2JABA

A designed ankyrin repeat protein evolved to picomolar affinity to her2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
124
structure length
124
Chain Sequence
SDLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGLTPLYLATAHGHLEIVEVLLKNGADVNAVDAIGFTPLHLAAFIGHLEIAEVLLKHGADVNAQDKFGKTAFDISIGNGNEDLAEILQKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords H10-2-G3
publication title A Designed Ankyrin Repeat Protein Evolved to Picomolar Affinity to Her2
pubmed doi rcsb
source organism Synthetic construct
total genus 41
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2jabA00
3EU9A 3T8KA 5EYPF 4GPMA 2BKGA 3JXIA 3TWXA 3TWUA 4B93B 1TR4A 4HRLA 5HRYA 2XZDG 4YDWA 4F1PA 3AJIA 4JB8P 3AAAC 4U8VD 4ZFHA 4O1OA 1BD8A 4F6RD 4U8YD 1MYOA 5ENPD 1BU9A 3LJNA 5ENSD 5ITZF 2QYJA 4A63B 2L6BA 1MX2A 2V4HC 4QQIA 4UUCA 3JUEA 4GMRA 2QC9A 4LNUD 3B95A 5BXUA 5FIOA 3KEAA 5HKPA 1N0QA 1DC2A 5EIBE 2HE0A 2FO1E 3JXJA 1WDYA 4HLLA 2PNNA 4LG6A 5JMND 5KBAA 1SW6A 5AAOA 5KWDA 2V5QC 4HBDA 4J8YA 1AWCB 2A5EA 2DVWA 2J8SD 2VGEA 5EN5D 2AJAA 1QYMA 5HS0A 1N0RA 4HI9A 2B0OE 3ZNGA 2ZGGA 4DX7D 2JABA 3NBNB 3UXGA 5JA4D 1N11A 1IXVA 2KXPC 3EHQA 4BESA 5ENTD 4OAUC 4U96D 2F8XK 5ENRD 4DX6D 5CBNA 1NFIE 1K3ZD 1D9SA 3NOGD 5ENQD 4HRNA 3V30A 2XEEA 4HQDA 3T9KA 3TWRA 1BLXB 3TWQA 5CEDB 2RFMA 2XZTG 4CYMD 2XEHA 4O60A 5EILA 3HRAA 1AP7A 2DWZA 1OY3D 5FINA 3W9GA 1BI7B 5D66A 4RLYA 3Q9UC 5AARA 1YMPA 4N5QA 1G3NB 4BSZB 4K5BA 5AQBA 3V31A 2ETBA 3ZU7B 4Z68A 5CECB 3ZKJA 1MX6A 2ETAA 2F37A 1K1BA 2F8YA 5AQ7A 1A5EA 4BEPA 5AQAA 1WG0A 4DX1A 3V79K 4OAVB 3TWSA 3D9HA 5ENOD 4G8KA 4BERA 4DRXE 4K5CA 3W9FA 4HB5A 3UI2A 3HG0D 1IKND 5AQ9A 2NYJA 4C48B 3V2XA 3ZUVB 1IHBA 4ATZD 3DEPA 2P2CP 5KNGA 2ETCA 4NIKA 4QFVA 1OT8A 2Y1LE 3B7BA 4DX5D 5CBOA 3DEOA 2KBXA 1DCQA 1S70B 2MYOA 3TWVA 4HRMB 3SO8A 5EYLA 3UTMA 4U95D 5CEAA 3TWWA 3EHRA 1K1AA 2BKKB 4O1PA 4YDYA 2Y0BG 2RFAA 4CZ2D 5BXOA 1MX4A 1SVXA 4HI8A 4J7WA 2ZGDA 3F6QA 3J5QB 5KNHD 1YYHA 2DZNA 1UOHA 4LSZE 1MJ0A 4DX2A 4ZHBA 4K5AB 1YCSB 4TUMA 4DUIA 5CERB 1BI8B 2XENA 3V2OA 3C5RA 3IXEA 3J5PA 4G8LA 5EIDA 5AN8A 4BETA 3NOCD 3Q9NC 2DZOA 3TWTA 4HNAD
chains in the Genus database with same CATH superfamily
2YINA 3ML9A 2WXNA 3C3QA 4YDWA 3AJIA 4WWOA 1KZOA 3E37A 1W3BA 4FLBA 1BU9A 3LJNA 1MX2A 2CHWA 3R7QA 4OYSA 1S63A 5KBAA 5ANRA 2EIME 2J09A 2VGXA 2J49A 2B0OE 3KS2A 2KXPC 3CVYA 2F8XK 5ENRD 1KZPA 5ENQD 4HQDA 5D0QD 4DPRA 1QZ2A 4EHMA 1TJFA 1OY3D 5BW8C 1BI7B 3Q49B 4FU3A 4ILHB 3EHNA 1S64A 3MYVA 3KAEA 2UY1B 3CLJA 3PZ1A 2J08A 3U66A 1Z6TA 1ELKA 4JHJA 2IF4A 3G2UA 5A6CA 5BNWA 4J8DA 5BXOA 5CCMA 4PDXA 5CHEE 4ANUA 1JCRA 4DX2A 3ABKE 4ACKA 4TUMA 5CERB 3LCAA 2XENA 3V2OA 4GTOA 3APFA 4G8LA 2XPIA 4UQYA 5AN8A 3Q9NC 5CRVA 4V3IA 4B8AA 4L9PA 2P9PG 3SHFA 2PM7A 1HZ4A 4MLPA 4GAAA 4PS8A 4F1SA 4HOTA 3CHQA 5ENPD 4I6JA 3FUMA 2I2OA 4A63B 4JC8A 4GTPA 2XPYA 5FIOA 3HXBA 1E8XA 4UQXA 2PNNA 1NP7A 4LRZA 2Y3AA 5JJTA 4HORA 1JWFA 3CSFA 3NF1A 3UKUG 2R59A 3MV2B 4CGWA 3D9PA 2ZISA 5LOZA 4LUNU 3UKRG 3X2QE 3UX4A 5A23A 3ZU7B 5JJ7A 2XPZA 4A3VA 1NI1A 1B89A 4I1MA 3FTXA 3L08A 4CRWA 1Y6IA 4UI9C 2J4DA 3JQ0A 3BG1B 5JJ6A 4KZCA 4QFVA 4JHKA 5KCMA 4GYOA 2UY1A 5FQ4A 3QB2A 2RFAA 1SZAA 4PS7A 4PS3A 2DZNA 4F53A 4XKBA 2I1JA 4FJYA 4G25A 2PM6A 3TWUA 5HRYA 5KJLA 2AW6A 3ASHA 5E76A 1HXIA 1SQMA 4UUCA 1OCRE 4L7TA 3IEGA 2FEZA 4UI9J 5EIBE 4TXRA 4LG6A 2XGSA 4WUYA 3AS8A 3ZXSA 3JYSA 2XS1A 5T8IA 4Q94A 3MCXA 2EINE 3QK0A 3NZSA 2EQXA 1NL4A 3SGHA 1Q2ZA 4KMOA 4E85A 3Q73A 3ZIMA 3CHRA 1BLXB 3RO3A 4C0EA 5FZSA 3SD5A 4IN3B 4J0UA 1YMPA 1G3NB 1PC2A 4Z68A 2P58C 1GW6A 3I3NA 1K1BA 3P2BA 5AQ7A 4JW1A 2P9SG 3D9HA 2C0MA 2V4LA 5G05C 3MKQA 2MRIA 1Z3XA 2FI7A 4B0ZA 2WXGA 2R02A 3EUVA 2KC7A 3HHMA 3AG3E 3RKVA 3F6QA 2QY7A 4AEZC 4KVOA 4ZHBA 1KLXA 4U0SA 1KPSB 2I1KA 3WG7E 2XRYA 2DCPA 4E6HA 2R17C 1BI8B 3MKRA 3GZ2A 4U0UA 