3HYMB

Insights into anaphase promoting complex tpr subdomain assembly from a cdc26-apc6 structure
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
301
structure length
301
Chain Sequence
ENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle, ligase
molecule keywords Anaphase-promoting complex subunit CDC26
publication title Insights into anaphase promoting complex TPR subdomain assembly from a CDC26-APC6 structure.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 301
sequence length 301
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2009-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13176 TPR_7 Tetratricopeptide repeat
B PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3hymB00
3CVLA 4WNEA 4G23A 2IF4A 4U0ZA 5JJTA 2FF4A 4UQXA 5G05J 3ESKA 3TAXA 2PQRA 5G04C 4GZ6A 2Y4TA 3IEGA 1KLXA 4NRHB 4HOUA 4RG9A 4ME2A 4AIFA 2I6HA 3UUXA 4I9EA 4LEUA 4YNDA 1WM5A 4GYOA 5D0OD 5CCMA 4U0SA 2UY1A 5AYWD 3RIBA 4N3AA 1P5QA 4JHRA 3FFLA 3CV0A 4HORA 5BNWA 4U0UA 1A17A 4U07A 1FCHA 4HOSA 1ZBPA 3KS2A 3Q4AB 4BT9A 4YVOA 3SF4A 5KJNA 3LY9A 4GA1A 3RO2A 3Q47B 3TGOA 4N3BA 3ASGA 4N5CA 5KJMA 3S7FA 3CVPA 4ABNA 3TG5A 3GYZA 4APOA 5CCLA 1QQEA 4CDRA 4GZ3A 5ARGA 3OXLA 2XCCA 4RG6A 5C1DA 2IFUA 4J8FA 5FZRA 3MKRA 2Y4UA 3S7DA 3AS4A 5FT9A 3Q15A 3CKBA 1HH8A 2KC7A 3ULQA 3LYAA 4B94A 4AY5A 2KCLA 3RU0A 2WQHA 2LNIA 3FWVA 4GYYA 2FI7A 3Q49B 1ELRA 4BTBA 2DBAA 5DIZA 3CK8A 3TG4A 3EDTB 3KAEA 3GW4A 2P58C 5KJLA 3K9IA 4BT8A 3O48A 4XI9A 3PE4A 4JL0A 5LCWC 5EX0A 3LKUA 3LY8A 2L6JA 4HOTA 3QOUA 4H7YA 3AS8A 3HYMB 3PE3A 1QZ2A 4KYOB 3ASHA 3PDNA 4W9RA 5ARFA 5A7DB 2KATA 4KBQA 3N71A 3CKCA 2XGOA 3UPVA 4UQZA 5DBKA 2HO1A 2BUGA 2FEZA 1B89A 4I1AA 4WNGA 3MV2B 3U4TA 3KD7A 4BWRA 5JJ6A 2HYZA 2QFCA 2OOEA 3ZGQA 2FO7A 2HR2A 3CEQA 1ZU2A 3LCAA 3CVQA 2VGYA 2GW1A 4O6FA 3ASFA 3GZ1A 5D0QD 3ZFWA 2VGXB 5KJKA 4XIFA 2Q7FA 4GA2A 4YVQC 4Y6WA 3URZA 4G25A 2C0MA 2MHKA 1YA0A 4A1SA 3U3WA 4N2SA 4IN3B 5HI7A 4N3CA 3ZN3A 2XGSA 4JA9A 3QWPA 1HXIA 4G26A 1TJCA 3VTYA 4UQYA 5LCWJ 1OUVA 4J0UA 4KXKB 3CK9A 4I2ZA 4EQFA 2AVPA 1Y8MA 4JA7A 1HZ4A 1WAO1 2V5FA 4AY6A 2J9QA 2E2EA 2WPVA 5CHEE 5FZSA 3OXFA 1IYGA 4UI9J 3MEKA 5A6CA 5JJ7A 3E4BA 4J8DA 4CGVA 3QWVA 2VYIA 3OXGA 2XCBA 2LSUA 2FBNA 2NC9A 3ZHEB 5BT1A 4CGWA 4UI9C 1NZNA 4NQ0A 4HOQA 4I17A 3S7BA 3MA5A 3GZ2A 2YQ8A 4J8EA 2JLBA 3FP3A 2ONDA 3LY7A 4I9CA 3ASDA 1NA3A 4GCOA 5G05C 1IHGA 4G2VA 1ELWA 2PZIA 4U04A 1XNFA 2R5SA 3QKYA 2VSYA 1NA0A 3VTXA 4N2QA 4N39A 3BEEA 1E96B 4GA0A 3S7JA 4GPKA 4GYWA 2VQ2A 2YHCA 4Y6CA 4G24A 5FJYA 5HQ8A 3WXXA 2XGMA 1PC2A 3ZHEA 3CK7A 2LSVA 3JYSA 3Q5MA 2XEVA 3CVNA 3RJVA 3RO3A 4XI0A 2PL2A 2KCVA 5EX3A 4BTAA 3LPZA 3R9AB 4H7XA 5BW8C 3ZPJA 3MV3B 3QWWA 4GZ5A 2C2LA 2VSNA 4WNDA 2KCKA 4G1TA 4GCNA 2XPIA 5FZQA 3NF1A 4I2WA 5M72A 1KT0A 2UY1B 3SZ7A 2C0LA 5FTPA 1W3BA 4WUYA 4UI9K 3UQ3A 2PQNA 2UWJG 5EKQD 4F3VA 5G04J 3RKVA 1KT1A 4AM9A 4WNFA 3QDNA 2VGXA 3AS5A
chains in the Genus database with same CATH superfamily
4G23A 1Z5SC 3G2TA 2P9NG 2A5EA 5JJTA 4UQXA 3TWQA 3D9JA 1DVPA 2WXPA 4K5AB 4OVUA 2KZTA 3CGHA 3ESKA 1UJKA 1OWLA 2Y4TA 3ZUVB 3LJNA 4LRZA 1N4PA 3JCKC 4I6JA 2MOWA 2GGFA 5BV0A 4I9EA 1WM5A 4GYOA 2PM6A 1TN8A 5CCMA 1SA4A 5E75A 4JHRA 1X81A 4X8QA 4K03A 4ANUA 3UINC 5AJDA 3W9FA 4BSZB 5FQ6A 2BF0X 1ZBPA 3KS2A 5AQ9A 2DZNA 5KJNA 3SF4A 3RO2A 1TN6A 4UUCA 3ZEFA 5AQBA 2QYJA 2L0TB 2Y69E 3AAAC 4RVBA 4TXPA 3FUEA 2PNNA 5E76A 4FJZA 4BEPA 1OWOA 5C1DA 3IXEA 4BERA 3ZYLA 5FZRA 3S7DA 4U96D 3QB2A 1HU3A 3ZXPA 2IO2C 3FEYA 5FT9A 3J5QB 2KC7A 2GRPB 5ENPD 3RU0A 1EDUA 1NI1A 2ETCA 4RSYA 2H6GA 4GYYA 4L2YA 2WXIA 3TWTA 3B13A 3KAEA 4GTSA 4C0EA 4K5CA 2NXPA 3K9IA 4BT8A 1K1AA 3I3NA 3SO8A 3UM1A 3FDHA 4JL0A 2WXMA 4XE0A 4UWFA 1N94A 4LNGA 4JC8A 2ZGGA 3LY8A 4O60A 4APFA 4CZ2D 4A3VA 4MS6A 4HOTA 2DWZA 2ETAA 2XZDG 3UT8A 5C2YA 4NACA 4KYOB 2IY0C 3DSSA 3MX3A 1YMPA 3RSEG 5BPPA 3PNLB 5AAOA 3DBSA 3CHOA 3N71A 3FTSA 3CKCA 4ATZD 5ENOD 4UQZA 5DBKA 3UPVA 2X6IA 3Q75A 1JWFA 2X6FA 1QYMA 2IOSA 5B1AE 2EIJE 5J90A 4I1AA 3SHFA 3HG0D 2VJ8A 4BWRA 1FVHA 3FEXA 2HYZA 2OOEA 4I1OB 2FO7A 5JA4D 1DCEA 4KMOA 3E33A 3DXMG 3LCAA 2VGYA 4O1OA 4DX6D 1IKND 3PUKA 3HXCA 4M3OA 3FUFA 4L9PA 3ZFWA 2F8XK 1N52A 2Q7FA 4YVQC 3URZA 4G25A 2P9PG 3U3WA 4A1SA 5ITZF 4J6IA 1HFAA 4IRUA 2P9SG 3GZSA 4L2LA 5ENSD 3FTUA 4QQIA 5FQ7A 1HF8A 3T5XA 4FHKA 4WWPA 3L13A 4GZDA 3CK9A 4OVVA 4JA7A 1SA5A 4JXTA 1S70B 1WAO1 4K5BA 4FULA 5CHEE 5FZSA 3RRNB 4UI9J 2L9BA 5A6CA 5JJ7A 1NL4A 3JQ1A 4JHKA 3L9TA 2LSUA 5HS0A 4BX9A 1D9SA 1MX6A 1UN9A 4HRMB 4PDXA 3ABLE 2JABA 3D9LA 4FA6A 4ILIA 3FUJA 4DLOA 2IU1A 3HXFA 3B7TA 2YINA 3FU6A 2WMOA 4RLYA 4R7LA 3CVUA 2XPYA 3CHQA 4PS8A 3C98A 3JUIA 4GCOA 1E7UA 3HHMA 3SGHA 1ELWA 5FWQA 5ENQD 2WXKA 1XNFA 2R5SA 3V30A 3QKYA 3VTXA 2LAHA 3CHMA 4N39A 2DIWA 3SQVA 2WQ7A 3T8MA 3S7JA 2VQ2A 4DI4A 1KZPA 3UXGA 2NYJA 5FJYA 2OV8A 5HKPA 3L6AA 3AU5A 3ZHEA 5EDSA 3FU3A 3ZYKA 4HNAD 1UG3A 2XEHA 2LSVA 3Q5MA 2J49A 1U2VG 3CVNA 4XI0A 2KZTB 2PL2A 5AJLA 1DC2A 3AG3E 3Q79A 4H7XA 3ULEG 4Q69A 2VGEA 4HRLA 3QWWA 5EYLA 4GZ5A 4WNDA 2OVBA 4G1TA 3FU5A 2BEDA 2XPIA 4ANVA 4AJWA 2FULA 1KT0A 5FTPA 4YDYA 1H2UA 3CHPA 2GRNB 3D9MA 3BG1B 5EKQD 3RKVA 3FTWA 4NURA 4OYSA 4AM9A 4WNFA 5D66A 3NB2A 3AS5A 4WNEA 4U0ZA 2FF4A 4ACLA 4WWNA 5G05J 4U7EB 4DX7D 4KZ0A 1VDYA 2PQRA 1SW6A 3Q78A 4GZ6A 4D10C 2WXOA 1LD8A 2R03A 4QFVA 2GROB 1KLXA 4HOUA 3PZ4A 1TYQG 5JHAA 3UUXA 4A55A 3G2VA 3R7RA 5BXOA 3UKRG 3FUHA 4YNDA 1N0QA 3DSUA 1DCQA 3B7SA 1E8WA 4GTQA 3DPYA 