2JABA

A designed ankyrin repeat protein evolved to picomolar affinity to her2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
124
structure length
124
Chain Sequence
b'SDLGKKLLEAARAGQDDEVRILMANGADVNAKDEYGLTPLYLATAHGHLEIVEVLLKNGADVNAVDAIGFTPLHLAAFIGHLEIAEVLLKHGADVNAQDKFGKTAFDISIGNGNEDLAEILQKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H10-2-G3
publication title A Designed Ankyrin Repeat Protein Evolved to Picomolar Affinity to Her2
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 41
structure length 124
sequence length 124
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2jabA00
3EHRA 4O1PA 4O60A 4DX5D 4OAUC 4GMRA 1N11A 1N0RA 3ZNGA 4DUIA 4HLLA 3JXJA 3NBNB 3V30A 1BI8B 5JA4D 2RFMA 1DCQA 4HRMB 4BSZB 1YYHA 4HBDA 4HRNA 4K5BA 5CBNA 3AAAC 3W9GA 2P2CP 3SO8A 5CBOA 2XENA 4NIKA 5HRYA 1MX4A 3W9FA 4N5QA 5ENTD 4DX2A 4HQDA 5AN8A 4DX1A 2QYJA 4K5CA 5ENOD 3ZU7B 5FIOA 3T8KA 2NYJA 3Q9NC 5ENSD 3V2OA 2ETBA 4BESA 4J7WA 5CEDB 3J5QB 4ZHBA 4G8LA 2RFAA 3EHQA 4U8VD 3J5PA 4F6RD 1MX2A 4ZFHA 3KEAA 3ZKJA 5EYPF 5ENRD 5JMND 2F8YA 5BXOA 5EIBE 3V31A 5CEAA 4Z68A 1NFIE 1G3NB 1N0QA 2Y0BG 4RLYA 2Y1LE 3TWUA 1YCSB 5KBAA 5CECB 4HNAD 3TWVA 3V2XA 2XEEA 2V4HC 2ZGDA 3F6QA 1S70B 3UTMA 4B93B 3B95A 3JXIA 1K1BA 2XZDG 4YDWA 4C48B 1QYMA 3TWSA 2BKGA 2ETAA 5CERB 1OY3D 3LJNA 2KXPC 4LSZE 5FINA 1IXVA 3V79K 4UUCA 1DC2A 5EILA 4BEPA 5HS0A 4TUMA 3TWWA 3T9KA 3TWQA 1BU9A 3IXEA 5EYLA 4G8KA 1YMPA 4QQIA 3EU9A 4YDYA 3NOCD 2XZTG 5ITZF 1MYOA 2MYOA 3JUEA 4HRLA 3D9HA 4HI9A 4JB8P 3TWRA 1K3ZD 3B7BA 2J8SD 2L6BA 3DEOA 1IHBA 2QC9A 5EIDA 4BETA 1AWCB 4HI8A 2DWZA 4O1OA 1MJ0A 5ENPD 5AAOA 2VGEA 1A5EA 1D9SA 5AQ9A 3HRAA 1K1AA 5ENQD 3TWXA 1AP7A 2JABA 1SVXA 3C5RA 4HB5A 5AQBA 2XEHA 1BLXB 5HKPA 1BD8A 1UOHA 2AJAA 4CYMD 4OAVB 4BERA 4U95D 1WG0A 3HG0D 4U8YD 4F1PA 4DX6D 3NOGD 4QFVA 4U96D 4DRXE 2FO1E 3ZUVB 1TR4A 4GPMA 2B0OE 5AQ7A 1SW6A 2A5EA 5KNGA 5BXUA 4A63B 1WDYA 2F37A 1OT8A 4J8YA 1MX6A 2BKKB 4CZ2D 4ATZD 2DVWA 5AARA 3Q9UC 2DZOA 2F8XK 2PNNA 2ZGGA 4K5AB 2KBXA 1BI7B 5EN5D 5D66A 2HE0A 2V5QC 5KWDA 2DZNA 3UXGA 2ETCA 3UI2A 4LNUD 5AQAA 3AJIA 4LG6A 1IKND 3TWTA 4DX7D 5KNHD 3DEPA
chains in the Genus database with same CATH superfamily
3CVPA 3AS4A 4BT9A 3FUHA 4GTSA 4AJWA 3QK0A 1TJCA 5FZSA 5T4YA 1MX4A 4ME2A 4AY6A 3S7FA 2H6GA 5KJKA 2V8SE 1U2VG 3IBEA 2VTBA 2FBNA 3MKQB 3FTZA 4WNFA 5AIJA 5B1AE 4HOSA 3FUDA 3PZ2A 3HXEA 4GA2A 3C98A 1OXJA 3PUJA 3UTMA 3FDHA 3RIBA 2XRYA 1KPSB 1OCCE 3ULQA 1HXIA 2VGYA 4MBGA 4P29A 4FULA 2XS8A 3TWQA 3AU5A 3VTXA 3MZLB 4E85A 1EYHA 3QDNA 2YHCA 1A5EA 4N2SA 2VSYA 3RKVA 1HX8A 2PQNA 2QYUA 1IQRA 2EIJE 4GPMA 3ASDA 5BNWA 4AV7A 3NZSA 5E75A 5BPPA 4UWLA 4GZ3A 3CSFA 3PREA 4CGVA 2F8XK 3IHVA 4K5AB 4HOTA 3QC1A 3JQ1A 2Y3AA 4GMLA 5AQAA 3SHFA 4UQZA 4DX5D 1XNFA 2WVIA 3ZNGA 2P9LG 5JA4D 4U63A 4HBDA 5CBNA 3RRMB 1N4SA 4MRUA 3BG1B 1HZ4A 3QNKA 1TEZA 3C3OA 1NL4A 3LKUA 2MOWA 3T8KA 3DPYA 1TN8A 3KS2A 3UQ3A 5BV1A 3ZKJA 4DLQA 4EZLA 4LCTA 2V5FA 2I1JA 3TWUA 2V4HC 5KJNA 3AS8A 3B7TA 1FPPA 1D8EA 5G04C 1MZCA 4R7LA 1OY3D 2F0YA 2BEDA 2AW6A 1H2VC 1Y8MA 4APOA 3DSXA 1SQMA 4KZCA 5CCLA 4BETA 4GMJA 3FUMA 5CRUA 3FTSA 3TWXA 1SVXA 2V0PA 3HVEA 3S7JA 3CVLA 2WXMA 3L9TA 4Y6WA 1N4RA 2ZXWE 3ZUVB 2B0OE 2IEJA 1SW6A 2IO3C 2A5EA 3FTWA 1LD8A 2J49A 4GYYA 4GTPA 2WXPA 1SZAA 3NF1A 2XPIA 1HH8A 3Q73A 1BI7B 4FHJA 3APDA 4JHKA 2P9KG 3HXFA 3DEPA 1N0RA 3ML9A 5J08A 3Q7FA 3V30A 4BSZB 1O1RA 4UWGA 3VTYA 2L0IA 2YQ8A 3AG2E 3QJZA 2VTBB 3ZXSA 3LPZA 4N5CA 1HS6A 5JMND 4Z68A 1NFIE 4RLYA 4F53A 3TWVA 3V2XA 4GZCA 2P58C 2R17C 3MV3B 4EBAG 2IONA 3UX4A 1IXVA 1OCZE 5CMYA 4BEPA 2AVPA 3N71A 3MEKA 4JHJA 1OCRE 1TNUA 5JHAA 3HRAA 4RG9A 4CYMD 2HR2A 1LF8A 1WG0A 4F1PA 1HO8A 4QFVA 3EHMA 3TAXA 4TRQA 4CT4A 3PEUB 1NI1A 4HLEA 3D9JA 2DZOA 2LNIA 3B13A 5D66A 2H6HA 2WQ7A 3SY2A 2I2OA 4GTOA 1S63A 1EPUA 3SQVA 3L6AA 3RSEG 