4GA2A

Structure of the n-terminal domain of nup358
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
144
structure length
144
Chain Sequence
b'RRSKADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAVYKLKEQLLDCEGED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-PROTEIN LIGASE RANBP2
publication title Crystal structure of the N-terminal domain of Nup358/RanBP2.
pubmed doi rcsb
source organism Pan troglodytes
molecule tags Transport protein
total genus 56
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ga2A00
4U04A 3CV0A 1KT0A 1FCHA 4G23A 5AYWD 4G26A 4HOUA 3S7FA 2E2EA 3CK8A 3EDTB 4WUYA 2C0MA 4A1SA 4CGWA 4G1TA 2XGMA 3TAXA 2R5SA 4AY6A 3PDNA 2LSVA 3ASGA 3UQ3A 3JYSA 3LY7A 3O48A 2HYZA 3URZA 4BTAA 4WNDA 4RG9A 4EQFA 3RIBA 4ME2A 1Y8MA 5G05J 3MV3B 5CHEE 2Q7FA 5C1DA 3S7BA 2KCVA 5ARGA 1HZ4A 5G05C 2UWJG 3OXGA 4XI0A 4NQ0A 1WM5A 3Q5MA 1QZ2A 3QKYA 1QQEA 2PL2A 2XGSA 2VGXA 3GW4A 1ZU2A 2OOEA 1HXIA 3CK9A 2PQNA 2QFCA 3BEEA 3RO3A 1YA0A 4J8EA 2PQRA 3U4TA 4ABNA 4AIFA 2IFUA 4APOA 4YNDA 3LYAA 5D0QD 3ZN3A 4G25A 3VTYA 2NC9A 1W3BA 2YHCA 3ASHA 3GYZA 4N2QA 4AM9A 3KD7A 3S7JA 4GZ6A 5EX3A 3KS2A 5D0OD 3FWVA 3NF1A 2GW1A 3ZHEA 3TGOA 4J8DA 1TJCA 3LKUA 2VSYA 3AS8A 3RJVA 3ESKA 3R9AB 4H7XA 5FZRA 3ASDA 4HOQA 3QWPA 2P58C 3RKVA 2FBNA 3RO2A 2YQ8A 4I9EA 4KXKB 4GYOA 2FF4A 3CVNA 4N3CA 2L6JA 4BTBA 2XEVA 3GZ2A 5A7DB 2VGYA 2ONDA 4J0UA 4AY5A 4GA0A 5LCWJ 4HOTA 4RG6A 5DIZA 5LCWC 5HI7A 2KCLA 4Y6CA 3LCAA 4GYYA 4GA2A 1IYGA 4KBQA 3CEQA 4G24A 3LPZA 3MV2B 4CDRA 3CVPA 4GCOA 2C2LA 3HYMB 4H7YA 2WPVA 5JJ7A 2XPIA 4UI9K 4GA1A 3AS5A 3TG4A 4O6FA 4IN3B 2C0LA 2XCCA 4BT8A 5KJNA 3FFLA 4WNFA 1NA0A 1B89A 5JJ6A 3Q49B 3FP3A 1P5QA 3MKRA 3Q47B 5FZSA 2XGOA 4UI9J 2J9QA 1NA3A 2VGXB 2DBAA 1PC2A 2UY1A 5KJLA 4UI9C 3QWVA 4UQXA 4YVOA 3TG5A 5BW8C 2KCKA 2PZIA 2FI7A 2KC7A 3ZPJA 2VYIA 4I1AA 3IEGA 3Q4AB 4UQYA 3LY9A 4N39A 5DBKA 4GZ5A 4CGVA 4YVQC 3ZFWA 3LY8A 5CCLA 3ZHEB 2HR2A 4U0SA 1OUVA 4U07A 1HH8A 5JJTA 2VQ2A 5FZQA 1IHGA 5BNWA 4I9CA 3Q15A 3VTXA 4J8FA 3CK7A 1WAO1 5A6CA 3QDNA 3ULQA 3UPVA 5CCMA 4F3VA 2I6HA 4BWRA 4XIFA 3N71A 4N5CA 3K9IA 2Y4UA 4N3BA 4JL0A 5BT1A 2Y4TA 4U0UA 4BT9A 2FO7A 5EKQD 3KAEA 4I2WA 4LEUA 2HO1A 5FT9A 3U3WA 4JA7A 4WNGA 4GYWA 2AVPA 1KLXA 1ZBPA 2IF4A 4Y6WA 3SF4A 3MA5A 2BUGA 1KT1A 4G2VA 4KYOB 4I2ZA 3CKBA 2MHKA 3ASFA 4U0ZA 4NRHB 4N2SA 3PE3A 2KATA 3OXLA 5HQ8A 4UQZA 5M72A 1A17A 4GCNA 5KJKA 3GZ1A 4JHRA 5G04J 3SZ7A 3PE4A 3OXFA 3QOUA 3MEKA 2UY1B 4W9RA 3S7DA 4N3AA 1E96B 5G04C 4I17A 3E4BA 3CKCA 4B94A 2LNIA 3AS4A 2V5FA 5EX0A 1XNFA 2VSNA 4HOSA 5ARFA 2JLBA 1NZNA 1ELWA 2FEZA 4WNEA 4GZ3A 1ELRA 3QWWA 5FJYA 2XCBA 2WQHA 3UUXA 3ZGQA 4XI9A 5KJMA 3RU0A 2LSUA 3CVLA 4GPKA 3WXXA 5FTPA 4JA9A 4HORA 3CVQA
chains in the Genus database with same CATH superfamily
3V31A 4URKA 4U8HA 3ZU7B 1BPOA 4ATGA 5AYWD 3CK8A 3EDTB 5BV1A 1WDYA 2BTDA 4MKTA 3HXFA 3ASNE 4G1TA 2X6HA 3FHEA 1N4SA 3E30A 4LNBA 4XKCA 2VSXE 2LSVA 3FUMA 3JYSA 1U2VG 3LY7A 5CRUA 2F37A 2HYZA 4WNDA 1SW6A 3RIBA 3RSEG 1H6OA 3CHQA 4ME2A 5CMWA 2WXNA 5H7PA 4EHMA 3FUJA 5CHEE 2QY7A 3G2VA 5C1DA 3S7BA 2KCVA 3DWLG 5ARGA 1TNBA 5G05C 3G2UA 2UWJG 4XI0A 4NQ0A 1WM5A 3TJPA 2F8XK 5LOZA 4JZYA 1Q2ZA 5LFAA 4CT0A 2XPYA 2P2CP 1QQEA 4GMRA 4I1MA 2PQNA 1LTXA 4LNGA 5AIJA 3CVVA 5HS0A 3RO3A 4HLEA 1H0AA 2WXLA 5IY5E 4JXTA 2B0OE 5E75A 1BI8B 2NC9A 4ACKA 1N94A 1W3BA 2YHCA 3IKOB 4BSZB 1TNZA 4GZCA 3AG2E 3KD7A 1LF8A 4HVBA 1E7UA 5AJDA 3JXIA 3ZYMA 5D0OD 3FWVA 3JUEA 4LCTA 3PEUB 2J49A 3LKUA 2XRYA 3KEAA 2ZGGA 3ESKA 3FH7A 2CHZA 2WXOA 5CEDB 1INZA 3DSSA 4RLYA 5AJLA 2FBNA 2YQ8A 1VDYA 3QJZA 3ZYQA 4GYOA 4N3CA 2L6JA 3NQPA 5J90A 4XZ4A 1H2UA 4C48B 1S64A 1LD8A 3CHSA 1UJJA 4GTSA 1TEZA 2XZDG 3ZNGA 2IQCA 5DIZA 4HS2A 3CSTA 4Y6CA 4OVVA 4GA2A 4I1OB 3B7TA 1S70B 4I6EA 2I1KA 3HYMB 4YDEA 4C0EA 1EYHA 3DPYA 5JJ7A 2XPIA 3QNKA 4GTRA 1OCZE 4GTVA 5ENTD 2XCCA 4BT8A 3I5PA 3FUFA 3B7RL 3FTWA 4NIKA 5AQ7A 3W9GA 2WB2A 3RRMB 4GPMA 1BI7B 4O60A 3U66A 3SNXA 3T8KA 2BF0X 1SZ9A 1TNUA 4ACLA 4WAFA 3E33A 4JHKA 2CHXA 1NA3A 4Q96A 2V8SE 3E34A 5EIDA 3TG5A 5BW8C 1TNYA 2DIWA 2PZIA 1SQMA 2A5EA 2J4DA 3BG0B 2VYIA 5C2YA 4JEHA 4I1AA 3TWXA 3CVUA 3L82A 2PM6A 3IBEA 3ZKJA 3LY9A 2P9IG 4N39A 3RRNB 4DX5D 4LERA 1N4QA 3Q78A 3FEXA 2WXHA 3UM1A 4TUUA 2LXMA 4FP7A 4BFRA 4F53A 3U64A 4FJYA 1IHGA 1BLXB 5EYPF 3Q73A 3CK7A 3OAWA 5AQAA 3HXBA 2OVBA 3V30A 5CCMA 1D9SA 4L7TA 2I6HA 2P9NG 4LUNU 1NL4A 3NAWA 1U3DA 2IO3C 2Y4TA 3KAEA 2AXVA 4J8YA 5CBNA 3W9FA 3AU4A 5KNGA 1OWOA 1QNFA 2ZGDA 2Y69E 1N52A 2WXIA 4GYWA 3FTYA 2V5QC 4Z68A 4D10C 1KLXA 3SF4A 3MA5A 4KVMA 4FLBA 3TWUA 3EU9A 4DK5A 2Y3AA 3DXMG 2NSZA 1UW4B 4U0ZA 1WG0A 5E76A 3T5XA 5JHAA 5ENSD 4I6JA 2NYJA 3OXFA 4TXPA 1O1RA 3E4BA 4AP2A 4FADA 1IXVA 3TWSA 3ML8A 1TN6A 1XNFA 4MBGA 1RZ4A 3APFA 3PEVB 5AAOA 1PY1A 2LO6A 3FU5A 1OY3D 4WNEA 4AOFA 1ELRA 4A1GA 3DPDA 2XCBA 2EINE 3UUXA 3KSLA 1HU3A 4XI9A 5KJMA 2CHWA 4ILIA 1XGWA 2RFMA 3SY2A 1IKND 3HIZA 1O1SA 4HORA 4LG6A 3CV0A 2OEWA 1KT0A 2V4LA 4BY6A 3EU5A 2X3MA 3SHFA 3TWWA 3ASOE 1HG5A 4BX9A 4IYPA 3UKRG 3TXMA 1N0QA 3MZLB 3TWRA 3CVXA 3CHOA 2XHEA 3ASGA 3FTZA 1ZB1A 3FTXA 1KPSB 2VSOE 3URZA 4BTAA 3FEYA 1OWLA 3EHRA 4EQFA 4C9BB 1QBQA 3B7UX 3MV3B 2L0TB 2Q7FA 2EIJE 4EBAG 2Y0BG 1FVHA 3DRAA 3LS8A 3D3MA 2CFZA 3O4ZA 1S0PA 3TWVA 2ETAA 4V3IA 5ENRD 3QKYA 1RW2A 5B3SE 3R7RA 2IO2C 2XGSA 3R7QA 1N4PA 4G8LA 4JPSA 3GW4A 4KMOA 1HXIA 1MX2A 1MHQA 3BEEA 5CEAA 2KM4A 1IHBA 3U4TA 4RSYA 3PUJA 4ABNA 4YNDA 3ZN3A 4U95D 