2JABA

A designed ankyrin repeat protein evolved to picomolar affinity to her2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
124
structure length
124
Chain Sequence
SDLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGLTPLYLATAHGHLEIVEVLLKNGADVNAVDAIGFTPLHLAAFIGHLEIAEVLLKHGADVNAQDKFGKTAFDISIGNGNEDLAEILQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H10-2-G3
publication title A Designed Ankyrin Repeat Protein Evolved to Picomolar Affinity to Her2
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 41
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2jabA00
5BXUA 3W9FA 1IXVA 5BXOA 1N0QA 5CBNA 1MX6A 2ETCA 4O60A 2V5QC 3F6QA 5EILA 4J7WA 5HS0A 2RFAA 4LSZE 1BLXB 4JB8P 4A63B 3ZNGA 3NBNB 4HB5A 4BEPA 5HRYA 2F8YA 4LG6A 1OY3D 2Y1LE 1A5EA 4G8KA 1K1AA 3Q9UC 3AJIA 2J8SD 3W9GA 3LJNA 4C48B 3DEPA 4BESA 4DX6D 1G3NB 4RLYA 4B93B 4O1PA 4ZHBA 1BI7B 2F37A 3J5QB 2ETBA 2KXPC 3DEOA 2P2CP 3IXEA 5ENQD 2QYJA 5FIOA 3JUEA 2XEEA 5AARA 3NOGD 3HRAA 3UTMA 4YDWA 4CYMD 3TWRA 1DC2A 2QC9A 2NYJA 4DX2A 3V79K 2B0OE 3HG0D 5EYPF 1MJ0A 4HRLA 2BKGA 3EHRA 4YDYA 3B7BA 5KNGA 1QYMA 3D9HA 4QFVA 4U8VD 3JXIA 1K3ZD 2KBXA 2XZTG 5AN8A 3TWVA 3ZU7B 3EHQA 5FINA 5ENSD 4OAUC 3B95A 4ZFHA 2ZGGA 4DRXE 3KEAA 4Z68A 2XEHA 4ATZD 4DX1A 1YMPA 4BERA 5JA4D 4J8YA 3UXGA 3TWUA 1OT8A 3V30A 4HI8A 3J5PA 4HNAD 1MYOA 3UI2A 1TR4A 1YYHA 1BD8A 2DZOA 2DVWA 4NIKA 3SO8A 5KBAA 2DWZA 4GPMA 5EIDA 2DZNA 3TWWA 4HBDA 1YCSB 5EYLA 5ENPD 5ENTD 5AQ7A 1SVXA 2PNNA 4K5CA 5AQBA 3ZUVB 4BETA 3AAAC 2FO1E 4K5BA 5KNHD 3JXJA 5EIBE 3V2XA 4G8LA 4U95D 3T8KA 3V2OA 3TWXA 4QQIA 4HLLA 4U96D 4DX5D 4F1PA 5CEAA 4N5QA 2F8XK 1MX4A 4OAVB 4HRNA 4HRMB 2JABA 1IKND 3Q9NC 4K5AB 2RFMA 2Y0BG 5ENOD 5AQ9A 1N11A 5AQAA 3T9KA 5CECB 2ZGDA 1K1BA 3TWSA 4DX7D 2HE0A 3TWQA 1UOHA 4O1OA 3EU9A 2A5EA 3NOCD 3ZKJA 5AAOA 1S70B 5CEDB 5KWDA 1D9SA 2AJAA 1BI8B 2L6BA 1IHBA 5D66A 1DCQA 1SW6A 4BSZB 4U8YD 5HKPA 1WG0A 4DUIA 2XENA 2MYOA 3V31A 4UUCA 2XZDG 4TUMA 5EN5D 2ETAA 5ENRD 5CERB 1N0RA 4CZ2D 5CBOA 2VGEA 1WDYA 3TWTA 2V4HC 4HQDA 1MX2A 2BKKB 1NFIE 5ITZF 5JMND 4GMRA 3C5RA 4LNUD 1BU9A 1AWCB 1AP7A 4HI9A 4F6RD
chains in the Genus database with same CATH superfamily
1N0QA 2EILE 4IYPA 2EQXA 2R05A 2EINE 5T8IA 2Y3AA 1INZA 3SZ7A 4GYWA 1G3NB 1WY6A 3Q4AB 2I1JA 4RLYA 4HVBA 3ZPJA 3ZFWA 1HF8A 5FIOA 2FF4A 3IEGA 3EUVA 1N95A 4KVOA 2FEZA 3C98A 5KNGA 4U8VD 4FHJA 4CT4A 1Z3YA 1N52A 4GU5A 2IFUA 5ENSD 3RIBA 5C1DA 2VGXA 3VLFA 1KT0A 3Q73A 4DRXE 3CHQA 3ABKE 2MRIA 4PDXA 2XRZA 3UI2A 1OUVA 4KXKB 1JCSA 1ELKA 3FEXA 3ZUVB 3AAAC 2FO1E 4K5BA 1UN8A 4QQIA 4HLLA 2XRYA 4J8DA 2R17C 2M63A 3U66A 5D0QD 3TWSA 5FZSA 1JPLA 4I9EA 3L6AA 3PREA 2PM6A 3QNKA 2PQNA 3FULA 3RO2A 3QKYA 4EZJA 4JPSA 3ZYLA 3D9PA 3NZUA 1QZ2A 4KZ0A 1IQUA 3JCKC 3CGHA 3PE3A 3QK0A 1QBQA 2XEEA 1NI1A 3NOGD 5JHAA 5BV0A 3S7FA 4FP7A 2KATA 4JXTA 2V5FA 4MRUA 3FEYA 2NXPA 2IO2C 4UWLA 3QWVA 2JEKA 3KAEA 3SY2A 4EZKA 1HFAA 3DBSA 4J8YA 3TWUA 3J5PA 3UMVA 3UT4A 2WXJA 2IONA 3S7DA 4DLQA 2RKKA 3MCXA 5B1AE 2IEJA 3O4ZA 4U95D 4V3IA 3HDXA 4N5QA 1S0PA 4EECA 5AQ9A 2FO7A 1K1BA 2HE0A 4PUCA 4KT6B 2AWIA 2CHZA 2WMNA 2GRRB 3TXNA 1JWGA 2L6BA 5D66A 4CGVA 3R7RA 5CMWA 5KJKA 4M3OA 4I1OB 5ITZF 4GMRA 3C5RA 3C3RA 3BUAA 4LSZE 2HO1A 4UWKA 1NA0A 4BEPA 3SBTB 1K8KG 4UQXA 2YHEA 3Q75A 4NQ0A 3SFXA 1H6KA 4CCAA 3FFLA 4U8HA 3IXEA 5ENQD 5ARFA 4TV3A 2QYUA 4I6JA 4G26A 5JHBA 2B0OE 3DSSA 4HRLA 3IHVA 1ELRA 4A3VA 1QYMA 4QFVA 5FZRA 3LYAA 3AG1E 4TRQA 3ESLA 4LCTA 3CK8A 2P9PG 4J8SA 3ULYA 2I6HA 5BUZA 3EU5A 3APCA 4FU3A 1Z3XA 2H6HA 4XKCA 4JW1A 3Q47B 3PZ1A 3HIZA 3Q5MA 2J4DA 4DX5D 5CEAA 3ONKA 1OCRE 2AXZA 4AVXA 2J07A 1EPUA 1SA5A 4CDNA 4BTAA 3TGOA 3NB2A 3Q7AA 4GA1A 1Z5SC 2L0IA 3C72A 2PL2A 3UPVA 1TN6A 4XI9A 1FPPA 2X6IA 4U8YD 3C3OA 3FH5A 3RKVA 4ILIA 5G55A 1N4SA 3G2UA 1H2TC 1OCCE 4TUMA 5EN5D 3LY7A 1WDYA 5DBKA 1U3DA 1NFIE 