4GA2A

Structure of the n-terminal domain of nup358
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
144
structure length
144
Chain Sequence
RRSKADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAVYKLKEQLLDCEGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords E3 SUMO-PROTEIN LIGASE RANBP2
publication title Crystal structure of the N-terminal domain of Nup358/RanBP2.
pubmed doi rcsb
source organism Pan troglodytes
total genus 56
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ga2A00
5KJMA 5BNWA 3CVLA 3QWWA 4YVQC 2XCBA 3E4BA 2PL2A 4HOTA 2VSNA 3KD7A 4CGWA 4WNEA 4BTBA 2PQRA 2FF4A 4I9EA 4WNDA 5A7DB 2PQNA 1PC2A 3EDTB 4KBQA 3SF4A 2XGSA 3AS5A 3QWPA 3CVNA 4J8FA 2V5FA 3ZHEA 5G04J 2PZIA 4N3AA 4UQXA 3ULQA 2VGXA 4KYOB 2NC9A 5G05J 2I6HA 2WQHA 4G25A 4CGVA 5HQ8A 5FTPA 3R9AB 4IN3B 4U0UA 3CVPA 4WNFA 2YQ8A 1OUVA 4RG6A 3O48A 4YNDA 3SZ7A 1TJCA 4HORA 5A6CA 4G24A 4RG9A 2AVPA 2Q7FA 3MKRA 2KCKA 3S7JA 3MA5A 3CK9A 3URZA 4F3VA 3PE4A 1HH8A 4J8DA 4I9CA 4JL0A 4EQFA 4G2VA 2YHCA 4GZ6A 3RJVA 4J8EA 2UY1B 4W9RA 4G23A 5DBKA 1E96B 1B89A 3IEGA 2LSUA 3GYZA 3RU0A 4I17A 3GW4A 2GW1A 3RO2A 5FZRA 5D0QD 2VSYA 3Q4AB 4G26A 4G1TA 3ASHA 3CK8A 4U0ZA 5CCMA 4GCOA 3RKVA 5G04C 5JJTA 4N3CA 1HXIA 4GA0A 1KLXA 3VTXA 5G05C 3QWVA 3ZN3A 1ZBPA 3QDNA 4GPKA 3ZPJA 5EX3A 4JHRA 2E2EA 1FCHA 5JJ7A 5LCWJ 1A17A 3VTYA 4JA9A 2HR2A 2VQ2A 3CKBA 4Y6WA 2Y4TA 4J0UA 3LKUA 5EX0A 4YVOA 2R5SA 2HO1A 4B94A 4APOA 4BWRA 4I2WA 2FI7A 1HZ4A 3MV3B 3PDNA 2UY1A 3PE3A 4NQ0A 4BTAA 2IFUA 3AS8A 3LY8A 3K9IA 3TG5A 2FO7A 3CV0A 3OXLA 3OXGA 5AYWD 3UPVA 3U3WA 3BEEA 2XPIA 5CCLA 2FBNA 4BT9A 4GA2A 5KJLA 1IYGA 1W3BA 1P5QA 3JYSA 4Y6CA 2XGMA 4GZ5A 3KS2A 4JA7A 1QQEA 4H7YA 3TG4A 4N2SA 5KJKA 5HI7A 4XIFA 1ZU2A 2BUGA 3CVQA 3WXXA 3NF1A 2L6JA 4AM9A 2Y4UA 2OOEA 3TGOA 3Q15A 5DIZA 3AS4A 2VGYA 4A1SA 2KATA 2XCCA 3Q5MA 2P58C 2QFCA 4HOQA 3UQ3A 4GZ3A 5EKQD 3GZ1A 3S7BA 3ZGQA 5FT9A 5LCWC 5ARFA 4N3BA 5CHEE 4WNGA 4N5CA 4NRHB 4UI9K 3Q49B 2C0MA 4UI9J 3N71A 4XI0A 1Y8MA 4AIFA 4UQZA 1ELWA 3FFLA 2FEZA 