3CGHA 4G25A 3EIQC 3AAAC 1FVFA 2LXLA 5BPPA 1NI1A 3CR3A 5KWDA 3D9HA 3ZVVA 3UKUG 4AM9A 2MYOA 4A63B 2X6KA 1N9AA 3KEZA 1E8YA 4GZ6A 2WXQA 2GW1A 3L22A 3ZHEA 4HI8A 1TJCA 3RJVA 4GTTA 5EDSA 3R9AB 3X2QE 4H7XA 3U9WA 4CYMD 3ASDA 3PZ3A 2QZAA 2XEEA 3Q7AA 3P2BA 3CVNA 3MX3A 2XEVA 3GZ2A 4XKBA 4LSZE 2ONDA 5EYLA 3FTVA 1O1TA 2WQ7A 4K5AB 5LCWJ 3CQCB 4HOTA 1EPUA 2ZU6B 3ZYLA 3ZXSA 1AP7A 4PS3A 2KCLA 4BETA 4G24A 5AENA 4DX7D 4U96D 3LPZA 4CDRA 3Q7FA 3LXUX 4H7YA 2WPVA 4CT4A 4F6RD 4UI9K 3J5PA 3LJNA 3TG4A 3ZW3A 4GMLA 1DVPA 3ML9A 5BUZA 1Y6IA 2WXMA 1ELKA 5A23A 3D9IA 1OCRE 3LVQE 3FFLA 1PAQA 1NP7A 3PUKA 3JQ0A 5CERB 1SA4A 3FP3A 2AW6A 4IULA 3Q47B 5AQBA 3L17A 2WXKA 1N0RA 4P29A 3PZ4A 4GMJA 3I4GA 4TXQA 4LNUD 2YNQA 2DBAA 1PC2A 5T4YA 3UT4A 3D9LA 4UI9C 5CECB 4JHJA 4UQXA 3J5QB 5JHBA 5ENPD 4EZKA 3QK0A 3UI2A 1JUQA 3FUEA 2FI7A 2J8SD 3TWQA 3C3QA 3I4RB 2VJ8A 3S2AA 3PNLB 2WXRA 1HF8A 1N11A 3L13A 4G11A 5DBKA 4GZ5A 4CGVA 2QC9A 4CDNA 4KZCA 2I9CA 1V55E 1SVXA 3ZHEB 4U0SA 3SBSA 3MYVA 3ZYKA 1OUVA 2OEVA 4U07A 1HG2A 5JJTA 3NBNB 1JCQA 2RFAA 5ITZF 2BEDA 4OAVB 3VTXA 4J8FA 3KSQA 4XE0A 4BSXA 3I3NA 4HXIA 5CRVA 4MRUA 2ZISA 3G2SA 2OVFA 4FULA 4XIFA 5B1AE 1JWFA 1Z3YA 4QQIA 4NACA 5BT1A 2EIME 3CHPA 2FO7A 4TRQA 5EKQD 1DNPA 3MCXA 3ABME 4BESA 3UM0A 3DSXA 3U3WA 2JEKA 5ANLA 3B13A 4JB8P 5ANRA 3UINC 4Y6WA 2BUGA 4YDYA 4HBDA 3HDXA 2AJAA 1YCSB 4G2VA 4A55A 4UWFA 4I2ZA 3CKBA 3ASFA 2P9UG 2XENA 4OYSA 3LDZA 4M3OA 4B0ZA 4N2SA 1D8EA 2J08A 3L6AA 3OXLA 4B93B 5HQ8A 4UWLA 1A17A 2GROB 3AJIA 2GRLA 3GZ1A 4GTMA 2F8YA 1K1BA 2EQXA 3SZ7A 3PE4A 3WG7E 3MEKA 4HRNA 4W9RA 5G2NA 5G04C 4I17A 2KZTA 3RK6A 4CDMA 2VTBA 5G55A 4B94A 2LNIA 3AG3E 4XX5A 5EX0A 2VSNA 3UIOC 5ARFA 4BERA 5FQ7A 1NZNA 1WY6A 5HKPA 4CZ2D 5ENOD 2R59A 4Q69A 3G2WA 4TUMA 4JW1A 2WQHA 3SQVA 3C98A 3ZGQA 5HRYA 2GRPB 3CVLA 1YMPA 3UMVA 4GPKA 2J07A 3ISMC 2A5UA 3HHMA 2BKGA 4U04A 4KZ0A 5CMYA 1FCHA 4G23A 5FWQA 4DX1A 4WUYA 3L16A 4A1SA 3SBTB 4OVUA 2IY0C 3D9OA 4JVSA 1MX6A 4ANUA 2R5SA 4AY6A 3FH8A 3PVLA 1G3NB 3UQ3A 4FHKA 2GRMA 5D2MC 2IONA 1H6PA 5G05J 3CVWA 3DSTA 2V4HC 3OXGA 1JCRA 3CLJA 4GTPA 3Q9UC 2PL2A 3L08A 2R03A 2VGXA 4OAUC 2OCCE 2OOEA 3ZEFA 3PZ1A 2GRNB 3CK9A 1S63A 3D9JA 4GZDA 4K5CA 2XS8A 1LD7A 1YA0A 2ETBA 1QYMA 2PQRA 3GZSA 4AIFA 5D0QD 3LYAA 4HB5A 1H2TC 1OWNA 4A3TA 5CBOA 4R7LA 2M63A 3UM2A 4U63A 1X5BA 3GYZA 4N2QA 2KZTB 2VTBB 3APCA 5EX3A 4N5QA 1Z5SC 3ZRHA 3F6QA 5LP0A 5AQ9A 4J8DA 3AG1E 2VSYA 3AS8A 1SZAA 4HRLA 4U8VD 2BKKB 1E8XA 4HOQA 4EECA 2P58C 5T3RA 2H6IA 4EPZA 1TR4A 3FDHA 2FF4A 2Y1LE 4BTBA 5ENNA 1N4RA 3ABLE 2VGYA 4B8AA 4AY5A 3AG4E 5EILA 4GA0A 3FU3A 4RG6A 2X6IA 4DPRA 2DZOA 1U3CA 1BU9A 3QB2A 5HI7A 4HNAD 3LJ3A 4K5BA 3LCAA 4GYYA 4KBQA 3CEQA 3C3RA 3PS6A 3CVPA 4GCOA 2FO1E 3G2TA 2IOSA 1MJ0A 3IXEA 4GA1A 1MX4A 4HRMB 3AS5A 1HE8A 2KXPC 2AXUA 4O6FA 3DBSA 4ZHBA 2R05A 2C0LA 3P1UA 4IN3B 4K0RA 3CIAA 5B1BE 5JJ6A 3Q49B 1FT2A 3JCKC 4TXRA 4PH4B 4LRZA 2H6GA 2L0IA 3SFZA 1P5QA 4WWNA 3ONLA 5FZSA 2ZXWE 2XGOA 3FTSA 3NOCD 2VGXB 3PRZA 2P9LG 2UY1A 3EJNA 3FUHA 4YVOA 1GW6A 2RD0A 3VLDA 2J4BA 4APFA 5T8IA 2JABA 1FT1A 3IEGA 5AARA 3V2XA 4CRWA 3ENEA 3UIPC 5EIBE 4F1SA 3RRUA 1UN8A 4FC8A 4AEZC 4J7WA 1BD8A 4RQIA 4EBAA 3C3OA 5BV0A 3QAQA 4O1PA 2R2LA 4Q94A 2VQ2A 2XEHA 2P9KG 3EUVA 4PS8A 3CHMA 4J8SA 2AXZA 2WXFA 3ULQA 4EZLA 3UX4A 5JMND 3NZUA 4U7EB 3IHYA 4F3VA 3JUIA 4BWRA 3FU6A 3HXDA 3ZIMA 4N5CA 3SI5A 3B95A 3HXEA 3K9IA 4JL0A 1X81A 3SO8A 3UXGA 4BT9A 4PS7A 3FTUA 4I2WA 2HO1A 4PUCA 4WWOA 5FT9A 4F1PA 3MJWA 2YINA 2AVPA 4X8QA 3DSWA 3FUIA 4ZFHA 4UUCA 3UT7A 2IU1A 3EHQA 2ZIRA 3PZDA 4ANXA 3JXJA 3SFYA 3EIJA 4I6GA 4B8CB 4NRHB 4CCAA 3ABKE 4J6IA 4YDOA 3ZUVB 2WQ6A 3PE3A 2KATA 3MKQA 1DC2A 5FQ4A 1SA5A 4UQZA 1OWPA 4YDWA 5M72A 5KJKA 2GGFA 4K03A 3HXCA 3T8MA 2UY1B 3S7DA 4AV7A 2EIKE 1DCQA 2ETCA 3AS4A 2V5FA 1H2VC 3HG0D 4QFVA 4JC8A 4E6HA 4HOSA 2DZNA 1UJKA 4EZJA 4DRXE 1E90A 5JA4D 5FQ8A 4I43A 2XZTG 2GRQB 3L54A 2LSUA 3DEOA 5LX8A 1UG3A 1OCCE 3B7SA 4RVBA 5ENQD 3CVQA 3TL5A 1HO8A 2WXJA 3HRAA 4G26A 4HOUA 3S7FA 3Q75A 2E2EA 3SD5A 4PDXA 2C0MA 4CGWA 3DEPA 3D9PA 1Z6TA 2B6CA 2CG3A 2XGMA 4DI3A 3TAXA 2KBXA 4B89A 5KBAA 2WXPA 2FULA 3PDNA 3TWTA 1EDUA 3E32A 3UTMA 4DX2A 3EHMA 3O48A 4DX6D 3EHNA 4MS6A 3C72A 4RG9A 4FLHA 4FJZA 1Y8MA 2R17C 4GU5A 1E7VA 4ATZD 3ULEG 1KZOA 2DWZA 2LUHA 1HZ4A 3Q9NC 4FU3A 1TN8A 3Q5MA 3ULYA 1QZ2A 1H19A 4WWPA 2ILRA 4G8KA 2J09A 2MRIA 2E0IA 2P9PG 3PH0C 1TJFA 4NURA 1ZU2A 4L9PA 3IHVA 3PZ2A 4ILHB 4FHJA 3FH5A 2QFCA 3DSUA 4GAAA 4J8EA 1K8KG 2IFUA 3MKQB 4APOA 4AXHA 1YYHA 4KVOA 2X6FA 1HS6A 1N54A 3VTYA 4CEMA 4DLOA 3FY4A 3ASHA 3HVEA 3AU5A 1MYOA 2PM7A 2VGEA 3LVRE 4JD2G 4C0MA 3C5RA 3S7JA 3KS2A 3NF1A 4GTOA 3TGOA 4GB9A 3V2OA 2LAIA 3FU0A 1TN7A 1E8WA 4XEIG 5FQ6A 3LEWA 1A5EA 1H6KA 2XS1A 5FZRA 1N95A 1IQUA 2RG8A 3DSVA 3QWPA 5AN8A 3RKVA 4AJWA 3RO2A 3NB2A 4I9EA 2OV8A 3SFXA 3VLEA 4KXKB 2WXGA 1HFAA 2DCPA 4MLPA 5A7DB 4ANVA 4J0UA 3B7BA 2L6BA 5KNHD 1OT8A 3JQ1A 4E85A 3T5VA 2QYUA 5EN5D 5LCWC 5BXUA 2IEJA 3D9MA 2WVIA 4HQDA 1IYGA 3R9MA 2I2OA 5J08A 4BEPA 3ESLA 3MV2B 2C2LA 1UN9A 2AWIA 1JPLA 2R02A 3NOGD 1L5JA 1JWGA 2MOWA 2X6JA 2XQ0A 4L2LA 4IRUA 2EILE 3FULA 5KJNA 2HM8A 3E37A 4WNFA 1NA0A 1B89A 2XPZA 1FPPA 2DYRE 3MKRA 1E8ZA 3UM3A 4UI9J 2J9QA 3CVYA 1IQRA 4L1BA 3BQOA 5KJLA 3QWVA 1JCSA 2CFUA 1MZCA 2KCKA 3T9KA 4DLQA 3BG1B 2KC7A 3ZPJA 5D66A 4L23A 1TYQG 1HX8A 3Q4AB 4ILGA 4UQYA 3HVEB 4HLLA 1EF1C 2X38A 4YVQC 1AWCB 3ZFWA 3LY8A 3PNTB 5CCLA 1MQSA 4HI9A 3V79K 2HR2A 3ZXPA 1OXJA 5FIOA 1Z3XA 3QARA 1HH8A 2GRRB 3APDA 4KT6B 1K1AA 1O5MA 5FZQA 5BNWA 4I9CA 3Q15A 2HE0A 1WAO1 5A6CA 2IJGX 2I1JA 3QDNA 3IV0A 4L2YA 3UPVA 3N71A 2XRZA 2LAHA 2Y4UA 4N3BA 1OCOE 3D9KA 4U0UA 2QYJA 4LEUA 4ANWA 4BX8A 2A4ZA 1NFIE 4JA7A 4WNGA 4UWKA 4M7CA 3PREA 2CG2A 1ZBPA 2IF4A 1TNOA 4HFGA 2DYSE 2PNNA 1KT1A 3SGHA 1UOHA 2WMOA 3Q79A 3VLFA 4KYOB 3BU8A 3OTNA 2MHKA 4O1OA 3NZSA 2RKKA 2F0YA 4DI4A 3QC1A 1OWMA 1DCEA 4F7AA 3FUNA 3DXKG 1KZPA 4GCNA 4U8YD 4AVXA 4JHRA 2V0PA 4DUIA 3BUAA 5G04J 3QOUA 4N3AA 1E96B 4TV3A 3CQGB 3MGBA 1D8DA 3RAUA 2NXPA 2WM9A 3ONKA 5FINA 3CKCA 3D9NA 5BXOA 2WMNA 3FUKA 2JLBA 4UWHA 3L9TA 1ELWA 4A3VA 2FEZA 2IOLA 2YHEA 4FA6A 4GTQA 2DVWA 4GZ3A 5KCMA 3QWWA 3TXNA 5FJYA 3FUDA 4UWGA 3UT8A 4JEUA 2H6HA 2P9SG 3CSFA 3RU0A 1V54E 3WXXA 5FTPA 4JA9A 3CHRA 2L9BA 1K3ZD 4DJAA 2H6FA