1OCZE 4EQFA 2VQ2A 3ENEA 2XGOA 4GPMA 2BKGA 3OAWA 3I5PA 4N3CA 4GMLA 2H6HA 4RQIA 4XI9A 2L0IA 5E75A 4U8VD 4O1OA 3AS4A 5HQ8A 3DSUA 4GZ6A 1KT1A 1TYQG 5ARGA 4EZLA 1X5BA 2RD0A 5G05J 3PZ3A 2A5EA 5ENNA 3B7UX 2WMOA 3MX3A 1IXVA 3B7SA 4OAUC 3CKCA 3S7JA 1HF8A 3ONLA 3O4ZA 4CYMD 3HRAA 1FVFA 4LERA 2I6HA 5CMWA 5EX0A 3SI5A 1H2TC 3Q15A 1IYGA 3KEZA 1MHQA 2NXPA 3L6AA 3ABME 2XQ0A 3V79K 4WWNA 2H6IA 1U2VG 3MV3B 2XCCA 3UIOC 3ZUVB 4LCTA 1IQRA 4BTBA 4BX9A 3DSWA 3BG0B 3FUNA 2ONDA 3EHRA 2WPVA 2BKKB 4GTMA 4O1PA 4BT9A 4CZ2D 1MX4A 2ZGDA 2KZTA 4KYOB 3ZRHA 3L22A 3UM1A 4I6EA 4MS6A 4AJWA 2H6FA 1XGWA 3ESLA 4IRUA 4EZJA 5B1BE 1H19A 3DSXA 2IY0C 2CFUA 4B93B 1TR4A 3URZA 1ELRA 4CDNA 2LXLA 3DSSA 3SY2A 4JA7A 3TGOA 4JZYA 3CSTA 2OV8A 3ONKA 5HKPA 4TUUA 5A7DB 2VSYA 2NSZA 4R7LA 1LF8A 2GRQB 3PRZA 5C2YA 4HI9A 1H2UA 3KD7A 4XKCA 4B89A 3PE3A 3UINC 3QAQA 2XEEA 3PDNA 5EILA 3SBTB 5D66A 5AARA 1HX8A 4LNGA 2DYSE 5AQAA 1WG0A 2BEDA 3OXFA 4K0RA 2NC9A 2GRNB 3V2XA 3FUIA 2ETCA 3FUJA 1IHGA 3N71A 4GTTA 1N4PA 4P29A 1OWLA 1SVXA 2WXKA 1FVHA 2GGFA 2OEVA 4KVMA 1OWMA 5J08A 2DZOA 3ZN3A 1N95A 4GZDA 3ZGQA 2XHEA 2C0LA 2ILRA 3DPYA 3C72A 2LAIA 2RKKA 2QYJA 4YVOA 3QNKA 4ANWA 2WXRA 4TRQA 1EYHA 2VYIA 5BV0A 3ZYMA 3CK7A 1P5QA 3GW4A 3L16A 2LNIA 3FH7A 1HH8A 1NFIE 3JUIA 3CVQA 1BPOA 2DBAA 4DLQA 1IQUA 1HG5A 1TN7A 3DPDA 4MRUA 4Y6CA 5AQBA 2A5UA 3B7RL 2GW1A 5EKQD 3ZHEA 1A5EA 4BEPA 4GB9A 5ENOD 5G04C 1HE8A 1QBQA 3U3WA 4C48B 4EPZA 3IHYA 1H6OA 1PY1A 2E2EA 3D9NA 2FULA 4AV7A 2YHEA 1MZCA 3QDNA 2PZIA 2WXHA 3FY4A 3RK6A 2IEJA 4I9CA 3U4TA 3DSTA 4BT8A 1ZB1A 3ZYQA 3PH0C 3LPZA 4AIFA 4WNEA 4U8YD 3NAWA 3ZXPA 4GCNA 2WXMA 4FULA 4F1PA 1EF1C 2AXUA 4ZFHA 3DRAA 3G2SA 3CV0A 4N5CA 2L6BA 1H0AA 4LNUD 4L2YA 5G04J 3CGHA 3UM2A 5LX8A 1N9AA 2KATA 4A1SA 4AM9A 3E30A 4URKA 2MOWA 3O48A 1L5JA 3FDHA 3FH5A 1LD8A 5EX3A 4I17A 3HXFA 3TWQA 1E7VA 5CEDB 1OWPA 4O60A 1E8ZA 1WAO1 3AU4A 2WVIA 4K5BA 3FUDA 3CIAA 5EDSA 5T4YA 2GRRB 4FADA 5B3SE 3S7DA 3RSEG 3TAXA 4XZ4A 2LSVA 4FA6A 2R5SA 4Y6WA 3G2WA 4BFRA 5KNGA 2EILE 4AP2A 4DX5D 1S70B 2V8SE 5EYLA 3AG2E 4KXKB 3DXMG 1U3DA 2CHXA 4XX5A 3VLDA 3MKQB 3CHSA 1OCCE 3CK8A 5DBKA 2R05A 1YYHA 2IQCA 3TXNA 2B6CA 3T5XA 1H6PA 2GRPB 3PNLB 3CHOA 5EIDA 3E4BA 2WXLA 3E34A 4UWFA 3U64A 5LP0A 3FHEA 4JB8P 2F0YA 3ASGA 1E96B 1E7UA 3JUEA 4CCAA 3E32A 1RZ4A 3EU5A 4FHKA 2MHKA 1SW6A 4HBDA 2DVWA 3VLEA 4GYWA 3C3RA 4G23A 1DNPA 4GA1A 1Y8MA 1O1TA 2P9UG 2IOLA 3LY8A 4U96D 2CFZA 3Q5MA 2AXVA 3NOGD 3BEEA 2P9NG 2RFMA 4CDRA 3ASOE 4APOA 2BTDA 5FINA 1EDUA 3PEUB 3UT4A 3ISMC 5BPPA 4J8FA 4N5QA 1H2VC 5CECB 4GTRA 3Q7FA 1UW4B 3W9FA 5JHAA 4U63A 4WNFA 3MA5A 5D0OD 3CQGB 4HRMB 1SZ9A 4FP7A 3D9KA 2Q7FA 3CHMA 3CK9A 1VDYA 3RAUA 4J7WA 3D9JA 1TN6A 5AYWD 3ZVVA 1HO8A 1E8WA 4LNBA 1YCSB 3PUKA 4WWPA 3PEVB 4GPKA 4NACA 2LXMA 4BETA 2KZTB 5EYPF 1OCOE 4HRLA 4J8SA 3FEYA 3RRNB 5BUZA 3Q4AB 3LVRE 3UT7A 3AU5A 4UI9K 2P9KG 4TXQA 4GMRA 5FJYA 3JQ1A 4JL0A 4M3OA 3JXJA 1N94A 4GA2A 1D8DA 5JMND 5AAOA 2L0TB 4GTSA 2X3MA 1QNFA 3TG4A 5EN5D 4AXHA 1INZA 3ZYLA 3EDTB 5CBNA 3CVUA 3ZW3A 1E90A 3RRMB 3ULEG 1JUQA 1FCHA 3I4GA 1NZNA 4BSZB 1TNBA 2ETBA 5AJDA 3ZKJA 5BT1A 2I9CA 4CT4A 3HVEB 2E0IA 1FT2A 2J4BA 2V5FA 4CDMA 2P2CP 2Y1LE 5CBOA 3RJVA 3BQOA 2ZIRA 3TWWA 4HVBA 2OCCE 1X81A 1D8EA 3EHMA 1NA0A 3FTSA 1MJ0A 1O1RA 2WXPA 4B8CB 3DXKG 2J07A 3Q75A 4NRHB 4G11A 2QFCA 4F7AA 3SFYA 4G2VA 3FTUA 4WNDA 1TNOA 4CGVA 1MYOA 3S7FA 4DI4A 5JHBA 5ENSD 4ATGA 3LJ3A 3KEAA 3L9TA 2GRMA 5J90A 2X6HA 3FUEA 3ABLE 4U04A 3UPVA 3EIQC 1FT1A 3D9MA 3SBSA 1N0RA 4A1GA 2R2LA 3CR3A 2JABA 1S0PA 5JA4D 3MGBA 3EHQA 3BU8A 4J8EA 1K3ZD 3T9KA 3CVXA 4PUCA 1AP7A 4U0ZA 1TJCA 2OVBA 3V31A 2GRLA 3FU5A 2OOEA 2CG3A 3SFZA 3PVLA 4NQ0A 4DX1A 4OAVB 4DLOA 1V55E 2DYRE 3TXMA 4HB5A 4GZ5A 3UI2A 2VSOE 2X6FA 3CVWA 3GZ1A 3ZHEB 5CRUA 3WXXA 4YDOA 2H6GA 1DCQA 2HO1A 3TWVA 3Q7AA 2M63A 3HVEA 4Q96A 2X6KA 1OWNA 1KT0A 5LFAA 