4JC8A 2IQCA 3HXCA 4OVUA 4I9CA 4DX2A 3FTVA 4LERA 3PEVB 3AG3E 4BTAA 4F1SA 3ZN3A 3QKYA 4I6GA 3V2OA 5CEDB 3C3QA 2CHXA 4GA1A 4EQFA 5CECB 4G1TA 3F6QA 4G2VA 3P2BA 5DIZA 1B89A 4RVBA 3B95A 5G05J 3MA5A 1P5QA 3IXEA 1FVFA 4QQIA 2P9UG 3LEWA 2VGXB 2WMOA 4XKCA 3ZVVA 4XE0A 3B7BA 1HG5A 2GRRB 2OCCE 3R9MA 4AVXA 1UN8A 4HVBA 2R5SA 5FQ4A 4GYOA 4DLOA 2JABA 3HVEB 3EIQC 1UOHA 4B94A 3L22A 4GCNA 3OXLA 3MGBA 1E8ZA 2EIKE 4G25A 4AXHA 2KC7A 3FHEA 3MX3A 4B8CB 1IYGA 4PDXA 5DBKA 4WUYA 3FUNA 2NC9A 4GTMA 2XGSA 4KVMA 3AJIA 2R59A 4O1PA 4I6JA 4XX5A 3ASOE 2FEZA 5FTPA 2DCPA 2WXNA 1EDUA 1WY6A 3CKBA 1RZ4A 3PRZA 3BUAA 1N4QA 4J7WA 3Q78A 4G8LA 3FU0A 5T8IA 1H19A 3BEEA 4PS8A 1G3NB 5FJYA 2IU1A 3PZ1A 3MYVA 4B93B 3PE3A 3I4GA 3CLJA 3NQPA 3DRAA 4GA0A 4EBAA 2ETAA 4LSZE 3ONKA 2PQRA 2Q7FA 4L1BA 4FP7A 4KVOA 2KATA 5ITZF 3T8MA 3ZYLA 4HI9A 2WPVA 3BU8A 4GYWA 2FF4A 3LXUX 1HU3A 4G24A 2OEWA 1OUVA 3ZPJA 3CHQA 3Q47B 1QZ2A 3DXMG 5AQBA 2LO6A 3DSSA 3HG0D 3LVRE 3HIZA 3S7DA 3TXNA 4GTQA 3L16A 3FH7A 3CVXA 3AU4A 5ARGA 4OVVA 3FTUA 1TNBA 4A63B 3EU5A 2F37A 4BT8A 3I3NA 2DYSE 2BKKB 5EDSA 3R7RA 3LS8A 2KBXA 3CQCB 5EN5D 5G55A 3WG7E 4JA7A 4LNUD 4LG6A 3Q7AA 3VLDA 2KZTA 5FZQA 1H0AA 5A6CA 4GB9A 3NBNB 4Q69A 4C0MA 3OXGA 1BPOA 2ZIRA 3FUJA 4HFGA 4TXRA 5AN8A 4EECA 5FIOA 3Q9NC 2JEKA 3D9NA 4ANXA 3URZA 5HQ8A 1NA0A 5ENRD 2F8YA 2Y69E 2Y1LE 3LJ3A 3Q5MA 1JUQA 1S70B 2I9CA 1KLXA 4LEUA 3D9KA 4YNDA 3IV0A 2KCLA 1FT1A 1TNZA 5AYWD 3L08A 4YDYA 1H2TC 4EHMA 3UKRG 2MYOA 5BT1A 5J90A 3SGHA 3ZYKA 4CEMA 3RAUA 2J8SD 3EDTB 4O1OA 5ENPD 2ZU6B 3FFLA 3FUFA 1BLXB 1OWOA 3QARA 2FO7A 3G2TA 1UW4B 3G2WA 3FY4A 1OWNA 5C2YA 4J8YA 1Q2ZA 2WMNA 4ATZD 4GPKA 1E7UA 2PNNA 5FQ6A 3UINC 5BUZA 2V4LA 5LFAA 4FJZA 3JQ0A 3EHRA 4HLLA 3PS6A 3I5PA 3SO8A 3T5VA 4BTBA 4B8AA 2PM7A 4PS3A 2X3MA 4LUNU 3JCKC 2XEVA 2J08A 4K0RA 2BF0X 3UIPC 3KD7A 5EIBE 4DPRA 4ILGA 3RO3A 3C3RA 4WWPA 4JL0A 3CKCA 1D8DA 4GZ5A 3PZ3A 3U66A 5D2MC 2AXVA 2H6IA 2KXPC 5B3SE 3V79K 1Z5SC 2KCVA 3CK8A 4RQIA 4BX8A 5LCWJ 4JB8P 3AS5A 2L6BA 1IHBA 1MJ0A 1QBQA 1U3CA 2IF4A 4CT0A 2XEHA 5JJ6A 2I6HA 2WB2A 2P9NG 4I1MA 4EPZA 2E2EA 4ANUA 2VYIA 3L13A 5AQ7A 2DIWA 5CMWA 5G05C 2HM8A 3MKRA 4UI9J 3D9LA 3CK7A 2CFZA 2GRLA 2KZTB 4BY6A 3UM0A 2YINA 1WM5A 4DUIA 1N94A 4GU5A 2QY7A 3ZYQA 3HHMA 1HE8A 2WXJA 3SI5A 5T3RA 4KZ0A 3DSUA 4DJAA 2XPYA 3J5QB 4ZFHA 5BXOA 5B1BE 4J8FA 3T5XA 4HXIA 3KSQA 3UM1A 4LNBA 2IOLA 2XEEA 2XGMA 4GZ6A 1ELRA 2JLBA 3QWPA 3FH8A 3QWVA 4I2ZA 2GGFA 3TXMA 4U7EB 3ULYA 2RD0A 1HFAA 4KYOB 4JEUA 3SZ7A 3DPDA 5HS0A 4TUMA 3UPVA 1E7VA 3NOCD 4Y6CA 3CVWA 4IYPA 1AWCB 2C0MA 3DBSA 2I1KA 4FLHA 5HKPA 1GW6A 4OAVB 2XRZA 4JD2G 3UT4A 4U8YD 3SBTB 3NOGD 4EZKA 4J0UA 5E76A 4NRHB 1MQSA 3ZYMA 4CDMA 1QQEA 2J09A 4YDOA 3U4TA 2WXHA 3PE4A 3L82A 2E0IA 3CEQA 3CVVA 3JYSA 2WXFA 2DVWA 2AXUA 2H6FA 4U0ZA 3UIOC 2EINE 3LYAA 3UI2A 4DX7D 3Q4AB 2CG3A 2B6CA 3L17A 3NB2A 4F3VA 1DCQA 3ZRHA 4K5BA 4BWRA 2J4BA 3CVUA 2XS1A 3D3MA 4I17A 4WWOA 3FH5A 3ABKE 2ETBA 1FCHA 1OWMA 4BESA 4ACLA 4U8VD 2R03A 4G11A 4RG6A 4N3CA 1RW2A 4HNAD 4CCAA 4ILIA 4V3IA 2HYZA 1V55E 2LXLA 3ASHA 1HG2A 3CQGB 3CIAA 4C48B 4YDWA 3LY9A 3FUKA 2CG2A 3TWSA 5CERB 3U64A 2KCKA 4WWNA 3PDNA 4OYSA 1BU9A 4M7CA 5G2NA 2DBAA 4C0EA 3D9HA 1JCRA 4WAFA 4GZDA 1UJJA 2RG8A 3EJNA 3O4ZA 3CVQA 3Q49B 4HI8A 1HF8A 4HORA 3ZW3A 1SA5A 3UM3A 2AJAA 4BERA 5JHBA 3UMVA 5CRVA 3HYMB 1ZU2A 4WNDA 1XGWA 2WXRA 2AWIA 2FO1E 1TN6A 3ONLA 3PVLA 4B89A 4EZJA 3SNXA 3QB2A 5FQ8A 1ELWA 4A3TA 5FT9A 4L7TA 3LY8A 1JPLA 1KT0A 3Q75A 3L54A 5KJMA 3EUVA 4J8DA 4ACKA 4GMRA 1N11A 1ZBPA 3EIJA 3FU3A 3BQOA 1BI8B 3FTYA 1KT1A 4HRNA 1JCSA 3NAWA 3G2SA 4XZ4A 4NIKA 3D9MA 3FU5A 2QZAA 2NYJA 1N54A 3TGOA 3APFA 2PL2A 4FADA 2L9BA 3J5PA 3SF4A 3V31A 1Z3XA 4U04A 1V54E 1YCSB 3AG4E 3E32A 1NP7A 1JWFA 4RSYA 1Y6IA 2LSVA 2XHEA 4APFA 2VSXE 4N2QA 3PZDA 3PNLB 3UT7A 3JUEA 3CGHA 3AG1E 3U3WA 2LXMA 2DWZA 3E37A 2VGEA 1D9SA 