chains in the Genus database with same CATH topology
4URKA 4U04A 3CV0A 1HO8A 1KT0A 4KZ0A 5CMYA 1FCHA 2V4LA 4U8HA 2WXJA 4BY6A 2X3MA 3SHFA 1BPOA 4ATGA 4G23A 5AYWD 1HG5A 4G26A 4HOUA 5FWQA 3S7FA 2E2EA 3SD5A 3CK8A 3EDTB 4PDXA 4WUYA 4BX9A 5BV1A 3L16A 2BTDA 4IYPA 3TXMA 4MKTA 2C0MA 4A1SA 3SBTB 4CGWA 3MZLB 4OVUA 4G1TA 3CVXA 3D9PA 2X6HA 1Z6TA 3FHEA 3D9OA 2CG3A 2XGMA 4DI3A 4JVSA 3TAXA 4ANUA 4XKCA 2R5SA 4B89A 3FH8A 4AY6A 3PVLA 2WXPA 2FULA 3CHOA 3PDNA 2VSXE 2XHEA 2LSVA 3ASGA 1EDUA 3FTZA 3FUMA 3UQ3A 3JYSA 4FHKA 3FTXA 2VSOE 3EHMA 3LY7A 3O48A 2HYZA 2GRMA 3EHNA 4MS6A 3URZA 3FEYA 4BTAA 1OWLA 4WNDA 4RG9A 4FLHA 4EQFA 3RIBA 4FJZA 3CHQA 2IONA 4ME2A 4C9BB 5CMWA 1Y8MA 2R17C 4GU5A 5G05J 2WXNA 3CVWA 3B7UX 1E7VA 3FUJA 3MV3B 5CHEE 2L0TB 2Q7FA 2QY7A 3G2VA 4EBAG 5C1DA 3S7BA 2KCVA 5ARGA 1FVHA 1HZ4A 5G05C 3G2UA 2UWJG 3LS8A 3OXGA 4XI0A 3D3MA 4NQ0A 2CFZA 3O4ZA 1WM5A 4FU3A 1S0PA 3TJPA 3CLJA 5LOZA 4V3IA 3Q5MA 4JZYA 1QZ2A 3QKYA 3R7RA 1H19A 4WWPA 2ILRA 5LFAA 2J09A 4CT0A 2XPYA 2MRIA 2E0IA 1QQEA 2PL2A 2XGSA 3R7QA 3L08A 4JPSA 3PH0C 1TJFA 2VGXA 3GW4A 4NURA 1ZU2A 4KMOA 4I1MA 2OOEA 1HXIA 3ZEFA 3IHVA 3CK9A 3D9JA 4GZDA 2PQNA 4FHJA 4ILHB 1MHQA 3FH5A 2QFCA 5AIJA 3CVVA 4GAAA 3BEEA 3RO3A 1YA0A 4HLEA 4J8EA 1H0AA 2KM4A 2PQRA 3U4TA 4RSYA 3PUJA 3GZSA 4ABNA 2IFUA 3MKQB 4AIFA 4APOA 4YNDA 3LYAA 5D0QD 4AXHA 3ZN3A 1H2TC 2WXLA 1OWNA 3CGHA 4KVOA 4A3TA 2X6FA 4G25A 3EIQC 1HS6A 4JXTA 1FVFA 5BPPA 1N54A 3VTYA 3CR3A 5E75A 2NC9A 4ACKA 4CEMA 4DLOA 1W3BA 2M63A 2YHCA 3ASHA 3FY4A 3IKOB 4R7LA 3HVEA 4U63A 1X5BA 3ZVVA 3AU5A 3GYZA 4GZCA 2PM7A 4N2QA 4AM9A 3LVRE 3KD7A 2X6KA 2KZTB 1LF8A 4HVBA 4C0MA 1E7UA 2VTBB 3APCA 1E8YA 3KEZA 4GZ6A 5EX3A 3S7JA 3KS2A 5AJDA 3ZYMA 5D0OD 3FWVA 2WXQA 3NF1A 2GW1A 3L22A 3ZRHA 3ZHEA 4LCTA 5LP0A 3PEUB 3TGOA 4GB9A 4J8DA 2J49A 1TJCA 3LKUA 2LAIA 2VSYA 3AS8A 2XRYA 3FU0A 3RJVA 1SZAA 1E8WA 5EDSA 3ESKA 5FQ6A 3LEWA 3R9AB 4H7XA 1H6KA 3FH7A 3U9WA 2CHZA 2WXOA 5FZRA 1IQUA 1E8XA 2RG8A 1INZA 3ASDA 4HOQA 4EECA 3QWPA 2P58C 5T3RA 5AJLA 3RKVA 2FBNA 4AJWA 3RO2A 4EPZA 2YQ8A 1VDYA 3QJZA 3P2BA 3FDHA 2OV8A 4I9EA 3VLEA 3ZYQA 4KXKB 2WXGA 4GYOA 2FF4A 3CVNA 4N3CA 2L6JA 1HFAA 3NQPA 2DCPA 3MX3A 5J90A 4BTBA 4XZ4A 2XEVA 3GZ2A 4MLPA 1H2UA 5ENNA 5A7DB 4XKBA 4ANVA 2VGYA 2ONDA 4J0UA 4B8AA 3CHSA 4AY5A 1UJJA 3FTVA 2WQ7A 1TEZA 4GA0A 5LCWJ 3CQCB 3FU3A 4HOTA 1EPUA 2ZU6B 3JQ1A 4RG6A 2IQCA 2X6IA 3ZYLA 3ZXSA 4DPRA 4E85A 3T5VA 4PS3A 5DIZA 5LCWC 1U3CA 4HS2A 3QB2A 5HI7A 3CSTA 3LJ3A 2KCLA 3D9MA 4Y6CA 3LCAA 4GYYA 2WVIA 4GA2A 4OVVA 4I1OB 1IYGA 4KBQA 3B7TA 2I2OA 5J08A 3CEQA 4G24A 4I6EA 5AENA 3ESLA 3LPZA 2I1KA 3MV2B 3PS6A 4CDRA 3CVPA 4GCOA 3LXUX 2C2LA 1UN9A 3G2TA 2IOSA 3HYMB 4H7YA 1EYHA 4C0EA 2WPVA 4CT4A 2AWIA 1JPLA 5JJ7A 2XPIA 1L5JA 4UI9K 4GA1A 1JWGA 3AS5A 1HE8A 3TG4A 2MOWA 2X6JA 3ZW3A 2XQ0A 1DVPA 3QNKA 4GMLA 4L2LA 3ML9A 5BUZA 1Y6IA 2AXUA 1ELKA 2WXMA 3DBSA 4IRUA 4O6FA 5A23A 3D9IA 4IN3B 2C0LA 2XCCA 3FULA 3LVQE 3P1UA 4K0RA 4BT8A 3FFLA 5KJNA 3I5PA 3FUFA 1PAQA 2HM8A 3B7RL 1NP7A 3FTWA 3PUKA 3JQ0A 4WNFA 1NA0A 3CIAA 2WB2A 1B89A 2XPZA 5JJ6A 3Q49B 3FP3A 3JCKC 3RRMB 2AW6A 4PH4B 3U66A 3SNXA 4LRZA 4IULA 2L0IA 3SFZA 1P5QA 2BF0X 3MKRA 1SZ9A 1E8ZA 3L17A 3ONLA 3Q47B 4WWNA 5FZSA 2WXKA 4P29A 4GMJA 2XGOA 3FTSA 4WAFA 3I4GA 4ACLA 4JHKA 2CHXA 4UI9J 2J9QA 1NA3A 2YNQA 4Q96A 2VGXB 2DBAA 3PRZA 1PC2A 5T4YA 3UT4A 2V8SE 3D9LA 3CVYA 2UY1A 1IQRA 4L1BA 5KJLA 4UI9C 3EJNA 3FUHA 3QWVA 4JHJA 4UQXA 2CFUA 4YVOA 3TG5A 1GW6A 5JHBA 5BW8C 2KCKA 3QK0A 4EZKA 2DIWA 2PZIA 2RD0A 4DLQA 1JUQA 3BG1B 1SQMA 3FUEA 2FI7A 2KC7A 2J4DA 3VLDA 2J4BA 3BG0B 3ZPJA 2VYIA 5C2YA 4APFA 4JEHA 4L23A 5T8IA 4I1AA 3I4RB 2VJ8A 3IEGA 3CVUA 1HX8A 3S2AA 3PNLB 4CRWA 3Q4AB 4ILGA 2PM6A 4UQYA 2WXRA 3IBEA 3LY9A 1HF8A 3ENEA 3L13A 4N39A 3HVEB 4G11A 4F1SA 3RRNB 3RRUA 1UN8A 4FC8A 5DBKA 4AEZC 1EF1C 4LERA 4GZ5A 4CGVA 2X38A 4YVQC 4CDNA 3ZFWA 4KZCA 2I9CA 3LY8A 3PNTB 5CCLA 1MQSA 3FEXA 2WXHA 4EBAA 3ZHEB 2HR2A 4U0SA 3SBSA 5BV0A 3MYVA 3QAQA 1OUVA 3ZYKA 4TUUA 1Z3XA 4FP7A 4BFRA 4U07A 1HG2A 3QARA 4Q94A 1HH8A 5JJTA 2VQ2A 4F53A 3APDA 4KT6B 3U64A 4PS8A 4FJYA 5FZQA 1IHGA 5BNWA 4I9CA 3Q15A 3CHMA 3VTXA 4J8FA 4J8SA 3CK7A 3OAWA 4XE0A 2AXZA 4BSXA 1WAO1 5A6CA 2IJGX 2I1JA 3QDNA 2WXFA 3I3NA 3ULQA 3IV0A 4L2YA 2OVBA 4HXIA 4EZLA 3UPVA 3UX4A 4MRUA 5CCMA 3NZUA 4L7TA 3IHYA 4F3VA 2I6HA 3G2SA 3JUIA 4BWRA 3FU6A 2OVFA 4FULA 4XIFA 3ZIMA 3N71A 4LUNU 4N5CA 3SI5A 2XRZA 2LAHA 1JWFA 1Z3YA 2Y4UA 3K9IA 4N3BA 1U3DA 4JL0A 4NACA 5BT1A 2Y4TA 3D9KA 3CHPA 4U0UA 4BT9A 2FO7A 4TRQA 5EKQD 1DNPA 3KAEA 2AXVA 3FTUA 4I2WA 4PS7A 3MCXA 4LEUA 2HO1A 4PUCA 4ANWA 3AU4A 4WWOA 1OWOA 5FT9A 1QNFA 3MJWA 4BX8A 