3KSLA 3HYMB 2HM8A 3QC1A 5AJLA 2KCLA 3J5QB 5FZQA 4O6FA 2FF4A 3ZFWA 3QARA 4OVVA 4HOUA 2ZU6B 4XEIG 2WB2A 4W9RA 3CHPA 3ASFA 4IULA 1TNUA 1K8KG 3FP3A 1BD8A 3QWVA 2AVPA 5CMYA 5BXUA 3GZSA 2Y4TA 4I9EA 2A4ZA 3JCKC 2OEWA 5HI7A 2ZXWE 4HOSA 2R03A 1ZU2A 2WXIA 3C3OA 4WNGA 4I43A 1N52A 4CEMA 3UIPC 3V30A 4FJZA 3SF4A 3HXCA 4BWRA 5FT9A 3OTNA 3TL5A 4ANVA 2IFUA 3L82A 5D2MC 2IONA 4GYYA 1V54E 2YNQA 4G8KA 2PQNA 4BTAA 4G26A 3HG0D 4GTVA 3QWPA 3CEQA 4GTQA 4FC8A 4UWKA 4JD2G 4UWLA 3MJWA 3DEOA 3SQVA 3R9MA 2LSUA 4BY6A 5C1DA 5FQ7A 5IY5E 4X8QA 3FULA 2YQ8A 4JEHA 4A55A 1Z5SC 4TV3A 3OXGA 3HDXA 1JCQA 1UOHA 3D9OA 4AY6A 2XGMA 1UG3A 4I1OB 5FZRA 3QWWA 3C98A 3D9IA 2VSNA 4U8HA 3JXIA 4ME2A 2V0PA 4B94A 4JXTA 4ILIA 2FO7A 3Q78A 3L17A 3AG4E 4AOFA 3MZLB 3G2VA 3FTWA 4HLLA 4OVUA 2VSXE 2V5QC 2VGEA 2AJAA 3PNTB 4ILGA 5KJNA 4YNDA 4BESA 5ENTD 3K9IA 3T5VA 1UN8A 3HXEA 5FWQA 1HG2A 2OVFA 3IBEA 4DJAA 3W9GA 3SFXA 1JWGA 4K03A 2IO3C 1OXJA 4N2SA 3Q9UC 1TEZA 3D3MA 4ANXA 1MX6A 2F37A 3P1UA 3FTZA 2VJ8A 1QQEA 3L54A 4U7EB 4HXIA 4GMJA 3ZYKA 5LCWC 3AS5A 2QYUA 4N2QA 1ELWA 5B1AE 1N4QA 1IHBA 4H7YA 1OT8A 3FUHA 3IKOB 2MYOA 3B7TA 3NQPA 4EBAA 5KJMA 1RW2A 2VTBA 3LVQE 2AWIA 2J9QA 2UWJG 4AVXA 4GCOA 5G2NA 4EBAG 3EIJA 5CCLA 3IV0A 4DUIA 3FEXA 3CVNA 4I6GA 3IXEA 2P9LG 4GZ3A 3EU9A 4RG9A 3T8KA 3FU3A 3TWXA 3FU6A 2HYZA 2XZDG 2DIWA 2CG2A 3AAAC 3DSVA 4F6RD 2WQ7A 3KSQA 3QJZA 4GZCA 1TN8A 4APFA 2V4HC 2WQHA 3B95A 4TXPA 4HS2A 5LCWJ 4A3TA 3RIBA 4RG6A 5KWDA 3IHVA 4J8YA 1N54A 2BUGA 4JA9A 4HFGA 4N3AA 3UM0A 2ZGGA 3NBNB 1N11A 3RU0A 3LYAA 2WQ6A 1MQSA 4PH4B 2IJGX 4JPSA 2BF0X 3AG1E 3E33A 1XNFA 4G24A 2WXJA 4UQZA 5DIZA 1JPLA 1PAQA 3ASDA 1SA5A 4FHJA 3CVLA 4K5CA 2XS8A 3DEPA 4NIKA 1N4SA 1N4RA 3RO2A 2KBXA 3UTMA 4GA0A 4M7CA 3BUAA 4CT0A 5T3RA 4U07A 2RG8A 3EJNA 3R7RA 4JEUA 3UT8A 1O1SA 1TNYA 1HS6A 3LEWA 2JEKA 3U9WA 3PE4A 5H7PA 4QQIA 1N0QA 1DC2A 3APDA 2WXQA 2FO1E 1WDYA 3PREA 4KBQA 2J8SD 4HLEA 1QYMA 3FFLA 3DBSA 4I1AA 2C2LA 3VLFA 3ZNGA 4GU5A 3ML8A 3S7BA 2QZAA 4G1TA 4BSXA 4XE0A 4D10C 4RVBA 1ZBPA 1LTXA 3Q47B 5BV1A 5ARFA 3UM3A 2L6JA 3UMVA 4L1BA 2Y69E 2GROB 3QOUA 3ASNE 5AENA 3SZ7A 2F8YA 4LEUA 4KT6B 4BERA 2KCVA 2Y4UA 3OXLA 3HXDA 4FLHA 5AQ9A 2NYJA 3NZUA 2IU1A 1YA0A 2P9IG 3FH8A 3B7BA 5CEAA 5KJKA 1K1AA 2X6JA 2Y0BG 5AIJA 3Q79A 3VTXA 4HI8A 4BX8A 3FU0A 3LKUA 5FTPA 5FQ6A 4K5AB 2AXZA 3ESKA 3B13A 4J6IA 3J5PA 2LUHA 3NOCD 3TWTA 4HNAD 1DVPA 4EZKA 4JHRA 4UWHA 3L13A 3ZEFA 4DK5A 4UWGA 1WM5A 3ULQA 3ZPJA 3APCA 4MBGA 5ITZF 3UQ3A 3D9LA 3R9AB 2QC9A 3UUXA 2HE0A 1UJJA 3NB2A 3T8MA 4C0MA 5HS0A 1FPPA 2XEVA 2KM4A 2LAHA 4DX6D 1D9SA 4HRNA 3FUFA 3TWRA 1JCSA 2L9BA 1E8YA 2XEHA 5ANLA 3QKYA 1A17A 4XIFA 4DI3A 2ETAA 2CHZA 1UJKA 2EIKE 4RSYA 3SNXA 4I2WA 4EECA 2XRZA 4DRXE 2IO2C 1IKND 3S2AA 2PL2A 4ATZD 2VGYA 2JLBA 2X6IA 1NA3A 1WY6A 3LDZA 4U95D 4YDYA 3I4RB 4JVSA 2HR2A 4WAFA 4ABNA 3RRUA 3VTYA 3PUJA 3LY7A 2KCKA 2WXFA 2WXOA 4N39A 3FTVA 3TJPA 4MKTA 4HOQA 3ULYA 1UN9A 1LD7A 2LO6A 1O5MA 2PQRA 3FUKA 4NURA 4AY5A 3PZDA 3DWLG 2VGXB 4L2LA 2EIJE 3LY9A 3LXUX 5M72A 1OWOA 3G2TA 1AWCB 2YHCA 4DX7D 3UXGA 3CVVA 3CVPA 4C9BB 3HIZA 4XI0A 1DCEA 5FQ8A 3FTYA 2XZTG 2DWZA 5G55A 4RLYA 4YDEA 1Z3YA 4H7XA 3MEKA 3PZ2A 4N3BA 3FWVA 3TWSA 4I2ZA 3CQCB 3TG5A 1HU3A 3LS8A 1H6KA 4ACLA 3SO8A 2IOSA 3PS6A 2X38A 4YVQC 1SA4A 1OUVA 3PZ4A 1HFAA 4F3VA 1U3CA 3GYZA 1TNZA 5KNHD 1EPUA 4IYPA 4LSZE 4L23A 4Q69A 2XCBA 2FBNA 2VTBB 2WMNA 2WM9A 3C5RA 4KZ0A 3CKBA
chains in the Genus database with same CATH topology