1TNOA 1K1AA 2FULA 3B7RL 1BD8A 4UI9K 4TV3A 2WXLA 5A7DB 4DX6D 4XI9A 4ABNA 2L6JA 3MV2B 5BXUA 1MHQA 1NA3A 1X5BA 5BV0A 3ISMC 4GAAA 1Z6TA 3QWWA 2VSOE 4J8EA 2LSUA 3JUIA 1VDYA 3LCAA 2CFUA 4DK5A 3FWVA 2BUGA 3CV0A 5LCWC 3D9PA 2X6HA 2HO1A 2P9IG 4I2WA 2J9QA 3W9GA 5LOZA 3W9FA 4N5QA 2VQ2A 2XQ0A 1L5JA 4K5CA 5ENOD 2NSZA 1TJFA 3E34A 5C1DA 4FA6A 1MX2A 3CHPA 3FUEA 4ANVA 3FP3A 5ARFA 4NURA 2QFCA 4UI9C 3CVNA 4JA9A 3U9WA 2WQ6A 3FEXA 2KM4A 5EILA 4L23A 2WXIA 4N39A 5ENQD 1LTXA 4I1AA 4U95D 5A23A 4PH4B 3SBSA 5ANRA 5AJDA 5CCMA 3ZFWA 3PUKA 1TN7A 1A17A 1OT8A 2OVBA 4L2LA 4AM9A 4IULA 4I6EA 1E8WA 5KWDA 2DZNA 3UUXA 3MCXA 2PZIA 4X8QA 5HI7A 1OWPA 1NZNA 4O60A 3SFYA 5M72A 2WQHA 1UJKA 2XENA 2QYJA 3TG4A 1LD7A 2WXKA 3ZU7B 3GYZA 2AXZA 4O6FA 2R05A 4ZHBA 3EHQA 4FU3A 4I1OB 2Y0BG 1EF1C 1TYQG 5KBAA 2CHZA 1INZA 2WXGA 2ZGDA 3IEGA 2GRNB 3SFXA 1W3BA 2UY1A 4H7XA 1O5MA 3IHYA 3RU0A 3FUIA 4IN3B 3SFZA 3ULEG 1JWGA 5EYLA 4G8KA 2X6FA 4GTRA 4JEHA 4U0UA 4JHRA 4HRLA 3VLEA 2P9SG 5EIDA 4BSXA 4GCOA 5AAOA 2A4ZA 2M63A 3WXXA 3G2UA 4TXPA 4HB5A 5EX3A 4XIFA 1DCEA 4L9PA 3PZ4A 4JPSA 1PAQA 3I4RB 4AOFA 3HDXA 1X81A 3RRNB 1FT2A 4G23A 3DSWA 1H6OA 1MX6A 4CZ2D 3CR3A 3ZHEA 2HE0A 3QOUA 4KT6B 3DSVA 3TWTA 2XCCA 2PM6A 4TUUA 4XI0A 4XEIG 5JJ7A 4KMOA 4CGWA 3E33A 3JXJA 2X6IA 2RFMA 4KBQA 2GROB 4ANWA 4FLBA 5HRYA 5ENTD 4HQDA 4MKTA 4H7YA 4UWHA 3CHSA 4W9RA 4GTVA 2OV8A 5ENSD 4AP2A 4JXTA 3DWLG 4L2YA 3CHRA 1UG3A 1H6PA 3EHNA 2VGXA 1E8XA 2XPZA 3GZ1A 3CVYA 4WNGA 4YVOA 2EQXA 5FWQA 2XGOA 3OAWA 4ILHB 3ZEFA 4A1SA 5AJLA 3ML8A 3T9KA 2XCBA 4HOQA 4PUCA 3FULA 3UM2A 3TWRA 2X6KA 4N3AA 4D10C 5AQ9A 2GW1A 4AY5A 4FHKA 1AP7A 2OOEA 3D9IA 3B7UX 4Q96A 1QNFA 1E8YA 3APCA 4WNEA 4DI3A 2A5UA 3FTXA 4MS6A 1S64A 3B7SA 1N95A 4HS2A 3CHMA 5KCMA 4I43A 3CSTA 4NQ0A 2FI7A 4HOUA 2ZGGA 3GZSA 2IFUA 1IKND 1UN9A 5KNHD 4OAUC 5EKQD 4BFRA 4LRZA 4FC8A 3AAAC 5CBOA 5JJTA 2IY0C 2RKKA 5H7PA 3UT8A 5BW8C 1JCQA 3D9OA 5IY5E 5FZRA 2GRMA 4F6RD 2CHWA 2ONDA 2IJGX 5CEAA 1SA4A 1ZB1A 4CDRA 5CHEE 5ANLA 4URKA 3O48A 2UY1B 4J8SA 4JW1A 2XZDG 2MHKA 1O1TA 2WXOA 1KZPA 2BKGA 4UWKA 1N4PA 3ASFA 1DC2A 2VJ8A 1PC2A 1YMPA 3EU9A 4Q94A 3LVQE 4ATGA 3ZIMA 3KAEA 2YNQA 3ABLE 3E30A 2QC9A 1H6KA 4GTTA 1PY1A 3C5RA 4U0SA 3OTNA 1S0PA 4KXKB 4FJYA 3KSLA 1TR4A 2NXPA 2J07A 3Q15A 1IHGA 3HXDA 2R2LA 3ZHEB 2ILRA 2V5QC 3UXGA 5G04J 3GW4A 3PH0C 4AIFA 2P9PG 3CHOA 1E96B 4A3VA 3PNTB 1YYHA 4LNGA 2Y4TA 4CDNA 4I9EA 4DX1A 2LAHA 4YDEA 3MKQA 3RRUA 3KEAA 4JZYA 3ABME 3S2AA 1N0QA 3G2VA 1E90A 3LDZA 3C72A 3JXIA 1K1BA 1TNYA 3LJNA 4UUCA 3P1UA 3X2QE 4C9BB 4MLPA 4DI4A 1N9AA 3ZGQA 3TWWA 3OXFA 2DYRE 4M3OA 2WM9A 4XKBA 1K3ZD 4CRWA 3QAQA 2Y4UA 2IOSA 1OWLA 3ASGA 5AENA 3ENEA 3UKUG 1N52A 5KJLA 1OCOE 1O1SA 4BX9A 1DNPA 1SZ9A 4UWFA 2MRIA 3LY7A 3FEYA 3NZUA 3Q9UC 3ASNE 2LUHA 3GZ2A 4UQYA 2EILE 4N3BA 2UWJG 2ETCA 2EIME 5ENNA 2VSNA 2GRPB 1YA0A 2GRQB 3DXKG 4B0ZA 4HRMB 5D0OD 2P2CP 3RO2A 3VLFA 1U3DA 1K8KG 2LAIA 4J6IA 5FQ7A 3KEZA 3R7QA 2RFAA 2X6JA 5EYPF 3RK6A 1WAO1 4YVQC 1DVPA 3ESKA 4JVSA 3RJVA 1IQUA 5EX0A 3TL5A 4A1GA 4F7AA 1QYMA 2J4DA 3TG5A 3E4BA 3R9AB 4TXQA 5FINA 3Q79A 3BG0B 2X38A 2IO2C 3DSTA 2C0LA 5LX8A 3ZXPA 4IRUA 2XZTG 1MYOA 3SD5A 2OVFA 2ZISA 3DEOA 3ESLA 1FVHA 3TJPA 4U8HA 4K03A 4UQXA 4E6HA 2C2LA 3CK9A 2BTDA 4U96D 3MJWA 4DRXE 2R02A 1H2UA 4U07A 1Z3YA 5KNGA 2L0TB 4AEZC 1WDYA 2OEVA 4A55A 3IKOB 4PS7A 1ELKA 2YHEA 5AARA 4NACA 3HXBA 3S7BA 3FU6A 3K9IA 5LP0A 2WXQA 4G26A 1KZOA 5D0QD
chains in the Genus database with same CATH topology