2YINA 1N52A 2A4ZA 3U3WA 4JA7A 2WXIA 4WNGA 4GYWA 2JEKA 2AVPA 3B13A 3FTYA 4UWKA 5ANLA 3PREA 5ANRA 1KLXA 2CG2A 4D10C 3FUIA 1ZBPA 2IF4A 4Y6WA 3SF4A 3UT7A 2IU1A 3MA5A 4KVMA 2BUGA 4HFGA 4FLBA 3PZDA 4ANXA 3HDXA 1KT1A 3SGHA 4DK5A 2Y3AA 2WMOA 4G2VA 3VLFA 4A55A 2NSZA 4KYOB 4UWFA 4I2ZA 3CKBA 1UW4B 3OTNA 2MHKA 3ASFA 3EIJA 4I6GA 4U0ZA 4B8CB 5E76A 4OYSA 3NZSA 3LDZA 4M3OA 4NRHB 4CCAA 4J6IA 4B0ZA 3QC1A 1OWMA 4DI4A 4N2SA 3T5XA 4F7AA 5JHAA 2WQ6A 3FUNA 2J08A 3PE3A 2KATA 3MKQA 3L6AA 3OXLA 5FQ4A 5HQ8A 4UQZA 1OWPA 1A17A 4GCNA 4UWLA 4AVXA 5KJKA 5M72A 2GRLA 4I6JA 3GZ1A 2GGFA 4JHRA 2V0PA 4K03A 5G04J 2EQXA 3SZ7A 3PE4A 3T8MA 3OXFA 3QOUA 3MEKA 2UY1B 4W9RA 3S7DA 4N3AA 1E96B 5G2NA 4TV3A 4AV7A 3CQGB 3MGBA 4I17A 5G04C 2KZTA 2NXPA 3E4BA 3RK6A 4CDMA 4AP2A 4FADA 2WM9A 2VTBA 3ONKA 5G55A 3CKCA 4B94A 2LNIA 4XX5A 3D9NA 3AS4A 2V5FA 3ML8A 1H2VC 5EX0A 2WMNA 1XNFA 2VSNA 4QFVA 3FUKA 4JC8A 4E6HA 4HOSA 5ARFA 2JLBA 5FQ7A 1UJKA 4UWHA 1NZNA 1WY6A 3APFA 1ELWA 4EZJA 4A3VA 2FEZA 3PEVB 1E90A 2IOLA 1PY1A 2LO6A 2YHEA 5FQ8A 4FA6A 3FU5A 4WNEA 4AOFA 4I43A 2R59A 4GZ3A 1ELRA 5KCMA 4Q69A 3QWWA 3TXNA 3G2WA 5FJYA 4A1GA 3DPDA 4JW1A 2XCBA 3FUDA 2WQHA 4UWGA 3UUXA 3UT8A 3C98A 3ZGQA 1HU3A 4JEUA 3L54A 4XI9A 5KJMA 3CSFA 2CHWA 3RU0A 2LSUA 3CVLA 5LX8A 3UMVA 4GPKA 1UG3A 2J07A 5FTPA 4ILIA 4JA9A 1XGWA 3WXXA 3CHRA 3B7SA 3HIZA 2L9BA 4RVBA 2A5UA 4DJAA 3HHMA 4HORA 3CVQA 3TL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U04 A;  3CV0 A;  1KT0 A;  1FCH A;  4G23 A;  5AYW D;  4G26 A;  4HOU A;  3S7F A;  2E2E A;  3CK8 A;  3EDT B;  4WUY A;  2C0M A;  4A1S A;  4CGW A;  4G1T A;  2XGM A;  3TAX A;  2R5S A;  4AY6 A;  3PDN A;  2LSV A;  3ASG A;  3UQ3 A;  3JYS A;  3LY7 A;  3O48 A;  2HYZ A;  3URZ A;  4BTA A;  4WND A;  4RG9 A;  4EQF A;  3RIB A;  4ME2 A;  1Y8M A;  5G05 J;  3MV3 B;  5CHE E;  2Q7F A;  5C1D A;  3S7B A;  2KCV A;  5ARG A;  1HZ4 A;  5G05 C;  2UWJ G;  3OXG A;  4XI0 A;  4NQ0 A;  1WM5 A;  3Q5M A;  1QZ2 A;  3QKY A;  1QQE A;  2PL2 A;  2XGS A;  2VGX A;  3GW4 A;  1ZU2 A;  2OOE A;  1HXI A;  3CK9 A;  2PQN A;  2QFC A;  3BEE A;  3RO3 A;  1YA0 A;  4J8E A;  2PQR A;  3U4T A;  4ABN A;  4AIF A;  2IFU A;  4APO A;  4YND A;  3LYA A;  5D0Q D;  3ZN3 A;  4G25 A;  3VTY A;  2NC9 A;  1W3B A;  2YHC A;  3ASH A;  3GYZ A;  4N2Q A;  4AM9 A;  3KD7 A;  3S7J A;  4GZ6 A;  5EX3 A;  3KS2 A;  5D0O D;  3FWV A;  3NF1 A;  2GW1 A;  3ZHE A;  3TGO A;  4J8D A;  1TJC A;  3LKU A;  2VSY A;  3AS8 A;  3RJV A;  3ESK A;  3R9A B;  4H7X A;  5FZR A;  3ASD A;  4HOQ A;  3QWP A;  2P58 C;  3RKV A;  2FBN A;  3RO2 A;  2YQ8 A;  4I9E A;  4KXK B;  4GYO A;  2FF4 A;  3CVN A;  4N3C A;  2L6J A;  4BTB A;  2XEV A;  3GZ2 A;  5A7D B;  2VGY A;  2OND A;  4J0U A;  4AY5 A;  4GA0 A;  5LCW J;  4HOT A;  4RG6 A;  5DIZ A;  5LCW C;  5HI7 A;  2KCL A;  4Y6C A;  3LCA A;  4GYY A;  4GA2 A;  1IYG A;  4KBQ A;  3CEQ A;  4G24 A;  3LPZ A;  3MV2 B;  4CDR A;  3CVP A;  4GCO A;  2C2L A;  3HYM B;  4H7Y A;  2WPV A;  5JJ7 A;  2XPI A;  4UI9 K;  4GA1 A;  3AS5 A;  3TG4 A;  4O6F A;  4IN3 B;  2C0L A;  2XCC A;  4BT8 A;  5KJN A;  3FFL A;  4WNF A;  1NA0 A;  1B89 A;  5JJ6 A;  3Q49 B;  3FP3 A;  1P5Q A;  3MKR A;  3Q47 B;  5FZS A;  2XGO A;  4UI9 J;  2J9Q A;  1NA3 A;  2VGX B;  2DBA A;  1PC2 A;  2UY1 A;  5KJL A;  4UI9 C;  3QWV A;  4UQX A;  4YVO A;  3TG5 A;  5BW8 C;  2KCK A;  2PZI A;  2FI7 A;  2KC7 A;  3ZPJ A;  2VYI A;  4I1A A;  3IEG A;  3Q4A B;  4UQY A;  3LY9 A;  4N39 A;  5DBK A;  4GZ5 A;  4CGV A;  4YVQ C;  3ZFW A;  3LY8 A;  5CCL A;  3ZHE B;  2HR2 A;  4U0S A;  1OUV A;  4U07 A;  1HH8 A;  5JJT A;  2VQ2 A;  5FZQ A;  1IHG A;  5BNW A;  4I9C A;  3Q15 A;  3VTX A;  4J8F A;  3CK7 A;  1WAO 1;  5A6C A;  3QDN A;  3ULQ A;  3UPV A;  5CCM A;  4F3V A;  2I6H A;  4BWR A;  4XIF A;  3N71 A;  4N5C A;  3K9I A;  2Y4U A;  4N3B A;  4JL0 A;  5BT1 A;  2Y4T A;  4U0U A;  4BT9 A;  2FO7 A;  5EKQ D;  3KAE A;  4I2W A;  4LEU A;  2HO1 A;  5FT9 A;  3U3W A;  4JA7 A;  4WNG A;  4GYW A;  2AVP A;  1KLX A;  1ZBP A;  2IF4 A;  4Y6W A;  3SF4 A;  3MA5 A;  2BUG A;  1KT1 A;  4G2V A;  4KYO B;  4I2Z A;  3CKB A;  2MHK A;  3ASF A;  4U0Z A;  4NRH B;  4N2S A;  3PE3 A;  2KAT A;  3OXL A;  5HQ8 A;  4UQZ A;  5M72 A;  1A17 A;  4GCN A;  5KJK A;  3GZ1 A;  4JHR A;  5G04 J;  3SZ7 A;  3PE4 A;  3OXF A;  3QOU A;  3MEK A;  2UY1 B;  4W9R A;  3S7D A;  4N3A A;  1E96 B;  5G04 C;  4I17 A;  3E4B A;  3CKC A;  4B94 A;  2LNI A;  3AS4 A;  2V5F A;  5EX0 A;  1XNF A;  2VSN A;  4HOS A;  5ARF A;  2JLB A;  1NZN A;  1ELW A;  2FEZ A;  4WNE A;  4GZ3 A;  1ELR A;  3QWW A;  5FJY A;  2XCB A;  2WQH A;  3UUX A;  3ZGQ A;  4XI9 A;  5KJM A;  3RU0 A;  2LSU A;  3CVL A;  4GPK A;  3WXX A;  5FTP A;  4JA9 A;  4HOR A;  3CVQ A; 
#chains in the Genus database with same CATH topology