3Q79A 5BXUA 4WAFA 2CG2A 1MQSA 4APOA 1SA4A 2XCBA 1YA0A 1H2VC 4G2VA 3PS6A 3LXUX 3ZEFA 4FADA 2LAIA 2WVIA 4ANUA 3ML9A 3FUNA 3PEVB 2XGMA 3ZN3A 3GYZA 2ZU6B 2VYIA 4GZ6A 4YDOA 2PQRA 2GRNB 1TN7A 4I2ZA 3I4GA 1TNZA 3I5PA 1H0AA 3CHRA 1JCRA 3ZIMA 5JA4D 1HH8A 4FULA 4ANXA 3BU8A 4HBDA 4CRWA 4GCOA 1E96B 3D9MA 4A55A 3JQ0A 1FVFA 4HXIA 3HXCA 3ASDA 4K5AB 2X6JA 4A1GA 3ZHEB 5CRUA 2EIKE 2CFUA 2WQ6A 5CEDB 1IHBA 2VSNA 4B0ZA 3G2TA 4U04A 3EHMA 2LNIA 5HI7A 1O5MA 4DUIA 3CHPA 2J08A 1FVHA 1UG3A 5LOZA 3LJ3A 4YNDA 2BKKB 2OOEA 3U4TA 1TJFA 1UJJA 3W9FA 1N54A 1HG5A 5HS0A 2IO3C 2WQHA 4U0SA 1EYHA 5C2YA 3L13A 3FTUA 3J5QB 2P2CP 5EX0A 1TYQG 4RSYA 3LDZA 4N5CA 4TXRA 3V79K 2VSYA 2WXMA 4N3AA 3RRUA 2YQ8A 5LCWJ 2ZGGA 1KLXA 4ATZD 3SQVA 2XS1A 4WNFA 3OAWA 5G05J 4EQFA 1D8DA 3CEQA 1S63A 3Q49B 5AQBA 5FJYA 3QJZA 3V2OA 3KEZA 3PUJA 1N11A 2ZGDA 3MGBA 4NACA 2LXLA 5AAOA 3QARA 2C0LA 3CVUA 4AP2A 1HE8A 2Q7FA 2VGYA 3URZA 1W3BA 3PZ2A 4L2LA 4HORA 3B7SA 3D9NA 2V4HC 4N3BA 4EHMA 1TN8A 1WAO1 3AG2E 4F6RD 4N2QA 1ZBPA 4DPRA 3PDNA 2OVBA 3CKBA 2GRLA 2A4ZA 3FUJA 4L2YA 2VSOE 5AARA 3DSTA 5CHEE 4FJZA 2VJ8A 2KBXA 4PS8A 3FTZA 3ASGA 3D9LA 5FINA 2GRQB 3QAQA 4HOTA 3E4BA 5A23A 4Z68A 4LUNU 5G04J 4HI8A 2DCPA 4NURA 5FWQA 1TR4A 4U07A 4C0EA 2Y69E 4GTSA 2ILRA 4GPMA 2P9LG 3SI5A 1WM5A 4XE0A 1UW4B 5T4YA 2AXUA 3FU0A 3AU4A 4FLBA 4GTOA 3QDNA 2P9SG 2WXOA 3UIPC 1V55E 4OAVB 3QWWA 1O1TA 2UY1B 5CECB 4ACLA 1S64A 1LD7A 4KBQA 2OCCE 2R02A 2QFCA 5J08A 3B7TA 4DI4A 1OWNA 2V4LA 3FH8A 5BT1A 1HXIA 5HKPA 1N9AA 3MJWA 3QOUA 2XGOA 2WXPA 4JC8A 2C0MA 4IN3B 5A6CA 2FBNA 4GMJA 4TUUA 1ZU2A 5A7DB 3AG3E 1AWCB 3EDTB 1X81A 2GRMA 3FU3A 3NAWA 3R9MA 2V5QC 4XX5A 1IHGA 3WG7E 4HB5A 3NQPA 1PY1A 1K1AA 3FUKA 3FY4A 3PZ4A 4IRUA 1IYGA 3AS5A 1B89A 2EIJE 2P9IG 3SGHA 4CGWA 5DIZA 5D2MC 2XQ0A 3UTMA 4I1MA 4E6HA 2WPVA 3TXMA 3HG0D 4J6IA 3K9IA 3ZHEA 3EHRA 4YDYA 1O1RA 2EIME 5J90A 4HLEA 4RG6A 2XZTG 3LS8A 3VTXA 3MKRA 3UT8A 3E33A 1A17A 4KZCA 4G24A 1OWPA 5EIDA 3L82A 2X6HA 2PNNA 4F3VA 1SZAA 1E8WA 5KNHD 3JXJA 2FULA 3TWXA 4U96D 3D9OA 4J8FA 2F8XK 4CDMA 4JZYA 2WXKA 5IY5E 2WXLA 5ENOD 2LSVA 3UUXA 4UWGA 2LSUA 4Y6WA 4JA7A 2L0TB 1UOHA 4CDRA 4JHKA 3OXLA 3RRNB 3MKQB 3CVLA 3E30A 4UI9J 3PVLA 2WMOA 3JQ1A 4AOFA 1N0RA 3CVYA 3ZYMA 1HO8A 1Y8MA 3TWTA 1MX2A 2R59A 5JMND 4N2SA 4HS2A 4GZ3A 4EZLA 1AP7A 3LVQE 4BX9A 3R9AB 3DPYA 2I1KA 4JB8P 2YNQA 2WM9A 3DSUA 1OY3D 1PAQA 4G11A 3VLDA 3AJIA 4B89A 1U2VG 2Y4TA 3UINC 3DSWA 4ZHBA 3FU6A 5ANLA 3DEOA 3T5XA 3FTSA 2GRPB 3BG0B 2WXGA 1TNBA 2QC9A 4IULA 5JJ6A 3U64A 1O1SA 4HOQA 1NP7A 3ABME 3ZRHA 4ANVA 2KCVA 4DLOA 4GZDA 2H6IA 3MV3B 2E0IA 1JUQA 4ATGA 3FUHA 4BT9A 3PH0C 3RO3A 4GTMA 1LF8A 3OXFA 2DZNA 5ENPD 5ENTD 1NA3A 4JHRA 4F1PA 1OXJA 4I1AA 3S7JA 1SQMA 5KCMA 3AG4E 3Q9NC 1PC2A 2BF0X 5LX8A 1DCEA 1QQEA 2AJAA 3CVVA 3ML8A 4C9BB 3PEUB 4CEMA 2ETAA 4XI0A 3CSTA 1HU3A 3UM3A 5JJ7A 3RAUA 4JL0A 3QC1A 2KC7A 3CR3A 2IQCA 2P9UG 3DPDA 4W9RA 3L22A 4AXHA 1MZCA 5HRYA 3RK6A 2J4BA 4R7LA 5E75A 1FT1A 3FUMA 2DYRE 5FQ6A 2HYZA 2KXPC 3MV2B 2UY1A 3PUKA 2GGFA 2OVFA 3CHOA 5FT9A 2HR2A 3JXIA 1VDYA 5KJLA 3B95A 4ZFHA 3KEAA 3ABLE 3U9WA 3X2QE 3QWPA 1TNYA 4YDEA 3SF4A 4NIKA 1OWLA 3MX3A 3DXMG 3IBEA 5EX3A 3EHNA 2VGXB 4Q94A 5EIBE 4KMOA 2WXNA 2GROB 2KM4A 4GYOA 2X6KA 5AENA 2UWJG 4KVMA 2KZTB 4RQIA 5AIJA 1XNFA 3CKCA 4F1SA 1WG0A 5FQ8A 4B8AA 3CHMA 3FTYA 5EKQD 4LRZA 3RU0A 1HZ4A 2X38A 4A3TA 4BX8A 5HQ8A 2IF4A 3B7UX 3CK9A 3S2AA 5BXOA 2RG8A 3FUIA 3LVRE 4A63B 3FTXA 2V8SE 4XIFA 3NBNB 4UWFA 2AXVA 3ZGQA 2KCKA 2LO6A 3DRAA 4GB9A 3MZLB 3VTYA 3Q15A 4HOUA 3ZVVA 4YDWA 3SFYA 3CVWA 3U3WA 5EYPF 4ACKA 2LXMA 4LERA 1K3ZD 5LCWC 4I43A 3MKQA 1P5QA 2XEHA 5ARGA 3LKUA 4M7CA 2V0PA 3T5VA 3BEEA 2BEDA 3HXBA 3CV0A 3V2XA 3UT7A 1LD8A 4URKA 4BFRA 2XPYA 4ABNA 3T8MA 3T9KA 1ZB1A 2H6GA 4ILHB 3KSLA 3VLEA 5CCMA 3TWQA 4EPZA 4MS6A 2YINA 4H7YA 4GMLA 1TNUA 3ISMC 4DI3A 5E76A 3PNTB 4ANWA 