3EU9A 3T8KA 5EYPF 4GPMA 2BKGA 3JXIA 3TWXA 3TWUA 4B93B 1TR4A 4HRLA 5HRYA 2XZDG 4YDWA 4F1PA 3AJIA 4JB8P 3AAAC 4U8VD 4ZFHA 4O1OA 1BD8A 4F6RD 4U8YD 1MYOA 5ENPD 1BU9A 3LJNA 5ENSD 5ITZF 2QYJA 4A63B 2L6BA 1MX2A 2V4HC 4QQIA 4UUCA 3JUEA 4GMRA 2QC9A 4LNUD 3B95A 5BXUA 5FIOA 3KEAA 5HKPA 1N0QA 1DC2A 5EIBE 2HE0A 2FO1E 3JXJA 1WDYA 4HLLA 2PNNA 4LG6A 5JMND 5KBAA 1SW6A 5AAOA 5KWDA 2V5QC 4HBDA 4J8YA 1AWCB 2A5EA 2DVWA 2J8SD 2VGEA 5EN5D 2AJAA 1QYMA 5HS0A 1N0RA 4HI9A 2B0OE 3ZNGA 2ZGGA 4DX7D 2JABA 3NBNB 3UXGA 5JA4D 1N11A 1IXVA 2KXPC 3EHQA 4BESA 5ENTD 4OAUC 4U96D 2F8XK 5ENRD 4DX6D 5CBNA 1NFIE 1K3ZD 1D9SA 3NOGD 5ENQD 4HRNA 3V30A 2XEEA 4HQDA 3T9KA 3TWRA 1BLXB 3TWQA 5CEDB 2RFMA 2XZTG 4CYMD 2XEHA 4O60A 5EILA 3HRAA 1AP7A 2DWZA 1OY3D 5FINA 3W9GA 1BI7B 5D66A 4RLYA 3Q9UC 5AARA 1YMPA 4N5QA 1G3NB 4BSZB 4K5BA 5AQBA 3V31A 2ETBA 3ZU7B 4Z68A 5CECB 3ZKJA 1MX6A 2ETAA 2F37A 1K1BA 2F8YA 5AQ7A 1A5EA 4BEPA 5AQAA 1WG0A 4DX1A 3V79K 4OAVB 3TWSA 3D9HA 5ENOD 4G8KA 4BERA 4DRXE 4K5CA 3W9FA 4HB5A 3UI2A 3HG0D 1IKND 5AQ9A 2NYJA 4C48B 3V2XA 3ZUVB 1IHBA 4ATZD 3DEPA 2P2CP 5KNGA 2ETCA 4NIKA 4QFVA 1OT8A 2Y1LE 3B7BA 4DX5D 5CBOA 3DEOA 2KBXA 1DCQA 1S70B 2MYOA 3TWVA 4HRMB 3SO8A 5EYLA 3UTMA 4U95D 5CEAA 3TWWA 3EHRA 1K1AA 2BKKB 4O1PA 4YDYA 2Y0BG 2RFAA 4CZ2D 5BXOA 1MX4A 1SVXA 4HI8A 4J7WA 2ZGDA 3F6QA 3J5QB 5KNHD 1YYHA 2DZNA 1UOHA 4LSZE 1MJ0A 4DX2A 4ZHBA 4K5AB 1YCSB 4TUMA 4DUIA 5CERB 1BI8B 2XENA 3V2OA 3C5RA 3IXEA 3J5PA 4G8LA 5EIDA 5AN8A 4BETA 3NOCD 3Q9NC 2DZOA 3TWTA 4HNAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EU9 A;  3T8K A;  5EYP F;  4GPM A;  2BKG A;  3JXI A;  3TWX A;  3TWU A;  4B93 B;  1TR4 A;  4HRL A;  5HRY A;  2XZD G;  4YDW A;  4F1P A;  3AJI A;  4JB8 P;  3AAA C;  4U8V D;  4ZFH A;  4O1O A;  1BD8 A;  4F6R D;  4U8Y D;  1MYO A;  5ENP D;  1BU9 A;  3LJN A;  5ENS D;  5ITZ F;  2QYJ A;  4A63 B;  2L6B A;  1MX2 A;  2V4H C;  4QQI A;  4UUC A;  3JUE A;  4GMR A;  2QC9 A;  4LNU D;  3B95 A;  5BXU A;  5FIO A;  3KEA A;  5HKP A;  1N0Q A;  1DC2 A;  5EIB E;  2HE0 A;  2FO1 E;  3JXJ A;  1WDY A;  4HLL A;  2PNN A;  4LG6 A;  5JMN D;  5KBA A;  1SW6 A;  5AAO A;  5KWD A;  2V5Q C;  4HBD A;  4J8Y A;  1AWC B;  2A5E A;  2DVW A;  2J8S D;  2VGE A;  5EN5 D;  2AJA A;  1QYM A;  5HS0 A;  1N0R A;  4HI9 A;  2B0O E;  3ZNG A;  2ZGG A;  4DX7 D;  2JAB A;  3NBN B;  3UXG A;  5JA4 D;  1N11 A;  1IXV A;  2KXP C;  3EHQ A;  4BES A;  5ENT D;  4OAU C;  4U96 D;  2F8X K;  5ENR D;  4DX6 D;  5CBN A;  1NFI E;  1K3Z D;  1D9S A;  3NOG D;  5ENQ D;  4HRN A;  3V30 A;  2XEE A;  4HQD A;  3T9K A;  3TWR A;  1BLX B;  3TWQ A;  5CED B;  2RFM A;  2XZT G;  4CYM D;  2XEH A;  4O60 A;  5EIL A;  3HRA A;  1AP7 A;  2DWZ A;  1OY3 D;  5FIN A;  3W9G A;  1BI7 B;  5D66 A;  4RLY A;  3Q9U C;  5AAR A;  1YMP A;  4N5Q A;  1G3N B;  4BSZ B;  4K5B A;  5AQB A;  3V31 A;  2ETB A;  3ZU7 B;  4Z68 A;  5CEC B;  3ZKJ A;  1MX6 A;  2ETA A;  2F37 A;  1K1B A;  2F8Y A;  5AQ7 A;  1A5E A;  4BEP A;  5AQA A;  1WG0 A;  4DX1 A;  3V79 K;  4OAV B;  3TWS A;  3D9H A;  5ENO D;  4G8K A;  4BER A;  4DRX E;  4K5C A;  3W9F A;  4HB5 A;  3UI2 A;  3HG0 D;  1IKN D;  5AQ9 A;  2NYJ A;  4C48 B;  3V2X A;  3ZUV B;  1IHB A;  4ATZ D;  3DEP A;  2P2C P;  5KNG A;  2ETC A;  4NIK A;  4QFV A;  1OT8 A;  2Y1L E;  3B7B A;  4DX5 D;  5CBO A;  3DEO A;  2KBX A;  1DCQ A;  1S70 B;  2MYO A;  3TWV A;  4HRM B;  3SO8 A;  5EYL A;  3UTM A;  4U95 D;  5CEA A;  3TWW A;  3EHR A;  1K1A A;  2BKK B;  4O1P A;  4YDY A;  2Y0B G;  2RFA A;  4CZ2 D;  5BXO A;  1MX4 A;  1SVX A;  4HI8 A;  4J7W A;  2ZGD A;  3F6Q A;  3J5Q B;  5KNH D;  1YYH A;  2DZN A;  1UOH A;  4LSZ E;  1MJ0 A;  4DX2 A;  4ZHB A;  4K5A B;  1YCS B;  4TUM A;  4DUI A;  5CER B;  1BI8 B;  2XEN A;  3V2O A;  3C5R A;  3IXE A;  3J5P A;  4G8L A;  5EID A;  5AN8 A;  4BET A;  3NOC D;  3Q9N C;  2DZO A;  3TWT A;  4HNA D; 
#chains in the Genus database with same CATH topology