 3V31 A;  4URK A;  4U8H A;  3ZU7 B;  1BPO A;  4ATG A;  5AYW D;  3CK8 A;  3EDT B;  5BV1 A;  1WDY A;  2BTD A;  4MKT A;  3HXF A;  3ASN E;  4G1T A;  2X6H A;  3FHE A;  1N4S A;  3E30 A;  4LNB A;  4XKC A;  2VSX E;  2LSV A;  3FUM A;  3JYS A;  1U2V G;  3LY7 A;  5CRU A;  2F37 A;  2HYZ A;  4WND A;  1SW6 A;  3RIB A;  3RSE G;  1H6O A;  3CHQ A;  4ME2 A;  5CMW A;  2WXN A;  5H7P A;  4EHM A;  3FUJ A;  5CHE E;  2QY7 A;  3G2V A;  5C1D A;  3S7B A;  2KCV A;  3DWL G;  5ARG A;  1TNB A;  5G05 C;  3G2U A;  2UWJ G;  4XI0 A;  4NQ0 A;  1WM5 A;  3TJP A;  2F8X K;  5LOZ A;  4JZY A;  1Q2Z A;  5LFA A;  4CT0 A;  2XPY A;  2P2C P;  1QQE A;  4GMR A;  4I1M A;  2PQN A;  1LTX A;  4LNG A;  5AIJ A;  3CVV A;  5HS0 A;  3RO3 A;  4HLE A;  1H0A A;  2WXL A;  5IY5 E;  4JXT A;  2B0O E;  5E75 A;  1BI8 B;  2NC9 A;  4ACK A;  1N94 A;  1W3B A;  2YHC A;  3IKO B;  4BSZ B;  1TNZ A;  4GZC A;  3AG2 E;  3KD7 A;  1LF8 A;  4HVB A;  1E7U A;  5AJD A;  3JXI A;  3ZYM A;  5D0O D;  3FWV A;  3JUE A;  4LCT A;  3PEU B;  2J49 A;  3LKU A;  2XRY A;  3KEA A;  2ZGG A;  3ESK A;  3FH7 A;  2CHZ A;  2WXO A;  5CED B;  1INZ A;  3DSS A;  4RLY A;  5AJL A;  2FBN A;  2YQ8 A;  1VDY A;  3QJZ A;  3ZYQ A;  4GYO A;  4N3C A;  2L6J A;  3NQP A;  5J90 A;  4XZ4 A;  1H2U A;  4C48 B;  1S64 A;  1LD8 A;  3CHS A;  1UJJ A;  4GTS A;  1TEZ A;  2XZD G;  3ZNG A;  2IQC A;  5DIZ A;  4HS2 A;  3CST A;  4Y6C A;  4OVV A;  4GA2 A;  4I1O B;  3B7T A;  1S70 B;  4I6E A;  2I1K A;  3HYM B;  4YDE A;  4C0E A;  1EYH A;  3DPY A;  5JJ7 A;  2XPI A;  3QNK A;  4GTR A;  1OCZ E;  4GTV A;  5ENT D;  2XCC A;  4BT8 A;  3I5P A;  3FUF A;  3B7R L;  3FTW A;  4NIK A;  5AQ7 A;  3W9G A;  2WB2 A;  3RRM B;  4GPM A;  1BI7 B;  4O60 A;  3U66 A;  3SNX A;  3T8K A;  2BF0 X;  1SZ9 A;  1TNU A;  4ACL A;  4WAF A;  3E33 A;  4JHK A;  2CHX A;  1NA3 A;  4Q96 A;  2V8S E;  3E34 A;  5EID A;  3TG5 A;  5BW8 C;  1TNY A;  2DIW A;  2PZI A;  1SQM A;  2A5E A;  2J4D A;  3BG0 B;  2VYI A;  5C2Y A;  4JEH A;  4I1A A;  3TWX A;  3CVU A;  3L82 A;  2PM6 A;  3IBE A;  3ZKJ A;  3LY9 A;  2P9I G;  4N39 A;  3RRN B;  4DX5 D;  4LER A;  1N4Q A;  3Q78 A;  3FEX A;  2WXH A;  3UM1 A;  4TUU A;  2LXM A;  4FP7 A;  4BFR A;  4F53 A;  3U64 A;  4FJY A;  1IHG A;  1BLX B;  5EYP F;  3Q73 A;  3CK7 A;  3OAW A;  5AQA A;  3HXB A;  2OVB A;  3V30 A;  5CCM A;  1D9S A;  4L7T A;  2I6H A;  2P9N G;  4LUN U;  1NL4 A;  3NAW A;  1U3D A;  2IO3 C;  2Y4T A;  3KAE A;  2AXV A;  4J8Y A;  5CBN A;  3W9F A;  3AU4 A;  5KNG A;  1OWO A;  1QNF A;  2ZGD A;  2Y69 E;  1N52 A;  2WXI A;  4GYW A;  3FTY A;  2V5Q C;  4Z68 A;  4D10 C;  1KLX A;  3SF4 A;  3MA5 A;  4KVM A;  4FLB A;  3TWU A;  3EU9 A;  4DK5 A;  2Y3A A;  3DXM G;  2NSZ A;  1UW4 B;  4U0Z A;  1WG0 A;  5E76 A;  3T5X A;  5JHA A;  5ENS D;  4I6J A;  2NYJ A;  3OXF A;  4TXP A;  1O1R A;  3E4B A;  4AP2 A;  4FAD A;  1IXV A;  3TWS A;  3ML8 A;  1TN6 A;  1XNF A;  4MBG A;  1RZ4 A;  3APF A;  3PEV B;  5AAO A;  1PY1 A;  2LO6 A;  3FU5 A;  1OY3 D;  4WNE A;  4AOF A;  1ELR A;  4A1G A;  3DPD A;  2XCB A;  2EIN E;  3UUX A;  3KSL A;  1HU3 A;  4XI9 A;  5KJM A;  2CHW A;  4ILI A;  1XGW A;  2RFM A;  3SY2 A;  1IKN D;  3HIZ A;  1O1S A;  4HOR A;  4LG6 A;  3CV0 A;  2OEW A;  1KT0 A;  2V4L A;  4BY6 A;  3EU5 A;  2X3M A;  3SHF A;  3TWW A;  3ASO E;  1HG5 A;  4BX9 A;  4IYP A;  3UKR G;  3TXM A;  1N0Q A;  3MZL B;  3TWR A;  3CVX A;  3CHO A;  2XHE A;  3ASG A;  3FTZ A;  1ZB1 A;  3FTX A;  1KPS B;  2VSO E;  3URZ A;  4BTA A;  3FEY A;  1OWL A;  3EHR A;  4EQF A;  4C9B B;  1QBQ A;  3B7U X;  3MV3 B;  2L0T B;  2Q7F A;  2EIJ E;  4EBA G;  2Y0B G;  1FVH A;  3DRA A;  3LS8 A;  3D3M A;  2CFZ A;  3O4Z A;  1S0P A;  3TWV A;  2ETA A;  4V3I A;  5ENR D;  3QKY A;  1RW2 A;  5B3S E;  3R7R A;  2IO2 C;  2XGS A;  3R7Q A;  1N4P A;  4G8L A;  4JPS A;  3GW4 A;  4KMO A;  1HXI A;  1MX2 A;  1MHQ A;  3BEE A;  5CEA A;  2KM4 A;  1IHB A;  3U4T A;  4RSY A;  3PUJ A;  4ABN A;  4YND A;  3ZN3 A;  4U95 D;  3CGH A;  4G25 A;  3EIQ C;  3AAA C;  1FVF A;  2LXL A;  5BPP A;  1NI1 A;  3CR3 A;  5KWD A;  3D9H A;  3ZVV A;  3UKU G;  4AM9 A;  2MYO A;  4A63 B;  2X6K A;  1N9A A;  3KEZ A;  1E8Y A;  4GZ6 A;  2WXQ A;  2GW1 A;  3L22 A;  3ZHE A;  4HI8 A;  1TJC A;  3RJV A;  4GTT A;  5EDS A;  3R9A B;  3X2Q E;  4H7X A;  3U9W A;  4CYM D;  3ASD A;  3PZ3 A;  2QZA A;  2XEE A;  3Q7A A;  3P2B A;  3CVN A;  3MX3 A;  2XEV A;  3GZ2 A;  4XKB A;  4LSZ E;  2OND A;  5EYL A;  3FTV A;  1O1T A;  2WQ7 A;  4K5A B;  5LCW J;  3CQC B;  4HOT A;  1EPU A;  2ZU6 B;  3ZYL A;  3ZXS A;  1AP7 A;  4PS3 A;  2KCL A;  4BET A;  4G24 A;  5AEN A;  4DX7 D;  4U96 D;  3LPZ A;  4CDR A;  3Q7F A;  3LXU X;  4H7Y A;  2WPV A;  4CT4 A;  4F6R D;  4UI9 K;  3J5P A;  3LJN A;  3TG4 A;  3ZW3 A;  4GML A;  1DVP A;  3ML9 A;  5BUZ A;  1Y6I A;  2WXM A;  1ELK A;  5A23 A;  3D9I A;  1OCR E;  3LVQ E;  3FFL A;  1PAQ A;  1NP7 A;  3PUK A;  3JQ0 A;  5CER B;  1SA4 A;  3FP3 A;  2AW6 A;  4IUL A;  3Q47 B;  5AQB A;  3L17 A;  2WXK A;  1N0R A;  4P29 A;  3PZ4 A;  4GMJ A;  3I4G A;  4TXQ A;  4LNU D;  2YNQ A;  2DBA A;  1PC2 A;  5T4Y A;  3UT4 A;  3D9L A;  4UI9 C;  5CEC B;  4JHJ A;  4UQX A;  3J5Q B;  5JHB A;  5ENP D;  4EZK A;  3QK0 A;  3UI2 A;  1JUQ A;  3FUE A;  2FI7 A;  2J8S D;  3TWQ A;  3C3Q A;  3I4R B;  2VJ8 A;  3S2A A;  3PNL B;  2WXR A;  1HF8 A;  1N11 A;  3L13 A;  4G11 A;  5DBK A;  4GZ5 A;  4CGV A;  2QC9 A;  4CDN A;  4KZC A;  2I9C A;  1V55 E;  1SVX A;  3ZHE B;  4U0S A;  3SBS A;  3MYV A;  3ZYK A;  1OUV A;  2OEV A;  4U07 A;  1HG2 A;  5JJT A;  3NBN B;  1JCQ A;  2RFA A;  5ITZ F;  2BED A;  4OAV B;  3VTX A;  4J8F A;  3KSQ A;  4XE0 A;  4BSX A;  3I3N A;  4HXI A;  5CRV A;  4MRU A;  2ZIS A;  3G2S A;  2OVF A;  4FUL A;  4XIF A;  5B1A E;  1JWF A;  1Z3Y A;  4QQI A;  4NAC A;  5BT1 A;  2EIM E;  3CHP A;  2FO7 A;  4TRQ A;  5EKQ D;  1DNP A;  3MCX A;  3ABM E;  4BES A;  3UM0 A;  3DSX A;  3U3W A;  2JEK A;  5ANL A;  3B13 A;  4JB8 P;  5ANR A;  3UIN C;  4Y6W A;  2BUG A;  4YDY A;  4HBD A;  3HDX A;  2AJA A;  1YCS B;  4G2V A;  4A55 A;  4UWF A;  4I2Z A;  3CKB A;  3ASF A;  2P9U G;  2XEN A;  4OYS A;  