3LVR E;  5BT1 A;  5FQ4 A;  4UQZ A;  1EPU A;  3Q5M A;  3KSQ A;  1RW2 A;  3ZNG A;  3ZXS A;  3ASN E;  2GRP B;  3NZU A;  1Y8M A;  4KT6 B;  2X6H A;  2MRI A;  5EX3 A;  1TN7 A;  3B7S A;  1EF1 C;  3LYA A;  3ML8 A;  4K5C A;  1N4P A;  1V55 E;  5G55 A;  3ASF A;  4XZ4 A;  2KXP C;  3I5P A;  5ARG A;  1S70 B;  3UT7 A;  5ENO D;  4K03 A;  4WUY A;  1O1R A;  3JXI A;  2DYR E;  2P9S G;  3DSW A;  3E32 A;  3QOU A;  1OCZ E;  5HS0 A;  3LY8 A;  3D9H A;  1FT2 A;  3RIB A;  2YIN A;  1OWN A;  3LS8 A;  5G05 C;  3EDT B;  3V30 A;  4AY6 A;  3ABL E;  4XEI G;  1O1T A;  2L0T B;  4I43 A;  3FU5 A;  1ZB1 A;  1YYH A;  3FUH A;  1E7U A;  4GCO A;  3TL5 A;  1XGW A;  4NQ0 A;  3TXN A;  3V31 A;  2J8S D;  3NOG D;  4NAC A;  3ASD A;  4JHR A;  2BKG A;  3VLE A;  3UT4 A;  3UTM A;  4FLH A;  1O5M A;  5AJL A;  2DZN A;  5AQB A;  3MJW A;  4HRN A;  2R5S A;  3DXM G;  3FUE A;  2J08 A;  3EHM A;  2WXO A;  3FP3 A;  3G2W A;  3KD7 A;  4LNU D;  4U96 D;  3CVQ A;  1IXV A;  2CHZ A;  2E0I A;  2WXI A;  3ABK E;  2I1K A;  1Z6T A;  2WXQ A;  1TN6 A;  4FAD A;  1Z3X A;  4I6J A;  3CKC A;  4FA6 A;  4U7E B;  2PL2 A;  2HYZ A;  5DBK A;  2P9K G;  4XKB A;  4DX7 D;  1JCQ A;  2XCC A;  5HI7 A;  5KBA A;  4HOQ A;  3RK6 A;  4XX5 A;  3MGB A;  4UWG A;  2HR2 A;  1HG5 A;  1SZ9 A;  1DVP A;  3GZ2 A;  4JEU A;  3PZ4 A;  4APO A;  4B89 A;  2LAI A;  4OAV B;  2BTD A;  2RFM A;  2IO2 C;  3W9G A;  1N9A A;  2LO6 A;  3DPD A;  3K9I A;  1H2T C;  3D9M A;  4GTR A;  3NBN B;  5EN5 D;  2R03 A;  1FPP A;  3FHE A;  3ONL A;  2FF4 A;  2GGF A;  1B89 A;  2QY7 A;  4GPM A;  5EID A;  1MX2 A;  3DRA A;  3DSS A;  3TWT A;  4FJZ A;  1U3D A;  5FZR A;  2KCL A;  2DCP A;  4Z68 A;  2Y3A A;  2LXL A;  4B94 A;  4PUC A;  3DSV A;  4GMR A;  3AJI A;  2PM7 A;  3L22 A;  2XZD G;  2VSX E;  3BEE A;  1TJC A;  4HLL A;  3CQG B;  1YA0 A;  2J4D A;  2AXU A;  3AG2 E;  1HH8 A;  4CT0 A;  3JXJ A;  1HG2 A;  4E85 A;  4J8F A;  2LNI A;  3ZYK A;  4AEZ C;  3DSU A;  3OTN A;  2IOL A;  1X5B A;  3ESK A;  4YVO A;  2C0L A;  4HOU A;  4ANX A;  4J8E A;  1TEZ A;  4Q69 A;  4A63 B;  2WQ6 A;  2OV8 A;  4RG6 A;  4B8C B;  3BG1 B;  2PNN A;  4APF A;  1H2U A;  4XKC A;  2KBX A;  4K5B A;  3PZ3 A;  3SD5 A;  3FTU A;  4DX5 D;  2WXL A;  2X6K A;  4YDO A;  3CK8 A;  3FEX A;  2ZIR A;  3TWU A;  4GAA A;  3CR3 A;  3E34 A;  3FTW A;  4PS7 A;  3ULE G;  5AN8 A;  4WWO A;  1H19 A;  1K8K G;  4I1M A;  3ULY A;  3PUK A;  4GZ5 A;  4G26 A;  4I6E A;  4LER A;  4FC8 A;  3ZEF A;  3ASH A;  2BKK B;  2FO1 E;  1PC2 A;  3HG0 D;  4W9R A;  1JCS A;  4Y6W A;  5D0O D;  1N95 A;  1H6K A;  2XGM A;  3LKU A;  1PAQ A;  2KCK A;  3QWW A;  5ENP D;  2XPY A;  2KC7 A;  3N71 A;  3CQC B;  4HI8 A;  5B1A E;  3W9F A;  3MZL B;  3T5V A;  2ETC A;  2DZO A;  4N2S A;  3IHY A;  5IY5 E;  4G2V A;  4AVX A;  1V54 E;  3MX3 A;  3UM1 A;  3UIN C;  5C1D A;  4JW1 A;  3QK0 A;  4G11 A;  4RSY A;  3MKR A;  1OUV A;  3HDX A;  4GTT A;  3QWV A;  5LOZ A;  1OWP A;  3QC1 A;  5HKP A;  3QAQ A;  2XEV A;  4I17 A;  2M63 A;  2XS1 A;  3HXB A;  1K3Z D;  4GTS A;  4H7X A;  2I6H A;  4TRQ A;  1TJF A;  4ACK A;  5BPP A;  3JYS A;  4GTV A;  4A1S A;  3MKQ B;  1DNP A;  1UN9 A;  3SFX A;  3CHR A;  1TNZ A;  1NL4 A;  2WXJ A;  1UOH A;  1P5Q A;  4BT8 A;  2F37 A;  4DI3 A;  2UY1 B;  4BX8 A;  1IHB A;  1NA0 A;  1OWL A;  4FU3 A;  3F6Q A;  5JJ6 A;  2ZXW E;  3TWV A;  4BTB A;  3CGH A;  2OOE A;  2F8X K;  1N0R A;  4LUN U;  4D10 C;  1S64 A;  4UI9 J;  1MHQ A;  3HVE A;  1E8Y A;  3EJN A;  1SA4 A;  4LSZ E;  1XNF A;  5T3R A;  2J09 A;  1NFI E;  2R05 A;  4G1T A;  1RZ4 A;  3DBS A;  3ZUV B;  2EQX A;  2NXP A;  3SNX A;  3CIA A;  2J49 A;  1AP7 A;  3ASG A;  3JUE A;  3G2S A;  3CVL A;  1BI7 B;  3U66 A;  2MOW A;  4A3T A;  2WXR A;  4XIF A;  5FQ7 A;  1D8D A;  5KNG A;  1FT1 A;  1UJK A;  2F8Y A;  3G2U A;  3X2Q E;  2ILR A;  2QYU A;  3AS8 A;  4LEU A;  4RVB A;  1TNY A;  3CEQ A;  1TNU A;  3CHM A;  3OXF A;  3S7F A;  1JWG A;  4OYS A;  4EZK A;  3TAX A;  4DRX E;  4RQI A;  4CCA A;  5FT9 A;  1ELW A;  4OVV A;  3DWL G;  4KMO A;  3FU0 A;  2QZA A;  2PQR A;  5T4Y A;  4HVB A;  1ELR A;  3R9M A;  4FHJ A;  4PS8 