3HYMB

Insights into anaphase promoting complex tpr subdomain assembly from a cdc26-apc6 structure
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
301
structure length
301
Chain Sequence
ENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, ligase
molecule keywords Anaphase-promoting complex subunit CDC26
total genus 84
structure length 301
sequence length 301
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13176 TPR_7 Tetratricopeptide repeat
B PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hymB00
4KXKB 3ASHA 3N71A 1OUVA 2OOEA 2WPVA 4U0UA 4U0SA 3U4TA 3MKRA 5G04J 4CDRA 4N2SA 4HOTA 2QFCA 2KC7A 1IHGA 2UY1A 2YHCA 2KCVA 3O48A 4HOSA 5FZSA 3QKYA 4GYOA 2JLBA 4H7XA 4UI9K 4JA7A 4WNFA 3ZPJA 2KATA 2L6JA 5A6CA 3JYSA 4GA2A 3WXXA 5KJNA 3CKBA 1IYGA 4JL0A 3SZ7A 2IF4A 4AIFA 1WM5A 3HYMB 4WNDA 4GA0A 1KLXA 1A17A 4JA9A 2XGMA 4I1AA 4KYOB 1PC2A 5C1DA 1ZU2A 4I2ZA 2C0MA 2WQHA 4HOQA 1P5QA 3CK7A 4J0UA 3ESKA 4N39A 4UQYA 4WUYA 1ELRA 3ASGA 2GW1A 2UY1B 2PL2A 3GZ1A 5FT9A 3MEKA 3TG4A 5KJMA 3CVNA 3FP3A 4AY5A 4GZ6A 3U3WA 3EDTB 5LCWC 4Y6WA 2J9QA 4XIFA 4U0ZA 2XGSA 3NF1A 1Y8MA 2VGYA 4YVOA 4AY6A 2VSNA 3E4BA 2VYIA 2AVPA 4GCNA 5BW8C 2FI7A 4XI0A 3RJVA 2HYZA 1KT0A 2FF4A 4UI9J 4WNEA 2XPIA 3ZFWA 5JJTA 3Q15A 4UI9C 2C0LA 2FO7A 2Q7FA 4G2VA 3BEEA 4AM9A 3KAEA 2Y4UA 2FEZA 3OXGA 3AS4A 3CK9A 2XCCA 4GPKA 4G1TA 1NA0A 3LPZA 2KCKA 4YNDA 4GA1A 4RG9A 3AS5A 3TG5A 4N3CA 3LY9A 5JJ7A 1NA3A 4G23A 5BT1A 2KCLA 3FFLA 3SF4A 3ZHEB 4EQFA 2VSYA 3ASDA 3GW4A 4J8DA 2XGOA 4I17A 3LCAA 4I2WA 4UQZA 1B89A 3Q4AB 4Y6CA 3RU0A 5G05J 1ELWA 3QWVA 3ZN3A 3CK8A 3R9AB 3S7DA 5BNWA 1W3BA 4H7YA 1HH8A 3VTXA 1TJCA 5M72A 4N2QA 4CGWA 3MA5A 5KJKA 1E96B 4GZ3A 4U04A 5A7DB 5ARFA 4CGVA 2NC9A 3KS2A 2P58C 5G05C 5CCLA 1KT1A 3QDNA 2PZIA 5G04C 5CCMA 4JHRA 2R5SA 2VQ2A 4N3BA 4I9CA 4HOUA 2XCBA 2I6HA 2MHKA 2PQNA 4G24A 2V5FA 3LYAA 4ABNA 4J8EA 4WNGA 5FZRA 5JJ6A 4I9EA 2E2EA 3CVLA 3QWWA 4GZ5A 3Q5MA 3URZA 4APOA 3VTYA 3OXFA 3PE4A 5D0OD 5EX0A 3QWPA 4YVQC 3S7JA 4HORA 3TAXA 5HI7A 4GCOA 5AYWD 2FBNA 3AS8A 5EKQD 3LY7A 4BT9A 1NZNA 4W9RA 4F3VA 3IEGA 1YA0A 1QZ2A 2DBAA 4LEUA 5D0QD 5HQ8A 4XI9A 1HZ4A 2UWJG 3PDNA 2BUGA 3KD7A 4ME2A 4RG6A 3S7FA 3CEQA 3UUXA 3ZGQA 5LCWJ 5DBKA 3TGOA 3GZ2A 3CV0A 4G25A 4J8FA 4O6FA 3QOUA 5FZQA 3LKUA 4N5CA 3S7BA 3CVPA 3UPVA 5FJYA 2LSUA 2IFUA 4A1SA 4BTBA 3OXLA 5DIZA 2LSVA 1QQEA 2YQ8A 3PE3A 3Q47B 2PQRA 4UQXA 2XEVA 3K9IA 4N3AA 4BTAA 3RO2A 1FCHA 5FTPA 4IN3B 1XNFA 1ZBPA 3MV3B 3MV2B 5EX3A 3ULQA 4NQ0A 4GYYA 5KJLA 2VGXB 2HR2A 2C2LA 3CVQA 4U07A 1HXIA 1WAO1 2Y4TA 5CHEE 5ARGA 3ASFA 4G26A 3RKVA 3UQ3A 2VGXA 3CKCA 2ONDA 3GYZA 3ZHEA 4B94A 4BT8A 4BWRA 3RO3A 3FWVA 4KBQA 4GYWA 3Q49B 2LNIA 2HO1A 4NRHB 3LY8A 3RIBA
chains in the Genus database with same CATH superfamily
4JVSA 3N71A 3ZVVA 3X2QE 1FPPA 4GYOA 3JYSA 1KLXA 1A17A 4KYOB 4EBAG 1OXJA 4YDYA 3I4RB 2PNNA 3CVNA 2IJGX 3ASNE 3E4BA 4MBGA 2FF4A 3PEVB 2X6HA 2XPIA 2L0IA 1IQRA 1UN9A 1HE8A 2A5UA 1IXVA 5BXOA 4BFRA 2QZAA 2ZISA 3R9MA 2KCLA 3DSSA 1QNFA 3ZHEB 5CEAA 2XGOA 1MHQA 4O1OA 3CSFA 4XE0A 2VTBB 2A5EA 1E90A 1TYQG 2WQ7A 4AVXA 4ILIA 2R5SA 1HX8A 2I6HA 5FQ8A 4CEMA 3DEPA 5EYLA 5EX0A 4YVQC 1Q2ZA 1FT1A 4QQIA 5EKQD 3SY2A 3QARA 3ENEA 5HQ8A 3FTZA 3LS8A 1EF1C 2CHZA 4F1PA 3LKUA 4U8VD 5FJYA 4BTBA 4RLYA 2AXZA 3PE3A 5EYPF 2PQRA 3LDZA 3RO2A 1MZCA 4AXHA 3EUVA 4NQ0A 1TNUA 2RFMA 1WAO1 5ARGA 3UQ3A 3PUKA 2VGXA 4L2YA 3GYZA 4HRNA 2Y69E 4NRHB 3HVEA 4HFGA 5JA4D 2GRPB 3PS6A 5B1BE 4HNAD 4N2SA 2J08A 2LAIA 2CG3A 3T9KA 3R7RA 3C3QA 4XKCA 1PY1A 3RK6A 4HOQA 3EHMA 1NL4A 2GW1A 3GZ1A 4ANWA 4AY6A 3ZYKA 1JWFA 3FU5A 3RJVA 3ESLA 2EINE 1LD8A 2MOWA 2DCPA 3QJZA 4AJWA 3ZYLA 3UT7A 4GMJA 3AS5A 3UI2A 5BT1A 2WQ6A 3FFLA 2VSYA 4UQZA 1UJJA 3KEZA 4HLEA 2XHEA 2AW6A 4GMLA 5FQ4A 1U3CA 5EN5D 5BPPA 4GTOA 3HDXA 3QWWA 1FVFA 4BESA 2VJ8A 5D0OD 3QWPA 4KZ0A 2FULA 3J5QB 3CLJA 2DIWA 3E30A 3FTUA 5LFAA 3LVQE 3DSTA 4OYSA 1OY3D 2KZTA 3Q47B 4N3AA 3FY4A 4MLPA 5FTPA 1H19A 2OEVA 3FUFA 1N95A 1HU3A 3RIBA 5ENSD 3W9FA 5AJLA 4CRWA 2UY1A 2EIJE 4FADA 4LUNU 3WXXA 1WM5A 4HXIA 2EQXA 3CHMA 4JA9A 4OVVA 3NZSA 1UW4B 3FUNA 4EBAA 3UX4A 3TJPA 2GROB 2CHXA 3DEOA 4A63B 3KSLA 2ETCA 4BY6A 4LSZE 2KCKA 4GA1A 2AXUA 4DX5D 3LY9A 2CFUA 4UWGA 3CSTA 5BUZA 4GU5A 1TN6A 5AAOA 4KVOA 2P9KG 2M63A 3EHQA 1S70B 5KJKA 5ARFA 5AENA 2F8XK 3D9JA 1DVPA 3C3RA 4L2LA 5CECB 5JJ6A 3HIZA 1BI7B 3Q5MA 5KNHD 4XEIG 3AS8A 4OAVB 4OAUC 2DBAA 4LEUA 1S63A 4RG6A 1JCQA 3ZGQA 2AXVA 5DBKA 4ATZD 3CVPA 3FTSA 1BD8A 2ZGDA 5C2YA 4K5BA 1HXIA 3UM2A 3B95A 3QK0A 3V79K 4BWRA 3ZHEA 3PZ3A 2P9PG 3JUIA 4URKA 4PS8A 1N0RA 4C48B 2KCVA 3HXBA 5FZSA 4BERA 4I1AA 3O4ZA 4FC8A 3I4GA 3APCA 3NAWA 3R7QA 5LCWC 3MJWA 4CT4A 3FUKA 5CEDB 4AOFA 2FI7A 2HYZA 3ONKA 3ZRHA 4J8SA 3T5XA 5ITZF 5JJTA 2FO7A 2Q7FA 4G2VA 2R59A 1DNPA 3AS4A 3OTNA 2QY7A 2ZXWE 3FU0A 3B13A 3CHRA 4N3CA 3TG5A 2AWIA 1H6KA 3SO8A 1ELWA 4LCTA 5M72A 4TXRA 4GZDA 4J7WA 3GZSA 5CMYA 3BG0B 4HOTA 3RSEG 5HI7A 5ENRD 4GCOA 2BF0X 2XPZA 5D0QD 4XI9A 2UWJG 3CEQA 3IHYA 2WXMA 3Q9UC 2IOSA 3ABLE 5DIZA 3AG3E 4C9BB 1FCHA 1ZBPA 3MV2B 5KJLA 2NYJA 2R02A 4CCAA 2VSOE 5EIDA 1KZPA 1BU9A 4KXKB 3RRMB 1OUVA 4EHMA 2X38A 4G8LA 3ULYA 4WNFA 2L6JA 3QAQA 4GTQA 3PH0C 3FULA 3PNTB 1JCSA 3RRNB 5A7DB 4ANVA 4B0ZA 3MEKA 2ZU6B 5FWQA 4XIFA 1N9AA 1DCEA 4WNEA 3Q15A 4TV3A 3CK9A 5CMWA 3JQ1A 4JD2G 3D9NA 5ENTD 3AU5A 3QNKA 2ZIRA 4EECA 2DYSE 1JUQA 5G05J 3B7BA 1HH8A 3MA5A 4U7EB 4A55A 3G2UA 4U95D 2WXFA 4FLBA 4C0EA 2MHKA 