1HG2A 5AYWD 1OT8A 3RIBA 5BUZA 1YCSB 4N3AA 1P5QA 3FTZA 3C5RA 3IKOB 5CRVA 3IHVA 3ZYQA 5KWDA 4UWGA 4HORA 5D2MC 5BNWA 3C3RA 1SQMA 1UW4B 4U07A 5CEAA 5EIDA 3Q4AB 3BQOA 3PRZA 1JUQA 3NZSA 2CG2A 4N3BA 2R59A 4LG6A 5KJMA 3CSFA 1QNFA 1SVXA 2IJGX 3GYZA 2I9CA 5ENRD 1OCCE 4JHJA 4XX5A 4GZ3A 4MLPA 5CECB 3OXLA 1IXVA 4AVXA 2IFUA 4F1SA 3IHYA 2Y4UA 1V54E 5JHBA 4J7WA 3CKBA 3ULQA 3UT7A 2VSXE 3ZU7B 3EUVA 3EU9A 2WQHA 2ETBA 2H6IA 2LNIA 4Z68A 3FWVA 4LCTA 3PZDA 1ELRA 2CFZA 5DIZA 1TNUA 2F8YA 2P58C 3JXIA 2PM7A 2OCCE 3BUAA 1AP7A 3O48A 2QC9A 4B89A 4LUNU 3TJPA 4I6GA 3E32A 4HXIA 3X2QE 1DNPA 4F53A 3QOUA 4H7YA 4WAFA 4F1PA 4OAVB 2WXGA 4W9RA 5CRUA 5ARFA 5A7DB 2R2LA 3T5VA 2KATA 1H6KA 3AG4E 3HXEA 3FULA 3FHEA 4O1PA 3TWXA 2HO1A 1FVFA 3ONKA 4PH4B 2BUGA 2IQCA 4L23A 4WNGA 4DX1A 3U4TA 3UM3A 3SBTB 2HE0A 3MZLB 3CIAA 5LOZA 3WG7E 3CVQA 2GW1A 3DSXA 4HQDA 4LNUD 2IEJA 3QNKA 1Z6TA 3U66A 3S2AA 1O1SA 3APCA 4FHJA 5CMWA 4DLQA 1OWMA 5EIBE 1BD8A 3DSVA 3ESLA 4F7AA 2JEKA 3TWWA 2M63A 1IQRA 5HI7A 5AARA 4JVSA 3TWSA 2XGSA 3T9KA 4JA9A 3V79K 2QZAA 3D3MA 3PUJA 3ONLA 4G26A 1TJCA 3VTYA 2A4ZA 4KT6B 3ML9A 4UQYA 4KXKB 1S64A 1BU9A 2IOLA 3UMVA 2AVPA 3ENEA 5CERB 2V5FA 2CHXA 4M7CA 3IV0A 4N5QA 3E30A 3P1UA 3APDA 1K8KG 4AOFA 1JCQA 3TWVA 1SZAA 3E4BA 2L0IA 4J8DA 4CGVA 2VYIA 1PAQA 5LFAA 1N95A 1YYHA 3V2OA 4MRUA 2FBNA 2NC9A 1OXJA 4B0ZA 3ZYMA 3ZHEB 2ZISA 5BT1A 1E90A 4HVBA 4I17A 2J07A 1Q2ZA 3Q7AA 4P29A 4HI8A 4J8EA 2JLBA 2ONDA 1V55E 4U8VD 1H2TC 2J08A 3J5PA 3DWLG 2WM9A 5AQAA 2R02A 5G05C 3ZVVA 4B8AA 2B0OE 5CBOA 3FU0A 2LXLA 4L1BA 3LVRE 1OCRE 3D9OA 3B7BA 4GYWA 5JMND 3G2UA 2YHCA 5T8IA 2WB2A 4G24A 5HQ8A 4YDWA 5G55A 5KCMA 1KZOA 4IYPA 2XGMA 1TEZA 1IHBA 3HIZA 4TV3A 3RJVA 3RO3A 1HO8A 4F6RD 4JD2G 2KCVA 3PVLA 3CHSA 1TNZA 3ZRHA 3EHMA 3LPZA 2RKKA 4FC8A 3ZPJA 3SFXA 2C2LA 3ABME 2DYRE 2B6CA 3VLDA 2KCKA 2XEEA 1EYHA 4ZHBA 3NF1A 5M72A 3DEPA 4ANWA 3JXJA 4FU3A 4HB5A 2C0LA 4ATGA 4XKCA 1G3NB 2AWIA 2X38A 1W3BA 2V8SE 2OEWA 3SNXA 3UQ3A 1MQSA 4F3VA 4EBAA 1H0AA 4UWKA 1TJFA 2Y1LE 4DPRA 3QDNA 2WXQA 4HI9A 3CVLA 2IF4A 2KM4A 4CDMA 4RQIA 2ILRA 4KZCA 1K3ZD 2OVFA 3TAXA 4HFGA 3LDZA 2LAIA 3V2XA 1N0RA 5G04C 3CLJA 1RW2A 3IEGA 3PS6A 2J09A 2WVIA 4G11A 4NRHB 1ELKA 4RG9A 4AIFA 2Y0BG 3BG0B 5B3SE 4LEUA 4CEMA 2CFUA 4L7TA 5FIOA 3KSQA 2DYSE 4GPMA 4EECA 2LO6A 2X3MA 2X6HA 1E8ZA 2E0IA 4XKBA 1Y6IA 3FFLA 3SI5A 1EPUA 1H2VC 1WY6A 1A17A 5AENA 2LXMA 1FCHA 4HOSA 4E85A 4BT9A 4YVOA 4V3IA 3LY9A 2I1KA 1BI7B 1S0PA 4TUMA 3PH0C 3Q47B 3ASGA 3JUEA 2J8SD 2WXNA 5IY5E 1WDYA 4ABNA 3HVEA 1FPPA 3L16A 4UWHA 1JCSA 5CCLA 4BFRA 3PZ3A 4HLEA 5ARGA 1N54A 4J8FA 3MKRA 3UX4A 1AWCB 3UI2A 4GTRA 3AS4A 2EIME 1HH8A 1E7VA 1O1RA 2BKGA 3LYAA 4AY5A 5KNGA 3D9PA 3HRAA 3B95A 2FI7A 3Q49B 2XZTG 4BTBA 2DBAA 4JPSA 1N11A 3QARA 3CK8A 3EHRA 3TG4A 3FTXA 3GW4A 3FH7A 5KJLA 5T4YA 5KBAA 5ENNA 3EIQC 3PE4A 1O1TA 5EX0A 4TRQA 2DCPA 3LXUX 4JB8P 2L6JA 3V31A 4JW1A 5ANLA 3PNTB 2RFAA 1QBQA 2ZIRA 4GTPA 4BSXA 3PDNA 2EQXA 4C9BB 4GU5A 4KBQA 4CYMD 4DX2A 4Q94A 3NBNB 2P2CP 4DK5A 4BY6A 3FTYA 4PS7A 1NFIE 1N4SA 3HXDA 4CCAA 3MKQA 1H6OA 3B7UX 2I2OA 3MV2B 2J4BA 5JJ6A 4TXQA 1NP7A 3C3QA 2L6BA 3VLFA 3EHQA 1N4RA 2HR2A 2V4HC 1SZ9A 3Q7FA 4O6FA 3QJZA 1Z3YA 1OCZE 3L08A 2X6JA 3GZ1A 1TR4A 5G2NA 2VGXB 3FH5A 4XIFA 3PZ2A 1S63A 3G2WA 3KEZA 1U3CA 2C0MA 4LSZE 1YA0A 5CBNA 2XS1A 4IN3B 4EZLA 4NIKA 2XPZA 3SFZA 4N3CA 3D9NA 3W9GA 3UTMA 3QWPA 1WG0A 3QAQA 3I4GA 1HXIA 1MHQA 4GB9A 4HLLA 4B93B 3NZUA 5LCWJ 1OUVA 2P9IG 4TXRA 4AXHA 3UT4A 3R9MA 1HZ4A 3NAWA 3F6QA 2DZOA 2I1JA 2XRZA 2J9QA 2OEVA 2WPVA 4EHMA 2Y3AA 2XENA 3SBSA 3I5PA 1ZB1A 4I1MA 3VLEA 1TNBA 2XCBA 2P9LG 2FO1E 2RG8A 3CHRA 5EILA 4KVOA 1E8YA 4CGWA 4UI9C 5FINA 3DPDA 4YDEA 1NZNA 4CT0A 4HOQA 3GZ2A 2VTBA 2MYOA 3FP3A 3E34A 1O5MA 3LY7A 1TNYA 3ASDA 2YNQA 3SD5A 1UN8A 3BU8A 4G2VA 1A5EA 1TN7A 4U04A 4BX8A 2J4DA 2VSYA 2GRLA 3CVYA 4PS3A 3E37A 4AV7A 1E96B 2YHEA 4K0RA 3CVVA 4Y6CA 2MRIA 1GW6A 1FT1A 5ENTD 3C3OA 3ISMC 3CK7A 1MX2A 4BETA 2XQ0A 3JYSA 3UIPC 2QY7A 2CHWA 4JEUA 2WQ6A 5HRYA 3KSLA 1JCRA 3O4ZA 1HX8A 1LTXA 1H19A 2GRQB 3PEVB 5BW8C 5AQ7A 4GTVA 4GMLA 2VSNA 2BTDA 1MJ0A 2AXUA 2CG3A 4DI3A 4B8CB 4J8SA 3NOCD 3FH8A 4WWOA 4I43A 4HS2A 4DJAA 3CQGB 3TXMA 3EU5A 3SZ7A 1UJJA 4IULA 5LX8A 2R05A 1N4QA 4WUYA 2UWJG 5BV1A 1K1BA 1KT1A 1TNOA 2VGXA 4AEZC 1X5BA 3UM0A 3QK0A 4GTOA 3JQ0A 4FLBA 4DX5D 3CVWA 3HDXA 3FUMA 3Q9NC 3RAUA 3EIJA 4FP7A 3TWUA 5FQ4A 3HVEB 1HE8A 4FLHA 3D9KA 4GZCA 1XGWA 1BLXB 4G8KA 2XRYA 4ME2A 4EZKA 4CRWA 2I6HA 5H7PA 2ZU6B 2R17C 1L5JA 5D0OD 4URKA 4FADA 4U0SA 2UY1A 2H6HA 4EPZA 3ASOE 3CV0A 4U0UA 2AW6A 2EIKE 1OY3D 4C0MA 3RRUA 1MZCA 4GA1A 1OWNA 4AP2A 3TGOA 3FUDA 5AN8A 3TWRA 4N5CA 2XHEA 3S7FA 3CVPA 3TG5A 3PZ1A 3R7QA 3QC1A 1JPLA 4HBDA 4APOA 3CQCB 4I6EA 1QQEA 4CDRA 2WXLA 4U95D 3G2SA 2XCCA 4RG6A 5EYPF 3UIOC 4YDOA 4PUCA 3Q15A 3DSTA 4ANXA 4B94A 4FJYA 2KCLA 5EN5D 3NOGD 3ZW3A 2WXHA 2BKKB 1Z3XA 3MKQB 4ILGA 2V0PA 3ML8A 4CDNA 1FT2A 3UKUG 5LP0A 3U9WA 2HM8A 1MYOA 3EDTB 2V4LA 1JWGA 1H6PA 2WXRA 4C48B 4DRXE 4XI9A 5LCWC 3FUKA 3RK6A 3LKUA 2WXJA 2RFMA 4MKTA 3ZKJA 3DRAA 3ZIMA 3EJNA 4GMJA 3NQPA 3Q73A 3KEAA 5ANRA 1IQUA 3AS8A 3HYMB 3MGBA 3PE3A 1QZ2A 3ASHA 1RZ4A 2ZGDA 2P9UG 3OAWA 4E6HA 4DUIA 2AXVA 2XGOA 3LVQE 3ABKE 2EINE 3B7RL 3ZXSA 2WXFA 2FEZA 5FQ8A 1B89A 2EILE 4GTMA 2A5UA 3ZNGA 1PY1A 3KD7A 3C72A 2ZXWE 2QFCA 1INZA 3AG2E 3ZGQA 2V5QC 3CEQA 1D8DA 3LJ3A 4KVMA 1ZU2A 2IO3C 5BXUA 4GTTA 2F0YA 4G8LA 3ASFA 5D0QD 1EF1C 1E8XA 5KJKA 3APFA 1HS6A 3D9IA 4GA2A 1KPSB 4Y6WA 2MHKA 4N2SA 