A;  3HXF A;  5BV1 A;  3DEP A;  4TUM A;  4FLB A;  2MYO A;  4I1A A;  4ANW A;  4CEM A;  3DST A;  1LF8 A;  4AP2 A;  4BFR A;  1BU9 A;  2WVI A;  5EIL A;  1QYM A;  4HQD A;  3MEK A;  3T8M A;  4ATZ D;  3ZU7 B;  3LY9 A;  2OVB A;  2IFU A;  1JWF A;  3R7R A;  2ZGD A;  4GZD A;  5D2M C;  4F7A A;  1SZA A;  3GW4 A;  3SI5 A;  3GYZ A;  5FWQ A;  4GTO A;  1LD7 A;  5CHE E;  3UIO C;  3ZHE B;  2ZIS A;  1N4S A;  3URZ A;  1KT1 A;  3SHF A;  1O1S A;  5LCW J;  3Q78 A;  1H2V C;  2IJG X;  3UXG A;  1IHG A;  4AXH A;  3TWX A;  3D9P A;  1OCC E;  3CHP A;  1E8Z A;  4ABN A;  3ML9 A;  1ELK A;  4K0R A;  4IUL A;  5J90 A;  2YHE A;  3ISM C;  1W3B A;  4PDX A;  3UIP C;  2AVP A;  3D9J A;  4UWL A;  2XRZ A;  5A7D B;  4DPR A;  3V2O A;  4F1S A;  3QNK A;  3ZPJ A;  4RLY A;  3HIZ A;  3ASO E;  1HX8 A;  3ZYM A;  4DJA A;  1EYH A;  3JUI A;  4L2Y A;  2RG8 A;  5CRU A;  4N3C A;  2ETB A;  4JHJ A;  2WXM A;  3ZW3 A;  1WY6 A;  3J5Q B;  4Y6C A;  4HOS A;  3UM2 A;  4BER A;  4U07 A;  1MJ0 A;  2P9N G;  4BTA A;  4BX9 A;  4LNG A;  1LD8 A;  1L5J A;  2VSY A;  3L9T A;  2J9Q A;  4MS6 A;  1Q2Z A;  4UWH A;  3QWP A;  3O48 A;  4JPS A;  1QQE A;  3IV0 A;  5E75 A;  3ZN3 A;  4JZY A;  4L9P A;  4IRU A;  1BLX B;  3PE3 A;  3PZD A;  2XCB A;  3PRZ A;  3Q7A A;  1MX4 A;  3CK9 A;  3L54 A;  4DK5 A;  4KYO B;  3QDN A;  5AEN A;  1KT0 A;  2WPV A;  3LCA A;  1OCO E;  4CGV A;  5AIJ A;  2ZGG A;  2EIM E;  3FUI A;  4MBG A;  1UG3 A;  4ZFH A;  2CG2 A;  4J7W A;  1GW6 A;  5J08 A;  3UPV A;  2LUH A;  4GZC A;  2BED A;  1WDY A;  3CLJ A;  1SVX A;  2NYJ A;  2OND A;  1HE8 A;  3J5P A;  4TXR A;  2R59 A;  3FUF A;  3ZGQ A;  4XI9 A;  4I9C A;  4UQY A;  3FUK A;  1SQM A;  3C98 A;  3LXU X;  1UW4 B;  2X3M A;  3JQ1 A;  4JVS A;  5CBN A;  4Q96 A;  2P9P G;  4GA1 A;  5CCM A;  4LRZ A;  3ZIM A;  2XHE A;  2B6C A;  2WXF A;  4KVM A;  4J8Y A;  4U0Z A;  1QBQ A;  1H6P A;  2AJA A;  2CFZ A;  3Q7F A;  1E96 B;  5ENQ D;  2CG3 A;  1TNO A;  4JEH A;  2DWZ A;  3TG5 A;  4HBD A;  2YQ8 A;  2NC9 A;  2WXN A;  5FZQ A;  4EPZ A;  4EQF A;  