3QKYA 1XNFA 4AY5A 3S7DA 3MV2B 4GYOA 5KJNA 3ASFA 3CKCA 3RIBA 5BW8C 4H7XA 3CK7A 3HYMB 4O6FA 2KCLA 4U07A 4GCNA 2LNIA 2IF4A 2KC7A 5M72A 1IHGA 3FP3A 4ABNA 5FZQA 4U0SA 2MHKA 4BT8A 1KT1A 3UUXA 3LY9A 3MEKA 3LCAA 4GYWA 4HOUA 3ZFWA 2XEVA 3U4TA 3FWVA 3OXFA 3LPZA 5FJYA 4GA1A 2HYZA 4KXKB 4N39A 2KCVA 1NA0A 3ESKA 4LEUA 1NA3A 2ONDA 5JJ6A 4CDRA 4GYYA 5ARGA 2LSVA 2JLBA 4I2ZA 3CEQA 2UWJG 4U04A 5D0OD 3ASDA 1QZ2A 3TAXA 2C2LA 1KT0A 4HOSA 3RO3A 1YA0A 4WUYA 5BT1A 3Q47B 4ME2A 1ELRA 4UI9C 4N2QA 4XI9A 2C0LA 3ZHEB 2J9QA 3LYAA 3LY7A 3GZ2A 2VGXB 4AY6A 2VYIA 4I1AA 1WM5A 3S7FA 2XGOA 4UQYA 3QOUA 5FZSA 3ASGA 2WPVA 3KAEA 5C1DA 2DBAA 1NZNA 1WAO1
chains in the Genus database with same CATH superfamily
3PZDA 3JUEA 3CVLA 3CHOA 3QWWA 3FTVA 3FTWA 3U9WA 2P9IG 4LSZE 2HE0A 2L0IA 2PL2A 3APDA 4HOTA 2JABA 2QY7A 3C72A 3PUJA 2WXLA 5CRVA 4FULA 3CLJA 4WNEA 2RFMA 2PQRA 4I9EA 3DSVA 5LX8A 2RKKA 5CMYA 3EDTB 2WXMA 4KBQA 3SO8A 4CT4A 3AS5A 3JQ1A 1H19A 1H6PA 3MCXA 4WWNA 5AQ9A 3KSQA 4WAFA 1TYQG 2X3MA 3ULQA 2VGXA 4HLLA 4G25A 5HQ8A 5FTPA 3R7RA 3R9AB 4IN3B 1H2TC 4U0UA 4U7EB 3TWQA 4HBDA 3D9OA 4YNDA 3E37A 5A6CA 3D3MA 2WQ7A 5ANRA 4KMOA 4PDXA 5JHAA 3FUDA 3MYVA 3UINC 3MA5A 3PE4A 2XZDG 4EZJA 1HH8A 1S64A 3PRZA 1OY3D 4I6EA 1H6OA 3ZU7B 5CMWA 3D9PA 2EIJE 3EU9A 3TWXA 2WXQA 4O1PA 3VLEA 2H6FA 4W9RA 4ILGA 1E96B 4UWHA 3IKOB 1B89A 2GRPB 5FZRA 4AP2A 3Q4AB 1OWNA 4GAAA 1MX6A 4F53A 4GTMA 2OV8A 3FY4A 4FLBA 5CERB 1KZOA 4HVBA 2OCCE 3EHRA 2V5QC 2A5UA 1RW2A 5E75A 2WXPA 4ANUA 4AJWA 3PNLB 2R17C 3QWVA 4HRMB 1Z5SC 2R2LA 3PZ4A 4XKCA 3IBEA 3FUEA 3DRAA 5EX3A 1NP7A 1N95A 3HVEB 3ABKE 1A17A 1VDYA 2XHEA 4GTQA 2P9LG 4Y6WA 2Y0BG 3HXFA 4TV3A 3RK6A 1S0PA 4JB8P 3T5XA 1DNPA 2ILRA 4I2WA 2X6JA 4DX6D 3PUKA 4JXTA 3PDNA 4ZHBA 4HI8A 2WB2A 4BTAA 2BEDA 3FTYA 4HNAD 2X6FA 3TG5A 2XZTG 2FO7A 1K1BA 3RSEG 5FQ8A 5B1BE 4DLQA 3FU5A 3U3WA 4URKA 5AJDA 3ZYMA 1DVPA 2XPIA 2DZNA 4BT9A 4GA2A 5KJLA 1W3BA 3EHQA 2XEEA 4GZ5A 2GRMA 2P9NG 3ZKJA 1TN8A 5HI7A 3C3RA 3ZYQA 3E34A 4HFGA 4FJZA 1N0QA 5EYPF 3HVEA 2WXJA 4NIKA 3Q15A 1PY1A 