5AQAA 5CERB 2V5FA 1D9SA 4GZ5A 4CDMA 4HS2A 3D9MA 1SVXA 1TNBA 3JUEA 4JB8P 3D9KA 5D66A 4FU3A 3QOUA 4FA6A 2J49A 4Z68A 2LXLA 3SBSA 4PS3A 5H7PA 2MRIA 1H2UA 4GYYA 2DWZA 4EZKA 5D2MC 3Q49B 1JWGA 4A3VA 2XRZA 2DVWA 4JC8A 5G04J 4GPMA 1UN8A 3SHFA 2R2LA 3HHMA 2KC7A 2I1KA 3UIOC 3QKYA 2BKKB 1ELKA 3D3MA 4WNDA 1DC2A 4GA0A 1E7UA 2WM9A 2YNQA 3URZA 3BUAA 4Y6WA 4JEUA 3B7SA 4RSYA 4BSXA 1KT0A 3IKOB 3FHEA 4K0RA 4U63A 4UI9C 5BV0A 4WWOA 3KAEA 4UWFA 3B7UX 4RG9A 2IO3C 4R7LA 3Q7FA 4J8DA 2F37A 3QWVA 5FQ6A 4H7YA 4N2QA 3KEAA 4CGVA 3CHOA 4IRUA 1N4QA 4DJAA 3UM0A 2I9CA 1EDUA 3NBNB 3U9WA 3EHNA 5CRVA 5LCWJ 1OWNA 2EIKE 4FP7A 2H6HA 3CV0A 3FTYA 4XZ4A 4N5CA 3UPVA 2H6FA 5BXUA 3PZ2A 1QBQA 4U07A 4G26A 4NURA 1LF8A 3V31A 3FTWA 2H6IA 2X6JA 2WXQA 3VLFA 4GTMA 1TR4A 2VSXE 3Q7AA 1WG0A 3HRAA 3TWXA 3SZ7A 3G2VA 2BEDA 3V2XA 4JHJA 3DSVA 1OCCE 3DSXA 3APDA 4WAFA 2XGSA 3TWSA 3L54A 4HLLA 2V0PA 3TXMA 3DPYA 3NOGD 2ETBA 3FU6A 3BEEA 3ABME 4G1TA 3JXJA 4WWNA 3TWRA 1N94A 2ZGGA 3ZXSA 2NXPA 5T4YA 5C1DA 2X6IA 1B89A 3TXNA 3ZEFA 1TEZA 2JEKA 3CGHA 2P58C 1S64A 3ML8A 2XCBA 3SFYA 3Q9NC 2P9LG 2OV8A 3L6AA 1NZNA 1N4RA 2WXRA 3FDHA 4BEPA 4GAAA 5AQ9A 3KD7A 3G2WA 3FUJA 3GZ2A 4J8FA 3J5PA 3U64A 1E7VA 1O1TA 4JPSA 2Y3AA 1QQEA 4GZCA 3Q79A 3CVXA 2GRRB 3C98A 3MV3B 3CVWA 2IOLA 3SNXA 4LNGA 1OWPA 3CKCA 3E33A 3FWVA 3UKUG 3LY8A 4I9EA 5CBNA 3EHRA 4JEHA 4FHKA 3ZPJA 5A6CA 4GA2A 3CKBA 4QFVA 5KWDA 1X81A 1LD7A 3LJNA 3NB2A 4TRQA 2WVIA 2WQHA 4J0UA 1P5QA 4N39A 3WG7E 4AV7A 3TG4A 5FT9A 1FT2A 2PL2A 3BU8A 4AY5A 4APFA 3CVYA 4U0ZA 2OCCE 4NACA 5G2NA 2WXOA 5AJDA 2XEHA 4UWKA 4I2WA 1K8KG 3CK8A 4B93B 3VTXA 2A4ZA 4GZ3A 2R17C 3FUDA 4HQDA 3D9IA 2PZIA 3MKQB 3CHPA 4HVBA 3EIQC 1QYMA 4ABNA 3L17A 4UWHA 1O1RA 1HZ4A 3S7FA 3TGOA 3BG1B 4LNUD 3HXFA 4JXTA 3QB2A 4KMOA 2LSUA 2V4LA 2LSVA 2YQ8A 2VTBA 3HXCA 5B1AE 5ENQD 3RRUA 5CHEE 2Y4TA 3AJIA 1E8YA 4L1BA 2F0YA 3FUIA 1MX6A 2KATA 3CQGB 3DWLG 1IYGA 4ANUA 2IF4A 4FHJA 4GTVA 1SA5A 3AG4E 1RZ4A 2C0MA 3ESKA 4EZJA 3L13A 1N54A 1H2VC 3HG0D 3T8MA 4A1GA 4XI0A 4UI9J 5ENPD 1FVHA 1MJ0A 2WXPA 3EIJA 4AM9A 3FTVA 1AWCB 3FEXA 3TL5A 3FU3A 3MX3A 2L6BA 4C0MA 5BNWA 1W3BA 2XPYA 2I1JA 2P9SG 3KS2A 3KSQA 1V54E 2KM4A 1H0AA 5FINA 1N4PA 1KT1A 4HB5A 4HOUA 3ZW3A 3TWWA 1HG5A 3VTYA 2FBNA 2X6KA 2WXGA 4PUCA 4F1SA 3DSUA 3P2BA 3SD5A 2XENA 4MS6A 2WB2A 3OXLA 3UXGA 5HS0A 4GMRA 3ONLA 4UQXA 3EU9A 2DZNA 2XZDG 4PH4B 3C5RA 2QC9A 3B7TA 3U4TA 1TNZA 3DBSA 4HOSA 3O48A 2WXLA 4UI9K 4JA7A 5ENNA 4DUIA 2RKKA 1MX2A 2XGMA 3PREA 4RVBA 5JHBA 5KNGA 2RG8A 3L08A 1MQSA 2EIME 3FUEA 4TXQA 2XS8A 4DK5A 4MRUA 4F7AA 1NA0A 4E6HA 4FULA 1Z3YA 2I2OA 4EQFA 3LCAA 3PVLA 1RW2A 4HI9A 5JMND 4I6JA 2ETAA 2VQ2A 1SW6A 3QC1A 2P9IG 4DPRA 5T3RA 2GRLA 2LO6A 2L0TB 3OXFA 2MYOA 5LX8A 4DI3A 2WMNA 3LY7A 4BT9A 5B3SE 4IYPA 4JHKA 1JPLA 3G2SA 1V55E 2Y1LE 4LNBA 2IFUA 4AP2A 3UINC 2R05A 2VGXB 2C2LA 1UG3A 1GW6A 2CG2A 3ASFA 2IQCA 4ILHB 3D9OA 3AG1E 2V5QC 3ZNGA 3D9HA 1E8WA 2X6FA 4ANXA 1OT8A 1TNOA 2YHCA 2WXKA 3W9GA 4LRZA 1L5JA 4H7XA 5KJNA 3AU4A 1PC2A 4N5QA 4DLOA 3PZ4A 4UQYA 2IU1A 3SBTB 3ZYQA 1Y8MA 2V8SE 4F6RD 3NQPA 2AJAA 1K3ZD 3TWVA 2E0IA 2Y4UA 2X3MA 4Q69A 4AEZC 3NZUA 4K5AB 1O1SA 3TWQA 2JABA 1N0QA 3GW4A 3Q4AB 3R9AB 1ZB1A 4E85A 4U04A 4U8YD 4K03A 3ISMC 2NC9A 3Q75A 4WWPA 4YDEA 5E75A 4B89A 2J4BA 4V3IA 3CVLA 1HS6A 4DLQA 5AYWD 3AG2E 3IBEA 1QZ2A 3DXKG 2LAHA 4GTPA 5AQBA 3S7BA 2KZTB 1S0PA 2B6CA 4X8QA 3UTMA 3K9IA 4I43A 5EX3A 3U66A 2GGFA 3C72A 3CVQA 2IONA 5AN8A 4EZLA 1EPUA 4BT8A 5LP0A 3Q78A 2LNIA 3SI5A 2XQ0A 4ILGA 1IQUA 2OVBA 4CDRA 3D9PA 1U2VG 5ANLA 4U8HA 2XEEA 4AIFA 3HYMB 1Z6TA 3L9TA 1ZU2A 2KBXA 4DX7D 2WXNA 1N11A 2DYRE 4XKBA 4GZ6A 2WXJA 3EDTB 1INZA 3TWTA 2J9QA 3DRAA 3CVVA 1WY6A 2CFZA 1N4SA 4ZHBA 3ZFWA 1BI8B 4KZCA 3CIAA 1NI1A 3UMVA 5FIOA 3MCXA 2J8SD 5CRUA 2XCCA 4FJZA 3FEYA 3HXEA 3ASOE 3PEUB 2IY0C 3UUXA 2J09A 4I17A 5HRYA 4BTAA 1TJCA 3IXEA 4TUMA 4M7CA 5G05C 3UM3A 5G04C 1TJFA 2XZTG 3LYAA 4APOA 4ACLA 1TNYA 4F3VA 1HF8A 1YA0A 3V30A 3FH8A 3DSWA 2BUGA 5AQ7A 2HM8A 4XX5A 5FZQA 3PZDA 3B7RL 4G8KA 3UT8A 1H6OA 1JCRA 4TUUA 3ULQA 1NP7A 4PS7A 3CVUA 4CZ2D 3PRZA 1OCZE 1Z3XA 3I5PA 3HVEB 4DX1A 4LERA 1YCSB 1BPOA 2QFCA 4HRMB 2NSZA 1LTXA 2JLBA 2QYJA 4JL0A 2BTDA 2OEWA 4I2ZA 4WUYA 1XGWA 1ELRA 3ASGA 5KJMA 3E37A 3Q73A 2P2CP 3EU5A 2FO1E 2HE0A 3NF1A 2VYIA 1G3NB 1SA4A 5J08A 5J90A 5ENOD 3ML9A 3MGBA 4YNDA 3SGHA 1NA3A 2LUHA 2GRMA 3SFXA 3SF4A 4Y6CA 4ATGA 3RU0A 1SZ9A 5JHAA 5EILA 3BQOA 4DX6D 3CQCB 5EIBE 4A3TA 4UWLA 3MZLB 4BX9A 4Q96A 2PQNA 3MKQA 2E2EA 3ULEG 3PE4A 1N52A 4HRLA 4NIKA 3PDNA 1BLXB 2BKGA 4I1OB 3SFZA 2IEJA 3CHQA 4L7TA 2ILRA 4DX2A 3RKVA 2ONDA 4JW1A 3ABKE 3RO3A 4GYWA 2HO1A 3ZUVB 4ZFHA 1KPSB 2J4DA 3FTXA 4CT0A 2V4HC 1YMPA 4JZYA 3I3NA 1O5MA 3CK7A 4L9PA 1E8XA 2QYUA 3U3WA 3SQVA 2VSNA 5T8IA 4F53A 3JQ0A 3P1UA 1YYHA 4OVUA 3L16A 3ZKJA 3D9LA 3LEWA 3CR3A 4MKTA 3E34A 4PDXA 4GPKA 2OVFA 5JJ7A 1TN8A 3ASDA 4YDWA 3ZN3A 4IULA 4CGWA 1OCOE 3UKRG 4O1PA 4GTRA 1OWLA 4UUCA 4J8EA 5IY5E 5FZRA 3T8KA 1H6PA 2H6GA 2P9UG 2KXPC 2XRYA 3IEGA 1OCRE 3FUHA 4ME2A 2GRNB 2VGEA 2Y0BG 4G25A 4O6FA 2DZOA 4CYMD 5EDSA 1KZOA 1SZAA 2HR2A 2P9NG 4I6GA 3LXUX 3PUJA 4KBQA 2FEZA 3V2OA 2WPVA 4U0UA 1IHGA 3IHVA 3ZIMA 4HI8A 1NFIE 4U96D 2WXIA 4FLHA 3UM1A 4BETA 2J07A 4DRXE 3HXDA 1OWMA 5CBOA 1OWOA 4GTTA 3FP3A 1H2TC 1D8DA 1VDYA 3NOCD 3JCKC 4GCNA 2WXHA 2LXMA 4B8CB 3FH5A 3L22A 4J8YA 2C0LA 5G55A 3ZYMA 4KT6B 3UIPC 3G2TA 2GRQB 2PM7A 3PNLB 5CCLA 1E8ZA 5CCMA 3LJ3A 4N3BA 4I9CA 5LOZA 3VLDA 2EILE 4FJYA 4Q94A 3ZXPA 3PZ1A 1TN7A 2F8YA 4O60A 3S7JA 4HORA 3TAXA 4BX8A 2XS1A 4TXPA 1WDYA 4LG6A 4ACKA 3RAUA 4K5CA 3OAWA 1HG2A 4A1SA 1IHBA 2XEVA 3EJNA 4P29A 1UJKA 4G11A 1MX4A 5E76A 3ZU7B 3LPZA 3ASHA 2OOEA 4U0SA 1HO8A 3MKRA 3T5VA 1HFAA 1D8EA 1Z5SC 3C3OA 4I1MA 2YINA 3AAAC 4CDNA 3DPDA 1DCQA 1K1AA 1U3DA 1SQMA 2RFAA 3LVRE 2UY1B 4RQIA 5ANRA 4I6EA 5FQ7A 2VGYA 1PAQA 4YVOA 3DXMG 2AVPA 5BW8C 2WMOA 3VLEA 3APFA 3IV0A 4HBDA 1UOHA 3OXGA 2RD0A 3S2AA 2B0OE 1EYHA 5KCMA 1X5BA 4G23A 3UT4A 3L82A 4J6IA 3S7DA 1K1BA 4L23A 2YHEA 3FUMA 1E96B 5AARA 4YDOA 3TWUA 5AIJA 3QDNA 4B8AA 2R03A 4JHRA 4KVMA 4G24A 3JXIA 1A5EA 3CHSA 4WNGA 2PM6A 3E32A 1AP7A 4M3OA 3MYVA 4BSZB 4DI4A 3F6QA 3FH7A 4W9RA 5KBAA 2CHWA 1IKND 5A23A 4IN3B 1XNFA 4D10C 5BV1A 1MYOA 4B94A 4EPZA 4GB9A 5HKPA 1Y6IA 2IO2C 4GTSA 2L9BA