3LDZ A;  4M3O A;  4B0Z A;  4N2S A;  1D8E A;  2J08 A;  3L6A A;  3OXL A;  4B93 B;  5HQ8 A;  4UWL A;  1A17 A;  2GRO B;  3AJI A;  2GRL A;  3GZ1 A;  4GTM A;  2F8Y A;  1K1B A;  2EQX A;  3SZ7 A;  3PE4 A;  3WG7 E;  3MEK A;  4HRN A;  4W9R A;  5G2N A;  5G04 C;  4I17 A;  2KZT A;  3RK6 A;  4CDM A;  2VTB A;  5G55 A;  4B94 A;  2LNI A;  3AG3 E;  4XX5 A;  5EX0 A;  2VSN A;  3UIO C;  5ARF A;  4BER A;  5FQ7 A;  1NZN A;  1WY6 A;  5HKP A;  4CZ2 D;  5ENO D;  2R59 A;  4Q69 A;  3G2W A;  4TUM A;  4JW1 A;  2WQH A;  3SQV A;  3C98 A;  3ZGQ A;  5HRY A;  2GRP B;  3CVL A;  1YMP A;  3UMV A;  4GPK A;  2J07 A;  3ISM C;  2A5U A;  3HHM A;  2BKG A;  4U04 A;  4KZ0 A;  5CMY A;  1FCH A;  4G23 A;  5FWQ A;  4DX1 A;  4WUY A;  3L16 A;  4A1S A;  3SBT B;  4OVU A;  2IY0 C;  3D9O A;  4JVS A;  1MX6 A;  4ANU A;  2R5S A;  4AY6 A;  3FH8 A;  3PVL A;  1G3N B;  3UQ3 A;  4FHK A;  2GRM A;  5D2M C;  2ION A;  1H6P A;  5G05 J;  3CVW A;  3DST A;  2V4H C;  3OXG A;  1JCR A;  3CLJ A;  4GTP A;  3Q9U C;  2PL2 A;  3L08 A;  2R03 A;  2VGX A;  4OAU C;  2OCC E;  2OOE A;  3ZEF A;  3PZ1 A;  2GRN B;  3CK9 A;  1S63 A;  3D9J A;  4GZD A;  4K5C A;  2XS8 A;  1LD7 A;  1YA0 A;  2ETB A;  1QYM A;  2PQR A;  3GZS A;  4AIF A;  5D0Q D;  3LYA A;  4HB5 A;  1H2T C;  1OWN A;  4A3T A;  5CBO A;  4R7L A;  2M63 A;  3UM2 A;  4U63 A;  1X5B A;  3GYZ A;  4N2Q A;  2KZT B;  2VTB B;  3APC A;  5EX3 A;  4N5Q A;  1Z5S C;  3ZRH A;  3F6Q A;  5LP0 A;  5AQ9 A;  4J8D A;  3AG1 E;  2VSY A;  3AS8 A;  1SZA A;  4HRL A;  4U8V D;  2BKK B;  1E8X A;  4HOQ A;  4EEC A;  2P58 C;  5T3R A;  2H6I A;  4EPZ A;  1TR4 A;  3FDH A;  2FF4 A;  2Y1L E;  4BTB A;  5ENN A;  1N4R A;  3ABL E;  2VGY A;  4B8A A;  4AY5 A;  3AG4 E;  5EIL A;  4GA0 A;  3FU3 A;  4RG6 A;  2X6I A;  4DPR A;  2DZO A;  1U3C A;  1BU9 A;  3QB2 A;  5HI7 A;  4HNA D;  3LJ3 A;  4K5B A;  3LCA A;  4GYY A;  4KBQ A;  3CEQ A;  3C3R A;  3PS6 A;  3CVP A;  4GCO A;  2FO1 E;  3G2T A;  2IOS A;  1MJ0 A;  3IXE A;  4GA1 A;  1MX4 A;  4HRM B;  3AS5 A;  1HE8 A;  2KXP C;  2AXU A;  4O6F A;  3DBS A;  4ZHB A;  2R05 A;  2C0L A;  3P1U A;  4IN3 B;  4K0R A;  3CIA A;  5B1B E;  5JJ6 A;  3Q49 B;  1FT2 A;  3JCK C;  4TXR A;  4PH4 B;  4LRZ A;  2H6G A;  2L0I A;  3SFZ A;  1P5Q A;  4WWN A;  3ONL A;  5FZS A;  2ZXW E;  2XGO A;  3FTS A;  3NOC D;  2VGX B;  3PRZ A;  2P9L G;  2UY1 A;  3EJN A;  3FUH A;  4YVO A;  1GW6 A;  2RD0 A;  3VLD A;  2J4B A;  4APF A;  5T8I A;  2JAB A;  1FT1 A;  3IEG A;  5AAR A;  3V2X A;  4CRW A;  3ENE A;  3UIP C;  5EIB E;  4F1S A;  3RRU A;  1UN8 A;  4FC8 A;  4AEZ C;  4J7W A;  1BD8 A;  4RQI A;  4EBA A;  3C3O A;  5BV0 A;  3QAQ A;  4O1P A;  2R2L A;  4Q94 A;  2VQ2 A;  2XEH A;  2P9K G;  3EUV A;  4PS8 A;  3CHM A;  4J8S A;  2AXZ A;  2WXF A;  3ULQ A;  4EZL A;  3UX4 A;  5JMN D;  3NZU A;  4U7E B;  3IHY A;  4F3V A;  3JUI A;  4BWR A;  3FU6 A;  3HXD A;  3ZIM A;  4N5C A;  3SI5 A;  3B95 A;  3HXE A;  3K9I A;  4JL0 A;  1X81 A;  3SO8 A;  3UXG A;  4BT9 A;  4PS7 A;  3FTU A;  4I2W A;  2HO1 A;  4PUC A;  4WWO A;  5FT9 A;  4F1P A;  3MJW A;  2YIN A;  2AVP A;  4X8Q A;  3DSW A;  3FUI A;  4ZFH A;  4UUC A;  3UT7 A;  2IU1 A;  3EHQ A;  2ZIR A;  3PZD A;  4ANX A;  3JXJ A;  3SFY A;  3EIJ A;  4I6G A;  4B8C B;  4NRH B;  4CCA A;  3ABK E;  4J6I A;  4YDO A;  3ZUV B;  2WQ6 A;  3PE3 A;  2KAT A;  3MKQ A;  1DC2 A;  5FQ4 A;  1SA5 A;  4UQZ A;  1OWP A;  4YDW A;  5M72 A;  5KJK A;  2GGF A;  4K03 A;  3HXC A;  3T8M A;  2UY1 B;  3S7D A;  4AV7 A;  2EIK E;  1DCQ A;  2ETC A;  3AS4 A;  2V5F A;  1H2V C;  3HG0 D;  4QFV A;  4JC8 A;  4E6H A;  4HOS A;  2DZN A;  1UJK A;  4EZJ A;  4DRX E;  1E90 A;  5JA4 D;  5FQ8 A;  4I43 A;  2XZT G;  2GRQ B;  3L54 A;  2LSU A;  3DEO A;  5LX8 A;  1UG3 A;  1OCC E;  3B7S A;  4RVB A;  5ENQ D;  3CVQ A;  3TL5 A;  1HO8 A;  2WXJ A;  3HRA A;  4G26 A;  4HOU A;  3S7F A;  3Q75 A;  2E2E A;  3SD5 A;  4PDX A;  2C0M A;  4CGW A;  3DEP A;  3D9P A;  1Z6T A;  2B6C A;  2CG3 A;  2XGM A;  4DI3 A;  3TAX A;  2KBX A;  4B89 A;  5KBA A;  2WXP A;  2FUL A;  3PDN A;  3TWT A;  1EDU A;  3E32 A;  3UTM A;  4DX2 A;  3EHM A;  3O48 A;  4DX6 D;  3EHN A;  4MS6 A;  3C72 A;  4RG9 A;  4FLH A;  4FJZ A;  1Y8M A;  2R17 C;  4GU5 A;  1E7V A;  4ATZ D;  3ULE G;  1KZO A;  2DWZ A;  2LUH A;  1HZ4 A;  3Q9N C;  4FU3 A;  1TN8 A;  3Q5M A;  3ULY A;  1QZ2 A;  1H19 A;  4WWP A;  2ILR A;  4G8K A;  2J09 A;  2MRI A;  2E0I A;  2P9P G;  3PH0 C;  1TJF A;  4NUR A;  1ZU2 A;  4L9P A;  3IHV A;  3PZ2 A;  4ILH B;  4FHJ A;  3FH5 A;  2QFC A;  3DSU A;  4GAA A;  4J8E A;  1K8K G;  2IFU A;  3MKQ B;  4APO A;  4AXH A;  1YYH A;  4KVO A;  2X6F A;  1HS6 A;  1N54 A;  3VTY A;  4CEM A;  4DLO A;  3FY4 A;  3ASH A;  3HVE A;  3AU5 A;  1MYO A;  2PM7 A;  2VGE A;  3LVR E;  4JD2 G;  4C0M A;  3C5R A;  3S7J A;  3KS2 A;  3NF1 A;  4GTO A;  3TGO A;  4GB9 A;  3V2O A;  2LAI A;  3FU0 A;  1TN7 A;  1E8W A;  4XEI G;  5FQ6 A;  3LEW A;  1A5E A;  1H6K A;  2XS1 A;  5FZR A;  1N95 A;  1IQU A;  2RG8 A;  3DSV A;  3QWP A;  5AN8 A;  3RKV A;  4AJW A;  3RO2 A;  3NB2 A;  4I9E A;  2OV8 A;  3SFX A;  3VLE A;  4KXK B;  2WXG A;  1HFA A;  2DCP A;  4MLP A;  5A7D B;  4ANV A;  4J0U A;  3B7B A;  2L6B A;  5KNH D;  1OT8 A;  3JQ1 A;  4E85 A;  3T5V A;  2QYU A;  5EN5 D;  5LCW C;  5BXU A;  2IEJ A;  3D9M A;  2WVI A;  4HQD A;  1IYG A;  3R9M A;  2I2O A;  5J08 A;  4BEP A;  3ESL A;  3MV2 B;  2C2L A;  1UN9 A;  2AWI A;  1JPL A;  2R02 A;  3NOG D;  1L5J A;  1JWG A;  