4EZJA 1BI8B 3ZN3A 1BPOA 2VTBB 3P2BA 4UWLA 5J08A 3AG1E 4ZFHA 4J0UA 2CHZA 3PREA 1HG5A 3TXNA 4I2ZA 3LEWA 4EQFA 1Y8MA 2P9KG 5A23A 3RRMB 1N9AA 4AY6A 2E2EA 2GRRB 2F37A 3OXFA 1IYGA 5T3RA 3MEKA 4CT4A 2DVWA 3L82A 2KBXA 3TL5A 3MCXA 3QWVA 3OXGA 4ILHB 4A3TA 5B1BE 4GAAA 3LS8A 4MBGA 3CSTA 4A63B 2H6FA 3CVXA 3FUIA 4NQ0A 3S7BA 3MA5A 1UOHA 2YQ8A 3MYVA 3ASNE 4XZ4A 3L22A 4I9CA 4LERA 1NA3A 2XS8A 4GMRA 3DEOA 3U64A 1IHGA 3SY2A 4XEIG 3FUNA 4TUUA 2PZIA 4U8HA 1NA0A 1MX4A 4A1GA 3L17A 4N2QA 3BEEA 1D8EA 3AU4A 2AJAA 4HRNA 3IBEA 3MJWA 3FTVA 4GA0A 2LUHA 5AIJA 4GPKA 3DXKG 4LNBA 4JZYA 3L54A 2QYUA 4JEHA 2VSOE 3WXXA 3PEUB 1PC2A 2NSZA 4Q96A 4U63A 3AJIA 1U3DA 3FY4A 2RD0A 4EBAG 2XEVA 4BESA 1OWPA 1LF8A 3I4RB 5CEDB 3HXBA 2IONA 2GRMA 2WMNA 3DSWA 1LD7A 3Q9UC 5EX3A 4BTAA 3CR3A 4J8YA 3R9AB 1OCOE 3D9HA 3MV3B 2KXPC 5KNHD 3SFYA 4GCNA 5FZQA 3UM2A 4I2WA 4OAUC 2UY1B 3ULYA 5CMYA 4U8YD 2X6KA 4UI9K 2AXZA 2PQNA 3EHNA 5G04J 3OTNA 3T8KA 4ACKA
chains in the Genus database with same CATH topology
3CVLA 1X5BA 4WNEA 4G23A 2IF4A 2KM4A 3QK0A 3JQ0A 3G2TA 4CDMA 4FLBA 4U0ZA 5JJTA 2FF4A 4UQXA 4ACLA 2ILRA 4WWNA 3D9JA 4KZCA 1DVPA 3CVWA 3HDXA 3FUMA 2OVFA 2WXPA 4OVUA 5G05J 2KZTA 3CGHA 3ESKA 3TAXA 4HFGA 1UJKA 3LDZA 1OWLA 4KZ0A 2LAIA 1VDYA 2PQRA 5G04C 4GZ6A 2Y4TA 4D10C 3CLJA 2WXOA 3EIJA 4FP7A 5FQ4A 3IEGA 3HVEB 3PS6A 2J09A 1HE8A 4LRZA 4QFVA 2WVIA 4FLHA 1KLXA 3JCKC 4G11A 4I6JA 1ELKA 3D9KA 2MOWA 1XGWA 4GZCA 4HOUA 2XRYA 4ME2A 4RG9A 4AIFA 2GGFA 4CRWA 5BV0A 2I6HA 5JHAA 3UUXA 3BG0B 3G2VA 4I9EA 3R7RA 4A55A 2ZU6B 3FUHA 4LEUA 4YNDA 4CEMA 1WM5A 2R17C 4GYOA 2PM6A 1L5JA 2CFUA 3B7SA 4L7TA 1E8WA 4EECA 5D0OD 2LO6A 5CCMA 4URKA 2X3MA 2X6HA 4FADA 4U0SA 1HG2A 2UY1A 5AYWD 3RIBA 5BUZA 1E8ZA 2E0IA 4N3AA 1P5QA 3FTZA 4XKBA 5E75A 1Y6IA 3IKOB 4JHRA 4EPZA 3IHVA 3ZYQA 3FFLA 3SI5A 3CV0A 4K03A 4UWGA 4HORA 4ANUA 5BNWA 4U0UA 1EPUA 5AJDA 1H2VC 2AW6A 1WY6A 1A17A 5AENA 1SQMA 1UW4B 5FQ6A 4U07A 1FCHA 2BF0X 4HOSA 1ZBPA 3KS2A 3Q4AB 4E85A 4C0MA 3PRZA 3RRUA 4BT9A 4YVOA 3SF4A 5KJNA 4V3IA 3LY9A 1JUQA 4GA1A 2I1KA 3RO2A 1S0PA 1OWNA 3PH0C 3Q47B 4AP2A 3NZSA 2CG2A 4N3BA 3ASGA 3TGOA 3ZEFA 3FUDA 2R59A 2L0TB 4N5CA 2XHEA 5KJMA 2WXNA 3S7FA 3CSFA 3CVPA 1QNFA 4ABNA 3TG5A 4RVBA 2IJGX 3GYZA 3R7QA 3QC1A 3HVEA 3FUEA 1JPLA 3L16A 2I9CA 4APOA 4UWHA 3CQCB 5E76A 5CCLA 4I6EA 1QQEA 4JHJA 4FJZA 4BFRA 2WXLA 4GZ3A 4MLPA 4XX5A 4CDRA 3G2SA 4HLEA 5ARGA 1N54A 1OWOA 3OXLA 2XCCA 4RG6A 4AVXA 5C1DA 2IFUA 4J8FA 3ZYLA 5FZRA 4F1SA 3MKRA 3IHYA 3UX4A 2Y4UA 3S7DA 3QB2A 1HU3A 5JHBA 4PUCA 3AS4A 3FEYA 5FT9A 3Q15A 3CKBA 1HH8A 1E7VA 2KC7A 4ANXA 3ULQA 3LYAA 3UT7A 4FJYA 4B94A 4AY5A 2VSXE 2KCLA 3RU0A 1EDUA 4EZKA 3D9PA 2WQHA 2LNIA 4RSYA 3ZW3A 3FWVA 4GYYA 4LCTA 2FI7A 2WXHA 1Z3XA 3PZDA 3Q49B 1ELRA 4BTBA 2CFZA 3MKQB 4ILGA 2DBAA 4JPSA 2V0PA 3ML8A 5DIZA 4CDNA 3QARA 3CK8A 4L2YA 5LP0A 3TG4A 3U9WA 2HM8A 2WXIA 3EDTB 3FTXA 3B13A 3KAEA 3GW4A 2P58C 3FH7A 4C0EA 2V4LA 5KJLA 1JWGA 5T4YA 2PM7A 2WXRA 5ENNA 3EIQC 2NXPA 3K9IA 4BT8A 3I3NA 3O48A 3FDHA 4XI9A 3PE4A 4JL0A 2WXMA 4XE0A 5LCWC 3FUKA 4UWFA 3RK6A 4JC8A 5EX0A 4B89A 3LKUA 4LUNU 3LY8A 3TJPA 4I6GA 4TRQA 2DCPA 2WXJA 4APFA 4HXIA 4NRHB 3LXUX 4MKTA 4A3VA 1DNPA 4MS6A 4F53A 3ZIMA 3EJNA 2L6JA 4GMJA 4HOTA 3QOUA 3NQPA 4JW1A 4H7YA 5ANRA 4WAFA 1IQUA 5ANLA 3PNTB 3UT8A 5C2YA 3AS8A 3HYMB 3MGBA 2WXGA 4NACA 3PE3A 1QZ2A 4KYOB 3ASHA 4BSXA 3MX3A 3PDNA 4W9RA 2EQXA 5BPPA 5ARFA 3PNLB 5A7DB 3T5VA 3DBSA 4C9BB 2KATA 4GU5A 1H6KA 3OAWA 4E6HA 4KBQA 3CHOA 3N71A 3FULA 4Q94A 3FTSA 3CKCA 2AXVA 2XGOA 3LVQE 3FHEA 3UPVA 4UQZA 5DBKA 4BY6A 4DK5A 2X6IA 2HO1A 3FTYA 4PS7A 1JWFA 3B7RL 4CCAA 3MKQA 3ZXSA 2WXFA 1FVFA 2X6FA 3ONKA 4PH4B 2BUGA 2IQCA 2IOSA 2FEZA 5FQ8A 1B89A 5J90A 4I1AA 3SHFA 4L23A 4WNGA 2A5UA 3B7UX 2I2OA 3MV2B 2VJ8A 3U4TA 1PY1A 1FVHA 3KD7A 3FEXA 4BWRA 2J4BA 5JJ6A 2HYZA 2QFCA 2OOEA 1NP7A 1INZA 3SBTB 3VLFA 4I1OB 3ZGQA 2FO7A 3MZLB 2HR2A 3CIAA 3CEQA 5LOZA 3LJ3A 4KMOA 4KVMA 1ZU2A 3LCAA 2VGYA 1SZ9A 3CVQA 2GW1A 3QNKA 4O6FA 1Z6TA 3QJZA 1Z3YA 3S2AA 3U66A 3L08A 3PUKA 2X6JA 4M3OA 3ASFA 3APCA 4FHJA 5CMWA 4DLQA 1OWMA 3FUFA 3GZ1A 5D0QD 1EF1C 5G2NA 3ZFWA 1E8XA 2VGXB 5KJKA 3ESLA 3FH5A 4XIFA 1N52A 3APFA 1HS6A 2Q7FA 3D9IA 4F7AA 2JEKA 4GA2A 4YVQC 3G2WA 4Y6WA 3KEZA 3URZA 4G25A 1U3CA 2C0MA 2MHKA 1YA0A 4A1SA 3U3WA 4N2SA 4EZJA 4IN3B 4J6IA 4EZLA 2M63A 1IQRA 2XPZA 5HI7A 3SFZA 4JVSA 4N3CA 1HFAA 3D9NA 4IRUA 3ZN3A 1BPOA 2XGSA 2VTBB 3GZSA 4L2LA 4JA9A 3D3MA 3FTUA 3QWPA 3PUJA 3QAQA 3I4GA 5FQ7A 1HXIA 3ONLA 4G26A 1TJCA 1HF8A 1MHQA 3P2BA 2A4ZA 4GB9A 4KT6B 4UWLA 3T5XA 3VTYA 5J08A 3ML9A 4FHKA 4WWPA 4UQYA 3NZUA 5LCWJ 3L13A 1OUVA 4J0UA 2CHZA 4KXKB 3PREA 1HG5A 4GZDA 3CK9A 3TXNA 2IOLA 4I2ZA 3LEWA 3UMVA 4AXHA 3UT4A 4EQFA 2AVPA 4OVVA 3ENEA 1Y8MA 4JA7A 1HZ4A 5A23A 3RRMB 4JXTA 1WAO1 2V5FA 2CHXA 4AY6A 2I1JA 2XRZA 4FULA 2J9QA 2E2EA 2WPVA 5CHEE 5FZSA 3IV0A 3OXFA 2Y3AA 1IYGA 3RRNB 4UI9J 2L9BA 5T3RA 3MEKA 3P1UA 3SBSA 3APDA 4CT4A 5A6CA 4AOFA 3I5PA 1SZAA 5JJ7A 3E4BA 3TL5A 4I1MA 2L0IA 4J8DA 3JQ1A 4CGVA 3VLEA 3MCXA 3QWVA 2VYIA 4JHKA 3OXGA 2XCBA 4ILHB 1PAQA 5LFAA 2LSUA 4A3TA 4MRUA 4BX9A 4GAAA 2FBNA 2NC9A 1UN9A 2RG8A 3CHRA 4PDXA 4KVOA 1E8YA 4B0ZA 3ZYMA 3ZHEB 3LS8A 5BT1A 3D9LA 4CGWA 1E90A 4UI9C 4FA6A 3CSTA 3DPDA 4ILIA 4HVBA 3FUJA 4DLOA 3CVXA 1NZNA 4CT0A 3FUIA 4NQ0A 4HOQA 2IU1A 4I17A 2J07A 3S7BA 3B7TA 2YINA 3MA5A 3FU6A 4P29A 3GZ2A 2WMOA 2VTBA 2YQ8A 4J8EA 4R7LA 2JLBA 3FP3A 3CVUA 2ONDA 3MYVA 4XZ4A 3LY7A 2XPYA 3CHQA 3L22A 3C98A 4PS8A 1H2TC 4I9CA 2J08A 3JUIA 3ASDA 2YNQA 1NA3A 4LERA 4GCOA 3SD5A 2WM9A 1E7UA 3U64A 1UN8A 5G05C 1IHGA 3HHMA 3SGHA 4G2VA 1ELWA 3FUNA 5FWQA 3ZVVA 4TUUA 4B8AA 2WXKA 2PZIA 4U04A 4BX8A 1XNFA 2R5SA 4U8HA 2J4DA 3QKYA 2VSYA 1NA0A 3VTXA 2LAHA 3CHMA 4A1GA 3FU0A 3L17A 2GRLA 4N2QA 4N39A 3CVYA 4L1BA 3BEEA 3LVRE 4PS3A 2DIWA 4AV7A 1E96B 3AU4A 3D9OA 2WQ7A 3T8MA 2YHEA 3IBEA 3MJWA 3FTVA 4GA0A 4K0RA 3S7JA 4GYWA 5AIJA 4GPKA 3G2UA 4JZYA 2VQ2A 2YHCA 4DI4A 3L54A 3CVVA 5T8IA 2WB2A 4Y6CA 4G24A 4JEHA 5FJYA 5HQ8A 2VSOE 2OV8A 5G55A 5KCMA 4IYPA 3WXXA 2XGMA 3PEUB 2MRIA 1TEZA 3L6AA 1PC2A 2NSZA 3AU5A 3HIZA 3ZHEA 1GW6A 5EDSA 3FU3A 4Q96A 4U63A 3ZYKA 3CK7A 1U3DA 3FY4A 4TV3A 2XQ0A 2RD0A 1UG3A 4EBAG 2LSVA 3JYSA 3Q5MA 2XEVA 2J49A 2QY7A 3CVNA 3RJVA 1OWPA 1LF8A 2CHWA 3I4RB 3RO3A 1HO8A 4JEUA 4XI0A 2IONA 2KZTB 2GRMA 2PL2A 2WMNA 2KCVA 3PVLA 3CHSA 2WQ6A 5EX3A 5AJLA 3ZRHA 4BTAA 3O4ZA 3EHMA 1HX8A 3CR3A 3LPZA 3R9AB 1H19A 4H7XA 4Q69A 3PEVB 5BW8C 4FC8A 3ZPJA 3MV3B 3QWWA 4GMLA 4GZ5A 2C2LA 2VSNA 2BTDA 4WNDA 3VLDA 2AXUA 2CG3A 2KCKA 2OVBA 4DI3A 4G1TA 4B8CB 3FU5A 4GCNA 4J8SA 2XPIA 1EYHA 5FZQA 3NF1A 4I2WA 5M72A 3FH8A 4ANWA 4ANVA 4WWOA 4AJWA 4I43A 4HS2A 2FULA 4FU3A 4DJAA 3CQGB 3TXMA 1KT0A 2UY1B 3SZ7A 2C0LA 4ATGA 4XKCA 5CMYA 2AWIA 1UJJA 2X38A 4IULA 5LX8A 5FTPA 1W3BA 4WUYA 2V8SE 2X6KA 4UI9K 3SNXA 2AXZA 3UQ3A 1H2UA 3CHPA 3D9MA 2PQNA 1MQSA 3BG1B 2UWJG 3EHNA 5EKQD 4F3VA 5G04J 3RKVA 3FTWA 5BV1A 4EBAA 4NURA 1H0AA 1KT1A 4OYSA 4UWKA 1TJFA 4AM9A 4DPRA 3OTNA 4WNFA 3QDNA 2VGXA 2WXQA 4ACKA 4AEZC 3AS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CVL A;  4WNE A;  4G23 A;  2IF4 A;  4U0Z A;  5JJT A;  2FF4 A;  4UQX A;  5G05 J;  3ESK A;  3TAX A;  2PQR A;  5G04 C;  4GZ6 A;  2Y4T A;  3IEG A;  1KLX A;  4NRH B;  4HOU A;  4RG9 A;  4ME2 A;  4AIF A;  2I6H A;  3UUX A;  4I9E A;  4LEU A;  4YND A;  1WM5 A;  4GYO A;  5D0O D;  5CCM A;  4U0S A;  2UY1 A;  5AYW D;  3RIB A;  4N3A A;  1P5Q A;  4JHR A;  3FFL A;  3CV0 A;  4HOR A;  5BNW A;  4U0U A;  1A17 A;  4U07 A;  1FCH A;  4HOS A;  1ZBP A;  3KS2 A;  3Q4A B;  4BT9 A;  4YVO A;  3SF4 A;  5KJN A;  3LY9 A;  4GA1 A;  3RO2 A;  3Q47 B;  3TGO A;  4N3B A;  3ASG A;  4N5C A;  5KJM A;  3S7F A;  3CVP A;  4ABN A;  3TG5 A;  3GYZ A;  4APO A;  5CCL A;  1QQE A;  4CDR A;  4GZ3 A;  5ARG A;  3OXL A;  2XCC A;  4RG6 A;  5C1D A;  2IFU A;  4J8F A;  5FZR A;  3MKR A;  2Y4U A;  3S7D A;  3AS4 A;  5FT9 A;  3Q15 A;  3CKB A;  1HH8 A;  2KC7 A;  3ULQ A;  3LYA A;  4B94 A;  4AY5 A;  2KCL A;  3RU0 A;  2WQH A;  2LNI A;  3FWV A;  4GYY A;  2FI7 A;  3Q49 B;  1ELR A;  4BTB A;  2DBA A;  5DIZ A;  3CK8 A;  3TG4 A;  3EDT B;  3KAE A;  3GW4 A;  2P58 C;  5KJL A;  3K9I A;  4BT8 A;  3O48 A;  4XI9 A;  3PE4 A;  4JL0 A;  5LCW C;  5EX0 A;  3LKU A;  3LY8 A;  2L6J A;  4HOT A;  3QOU A;  4H7Y A;  3AS8 A;  3HYM B;  3PE3 A;  1QZ2 A;  4KYO B;  3ASH A;  3PDN A;  4W9R A;  5ARF A;  5A7D B;  2KAT A;  4KBQ A;  3N71 A;  3CKC A;  2XGO A;  3UPV A;  4UQZ A;  5DBK A;  2HO1 A;  2BUG A;  2FEZ A;  1B89 A;  4I1A A;  4WNG A;  3MV2 B;  3U4T A;  3KD7 A;  4BWR A;  5JJ6 A;  2HYZ A;  2QFC A;  2OOE A;  3ZGQ A;  2FO7 A;  2HR2 A;  3CEQ A;  1ZU2 A;  3LCA A;  3CVQ A;  2VGY A;  2GW1 A;  4O6F A;  3ASF A;  3GZ1 A;  5D0Q D;  3ZFW A;  2VGX B;  5KJK A;  4XIF A;  2Q7F A;  4GA2 A;  4YVQ C;  4Y6W A;  3URZ A;  4G25 A;  2C0M A;  2MHK A;  1YA0 A;  4A1S A;  3U3W A;  4N2S A;  4IN3 B;  5HI7 A;  4N3C A;  3ZN3 A;  2XGS A;  4JA9 A;  3QWP A;  1HXI A;  4G26 A;  1TJC A;  3VTY A;  4UQY A;  5LCW J;  1OUV A;  4J0U A;  4KXK B;  3CK9 A;  4I2Z A;  4EQF A;  2AVP A;  1Y8M A;  4JA7 A;  1HZ4 A;  1WAO 1;  2V5F A;  4AY6 A;  2J9Q A;  2E2E A;  2WPV A;  5CHE E;  5FZS A;  3OXF A;  1IYG A;  4UI9 J;  3MEK A;  5A6C A;  5JJ7 A;  3E4B A;  4J8D A;  4CGV A;  3QWV A;  2VYI A;  3OXG A;  2XCB A;  2LSU A;  2FBN A;  2NC9 A;  3ZHE B;  5BT1 A;  4CGW A;  4UI9 C;  1NZN A;  4NQ0 A;  4HOQ A;  4I17 A;  3S7B A;  3MA5 A;  3GZ2 A;  2YQ8 A;  4J8E A;  2JLB A;  3FP3 A;  2OND A;  3LY7 A;  4I9C A;  3ASD A;  1NA3 A;  4GCO A;  5G05 C;  1IHG A;  4G2V A;  1ELW A;  2PZI A;  4U04 A;  1XNF A;  2R5S A;  3QKY A;  2VSY A;  1NA0 A;  3VTX A;  4N2Q A;  4N39 A;  3BEE A;  1E96 B;  4GA0 A;  3S7J A;  4GPK A;  4GYW A;  2VQ2 A;  2YHC A;  4Y6C A;  4G24 A;  5FJY A;  5HQ8 A;  3WXX A;  2XGM A;  1PC2 A;  3ZHE A;  3CK7 A;  2LSV A;  3JYS A;  3Q5M A;  2XEV A;  3CVN A;  3RJV A;  3RO3 A;  4XI0 A;  2PL2 A;  2KCV A;  5EX3 A;  4BTA A;  3LPZ A;  3R9A B;  4H7X A;  5BW8 C;  3ZPJ A;  3MV3 B;  3QWW A;  4GZ5 A;  2C2L A;  2VSN A;  4WND A;  2KCK A;  4G1T A;  4GCN A;  2XPI A;  5FZQ A;  3NF1 A;  4I2W A;  5M72 A;  1KT0 A;  2UY1 B;  3SZ7 A;  2C0L A;  5FTP A;  1W3B A;  4WUY A;  4UI9 K;  3UQ3 A;  2PQN A;  2UWJ G;  5EKQ D;  4F3V A;  5G04 J;  3RKV A;  1KT1 A;  4AM9 A;  4WNF A;  3QDN A;  2VGX A;  3AS5 A; 
#chains in the Genus database with same CATH topology