 2YIN A;  3ML9 A;  2WXN A;  3C3Q A;  4YDW A;  3AJI A;  4WWO A;  1KZO A;  3E37 A;  1W3B A;  4FLB A;  1BU9 A;  3LJN A;  1MX2 A;  2CHW A;  3R7Q A;  4OYS A;  1S63 A;  5KBA A;  5ANR A;  2EIM E;  2J09 A;  2VGX A;  2J49 A;  2B0O E;  3KS2 A;  2KXP C;  3CVY A;  2F8X K;  5ENR D;  1KZP A;  5ENQ D;  4HQD A;  5D0Q D;  4DPR A;  1QZ2 A;  4EHM A;  1TJF A;  1OY3 D;  5BW8 C;  1BI7 B;  3Q49 B;  4FU3 A;  4ILH B;  3EHN A;  1S64 A;  3MYV A;  3KAE A;  2UY1 B;  3CLJ A;  3PZ1 A;  2J08 A;  3U66 A;  1Z6T A;  1ELK A;  4JHJ A;  2IF4 A;  3G2U A;  5A6C A;  5BNW A;  4J8D A;  5BXO A;  5CCM A;  4PDX A;  5CHE E;  4ANU A;  1JCR A;  4DX2 A;  3ABK E;  4ACK A;  4TUM A;  5CER B;  3LCA A;  2XEN A;  3V2O A;  4GTO A;  3APF A;  4G8L A;  2XPI A;  4UQY A;  5AN8 A;  3Q9N C;  5CRV A;  4V3I A;  4B8A A;  4L9P A;  2P9P G;  3SHF A;  2PM7 A;  1HZ4 A;  4MLP A;  4GAA A;  4PS8 A;  4F1S A;  4HOT A;  3CHQ A;  5ENP D;  4I6J A;  3FUM A;  2I2O A;  4A63 B;  4JC8 A;  4GTP A;  2XPY A;  5FIO A;  3HXB A;  1E8X A;  4UQX A;  2PNN A;  1NP7 A;  4LRZ A;  2Y3A A;  5JJT A;  4HOR A;  1JWF A;  3CSF A;  3NF1 A;  3UKU G;  2R59 A;  3MV2 B;  4CGW A;  3D9P A;  2ZIS A;  5LOZ A;  4LUN U;  3UKR G;  3X2Q E;  3UX4 A;  5A23 A;  3ZU7 B;  5JJ7 A;  2XPZ A;  4A3V A;  1NI1 A;  1B89 A;  4I1M A;  3FTX A;  3L08 A;  4CRW A;  1Y6I A;  4UI9 C;  2J4D A;  3JQ0 A;  3BG1 B;  5JJ6 A;  4KZC A;  4QFV A;  4JHK A;  5KCM A;  4GYO A;  2UY1 A;  5FQ4 A;  3QB2 A;  2RFA A;  1SZA A;  4PS7 A;  4PS3 A;  2DZN A;  4F53 A;  4XKB A;  2I1J A;  4FJY A;  4G25 A;  2PM6 A;  3TWU A;  5HRY A;  5KJL A;  2AW6 A;  3ASH A;  5E76 A;  1HXI A;  1SQM A;  4UUC A;  1OCR E;  4L7T A;  3IEG A;  2FEZ A;  4UI9 J;  5EIB E;  4TXR A;  4LG6 A;  2XGS A;  4WUY A;  3AS8 A;  3ZXS A;  3JYS A;  2XS1 A;  5T8I A;  4Q94 A;  3MCX A;  2EIN E;  3QK0 A;  3NZS A;  2EQX A;  1NL4 A;  3SGH A;  1Q2Z A;  4KMO A;  4E85 A;  3Q73 A;  3ZIM A;  3CHR A;  1BLX B;  3RO3 A;  4C0E A;  5FZS A;  3SD5 A;  4IN3 B;  4J0U A;  1YMP A;  1G3N B;  1PC2 A;  4Z68 A;  2P58 C;  1GW6 A;  3I3N A;  1K1B A;  3P2B A;  5AQ7 A;  4JW1 A;  2P9S G;  3D9H A;  2C0M A;  2V4L A;  5G05 C;  3MKQ A;  2MRI A;  1Z3X A;  2FI7 A;  4B0Z A;  2WXG A;  2R02 A;  3EUV A;  2KC7 A;  3HHM A;  3AG3 E;  3RKV A;  3F6Q A;  2QY7 A;  4AEZ C;  4KVO A;  4ZHB A;  1KLX A;  4U0S A;  1KPS B;  2I1K A;  3WG7 E;  2XRY A;  2DCP A;  4E6H A;  2R17 C;  1BI8 B;  3MKR A;  3GZ2 A;  4U0U A;  1OCZ E;  4EQF A;  2VQ2 A;  3ENE A;  2XGO A;  4GPM A;  2BKG A;  3OAW A;  3I5P A;  4N3C A;  4GML A;  2H6H A;  4RQI A;  4XI9 A;  2L0I A;  5E75 A;  4U8V D;  4O1O A;  3AS4 A;  5HQ8 A;  3DSU A;  4GZ6 A;  1KT1 A;  1TYQ G;  5ARG A;  4EZL A;  1X5B A;  2RD0 A;  5G05 J;  3PZ3 A;  2A5E A;  5ENN A;  3B7U X;  2WMO A;  3MX3 A;  1IXV A;  3B7S A;  4OAU C;  3CKC A;  3S7J A;  1HF8 A;  3ONL A;  3O4Z A;  4CYM D;  3HRA A;  1FVF A;  4LER A;  2I6H A;  5CMW A;  5EX0 A;  3SI5 A;  1H2T C;  3Q15 A;  1IYG A;  3KEZ A;  1MHQ A;  2NXP A;  3L6A A;  3ABM E;  2XQ0 A;  3V79 K;  4WWN A;  2H6I A;  1U2V G;  3MV3 B;  2XCC A;  3UIO C;  3ZUV B;  4LCT A;  1IQR A;  4BTB A;  4BX9 A;  3DSW A;  3BG0 B;  3FUN A;  2OND A;  3EHR A;  2WPV A;  2BKK B;  4GTM A;  4O1P A;  4BT9 A;  4CZ2 D;  1MX4 A;  2ZGD A;  2KZT A;  4KYO B;  3ZRH A;  3L22 A;  3UM1 A;  4I6E A;  4MS6 A;  4AJW A;  2H6F A;  1XGW A;  3ESL A;  4IRU A;  4EZJ A;  5B1B E;  1H19 A;  3DSX A;  2IY0 C;  2CFU A;  4B93 B;  1TR4 A;  3URZ A;  1ELR A;  4CDN A;  2LXL A;  3DSS A;  3SY2 A;  4JA7 A;  3TGO A;  4JZY A;  3CST A;  2OV8 A;  3ONK A;  5HKP A;  4TUU A;  5A7D B;  2VSY A;  2NSZ A;  4R7L A;  1LF8 A;  2GRQ B;  3PRZ A;  5C2Y A;  4HI9 A;  1H2U A;  3KD7 A;  4XKC A;  4B89 A;  3PE3 A;  3UIN C;  3QAQ A;  2XEE A;  3PDN A;  5EIL A;  3SBT B;  5D66 A;  5AAR A;  1HX8 A;  4LNG A;  2DYS E;  5AQA A;  1WG0 A;  2BED A;  3OXF A;  4K0R A;  2NC9 A;  2GRN B;  3V2X A;  3FUI A;  2ETC A;  3FUJ A;  1IHG A;  3N71 A;  4GTT A;  1N4P A;  4P29 A;  1OWL A;  1SVX A;  2WXK A;  1FVH A;  2GGF A;  2OEV A;  4KVM A;  1OWM A;  5J08 A;  2DZO A;  3ZN3 A;  1N95 A;  4GZD A;  3ZGQ A;  2XHE A;  2C0L A;  2ILR A;  3DPY A;  3C72 A;  2LAI A;  