2MOW A;  2X6J A;  2XQ0 A;  4L2L A;  4IRU A;  2EIL E;  3FUL A;  5KJN A;  2HM8 A;  3E37 A;  4WNF A;  1NA0 A;  1B89 A;  2XPZ A;  1FPP A;  2DYR E;  3MKR A;  1E8Z A;  3UM3 A;  4UI9 J;  2J9Q A;  3CVY A;  1IQR A;  4L1B A;  3BQO A;  5KJL A;  3QWV A;  1JCS A;  2CFU A;  1MZC A;  2KCK A;  3T9K A;  4DLQ A;  3BG1 B;  2KC7 A;  3ZPJ A;  5D66 A;  4L23 A;  1TYQ G;  1HX8 A;  3Q4A B;  4ILG A;  4UQY A;  3HVE B;  4HLL A;  1EF1 C;  2X38 A;  4YVQ C;  1AWC B;  3ZFW A;  3LY8 A;  3PNT B;  5CCL A;  1MQS A;  4HI9 A;  3V79 K;  2HR2 A;  3ZXP A;  1OXJ A;  5FIO A;  1Z3X A;  3QAR A;  1HH8 A;  2GRR B;  3APD A;  4KT6 B;  1K1A A;  1O5M A;  5FZQ A;  5BNW A;  4I9C A;  3Q15 A;  2HE0 A;  1WAO 1;  5A6C A;  2IJG X;  2I1J A;  3QDN A;  3IV0 A;  4L2Y A;  3UPV A;  3N71 A;  2XRZ A;  2LAH A;  2Y4U A;  4N3B A;  1OCO E;  3D9K A;  4U0U A;  2QYJ A;  4LEU A;  4ANW A;  4BX8 A;  2A4Z A;  1NFI E;  4JA7 A;  4WNG A;  4UWK A;  4M7C A;  3PRE A;  2CG2 A;  1ZBP A;  2IF4 A;  1TNO A;  4HFG A;  2DYS E;  2PNN A;  1KT1 A;  3SGH A;  1UOH A;  2WMO A;  3Q79 A;  3VLF A;  4KYO B;  3BU8 A;  3OTN A;  2MHK A;  4O1O A;  3NZS A;  2RKK A;  2F0Y A;  4DI4 A;  3QC1 A;  1OWM A;  1DCE A;  4F7A A;  3FUN A;  3DXK G;  1KZP A;  4GCN A;  4U8Y D;  4AVX A;  4JHR A;  2V0P A;  4DUI A;  3BUA A;  5G04 J;  3QOU A;  4N3A A;  1E96 B;  4TV3 A;  3CQG B;  3MGB A;  1D8D A;  3RAU A;  2NXP A;  2WM9 A;  3ONK A;  5FIN A;  3CKC A;  3D9N A;  5BXO A;  2WMN A;  3FUK A;  2JLB A;  4UWH A;  3L9T A;  1ELW A;  4A3V A;  2FEZ A;  2IOL A;  2YHE A;  4FA6 A;  4GTQ A;  2DVW A;  4GZ3 A;  5KCM A;  3QWW A;  3TXN A;  5FJY A;  3FUD A;  4UWG A;  3UT8 A;  4JEU A;  2H6H A;  2P9S G;  3CSF A;  3RU0 A;  1V54 E;  3WXX A;  5FTP A;  4JA9 A;  3CHR A;  2L9B A;  1K3Z D;  4DJA A;  2H6F A; 
#chains in the Genus database with same CATH homology
 4URK A;  4U04 A;  3CV0 A;  1HO8 A;  1KT0 A;  4KZ0 A;  5CMY A;  1FCH A;  2V4L A;  4U8H A;  2WXJ A;  4BY6 A;  2X3M A;  3SHF A;  1BPO A;  4ATG A;  4G23 A;  5AYW D;  1HG5 A;  4G26 A;  4HOU A;  5FWQ A;  3S7F A;  2E2E A;  3SD5 A;  3CK8 A;  3EDT B;  4PDX A;  4WUY A;  4BX9 A;  5BV1 A;  3L16 A;  2BTD A;  4IYP A;  3TXM A;  4MKT A;  2C0M A;  4A1S A;  3SBT B;  4CGW A;  3MZL B;  4OVU A;  4G1T A;  3CVX A;  3D9P A;  2X6H A;  1Z6T A;  3FHE A;  3D9O A;  2CG3 A;  2XGM A;  4DI3 A;  4JVS A;  3TAX A;  4ANU A;  4XKC A;  2R5S A;  4B89 A;  3FH8 A;  4AY6 A;  3PVL A;  2WXP A;  2FUL A;  3CHO A;  3PDN A;  2VSX E;  2XHE A;  2LSV A;  3ASG A;  1EDU A;  3FTZ A;  3FUM A;  3UQ3 A;  3JYS A;  4FHK A;  3FTX A;  2VSO E;  3EHM A;  3LY7 A;  3O48 A;  2HYZ A;  2GRM A;  3EHN A;  4MS6 A;  3URZ A;  3FEY A;  4BTA A;  1OWL A;  4WND A;  4RG9 A;  4FLH A;  4EQF A;  3RIB A;  4FJZ A;  3CHQ A;  2ION A;  4ME2 A;  4C9B B;  5CMW A;  1Y8M A;  2R17 C;  4GU5 A;  5G05 J;  2WXN A;  3CVW A;  3B7U X;  1E7V A;  3FUJ A;  3MV3 B;  5CHE E;  2L0T B;  2Q7F A;  2QY7 A;  3G2V A;  4EBA G;  5C1D A;  3S7B A;  2KCV A;  5ARG A;  1FVH A;  1HZ4 A;  5G05 C;  3G2U A;  2UWJ G;  3LS8 A;  3OXG A;  4XI0 A;  3D3M A;  4NQ0 A;  2CFZ A;  3O4Z A;  1WM5 A;  4FU3 A;  1S0P A;  3TJP A;  3CLJ A;  5LOZ A;  4V3I A;  3Q5M A;  4JZY A;  1QZ2 A;  3QKY A;  3R7R A;  1H19 A;  4WWP A;  2ILR A;  5LFA A;  2J09 A;  4CT0 A;  2XPY A;  2MRI A;  2E0I A;  1QQE A;  2PL2 A;  2XGS A;  3R7Q A;  3L08 A;  4JPS A;  3PH0 C;  1TJF A;  2VGX A;  3GW4 A;  4NUR A;  1ZU2 A;  4KMO A;  4I1M A;  2OOE A;  1HXI A;  3ZEF A;  3IHV A;  3CK9 A;  3D9J A;  4GZD A;  2PQN A;  4FHJ A;  4ILH B;  1MHQ A;  3FH5 A;  2QFC A;  5AIJ A;  3CVV A;  4GAA A;  3BEE A;  3RO3 A;  1YA0 A;  4HLE A;  4J8E A;  1H0A A;  2KM4 A;  2PQR A;  3U4T A;  4RSY A;  3PUJ A;  3GZS A;  4ABN A;  2IFU A;  3MKQ B;  4AIF A;  4APO A;  4YND A;  3LYA A;  5D0Q D;  4AXH A;  3ZN3 A;  1H2T C;  2WXL A;  1OWN A;  3CGH A;  4KVO A;  4A3T A;  2X6F A;  4G25 A;  3EIQ C;  1HS6 A;  4JXT A;  1FVF A;  5BPP A;  1N54 A;  3VTY A;  3CR3 A;  5E75 A;  2NC9 A;  4ACK A;  4CEM A;  4DLO A;  1W3B A;  2M63 A;  2YHC A;  3ASH A;  3FY4 A;  3IKO B;  4R7L A;  3HVE A;  4U63 A;  1X5B A;  3ZVV A;  3AU5 A;  3GYZ A;  4GZC A;  2PM7 A;  4N2Q A;  4AM9 A;  3LVR E;  3KD7 A;  2X6K A;  2KZT B;  1LF8 A;  4HVB A;  4C0M A;  1E7U A;  2VTB B;  3APC A;  1E8Y A;  3KEZ A;  4GZ6 A;  5EX3 A;  3S7J A;  3KS2 A;  5AJD A;  3ZYM A;  5D0O D;  3FWV A;  2WXQ A;  3NF1 A;  2GW1 A;  3L22 A;  3ZRH A;  3ZHE A;  4LCT A;  5LP0 A;  3PEU B;  3TGO A;  4GB9 A;  4J8D A;  2J49 A;  1TJC A;  3LKU A;  2LAI A;  2VSY A;  3AS8 A;  2XRY A;  3FU0 A;  3RJV A;  1SZA A;  1E8W A;  5EDS A;  3ESK A;  5FQ6 A;  3LEW A;  3R9A B;  4H7X A;  1H6K A;  3FH7 A;  3U9W A;  2CHZ A;  2WXO A;  5FZR A;  1IQU A;  1E8X A;  2RG8 A;  1INZ A;  3ASD A;  4HOQ A;  4EEC A;  3QWP A;  2P58 C;  5T3R A;  5AJL A;  3RKV A;  2FBN A;  4AJW A;  3RO2 A;  4EPZ A;  2YQ8 A;  1VDY A;  3QJZ A;  3P2B A;  3FDH A;  2OV8 A;  4I9E A;  3VLE A;  3ZYQ A;  4KXK B;  2WXG A;  4GYO A;  2FF4 A;  3CVN A;  4N3C A;  2L6J A;  1HFA A;  3NQP A;  2DCP A;  3MX3 A;  5J90 A;  4BTB A;  4XZ4 A;  2XEV A;  3GZ2 A;  4MLP A;  1H2U A;  5ENN A;  5A7D B;  4XKB A;  4ANV A;  2VGY A;  2OND A;  4J0U A;  4B8A A;  3CHS A;  4AY5 A;  1UJJ A;  3FTV A;  2WQ7 A;  1TEZ A;  4GA0 A;  5LCW J;  3CQC B;  3FU3 A;  4HOT A;  1EPU A;  2ZU6 B;  3JQ1 A;  4RG6 A;  2IQC A;  2X6I A;  3ZYL A;  3ZXS A;  4DPR A;  4E85 A;  3T5V A;  4PS3 A;  5DIZ A;  5LCW C;  1U3C