2XENA 1DVPA 2OEWA 3UKUG 4A1SA 3IHYA 4DJAA 4O6FA 3SBSA 2R5SA 3UM2A 2GW1A 4WNDA 4J7WA 3TJPA 3EJNA 3ZNGA 3W9GA 4C48B 3DEPA 1KZPA 2IOSA 2ETBA 4GCNA 2QY7A 3JUEA 4GTQA 3LY8A 4RVBA 4K0RA 3SD5A 4CYMD 3TG4A 1MJ0A 5AYWD 3ASHA 3E37A 1IQRA 2XGSA 4OAUC 3PRZA 5G04C 1BPOA 3DSVA 4CT0A 3S7BA 1BD8A 3CSFA 2DZOA 4GTRA 2DWZA 4FHKA 2F0YA 4BETA 2OV8A 3ASFA 4UQYA 3CHSA 4HRNA 1LTXA 1IKND 4UI9K 4DX7D 3D9IA 4JA9A 5FTPA 2A5UA 4YVOA 4BSZB 4L7TA 2VQ2A 4XZ4A 3LEWA 5CBOA 4J0UA 3CVNA 4HQDA 5AJDA 4Q96A 3BG1B 3ZW3A 1TNOA 3SNXA 2ETCA 1H6PA 3F6QA 3D3MA 3D9JA 5ANRA 2BTDA 5M72A 2F8YA 2Y1LE 2XPIA 3UIOC 1N4PA 1QNFA 3LPZA 4O1PA 4BTBA 3L54A 4B94A 4JEUA 2XPZA 4FJYA 4GTVA 2WB2A 3SHFA 1N4QA 1X5BA 2LAHA 3TWRA 1U3CA 2NYJA 4GTTA 2KZTA 2CHWA 3UKRG 5CMYA 3SFZA 2WXRA 4JEHA 5AN8A 3TWVA 1XGWA 5H7PA 3E32A 3UM1A 2QZAA 4DX1A 3FHEA 4BERA 3FU5A 2PZIA 1GW6A 1E8YA 1YYHA 3RJVA 2FI7A 2B6CA 1D8EA 4I6EA 3ULQA 2IU1A 3TWWA 3TL5A 1UN9A 3UM0A 3PZDA 1MHQA 3PE4A 1Y6IA 3GZ1A 2IY0C 3CQGB 3HXFA 5AQAA 4XEIG 3I3NA 3EU9A 2A5EA 5KWDA 3ZKJA 1S70B 1BI8B 3MA5A 4LEUA 4UI9C 3APDA 1L5JA 1FT2A 3V31A 2XZDG 4MBGA 3DWLG 2R2LA 2PM7A 5CERB 4JD2G 2L6JA 2C2LA 2VSXE 4OVVA 1BU9A 1IXVA 3ONLA 5CBNA 1MX6A 3IKOB 4O60A 4GYYA 5EILA 4BWRA 3G2VA 3B7RL 5BW8C 3FWVA 4Q69A 4LG6A 3CK7A 4GAAA 4U7EB 3D9KA 3G2SA 3AS8A 5KJMA 2WXQA 4DX6D 3CVXA 4B93B 2OEVA 4NRHB 1FCHA 3LY9A 1HS6A 4OVUA 1JCQA 3HXDA 1DC2A 1H6OA 3Q7FA 2YHCA 4TXPA 4FC8A 2CFZA 4MLPA 5EDSA 4G25A 5G2NA 3FTWA 1YMPA 1HX8A 4DK5A 1KPSB 5AJLA 3LCAA 4BSXA 1DNPA 3HVEB 5AQ7A 1OWMA 2DBAA 4AM9A 3RRMB 4AJWA 4PS3A 3B13A 4WUYA 3GZSA 2JABA 4FLHA 4UQZA 3OTNA 3HHMA 3ULEG 2XS8A 4O1OA 3NOCD 5BNWA 1D9SA 4FA6A 4PH4B 3APFA 4L1BA 2CG3A 2J09A 5CCLA 3HYMB 4N39A 2VTBB 4WWOA 2MYOA 4U0ZA 4ILGA 2H6FA 5LP0A 4X8QA 4CZ2D 4B8CB 3JYSA 4GZCA 4GTPA 4LNUD 4BT8A 3C3QA 3R7QA 4WWNA 3HXEA 4OYSA 5T3RA 2IOLA 1BLXB 2J8SD 4GZ5A 2AVPA 4AY5A 1OWOA 1BI7B 1NL4A 4TXQA 4AIFA 4GA2A 3CVQA 4PS7A 2MOWA 2JLBA 2E2EA 2P9NG 4EBAA 4KYOB 4L23A 3B7BA 1ELWA 2MHKA 4D10C 5D0OD 4AEZC 3UQ3A 1RZ4A 4UWHA 2CHXA 3G2WA 4APFA 2DVWA 3SO8A 5EYLA 4ME2A 4YVQC 4E85A 2X3MA 4N3CA 4C0MA 2P58C 4HRMB 2Y0BG 3CLJA 3ESKA 2ZXWE 4I17A 3KSQA 1HG2A 4G23A 5B1BE 5ENNA 5KJNA 4I2WA 2LUHA 4UUCA 1NZNA 3RSEG 5ENRD 2XCCA 3MEKA 1TEZA 4RG9A 2KCLA 3CIAA 2I2OA 3L16A 4HI9A 4H7XA 3CQCB 2RFAA 4F53A 4J8EA 3OXGA 3FP3A 1A5EA 4G8KA 4WNEA 3Q9UC 3LJNA 4GA0A 3QB2A 1E90A 2BUGA 2F37A 1E8ZA 3E34A 3FUFA 2NC9A 1E7UA 3P1UA 3FH7A 1N4RA 5JJTA 3L08A 4GPKA 2WXHA 3D9HA 4HFGA 3ASNE 3ZYQA 3ZU7B 2WQ7A 4F7AA 4HOSA 3DSXA 2XEVA 3UXGA 1OT8A 3V30A 1MYOA 2WXFA 2XHEA 5KBAA 3I4RB 3Q78A 2L9BA 4U0UA 1YCSB 3GW4A 2Y4UA 1SVXA 4K5CA 2I9CA 4G1TA 3T8KA 4Y6CA 3PZ3A 1V54E 3WXXA 2J9QA 2RFMA 5G05C 2X6FA 4AY6A 1N94A 4L9PA 3L17A 2IJGX 1DCQA 1SW6A 3L9TA 3GZ2A 4U63A 3KS2A 2ZISA 4I6GA 2VGEA 1OCZE 4BY6A 2RD0A 1JWFA 3ASOE 1TJCA 1EDUA 3NF1A 4BESA 3HVEA 3ENEA 5FQ4A 2J49A 3ZXPA 3BQOA 5LFAA 3UX4A 5CRVA 1H2UA 2QYJA 3JUIA 1KZOA 4MKTA 3MYVA 3HRAA 5BPPA 3KD7A 3EIJA 4DX2A 5BV1A 2BKGA 4JVSA 3IV0A 4XKBA 3AS4A 3DXKG 3EHQA 3CVPA 4I9CA 5B3SE 2ZIRA 2VTBA 2DYSE 3P2BA 5FZQA 1Z6TA 3NZSA 4HNAD 3N71A 3FDHA 1OCOE 3FUDA 1E8XA 2P9KG 3O48A 3TAXA 2NSZA 1KT1A 1Q2ZA 3ZYKA 4G8LA 4LNBA 4K03A 3AU5A 1MX4A 3PNLB 3TG5A 1EF1C 2HM8A 5FQ7A 4P29A 2R03A 4AV7A 1SZ9A 4JHJA 2ONDA 2DIWA 3FTVA 3EIQC 1UJKA 1E7VA 4LNGA 3FUEA 1RW2A 1H19A 4WWPA 3ZXSA 4EBAG 2AW6A 2WXIA 4WNGA
chains in the Genus database with same CATH topology