3AS4A 3AG1E 4A1SA 2KATA 2XCCA 3Q5MA 2P58C 2QFCA 2WVIA 5IY5E 3TXNA 1N4QA 4UI9J 4K5AB 2H6IA 2IOLA 2Y1LE 3LXUX 4XI0A 1Y8MA 3FFLA 3ESLA 5BXUA 4AY5A 5ENSD 4GYOA 3ABME 4LG6A 3LJNA 1OWOA 3CKCA 2NXPA 3B7UX 4H7XA 4M3OA 3ASNE 2LNIA 5B3SE 4GMLA 5D2MC 3B95A 4ABNA 3NOCD 4U0SA 5AAOA 5KNHD 5G55A 4BT8A 1OXJA 1N52A 1Z3YA 2M63A 4CDNA 3ASOE 3EIQC 2HM8A 1AP7A 3TL5A 3LCAA 1TR4A 3UIPC 2A5EA 4FA6A 3HXCA 4HOUA 4TXRA 2XEVA 5ENQD 3LPZA 2HYZA 2E0IA 4DK5A 4N39A 1N4RA 2WMOA 3RRMB 1HX8A 1BU9A 1ZB1A 2ONDA 4CDRA 4GYYA 3C3OA 5D0OD 4IRUA 3QK0A 3WG7E 4JEHA 1FPPA 3CVUA 1QZ2A 3TAXA 2OEVA 2IQCA 2WXIA 4Q94A 3RO3A 3LEWA 4E6HA 1TNOA 4J8SA 3Q47B 2CHWA 3DSXA 4ME2A 4UI9C 3CHSA 1SW6A 1H2VC 2C0LA 5JA4D 5EDSA 4AY6A 2BTDA 4I1AA 2RFAA 2X6HA 3NZUA 4AXHA 4UQYA 4MLPA 3QOUA 5FZSA 1MHQA 1S63A 1D8DA 4TXPA 4F1PA 3FULA 2DBAA 2DYRE 1JUQA 5EIBE 4QQIA 4XX5A 5BNWA 3IXEA 1JPLA 3UKUG 3C5RA 2WXHA 3L08A 2XCBA 3SFYA 2NSZA 3G2UA 4EPZA 2X6KA 2J4BA 2VTBB 4I43A 2IONA 2L0TB 5FWQA 3Q79A 3ULYA 3HXDA 4CGWA 2IU1A 3SFXA 5A7DB 1BPOA 2PQNA 5LOZA 3ZEFA 3JQ0A 3ML9A 3QWPA 3ONKA 1OCOE 3CQCB 4FHKA 4J8FA 2LUHA 5ENPD 2R02A 5BV1A 3RRUA 3ZW3A 3FUJA 3UM3A 3LS8A 3L22A 3LVQE 3RAUA 1OT8A 4K03A 4DI4A 2ZISA 2AW6A 1OCRE 3MZLB 4KZCA 1UJKA 1TJCA 3QNKA 4LUNU 2YHEA 4IULA 1E8YA 3CHRA 2AVPA 2Q7FA 3CQGB 4D10C 2CG2A 2OVFA 3NBNB 3P2BA 3CK9A 3URZA 2I2OA 3GZSA 3C98A 4OVUA 2QYUA 3CHMA 4JL0A 3PZ2A 4EQFA 2VTBA 4APFA 1N11A 1QNFA 4GTRA 1TEZA 2J07A 3G2SA 2UY1B 3QJZA 4DI3A 5DBKA 2XRYA 3J5PA 4BY6A 1N94A 1HS6A 3GW4A 3HDXA 5D0QD 2VSYA 1DC2A 4G1TA 2WM9A 5LFAA 1D9SA 4BEPA 3APCA 1E7UA 3CK8A 5CCMA 5KWDA 2LAHA 2XQ0A 2R59A 1ZBPA 4Q69A 1OWMA 3QDNA 2DVWA 3MJWA 4JHRA 3G2TA 2E2EA 3AG3E 1GW6A 1OCZE 5LCWJ 2HR2A 3HXEA 2VQ2A 4GU5A 3KSLA 2WQ6A 4OVVA 3LKUA 3ZRHA 5EX0A 3PZ1A 3UT7A 2R5SA 3ENEA 4QFVA 4EECA 4L1BA 5D66A 2FI7A 2BKKB 1HG2A 4LCTA 1IQRA 3MV3B 2QC9A 2UY1A 1Q2ZA 3BUAA 3LY8A 3K9IA 3CV0A 4X8QA 3OXLA 1TN6A 1JWGA 1HG5A 2I9CA 3L17A 3SD5A 3UPVA 4DRXE 2ZGDA 5CCLA 3FTXA 2P9UG 5AQ7A 3L54A 4P29A 1IYGA 1UN8A 3SHFA 3EHNA 3FTSA 