A;  4HS2 A;  3QB2 A;  5HI7 A;  3CST A;  3LJ3 A;  2KCL A;  3D9M A;  4Y6C A;  3LCA A;  4GYY A;  2WVI A;  4GA2 A;  4OVV A;  4I1O B;  1IYG A;  4KBQ A;  3B7T A;  2I2O A;  5J08 A;  3CEQ A;  4G24 A;  4I6E A;  5AEN A;  3ESL A;  3LPZ A;  2I1K A;  3MV2 B;  3PS6 A;  4CDR A;  3CVP A;  4GCO A;  3LXU X;  2C2L A;  1UN9 A;  3G2T A;  2IOS A;  3HYM B;  4H7Y A;  1EYH A;  4C0E A;  2WPV A;  4CT4 A;  2AWI A;  1JPL A;  5JJ7 A;  2XPI A;  1L5J A;  4UI9 K;  4GA1 A;  1JWG A;  3AS5 A;  1HE8 A;  3TG4 A;  2MOW A;  2X6J A;  3ZW3 A;  2XQ0 A;  1DVP A;  3QNK A;  4GML A;  4L2L A;  3ML9 A;  5BUZ A;  1Y6I A;  2AXU A;  1ELK A;  2WXM A;  3DBS A;  4IRU A;  4O6F A;  5A23 A;  3D9I A;  4IN3 B;  2C0L A;  2XCC A;  3FUL A;  3LVQ E;  3P1U A;  4K0R A;  4BT8 A;  3FFL A;  5KJN A;  3I5P A;  3FUF A;  1PAQ A;  2HM8 A;  3B7R L;  1NP7 A;  3FTW A;  3PUK A;  3JQ0 A;  4WNF A;  1NA0 A;  3CIA A;  2WB2 A;  1B89 A;  2XPZ A;  5JJ6 A;  3Q49 B;  3FP3 A;  3JCK C;  3RRM B;  2AW6 A;  4PH4 B;  3U66 A;  3SNX A;  4LRZ A;  4IUL A;  2L0I A;  3SFZ A;  1P5Q A;  2BF0 X;  3MKR A;  1SZ9 A;  1E8Z A;  3L17 A;  3ONL A;  3Q47 B;  4WWN A;  5FZS A;  2WXK A;  4P29 A;  4GMJ A;  2XGO A;  3FTS A;  4WAF A;  3I4G A;  4ACL A;  4JHK A;  2CHX A;  4UI9 J;  2J9Q A;  1NA3 A;  2YNQ A;  4Q96 A;  2VGX B;  2DBA A;  3PRZ A;  1PC2 A;  5T4Y A;  3UT4 A;  2V8S E;  3D9L A;  3CVY A;  2UY1 A;  1IQR A;  4L1B A;  5KJL A;  4UI9 C;  3EJN A;  3FUH A;  3QWV A;  4JHJ A;  4UQX A;  2CFU A;  4YVO A;  3TG5 A;  1GW6 A;  5JHB A;  5BW8 C;  2KCK A;  3QK0 A;  4EZK A;  2DIW A;  2PZI A;  2RD0 A;  4DLQ A;  1JUQ A;  3BG1 B;  1SQM A;  3FUE A;  2FI7 A;  2KC7 A;  2J4D A;  3VLD A;  2J4B A;  3BG0 B;  3ZPJ A;  2VYI A;  5C2Y A;  4APF A;  4JEH A;  4L23 A;  5T8I A;  4I1A A;  3I4R B;  2VJ8 A;  3IEG A;  3CVU A;  1HX8 A;  3S2A A;  3PNL B;  4CRW A;  3Q4A B;  4ILG A;  2PM6 A;  4UQY A;  2WXR A;  3IBE A;  3LY9 A;  1HF8 A;  3ENE A;  3L13 A;  4N39 A;  3HVE B;  4G11 A;  4F1S A;  3RRN B;  3RRU A;  1UN8 A;  4FC8 A;  5DBK A;  4AEZ C;  1EF1 C;  4LER A;  4GZ5 A;  4CGV A;  2X38 A;  4YVQ C;  4CDN A;  3ZFW A;  4KZC A;  2I9C A;  3LY8 A;  3PNT B;  5CCL A;  1MQS A;  3FEX A;  2WXH A;  4EBA A;  3ZHE B;  2HR2 A;  4U0S A;  3SBS A;  5BV0 A;  3MYV A;  3QAQ A;  1OUV A;  3ZYK A;  4TUU A;  1Z3X A;  4FP7 A;  4BFR A;  4U07 A;  1HG2 A;  3QAR A;  4Q94 A;  1HH8 A;  5JJT A;  2VQ2 A;  4F53 A;  3APD A;  4KT6 B;  3U64 A;  4PS8 A;  4FJY A;  5FZQ A;  1IHG A;  5BNW A;  4I9C A;  3Q15 A;  3CHM A;  3VTX A;  4J8F A;  4J8S A;  3CK7 A;  3OAW A;  4XE0 A;  2AXZ A;  4BSX A;  1WAO 1;  5A6C A;  2IJG X;  2I1J A;  3QDN A;  2WXF A;  3I3N A;  3ULQ A;  3IV0 A;  4L2Y A;  2OVB A;  4HXI A;  4EZL A;  3UPV A;  3UX4 A;  4MRU A;  5CCM A;  3NZU A;  4L7T A;  3IHY A;  4F3V A;  2I6H A;  3G2S A;  3JUI A;  4BWR A;  3FU6 A;  2OVF A;  4FUL A;  4XIF A;  3ZIM A;  3N71 A;  4LUN U;  4N5C A;  3SI5 A;  2XRZ A;  2LAH A;  1JWF A;  1Z3Y A;  2Y4U A;  3K9I A;  4N3B A;  1U3D A;  4JL0 A;  4NAC A;  5BT1 A;  2Y4T A;  3D9K A;  3CHP A;  4U0U A;  4BT9 A;  2FO7 A;  4TRQ A;  5EKQ D;  1DNP A;  3KAE A;  2AXV A;  3FTU A;  4I2W A;  4PS7 A;  3MCX A;  4LEU A;  2HO1 A;  4PUC A;  4ANW A;  3AU4 A;  4WWO A;  1OWO A;  5FT9 A;  1QNF A;  3MJW A;  4BX8 A;  2YIN A;  1N52 A;  2A4Z A;  3U3W A;  4JA7 A;  2WXI A;  4WNG A;  4GYW A;  2JEK A;  2AVP A;  3B13 A;  3FTY A;  4UWK A;  5ANL A;  3PRE A;  5ANR A;  1KLX A;  2CG2 A;  4D10 C;  3FUI A;  1ZBP A;  2IF4 A;  4Y6W A;  3SF4 A;  3UT7 A;  2IU1 A;  3MA5 A;  4KVM A;  2BUG A;  4HFG A;  4FLB A;  3PZD A;  4ANX A;  3HDX A;  1KT1 A;  3SGH A;  4DK5 A;  2Y3A A;  2WMO A;  4G2V A;  3VLF A;  4A55 A;  2NSZ A;  4KYO B;  4UWF A;  4I2Z A;  3CKB A;  1UW4 B;  3OTN A;  2MHK A;  3ASF A;  3EIJ A;  4I6G A;  4U0Z A;  4B8C B;  5E76 A;  4OYS A;  3NZS A;  3LDZ A;  4M3O A;  4NRH B;  4CCA A;  4J6I A;  4B0Z A;  3QC1 A;  1OWM A;  4DI4 A;  4N2S A;  3T5X A;  4F7A A;  5JHA A;  2WQ6 A;  3FUN A;  2J08 A;  3PE3 A;  2KAT A;  3MKQ A;  3L6A A;  3OXL A;  5FQ4 A;  5HQ8 A;  4UQZ A;  1OWP A;  1A17 A;  4GCN A;  4UWL A;  4AVX A;  5KJK A;  5M72 A;  2GRL A;  4I6J A;  3GZ1 A;  2GGF A;  4JHR A;  2V0P A;  4K03 A;  5G04 J;  2EQX A;  3SZ7 A;  3PE4 A;  3T8M A;  3OXF A;  3QOU A;  3MEK A;  2UY1 B;  4W9R A;  3S7D A;  4N3A A;  1E96 B;  5G2N A;  4TV3 A;  4AV7 A;  3CQG B;  3MGB A;  4I17 A;  5G04 C;  2KZT A;  2NXP A;  3E4B A;  3RK6 A;  4CDM A;  4AP2 A;  4FAD A;  2WM9 A;  2VTB A;  3ONK A;  5G55 A;  3CKC A;  4B94 A;  2LNI A;  4XX5 A;  3D9N A;  3AS4 A;  2V5F A;  3ML8 A;  1H2V C;  5EX0 A;  2WMN A;  1XNF A;  2VSN A;  4QFV A;  3FUK A;  4JC8 A;  4E6H A;  4HOS A;  5ARF A;  2JLB A;  5FQ7 A;  1UJK A;  4UWH A;  1NZN A;  1WY6 A;  3APF A;  1ELW A;  4EZJ A;  4A3V A;  2FEZ A;  3PEV B;  1E90 A;  2IOL A;  1PY1 A;  2LO6 A;  2YHE A;  5FQ8 A;  4FA6 A;  3FU5 A;  4WNE A;  4AOF A;  4I43 A;  2R59 A;  4GZ3 A;  1ELR A;  5KCM A;  4Q69 A;  3QWW A;  3TXN A;  3G2W A;  5FJY A;  4A1G A;  3DPD A;  4JW1 A;  2XCB A;  3FUD A;  2WQH A;  4UWG A;  3UUX A;  3UT8 A;  3C98 A;  3ZGQ A;  1HU3 A;  4JEU A;  3L54 A;  4XI9 A;  5KJM A;  3CSF A;  2CHW A;  3RU0 A;  2LSU A;  3CVL A;  5LX8 A;  3UMV A;  4GPK A;  1UG3 A;  2J07 A;  5FTP A;  4ILI A;  4JA9 A;  1XGW A;  3WXX A;  3CHR A;  3B7S A;  3HIZ A;  2L9B A;  4RVB A;  2A5U A;  4DJA A;  3HHM A;  4HOR A;  3CVQ A;  3TL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...