chains in the Genus database with same CATH topology
4JVSA 4KXKB 3I5PA 3RRMB 3N71A 1OUVA 3FUIA 3HVEB 3ZVVA 4LERA 1BPOA 2QFCA 2X38A 2NSZA 4GYOA 2JLBA 4WNFA 2KATA 2L6JA 3JYSA 3CQGB 1IYGA 3QAQA 4JL0A 4ANUA 2IF4A 4FHJA 2BTDA 1KLXA 1A17A 3PH0C 3FULA 3PNTB 4KYOB 4EBAG 3RRNB 4I2ZA 2C0MA 5A7DB 4WUYA 3ESKA 4EZJA 1XGWA 4ANVA 1ELRA 3ASGA 3I4RB 4B0ZA 3L13A 5KJMA 1N54A 3MEKA 2ZU6B 3CVNA 2IJGX 1H2VC 5FWQA 4XIFA 3NF1A 3T8MA 3E4BA 2VYIA 4A1GA 4XI0A 2FF4A 4UI9J 3PEVB 4WNEA 2X6HA 2XPIA 2L0IA 1IQRA 5J08A 5J90A 1FVHA 1UN9A 2WXPA 3Q15A 1HE8A 3EIJA 2A5UA 4TV3A 4AM9A 3FTVA 3CK9A 5CMWA 3JQ1A 3ML9A 4BFRA 3D9NA 3MGBA 4YNDA 3AU5A 3QNKA 3FEXA 3SGHA 4EECA 1NA3A 2KCLA 3TL5A 2GRMA 3SF4A 1QNFA 3FU3A 3ZHEB 1JUQA 3MX3A 2XGOA 4Y6CA 4ATGA 1MHQA 3RU0A 1SZ9A 4C0MA 5G05J 5JHAA 3CSFA 5BNWA 1W3BA 1HH8A 2XPYA 4XE0A 2I1JA 3CQCB 2VTBB 3MA5A 4A55A 3G2UA 2WXFA 3KS2A 4A3TA 1E90A 2KM4A 1H0AA 2WQ7A 4AVXA 1KT1A 4FLBA 4ILIA 4UWLA 3MZLB 2R5SA 4BX9A 4C0EA 4HOUA 4Q96A 1HX8A 2I6HA 2MHKA 2PQNA 3MKQA 3ZW3A 2V5FA 5FQ8A 4CEMA 2E2EA 1HG5A 4GZ5A 4CDMA 3VTYA 3PE4A 5EX0A 4YVQC 4HS2A 3D9MA 1N52A 2FBNA 5EKQD 2X6KA 3ENEA 3QARA 3D9KA 5HQ8A 2WXGA 4PUCA 3PDNA 3P2BA 4F1SA 4FU3A 3FTZA 3LS8A 3SD5A 1EF1C 2CHZA 3QOUA 4MS6A 3LKUA 4I1OB 4FA6A 5FJYA 2WB2A 4BTBA 3OXLA 2J49A 3SFZA 2AXZA 3ONLA 3PE3A 2PQRA 3LDZA 4UQXA 3SBSA 4PS3A 3RO2A 3CHQA 2MRIA 4AXHA 1H2UA 4L7TA 4GYYA 4NQ0A 2ILRA 1WAO1 3RKVA 5ARGA 3UQ3A 3PUKA 2VGXA 4L2YA 2ONDA 3GYZA 4EZKA 4JW1A 3RO3A 4PH4B 4GYWA 3Q49B 1JWGA 4A3VA 2HO1A 4NRHB 3B7TA 3HVEA 4HFGA 2XRZA 4JC8A 3PS6A 3U4TA 5G04J 3DBSA 1UN8A 4N2SA 3SHFA 3HHMA 2J08A 2KC7A 2I1KA 3O48A 4HOSA 2LAIA 2WXLA 3QKYA 2J4DA 2CG3A 4UI9K 4JA7A 5ENNA 3FTXA 4CT0A 1ELKA 3R7RA 3D3MA 4XKCA 4WNDA 4GA0A 1PY1A 2XGMA 4JZYA 3PREA 1E7UA 3I3NA 2WM9A 4RVBA 3RK6A 4HOQA 2YNQA 3CK7A 5JHBA 1E8XA 3EHMA 3URZA 2GW1A 3GZ1A 3U3WA 4Y6WA 4JEUA 4ANWA 4AY6A 3ZYKA 3B7SA 2RG8A 2VSNA 1JWFA 3FU5A 3L08A 3ESLA 4RSYA 5T8IA 3RJVA 1KT0A 3JQ0A 3P1UA 4BSXA 1MQSA 3IKOB 3FHEA 4K0RA 2MOWA 2DCPA 3FUEA 4OVUA 3L16A 4U63A 4UI9C 5BV0A 3D9LA 3QJZA 3LEWA 4DK5A 4WWOA 3KAEA 4MRUA 3CR3A 4UWFA 4MKTA 4F7AA 4AJWA 4PDXA 3ZYLA 3B7UX 3UT7A 2OVFA 1NA0A 4GPKA 4GMJA 4E6HA 4RG9A 4FULA 3AS5A 5JJ7A 4R7LA 5BT1A 1Z3YA 2WQ6A 2I2OA 3FFLA 4EQFA 2VSYA 3ASDA 4J8DA 4UQZA 1UJJA 3LCAA 3KEZA 3PVLA 3ZN3A 3QWVA 2XHEA 2AW6A 4HLEA 4IULA 4GMLA 5FQ6A 4H7YA 4N2QA 4CGWA 5FQ4A 1U3CA 4CGVA 3CHOA 4I6JA 4IRUA 4DJAA 2VQ2A 3QC1A 4DPRA 5T3RA 2GRLA 1OWLA 2LO6A 5BPPA 4J8EA 5FZRA 3HDXA 3QWWA 1FVFA 2L0TB 2VJ8A 3OXFA 5D0OD 3QWPA 4KZ0A 2I9CA 5LX8A 2FULA 4DI3A 2WMNA 3CLJA 1EDUA 3LY7A 4BT9A 2XRYA 2DIWA 3IEGA 4IYPA 3FTUA 3U9WA 4JHKA 1JPLA 3EHNA 3G2SA 4ME2A 3FUHA 5LFAA 1OWNA 5LCWJ 3LVQE 4FP7A 4G25A 3CV0A 3FTYA 4O6FA 4XZ4A 4N5CA 3UPVA 4OYSA 2IFUA 4F53A 2KZTA 4AP2A 3Q47B 4N3AA 3FY4A 4MLPA 5FTPA 5EDSA 1H19A 1SZAA 2VGXB 2HR2A 2C2LA 4U07A 3FUFA 1UG3A 1GW6A 2CG2A 4I6GA 3ASFA 2IQCA 4G26A 4NURA 3LXUX 1LF8A 3PUJA 4ILHB 1HU3A 3D9OA 3FTWA 4KBQA 2X6JA 2WXQA 2FEZA 3RIBA 1E8WA 2X6FA 5AJLA 3VLFA 4CRWA 2WPVA 4U0UA 4ANXA 1IHGA 2UY1A 2YHCA 2WXKA 3IHVA 4LRZA 4FADA 4LUNU 3ZIMA 1L5JA 2VSXE 4H7XA 3WXXA 5KJNA 2WXIA 4FLHA 3AU4A 3SZ7A 1WM5A 4HXIA 3G2VA 2EQXA 3CHMA 4JA9A 4OVVA 1PC2A 4JHJA 2J07A 4DLOA 1OWMA 3NZSA 1UW4B 3FUNA 4UQYA 1OWOA 2IU1A 3SBTB 3ZYQA 3APDA 3FP3A 4EBAA 1H2TC 4WAFA 1VDYA 2XGSA 3UX4A 1Y8MA 2V8SE 3JCKC 4GCNA 2WXHA 3TJPA 4B8CB 3FH5A 3L54A 3NQPA 3L22A 2V0PA 3TXMA 2CHXA 2C0LA 5G55A 3FU6A 3BEEA 2E0IA 2Y4UA 2X3MA 3ZYMA 4BY6A 4Q69A 4G1TA 4WWNA 4AEZC 2KCKA 3NZUA 4GA1A 2AXUA 3LY9A 2CFUA 4UWGA 3ZXSA 3CSTA 5BUZA 2NXPA 4GU5A 3GW4A 5T4YA 5C1DA 2X6IA 4KVOA 1B89A 3Q4AB 3R9AB 3TXNA 4KT6B 2M63A 3ZEFA 4E85A 5KJKA 3G2TA 1TEZA 2JEKA 4U04A 4K03A 5ARFA 2NC9A 5AENA 3CGHA 2PM7A 3D9JA 2P58C 3PNLB 1DVPA 3ML8A 5CCLA 4WWPA 1E8ZA 5CCMA 3LJ3A 4N3BA 4I9CA 5LOZA 3VLDA 2XCBA 4FJYA 4Q94A 5E75A 4B89A 2J4BA 4L2LA 5JJ6A 4V3IA 3HIZA 3CVLA 3Q5MA 2OV8A 3S7JA 1HS6A 4HORA 3L6AA 3TAXA 4DLQA 5AYWD 3AS8A 4BX8A 1NZNA 3IBEA 1QZ2A 2WXRA 2DBAA 3FDHA 4LEUA 4GAAA 3KD7A 4RG6A 3ZGQA 3G2WA 2AXVA 4ACKA 3FUJA 5DBKA 2LAHA 3GZ2A 4J8FA 3S7BA 3U64A 2KZTB 1E7VA 3CVPA 1HG2A 3OAWA 1S0PA 4A1SA 3FTSA 4JPSA 2Y3AA 1QQEA 4GZCA 2XEVA 3K9IA 5C2YA 3CVXA 3C98A 3EJNA 3MV3B 4I43A 5EX3A 3U66A 2GGFA 4P29A 3CVWA 3CVQA 2IOLA 1UJKA 1HXIA 2IONA 3SNXA 3QK0A 1EPUA 1OWPA 3CKCA 4G11A 3ZHEA 4BT8A 4BWRA 4EZLA 5LP0A 3FWVA 5E76A 2LNIA 3JUIA 3LPZA 3LY8A 4I9EA 3SI5A 3ASHA 2XQ0A 4ILGA 4JEHA 2OOEA 1IQUA 4URKA 4U0SA 4FHKA 1HO8A 2OVBA 4PS8A 3MKRA 4CDRA 3D9PA 5ANLA 3T5VA 2KCVA 1HFAA 5FZSA 4U8HA 3ZPJA 5A6CA 4GA2A 4I1MA 3CKBA 4QFVA 2YINA 4AIFA 3HYMB 