 4G23 A;  1Z5S C;  3G2T A;  2P9N G;  2A5E A;  5JJT A;  4UQX A;  3TWQ A;  3D9J A;  1DVP A;  2WXP A;  4K5A B;  4OVU A;  2KZT A;  3CGH A;  3ESK A;  1UJK A;  1OWL A;  2Y4T A;  3ZUV B;  3LJN A;  4LRZ A;  1N4P A;  3JCK C;  4I6J A;  2MOW A;  2GGF A;  5BV0 A;  4I9E A;  1WM5 A;  4GYO A;  2PM6 A;  1TN8 A;  5CCM A;  1SA4 A;  5E75 A;  4JHR A;  1X81 A;  4X8Q A;  4K03 A;  4ANU A;  3UIN C;  5AJD A;  3W9F A;  4BSZ B;  5FQ6 A;  2BF0 X;  1ZBP A;  3KS2 A;  5AQ9 A;  2DZN A;  5KJN A;  3SF4 A;  3RO2 A;  1TN6 A;  4UUC A;  3ZEF A;  5AQB A;  2QYJ A;  2L0T B;  2Y69 E;  3AAA C;  4RVB A;  4TXP A;  3FUE A;  2PNN A;  5E76 A;  4FJZ A;  4BEP A;  1OWO A;  5C1D A;  3IXE A;  4BER A;  3ZYL A;  5FZR A;  3S7D A;  4U96 D;  3QB2 A;  1HU3 A;  3ZXP A;  2IO2 C;  3FEY A;  5FT9 A;  3J5Q B;  2KC7 A;  2GRP B;  5ENP D;  3RU0 A;  1EDU A;  1NI1 A;  2ETC A;  4RSY A;  2H6G A;  4GYY A;  4L2Y A;  2WXI A;  3TWT A;  3B13 A;  3KAE A;  4GTS A;  4C0E A;  4K5C A;  2NXP A;  3K9I A;  4BT8 A;  1K1A A;  3I3N A;  3SO8 A;  3UM1 A;  3FDH A;  4JL0 A;  2WXM A;  4XE0 A;  4UWF A;  1N94 A;  4LNG A;  4JC8 A;  2ZGG A;  3LY8 A;  4O60 A;  4APF A;  4CZ2 D;  4A3V A;  4MS6 A;  4HOT A;  2DWZ A;  2ETA A;  2XZD G;  3UT8 A;  5C2Y A;  4NAC A;  4KYO B;  2IY0 C;  3DSS A;  3MX3 A;  1YMP A;  3RSE G;  5BPP A;  3PNL B;  5AAO A;  3DBS A;  3CHO A;  3N71 A;  3FTS A;  3CKC A;  4ATZ D;  5ENO D;  4UQZ A;  5DBK A;  3UPV A;  2X6I A;  3Q75 A;  1JWF A;  2X6F A;  1QYM A;  2IOS A;  5B1A E;  2EIJ E;  5J90 A;  4I1A A;  3SHF A;  3HG0 D;  2VJ8 A;  4BWR A;  1FVH A;  3FEX A;  2HYZ A;  2OOE A;  4I1O B;  2FO7 A;  5JA4 D;  1DCE A;  4KMO A;  3E33 A;  3DXM G;  3LCA A;  2VGY A;  4O1O A;  4DX6 D;  1IKN D;  3PUK A;  3HXC A;  4M3O A;  3FUF A;  4L9P A;  3ZFW A;  2F8X K;  1N52 A;  2Q7F A;  4YVQ C;  3URZ A;  4G25 A;  2P9P G;  3U3W A;  4A1S A;  5ITZ F;  4J6I A;  1HFA A;  4IRU A;  2P9S G;  3GZS A;  4L2L A;  5ENS D;  3FTU A;  4QQI A;  5FQ7 A;  1HF8 A;  3T5X A;  4FHK A;  4WWP A;  3L13 A;  4GZD A;  3CK9 A;  4OVV A;  4JA7 A;  1SA5 A;  4JXT A;  1S70 B;  1WAO 1;  4K5B A;  4FUL A;  5CHE E;  5FZS A;  3RRN B;  4UI9 J;  2L9B A;  5A6C A;  5JJ7 A;  1NL4 A;  3JQ1 A;  4JHK A;  3L9T A;  2LSU A;  5HS0 A;  4BX9 A;  1D9S A;  1MX6 A;  1UN9 A;  4HRM B;  4PDX A;  3ABL E;  2JAB A;  3D9L A;  4FA6 A;  4ILI A;  3FUJ A;  4DLO A;  2IU1 A;  3HXF A;  3B7T A;  2YIN A;  3FU6 A;  2WMO A;  4RLY A;  4R7L A;  3CVU A;  2XPY A;  3CHQ A;  4PS8 A;  3C98 A;  3JUI A;  4GCO A;  1E7U A;  3HHM A;  3SGH A;  1ELW A;  5FWQ A;  5ENQ D;  2WXK A;  1XNF A;  2R5S A;  3V30 A;  3QKY A;  3VTX A;  2LAH A;  3CHM A;  4N39 A;  2DIW A;  3SQV A;  2WQ7 A;  3T8M A;  3S7J A;  2VQ2 A;  4DI4 A;  1KZP A;  3UXG A;  2NYJ A;  5FJY A;  2OV8 A;  5HKP A;  3L6A A;  3AU5 A;  3ZHE A;  5EDS A;  3FU3 A;  3ZYK A;  4HNA D;  1UG3 A;  2XEH A;  2LSV A;  3Q5M A;  2J49 A;  1U2V G;  3CVN A;  4XI0 A;  2KZT B;  2PL2 A;  5AJL A;  1DC2 A;  3AG3 E;  3Q79 A;  4H7X A;  3ULE G;  4Q69 A;  2VGE A;  4HRL A;  3QWW A;  5EYL A;  4GZ5 A;  4WND A;  2OVB A;  4G1T A;  3FU5 A;  2BED A;  2XPI A;  4ANV A;  4AJW A;  2FUL A;  1KT0 A;  5FTP A;  4YDY A;  1H2U A;  3CHP A;  2GRN B;  3D9M A;  3BG1 B;  5EKQ D;  3RKV A;  3FTW A;  4NUR A;  4OYS A;  4AM9 A;  4WNF A;  5D66 A;  3NB2 A;  3AS5 A;  4WNE A;  4U0Z A;  2FF4 A;  4ACL A;  4WWN A;  5G05 J;  4U7E B;  4DX7 D;  4KZ0 A;  1VDY A;  2PQR A;  1SW6 A;  3Q78 A;  4GZ6 A;  4D10 C;  2WXO A;  1LD8 A;  2R03 A;  4QFV A;  2GRO B;  1KLX A;  4HOU A;  3PZ4 A;  1TYQ G;  5JHA A;  3UUX A;  4A55 A;  3G2V A;  3R7R A;  5BXO A;  3UKR G;  3FUH A;  4YND A;  1N0Q A;  3DSU A;  1DCQ A;  3B7S A;  1E8W A;  4GTQ A;  3DPY A;  1HG2 A;  5AYW D;  1OT8 A;  3RIB A;  5BUZ A;  1YCS B;  4N3A A;  1P5Q A;  3FTZ A;  3C5R A;  3IKO B;  5CRV A;  3IHV A;  3ZYQ A;  5KWD A;  4UWG A;  4HOR A;  5D2M C;  5BNW A;  3C3R A;  1SQM A;  1UW4 B;  4U07 A;  5CEA A;  5EID A;  3Q4A B;  3BQO A;  3PRZ A;  1JUQ A;  3NZS A;  2CG2 A;  4N3B A;  2R59 A;  4LG6 A;  5KJM A;  3CSF A;  1QNF A;  1SVX A;  2IJG X;  3GYZ A;  2I9C A;  5ENR D;  1OCC E;  4JHJ A;  4XX5 A;  4GZ3 A;  4MLP A;  5CEC B;  3OXL A;  1IXV A;  4AVX A;  2IFU A;  4F1S A;  3IHY A;  2Y4U A;  1V54 E;  5JHB A;  4J7W A;  3CKB A;  3ULQ A;  3UT7 A;  2VSX E;  3ZU7 B;  3EUV A;  3EU9 A;  2WQH A;  2ETB A;  2H6I A;  2LNI A;  4Z68 A;  3FWV A;  4LCT A;  3PZD A;  1ELR A;  2CFZ A;  5DIZ A;  1TNU A;  2F8Y A;  2P58 C;  3JXI A;  2PM7 A;  2OCC E;  3BUA A;  1AP7 A;  3O48 A;  2QC9 A;  4B89 A;  4LUN U;  3TJP A;  4I6G A;  3E32 A;  4HXI A;  3X2Q E;  1DNP A;  4F53 A;  3QOU A;  4H7Y A;  4WAF A;  4F1P A;  4OAV B;  2WXG A;  4W9R A;  5CRU A;  5ARF A;  5A7D B;  2R2L A;  3T5V A;  2KAT A;  1H6K A;  3AG4 E;  3HXE A;  3FUL A;  3FHE A;  4O1P A;  3TWX A;  2HO1 A;  1FVF A;  3ONK A;  4PH4 B;  2BUG A;  2IQC A;  4L23 A;  4WNG A;  4DX1 A;  3U4T A;  3UM3 A;  3SBT B;  2HE0 A;  3MZL B;  3CIA A;  5LOZ A;  3WG7 E;  3CVQ A;  2GW1 A;  3DSX A;  4HQD A;  4LNU D;  2IEJ A;  3QNK A;  1Z6T A;  3U66 A;  3S2A A;  1O1S A;  3APC A;  4FHJ A;  5CMW A;  4DLQ A;  1OWM A;  5EIB E;  1BD8 A;  3DSV A;  3ESL A;  4F7A A;  2JEK A;  3TWW A;  2M63 A;  1IQR A;  5HI7 A;  5AAR A;  4JVS A;  3TWS A;  2XGS A;  3T9K A;  4JA9 A;  3V79 K;  2QZA A;  3D3M A;  3PUJ A;  3ONL A;  4G26 A;  1TJC A;  3VTY A;  2A4Z A;  4KT6 B;  3ML9 A;  4UQY A;  4KXK B;  1S64 A;  1BU9 A;  2IOL A;  3UMV A;  2AVP A;  3ENE A;  5CER B;  2V5F A;  2CHX A;  4M7C A;  3IV0 A;  4N5Q A;  3E30 A;  3P1U A;  3APD A;  1K8K G;  4AOF A;  1JCQ A;  3TWV A;  1SZA A;  3E4B A;  2L0I A;  4J8D A;  4CGV A;  2VYI A;  1PAQ A;  5LFA A;  1N95 A;  1YYH A;  3V2O A;  4MRU A;  2FBN A;  2NC9 A;  1OXJ A;  4B0Z A;  3ZYM A;  3ZHE B;  2ZIS A;  5BT1 A;  1E90 A;  4HVB A;  4I17 A;  2J07 A;  1Q2Z A;  3Q7A A;  4P29 A;  4HI8 A;  4J8E A;  2JLB A;  2OND A;  1V55 E;  4U8V D;  1H2T C;  2J08 A;  3J5P A;  3DWL G;  2WM9 A;  5AQA A;  2R02 A;  5G05 C;  3ZVV A;  4B8A A;  2B0O E;  5CBO A;  3FU0 A;  2LXL