2RKK A;  2QYJ A;  4YVO A;  3QNK A;  4ANW A;  2WXR A;  4TRQ A;  1EYH A;  2VYI A;  5BV0 A;  3ZYM A;  3CK7 A;  1P5Q A;  3GW4 A;  3L16 A;  2LNI A;  3FH7 A;  1HH8 A;  1NFI E;  3JUI A;  3CVQ A;  1BPO A;  2DBA A;  4DLQ A;  1IQU A;  1HG5 A;  1TN7 A;  3DPD A;  4MRU A;  4Y6C A;  5AQB A;  2A5U A;  3B7R L;  2GW1 A;  5EKQ D;  3ZHE A;  1A5E A;  4BEP A;  4GB9 A;  5ENO D;  5G04 C;  1HE8 A;  1QBQ A;  3U3W A;  4C48 B;  4EPZ A;  3IHY A;  1H6O A;  1PY1 A;  2E2E A;  3D9N A;  2FUL A;  4AV7 A;  2YHE A;  1MZC A;  3QDN A;  2PZI A;  2WXH A;  3FY4 A;  3RK6 A;  2IEJ A;  4I9C A;  3U4T A;  3DST A;  4BT8 A;  1ZB1 A;  3ZYQ A;  3PH0 C;  3LPZ A;  4AIF A;  4WNE A;  4U8Y D;  3NAW A;  3ZXP A;  4GCN A;  2WXM A;  4FUL A;  4F1P A;  1EF1 C;  2AXU A;  4ZFH A;  3DRA A;  3G2S A;  3CV0 A;  4N5C A;  2L6B A;  1H0A A;  4LNU D;  4L2Y A;  5G04 J;  3CGH A;  3UM2 A;  5LX8 A;  1N9A A;  2KAT A;  4A1S A;  4AM9 A;  3E30 A;  4URK A;  2MOW A;  3O48 A;  1L5J A;  3FDH A;  3FH5 A;  1LD8 A;  5EX3 A;  4I17 A;  3HXF A;  3TWQ A;  1E7V A;  5CED B;  1OWP A;  4O60 A;  1E8Z A;  1WAO 1;  3AU4 A;  2WVI A;  4K5B A;  3FUD A;  3CIA A;  5EDS A;  5T4Y A;  2GRR B;  4FAD A;  5B3S E;  3S7D A;  3RSE G;  3TAX A;  4XZ4 A;  2LSV A;  4FA6 A;  2R5S A;  4Y6W A;  3G2W A;  4BFR A;  5KNG A;  2EIL E;  4AP2 A;  4DX5 D;  1S70 B;  2V8S E;  5EYL A;  3AG2 E;  4KXK B;  3DXM G;  1U3D A;  2CHX A;  4XX5 A;  3VLD A;  3MKQ B;  3CHS A;  1OCC E;  3CK8 A;  5DBK A;  2R05 A;  1YYH A;  2IQC A;  3TXN A;  2B6C A;  3T5X A;  1H6P A;  2GRP B;  3PNL B;  3CHO A;  5EID A;  3E4B A;  2WXL A;  3E34 A;  4UWF A;  3U64 A;  5LP0 A;  3FHE A;  4JB8 P;  2F0Y A;  3ASG A;  1E96 B;  1E7U A;  3JUE A;  4CCA A;  3E32 A;  1RZ4 A;  3EU5 A;  4FHK A;  2MHK A;  1SW6 A;  4HBD A;  2DVW A;  3VLE A;  4GYW A;  3C3R A;  4G23 A;  1DNP A;  4GA1 A;  1Y8M A;  1O1T A;  2P9U G;  2IOL A;  3LY8 A;  4U96 D;  2CFZ A;  3Q5M A;  2AXV A;  3NOG D;  3BEE A;  2P9N G;  2RFM A;  4CDR A;  3ASO E;  4APO A;  2BTD A;  5FIN A;  1EDU A;  3PEU B;  3UT4 A;  3ISM C;  5BPP A;  4J8F A;  4N5Q A;  1H2V C;  5CEC B;  4GTR A;  3Q7F A;  1UW4 B;  3W9F A;  5JHA A;  4U63 A;  4WNF A;  3MA5 A;  5D0O D;  3CQG B;  4HRM B;  1SZ9 A;  4FP7 A;  3D9K A;  2Q7F A;  3CHM A;  3CK9 A;  1VDY A;  3RAU A;  4J7W A;  3D9J A;  1TN6 A;  5AYW D;  3ZVV A;  1HO8 A;  1E8W A;  4LNB A;  1YCS B;  3PUK A;  4WWP A;  3PEV B;  4GPK A;  4NAC A;  2LXM A;  4BET A;  2KZT B;  5EYP F;  1OCO E;  4HRL A;  4J8S A;  3FEY A;  3RRN B;  5BUZ A;  3Q4A B;  3LVR E;  3UT7 A;  3AU5 A;  4UI9 K;  2P9K G;  4TXQ A;  4GMR A;  5FJY A;  3JQ1 A;  4JL0 A;  4M3O A;  3JXJ A;  1N94 A;  4GA2 A;  1D8D A;  5JMN D;  5AAO A;  2L0T B;  4GTS A;  2X3M A;  1QNF A;  3TG4 A;  5EN5 D;  4AXH A;  1INZ A;  3ZYL A;  3EDT B;  5CBN A;  3CVU A;  3ZW3 A;  1E90 A;  3RRM B;  3ULE G;  1JUQ A;  1FCH A;  3I4G A;  1NZN A;  4BSZ B;  1TNB A;  2ETB A;  5AJD A;  3ZKJ A;  5BT1 A;  2I9C A;  4CT4 A;  3HVE B;  2E0I A;  1FT2 A;  2J4B A;  2V5F A;  4CDM A;  2P2C P;  2Y1L E;  5CBO A;  3RJV A;  3BQO A;  2ZIR A;  3TWW A;  4HVB A;  2OCC E;  1X81 A;  1D8E A;  3EHM A;  1NA0 A;  3FTS A;  1MJ0 A;  1O1R A;  2WXP A;  4B8C B;  3DXK G;  2J07 A;  3Q75 A;  4NRH B;  4G11 A;  2QFC A;  4F7A A;  3SFY A;  4G2V A;  3FTU A;  4WND A;  1TNO A;  4CGV A;  1MYO A;  3S7F A;  4DI4 A;  5JHB A;  5ENS D;  4ATG A;  3LJ3 A;  3KEA A;  3L9T A;  2GRM A;  5J90 A;  2X6H A;  3FUE A;  3ABL E;  4U04 A;  3UPV A;  3EIQ C;  1FT1 A;  3D9M A;  3SBS A;  1N0R A;  4A1G A;  2R2L A;  3CR3 A;  2JAB A;  1S0P A;  5JA4 D;  3MGB A;  3EHQ A;  3BU8 A;  4J8E A;  1K3Z D;  3T9K A;  3CVX A;  4PUC A;  1AP7 A;  4U0Z A;  1TJC A;  2OVB A;  3V31 A;  2GRL A;  3FU5 A;  2OOE A;  2CG3 A;  3SFZ A;  3PVL A;  4NQ0 A;  4DX1 A;  4OAV B;  4DLO A;  1V55 E;  2DYR E;  3TXM A;  4HB5 A;  4GZ5 A;  3UI2 