1Z6TA 4TRQA 4I1AA 4CDNA 3O4ZA 4FC8A 1ZU2A 2WVIA 3DPDA 2WQHA 4J0UA 1P5QA 1U3DA 2WXNA 1SQMA 4N39A 4AV7A 3LVRE 5FT9A 3TG4A 2UY1B 2PL2A 3I4GA 3APCA 4XKBA 4GZ6A 2WXJA 5ANRA 3EDTB 3R7QA 4APFA 4AY5A 2J9QA 5LCWC 3CVYA 1INZA 4I6EA 3MJWA 4U0ZA 5FQ7A 4CT4A 2VGYA 1PAQA 1WY6A 3FUKA 4YVOA 4AOFA 2CFZA 2AVPA 5BW8C 2FI7A 4NACA 2HYZA 5G2NA 3ONKA 3ZFWA 3ZRHA 2WMOA 4J8SA 4KZCA 2WXOA 3T5XA 3CIAA 5AJDA 3UMVA 3VLEA 5JJTA 2FO7A 2Q7FA 3APFA 3IV0A 3MCXA 4G2VA 2R59A 1DNPA 3OXGA 2RD0A 3AS4A 2XCCA 3S2AA 3OTNA 2QY7A 1EYHA 5KCMA 3FU0A 3B13A 3CHRA 4N3CA 4FJZA 3TG5A 2AWIA 1X5BA 4G23A 3UT4A 3FEYA 1H6KA 3PEUB 4UWKA 3UUXA 2J09A 4I17A 4I2WA 4BTAA 4J6IA 1ELWA 3CK8A 3S7DA 4LCTA 5M72A 3VTXA 1TJCA 4L23A 2A4ZA 2YHEA 3FUMA 1E96B 4GZ3A 4GZDA 5G05C 2R17C 3FUDA 3GZSA 5AIJA 3D9IA 3QDNA 4B8AA 2PZIA 5G04C 4JHRA 3MKQB 3CHPA 5CMYA 3BG0B 3CVVA 1TJFA 4G24A 4KVMA 4HVBA 3EIQC 3LYAA 4ABNA 3CHSA 4WNGA 2PM6A 4HOTA 3L17A 4APOA 4ACLA 4UWHA 4M3OA 3MYVA 4DI4A 5HI7A 3FH7A 4GCOA 4F3VA 1HF8A 4W9RA 1YA0A 2BF0X 2XPZA 3FH8A 5D0QD 4XI9A 1HZ4A 2UWJG 2BUGA 3S7FA 3TGOA 3CEQA 3BG1B 2HM8A 3IHYA 2CHWA 2WXMA 4JXTA 4XX5A 5FZQA 3QB2A 3PZDA 2LSUA 4KMOA 3B7RL 2IOSA 5DIZA 2V4LA 2LSVA 2YQ8A 4C9BB 5A23A 2VTBA 1FCHA 3UT8A 4IN3B 1XNFA 1ZBPA 4D10C 3MV2B 4TUUA 3ULQA 5BV1A 1NP7A 4PS7A 5KJLA 3RRUA 5CHEE 3CVUA 2Y4TA 4CCAA 4B94A 4EPZA 4GB9A 2VSOE 3PRZA 1E8YA 1Z3XA 1Y6IA 4L1BA 2L9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KXK B;  3ASH A;  3N71 A;  1OUV A;  2OOE A;  2WPV A;  4U0U A;  4U0S A;  3U4T A;  3MKR A;  5G04 J;  4CDR A;  4N2S A;  4HOT A;  2QFC A;  2KC7 A;  1IHG A;  2UY1 A;  2YHC A;  2KCV A;  3O48 A;  4HOS A;  5FZS A;  3QKY A;  4GYO A;  2JLB A;  4H7X A;  4UI9 K;  4JA7 A;  4WNF A;  3ZPJ A;  2KAT A;  2L6J A;  5A6C A;  3JYS A;  4GA2 A;  3WXX A;  5KJN A;  3CKB A;  1IYG A;  4JL0 A;  3SZ7 A;  2IF4 A;  4AIF A;  1WM5 A;  3HYM B;  4WND A;  4GA0 A;  1KLX A;  1A17 A;  4JA9 A;  2XGM A;  4I1A A;  4KYO B;  1PC2 A;  5C1D A;  1ZU2 A;  4I2Z A;  2C0M A;  2WQH A;  4HOQ A;  1P5Q A;  3CK7 A;  4J0U A;  3ESK A;  4N39 A;  4UQY A;  4WUY A;  1ELR A;  3ASG A;  2GW1 A;  2UY1 B;  2PL2 A;  3GZ1 A;  5FT9 A;  3MEK A;  3TG4 A;  5KJM A;  3CVN A;  3FP3 A;  4AY5 A;  4GZ6 A;  3U3W A;  3EDT B;  5LCW C;  4Y6W A;  2J9Q A;  4XIF A;  4U0Z A;  2XGS A;  3NF1 A;  1Y8M A;  2VGY A;  4YVO A;  4AY6 A;  2VSN A;  3E4B A;  2VYI A;  2AVP A;  4GCN A;  5BW8 C;  2FI7 A;  4XI0 A;  3RJV A;  2HYZ A;  1KT0 A;  2FF4 A;  4UI9 J;  4WNE A;  2XPI A;  3ZFW A;  5JJT A;  3Q15 A;  4UI9 C;  2C0L A;  2FO7 A;  2Q7F A;  4G2V A;  3BEE A;  4AM9 A;  3KAE A;  2Y4U A;  2FEZ A;  3OXG A;  3AS4 A;  3CK9 A;  2XCC A;  4GPK A;  4G1T A;  1NA0 A;  3LPZ A;  2KCK A;  4YND A;  4GA1 A;  4RG9 A;  3AS5 A;  3TG5 A;  4N3C A;  3LY9 A;  5JJ7 A;  1NA3 A;  4G23 A;  5BT1 A;  2KCL A;  3FFL A;  3SF4 A;  3ZHE B;  4EQF A;  2VSY A;  3ASD A;  3GW4 A;  4J8D A;  2XGO A;  4I17 A;  3LCA A;  4I2W A;  4UQZ A;  1B89 A;  3Q4A B;  4Y6C A;  3RU0 A;  5G05 J;  1ELW A;  3QWV A;  3ZN3 A;  3CK8 A;  3R9A B;  3S7D A;  5BNW A;  1W3B A;  4H7Y A;  1HH8 A;  3VTX A;  1TJC A;  5M72 A;  4N2Q A;  4CGW A;  3MA5 A;  5KJK A;  1E96 B;  4GZ3 A;  4U04 A;  5A7D B;  5ARF A;  4CGV A;  2NC9 A;  3KS2 A;  2P58 C;  5G05 C;  5CCL A;  1KT1 A;  3QDN A;  2PZI A;  5G04 C;  5CCM A;  4JHR A;  2R5S A;  2VQ2 A;  4N3B A;  4I9C A;  4HOU A;  2XCB A;  2I6H A;  2MHK A;  2PQN A;  4G24 A;  2V5F A;  3LYA A;  4ABN A;  4J8E A;  4WNG A;  5FZR A;  5JJ6 A;  4I9E A;  2E2E A;  3CVL A;  3QWW A;  4GZ5 A;  3Q5M A;  3URZ A;  4APO A;  3VTY A;  3OXF A;  3PE4 A;  5D0O D;  5EX0 A;  3QWP A;  4YVQ C;  3S7J A;  4HOR A;  3TAX A;  5HI7 A;  4GCO A;  5AYW D;  2FBN A;  3AS8 A;  5EKQ D;  3LY7 A;  4BT9 A;  1NZN A;  4W9R A;  4F3V A;  3IEG A;  1YA0 A;  1QZ2 A;  2DBA A;  4LEU A;  5D0Q D;  5HQ8 A;  4XI9 A;  1HZ4 A;  2UWJ G;  3PDN A;  2BUG A;  3KD7 A;  4ME2 A;  4RG6 A;  3S7F A;  3CEQ A;  3UUX A;  3ZGQ A;  5LCW J;  5DBK A;  3TGO A;  3GZ2 A;  3CV0 A;  4G25 A;  4J8F A;  4O6F A;  3QOU A;  5FZQ A;  3LKU A;  4N5C A;  3S7B A;  3CVP A;  3UPV A;  5FJY A;  2LSU A;  2IFU A;  4A1S A;  4BTB A;  3OXL A;  5DIZ A;  2LSV A;  1QQE A;  2YQ8 A;  3PE3 A;  3Q47 B;  2PQR A;  4UQX A;  2XEV A;  3K9I A;  4N3A A;  4BTA A;  3RO2 A;  1FCH A;  5FTP A;  4IN3 B;  1XNF A;  1ZBP A;  3MV3 B;  3MV2 B;  5EX3 A;  3ULQ A;  4NQ0 A;  4GYY A;  5KJL A;  2VGX B;  2HR2 A;  2C2L A;  3CVQ A;  4U07 A;  1HXI A;  1WAO 1;  2Y4T A;  5CHE E;  5ARG A;  3ASF A;  4G26 A;  3RKV A;  3UQ3 A;  2VGX A;  3CKC A;  2OND A;  3GYZ A;  3ZHE A;  4B94 A;  4BT8 A;  4BWR A;  3RO3 A;  3FWV A;  4KBQ A;  4GYW A;  3Q49 B;  2LNI A;  2HO1 A;  4NRH B;  3LY8 A;  3RIB A; 
#chains in the Genus database with same CATH topology