5BXUA 3W9FA 1IXVA 5BXOA 1N0QA 5CBNA 1MX6A 2ETCA 4O60A 2V5QC 3F6QA 5EILA 4J7WA 5HS0A 2RFAA 4LSZE 1BLXB 4JB8P 4A63B 3ZNGA 3NBNB 4HB5A 4BEPA 5HRYA 2F8YA 4LG6A 1OY3D 2Y1LE 1A5EA 4G8KA 1K1AA 3Q9UC 3AJIA 2J8SD 3W9GA 3LJNA 4C48B 3DEPA 4BESA 4DX6D 1G3NB 4RLYA 4B93B 4O1PA 4ZHBA 1BI7B 2F37A 3J5QB 2ETBA 2KXPC 3DEOA 2P2CP 3IXEA 5ENQD 2QYJA 5FIOA 3JUEA 2XEEA 5AARA 3NOGD 3HRAA 3UTMA 4YDWA 4CYMD 3TWRA 1DC2A 2QC9A 2NYJA 4DX2A 3V79K 2B0OE 3HG0D 5EYPF 1MJ0A 4HRLA 2BKGA 3EHRA 4YDYA 3B7BA 5KNGA 1QYMA 3D9HA 4QFVA 4U8VD 3JXIA 1K3ZD 2KBXA 2XZTG 5AN8A 3TWVA 3ZU7B 3EHQA 5FINA 5ENSD 4OAUC 3B95A 4ZFHA 2ZGGA 4DRXE 3KEAA 4Z68A 2XEHA 4ATZD 4DX1A 1YMPA 4BERA 5JA4D 4J8YA 3UXGA 3TWUA 1OT8A 3V30A 4HI8A 3J5PA 4HNAD 1MYOA 3UI2A 1TR4A 1YYHA 1BD8A 2DZOA 2DVWA 4NIKA 3SO8A 5KBAA 2DWZA 4GPMA 5EIDA 2DZNA 3TWWA 4HBDA 1YCSB 5EYLA 5ENPD 5ENTD 5AQ7A 1SVXA 2PNNA 4K5CA 5AQBA 3ZUVB 4BETA 3AAAC 2FO1E 4K5BA 5KNHD 3JXJA 5EIBE 3V2XA 4G8LA 4U95D 3T8KA 3V2OA 3TWXA 4QQIA 4HLLA 4U96D 4DX5D 4F1PA 5CEAA 4N5QA 2F8XK 1MX4A 4OAVB 4HRNA 4HRMB 2JABA 1IKND 3Q9NC 4K5AB 2RFMA 2Y0BG 5ENOD 5AQ9A 1N11A 5AQAA 3T9KA 5CECB 2ZGDA 1K1BA 3TWSA 4DX7D 2HE0A 3TWQA 1UOHA 4O1OA 3EU9A 2A5EA 3NOCD 3ZKJA 5AAOA 1S70B 5CEDB 5KWDA 1D9SA 2AJAA 1BI8B 2L6BA 1IHBA 5D66A 1DCQA 1SW6A 4BSZB 4U8YD 5HKPA 1WG0A 4DUIA 2XENA 2MYOA 3V31A 4UUCA 2XZDG 4TUMA 5EN5D 2ETAA 5ENRD 5CERB 1N0RA 4CZ2D 5CBOA 2VGEA 1WDYA 3TWTA 2V4HC 4HQDA 1MX2A 2BKKB 1NFIE 5ITZF 5JMND 4GMRA 3C5RA 4LNUD 1BU9A 1AWCB 1AP7A 4HI9A 4F6RD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BXU A;  3W9F A;  1IXV A;  5BXO A;  1N0Q A;  5CBN A;  1MX6 A;  2ETC A;  4O60 A;  2V5Q C;  3F6Q A;  5EIL A;  4J7W A;  5HS0 A;  2RFA A;  4LSZ E;  1BLX B;  4JB8 P;  4A63 B;  3ZNG A;  3NBN B;  4HB5 A;  4BEP A;  5HRY A;  2F8Y A;  4LG6 A;  1OY3 D;  2Y1L E;  1A5E A;  4G8K A;  1K1A A;  3Q9U C;  3AJI A;  2J8S D;  3W9G A;  3LJN A;  4C48 B;  3DEP A;  4BES A;  4DX6 D;  1G3N B;  4RLY A;  4B93 B;  4O1P A;  4ZHB A;  1BI7 B;  2F37 A;  3J5Q B;  2ETB A;  2KXP C;  3DEO A;  2P2C P;  3IXE A;  5ENQ D;  2QYJ A;  5FIO A;  3JUE A;  2XEE A;  5AAR A;  3NOG D;  3HRA A;  3UTM A;  4YDW A;  4CYM D;  3TWR A;  1DC2 A;  2QC9 A;  2NYJ A;  4DX2 A;  3V79 K;  2B0O E;  3HG0 D;  5EYP F;  1MJ0 A;  4HRL A;  2BKG A;  3EHR A;  4YDY A;  3B7B A;  5KNG A;  1QYM A;  3D9H A;  4QFV A;  4U8V D;  3JXI A;  1K3Z D;  2KBX A;  2XZT G;  5AN8 A;  3TWV A;  3ZU7 B;  3EHQ A;  5FIN A;  5ENS D;  4OAU C;  3B95 A;  4ZFH A;  2ZGG A;  4DRX E;  3KEA A;  4Z68 A;  2XEH A;  4ATZ D;  4DX1 A;  1YMP A;  4BER A;  5JA4 D;  4J8Y A;  3UXG A;  3TWU A;  1OT8 A;  3V30 A;  4HI8 A;  3J5P A;  4HNA D;  1MYO A;  3UI2 A;  1TR4 A;  1YYH A;  1BD8 A;  2DZO A;  2DVW A;  4NIK A;  3SO8 A;  5KBA A;  2DWZ A;  4GPM A;  5EID A;  2DZN A;  3TWW A;  4HBD A;  1YCS B;  5EYL A;  5ENP D;  5ENT D;  5AQ7 A;  1SVX A;  2PNN A;  4K5C A;  5AQB A;  3ZUV B;  4BET A;  3AAA C;  2FO1 E;  4K5B A;  5KNH D;  3JXJ A;  5EIB E;  3V2X A;  4G8L A;  4U95 D;  3T8K A;  3V2O A;  3TWX A;  4QQI A;  4HLL A;  4U96 D;  4DX5 D;  4F1P A;  5CEA A;  4N5Q A;  2F8X K;  1MX4 A;  4OAV B;  4HRN A;  4HRM B;  2JAB A;  1IKN D;  3Q9N C;  4K5A B;  2RFM A;  2Y0B G;  5ENO D;  5AQ9 A;  1N11 A;  5AQA A;  3T9K A;  5CEC B;  2ZGD A;  1K1B A;  3TWS A;  4DX7 D;  2HE0 A;  3TWQ A;  1UOH A;  4O1O A;  3EU9 A;  2A5E A;  3NOC D;  3ZKJ A;  5AAO A;  1S70 B;  5CED B;  5KWD A;  1D9S A;  2AJA A;  1BI8 B;  2L6B A;  1IHB A;  5D66 A;  1DCQ A;  1SW6 A;  4BSZ B;  4U8Y D;  5HKP A;  1WG0 A;  4DUI A;  2XEN A;  2MYO A;  3V31 A;  4UUC A;  2XZD G;  4TUM A;  5EN5 D;  2ETA A;  5ENR D;  5CER B;  1N0R A;  4CZ2 D;  5CBO A;  2VGE A;  1WDY A;  3TWT A;  2V4H C;  4HQD A;  1MX2 A;  2BKK B;  1NFI E;  5ITZ F;  5JMN D;  4GMR A;  3C5R A;  4LNU D;  1BU9 A;  1AWC B;  1AP7 A;  4HI9 A;  4F6R D; 
#chains in the Genus database with same CATH topology