A;  2VSO E;  2X6F A;  3CVW A;  3GZ1 A;  3ZHE B;  5CRU A;  3WXX A;  4YDO A;  2H6G A;  1DCQ A;  2HO1 A;  3TWV A;  3Q7A A;  2M63 A;  3HVE A;  4Q96 A;  2X6K A;  1OWN A;  1KT0 A;  5LFA A;  3KSL A;  3HYM B;  2HM8 A;  3QC1 A;  5AJL A;  2KCL A;  3J5Q B;  5FZQ A;  4O6F A;  2FF4 A;  3ZFW A;  3QAR A;  4OVV A;  4HOU A;  2ZU6 B;  4XEI G;  2WB2 A;  4W9R A;  3CHP A;  3ASF A;  4IUL A;  1TNU A;  1K8K G;  3FP3 A;  1BD8 A;  3QWV A;  2AVP A;  5CMY A;  5BXU A;  3GZS A;  2Y4T A;  4I9E A;  2A4Z A;  3JCK C;  2OEW A;  5HI7 A;  2ZXW E;  4HOS A;  2R03 A;  1ZU2 A;  2WXI A;  3C3O A;  4WNG A;  4I43 A;  1N52 A;  4CEM A;  3UIP C;  3V30 A;  4FJZ A;  3SF4 A;  3HXC A;  4BWR A;  5FT9 A;  3OTN A;  3TL5 A;  4ANV A;  2IFU A;  3L82 A;  5D2M C;  2ION A;  4GYY A;  1V54 E;  2YNQ A;  4G8K A;  2PQN A;  4BTA A;  4G26 A;  3HG0 D;  4GTV A;  3QWP A;  3CEQ A;  4GTQ A;  4FC8 A;  4UWK A;  4JD2 G;  4UWL A;  3MJW A;  3DEO A;  3SQV A;  3R9M A;  2LSU A;  4BY6 A;  5C1D A;  5FQ7 A;  5IY5 E;  4X8Q A;  3FUL A;  2YQ8 A;  4JEH A;  4A55 A;  1Z5S C;  4TV3 A;  3OXG A;  3HDX A;  1JCQ A;  1UOH A;  3D9O A;  4AY6 A;  2XGM A;  1UG3 A;  4I1O B;  5FZR A;  3QWW A;  3C98 A;  3D9I A;  2VSN A;  4U8H A;  3JXI A;  4ME2 A;  2V0P A;  4B94 A;  4JXT A;  4ILI A;  2FO7 A;  3Q78 A;  3L17 A;  3AG4 E;  4AOF A;  3MZL B;  3G2V A;  3FTW A;  4HLL A;  4OVU A;  2VSX E;  2V5Q C;  2VGE A;  2AJA A;  3PNT B;  4ILG A;  5KJN A;  4YND A;  4BES A;  5ENT D;  3K9I A;  3T5V A;  1UN8 A;  3HXE A;  5FWQ A;  1HG2 A;  2OVF A;  3IBE A;  4DJA A;  3W9G A;  3SFX A;  1JWG A;  4K03 A;  2IO3 C;  1OXJ A;  4N2S A;  3Q9U C;  1TEZ A;  3D3M A;  4ANX A;  1MX6 A;  2F37 A;  3P1U A;  3FTZ A;  2VJ8 A;  1QQE A;  3L54 A;  4U7E B;  4HXI A;  4GMJ A;  3ZYK A;  5LCW C;  3AS5 A;  2QYU A;  4N2Q A;  1ELW A;  5B1A E;  1N4Q A;  1IHB A;  4H7Y A;  1OT8 A;  3FUH A;  3IKO B;  2MYO A;  3B7T A;  3NQP A;  4EBA A;  5KJM A;  1RW2 A;  2VTB A;  3LVQ E;  2AWI A;  2J9Q A;  2UWJ G;  4AVX A;  4GCO A;  5G2N A;  4EBA G;  3EIJ A;  5CCL A;  3IV0 A;  4DUI A;  3FEX A;  3CVN A;  4I6G A;  3IXE A;  2P9L G;  4GZ3 A;  3EU9 A;  4RG9 A;  3T8K A;  3FU3 A;  3TWX A;  3FU6 A;  2HYZ A;  2XZD G;  2DIW A;  2CG2 A;  3AAA C;  3DSV A;  4F6R D;  2WQ7 A;  3KSQ A;  3QJZ A;  4GZC A;  1TN8 A;  4APF A;  2V4H C;  2WQH A;  3B95 A;  4TXP A;  4HS2 A;  5LCW J;  4A3T A;  3RIB A;  4RG6 A;  5KWD A;  3IHV A;  4J8Y A;  1N54 A;  2BUG A;  4JA9 A;  4HFG A;  4N3A A;  3UM0 A;  2ZGG A;  3NBN B;  1N11 A;  3RU0 A;  3LYA A;  2WQ6 A;  1MQS A;  4PH4 B;  2IJG X;  4JPS A;  2BF0 X;  3AG1 E;  3E33 A;  1XNF A;  4G24 A;  2WXJ A;  4UQZ A;  5DIZ A;  1JPL A;  1PAQ A;  3ASD A;  1SA5 A;  4FHJ A;  3CVL A;  4K5C A;  2XS8 A;  3DEP A;  4NIK A;  1N4S A;  1N4R A;  3RO2 A;  2KBX A;  3UTM A;  4GA0 A;  4M7C A;  3BUA A;  4CT0 A;  5T3R A;  4U07 A;  2RG8 A;  3EJN A;  3R7R A;  4JEU A;  3UT8 A;  1O1S A;  1TNY A;  1HS6 A;  3LEW A;  2JEK A;  3U9W A;  3PE4 A;  5H7P A;  4QQI A;  1N0Q A;  1DC2 A;  3APD A;  2WXQ A;  2FO1 E;  1WDY A;  3PRE A;  4KBQ A;  2J8S D;  4HLE A;  1QYM A;  3FFL A;  3DBS A;  4I1A A;  2C2L A;  3VLF A;  3ZNG A;  4GU5 A;  3ML8 A;  3S7B A;  2QZA A;  4G1T A;  4BSX A;  4XE0 A;  4D10 C;  4RVB A;  1ZBP A;  1LTX A;  3Q47 B;  5BV1 A;  5ARF A;  3UM3 A;  2L6J A;  3UMV A;  4L1B A;  2Y69 E;  2GRO B;  3QOU A;  3ASN E;  5AEN A;  3SZ7 A;  2F8Y A;  4LEU A;  4KT6 B;  4BER A;  2KCV A;  2Y4U A;  3OXL A;  3HXD A;  4FLH A;  5AQ9 A;  2NYJ A;  3NZU A;  2IU1 A;  1YA0 A;  2P9I G;  3FH8 A;  3B7B A;  5CEA A;  5KJK A;  1K1A A;  2X6J A;  2Y0B G;  5AIJ A;  3Q79 A;  3VTX A;  4HI8 A;  4BX8 A;  3FU0 A;  3LKU A;  5FTP A;  5FQ6 A;  4K5A B;  2AXZ A;  3ESK A;  3B13 A;  4J6I A;  3J5P A;  2LUH A;  3NOC D;  3TWT A;  4HNA D;  1DVP A;  4EZK A;  4JHR A;  4UWH A;  3L13 A;  3ZEF A;  4DK5 A;  4UWG A;  