3PUJ A;  2WQ7 A;  4O60 A;  5BUZ A;  4CT4 A;  3CVU A;  3PNL B;  3NF1 A;  1N54 A;  4ILH B;  3R7Q A;  4YND A;  4WWP A;  5KNH D;  4JXT A;  5AQA A;  3FUM A;  4NIK A;  5EDS A;  4BY6 A;  1HS6 A;  3S7J A;  3KAE A;  2JEK A;  1A17 A;  2XEH A;  2F0Y A;  3C3R A;  3MCX A;  2QFC A;  2IEJ A;  2MHK A;  2CHW A;  1LTX A;  2QYJ A;  4F6R D;  3D9N A;  1E7V A;  3Q4A B;  4UWK A;  2CHX A;  4QFV A;  1K1A A;  1UN8 A;  3PZ2 A;  4GMJ A;  3WG7 E;  4A55 A;  1HFA A;  1ZU2 A;  2R17 C;  3L16 A;  1TNB A;  5HQ8 A;  2OVF A;  4HB5 A;  3B7U X;  3MKQ A;  1BPO A;  4OAU C;  4C9B B;  2I2O A;  4GZ6 A;  4GYO A;  1VDY A;  1X81 A;  3FTS A;  3PEU B;  5FZS A;  2VSN A;  4N39 A;  5G04 J;  5JHB A;  2UY1 A;  2VSO E;  2RD0 A;  2HO1 A;  3UKR G;  2VQ2 A;  4F53 A;  4HOR A;  5ENT D;  4B8A A;  1N4R A;  2H6I A;  4N5Q A;  4L23 A;  3RO3 A;  2LAH A;  4MRU A;  1WG0 A;  3Q47 B;  3FUD A;  3APC A;  3NAW A;  3B95 A;  4ILI A;  3SBS A;  4DX2 A;  2BF0 X;  3L82 A;  3ZFW A;  4TXQ A;  4AM9 A;  3TG4 A;  4M3O A;  5CED B;  2VJ8 A;  4CDR A;  5FIO A;  3LVQ E;  4HRM B;  3ZXP A;  4AIF A;  3L6A A;  3I3N A;  2LSV A;  4ZHB A;  3L13 A;  4MLP A;  1OY3 D;  1YMP A;  5G05 J;  5KJN A;  3I4R B;  3AS5 A;  3PVL A;  3UUX A;  2P2C P;  3Q15 A;  3OAW A;  2IF4 A;  3D9O A;  2EIN E;  5ARF A;  3DPY A;  4KXK B;  5FQ6 A;  4O1P A;  3RRU A;  3TXM A;  1HF8 A;  3O4Z A;  4U04 A;  2J4B A;  3B7B A;  2WMO A;  4HLE A;  5C2Y A;  4UWF A;  3EIJ A;  2XPI A;  4L1B A;  3VLF A;  5AAR A;  1SW6 A;  3APD A;  5BNW A;  3U9W A;  4LG6 A;  5EX0 A;  1MQS A;  3FTY A;  5G2N A;  4C0M A;  3ONK A;  3FH7 A;  5KCM A;  2LSU A;  3AU4 A;  4GTP A;  4EZL A;  3C72 A;  3AS4 A;  1OT8 A;  2R02 A;  2X6I A;  2QC9 A;  5ENR D;  3ABM E;  3FDH A;  3U3W A;  4GTQ A;  4GA0 A;  3RJV A;  4PS3 A;  4BES A;  4V3I A;  4KBQ A;  3FUN A;  3UM3 A;  1DCQ A;  1KZO A;  2PZI A;  1A5E A;  2YNQ A;  3QAR A;  2GRQ B;  3PDN A;  3UT8 A;  4CZ2 D;  2XGO A;  4JB8 P;  4TXP A;  2I9C A;  3ZHE A;  4B93 B;  2VGE A;  3LPZ A;  2P9L G;  3TJP A;  5FIN A;  3RU0 A;  4CDM