A;  4L1B A;  3LVR E;  1OCR E;  3D9O A;  3B7B A;  4GYW A;  5JMN D;  3G2U A;  2YHC A;  5T8I A;  2WB2 A;  4G24 A;  5HQ8 A;  4YDW A;  5G55 A;  5KCM A;  1KZO A;  4IYP A;  2XGM A;  1TEZ A;  1IHB A;  3HIZ A;  4TV3 A;  3RJV A;  3RO3 A;  1HO8 A;  4F6R D;  4JD2 G;  2KCV A;  3PVL A;  3CHS A;  1TNZ A;  3ZRH A;  3EHM A;  3LPZ A;  2RKK A;  4FC8 A;  3ZPJ A;  3SFX A;  2C2L A;  3ABM E;  2DYR E;  2B6C A;  3VLD A;  2KCK A;  2XEE A;  1EYH A;  4ZHB A;  3NF1 A;  5M72 A;  3DEP A;  4ANW A;  3JXJ A;  4FU3 A;  4HB5 A;  2C0L A;  4ATG A;  4XKC A;  1G3N B;  2AWI A;  2X38 A;  1W3B A;  2V8S E;  2OEW A;  3SNX A;  3UQ3 A;  1MQS A;  4F3V A;  4EBA A;  1H0A A;  4UWK A;  1TJF A;  2Y1L E;  4DPR A;  3QDN A;  2WXQ A;  4HI9 A;  3CVL A;  2IF4 A;  2KM4 A;  4CDM A;  4RQI A;  2ILR A;  4KZC A;  1K3Z D;  2OVF A;  3TAX A;  4HFG A;  3LDZ A;  2LAI A;  3V2X A;  1N0R A;  5G04 C;  3CLJ A;  1RW2 A;  3IEG A;  3PS6 A;  2J09 A;  2WVI A;  4G11 A;  4NRH B;  1ELK A;  4RG9 A;  4AIF A;  2Y0B G;  3BG0 B;  5B3S E;  4LEU A;  4CEM A;  2CFU A;  4L7T A;  5FIO A;  3KSQ A;  2DYS E;  4GPM A;  4EEC A;  2LO6 A;  2X3M A;  2X6H A;  1E8Z A;  2E0I A;  4XKB A;  1Y6I A;  3FFL A;  3SI5 A;  1EPU A;  1H2V C;  1WY6 A;  1A17 A;  5AEN A;  2LXM A;  1FCH A;  4HOS A;  4E85 A;  4BT9 A;  4YVO A;  4V3I A;  3LY9 A;  2I1K A;  1BI7 B;  1S0P A;  4TUM A;  3PH0 C;  3Q47 B;  3ASG A;  3JUE A;  2J8S D;  2WXN A;  5IY5 E;  1WDY A;  4ABN A;  3HVE A;  1FPP A;  3L16 A;  4UWH A;  1JCS A;  5CCL A;  4BFR A;  3PZ3 A;  4HLE A;  5ARG A;  1N54 A;  4J8F A;  3MKR A;  3UX4 A;  1AWC B;  3UI2 A;  4GTR A;  3AS4 A;  2EIM E;  1HH8 A;  1E7V A;  1O1R A;  2BKG A;  3LYA A;  4AY5 A;  5KNG A;  3D9P A;  3HRA A;  3B95 A;  2FI7 A;  3Q49 B;  2XZT G;  4BTB A;  2DBA A;  4JPS A;  1N11 A;  3QAR A;  3CK8 A;  3EHR A;  3TG4 A;  3FTX A;  3GW4 A;  3FH7 A;  5KJL A;  5T4Y A;  5KBA A;  5ENN A;  3EIQ C;  3PE4 A;  1O1T A;  5EX0 A;  4TRQ A;  2DCP A;  3LXU X;  4JB8 P;  2L6J A;  3V31 A;  4JW1 A;  5ANL A;  3PNT B;  2RFA A;  1QBQ A;  2ZIR A;  4GTP A;  4BSX A;  3PDN A;  2EQX A;  4C9B B;  4GU5 A;  4KBQ A;  4CYM D;  4DX2 A;  4Q94 A;  3NBN B;  2P2C P;  4DK5 A;  4BY6 A;  3FTY A;  4PS7 A;  1NFI E;  1N4S A;  3HXD A;  4CCA A;  3MKQ A;  1H6O A;  3B7U X;  2I2O A;  3MV2 B;  2J4B A;  5JJ6 A;  4TXQ A;  1NP7 A;  3C3Q A;  2L6B A;  3VLF A;  3EHQ A;  1N4R A;  2HR2 A;  2V4H C;  1SZ9 A;  3Q7F A;  4O6F A;  3QJZ A;  1Z3Y A;  1OCZ E;  3L08 A;  2X6J A;  3GZ1 A;  1TR4 A;  5G2N A;  2VGX B;  3FH5 A;  4XIF A;  3PZ2 A;  1S63 A;  3G2W A;  3KEZ A;  1U3C A;  2C0M A;  4LSZ E;  1YA0 A;  5CBN A;  2XS1 A;  4IN3 B;  4EZL A;  4NIK A;  2XPZ A;  3SFZ A;  4N3C A;  3D9N A;  3W9G A;  3UTM A;  3QWP A;  1WG0 A;  3QAQ A;  3I4G A;  1HXI A;  1MHQ A;  4GB9 A;  4HLL A;  4B93 B;  3NZU A;  5LCW J;  1OUV A;  2P9I G;  4TXR A;  4AXH A;  3UT4 A;  3R9M A;  1HZ4 A;  3NAW A;  3F6Q A;  2DZO A;  2I1J A;  2XRZ A;  2J9Q A;  2OEV A;  2WPV A;  4EHM A;  2Y3A A;  2XEN A;  3SBS A;  3I5P A;  1ZB1 A;  4I1M A;  3VLE A;  1TNB A;  2XCB A;  2P9L G;  2FO1 E;  2RG8 A;  3CHR A;  5EIL A;  4KVO A;  1E8Y A;  4CGW A;  4UI9 C;  5FIN A;  3DPD A;  4YDE A;  1NZN A;  4CT0 A;  4HOQ A;  3GZ2 A;  2VTB A;  2MYO A;  3FP3 A;  3E34 A;  1O5M A;  3LY7 A;  1TNY A;  3ASD A;  2YNQ A;  3SD5 A;  1UN8 A;  3BU8 A;  4G2V A;  1A5E A;  1TN7 A;  4U04 A;  4BX8 A;  2J4D A;  2VSY A;  2GRL A;  3CVY A;  4PS3 A;  3E37 A;  4AV7 A;  1E96 B;  2YHE A;  4K0R A;  3CVV A;  4Y6C A;  2MRI A;  1GW6 A;  1FT1 A;  5ENT D;  3C3O A;  3ISM C;  3CK7 A;  1MX2 A;  4BET A;  2XQ0 A;  3JYS A;  3UIP C;  2QY7 A;  2CHW A;  4JEU A;  2WQ6 A;  5HRY A;  3KSL A;  1JCR A;  3O4Z A;  1HX8 A;  1LTX A;  1H19 A;  2GRQ B;  3PEV B;  5BW8 C;  5AQ7 A;  4GTV A;  4GML A;  2VSN A;  2BTD A;  1MJ0 A;  2AXU A;  2CG3 A;  4DI3 A;  4B8C B;  4J8S A;  3NOC D;  3FH8 A;  4WWO A;  4I43 A;  4HS2 A;  4DJA A;  3CQG B;  3TXM A;  3EU5 A;  3SZ7 A;  1UJJ A;  4IUL A;  5LX8 A;  2R05 A;  1N4Q A;  4WUY A;  2UWJ G;  5BV1 A;  1K1B A;  1KT1 A;  1TNO A;  2VGX A;  4AEZ C;  1X5B A;  3UM0 A;  3QK0 A;  4GTO A;  3JQ0 A;  4FLB A;  4DX5 D;  3CVW A;  3HDX A;  3FUM A;  3Q9N C;  3RAU A;  3EIJ A;  4FP7 A;  3TWU A;  5FQ4 A;  3HVE B;  1HE8 A;  4FLH A;  3D9K A;  4GZC A;  1XGW A;  1BLX B;  4G8K A;  2XRY A;  4ME2 A;  4EZK A;  4CRW A;  2I6H A;  5H7P A;  2ZU6 B;  2R17 C;  1L5J A;  5D0O D;  4URK A;  4FAD A;  4U0S A;  2UY1 A;  2H6H A;  4EPZ A;  3ASO E;  3CV0 A;  4U0U A;  2AW6 A;  2EIK E;  1OY3 D;  4C0M A;  3RRU A;  1MZC A;  4GA1 A;  1OWN A;  4AP2 A;  3TGO A;  3FUD A;  5AN8 A;  3TWR A;  4N5C A;  2XHE A;  3S7F A;  3CVP A;  3TG5 A;  3PZ1 A;  3R7Q A;  3QC1 A;  1JPL A;  4HBD A;  4APO A;  3CQC B;  4I6E A;  1QQE A;  4CDR A;  2WXL A;  4U95 D;  3G2S A;  2XCC A;  4RG6 A;  5EYP F;  3UIO C;  4YDO A;  4PUC A;  3Q15 A;  3DST A;  4ANX A;  4B94 A;  4FJY A;  2KCL A;  5EN5 D;  3NOG D;  3ZW3 A;  2WXH A;  2BKK B;  1Z3X A;  3MKQ B;  4ILG A;  2V0P A;  3ML8 A;  4CDN A;  1FT2 A;  3UKU G;  5LP0 A;  3U9W A;  2HM8 A;  1MYO A;  3EDT B;  2V4L A;  1JWG A;  1H6P A;  2WXR A;  4C48 B;  4DRX E;  4XI9 A;  5LCW C;  3FUK A;  3RK6 A;  3LKU A;  2WXJ A;  2RFM A;  4MKT A;  3ZKJ A;  3DRA A;  3ZIM A;  3EJN A;  4GMJ A;  3NQP A;  3Q73 A;  3KEA A;  5ANR A;  1IQU A;  3AS8 A;  3HYM B;  3MGB A;  3PE3 A;  1QZ2 A;  3ASH A;  1RZ4 A;  2ZGD A;  2P9U G;  3OAW A;  4E6H A;  4DUI A;  2AXV A;  2XGO A;  3LVQ E;  3ABK E;  2EIN E;  