 1N0Q A;  2EIL E;  4IYP A;  2EQX A;  2R05 A;  2EIN E;  5T8I A;  2Y3A A;  1INZ A;  3SZ7 A;  4GYW A;  1G3N B;  1WY6 A;  3Q4A B;  2I1J A;  4RLY A;  4HVB A;  3ZPJ A;  3ZFW A;  1HF8 A;  5FIO A;  2FF4 A;  3IEG A;  3EUV A;  1N95 A;  4KVO A;  2FEZ A;  3C98 A;  5KNG A;  4U8V D;  4FHJ A;  4CT4 A;  1Z3Y A;  1N52 A;  4GU5 A;  2IFU A;  5ENS D;  3RIB A;  5C1D A;  2VGX A;  3VLF A;  1KT0 A;  3Q73 A;  4DRX E;  3CHQ A;  3ABK E;  2MRI A;  4PDX A;  2XRZ A;  3UI2 A;  1OUV A;  4KXK B;  1JCS A;  1ELK A;  3FEX A;  3ZUV B;  3AAA C;  2FO1 E;  4K5B A;  1UN8 A;  4QQI A;  4HLL A;  2XRY A;  4J8D A;  2R17 C;  2M63 A;  3U66 A;  5D0Q D;  3TWS A;  5FZS A;  1JPL A;  4I9E A;  3L6A A;  3PRE A;  2PM6 A;  3QNK A;  2PQN A;  3FUL A;  3RO2 A;  3QKY A;  4EZJ A;  4JPS A;  3ZYL A;  3D9P A;  3NZU A;  1QZ2 A;  4KZ0 A;  1IQU A;  3JCK C;  3CGH A;  3PE3 A;  3QK0 A;  1QBQ A;  2XEE A;  1NI1 A;  3NOG D;  5JHA A;  5BV0 A;  3S7F A;  4FP7 A;  2KAT A;  4JXT A;  2V5F A;  4MRU A;  3FEY A;  2NXP A;  2IO2 C;  4UWL A;  3QWV A;  2JEK A;  3KAE A;  3SY2 A;  4EZK A;  1HFA A;  3DBS A;  4J8Y A;  3TWU A;  3J5P A;  3UMV A;  3UT4 A;  2WXJ A;  2ION A;  3S7D A;  4DLQ A;  2RKK A;  3MCX A;  5B1A E;  2IEJ A;  3O4Z A;  4U95 D;  4V3I A;  3HDX A;  4N5Q A;  1S0P A;  4EEC A;  5AQ9 A;  2FO7 A;  1K1B A;  2HE0 A;  4PUC A;  4KT6 B;  2AWI A;  2CHZ A;  2WMN A;  2GRR B;  3TXN A;  1JWG A;  2L6B A;  5D66 A;  4CGV A;  3R7R A;  5CMW A;  5KJK A;  4M3O A;  4I1O B;  5ITZ F;  4GMR A;  3C5R A;  3C3R A;  3BUA A;  4LSZ E;  2HO1 A;  4UWK A;  1NA0 A;  4BEP A;  3SBT B;  1K8K G;  4UQX A;  2YHE A;  3Q75 A;  4NQ0 A;  3SFX A;  1H6K A;  4CCA A;  3FFL A;  4U8H A;  3IXE A;  5ENQ D;  5ARF A;  4TV3 A;  2QYU A;  4I6J A;  4G26 A;  5JHB A;  2B0O E;  3DSS A;  4HRL A;  3IHV A;  1ELR A;  4A3V A;  1QYM A;  4QFV A;  5FZR A;  3LYA A;  3AG1 E;  4TRQ A;  3ESL A;  4LCT A;  3CK8 A;  2P9P G;  4J8S A;  3ULY A;  2I6H A;  5BUZ A;  3EU5 A;  3APC A;  4FU3 A;  1Z3X A;  2H6H A;  4XKC A;  4JW1 A;  3Q47 B;  3PZ1 A;  3HIZ A;  3Q5M A;  2J4D A;  4DX5 D;  5CEA A;  3ONK A;  1OCR E;  2AXZ A;  4AVX A;  2J07 A;  1EPU A;  1SA5 A;  4CDN A;  4BTA A;  3TGO A;  3NB2 A;  3Q7A A;  4GA1 A;  1Z5S C;  2L0I A;  3C72 A;  2PL2 A;  3UPV A;  1TN6 A;  4XI9 A;  1FPP A;  2X6I A;  4U8Y D;  3C3O A;  3FH5 A;  3RKV A;  4ILI A;  5G55 A;  1N4S A;  3G2U A;  1H2T C;  1OCC E;  4TUM A;  5EN5 D;  3LY7 A;  1WDY A;  5DBK A;  1U3D A;  1NFI E;  3Q79 A;  5BXU A;  4WAF A;  2CG2 A;  1MQS A;  4APO A;  1SA4 A;  2XCB A;  1YA0 A;  1H2V C;  4G2V A;  3PS6 A;  3LXU X;  3ZEF A;  4FAD A;  2LAI A;  2WVI A;  4ANU A;  3ML9 A;  3FUN A;  3PEV B;  2XGM A;  3ZN3 A;  3GYZ A;  2ZU6 B;  2VYI A;  4GZ6 A;  4YDO A;  2PQR A;  2GRN B;  1TN7 A;  4I2Z A;  3I4G A;  1TNZ A;  3I5P A;  1H0A A;  3CHR A;  1JCR A;  3ZIM A;  5JA4 D;  1HH8 A;  4FUL A;  4ANX A;  3BU8 A;  4HBD A;  4CRW A;  4GCO A;  1E96 B;  3D9M A;  4A55 A;  3JQ0 A;  1FVF A;  4HXI A;  3HXC A;  3ASD A;  4K5A B;  2X6J A;  4A1G A;  3ZHE B;  5CRU A;  2EIK E;  2CFU A;  2WQ6 A;  5CED B;  1IHB A;  2VSN A;  4B0Z A;  3G2T A;  4U04 A;  3EHM A;  2LNI A;  5HI7 A;  1O5M A;  4DUI A;  3CHP A;  2J08 A;  1FVH A;  1UG3 A;  5LOZ A;  3LJ3 A;  4YND A;  2BKK B;  2OOE A;  3U4T A;  1TJF A;  1UJJ A;  3W9F A;  1N54 A;  1HG5 A;  5HS0 A;  2IO3 C;  2WQH A;  4U0S A;  1EYH A;  5C2Y A;  3L13 A;  3FTU A;  3J5Q B;  2P2C P;  5EX0 A;  1TYQ G;  4RSY A;  3LDZ A;  4N5C A;  4TXR A;  3V79 K;  2VSY A;  2WXM A;  4N3A A;  3RRU A;  2YQ8 A;  5LCW J;  2ZGG A;  1KLX A;  4ATZ D;  3SQV A;  2XS1 A;  4WNF A;  3OAW A;  5G05 J;  4EQF A;  1D8D A;  3CEQ A;  1S63 A;  3Q49 B;  5AQB A;  5FJY A;  3QJZ A;  3V2O A;  3KEZ A;  3PUJ A;  1N11 A;  2ZGD A;  3MGB A;  4NAC A;  2LXL A;  5AAO A;  3QAR A;  2C0L A;  3CVU A;  4AP2 A;  1HE8 A;  2Q7F A;  2VGY A;  3URZ A;  1W3B A;  3PZ2 A;  4L2L A;  4HOR A;  3B7S A;  3D9N A;  2V4H C;  4N3B A;  4EHM A;  1TN8 A;  1WAO 1;  3AG2 E;  4F6R D;  4N2Q A;  1ZBP A;  4DPR A;  3PDN A;  2OVB A;  3CKB A;  2GRL A;  2A4Z A;  3FUJ A;  4L2Y A;  2VSO E;  5AAR A;  3DST A;  5CHE E;  4FJZ A;  2VJ8 A;  2KBX A;  4PS8 A;  3FTZ A;  3ASG A;  3D9L A;  