1WM5 A;  3ULQ A;  3ZPJ A;  3APC A;  4MBG A;  5ITZ F;  3UQ3 A;  3D9L A;  3R9A B;  2QC9 A;  3UUX A;  2HE0 A;  1UJJ A;  3NB2 A;  3T8M A;  4C0M A;  5HS0 A;  1FPP A;  2XEV A;  2KM4 A;  2LAH A;  4DX6 D;  1D9S A;  4HRN A;  3FUF A;  3TWR A;  1JCS A;  2L9B A;  1E8Y A;  2XEH A;  5ANL A;  3QKY A;  1A17 A;  4XIF A;  4DI3 A;  2ETA A;  2CHZ A;  1UJK A;  2EIK E;  4RSY A;  3SNX A;  4I2W A;  4EEC A;  2XRZ A;  4DRX E;  2IO2 C;  1IKN D;  3S2A A;  2PL2 A;  4ATZ D;  2VGY A;  2JLB A;  2X6I A;  1NA3 A;  1WY6 A;  3LDZ A;  4U95 D;  4YDY A;  3I4R B;  4JVS A;  2HR2 A;  4WAF A;  4ABN A;  3RRU A;  3VTY A;  3PUJ A;  3LY7 A;  2KCK A;  2WXF A;  2WXO A;  4N39 A;  3FTV A;  3TJP A;  4MKT A;  4HOQ A;  3ULY A;  1UN9 A;  1LD7 A;  2LO6 A;  1O5M A;  2PQR A;  3FUK A;  4NUR A;  4AY5 A;  3PZD A;  3DWL G;  2VGX B;  4L2L A;  2EIJ E;  3LY9 A;  3LXU X;  5M72 A;  1OWO A;  3G2T A;  1AWC B;  2YHC A;  4DX7 D;  3UXG A;  3CVV A;  3CVP A;  4C9B B;  3HIZ A;  4XI0 A;  1DCE A;  5FQ8 A;  3FTY A;  2XZT G;  2DWZ A;  5G55 A;  4RLY A;  4YDE A;  1Z3Y A;  4H7X A;  3MEK A;  3PZ2 A;  4N3B A;  3FWV A;  3TWS A;  4I2Z A;  3CQC B;  3TG5 A;  1HU3 A;  3LS8 A;  1H6K A;  4ACL A;  3SO8 A;  2IOS A;  3PS6 A;  2X38 A;  4YVQ C;  1SA4 A;  1OUV A;  3PZ4 A;  1HFA A;  4F3V A;  1U3C A;  3GYZ A;  1TNZ A;  5KNH D;  1EPU A;  4IYP A;  4LSZ E;  4L23 A;  4Q69 A;  2XCB A;  2FBN A;  2VTB B;  2WMN A;  2WM9 A;  3C5R A;  4KZ0 A;  3CKB A; 
#chains in the Genus database with same CATH homology
 3EU9 A;  3T8K A;  5EYP F;  4GPM A;  2BKG A;  3JXI A;  3TWX A;  3TWU A;  4B93 B;  1TR4 A;  4HRL A;  5HRY A;  2XZD G;  4YDW A;  4F1P A;  3AJI A;  4JB8 P;  3AAA C;  4U8V D;  4ZFH A;  4O1O A;  1BD8 A;  4F6R D;  4U8Y D;  1MYO A;  5ENP D;  1BU9 A;  3LJN A;  5ENS D;  5ITZ F;  2QYJ A;  4A63 B;  2L6B A;  1MX2 A;  2V4H C;  4QQI A;  4UUC A;  3JUE A;  4GMR A;  2QC9 A;  4LNU D;  3B95 A;  5BXU A;  5FIO A;  3KEA A;  5HKP A;  1N0Q A;  1DC2 A;  5EIB E;  2HE0 A;  2FO1 E;  3JXJ A;  1WDY A;  4HLL A;  2PNN A;  4LG6 A;  5JMN D;  5KBA A;  1SW6 A;  5AAO A;  5KWD A;  2V5Q C;  4HBD A;  4J8Y A;  1AWC B;  2A5E A;  2DVW A;  2J8S D;  2VGE A;  5EN5 D;  2AJA A;  1QYM A;  5HS0 A;  1N0R A;  4HI9 A;  2B0O E;  3ZNG A;  2ZGG A;  4DX7 D;  2JAB A;  3NBN B;  3UXG A;  5JA4 D;  1N11 A;  1IXV A;  2KXP C;  3EHQ A;  4BES A;  5ENT D;  4OAU C;  4U96 D;  2F8X K;  5ENR D;  4DX6 D;  5CBN A;  1NFI E;  1K3Z D;  1D9S A;  3NOG D;  5ENQ D;  4HRN A;  3V30 A;  2XEE A;  4HQD A;  3T9K A;  3TWR A;  1BLX B;  3TWQ A;  5CED B;  2RFM A;  2XZT G;  4CYM D;  2XEH A;  4O60 A;  5EIL A;  3HRA A;  1AP7 A;  2DWZ A;  1OY3 D;  5FIN A;  3W9G A;  1BI7 B;  5D66 A;  4RLY A;  3Q9U C;  5AAR A;  1YMP A;  4N5Q A;  1G3N B;  4BSZ B;  4K5B A;  5AQB A;  3V31 A;  2ETB A;  3ZU7 B;  4Z68 A;  5CEC B;  3ZKJ A;  1MX6 A;  2ETA A;  2F37 A;  1K1B A;  2F8Y A;  5AQ7 A;  1A5E A;  4BEP A;  5AQA A;  1WG0 A;  4DX1 A;  3V79 K;  4OAV B;  3TWS A;  3D9H A;  5ENO D;  4G8K A;  4BER A;  4DRX E;  4K5C A;  3W9F A;  4HB5 A;  3UI2 A;  3HG0 D;  1IKN D;  5AQ9 A;  2NYJ A;  4C48 B;  3V2X A;  3ZUV B;  1IHB A;  4ATZ D;  3DEP A;  2P2C P;  5KNG A;  2ETC A;  4NIK A;  4QFV A;  1OT8 A;  2Y1L E;  3B7B A;  4DX5 D;  5CBO A;  3DEO A;  2KBX A;  1DCQ A;  1S70 B;  2MYO A;  3TWV A;  4HRM B;  3SO8 A;  5EYL A;  3UTM A;  4U95 D;  5CEA A;  3TWW A;  3EHR A;  1K1A A;  2BKK B;  4O1P A;  4YDY A;  2Y0B G;  2RFA A;  4CZ2 D;  5BXO A;  1MX4 A;  1SVX A;  4HI8 A;  4J7W A;  2ZGD A;  3F6Q A;  3J5Q B;  5KNH D;  1YYH A;  2DZN A;  1UOH A;  4LSZ E;  1MJ0 A;  4DX2 A;  4ZHB A;  4K5A B;  1YCS B;  4TUM A;  4DUI A;  5CER B;  1BI8 B;  2XEN A;  3V2O A;  3C5R A;  3IXE A;  3J5P A;  4G8L A;  5EID A;  5AN8 A;  4BET A;  3NOC D;  3Q9N C;  2DZO A;  3TWT A;  4HNA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...