 4JVS A;  3N71 A;  3ZVV A;  3X2Q E;  1FPP A;  4GYO A;  3JYS A;  1KLX A;  1A17 A;  4KYO B;  4EBA G;  1OXJ A;  4YDY A;  3I4R B;  2PNN A;  3CVN A;  2IJG X;  3ASN E;  3E4B A;  4MBG A;  2FF4 A;  3PEV B;  2X6H A;  2XPI A;  2L0I A;  1IQR A;  1UN9 A;  1HE8 A;  2A5U A;  1IXV A;  5BXO A;  4BFR A;  2QZA A;  2ZIS A;  3R9M A;  2KCL A;  3DSS A;  1QNF A;  3ZHE B;  5CEA A;  2XGO A;  1MHQ A;  4O1O A;  3CSF A;  4XE0 A;  2VTB B;  2A5E A;  1E90 A;  1TYQ G;  2WQ7 A;  4AVX A;  4ILI A;  2R5S A;  1HX8 A;  2I6H A;  5FQ8 A;  4CEM A;  3DEP A;  5EYL A;  5EX0 A;  4YVQ C;  1Q2Z A;  1FT1 A;  4QQI A;  5EKQ D;  3SY2 A;  3QAR A;  3ENE A;  5HQ8 A;  3FTZ A;  3LS8 A;  1EF1 C;  2CHZ A;  4F1P A;  3LKU A;  4U8V D;  5FJY A;  4BTB A;  4RLY A;  2AXZ A;  3PE3 A;  5EYP F;  2PQR A;  3LDZ A;  3RO2 A;  1MZC A;  4AXH A;  3EUV A;  4NQ0 A;  1TNU A;  2RFM A;  1WAO 1;  5ARG A;  3UQ3 A;  3PUK A;  2VGX A;  4L2Y A;  3GYZ A;  4HRN A;  2Y69 E;  4NRH B;  3HVE A;  4HFG A;  5JA4 D;  2GRP B;  3PS6 A;  5B1B E;  4HNA D;  4N2S A;  2J08 A;  2LAI A;  2CG3 A;  3T9K A;  3R7R A;  3C3Q A;  4XKC A;  1PY1 A;  3RK6 A;  4HOQ A;  3EHM A;  1NL4 A;  2GW1 A;  3GZ1 A;  4ANW A;  4AY6 A;  3ZYK A;  1JWF A;  3FU5 A;  3RJV A;  3ESL A;  2EIN E;  1LD8 A;  2MOW A;  2DCP A;  3QJZ A;  4AJW A;  3ZYL A;  3UT7 A;  4GMJ A;  3AS5 A;  3UI2 A;  5BT1 A;  2WQ6 A;  3FFL A;  2VSY A;  4UQZ A;  1UJJ A;  3KEZ A;  4HLE A;  2XHE A;  2AW6 A;  4GML A;  5FQ4 A;  1U3C A;  5EN5 D;  5BPP A;  4GTO A;  3HDX A;  3QWW A;  1FVF A;  4BES A;  2VJ8 A;  5D0O D;  3QWP A;  4KZ0 A;  2FUL A;  3J5Q B;  3CLJ A;  2DIW A;  3E30 A;  3FTU A;  5LFA A;  3LVQ E;  3DST A;  4OYS A;  1OY3 D;  2KZT A;  3Q47 B;  4N3A A;  3FY4 A;  4MLP A;  5FTP A;  1H19 A;  2OEV A;  3FUF A;  1N95 A;  1HU3 A;  3RIB A;  5ENS D;  3W9F A;  5AJL A;  4CRW A;  2UY1 A;  2EIJ E;  4FAD A;  4LUN U;  3WXX A;  1WM5 A;  4HXI A;  2EQX A;  3CHM A;  4JA9 A;  4OVV A;  3NZS A;  1UW4 B;  3FUN A;  4EBA A;  3UX4 A;  3TJP A;  2GRO B;  2CHX A;  3DEO A;  4A63 B;  3KSL A;  2ETC A;  4BY6 A;  4LSZ E;  2KCK A;  4GA1 A;  2AXU A;  4DX5 D;  3LY9 A;  2CFU A;  4UWG A;  3CST A;  5BUZ A;  4GU5 A;  1TN6 A;  5AAO A;  4KVO A;  2P9K G;  2M63 A;  3EHQ A;  1S70 B;  5KJK A;  5ARF A;  5AEN A;  2F8X K;  3D9J A;  1DVP A;  3C3R A;  4L2L A;  5CEC B;  5JJ6 A;  3HIZ A;  1BI7 B;  3Q5M A;  5KNH D;  4XEI G;  3AS8 A;  4OAV B;  4OAU C;  2DBA A;  4LEU A;  1S63 A;  4RG6 A;  1JCQ A;  3ZGQ A;  2AXV A;  5DBK A;  4ATZ D;  3CVP A;  3FTS A;  1BD8 A;  2ZGD A;  5C2Y A;  4K5B A;  1HXI A;  3UM2 A;  3B95 A;  3QK0 A;  3V79 K;  4BWR A;  3ZHE A;  3PZ3 A;  2P9P G;  3JUI A;  4URK A;  4PS8 A;  1N0R A;  4C48 B;  2KCV A;  3HXB A;  5FZS A;  4BER A;  4I1A A;  3O4Z A;  4FC8 A;  3I4G A;  3APC A;  3NAW A;  3R7Q A;  5LCW C;  3MJW A;  4CT4 A;  3FUK A;  5CED B;  4AOF A;  2FI7 A;  2HYZ A;  3ONK A;  3ZRH A;  4J8S A;  3T5X A;  5ITZ F;  5JJT A;  2FO7 A;  2Q7F A;  4G2V A;  2R59 A;  1DNP A;  3AS4 A;  3OTN A;  2QY7 A;  2ZXW E;  3FU0 A;  3B13 A;  3CHR A;  4N3C A;  3TG5 A;  2AWI A;  1H6K A;  3SO8 A;  1ELW A;  4LCT A;  5M72 A;  4TXR A;  4GZD A;  4J7W A;  3GZS A;  5CMY A;  3BG0 B;  4HOT A;  3RSE G;  5HI7 A;  5ENR D;  4GCO A;  2BF0 X;  2XPZ A;  5D0Q D;  4XI9 A;  2UWJ G;  3CEQ A;  3IHY A;  2WXM A;  3Q9U C;  2IOS A;  3ABL E;  5DIZ A;  3AG3 E;  4C9B B;  1FCH A;  1ZBP A;  3MV2 B;  5KJL A;  2NYJ A;  2R02 A;  4CCA A;  2VSO E;  5EID A;  1KZP A;  1BU9 A;  4KXK B;  3RRM B;  1OUV A;  4EHM A;  2X38 A;  4G8L A;  3ULY A;  4WNF A;  2L6J A;  3QAQ A;  4GTQ A;  3PH0 C;  3FUL A;  3PNT B;  1JCS A;  3RRN B;  5A7D B;  4ANV A;  4B0Z A;  3MEK A;  2ZU6 B;  5FWQ A;  4XIF A;  1N9A A;  1DCE A;  4WNE A;  3Q15 A;  4TV3 A;  3CK9 A;  5CMW A;  3JQ1 A;  4JD2 G;  3D9N A;  5ENT D;  3AU5 A;  3QNK A;  2ZIR A;  4EEC A;  2DYS E;  1JUQ A;  5G05 J;  3B7B A;  1HH8 A;  3MA5 A;  4U7E B;  4A55 A;  3G2U A;  4U95 D;  2WXF A;  4FLB A;  4C0E A;  2MHK A;  5AQA A;  5CER B;  2V5F A;  1D9S A;  4GZ5 A;  4CDM A;  4HS2 A;  3D9M A;  1SVX A;  1TNB A;  3JUE A;  4JB8 P;  3D9K A;  5D66 A;  4FU3 A;  3QOU A;  4FA6 A;  2J49 A;  4Z68 A;  2LXL A;  3SBS A;  4PS3 A;  5H7P A;  2MRI A;  1H2U A;  4GYY A;  2DWZ A;  4EZK A;  5D2M C;  3Q49 B;  1JWG A;  4A3V A;  2XRZ A;  2DVW A;  4JC8 A;  5G04 J;  4GPM A;  1UN8 A;  3SHF A;  2R2L A;  3HHM A;  2KC7 A;  2I1K A;  3UIO C;  3QKY A;  2BKK B;  1ELK A;  3D3M A;  4WND A;  1DC2 A;  4GA0 A;  1E7U A;  2WM9 A;  2YNQ A;  3URZ A;  3BUA A;  4Y6W A;  4JEU A;  3B7S A;  4RSY A;  4BSX A;  1KT0 A;  3IKO B;  3FHE A;  4K0R A;  4U63 A;  4UI9 C;  5BV0 A;  4WWO A;  3KAE A;  4UWF A;  3B7U X;  4RG9 A;  2IO3 C;  4R7L A;  3Q7F A;  4J8D A;  2F37 A;  3QWV A;  5FQ6 A;  4H7Y A;  4N2Q A;  3KEA A;  4CGV A;  3CHO A;  4IRU A;  1N4Q A;  4DJA A;  3UM0 A;  2I9C A;  1EDU A;  3NBN B;  3U9W A;  3EHN A;  5CRV A;  5LCW J;  1OWN A;  2EIK E;  4FP7 A;  2H6H A;  3CV0 A;  3FTY A;  4XZ4 A;  4N5C A;  3UPV A;  2H6F A;  5BXU A;  3PZ2 A;  1QBQ A;  4U07 A;  4G26 A;  4NUR A;  1LF8 A;  3V31 A;  3FTW A;  2H6I A;  2X6J A;  2WXQ A;  3VLF A;  4GTM A;  1TR4 A;  2VSX E;  3Q7A A;  1WG0 A;  3HRA A;  3TWX A;  3SZ7 A;  3G2V A;  2BED A;  3V2X A;  4JHJ A;  3DSV A;  1OCC E;  3DSX A;  3APD A;  4WAF A;  2XGS A;  3TWS A;  3L54 A;  4HLL A;  2V0P A;  3TXM A;  3DPY A;  3NOG D;  2ETB A;  3FU6 A;  3BEE A;  3ABM E;  4G1T A;  3JXJ A;  4WWN A;  3TWR A;  1N94 A;  2ZGG A;  3ZXS A;  2NXP A;  5T4Y A;  5C1D A;  2X6I A;  1B89 A;  3TXN A;  3ZEF A;  1TEZ A;  2JEK A;  3CGH A;  2P58 C;  1S64 A;  3ML8 A;  2XCB A;  3SFY A;  3Q9N C;  2P9L G;  2OV8 A;  3L6A A;  1NZN A;  1N4R A;  2WXR A;  3FDH A;  4BEP A;  4GAA A;  5AQ9 A;  3KD7 A;  3G2W A;  3FUJ A;  3GZ2 A;  4J8F A;  3J5P A;  3U64 A;  1E7V A;  1O1T A;  4JPS A;  2Y3A A;  1QQE A;  4GZC A;  3Q79 A;  3CVX A;  2GRR B;  3C98 A;  3MV3 B;  3CVW A;  2IOL A;  3SNX A;  4LNG A;  1OWP A;  3CKC A;  3E33 A;  3FWV A;  3UKU G;  3LY8 A;  4I9E A;  5CBN A;  3EHR A;  4JEH A;  4FHK A;  3ZPJ A;  5A6C A;  4GA2 A;  3CKB A;  4QFV A;  5KWD A;  1X81 A;  1LD7 A;  3LJN