A;  2P9U G;  2WM9 A;  4H7Y A;  4ILG A;  2V5Q C;  3PZ1 A;  2XEE A;  4DI4 A;  3C3O A;  3L08 A;  2P58 C;  2KZT B;  4G8K A;  4HI9 A;  2R2L A;  2X6J A;  3CVV A;  5KJM A;  4O1O A;  2C0M A;  4B0Z A;  3NZS A;  1OWO A;  2XQ0 A;  2PM6 A;  3DSX A;  1TYQ G;  3PEV B;  2XS8 A;  2DVW A;  3AG4 E;  3LEW A;  3CVW A;  3FUJ A;  3U64 A;  3NOC D;  2H6G A;  4OVU A;  2XRY A;  4U0S A;  3P2B A;  3FWV A;  4GCN A;  3TWS A;  2KAT A;  3ZVV A;  2NSZ A;  5JJT A;  4GA2 A;  3VLD A;  2DYS E;  5ANL A;  1DCE A;  3PRE A;  3VTY A;  2LXM A;  3RRM B;  3CVX A;  5D0Q D;  3EU5 A;  3RKV A;  3KS2 A;  1N0Q A;  2RKK A;  1KLX A;  1OCR E;  3BG0 B;  3WXX A;  3UMV A;  1HZ4 A;  3U4T A;  2C2L A;  4BSZ B;  4ANU A;  3D9K A;  4U95 D;  4M7C A;  3AAA C;  3GZS A;  3RO2 A;  2Y1L E;  1FVF A;  1N94 A;  4J8S A;  5A6C A;  1D9S A;  4I2Z A;  3B7R L;  4A3V A;  3VTX A;  2GRL A;  1KPS B;  4C48 B;  3IBE A;  3RSE G;  2B0O E;  3TWW A;  2L6B A;  3KEZ A;  4U8Y D;  5B1B E;  4GZ3 A;  4BT9 A;  2IOS A;  5BXO A;  3UKU G;  4TV3 A;  2E2E A;  3QKY A;  4I1O B;  4WNG A;  4F1P A;  4TUU A;  4Q94 A;  2A4Z A;  4LCT A;  1NP7 A;  4KZC A;  3Q75 A;  2IU1 A;  4HOT A;  5CMY A;  4L7T A;  3AG3 E;  3TGO A;  3KSL A;  4A1G A;  1JCR A;  5M72 A;  1TR4 A;  4GTM A;  2WB2 A;  2X38 A;  2H6F A;  3S7B A;  1HU3 A;  2GRN B;  3QJZ A;  4IYP A;  5T8I A;  2VGX A;  4FHK A;  3UQ3 A;  4J8D A;  3SGH A;  4R7L A;  2XGS A;  1Z5S C;  3FU6 A;  4FUL A;  4AJW A;  1OXJ A;  3SO8 A;  4XI0 A;  1DC2 A;  4JHK A;  5B3S E;  4GPK A;  1QNF A;  4K5A B;  1G3N B;  3ZKJ A;  5AQ9 A;  1UJJ A;  5ITZ F;  4XE0 A;  4BWR A;  2ION A;  4HFG A;  3TWR A;  3HXE A;  4I6G A;  4P29 A;  2FUL A;  4CYM D;  2WXG A;  3ZYL A;  3EUV A;  3SY2 A;  3PE4 A;  3FTZ A;  1N11 A;  4WNF A;  2VTB A;  5CEA A;  4DX6 D;  3Q9U C;  2V4H C;  4G24 A;  5CCL A;  4ACL A;  2GRO B;  2ZU6 B;  5DIZ A;  5A23 A;  4N2Q A;  2EIL E;  5EYP F;  4I2W A;  2UWJ G;  5EYL A;  3E37 A;  3LY7 A;  4EEC A;  3Q79 A;  1FVH A;  5ENN A;  1HXI A;  4JA7 A;  2CFU A;  2GRM A;  4UI9 C;  4ATG A;  3HXC