3EHRA 4O1PA 4O60A 4DX5D 4OAUC 4GMRA 1N11A 1N0RA 3ZNGA 4DUIA 4HLLA 3JXJA 3NBNB 3V30A 1BI8B 5JA4D 2RFMA 1DCQA 4HRMB 4BSZB 1YYHA 4HBDA 4HRNA 4K5BA 5CBNA 3AAAC 3W9GA 2P2CP 3SO8A 5CBOA 2XENA 4NIKA 5HRYA 1MX4A 3W9FA 4N5QA 5ENTD 4DX2A 4HQDA 5AN8A 4DX1A 2QYJA 4K5CA 5ENOD 3ZU7B 5FIOA 3T8KA 2NYJA 3Q9NC 5ENSD 3V2OA 2ETBA 4BESA 4J7WA 5CEDB 3J5QB 4ZHBA 4G8LA 2RFAA 3EHQA 4U8VD 3J5PA 4F6RD 1MX2A 4ZFHA 3KEAA 3ZKJA 5EYPF 5ENRD 5JMND 2F8YA 5BXOA 5EIBE 3V31A 5CEAA 4Z68A 1NFIE 1G3NB 1N0QA 2Y0BG 4RLYA 2Y1LE 3TWUA 1YCSB 5KBAA 5CECB 4HNAD 3TWVA 3V2XA 2XEEA 2V4HC 2ZGDA 3F6QA 1S70B 3UTMA 4B93B 3B95A 3JXIA 1K1BA 2XZDG 4YDWA 4C48B 1QYMA 3TWSA 2BKGA 2ETAA 5CERB 1OY3D 3LJNA 2KXPC 4LSZE 5FINA 1IXVA 3V79K 4UUCA 1DC2A 5EILA 4BEPA 5HS0A 4TUMA 3TWWA 3T9KA 3TWQA 1BU9A 3IXEA 5EYLA 4G8KA 1YMPA 4QQIA 3EU9A 4YDYA 3NOCD 2XZTG 5ITZF 1MYOA 2MYOA 3JUEA 4HRLA 3D9HA 4HI9A 4JB8P 3TWRA 1K3ZD 3B7BA 2J8SD 2L6BA 3DEOA 1IHBA 2QC9A 5EIDA 4BETA 1AWCB 4HI8A 2DWZA 4O1OA 1MJ0A 5ENPD 5AAOA 2VGEA 1A5EA 1D9SA 5AQ9A 3HRAA 1K1AA 5ENQD 3TWXA 1AP7A 2JABA 1SVXA 3C5RA 4HB5A 5AQBA 2XEHA 1BLXB 5HKPA 1BD8A 1UOHA 2AJAA 4CYMD 4OAVB 4BERA 4U95D 1WG0A 3HG0D 4U8YD 4F1PA 4DX6D 3NOGD 4QFVA 4U96D 4DRXE 2FO1E 3ZUVB 1TR4A 4GPMA 2B0OE 5AQ7A 1SW6A 2A5EA 5KNGA 5BXUA 4A63B 1WDYA 2F37A 1OT8A 4J8YA 1MX6A 2BKKB 4CZ2D 4ATZD 2DVWA 5AARA 3Q9UC 2DZOA 2F8XK 2PNNA 2ZGGA 4K5AB 2KBXA 1BI7B 5EN5D 5D66A 2HE0A 2V5QC 5KWDA 2DZNA 3UXGA 2ETCA 3UI2A 4LNUD 5AQAA 3AJIA 4LG6A 1IKND 3TWTA 4DX7D 5KNHD 3DEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHR A;  4O1P A;  4O60 A;  4DX5 D;  4OAU C;  4GMR A;  1N11 A;  1N0R A;  3ZNG A;  4DUI A;  4HLL A;  3JXJ A;  3NBN B;  3V30 A;  1BI8 B;  5JA4 D;  2RFM A;  1DCQ A;  4HRM B;  4BSZ B;  1YYH A;  4HBD A;  4HRN A;  4K5B A;  5CBN A;  3AAA C;  3W9G A;  2P2C P;  3SO8 A;  5CBO A;  2XEN A;  4NIK A;  5HRY A;  1MX4 A;  3W9F A;  4N5Q A;  5ENT D;  4DX2 A;  4HQD A;  5AN8 A;  4DX1 A;  2QYJ A;  4K5C A;  5ENO D;  3ZU7 B;  5FIO A;  3T8K A;  2NYJ A;  3Q9N C;  5ENS D;  3V2O A;  2ETB A;  4BES A;  4J7W A;  5CED B;  3J5Q B;  4ZHB A;  4G8L A;  2RFA A;  3EHQ A;  4U8V D;  3J5P A;  4F6R D;  1MX2 A;  4ZFH A;  3KEA A;  3ZKJ A;  5EYP F;  5ENR D;  5JMN D;  2F8Y A;  5BXO A;  5EIB E;  3V31 A;  5CEA A;  4Z68 A;  1NFI E;  1G3N B;  1N0Q A;  2Y0B G;  4RLY A;  2Y1L E;  3TWU A;  1YCS B;  5KBA A;  5CEC B;  4HNA D;  3TWV A;  3V2X A;  2XEE A;  2V4H C;  2ZGD A;  3F6Q A;  1S70 B;  3UTM A;  4B93 B;  3B95 A;  3JXI A;  1K1B A;  2XZD G;  4YDW A;  4C48 B;  1QYM A;  3TWS A;  2BKG A;  2ETA A;  5CER B;  1OY3 D;  3LJN A;  2KXP C;  4LSZ E;  5FIN A;  1IXV A;  3V79 K;  4UUC A;  1DC2 A;  5EIL A;  4BEP A;  5HS0 A;  4TUM A;  3TWW A;  3T9K A;  3TWQ A;  1BU9 A;  3IXE A;  5EYL A;  4G8K A;  1YMP A;  4QQI A;  3EU9 A;  4YDY A;  3NOC D;  2XZT G;  5ITZ F;  1MYO A;  2MYO A;  3JUE A;  4HRL A;  3D9H A;  4HI9 A;  4JB8 P;  3TWR A;  1K3Z D;  3B7B A;  2J8S D;  2L6B A;  3DEO A;  1IHB A;  2QC9 A;  5EID A;  4BET A;  1AWC B;  4HI8 A;  2DWZ A;  4O1O A;  1MJ0 A;  5ENP D;  5AAO A;  2VGE A;  1A5E A;  1D9S A;  5AQ9 A;  3HRA A;  1K1A A;  5ENQ D;  3TWX A;  1AP7 A;  2JAB A;  1SVX A;  3C5R A;  4HB5 A;  5AQB A;  2XEH A;  1BLX B;  5HKP A;  1BD8 A;  1UOH A;  2AJA A;  4CYM D;  4OAV B;  4BER A;  4U95 D;  1WG0 A;  3HG0 D;  4U8Y D;  4F1P A;  4DX6 D;  3NOG D;  4QFV A;  4U96 D;  4DRX E;  2FO1 E;  3ZUV B;  1TR4 A;  4GPM A;  2B0O E;  5AQ7 A;  1SW6 A;  2A5E A;  5KNG A;  5BXU A;  4A63 B;  1WDY A;  2F37 A;  1OT8 A;  4J8Y A;  1MX6 A;  2BKK B;  4CZ2 D;  4ATZ D;  2DVW A;  5AAR A;  3Q9U C;  2DZO A;  2F8X K;  2PNN A;  2ZGG A;  4K5A B;  2KBX A;  1BI7 B;  5EN5 D;  5D66 A;  2HE0 A;  2V5Q C;  5KWD A;  2DZN A;  3UXG A;  2ETC A;  3UI2 A;  4LNU D;  5AQA A;  3AJI A;  4LG6 A;  1IKN D;  3TWT A;  4DX7 D;  5KNH D;  3DEP A; 
#chains in the Genus database with same CATH topology