A;  3NB2 A;  4TRQ A;  2WVI A;  2WQH A;  4J0U A;  1P5Q A;  4N39 A;  3WG7 E;  4AV7 A;  3TG4 A;  5FT9 A;  1FT2 A;  2PL2 A;  3BU8 A;  4AY5 A;  4APF A;  3CVY A;  4U0Z A;  2OCC E;  4NAC A;  5G2N A;  2WXO A;  5AJD A;  2XEH A;  4UWK A;  4I2W A;  1K8K G;  3CK8 A;  4B93 B;  3VTX A;  2A4Z A;  4GZ3 A;  2R17 C;  3FUD A;  4HQD A;  3D9I A;  2PZI A;  3MKQ B;  3CHP A;  4HVB A;  3EIQ C;  1QYM A;  4ABN A;  3L17 A;  4UWH A;  1O1R A;  1HZ4 A;  3S7F A;  3TGO A;  3BG1 B;  4LNU D;  3HXF A;  4JXT A;  3QB2 A;  4KMO A;  2LSU A;  2V4L A;  2LSV A;  2YQ8 A;  2VTB A;  3HXC A;  5B1A E;  5ENQ D;  3RRU A;  5CHE E;  2Y4T A;  3AJI A;  1E8Y A;  4L1B A;  2F0Y A;  3FUI A;  1MX6 A;  2KAT A;  3CQG B;  3DWL G;  1IYG A;  4ANU A;  2IF4 A;  4FHJ A;  4GTV A;  1SA5 A;  3AG4 E;  1RZ4 A;  2C0M A;  3ESK A;  4EZJ A;  3L13 A;  1N54 A;  1H2V C;  3HG0 D;  3T8M A;  4A1G A;  4XI0 A;  4UI9 J;  5ENP D;  1FVH A;  1MJ0 A;  2WXP A;  3EIJ A;  4AM9 A;  3FTV A;  1AWC B;  3FEX A;  3TL5 A;  3FU3 A;  3MX3 A;  2L6B A;  4C0M A;  5BNW A;  1W3B A;  2XPY A;  2I1J A;  2P9S G;  3KS2 A;  3KSQ A;  1V54 E;  2KM4 A;  1H0A A;  5FIN A;  1N4P A;  1KT1 A;  4HB5 A;  4HOU A;  3ZW3 A;  3TWW A;  1HG5 A;  3VTY A;  2FBN A;  2X6K A;  2WXG A;  4PUC A;  4F1S A;  3DSU A;  3P2B A;  3SD5 A;  2XEN A;  4MS6 A;  2WB2 A;  3OXL A;  3UXG A;  5HS0 A;  4GMR A;  3ONL A;  4UQX A;  3EU9 A;  2DZN A;  2XZD G;  4PH4 B;  3C5R A;  2QC9 A;  3B7T A;  3U4T A;  1TNZ A;  3DBS A;  4HOS A;  3O48 A;  2WXL A;  4UI9 K;  4JA7 A;  5ENN A;  4DUI A;  2RKK A;  1MX2 A;  2XGM A;  3PRE A;  4RVB A;  5JHB A;  5KNG A;  2RG8 A;  3L08 A;  1MQS A;  2EIM E;  3FUE A;  4TXQ A;  2XS8 A;  4DK5 A;  4MRU A;  4F7A A;  1NA0 A;  4E6H A;  4FUL A;  1Z3Y A;  2I2O A;  4EQF A;  3LCA A;  3PVL A;  1RW2 A;  4HI9 A;  5JMN D;  4I6J A;  2ETA A;  2VQ2 A;  1SW6 A;  3QC1 A;  2P9I G;  4DPR A;  5T3R A;  2GRL A;  2LO6 A;  2L0T B;  3OXF A;  2MYO A;  5LX8 A;  4DI3 A;  2WMN A;  3LY7 A;  4BT9 A;  5B3S E;  4IYP A;  4JHK A;  1JPL A;  3G2S A;  1V55 E;  2Y1L E;  4LNB A;  2IFU A;  4AP2 A;  3UIN C;  2R05 A;  2VGX B;  2C2L A;  1UG3 A;  1GW6 A;  2CG2 A;  3ASF A;  2IQC A;  4ILH B;  3D9O A;  3AG1 E;  2V5Q C;  3ZNG A;  3D9H A;  1E8W A;  2X6F A;  4ANX A;  1OT8 A;  1TNO A;  2YHC A;  2WXK A;  3W9G A;  4LRZ A;  1L5J A;  4H7X A;  5KJN A;  3AU4 A;  1PC2 A;  4N5Q A;  4DLO A;  3PZ4 A;  4UQY A;  2IU1 A;  3SBT B;  3ZYQ A;  1Y8M A;  2V8S E;  4F6R D;  3NQP A;  2AJA A;  1K3Z D;  3TWV A;  2E0I A;  2Y4U A;  2X3M A;  4Q69 A;  4AEZ C;  3NZU A;  4K5A B;  1O1S A;  3TWQ A;  2JAB A;  1N0Q A;  3GW4 A;  3Q4A B;  3R9A B;  1ZB1 A;  4E85 A;  4U04 A;  4U8Y D;  4K03 A;  3ISM C;  2NC9 A;  3Q75 A;  4WWP A;  4YDE A;  5E75 A;  4B89 A;  2J4B A;  4V3I A;  3CVL A;  1HS6 A;  4DLQ A;  5AYW D;  3AG2 E;  3IBE A;  1QZ2 A;  3DXK G;  2LAH A;  4GTP A;  5AQB A;  3S7B A;  2KZT B;  1S0P A;  2B6C A;  4X8Q A;  3UTM A;  3K9I A;  4I43 A;  5EX3 A;  3U66 A;  2GGF A;  3C72 A;  3CVQ A;  2ION A;  5AN8 A;  4EZL A;  1EPU A;  4BT8 A;  5LP0 A;  3Q78 A;  2LNI A;  3SI5 A;  2XQ0 A;  4ILG A;  1IQU A;  2OVB A;  4CDR A;  3D9P A;  1U2V G;  5ANL A;  4U8H A;  2XEE A;  4AIF A;  3HYM B;  1Z6T A;  3L9T A;  1ZU2 A;  2KBX A;  4DX7 D;  2WXN A;  1N11 A;  2DYR E;  4XKB A;  4GZ6 A;  2WXJ A;  3EDT B;  1INZ A;  3TWT A;  2J9Q A;  3DRA A;  3CVV A;  1WY6 A;  2CFZ A;  1N4S A;  4ZHB A;  3ZFW A;  1BI8 B;  4KZC A;  3CIA A;  1NI1 A;  3UMV A;  5FIO A;  3MCX A;  2J8S D;  5CRU A;  2XCC A;  4FJZ A;  3FEY A;  3HXE A;  3ASO E;  3PEU B;  2IY0 C;  3UUX A;  2J09 A;  4I17 A;  5HRY A;  4BTA A;  1TJC A;  3IXE A;  4TUM A;  4M7C A;  5G05 C;  3UM3 A;  5G04 C;  1TJF A;  2XZT G;  3LYA A;  4APO A;  4ACL A;  1TNY A;  4F3V A;  1HF8 A;  1YA0 A;  3V30 A;  3FH8 A;  3DSW A;  2BUG A;  5AQ7 A;  2HM8 A;  4XX5 A;  5FZQ A;  3PZD A;  3B7R L;  4G8K A;  3UT8 A;  1H6O A;  1JCR A;  4TUU A;  3ULQ A;  1NP7 A;  4PS7 A;  3CVU A;  4CZ2 D;  3PRZ A;  1OCZ E;  1Z3X A;  3I5P A;  3HVE B;  4DX1 A;  4LER A;  1YCS B;  1BPO A;  2QFC A;  4HRM B;  2NSZ A;  1LTX A;  2JLB A;  2QYJ A;  4JL0 A;  2BTD A;  2OEW A;  4I2Z A;  4WUY A;  1XGW A;  1ELR A;  3ASG A;  5KJM A;  3E37 A;  3Q73 A;  2P2C P;  3EU5 A;  2FO1 E;  2HE0 A;  3NF1 A;  2VYI A;  1G3N B;  1SA4 A;  5J08 A;  5J90 A;  5ENO D;  3ML9 A;  3MGB A;  4YND A;  3SGH A;  1NA3 A;  2LUH A;  2GRM A;  3SFX A;  3SF4 A;  4Y6C A;  4ATG A;  3RU0 A;  1SZ9 A;  5JHA A;  5EIL A;  3BQO A;  4DX6 D;  3CQC B;  5EIB E;  4A3T A;  4UWL A;  3MZL B;  4BX9 A;  4Q96 A;  2PQN A;  3MKQ A;  2E2E A;  3ULE G;  3PE4 A;  1N52 A;  4HRL A;  4NIK A;  3PDN A;  1BLX B;  2BKG A;  4I1O B;  3SFZ A;  2IEJ A;  3CHQ A;  4L7T A;  2ILR A;  4DX2 A;  3RKV A;  2OND A;  4JW1 A;  3ABK E;  3RO3 A;  4GYW A;  2HO1 A;  3ZUV B;  4ZFH A;  1KPS B;  2J4D A;  3FTX A;  4CT0 A;  2V4H C;  1YMP A;  4JZY A;  3I3N A;  1O5M A;  3CK7 A;  4L9P A;  1E8X A;  2QYU A;  3U3W A;  3SQV A;  2VSN A;  5T8I A;  4F53 A;  3JQ0 A;  3P1U A;  1YYH A;  4OVU A;  3L16 A;  3ZKJ A;  3D9L A;  3LEW A;  3CR3 A;  4MKT A;  3E34 A;  4PDX A;  4GPK A;  2OVF A;  5JJ7 A;  1TN8 A;  3ASD A;  4YDW A;  3ZN3 A;  4IUL A;  4CGW A;  1OCO E;  3UKR G;  4O1P A;  4GTR A;  1OWL A;  4UUC A;  4J8E A;  5IY5 E;  5FZR A;  3T8K A;  1H6P A;  2H6G A;  2P9U G;  2KXP C;  2XRY A;  3IEG A;  1OCR E;  3FUH A;  4ME2 A;  2GRN B;  2VGE A;  2Y0B G;  4G25 A;  4O6F A;  2DZO A;  4CYM D;  5EDS A;  