5FIN A;  2GRQ B;  3QAQ A;  4HOT A;  3E4B A;  5A23 A;  4Z68 A;  4LUN U;  5G04 J;  4HI8 A;  2DCP A;  4NUR A;  5FWQ A;  1TR4 A;  4U07 A;  4C0E A;  2Y69 E;  4GTS A;  2ILR A;  4GPM A;  2P9L G;  3SI5 A;  1WM5 A;  4XE0 A;  1UW4 B;  5T4Y A;  2AXU A;  3FU0 A;  3AU4 A;  4FLB A;  4GTO A;  3QDN A;  2P9S G;  2WXO A;  3UIP C;  1V55 E;  4OAV B;  3QWW A;  1O1T A;  2UY1 B;  5CEC B;  4ACL A;  1S64 A;  1LD7 A;  4KBQ A;  2OCC E;  2R02 A;  2QFC A;  5J08 A;  3B7T A;  4DI4 A;  1OWN A;  2V4L A;  3FH8 A;  5BT1 A;  1HXI A;  5HKP A;  1N9A A;  3MJW A;  3QOU A;  2XGO A;  2WXP A;  4JC8 A;  2C0M A;  4IN3 B;  5A6C A;  2FBN A;  4GMJ A;  4TUU A;  1ZU2 A;  5A7D B;  3AG3 E;  1AWC B;  3EDT B;  1X81 A;  2GRM A;  3FU3 A;  3NAW A;  3R9M A;  2V5Q C;  4XX5 A;  1IHG A;  3WG7 E;  4HB5 A;  3NQP A;  1PY1 A;  1K1A A;  3FUK A;  3FY4 A;  3PZ4 A;  4IRU A;  1IYG A;  3AS5 A;  1B89 A;  2EIJ E;  2P9I G;  3SGH A;  4CGW A;  5DIZ A;  5D2M C;  2XQ0 A;  3UTM A;  4I1M A;  4E6H A;  2WPV A;  3TXM A;  3HG0 D;  4J6I A;  3K9I A;  3ZHE A;  3EHR A;  4YDY A;  1O1R A;  2EIM E;  5J90 A;  4HLE A;  4RG6 A;  2XZT G;  3LS8 A;  3VTX A;  3MKR A;  3UT8 A;  3E33 A;  1A17 A;  4KZC A;  4G24 A;  1OWP A;  5EID A;  3L82 A;  2X6H A;  2PNN A;  4F3V A;  1SZA A;  1E8W A;  5KNH D;  3JXJ A;  2FUL A;  3TWX A;  4U96 D;  3D9O A;  4J8F A;  2F8X K;  4CDM A;  4JZY A;  2WXK A;  5IY5 E;  2WXL A;  5ENO D;  2LSV A;  3UUX A;  4UWG A;  2LSU A;  4Y6W A;  4JA7 A;  2L0T B;  1UOH A;  4CDR A;  4JHK A;  3OXL A;  3RRN B;  3MKQ B;  3CVL A;  3E30 A;  4UI9 J;  3PVL A;  2WMO A;  3JQ1 A;  4AOF A;  1N0R A;  3CVY A;  3ZYM A;  1HO8 A;  1Y8M A;  3TWT A;  1MX2 A;  2R59 A;  5JMN D;  4N2S A;  4HS2 A;  4GZ3 A;  4EZL A;  1AP7 A;  3LVQ E;  4BX9 A;  3R9A B;  3DPY A;  2I1K A;  4JB8 P;  2YNQ A;  2WM9 A;  3DSU A;  1OY3 D;  1PAQ A;  4G11 A;  3VLD A;  3AJI A;  4B89 A;  1U2V G;  2Y4T A;  3UIN C;  3DSW A;  4ZHB A;  3FU6 A;  5ANL A;  3DEO A;  3T5X A;  3FTS A;  2GRP B;  3BG0 B;  2WXG A;  1TNB A;  2QC9 A;  4IUL A;  5JJ6 A;  3U64 A;  1O1S A;  4HOQ A;  1NP7 A;  3ABM E;  3ZRH A;  4ANV A;  2KCV A;  4DLO A;  4GZD A;  2H6I A;  3MV3 B;  2E0I A;  1JUQ A;  4ATG A;  3FUH A;  4BT9 A;  3PH0 C;  3RO3 A;  4GTM A;  1LF8 A;  3OXF A;  2DZN A;  5ENP D;  5ENT D;  1NA3 A;  4JHR A;  4F1P A;  1OXJ A;  4I1A A;  3S7J A;  1SQM A;  5KCM A;  3AG4 E;  3Q9N C;  1PC2 A;  2BF0 X;  5LX8 A;  1DCE A;  1QQE A;  2AJA A;  3CVV A;  3ML8 A;  4C9B B;  3PEU B;  4CEM A;  2ETA A;  4XI0 A;  3CST A;  1HU3 A;  3UM3 A;  5JJ7 A;  3RAU A;  4JL0 A;  3QC1 A;  2KC7 A;  3CR3 A;  2IQC A;  2P9U G;  3DPD A;  4W9R A;  3L22 A;  4AXH A;  1MZC A;  5HRY A;  3RK6 A;  2J4B A;  4R7L A;  5E75 A;  1FT1 A;  3FUM A;  2DYR E;  5FQ6 A;  2HYZ A;  2KXP C;  3MV2 B;  2UY1 A;  3PUK A;  2GGF A;  2OVF A;  3CHO A;  5FT9 A;  2HR2 A;  3JXI A;  1VDY A;  5KJL A;  3B95 A;  4ZFH A;  3KEA A;  3ABL E;  3U9W A;  3X2Q E;  3QWP A;  1TNY A;  4YDE A;  3SF4 A;  4NIK A;  1OWL A;  3MX3 A;  3DXM G;  3IBE A;  5EX3 A;  3EHN A;  2VGX B;  4Q94 A;  5EIB E;  4KMO A;  2WXN A;  2GRO B;  2KM4 A;  4GYO A;  2X6K A;  5AEN A;  2UWJ G;  4KVM A;  2KZT B;  4RQI A;  5AIJ A;  1XNF A;  3CKC A;  4F1S A;  1WG0 A;  5FQ8 A;  4B8A A;  3CHM A;  3FTY A;  5EKQ D;  4LRZ A;  3RU0 A;  1HZ4 A;  2X38 A;  4A3T A;  4BX8 A;  5HQ8 A;  2IF4 A;  3B7U X;  3CK9 A;  3S2A A;  5BXO A;  2RG8 A;  3FUI A;  3LVR E;  4A63 B;  3FTX A;  2V8S E;  4XIF A;  3NBN B;  4UWF A;  2AXV A;  3ZGQ A;  2KCK A;  2LO6 A;  3DRA A;  4GB9 A;  3MZL B;  3VTY A;  3Q15 A;  4HOU A;  3ZVV A;  4YDW A;  3SFY A;  3CVW A;  3U3W A;  5EYP F;  4ACK A;  2LXM A;  4LER A;  1K3Z D;  5LCW C;  4I43 A;  3MKQ A;  1P5Q A;  2XEH A;  5ARG A;  3LKU A;  4M7C A;  2V0P A;  3T5V A;  3BEE A;  2BED A;  3HXB A;  3CV0 A;  3V2X A;  3UT7 A;  1LD8 A;  4URK A;  4BFR A;  