 3CVP A;  3AS4 A;  4BT9 A;  3FUH A;  4GTS A;  4AJW A;  3QK0 A;  1TJC A;  5FZS A;  5T4Y A;  1MX4 A;  4ME2 A;  4AY6 A;  3S7F A;  2H6G A;  5KJK A;  2V8S E;  1U2V G;  3IBE A;  2VTB A;  2FBN A;  3MKQ B;  3FTZ A;  4WNF A;  5AIJ A;  5B1A E;  4HOS A;  3FUD A;  3PZ2 A;  3HXE A;  4GA2 A;  3C98 A;  1OXJ A;  3PUJ A;  3UTM A;  3FDH A;  3RIB A;  2XRY A;  1KPS B;  1OCC E;  3ULQ A;  1HXI A;  2VGY A;  4MBG A;  4P29 A;  4FUL A;  2XS8 A;  3TWQ A;  3AU5 A;  3VTX A;  3MZL B;  4E85 A;  1EYH A;  3QDN A;  2YHC A;  1A5E A;  4N2S A;  2VSY A;  3RKV A;  1HX8 A;  2PQN A;  2QYU A;  1IQR A;  2EIJ E;  4GPM A;  3ASD A;  5BNW A;  4AV7 A;  3NZS A;  5E75 A;  5BPP A;  4UWL A;  4GZ3 A;  3CSF A;  3PRE A;  4CGV A;  2F8X K;  3IHV A;  4K5A B;  4HOT A;  3QC1 A;  3JQ1 A;  2Y3A A;  4GML A;  5AQA A;  3SHF A;  4UQZ A;  4DX5 D;  1XNF A;  2WVI A;  3ZNG A;  2P9L G;  5JA4 D;  4U63 A;  4HBD A;  5CBN A;  3RRM B;  1N4S A;  4MRU A;  3BG1 B;  1HZ4 A;  3QNK A;  1TEZ A;  3C3O A;  1NL4 A;  3LKU A;  2MOW A;  3T8K A;  3DPY A;  1TN8 A;  3KS2 A;  3UQ3 A;  5BV1 A;  3ZKJ A;  4DLQ A;  4EZL A;  4LCT A;  2V5F A;  2I1J A;  3TWU A;  2V4H C;  5KJN A;  3AS8 A;  3B7T A;  1FPP A;  1D8E A;  5G04 C;  1MZC A;  4R7L A;  1OY3 D;  2F0Y A;  2BED A;  2AW6 A;  1H2V C;  1Y8M A;  4APO A;  3DSX A;  1SQM A;  4KZC A;  5CCL A;  4BET A;  4GMJ A;  3FUM A;  5CRU A;  3FTS A;  3TWX A;  1SVX A;  2V0P A;  3HVE A;  3S7J A;  3CVL A;  2WXM A;  3L9T A;  4Y6W A;  1N4R A;  2ZXW E;  3ZUV B;  2B0O E;  2IEJ A;  1SW6 A;  2IO3 C;  2A5E A;  3FTW A;  1LD8 A;  2J49 A;  4GYY A;  4GTP A;  2WXP A;  1SZA A;  3NF1 A;  2XPI A;  1HH8 A;  3Q73 A;  1BI7 B;  4FHJ A;  3APD A;  4JHK A;  2P9K G;  3HXF A;  3DEP A;  1N0R A;  3ML9 A;  5J08 A;  3Q7F A;  3V30 A;  4BSZ B;  1O1R A;  4UWG A;  3VTY A;  2L0I A;  2YQ8 A;  3AG2 E;  3QJZ A;  2VTB B;  3ZXS A;  3LPZ A;  4N5C A;  1HS6 A;  5JMN D;  4Z68 A;  1NFI E;  4RLY A;  4F53 A;  3TWV A;  3V2X A;  4GZC A;  2P58 C;  2R17 C;  3MV3 B;  4EBA G;  2ION A;  3UX4 A;  1IXV A;  1OCZ E;  5CMY A;  4BEP A;  2AVP A;  3N71 A;  3MEK A;  4JHJ A;  1OCR E;  1TNU A;  5JHA A;  3HRA A;  4RG9 A;  4CYM D;  2HR2 A;  1LF8 A;  1WG0 A;  4F1P A;  1HO8 A;  4QFV A;  3EHM A;  3TAX A;  4TRQ A;  4CT4 A;  3PEU B;  1NI1 A;  4HLE A;  3D9J A;  2DZO A;  2LNI A;  3B13 A;  5D66 A;  2H6H A;  2WQ7 A;  3SY2 A;  2I2O A;  4GTO A;  1S63 A;  1EPU A;  3SQV A;  3L6A A;  3RSE G;  4JC8 A;  2IQC A;  3HXC A;  4OVU A;  4I9C A;  4DX2 A;  3FTV A;  4LER A;  3PEV B;  3AG3 E;  4BTA A;  4F1S A;  3ZN3 A;  3QKY A;  4I6G A;  3V2O A;  5CED B;  3C3Q A;  2CHX A;  4GA1 A;  4EQF A;  5CEC B;  4G1T A;  3F6Q A;  4G2V A;  3P2B A;  5DIZ A;  1B89 A;  4RVB A;  3B95 A;  5G05 J;  3MA5 A;  1P5Q A;  3IXE A;  1FVF A;  4QQI A;  2P9U G;  3LEW A;  2VGX B;  2WMO A;  4XKC A;  3ZVV A;  4XE0 A;  3B7B A;  1HG5 A;  2GRR B;  2OCC E;  3R9M A;  4AVX A;  1UN8 A;  4HVB A;  2R5S A;  5FQ4 A;  4GYO A;  4DLO A;  2JAB A;  3HVE B;  3EIQ C;  1UOH A;  4B94 A;  3L22 A;  4GCN A;  3OXL A;  3MGB A;  1E8Z A;  2EIK E;  4G25 A;  4AXH A;  2KC7 A;  3FHE A;  3MX3 A;  4B8C B;  1IYG A;  4PDX A;  5DBK A;  4WUY A;  3FUN A;  2NC9 A;  4GTM A;  2XGS A;  4KVM A;  3AJI A;  2R59 A;  4O1P A;  4I6J A;  4XX5 A;  3ASO E;  2FEZ A;  5FTP A;  2DCP A;  2WXN A;  1EDU A;  1WY6 A;  3CKB A;  1RZ4 A;  3PRZ A;  3BUA A;  1N4Q A;  4J7W A;  3Q78 A;  4G8L A;  3FU0 A;  5T8I A;  1H19 A;  3BEE A;  4PS8 A;  1G3N B;  5FJY A;  2IU1 A;  3PZ1 A;  3MYV A;  4B93 B;  3PE3 A;  3I4G A;  3CLJ A;  3NQP A;  3DRA A;  4GA0 A;  4EBA A;  2ETA A;  4LSZ E;  3ONK A;  2PQR A;  2Q7F A;  4L1B A;  4FP7 A;  4KVO A;  2KAT A;  5ITZ F;  3T8M A;  3ZYL A;  4HI9 A;  2WPV A;  3BU8 A;  4GYW A;  2FF4 A;  3LXU X;  1HU3 A;  4G24 A;  2OEW A;  1OUV A;  3ZPJ A;  3CHQ A;  3Q47 B;  1QZ2 A;  3DXM G;  5AQB A;  2LO6 A;  3DSS A;  3HG0 D;  3LVR E;  3HIZ A;  3S7D A;  3TXN A;  4GTQ A;  3L16 A;  3FH7 A;  3CVX A;  3AU4 A;  5ARG A;  4OVV A;  3FTU A;  1TNB A;  4A63 B;  3EU5 A;  2F37 A;  4BT8 A;  3I3N A;  2DYS E;  2BKK B;  5EDS A;  3R7R A;  3LS8 A;  2KBX A;  3CQC B;  5EN5 D;  5G55 A;  3WG7 E;  4JA7 A;  4LNU D;  4LG6 A;  