1KZO A;  1SZA A;  2HR2 A;  2P9N G;  4I6G A;  3LXU X;  3PUJ A;  4KBQ A;  2FEZ A;  3V2O A;  2WPV A;  4U0U A;  1IHG A;  3IHV A;  3ZIM A;  4HI8 A;  1NFI E;  4U96 D;  2WXI A;  4FLH A;  3UM1 A;  4BET A;  2J07 A;  4DRX E;  3HXD A;  1OWM A;  5CBO A;  1OWO A;  4GTT A;  3FP3 A;  1H2T C;  1D8D A;  1VDY A;  3NOC D;  3JCK C;  4GCN A;  2WXH A;  2LXM A;  4B8C B;  3FH5 A;  3L22 A;  4J8Y A;  2C0L A;  5G55 A;  3ZYM A;  4KT6 B;  3UIP C;  3G2T A;  2GRQ B;  2PM7 A;  3PNL B;  5CCL A;  1E8Z A;  5CCM A;  3LJ3 A;  4N3B A;  4I9C A;  5LOZ A;  3VLD A;  2EIL E;  4FJY A;  4Q94 A;  3ZXP A;  3PZ1 A;  1TN7 A;  2F8Y A;  4O60 A;  3S7J A;  4HOR A;  3TAX A;  4BX8 A;  2XS1 A;  4TXP A;  1WDY A;  4LG6 A;  4ACK A;  3RAU A;  4K5C A;  3OAW A;  1HG2 A;  4A1S A;  1IHB A;  2XEV A;  3EJN A;  4P29 A;  1UJK A;  4G11 A;  1MX4 A;  5E76 A;  3ZU7 B;  3LPZ A;  3ASH A;  2OOE A;  4U0S A;  1HO8 A;  3MKR A;  3T5V A;  1HFA A;  1D8E A;  1Z5S C;  3C3O A;  4I1M A;  2YIN A;  3AAA C;  4CDN A;  3DPD A;  1DCQ A;  1K1A A;  1U3D A;  1SQM A;  2RFA A;  3LVR E;  2UY1 B;  4RQI A;  5ANR A;  4I6E A;  5FQ7 A;  2VGY A;  1PAQ A;  4YVO A;  3DXM G;  2AVP A;  5BW8 C;  2WMO A;  3VLE A;  3APF A;  3IV0 A;  4HBD A;  1UOH A;  3OXG A;  2RD0 A;  3S2A A;  2B0O E;  1EYH A;  5KCM A;  1X5B A;  4G23 A;  3UT4 A;  3L82 A;  4J6I A;  3S7D A;  1K1B A;  4L23 A;  2YHE A;  3FUM A;  1E96 B;  5AAR A;  4YDO A;  3TWU A;  5AIJ A;  3QDN A;  4B8A A;  2R03 A;  4JHR A;  4KVM A;  4G24 A;  3JXI A;  1A5E A;  3CHS A;  4WNG A;  2PM6 A;  3E32 A;  1AP7 A;  4M3O A;  3MYV A;  4BSZ B;  4DI4 A;  3F6Q A;  3FH7 A;  4W9R A;  5KBA A;  2CHW A;  1IKN D;  5A23 A;  4IN3 B;  1XNF A;  4D10 C;  5BV1 A;  1MYO A;  4B94 A;  4EPZ A;  4GB9 A;  5HKP A;  1Y6I A;  2IO2 C;  4GTS A;  2L9B A; 
#chains in the Genus database with same CATH homology
 4JVS A;  4KXK B;  3I5P A;  3RRM B;  3N71 A;  1OUV A;  3FUI A;  3HVE B;  3ZVV A;  4LER A;  1BPO A;  2QFC A;  2X38 A;  2NSZ A;  4GYO A;  2JLB A;  4WNF A;  2KAT A;  2L6J A;  3JYS A;  3CQG B;  1IYG A;  3QAQ A;  4JL0 A;  4ANU A;  2IF4 A;  4FHJ A;  2BTD A;  1KLX A;  1A17 A;  3PH0 C;  3FUL A;  3PNT B;  4KYO B;  4EBA G;  3RRN B;  4I2Z A;  2C0M A;  5A7D B;  4WUY A;  3ESK A;  4EZJ A;  1XGW A;  4ANV A;  1ELR A;  3ASG A;  3I4R B;  4B0Z A;  3L13 A;  5KJM A;  1N54 A;  3MEK A;  2ZU6 B;  3CVN A;  2IJG X;  1H2V C;  5FWQ A;  4XIF A;  3NF1 A;  3T8M A;  3E4B A;  2VYI A;  4A1G A;  4XI0 A;  2FF4 A;  4UI9 J;  3PEV B;  4WNE A;  2X6H A;  2XPI A;  2L0I A;  1IQR A;  5J08 A;  5J90 A;  1FVH A;  1UN9 A;  2WXP A;  3Q15 A;  1HE8 A;  3EIJ A;  2A5U A;  4TV3 A;  4AM9 A;  3FTV A;  3CK9 A;  5CMW A;  3JQ1 A;  3ML9 A;  4BFR A;  3D9N A;  3MGB A;  4YND A;  3AU5 A;  3QNK A;  3FEX A;  3SGH A;  4EEC A;  1NA3 A;  2KCL A;  3TL5 A;  2GRM A;  3SF4 A;  1QNF A;  3FU3 A;  3ZHE B;  1JUQ A;  3MX3 A;  2XGO A;  4Y6C A;  4ATG A;  1MHQ A;  3RU0 A;  1SZ9 A;  4C0M A;  5G05 J;  5JHA A;  3CSF A;  5BNW A;  1W3B A;  1HH8 A;  2XPY A;  4XE0 A;  2I1J A;  3CQC B;  2VTB B;  3MA5 A;  4A55 A;  3G2U A;  2WXF A;  3KS2 A;  4A3T A;  1E90 A;  2KM4 A;  1H0A A;  2WQ7 A;  4AVX A;  1KT1 A;  4FLB A;  4ILI A;  4UWL A;  3MZL B;  2R5S A;  4BX9 A;  4C0E A;  4HOU A;  4Q96 A;  1HX8 A;  2I6H A;  2MHK A;  2PQN A;  3MKQ A;  3ZW3 A;  2V5F A;  5FQ8 A;  4CEM A;  2E2E A;  1HG5 A;  4GZ5 A;  4CDM A;  3VTY A;  3PE4 A;  5EX0 A;  4YVQ C;  4HS2 A;  3D9M A;  1N52 A;  2FBN A;  5EKQ D;  2X6K A;  3ENE A;  3QAR A;  3D9K A;  5HQ8 A;  2WXG A;  4PUC A;  3PDN A;  3P2B A;  4F1S A;  4FU3 A;  3FTZ A;  3LS8 A;  3SD5 A;  1EF1 C;  2CHZ A;  3QOU A;  4MS6 A;  3LKU A;  4I1O B;  4FA6 A;  5FJY A;  2WB2 A;  4BTB A;  3OXL A;  2J49 A;  3SFZ A;  2AXZ A;  3ONL A;  3PE3 A;  2PQR A;  3LDZ A;  4UQX A;  3SBS A;  4PS3 A;  3RO2 A;  3CHQ A;  2MRI A;  4AXH A;  1H2U A;  4L7T A;  4GYY A;  4NQ0 A;  2ILR A;  1WAO 1;  3RKV A;  5ARG A;  3UQ3 A;  3PUK A;  2VGX A;  4L2Y A;  2OND A;  3GYZ A;  4EZK A;  4JW1 A;  3RO3 A;  4PH4 B;  4GYW A;  3Q49 B;  1JWG A;  4A3V A;  2HO1 A;  4NRH B;  3B7T A;  3HVE A;  4HFG A;  2XRZ A;  4JC8 A;  3PS6 A;  3U4T A;  5G04 J;  3DBS A;  1UN8 A;  4N2S A;  3SHF A;  3HHM A;  2J08 A;  2KC7 A;  2I1K A;  3O48 A;  4HOS A;  2LAI A;  2WXL A;  3QKY A;  2J4D A;  2CG3 A;  4UI9 K;  4JA7 A;  5ENN A;  3FTX A;  4CT0 A;  1ELK A;  3R7R A;  3D3M A;  4XKC A;  4WND A;  4GA0 A;  1PY1 A;  2XGM A;  4JZY A;  3PRE A;  1E7U A;  3I3N A;  2WM9 A;  4RVB A;  3RK6 A;  4HOQ A;  2YNQ A;  3CK7 A;  5JHB A;  1E8X A;  3EHM A;  3URZ A;  2GW1 A;  3GZ1 A;  3U3W A;  4Y6W A;  4JEU A;  4ANW A;  4AY6 A;  3ZYK A;  3B7S A;  2RG8 A;  2VSN A;  1JWF A;  3FU5 A;  3L08 A;  3ESL A;  4RSY A;  5T8I A;  3RJV A;  1KT0 A;  3JQ0 A;  3P1U A;  4BSX A;  1MQS A;  3IKO B;  3FHE A;  4K0R A;  2MOW A;  2DCP A;  3FUE A;  4OVU A;  3L16 A;  4U63 A;  4UI9 C;  5BV0 A;  3D9L A;  3QJZ A;  3LEW A;  4DK5 A;  4WWO A;  3KAE A;  4MRU A;  3CR3 A;  4UWF A;  4MKT A;  4F7A A;  4AJW A;  4PDX A;  3ZYL A;  3B7U X;  3UT7 A;  2OVF A;  1NA0 A;  4GPK A;  4GMJ A;  4E6H A;  4RG9 A;  4FUL A;  3AS5 A;  5JJ7 A;  4R7L A;  5BT1 A;  1Z3Y A;  2WQ6 A;  2I2O A;  3FFL A;  4EQF A;  2VSY A;  3ASD A;  4J8D A;  4UQZ A;  1UJJ A;  3LCA A;  3KEZ A;  3PVL A;  3ZN3 A;  3QWV A;  2XHE A;  2AW6 A;  4HLE A;  4IUL A;  4GML A;  5FQ6 A;  4H7Y A;  4N2Q A;  4CGW A;  5FQ4 A;  1U3C A;  4CGV A;  3CHO A;  4I6J A;  4IRU A;  4DJA A;  2VQ2 A;  