A;  2XZT G;  3FTX A;  4GYY A;  3SFZ A;  3G2V A;  3SF4 A;  4CGW A;  2WXH A;  2XEN A;  4GYW A;  1NA3 A;  4HRL A;  5FQ8 A;  5JA4 D;  2Y4T A;  1E8X A;  4GU5 A;  2VGX B;  3S7D A;  3AG1 E;  3HXD A;  3V79 K;  1JPL A;  3V2X A;  4YDY A;  2L6J A;  5CER B;  5E76 A;  5D66 A;  4U63 A;  4LNB A;  5JJ7 A;  1BD8 A;  2ETA A;  1S63 A;  4PH4 B;  1NI1 A;  1FCH A;  1IQR A;  4O6F A;  3MA5 A;  3ZYQ A;  4EBA G;  5ANR A;  2VTB B;  4N3B A;  2IO3 C;  3GZ1 A;  3EHQ A;  2JAB A;  5BXU A;  3JQ0 A;  4WWN A;  2H6H A;  3R9A B;  3OXG A;  3FH8 A;  3NB2 A;  2I1J A;  4UQX A;  3ULQ A;  4WNE A;  3Q9N C;  2V8S E;  3FY4 A;  4KZ0 A;  4MKT A;  2WXK A;  4BEP A;  1MZC A;  2XPZ A;  5LFA A;  3EHR A;  3EHN A;  3Q49 B;  4URK A;  1D8E A;  5LX8 A;  2AW6 A;  3FUL A;  2VGY A;  5AYW D;  3G2T A;  2RFA A;  2FEZ A;  3EIQ C;  4HXI A;  4EHM A;  3ESL A;  2AXZ A;  5LP0 A;  3HRA A;  2Y69 E;  4N5C A;  3B7T A;  2AXV A;  2OEV A;  3CVP A;  5JHA A;  3FFL A;  3CHQ A;  4JC8 A;  2GRR B;  5H7P A;  5LCW C;  4U0U A;  1QZ2 A;  2L9B A;  4WND A;  2P9I G;  3IEG A;  4YDW A;  3CHS A;  1YCS B;  3BQO A;  5HRY A;  4BSX A;  5KJL A;  5BW8 C;  1INZ A;  3E4B A;  4C0E A;  3AU5 A;  4UI9 K;  2DIW A;  4U8H A;  3FTV A;  3E33 A;  4I9E A;  4CRW A;  2JLB A;  3P1U A;  4JL0 A;  5AJD A;  3DEO A;  3Q73 A;  4AV7 A;  3CST A;  2WQH A;  2KM4 A;  2BUG A;  2GW1 A;  3C3Q A;  4FJY A;  1JUQ A;  2V5F A;  2KZT A;  4N3A A;  2EIK E;  4NUR A;  2J07 A;  3DXK G;  2PQN A;  4J0U A;  3ENE A;  2YHC A;  1NZN A;  3IKO B;  3LJ3 A;  3SQV A;  2V0P A;  1SA5 A;  2WXP A;  3NQP A;  3CKB A;  3PNT B;  3JCK C;  4HS2 A;  3MV3 B;  4U8V D;  1H0A A;  3L17 A;  4G8L A;  1HO8 A;  5EIB E;  3CVN A;  3SBT B; 
#chains in the Genus database with same CATH homology