3B7R L;  3ZXS A;  2WXF A;  2FEZ A;  5FQ8 A;  1B89 A;  2EIL E;  4GTM A;  2A5U A;  3ZNG A;  1PY1 A;  3KD7 A;  3C72 A;  2ZXW E;  2QFC A;  1INZ A;  3AG2 E;  3ZGQ A;  2V5Q C;  3CEQ A;  1D8D A;  3LJ3 A;  4KVM A;  1ZU2 A;  2IO3 C;  5BXU A;  4GTT A;  2F0Y A;  4G8L A;  3ASF A;  5D0Q D;  1EF1 C;  1E8X A;  5KJK A;  3APF A;  1HS6 A;  3D9I A;  4GA2 A;  1KPS B;  4Y6W A;  2MHK A;  4N2S A;  4EZJ A;  1BI8 B;  3ZN3 A;  1BPO A;  2VTB B;  3P2B A;  4UWL A;  5J08 A;  3AG1 E;  4ZFH A;  4J0U A;  2CHZ A;  3PRE A;  1HG5 A;  3TXN A;  4I2Z A;  3LEW A;  4EQF A;  1Y8M A;  2P9K G;  5A23 A;  3RRM B;  1N9A A;  4AY6 A;  2E2E A;  2GRR B;  2F37 A;  3OXF A;  1IYG A;  5T3R A;  3MEK A;  4CT4 A;  2DVW A;  3L82 A;  2KBX A;  3TL5 A;  3MCX A;  3QWV A;  3OXG A;  4ILH B;  4A3T A;  5B1B E;  4GAA A;  3LS8 A;  4MBG A;  3CST A;  4A63 B;  2H6F A;  3CVX A;  3FUI A;  4NQ0 A;  3S7B A;  3MA5 A;  1UOH A;  2YQ8 A;  3MYV A;  3ASN E;  4XZ4 A;  3L22 A;  4I9C A;  4LER A;  1NA3 A;  2XS8 A;  4GMR A;  3DEO A;  3U64 A;  1IHG A;  3SY2 A;  4XEI G;  3FUN A;  4TUU A;  2PZI A;  4U8H A;  1NA0 A;  1MX4 A;  4A1G A;  3L17 A;  4N2Q A;  3BEE A;  1D8E A;  3AU4 A;  2AJA A;  4HRN A;  3IBE A;  3MJW A;  3FTV A;  4GA0 A;  2LUH A;  5AIJ A;  4GPK A;  3DXK G;  4LNB A;  4JZY A;  3L54 A;  2QYU A;  4JEH A;  2VSO E;  3WXX A;  3PEU B;  1PC2 A;  2NSZ A;  4Q96 A;  4U63 A;  3AJI A;  1U3D A;  3FY4 A;  2RD0 A;  4EBA G;  2XEV A;  4BES A;  1OWP A;  1LF8 A;  3I4R B;  5CED B;  3HXB A;  2ION A;  2GRM A;  2WMN A;  3DSW A;  1LD7 A;  3Q9U C;  5EX3 A;  4BTA A;  3CR3 A;  4J8Y A;  3R9A B;  1OCO E;  3D9H A;  3MV3 B;  2KXP C;  5KNH D;  3SFY A;  4GCN A;  5FZQ A;  3UM2 A;  4I2W A;  4OAU C;  2UY1 B;  3ULY A;  5CMY A;  4U8Y D;  2X6K A;  4UI9 K;  2AXZ A;  2PQN A;  3EHN A;  5G04 J;  3OTN A;  3T8K A;  4ACK A; 
#chains in the Genus database with same CATH homology
 3CVL A;  1X5B A;  4WNE A;  4G23 A;  2IF4 A;  2KM4 A;  3QK0 A;  3JQ0 A;  3G2T A;  4CDM A;  4FLB A;  4U0Z A;  5JJT A;  2FF4 A;  4UQX A;  4ACL A;  2ILR A;  4WWN A;  3D9J A;  4KZC A;  1DVP A;  3CVW A;  3HDX A;  3FUM A;  2OVF A;  2WXP A;  4OVU A;  5G05 J;  2KZT A;  3CGH A;  3ESK A;  3TAX A;  4HFG A;  1UJK A;  3LDZ A;  1OWL A;  4KZ0 A;  2LAI A;  1VDY A;  2PQR A;  5G04 C;  4GZ6 A;  2Y4T A;  4D10 C;  3CLJ A;  2WXO A;  3EIJ A;  4FP7 A;  5FQ4 A;  3IEG A;  3HVE B;  3PS6 A;  2J09 A;  1HE8 A;  4LRZ A;  4QFV A;  2WVI A;  4FLH A;  1KLX A;  3JCK C;  4G11 A;  4I6J A;  1ELK A;  3D9K A;  2MOW A;  1XGW A;  4GZC A;  4HOU A;  2XRY A;  4ME2 A;  4RG9 A;  4AIF A;  2GGF A;  4CRW A;  5BV0 A;  2I6H A;  5JHA A;  3UUX A;  3BG0 B;  3G2V A;  4I9E A;  3R7R A;  4A55 A;  2ZU6 B;  3FUH A;  4LEU A;  4YND A;  4CEM A;  1WM5 A;  2R17 C;  4GYO A;  2PM6 A;  1L5J A;  2CFU A;  3B7S A;  4L7T A;  1E8W A;  4EEC A;  5D0O D;  2LO6 A;  5CCM A;  4URK A;  2X3M A;  2X6H A;  4FAD A;  4U0S A;  1HG2 A;  2UY1 A;  5AYW D;  3RIB A;  5BUZ A;  1E8Z A;  2E0I A;  4N3A A;  1P5Q A;  3FTZ A;  4XKB A;  5E75 A;  1Y6I A;  3IKO B;  4JHR A;  4EPZ A;  3IHV A;  3ZYQ A;  3FFL A;  3SI5 A;  3CV0 A;  4K03 A;  4UWG A;  4HOR A;  4ANU A;  5BNW A;  4U0U A;  1EPU A;  5AJD A;  1H2V C;  2AW6 A;  1WY6 A;  1A17 A;  5AEN A;  1SQM A;  1UW4 B;  5FQ6 A;  4U07 A;  1FCH A;  2BF0 X;  4HOS A;  1ZBP A;  3KS2 A;  3Q4A B;  4E85 A;  4C0M A;  3PRZ A;  3RRU A;  4BT9 A;  4YVO A;  3SF4 A;  5KJN A;  4V3I A;  3LY9 A;  1JUQ A;  4GA1 A;  2I1K A;  3RO2 A;  1S0P A;  1OWN A;  3PH0 C;  3Q47 B;  4AP2 A;  3NZS A;  2CG2 A;  4N3B A;  3ASG A;  3TGO A;  3ZEF A;  3FUD A;  2R59 A;  2L0T B;  4N5C A;  2XHE A;  5KJM A;  2WXN A;  3S7F A;  3CSF A;  3CVP A;  1QNF A;  4ABN A;  3TG5 A;  4RVB A;  2IJG X;  3GYZ A;  3R7Q A;  3QC1 A;  3HVE A;  3FUE A;  1JPL A;  3L16 A;  2I9C A;  4APO A;  4UWH A;  3CQC B;  5E76 A;  5CCL A;  4I6E A;  1QQE A;  4JHJ A;  4FJZ A;  4BFR A;  2WXL A;  4GZ3 A;  4MLP A;  4XX5 A;  4CDR A;  3G2S A;  4HLE A;  5ARG A;  1N54 A;  1OWO A;  3OXL A;  2XCC A;  4RG6 A;  4AVX A;  5C1D A;  2IFU A;  4J8F A;  3ZYL A;  5FZR A;  4F1S A;  3MKR A;  3IHY A;  3UX4 A;  2Y4U A;  3S7D A;  3QB2 A;  1HU3 A;  5JHB A;  4PUC A;  3AS4 A;  3FEY A;  5FT9 A;  3Q15 A;  3CKB A;  1HH8 A;  1E7V A;  2KC7 A;  4ANX A;  3ULQ A;  3LYA A;  3UT7 A;  4FJY A;  4B94 A;  4AY5 A;  2VSX E;  2KCL A;  3RU0 A;  1EDU A;  4EZK A;  3D9P A;  2WQH A;  2LNI A;  4RSY A;  3ZW3 A;  3FWV A;  4GYY A;  4LCT A;  2FI7 A;  2WXH A;  1Z3X A;  3PZD A;  3Q49 B;  1ELR A;  4BTB A;  2CFZ A;  3MKQ B;  4ILG A;  2DBA A;  4JPS A;  2V0P A;  3ML8 A;  5DIZ A;  4CDN A;  3QAR A;  3CK8 A;  4L2Y A;  5LP0 A;  3TG4 A;  3U9W A;  2HM8 A;  2WXI A;  3EDT B;  3FTX A;  3B13 A;  3KAE A;  3GW4 A;  2P58 C;  3FH7 A;  4C0E A;  2V4L A;  5KJL A;  1JWG A;  5T4Y A;  2PM7 A;  2WXR A;  5ENN A;  3EIQ C;  2NXP A;  3K9I A;  4BT8 A;  3I3N A;  3O48 A;  3FDH A;  4XI9 A;  3PE4 A;  4JL0 A;  2WXM A;  4XE0 A;  5LCW C;  3FUK A;  4UWF A;  3RK6 A;  4JC8 A;  5EX0 A;  4B89 A;  3LKU A;  4LUN U;  3LY8 A;  3TJP A;  4I6G A;  4TRQ A;  2DCP A;  2WXJ A;  4APF A;  4HXI A;  4NRH B;  3LXU X;  4MKT A;  4A3V A;  1DNP A;  4MS6 A;  4F53 A;  3ZIM A;  3EJN A;  2L6J A;  4GMJ A;  4HOT A;  3QOU A;  3NQP A;  4JW1 A;  4H7Y A;  5ANR A;  4WAF A;  1IQU A;  5ANL A;  3PNT B;  3UT8 A;  5C2Y A;  3AS8 A;  3HYM B;  3MGB A;  2WXG A;  4NAC A;  3PE3 A;  1QZ2 A;  4KYO B;  3ASH A;  4BSX A;  3MX3 A;  3PDN A;  4W9R A;  2EQX A;  5BPP A;  