2XPY A;  4ABN A;  3T8M A;  3T9K A;  1ZB1 A;  2H6G A;  4ILH B;  3KSL A;  3VLE A;  5CCM A;  3TWQ A;  4EPZ A;  4MS6 A;  2YIN A;  4H7Y A;  4GML A;  1TNU A;  3ISM C;  4DI3 A;  5E76 A;  3PNT B;  4ANW A;  2XEN A;  1DVP A;  2OEW A;  3UKU G;  4A1S A;  3IHY A;  4DJA A;  4O6F A;  3SBS A;  2R5S A;  3UM2 A;  2GW1 A;  4WND A;  4J7W A;  3TJP A;  3EJN A;  3ZNG A;  3W9G A;  4C48 B;  3DEP A;  1KZP A;  2IOS A;  2ETB A;  4GCN A;  2QY7 A;  3JUE A;  4GTQ A;  3LY8 A;  4RVB A;  4K0R A;  3SD5 A;  4CYM D;  3TG4 A;  1MJ0 A;  5AYW D;  3ASH A;  3E37 A;  1IQR A;  2XGS A;  4OAU C;  3PRZ A;  5G04 C;  1BPO A;  3DSV A;  4CT0 A;  3S7B A;  1BD8 A;  3CSF A;  2DZO A;  4GTR A;  2DWZ A;  4FHK A;  2F0Y A;  4BET A;  2OV8 A;  3ASF A;  4UQY A;  3CHS A;  4HRN A;  1LTX A;  1IKN D;  4UI9 K;  4DX7 D;  3D9I A;  4JA9 A;  5FTP A;  2A5U A;  4YVO A;  4BSZ B;  4L7T A;  2VQ2 A;  4XZ4 A;  3LEW A;  5CBO A;  4J0U A;  3CVN A;  4HQD A;  5AJD A;  4Q96 A;  3BG1 B;  3ZW3 A;  1TNO A;  3SNX A;  2ETC A;  1H6P A;  3F6Q A;  3D3M A;  3D9J A;  5ANR A;  2BTD A;  5M72 A;  2F8Y A;  2Y1L E;  2XPI A;  3UIO C;  1N4P A;  1QNF A;  3LPZ A;  4O1P A;  4BTB A;  3L54 A;  4B94 A;  4JEU A;  2XPZ A;  4FJY A;  4GTV A;  2WB2 A;  3SHF A;  1N4Q A;  1X5B A;  2LAH A;  3TWR A;  1U3C A;  2NYJ A;  4GTT A;  2KZT A;  2CHW A;  3UKR G;  5CMY A;  3SFZ A;  2WXR A;  4JEH A;  5AN8 A;  3TWV A;  1XGW A;  5H7P A;  3E32 A;  3UM1 A;  2QZA A;  4DX1 A;  3FHE A;  4BER A;  3FU5 A;  2PZI A;  1GW6 A;  1E8Y A;  1YYH A;  3RJV A;  2FI7 A;  2B6C A;  1D8E A;  4I6E A;  3ULQ A;  2IU1 A;  3TWW A;  3TL5 A;  1UN9 A;  3UM0 A;  3PZD A;  1MHQ A;  3PE4 A;  1Y6I A;  3GZ1 A;  2IY0 C;  3CQG B;  3HXF A;  5AQA A;  4XEI G;  3I3N A;  3EU9 A;  2A5E A;  5KWD A;  3ZKJ A;  1S70 B;  1BI8 B;  3MA5 A;  4LEU A;  4UI9 C;  3APD A;  1L5J A;  1FT2 A;  3V31 A;  2XZD G;  4MBG A;  3DWL G;  2R2L A;  2PM7 A;  5CER B;  4JD2 G;  2L6J A;  2C2L A;  2VSX E;  4OVV A;  1BU9 A;  1IXV A;  3ONL A;  5CBN A;  1MX6 A;  3IKO B;  4O60 A;  4GYY A;  5EIL A;  4BWR A;  3G2V A;  3B7R L;  5BW8 C;  3FWV A;  4Q69 A;  4LG6 A;  3CK7 A;  4GAA A;  4U7E B;  3D9K A;  3G2S A;  3AS8 A;  5KJM A;  2WXQ A;  4DX6 D;  3CVX A;  4B93 B;  2OEV A;  4NRH B;  1FCH A;  3LY9 A;  1HS6 A;  4OVU A;  1JCQ A;  3HXD A;  1DC2 A;  1H6O A;  3Q7F A;  2YHC A;  4TXP A;  4FC8 A;  2CFZ A;  4MLP A;  5EDS A;  4G25 A;  5G2N A;  3FTW A;  1YMP A;  1HX8 A;  4DK5 A;  1KPS B;  5AJL A;  3LCA A;  4BSX A;  1DNP A;  3HVE B;  5AQ7 A;  1OWM A;  2DBA A;  4AM9 A;  3RRM B;  4AJW A;  4PS3 A;  3B13 A;  4WUY A;  3GZS A;  2JAB A;  4FLH A;  4UQZ A;  3OTN A;  3HHM A;  3ULE G;  2XS8 A;  4O1O A;  3NOC D;  5BNW A;  1D9S A;  4FA6 A;  4PH4 B;  3APF A;  4L1B A;  2CG3 A;  2J09 A;  5CCL A;  3HYM B;  4N39 A;  2VTB B;  4WWO A;  2MYO A;  4U0Z A;  4ILG A;  2H6F A;  5LP0 A;  4X8Q A;  4CZ2 D;  4B8C B;  3JYS A;  4GZC A;  4GTP A;  4LNU D;  4BT8 A;  3C3Q A;  3R7Q A;  4WWN A;  3HXE A;  4OYS A;  5T3R A;  2IOL A;  1BLX B;  2J8S D;  4GZ5 A;  2AVP A;  4AY5 A;  1OWO A;  1BI7 B;  1NL4 A;  4TXQ A;  4AIF A;  4GA2 A;  3CVQ A;  4PS7 A;  2MOW A;  2JLB A;  2E2E A;  2P9N G;  4EBA A;  4KYO B;  4L23 A;  3B7B A;  1ELW A;  2MHK A;  4D10 C;  5D0O D;  4AEZ C;  3UQ3 A;  1RZ4 A;  4UWH A;  2CHX A;  3G2W A;  4APF A;  2DVW A;  3SO8 A;  5EYL A;  4ME2 A;  4YVQ C;  4E85 A;  2X3M A;  4N3C A;  4C0M A;  2P58 C;  4HRM B;  2Y0B G;  3CLJ A;  3ESK A;  2ZXW E;  4I17 A;  3KSQ A;  1HG2 A;  4G23 A;  5B1B E;  5ENN A;  5KJN A;  4I2W A;  2LUH A;  4UUC A;  1NZN A;  3RSE G;  5ENR D;  2XCC A;  3MEK A;  1TEZ A;  4RG9 A;  2KCL A;  3CIA A;  2I2O A;  3L16 A;  4HI9 A;  4H7X A;  3CQC B;  2RFA A;  4F53 A;  4J8E A;  3OXG A;  3FP3 A;  1A5E A;  4G8K A;  4WNE A;  3Q9U C;  3LJN A;  4GA0 A;  3QB2 A;  1E90 A;  2BUG A;  2F37 A;  1E8Z A;  3E34 A;  3FUF