 2KBX A;  1A5E A;  1K3Z D;  2ZGG A;  4K5B A;  3HRA A;  3UI2 A;  4ZHB A;  4DX1 A;  3V79 K;  1OY3 D;  3V2X A;  2F8Y A;  1YMP A;  3T8K A;  4ZFH A;  4J7W A;  4YDY A;  3UXG A;  2XEH A;  4CZ2 D;  4BSZ B;  5HS0 A;  3D9H A;  4JB8 P;  5CER B;  4U95 D;  4DUI A;  4OAV B;  2P2C P;  2RFM A;  3AAA C;  4K5A B;  1G3N B;  3TWX A;  3ZKJ A;  3W9G A;  4DX5 D;  5AQ9 A;  5ITZ F;  2QYJ A;  3TWU A;  4F6R D;  1WDY A;  2Y1L E;  1SVX A;  3V30 A;  4B93 B;  2NYJ A;  5D66 A;  2VGE A;  1IKN D;  4YDW A;  3NBN B;  1D9S A;  5EN5 D;  5FIN A;  4QFV A;  1YCS B;  3TWR A;  5AN8 A;  1K1A A;  2Y0B G;  1UOH A;  5ENS D;  5HRY A;  1YYH A;  1BD8 A;  4O1P A;  1BI8 B;  2F37 A;  3J5P A;  5JMN D;  2V5Q C;  2ETA A;  4GPM A;  4CYM D;  2XEE A;  3B7B A;  5EID A;  4C48 B;  4DRX E;  1IHB A;  5KWD A;  1MX2 A;  3F6Q A;  2B0O E;  3V2O A;  4HB5 A;  3TWW A;  1N11 A;  2L6B A;  2BKK B;  3TWV A;  1K1B A;  5CEA A;  4U8Y D;  5AAR A;  3TWT A;  4RLY A;  1SW6 A;  2FO1 E;  4DX6 D;  3V31 A;  2J8S D;  3NOG D;  4G8K A;  4HI9 A;  4BET A;  5AAO A;  1DC2 A;  3Q9U C;  2V4H C;  2HE0 A;  4QQI A;  5BXO A;  3HG0 D;  2BKG A;  4UUC A;  5CBN A;  4HNA D;  4O1O A;  2ETB A;  3DEO A;  3IXE A;  4LG6 A;  2F8X K;  1N0R A;  4Z68 A;  3UTM A;  5CEC B;  5EYP F;  3C5R A;  2DZN A;  3J5Q B;  4OAU C;  3EHQ A;  5AQB A;  5EYL A;  3DEP A;  4F1P A;  4GMR A;  1MYO A;  3AJI A;  4HRN A;  3T9K A;  4BER A;  5AQ7 A;  1MJ0 A;  2JAB A;  3KEA A;  5ENT D;  5BXU A;  2XZD G;  2DVW A;  5ENP D;  3EU9 A;  4TUM A;  1AWC B;  2MYO A;  4J8Y A;  4HI8 A;  4LNU D;  4U96 D;  4N5Q A;  3NOC D;  1IXV A;  3W9F A;  2AJA A;  4LSZ E;  2ETC A;  2XZT G;  3LJN A;  4HLL A;  2DZO A;  1BU9 A;  1WG0 A;  5ENQ D;  3TWQ A;  3Q9N C;  1NFI E;  5EIL A;  1QYM A;  2DWZ A;  4HQD A;  3B95 A;  4HBD A;  3ZNG A;  1TR4 A;  3TWS A;  4BEP A;  3JXJ A;  3ZUV B;  4ATZ D;  5CBO A;  3ZU7 B;  1OT8 A;  1BLX B;  4DX2 A;  3EHR A;  1MX6 A;  2QC9 A;  4O60 A;  5ENR D;  1MX4 A;  2ZGD A;  2XEN A;  1AP7 A;  3JUE A;  2RFA A;  4HRL A;  4U8V D;  2A5E A;  4K5C A;  4BES A;  5JA4 D;  2KXP C;  4G8L A;  5KNH D;  5CED B;  1BI7 B;  5AQA A;  4DX7 D;  4A63 B;  1DCQ A;  1S70 B;  5HKP A;  5KBA A;  2PNN A;  1N0Q A;  5FIO A;  5ENO D;  5EIB E;  4HRM B;  4NIK A;  3SO8 A;  3JXI A;  5KNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...