3Q7A A;  3VLD A;  2KZT A;  5FZQ A;  1H0A A;  5A6C A;  4GB9 A;  3NBN B;  4Q69 A;  4C0M A;  3OXG A;  1BPO A;  2ZIR A;  3FUJ A;  4HFG A;  4TXR A;  5AN8 A;  4EEC A;  5FIO A;  3Q9N C;  2JEK A;  3D9N A;  4ANX A;  3URZ A;  5HQ8 A;  1NA0 A;  5ENR D;  2F8Y A;  2Y69 E;  2Y1L E;  3LJ3 A;  3Q5M A;  1JUQ A;  1S70 B;  2I9C A;  1KLX A;  4LEU A;  3D9K A;  4YND A;  3IV0 A;  2KCL A;  1FT1 A;  1TNZ A;  5AYW D;  3L08 A;  4YDY A;  1H2T C;  4EHM A;  3UKR G;  2MYO A;  5BT1 A;  5J90 A;  3SGH A;  3ZYK A;  4CEM A;  3RAU A;  2J8S D;  3EDT B;  4O1O A;  5ENP D;  2ZU6 B;  3FFL A;  3FUF A;  1BLX B;  1OWO A;  3QAR A;  2FO7 A;  3G2T A;  1UW4 B;  3G2W A;  3FY4 A;  1OWN A;  5C2Y A;  4J8Y A;  1Q2Z A;  2WMN A;  4ATZ D;  4GPK A;  1E7U A;  2PNN A;  5FQ6 A;  3UIN C;  5BUZ A;  2V4L A;  5LFA A;  4FJZ A;  3JQ0 A;  3EHR A;  4HLL A;  3PS6 A;  3I5P A;  3SO8 A;  3T5V A;  4BTB A;  4B8A A;  2PM7 A;  4PS3 A;  2X3M A;  4LUN U;  3JCK C;  2XEV A;  2J08 A;  4K0R A;  2BF0 X;  3UIP C;  3KD7 A;  5EIB E;  4DPR A;  4ILG A;  3RO3 A;  3C3R A;  4WWP A;  4JL0 A;  3CKC A;  1D8D A;  4GZ5 A;  3PZ3 A;  3U66 A;  5D2M C;  2AXV A;  2H6I A;  2KXP C;  5B3S E;  3V79 K;  1Z5S C;  2KCV A;  3CK8 A;  4RQI A;  4BX8 A;  5LCW J;  4JB8 P;  3AS5 A;  2L6B A;  1IHB A;  1MJ0 A;  1QBQ A;  1U3C A;  2IF4 A;  4CT0 A;  2XEH A;  5JJ6 A;  2I6H A;  2WB2 A;  2P9N G;  4I1M A;  4EPZ A;  2E2E A;  4ANU A;  2VYI A;  3L13 A;  5AQ7 A;  2DIW A;  5CMW A;  5G05 C;  2HM8 A;  3MKR A;  4UI9 J;  3D9L A;  3CK7 A;  2CFZ A;  2GRL A;  2KZT B;  4BY6 A;  3UM0 A;  2YIN A;  1WM5 A;  4DUI A;  1N94 A;  4GU5 A;  2QY7 A;  3ZYQ A;  3HHM A;  1HE8 A;  2WXJ A;  3SI5 A;  5T3R A;  4KZ0 A;  3DSU A;  4DJA A;  2XPY A;  3J5Q B;  4ZFH A;  5BXO A;  5B1B E;  4J8F A;  3T5X A;  4HXI A;  3KSQ A;  3UM1 A;  4LNB A;  2IOL A;  2XEE A;  2XGM A;  4GZ6 A;  1ELR A;  2JLB A;  3QWP A;  3FH8 A;  3QWV A;  4I2Z A;  2GGF A;  3TXM A;  4U7E B;  3ULY A;  2RD0 A;  1HFA A;  4KYO B;  4JEU A;  3SZ7 A;  3DPD A;  5HS0 A;  4TUM A;  3UPV A;  1E7V A;  3NOC D;  4Y6C A;  3CVW A;  4IYP A;  1AWC B;  2C0M A;  3DBS A;  2I1K A;  4FLH A;  5HKP A;  1GW6 A;  4OAV B;  2XRZ A;  4JD2 G;  3UT4 A;  4U8Y D;  3SBT B;  3NOG D;  4EZK A;  4J0U A;  5E76 A;  4NRH B;  1MQS A;  3ZYM A;  4CDM A;  1QQE A;  2J09 A;  4YDO A;  3U4T A;  2WXH A;  3PE4 A;  3L82 A;  2E0I A;  3CEQ A;  3CVV A;  3JYS A;  2WXF A;  2DVW A;  2AXU A;  2H6F A;  4U0Z A;  3UIO C;  2EIN E;  3LYA A;  3UI2 A;  4DX7 D;  3Q4A B;  2CG3 A;  2B6C A;  3L17 A;  3NB2 A;  4F3V A;  1DCQ A;  3ZRH A;  4K5B A;  4BWR A;  2J4B A;  3CVU A;  2XS1 A;  3D3M A;  4I17 A;  4WWO A;  3FH5 A;  3ABK E;  2ETB A;  1FCH A;  1OWM A;  4BES A;  4ACL A;  4U8V D;  2R03 A;  4G11 A;  4RG6 A;  4N3C A;  1RW2 A;  4HNA D;  4CCA A;  4ILI A;  4V3I A;  2HYZ A;  1V55 E;  2LXL A;  3ASH A;  1HG2 A;  3CQG B;  3CIA A;  4C48 B;  4YDW A;  3LY9 A;  3FUK A;  2CG2 A;  3TWS A;  5CER B;  3U64 A;  2KCK A;  4WWN A;  3PDN A;  4OYS A;  1BU9 A;  4M7C A;  5G2N A;  2DBA A;  4C0E A;  3D9H A;  1JCR A;  4WAF A;  4GZD A;  1UJJ A;  2RG8 A;  3EJN A;  3O4Z A;  3CVQ A;  3Q49 B;  4HI8 A;  1HF8 A;  4HOR A;  3ZW3 A;  1SA5 A;  3UM3 A;  2AJA A;  4BER A;  5JHB A;  3UMV A;  5CRV A;  3HYM B;  1ZU2 A;  4WND A;  1XGW A;  2WXR A;  2AWI A;  2FO1 E;  1TN6 A;  3ONL A;  3PVL A;  4B89 A;  4EZJ A;  3SNX A;  3QB2 A;  5FQ8 A;  1ELW A;  4A3T A;  5FT9 A;  4L7T A;  3LY8 A;  1JPL A;  1KT0 A;  3Q75 A;  3L54 A;  5KJM A;  3EUV A;  4J8D A;  4ACK A;  4GMR A;  1N11 A;  1ZBP A;  3EIJ A;  3FU3 A;  3BQO A;  1BI8 B;  3FTY A;  1KT1 A;  4HRN A;  1JCS A;  3NAW A;  3G2S A;  4XZ4 A;  4NIK A;  3D9M A;  3FU5 A;  2QZA A;  2NYJ A;  1N54 A;  3TGO A;  3APF A;  2PL2 A;  4FAD A;  2L9B A;  3J5P A;  3SF4 A;  3V31 A;  1Z3X A;  4U04 A;  1V54 E;  1YCS B;  3AG4 E;  3E32 A;  1NP7 A;  1JWF