3QC1 A;  4DPR A;  5T3R A;  2GRL A;  1OWL A;  2LO6 A;  5BPP A;  4J8E A;  5FZR A;  3HDX A;  3QWW A;  1FVF A;  2L0T B;  2VJ8 A;  3OXF A;  5D0O D;  3QWP A;  4KZ0 A;  2I9C A;  5LX8 A;  2FUL A;  4DI3 A;  2WMN A;  3CLJ A;  1EDU A;  3LY7 A;  4BT9 A;  2XRY A;  2DIW A;  3IEG A;  4IYP A;  3FTU A;  3U9W A;  4JHK A;  1JPL A;  3EHN A;  3G2S A;  4ME2 A;  3FUH A;  5LFA A;  1OWN A;  5LCW J;  3LVQ E;  4FP7 A;  4G25 A;  3CV0 A;  3FTY A;  4O6F A;  4XZ4 A;  4N5C A;  3UPV A;  4OYS A;  2IFU A;  4F53 A;  2KZT A;  4AP2 A;  3Q47 B;  4N3A A;  3FY4 A;  4MLP A;  5FTP A;  5EDS A;  1H19 A;  1SZA A;  2VGX B;  2HR2 A;  2C2L A;  4U07 A;  3FUF A;  1UG3 A;  1GW6 A;  2CG2 A;  4I6G A;  3ASF A;  2IQC A;  4G26 A;  4NUR A;  3LXU X;  1LF8 A;  3PUJ A;  4ILH B;  1HU3 A;  3D9O A;  3FTW A;  4KBQ A;  2X6J A;  2WXQ A;  2FEZ A;  3RIB A;  1E8W A;  2X6F A;  5AJL A;  3VLF A;  4CRW A;  2WPV A;  4U0U A;  4ANX A;  1IHG A;  2UY1 A;  2YHC A;  2WXK A;  3IHV A;  4LRZ A;  4FAD A;  4LUN U;  3ZIM A;  1L5J A;  2VSX E;  4H7X A;  3WXX A;  5KJN A;  2WXI A;  4FLH A;  3AU4 A;  3SZ7 A;  1WM5 A;  4HXI A;  3G2V A;  2EQX A;  3CHM A;  4JA9 A;  4OVV A;  1PC2 A;  4JHJ A;  2J07 A;  4DLO A;  1OWM A;  3NZS A;  1UW4 B;  3FUN A;  4UQY A;  1OWO A;  2IU1 A;  3SBT B;  3ZYQ A;  3APD A;  3FP3 A;  4EBA A;  1H2T C;  4WAF A;  1VDY A;  2XGS A;  3UX4 A;  1Y8M A;  2V8S E;  3JCK C;  4GCN A;  2WXH A;  3TJP A;  4B8C B;  3FH5 A;  3L54 A;  3NQP A;  3L22 A;  2V0P A;  3TXM A;  2CHX A;  2C0L A;  5G55 A;  3FU6 A;  3BEE A;  2E0I A;  2Y4U A;  2X3M A;  3ZYM A;  4BY6 A;  4Q69 A;  4G1T A;  4WWN A;  4AEZ C;  2KCK A;  3NZU A;  4GA1 A;  2AXU A;  3LY9 A;  2CFU A;  4UWG A;  3ZXS A;  3CST A;  5BUZ A;  2NXP A;  4GU5 A;  3GW4 A;  5T4Y A;  5C1D A;  2X6I A;  4KVO A;  1B89 A;  3Q4A B;  3R9A B;  3TXN A;  4KT6 B;  2M63 A;  3ZEF A;  4E85 A;  5KJK A;  3G2T A;  1TEZ A;  2JEK A;  4U04 A;  4K03 A;  5ARF A;  2NC9 A;  5AEN A;  3CGH A;  2PM7 A;  3D9J A;  2P58 C;  3PNL B;  1DVP A;  3ML8 A;  5CCL A;  4WWP A;  1E8Z A;  5CCM A;  3LJ3 A;  4N3B A;  4I9C A;  5LOZ A;  3VLD A;  2XCB A;  4FJY A;  4Q94 A;  5E75 A;  4B89 A;  2J4B A;  4L2L A;  5JJ6 A;  4V3I A;  3HIZ A;  3CVL A;  3Q5M A;  2OV8 A;  3S7J A;  1HS6 A;  4HOR A;  3L6A A;  3TAX A;  4DLQ A;  5AYW D;  3AS8 A;  4BX8 A;  1NZN A;  3IBE A;  1QZ2 A;  2WXR A;  2DBA A;  3FDH A;  4LEU A;  4GAA A;  3KD7 A;  4RG6 A;  3ZGQ A;  3G2W A;  2AXV A;  4ACK A;  3FUJ A;  5DBK A;  2LAH A;  3GZ2 A;  4J8F A;  3S7B A;  3U64 A;  2KZT B;  1E7V A;  3CVP A;  1HG2 A;  3OAW A;  1S0P A;  4A1S A;  3FTS A;  4JPS A;  2Y3A A;  1QQE A;  4GZC A;  2XEV A;  3K9I A;  5C2Y A;  3CVX A;  3C98 A;  3EJN A;  3MV3 B;  4I43 A;  5EX3 A;  3U66 A;  2GGF A;  4P29 A;  3CVW A;  3CVQ A;  2IOL A;  1UJK A;  1HXI A;  2ION A;  3SNX A;  3QK0 A;  1EPU A;  1OWP A;  3CKC A;  4G11 A;  3ZHE A;  4BT8 A;  4BWR A;  4EZL A;  5LP0 A;  3FWV A;  5E76 A;  2LNI A;  3JUI A;  3LPZ A;  3LY8 A;  4I9E A;  3SI5 A;  3ASH A;  2XQ0 A;  4ILG A;  4JEH A;  2OOE A;  1IQU A;  4URK A;  4U0S A;  4FHK A;  1HO8 A;  2OVB A;  4PS8 A;  3MKR A;  4CDR A;  3D9P A;  5ANL A;  3T5V A;  2KCV A;  1HFA A;  5FZS A;  4U8H A;  3ZPJ A;  5A6C A;  4GA2 A;  4I1M A;  3CKB A;  4QFV A;  2YIN A;  4AIF A;  3HYM B;  1Z6T A;  4TRQ A;  4I1A A;  4CDN A;  3O4Z A;  4FC8 A;  1ZU2 A;  2WVI A;  3DPD A;  2WQH A;  4J0U A;  1P5Q A;  1U3D A;  2WXN A;  1SQM A;  4N39 A;  4AV7 A;  3LVR E;  5FT9 A;  3TG4 A;  2UY1 B;  2PL2 A;  3I4G A;  3APC A;  4XKB A;  4GZ6 A;  2WXJ A;  5ANR A;  3EDT B;  3R7Q A;  4APF A;  4AY5 A;  2J9Q A;  5LCW C;  3CVY A;  1INZ A;  4I6E A;  3MJW A;  4U0Z A;  5FQ7 A;  4CT4 A;  2VGY A;  1PAQ A;  1WY6 A;  3FUK A;  4YVO A;  4AOF A;  2CFZ A;  2AVP A;  5BW8 C;  2FI7 A;  4NAC A;  2HYZ A;  5G2N A;  3ONK A;  3ZFW A;  3ZRH A;  2WMO A;  4J8S A;  4KZC A;  2WXO A;  3T5X A;  3CIA A;  5AJD A;  3UMV A;  3VLE A;  5JJT A;  2FO7 A;  2Q7F A;  3APF A;  3IV0 A;  3MCX A;  4G2V A;  2R59 A;  1DNP A;  3OXG A;  2RD0 A;  3AS4 A;  2XCC A;  3S2A A;  3OTN A;  2QY7 A;  1EYH A;  5KCM A;  3FU0 A;  3B13 A;  3CHR A;  4N3C A;  4FJZ A;  3TG5 A;  2AWI A;  1X5B A;  4G23 A;  3UT4 A;  3FEY A;  1H6K A;  3PEU B;  4UWK A;  3UUX A;  2J09 A;  4I17 A;  4I2W A;  4BTA A;  4J6I A;  1ELW A;  3CK8 A;  3S7D A;  4LCT A;  5M72 A;  3VTX A;  1TJC A;  4L23 A;  2A4Z A;  2YHE A;  3FUM A;  1E96 B;  4GZ3 A;  4GZD A;  5G05 C;  2R17 C;  3FUD A;  3GZS A;  5AIJ A;  3D9I A;  3QDN A;  4B8A A;  2PZI A;  5G04 C;  4JHR A;  3MKQ B;  3CHP A;  5CMY A;  3BG0 B;  3CVV A;  1TJF A;  4G24 A;  4KVM A;  4HVB A;  3EIQ C;  3LYA A;  4ABN A;  3CHS A;  4WNG A;  2PM6 A;  4HOT A;  3L17 A;  4APO A;  4ACL A;  4UWH A;  4M3O A;  3MYV A;  4DI4 A;  5HI7 A;  3FH7 A;  4GCO A;  4F3V A;  1HF8 A;  4W9R A;  1YA0 A;  2BF0 X;  2XPZ A;  3FH8 A;  5D0Q D;  4XI9 A;  1HZ4 A;  2UWJ G;  2BUG A;  3S7F A;  3TGO A;  3CEQ A;  3BG1 B;  2HM8 A;  3IHY A;  2CHW A;  2WXM A;  4JXT A;  4XX5 A;  5FZQ A;  3QB2 A;  3PZD A;  2LSU A;  4KMO A;  3B7R L;  2IOS A;  5DIZ A;  2V4L A;  2LSV A;  2YQ8 A;  4C9B B;  5A23 A;  2VTB A;  1FCH A;  3UT8 A;  4IN3 B;  1XNF A;  1ZBP A;  4D10 C;  3MV2 B;  4TUU A;  3ULQ A;  5BV1 A;  1NP7 A;  4PS7 A;  5KJL A;  3RRU A;  5CHE E;  3CVU A;  2Y4T A;  4CCA A;  4B94 A;  4EPZ A;  4GB9 A;  2VSO E;  3PRZ A;  1E8Y A;  1Z3X A;  1Y6I A;  4L1B A;  2L9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...