A;  2NC9 A;  1E7U A;  3P1U A;  3FH7 A;  1N4R A;  5JJT A;  3L08 A;  4GPK A;  2WXH A;  3D9H A;  4HFG A;  3ASN E;  3ZYQ A;  3ZU7 B;  2WQ7 A;  4F7A A;  4HOS A;  3DSX A;  2XEV A;  3UXG A;  1OT8 A;  3V30 A;  1MYO A;  2WXF A;  2XHE A;  5KBA A;  3I4R B;  3Q78 A;  2L9B A;  4U0U A;  1YCS B;  3GW4 A;  2Y4U A;  1SVX A;  4K5C A;  2I9C A;  4G1T A;  3T8K A;  4Y6C A;  3PZ3 A;  1V54 E;  3WXX A;  2J9Q A;  2RFM A;  5G05 C;  2X6F A;  4AY6 A;  1N94 A;  4L9P A;  3L17 A;  2IJG X;  1DCQ A;  1SW6 A;  3L9T A;  3GZ2 A;  4U63 A;  3KS2 A;  2ZIS A;  4I6G A;  2VGE A;  1OCZ E;  4BY6 A;  2RD0 A;  1JWF A;  3ASO E;  1TJC A;  1EDU A;  3NF1 A;  4BES A;  3HVE A;  3ENE A;  5FQ4 A;  2J49 A;  3ZXP A;  3BQO A;  5LFA A;  3UX4 A;  5CRV A;  1H2U A;  2QYJ A;  3JUI A;  1KZO A;  4MKT A;  3MYV A;  3HRA A;  5BPP A;  3KD7 A;  3EIJ A;  4DX2 A;  5BV1 A;  2BKG A;  4JVS A;  3IV0 A;  4XKB A;  3AS4 A;  3DXK G;  3EHQ A;  3CVP A;  4I9C A;  5B3S E;  2ZIR A;  2VTB A;  2DYS E;  3P2B A;  5FZQ A;  1Z6T A;  3NZS A;  4HNA D;  3N71 A;  3FDH A;  1OCO E;  3FUD A;  1E8X A;  2P9K G;  3O48 A;  3TAX A;  2NSZ A;  1KT1 A;  1Q2Z A;  3ZYK A;  4G8L A;  4LNB A;  4K03 A;  3AU5 A;  1MX4 A;  3PNL B;  3TG5 A;  1EF1 C;  2HM8 A;  5FQ7 A;  4P29 A;  2R03 A;  4AV7 A;  1SZ9 A;  4JHJ A;  2OND A;  2DIW A;  3FTV A;  3EIQ C;  1UJK A;  1E7V A;  4LNG A;  3FUE A;  1RW2 A;  1H19 A;  4WWP A;  3ZXS A;  4EBA G;  2AW6 A;  2WXI A;  4WNG A; 
#chains in the Genus database with same CATH homology
 5BXU A;  3W9F A;  1IXV A;  5BXO A;  1N0Q A;  5CBN A;  1MX6 A;  2ETC A;  4O60 A;  2V5Q C;  3F6Q A;  5EIL A;  4J7W A;  5HS0 A;  2RFA A;  4LSZ E;  1BLX B;  4JB8 P;  4A63 B;  3ZNG A;  3NBN B;  4HB5 A;  4BEP A;  5HRY A;  2F8Y A;  4LG6 A;  1OY3 D;  2Y1L E;  1A5E A;  4G8K A;  1K1A A;  3Q9U C;  3AJI A;  2J8S D;  3W9G A;  3LJN A;  4C48 B;  3DEP A;  4BES A;  4DX6 D;  1G3N B;  4RLY A;  4B93 B;  4O1P A;  4ZHB A;  1BI7 B;  2F37 A;  3J5Q B;  2ETB A;  2KXP C;  3DEO A;  2P2C P;  3IXE A;  5ENQ D;  2QYJ A;  5FIO A;  3JUE A;  2XEE A;  5AAR A;  3NOG D;  3HRA A;  3UTM A;  4YDW A;  4CYM D;  3TWR A;  1DC2 A;  2QC9 A;  2NYJ A;  4DX2 A;  3V79 K;  2B0O E;  3HG0 D;  5EYP F;  1MJ0 A;  4HRL A;  2BKG A;  3EHR A;  4YDY A;  3B7B A;  5KNG A;  1QYM A;  3D9H A;  4QFV A;  4U8V D;  3JXI A;  1K3Z D;  2KBX A;  2XZT G;  5AN8 A;  3TWV A;  3ZU7 B;  3EHQ A;  5FIN A;  5ENS D;  4OAU C;  3B95 A;  4ZFH A;  2ZGG A;  4DRX E;  3KEA A;  4Z68 A;  2XEH A;  4ATZ D;  4DX1 A;  1YMP A;  4BER A;  5JA4 D;  4J8Y A;  3UXG A;  3TWU A;  1OT8 A;  3V30 A;  4HI8 A;  3J5P A;  4HNA D;  1MYO A;  3UI2 A;  1TR4 A;  1YYH A;  1BD8 A;  2DZO A;  2DVW A;  4NIK A;  3SO8 A;  5KBA A;  2DWZ A;  4GPM A;  5EID A;  2DZN A;  3TWW A;  4HBD A;  1YCS B;  5EYL A;  5ENP D;  5ENT D;  5AQ7 A;  1SVX A;  2PNN A;  4K5C A;  5AQB A;  3ZUV B;  4BET A;  3AAA C;  2FO1 E;  4K5B A;  5KNH D;  3JXJ A;  5EIB E;  3V2X A;  4G8L A;  4U95 D;  3T8K A;  3V2O A;  3TWX A;  4QQI A;  4HLL A;  4U96 D;  4DX5 D;  4F1P A;  5CEA A;  4N5Q A;  2F8X K;  1MX4 A;  4OAV B;  4HRN A;  4HRM B;  2JAB A;  1IKN D;  3Q9N C;  4K5A B;  2RFM A;  2Y0B G;  5ENO D;  5AQ9 A;  1N11 A;  5AQA A;  3T9K A;  5CEC B;  2ZGD A;  1K1B A;  3TWS A;  4DX7 D;  2HE0 A;  3TWQ A;  1UOH A;  4O1O A;  3EU9 A;  2A5E A;  3NOC D;  3ZKJ A;  5AAO A;  1S70 B;  5CED B;  5KWD A;  1D9S A;  2AJA A;  1BI8 B;  2L6B A;  1IHB A;  5D66 A;  1DCQ A;  1SW6 A;  4BSZ B;  4U8Y D;  5HKP A;  1WG0 A;  4DUI A;  2XEN A;  2MYO A;  3V31 A;  4UUC A;  2XZD G;  4TUM A;  5EN5 D;  2ETA A;  5ENR D;  5CER B;  1N0R A;  4CZ2 D;  5CBO A;  2VGE A;  1WDY A;  3TWT A;  2V4H C;  4HQD A;  1MX2 A;  2BKK B;  1NFI E;  5ITZ F;  5JMN D;  4GMR A;  3C5R A;  4LNU D;  1BU9 A;  1AWC B;  1AP7 A;  4HI9 A;  4F6R D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...