A;  4RSY A;  1Y6I A;  2LSV A;  2XHE A;  4APF A;  2VSX E;  4N2Q A;  3PZD A;  3PNL B;  3UT7 A;  3JUE A;  3CGH A;  3AG1 E;  3U3W A;  2LXM A;  2DWZ A;  3E37 A;  2VGE A;  1D9S A;  1TNO A;  1K1A A;  2FUL A;  3B7R L;  1BD8 A;  4UI9 K;  4TV3 A;  2WXL A;  5A7D B;  4DX6 D;  4XI9 A;  4ABN A;  2L6J A;  3MV2 B;  5BXU A;  1MHQ A;  1NA3 A;  1X5B A;  5BV0 A;  3ISM C;  4GAA A;  1Z6T A;  3QWW A;  2VSO E;  4J8E A;  2LSU A;  3JUI A;  1VDY A;  3LCA A;  2CFU A;  4DK5 A;  3FWV A;  2BUG A;  3CV0 A;  5LCW C;  3D9P A;  2X6H A;  2HO1 A;  2P9I G;  4I2W A;  2J9Q A;  3W9G A;  5LOZ A;  3W9F A;  4N5Q A;  2VQ2 A;  2XQ0 A;  1L5J A;  4K5C A;  5ENO D;  2NSZ A;  1TJF A;  3E34 A;  5C1D A;  4FA6 A;  1MX2 A;  3CHP A;  3FUE A;  4ANV A;  3FP3 A;  5ARF A;  4NUR A;  2QFC A;  4UI9 C;  3CVN A;  4JA9 A;  3U9W A;  2WQ6 A;  3FEX A;  2KM4 A;  5EIL A;  4L23 A;  2WXI A;  4N39 A;  5ENQ D;  1LTX A;  4I1A A;  4U95 D;  5A23 A;  4PH4 B;  3SBS A;  5ANR A;  5AJD A;  5CCM A;  3ZFW A;  3PUK A;  1TN7 A;  1A17 A;  1OT8 A;  2OVB A;  4L2L A;  4AM9 A;  4IUL A;  4I6E A;  1E8W A;  5KWD A;  2DZN A;  3UUX A;  3MCX A;  2PZI A;  4X8Q A;  5HI7 A;  1OWP A;  1NZN A;  4O60 A;  3SFY A;  5M72 A;  2WQH A;  1UJK A;  2XEN A;  2QYJ A;  3TG4 A;  1LD7 A;  2WXK A;  3ZU7 B;  3GYZ A;  2AXZ A;  4O6F A;  2R05 A;  4ZHB A;  3EHQ A;  4FU3 A;  4I1O B;  2Y0B G;  1EF1 C;  1TYQ G;  5KBA A;  2CHZ A;  1INZ A;  2WXG A;  2ZGD A;  3IEG A;  2GRN B;  3SFX A;  1W3B A;  2UY1 A;  4H7X A;  1O5M A;  3IHY A;  3RU0 A;  3FUI A;  4IN3 B;  3SFZ A;  3ULE G;  1JWG A;  5EYL A;  4G8K A;  2X6F A;  4GTR A;  4JEH A;  4U0U A;  4JHR A;  4HRL A;  3VLE A;  2P9S G;  5EID A;  4BSX A;  4GCO A;  5AAO A;  2A4Z A;  2M63 A;  3WXX A;  3G2U A;  4TXP A;  4HB5 A;  5EX3 A;  4XIF A;  1DCE A;  4L9P A;  3PZ4 A;  4JPS A;  1PAQ A;  3I4R B;  4AOF A;  3HDX A;  1X81 A;  3RRN B;  1FT2 A;  4G23 A;  3DSW A;  1H6O A;  1MX6 A;  4CZ2 D;  3CR3 A;  3ZHE A;  2HE0 A;  3QOU A;  4KT6 B;  3DSV A;  3TWT A;  2XCC A;  2PM6 A;  4TUU A;  4XI0 A;  4XEI G;  5JJ7 A;  4KMO A;  4CGW A;  3E33 A;  3JXJ A;  2X6I A;  2RFM A;  4KBQ A;  2GRO B;  4ANW A;  4FLB A;  5HRY A;  5ENT D;  4HQD A;  4MKT A;  4H7Y A;  4UWH A;  3CHS A;  4W9R A;  4GTV A;  2OV8 A;  5ENS D;  4AP2 A;  4JXT A;  3DWL G;  4L2Y A;  3CHR A;  1UG3 A;  1H6P A;  3EHN A;  2VGX A;  1E8X A;  2XPZ A;  3GZ1 A;  3CVY A;  4WNG A;  4YVO A;  2EQX A;  5FWQ A;  2XGO A;  3OAW A;  4ILH B;  3ZEF A;  4A1S A;  5AJL A;  3ML8 A;  3T9K A;  2XCB A;  4HOQ A;  4PUC A;  3FUL A;  3UM2 A;  3TWR A;  2X6K A;  4N3A A;  4D10 C;  5AQ9 A;  2GW1 A;  4AY5 A;  4FHK A;  1AP7 A;  2OOE A;  3D9I A;  3B7U X;  4Q96 A;  1QNF A;  1E8Y A;  3APC A;  4WNE A;  4DI3 A;  2A5U A;  3FTX A;  4MS6 A;  1S64 A;  3B7S A;  1N95 A;  4HS2 A;  3CHM A;  5KCM A;  4I43 A;  3CST A;  4NQ0 A;  2FI7 A;  4HOU A;  2ZGG A;  3GZS A;  2IFU A;  1IKN D;  1UN9 A;  5KNH D;  4OAU C;  5EKQ D;  4BFR A;  4LRZ A;  4FC8 A;  3AAA C;  5CBO A;  5JJT A;  2IY0 C;  2RKK A;  5H7P A;  3UT8 A;  5BW8 C;  1JCQ A;  3D9O A;  5IY5 E;  5FZR A;  2GRM A;  4F6R D;  2CHW A;  2OND A;  2IJG X;  5CEA A;  1SA4 A;  1ZB1 A;  4CDR A;  5CHE E;  5ANL A;  4URK A;  3O48 A;  2UY1 B;  4J8S A;  4JW1 A;  2XZD G;  2MHK A;  1O1T A;  2WXO A;  1KZP A;  2BKG A;  4UWK A;  1N4P A;  3ASF A;  1DC2 A;  2VJ8 A;  1PC2 A;  1YMP A;  3EU9 A;  4Q94 A;  3LVQ E;  4ATG A;  3ZIM A;  3KAE A;  2YNQ A;  3ABL E;  3E30 A;  2QC9 A;  1H6K A;  4GTT A;  1PY1 A;  3C5R A;  4U0S A;  3OTN A;  1S0P A;  4KXK B;  4FJY A;  3KSL A;  1TR4 A;  2NXP A;  2J07 A;  3Q15 A;  1IHG A;  3HXD A;  2R2L A;  3ZHE B;  2ILR A;  2V5Q C;  3UXG A;  5G04 J;  3GW4 A;  3PH0 C;  4AIF A;  2P9P G;  3CHO A;  1E96 B;  4A3V A;  3PNT B;  1YYH A;  4LNG A;  2Y4T A;  4CDN A;  4I9E A;  4DX1 A;  2LAH A;  4YDE A;  3MKQ A;  3RRU A;  3KEA A;  