5ARF A;  3PNL B;  5A7D B;  3T5V A;  3DBS A;  4C9B B;  2KAT A;  4GU5 A;  1H6K A;  3OAW A;  4E6H A;  4KBQ A;  3CHO A;  3N71 A;  3FUL A;  4Q94 A;  3FTS A;  3CKC A;  2AXV A;  2XGO A;  3LVQ E;  3FHE A;  3UPV A;  4UQZ A;  5DBK A;  4BY6 A;  4DK5 A;  2X6I A;  2HO1 A;  3FTY A;  4PS7 A;  1JWF A;  3B7R L;  4CCA A;  3MKQ A;  3ZXS A;  2WXF A;  1FVF A;  2X6F A;  3ONK A;  4PH4 B;  2BUG A;  2IQC A;  2IOS A;  2FEZ A;  5FQ8 A;  1B89 A;  5J90 A;  4I1A A;  3SHF A;  4L23 A;  4WNG A;  2A5U A;  3B7U X;  2I2O A;  3MV2 B;  2VJ8 A;  3U4T A;  1PY1 A;  1FVH A;  3KD7 A;  3FEX A;  4BWR A;  2J4B A;  5JJ6 A;  2HYZ A;  2QFC A;  2OOE A;  1NP7 A;  1INZ A;  3SBT B;  3VLF A;  4I1O B;  3ZGQ A;  2FO7 A;  3MZL B;  2HR2 A;  3CIA A;  3CEQ A;  5LOZ A;  3LJ3 A;  4KMO A;  4KVM A;  1ZU2 A;  3LCA A;  2VGY A;  1SZ9 A;  3CVQ A;  2GW1 A;  3QNK A;  4O6F A;  1Z6T A;  3QJZ A;  1Z3Y A;  3S2A A;  3U66 A;  3L08 A;  3PUK A;  2X6J A;  4M3O A;  3ASF A;  3APC A;  4FHJ A;  5CMW A;  4DLQ A;  1OWM A;  3FUF A;  3GZ1 A;  5D0Q D;  1EF1 C;  5G2N A;  3ZFW A;  1E8X A;  2VGX B;  5KJK A;  3ESL A;  3FH5 A;  4XIF A;  1N52 A;  3APF A;  1HS6 A;  2Q7F A;  3D9I A;  4F7A A;  2JEK A;  4GA2 A;  4YVQ C;  3G2W A;  4Y6W A;  3KEZ A;  3URZ A;  4G25 A;  1U3C A;  2C0M A;  2MHK A;  1YA0 A;  4A1S A;  3U3W A;  4N2S A;  4EZJ A;  4IN3 B;  4J6I A;  4EZL A;  2M63 A;  1IQR A;  2XPZ A;  5HI7 A;  3SFZ A;  4JVS A;  4N3C A;  1HFA A;  3D9N A;  4IRU A;  3ZN3 A;  1BPO A;  2XGS A;  2VTB B;  3GZS A;  4L2L A;  4JA9 A;  3D3M A;  3FTU A;  3QWP A;  3PUJ A;  3QAQ A;  3I4G A;  5FQ7 A;  1HXI A;  3ONL A;  4G26 A;  1TJC A;  1HF8 A;  1MHQ A;  3P2B A;  2A4Z A;  4GB9 A;  4KT6 B;  4UWL A;  3T5X A;  3VTY A;  5J08 A;  3ML9 A;  4FHK A;  4WWP A;  4UQY A;  3NZU A;  5LCW J;  3L13 A;  1OUV A;  4J0U A;  2CHZ A;  4KXK B;  3PRE A;  1HG5 A;  4GZD A;  3CK9 A;  3TXN A;  2IOL A;  4I2Z A;  3LEW A;  3UMV A;  4AXH A;  3UT4 A;  4EQF A;  2AVP A;  4OVV A;  3ENE A;  1Y8M A;  4JA7 A;  1HZ4 A;  5A23 A;  3RRM B;  4JXT A;  1WAO 1;  2V5F A;  2CHX A;  4AY6 A;  2I1J A;  2XRZ A;  4FUL A;  2J9Q A;  2E2E A;  2WPV A;  5CHE E;  5FZS A;  3IV0 A;  3OXF A;  2Y3A A;  1IYG A;  3RRN B;  4UI9 J;  2L9B A;  5T3R A;  3MEK A;  3P1U A;  3SBS A;  3APD A;  4CT4 A;  5A6C A;  4AOF A;  3I5P A;  1SZA A;  5JJ7 A;  3E4B A;  3TL5 A;  4I1M A;  2L0I A;  4J8D A;  3JQ1 A;  4CGV A;  3VLE A;  3MCX A;  3QWV A;  2VYI A;  4JHK A;  3OXG A;  2XCB A;  4ILH B;  1PAQ A;  5LFA A;  2LSU A;  4A3T A;  4MRU A;  4BX9 A;  4GAA A;  2FBN A;  2NC9 A;  1UN9 A;  2RG8 A;  3CHR A;  4PDX A;  4KVO A;  1E8Y A;  4B0Z A;  3ZYM A;  3ZHE B;  3LS8 A;  5BT1 A;  3D9L A;  4CGW A;  1E90 A;  4UI9 C;  4FA6 A;  3CST A;  3DPD A;  4ILI A;  4HVB A;  3FUJ A;  4DLO A;  3CVX A;  1NZN A;  4CT0 A;  3FUI A;  4NQ0 A;  4HOQ A;  2IU1 A;  4I17 A;  2J07 A;  3S7B A;  3B7T A;  2YIN A;  3MA5 A;  3FU6 A;  4P29 A;  3GZ2 A;  2WMO A;  2VTB A;  2YQ8 A;  4J8E A;  4R7L A;  2JLB A;  3FP3 A;  3CVU A;  2OND A;  3MYV A;  4XZ4 A;  3LY7 A;  2XPY A;  3CHQ A;  3L22 A;  3C98 A;  4PS8 A;  1H2T C;  4I9C A;  2J08 A;  3JUI A;  3ASD A;  2YNQ A;  1NA3 A;  4LER A;  4GCO A;  3SD5 A;  2WM9 A;  1E7U A;  3U64 A;  1UN8 A;  5G05 C;  1IHG A;  3HHM A;  3SGH A;  4G2V A;  1ELW A;  3FUN A;  5FWQ A;  3ZVV A;  4TUU A;  4B8A A;  2WXK A;  2PZI A;  4U04 A;  4BX8 A;  1XNF A;  2R5S A;  4U8H A;  2J4D A;  3QKY A;  2VSY A;  1NA0 A;  3VTX A;  2LAH A;  3CHM A;  4A1G A;  3FU0 A;  3L17 A;  2GRL A;  4N2Q A;  4N39 A;  3CVY A;  4L1B A;  3BEE A;  3LVR E;  4PS3 A;  2DIW A;  4AV7 A;  1E96 B;  3AU4 A;  3D9O A;  2WQ7 A;  3T8M A;  2YHE A;  3IBE A;  3MJW A;  3FTV A;  4GA0 A;  4K0R A;  3S7J A;  4GYW A;  5AIJ A;  4GPK A;  3G2U A;  4JZY A;  2VQ2 A;  2YHC A;  4DI4 A;  3L54 A;  3CVV A;  5T8I A;  2WB2 A;  4Y6C A;  4G24 A;  4JEH A;  5FJY A;  5HQ8 A;  2VSO E;  2OV8 A;  5G55 A;  5KCM A;  4IYP A;  3WXX A;  2XGM A;  3PEU B;  2MRI A;  1TEZ A;  3L6A A;  1PC2 A;  2NSZ A;  3AU5 A;  3HIZ A;  3ZHE A;  1GW6 A;  5EDS A;  3FU3 A;  4Q96 A;  4U63 A;  3ZYK A;  3CK7 A;  1U3D A;  3FY4 A;  4TV3 A;  2XQ0 A;  2RD0 A;  1UG3 A;  4EBA G;  2LSV A;  3JYS A;  3Q5M A;  2XEV A;  2J49 A;  2QY7 A;  3CVN A;  3RJV A;  1OWP A;  1LF8 A;  2CHW A;  3I4R B;  3RO3 A;  1HO8 A;  4JEU A;  4XI0 A;  2ION A;  2KZT B;  2GRM A;  2PL2 A;  2WMN A;  2KCV A;  3PVL A;  3CHS A;  2WQ6 A;  5EX3 A;  5AJL A;  3ZRH A;  4BTA A;  3O4Z A;  3EHM A;  1HX8 A;  3CR3 A;  3LPZ A;  3R9A B;  1H19 A;  4H7X A;  4Q69 A;  3PEV B;  5BW8 C;  4FC8 A;  3ZPJ A;  3MV3 B;  3QWW A;  4GML A;  4GZ5 A;  2C2L A;  2VSN A;  2BTD A;  4WND A;  3VLD A;  2AXU A;  2CG3 A;  2KCK A;  2OVB A;  4DI3 A;  4G1T A;  4B8C B;  3FU5 A;  4GCN A;  4J8S A;  2XPI A;  1EYH A;  5FZQ A;  3NF1 A;  4I2W A;  5M72 A;  3FH8 A;  4ANW A;  4ANV A;  4WWO A;  4AJW A;  4I43 A;  4HS2 A;  2FUL A;  4FU3 A;  4DJA A;  3CQG B;  3TXM A;  1KT0 A;  2UY1 B;  3SZ7 A;  2C0L A;  4ATG A;  4XKC A;  5CMY A;  2AWI A;  1UJJ A;  2X38 A;  4IUL A;  5LX8 A;  5FTP A;  1W3B A;  4WUY A;  2V8S E;  2X6K A;  4UI9 K;  3SNX A;  2AXZ A;  3UQ3 A;  1H2U A;  3CHP A;  3D9M A;  2PQN A;  1MQS A;  3BG1 B;  2UWJ G;  3EHN A;  5EKQ D;  4F3V A;  5G04 J;  3RKV A;  3FTW A;  5BV1 A;  4EBA A;  4NUR A;  1H0A A;  1KT1 A;  4OYS A;  4UWK A;  1TJF A;  4AM9 A;  4DPR A;  3OTN A;  4WNF A;  3QDN A;  2VGX A;  2WXQ A;  4ACK A;  4AEZ C;  3AS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...