4JZY A;  3ABM E;  3S2A A;  1N0Q A;  3G2V A;  1E90 A;  3LDZ A;  3C72 A;  3JXI A;  1K1B A;  1TNY A;  3LJN A;  4UUC A;  3P1U A;  3X2Q E;  4C9B B;  4MLP A;  4DI4 A;  1N9A A;  3ZGQ A;  3TWW A;  3OXF A;  2DYR E;  4M3O A;  2WM9 A;  4XKB A;  1K3Z D;  4CRW A;  3QAQ A;  2Y4U A;  2IOS A;  1OWL A;  3ASG A;  5AEN A;  3ENE A;  3UKU G;  1N52 A;  5KJL A;  1OCO E;  1O1S A;  4BX9 A;  1DNP A;  1SZ9 A;  4UWF A;  2MRI A;  3LY7 A;  3FEY A;  3NZU A;  3Q9U C;  3ASN E;  2LUH A;  3GZ2 A;  4UQY A;  2EIL E;  4N3B A;  2UWJ G;  2ETC A;  2EIM E;  5ENN A;  2VSN A;  2GRP B;  1YA0 A;  2GRQ B;  3DXK G;  4B0Z A;  4HRM B;  5D0O D;  2P2C P;  3RO2 A;  3VLF A;  1U3D A;  1K8K G;  2LAI A;  4J6I A;  5FQ7 A;  3KEZ A;  3R7Q A;  2RFA A;  2X6J A;  5EYP F;  3RK6 A;  1WAO 1;  4YVQ C;  1DVP A;  3ESK A;  4JVS A;  3RJV A;  1IQU A;  5EX0 A;  3TL5 A;  4A1G A;  4F7A A;  1QYM A;  2J4D A;  3TG5 A;  3E4B A;  3R9A B;  4TXQ A;  5FIN A;  3Q79 A;  3BG0 B;  2X38 A;  2IO2 C;  3DST A;  2C0L A;  5LX8 A;  3ZXP A;  4IRU A;  2XZT G;  1MYO A;  3SD5 A;  2OVF A;  2ZIS A;  3DEO A;  3ESL A;  1FVH A;  3TJP A;  4U8H A;  4K03 A;  4UQX A;  4E6H A;  2C2L A;  3CK9 A;  2BTD A;  4U96 D;  3MJW A;  4DRX E;  2R02 A;  1H2U A;  4U07 A;  1Z3Y A;  5KNG A;  2L0T B;  4AEZ C;  1WDY A;  2OEV A;  4A55 A;  3IKO B;  4PS7 A;  1ELK A;  2YHE A;  5AAR A;  4NAC A;  3HXB A;  3S7B A;  3FU6 A;  3K9I A;  5LP0 A;  2WXQ A;  4G26 A;  1KZO A;  5D0Q D; 
#chains in the Genus database with same CATH homology
 3EHR A;  4O1P A;  4O60 A;  4DX5 D;  4OAU C;  4GMR A;  1N11 A;  1N0R A;  3ZNG A;  4DUI A;  4HLL A;  3JXJ A;  3NBN B;  3V30 A;  1BI8 B;  5JA4 D;  2RFM A;  1DCQ A;  4HRM B;  4BSZ B;  1YYH A;  4HBD A;  4HRN A;  4K5B A;  5CBN A;  3AAA C;  3W9G A;  2P2C P;  3SO8 A;  5CBO A;  2XEN A;  4NIK A;  5HRY A;  1MX4 A;  3W9F A;  4N5Q A;  5ENT D;  4DX2 A;  4HQD A;  5AN8 A;  4DX1 A;  2QYJ A;  4K5C A;  5ENO D;  3ZU7 B;  5FIO A;  3T8K A;  2NYJ A;  3Q9N C;  5ENS D;  3V2O A;  2ETB A;  4BES A;  4J7W A;  5CED B;  3J5Q B;  4ZHB A;  4G8L A;  2RFA A;  3EHQ A;  4U8V D;  3J5P A;  4F6R D;  1MX2 A;  4ZFH A;  3KEA A;  3ZKJ A;  5EYP F;  5ENR D;  5JMN D;  2F8Y A;  5BXO A;  5EIB E;  3V31 A;  5CEA A;  4Z68 A;  1NFI E;  1G3N B;  1N0Q A;  2Y0B G;  4RLY A;  2Y1L E;  3TWU A;  1YCS B;  5KBA A;  5CEC B;  4HNA D;  3TWV A;  3V2X A;  2XEE A;  2V4H C;  2ZGD A;  3F6Q A;  1S70 B;  3UTM A;  4B93 B;  3B95 A;  3JXI A;  1K1B A;  2XZD G;  4YDW A;  4C48 B;  1QYM A;  3TWS A;  2BKG A;  2ETA A;  5CER B;  1OY3 D;  3LJN A;  2KXP C;  4LSZ E;  5FIN A;  1IXV A;  3V79 K;  4UUC A;  1DC2 A;  5EIL A;  4BEP A;  5HS0 A;  4TUM A;  3TWW A;  3T9K A;  3TWQ A;  1BU9 A;  3IXE A;  5EYL A;  4G8K A;  1YMP A;  4QQI A;  3EU9 A;  4YDY A;  3NOC D;  2XZT G;  5ITZ F;  1MYO A;  2MYO A;  3JUE A;  4HRL A;  3D9H A;  4HI9 A;  4JB8 P;  3TWR A;  1K3Z D;  3B7B A;  2J8S D;  2L6B A;  3DEO A;  1IHB A;  2QC9 A;  5EID A;  4BET A;  1AWC B;  4HI8 A;  2DWZ A;  4O1O A;  1MJ0 A;  5ENP D;  5AAO A;  2VGE A;  1A5E A;  1D9S A;  5AQ9 A;  3HRA A;  1K1A A;  5ENQ D;  3TWX A;  1AP7 A;  2JAB A;  1SVX A;  3C5R A;  4HB5 A;  5AQB A;  2XEH A;  1BLX B;  5HKP A;  1BD8 A;  1UOH A;  2AJA A;  4CYM D;  4OAV B;  4BER A;  4U95 D;  1WG0 A;  3HG0 D;  4U8Y D;  4F1P A;  4DX6 D;  3NOG D;  4QFV A;  4U96 D;  4DRX E;  2FO1 E;  3ZUV B;  1TR4 A;  4GPM A;  2B0O E;  5AQ7 A;  1SW6 A;  2A5E A;  5KNG A;  5BXU A;  4A63 B;  1WDY A;  2F37 A;  1OT8 A;  4J8Y A;  1MX6 A;  2BKK B;  4CZ2 D;  4ATZ D;  2DVW A;  5AAR A;  3Q9U C;  2DZO A;  2F8X K;  2PNN A;  2ZGG A;  4K5A B;  2KBX A;  1BI7 B;  5EN5 D;  5D66 A;  2HE0 A;  2V5Q C;  5KWD A;  2DZN A;  3UXG A;  2ETC A;  3UI2 A;  4LNU D;  5AQA A;  3AJI A;  4LG6 A;  1IKN D;  3TWT A;  4DX7 D;  5KNH D;  3DEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...