1BD8A 2XGMA 3ZUVB 2XS8A 4WWPA 4KT6B 4LERA 3APFA 1ZU2A 3TWRA 3UKRG 4O60A 3C3QA 3DBSA 4AM9A 3UM2A 2OOEA 2RG8A 3VLFA 4DX7D 1JCRA 3IV0A 2AXZA 1HE8A 4UWFA 3AU4A 3D9IA 4F1SA 3PH0C 3NQPA 5LCWC 1N4SA 2DYSE 4A1GA 1HFAA 1LD8A 5ENTD 4WNGA 5T4YA 2C0MA 3N71A 2GROB 1ELWA 3S2AA 4YDOA 3DPYA 4CEMA 3B7TA 1XNFA 4TUMA 3KEAA 3V79K 1HF8A 3RIBA 5AARA 5BW8C 4KVOA 2WXKA 3B7BA 2P9SG 2KCLA 4O6FA 3FUKA 2CFZA 4PS8A 4LNGA 2P2CP 4ANVA 3AG4E 2EIKE 4MRUA 1KT1A 1V55E 1UG3A 4ACKA 3ONLA 3HRAA 4U95D 3DEPA 3Q75A 2XEHA 1N4PA 3U66A 3PREA 3I3NA 4I1OB 4K5CA 1D8EA 3U4TA 3FWVA 4GPMA 2WXGA 4J7WA 3I5PA 2KCVA 4MKTA 3RRNB 1NA0A 3ESKA 5H7PA 3ULEG 5ENOD 4PUCA 1NA3A 3JCKC 2YINA 2LSVA 2JLBA 1KZPA 3PEUB 3D9MA 2V4HC 2WMNA 2UWJG 4U04A 2MOWA 3UXGA 1YMPA 4OYSA 1TJFA 4N2QA 4JD2G 1KPSB 1LD7A 2GRLA 4GZCA 1UW4B 3DEOA 3FU6A 3IHVA 1X5BA 2VYIA 5J90A 1WM5A 5JHBA 2L9BA 3DWLG 3W9FA 3EIJA 5HS0A 2EQXA 4HLEA 4ZFHA 4FLHA 3MGBA 2F37A 1YYHA 2QZAA 3OAWA 4EZKA 4HS2A 3UI2A 4U8VD 5ENRD 5CBNA 4EZLA 4KVMA 2J4DA 3E4BA 2XS1A 3PS6A 4FJYA 3CSFA 3ZXPA 4IYPA 3KD7A 5A23A 5AQAA 4A63B 3PZ3A 2XPYA 4UWGA 3T8KA 3L6AA 3EU5A 3DXKG 3SQVA 4WNDA 1PC2A 1K3ZD 2KZTB 4PS7A 3NB2A 1SZ9A 3ZXSA 2V5FA 5G04J 2PZIA 3UTMA 4UQXA 4KYOB 2NC9A 5G05J 3L9TA 4AVXA 3CVPA 3I4GA 4RG6A 2Y69E 3FUIA 3O48A 4BETA 3KEZA 2ZGGA 4G24A 4RG9A 1EDUA 5AN8A 3MKRA 2GGFA 2KCKA 2I1JA 4LNBA 3DSSA 4F3VA 1U3CA 4J8DA 4ANWA 4XE0A 4FADA 1O1SA 2XPZA 4UUCA 3D9JA 4I1MA 2CFUA 2L6BA 2B6CA 2J08A 3G2WA 3ISMC 4GZ6A 2Y3AA 1WY6A 1WDYA 1HO8A 1QYMA 4BSXA 2KZTA 2AXUA 4O1OA 3IEGA 5T3RA 2LSUA 4ATGA 5CBOA 1L5JA 2GW1A 1FT1A 4G26A 3SY2A 4L7TA 3NAWA 3ZYLA 4J6IA 4A55A 3L13A 3UM1A 1TNYA 3FUMA 4U96D 5ENNA 1UOHA 4U0ZA 3ZVVA 2DIWA 5ITZF 3J5QB 3RKVA 5G04C 2P9KG 2WXOA 4N3CA 4GA0A 1KLXA 5FQ7A 3VTXA 5BXOA 5G05C 3ZN3A 4E85A 4KZ0A 4GPKA 3FH8A 2EILE 3FDHA 3BG1B 4FP7A 2X38A 4JA9A 3UT8A 5FQ4A 4J0UA 4Z68A 2F8YA 2HO1A 1K1AA 4BWRA 4APOA 5LP0A 3W9GA 5HKPA 1HZ4A 4NQ0A 3Q73A 1MYOA 2PM6A 3D9KA 4I6JA 1U3DA 3ZNGA 1OCCE 3Q7FA 4JHKA 5AYWD 1H2UA 5B1AE 3CVXA 3BEEA 1V54E 2VSOE 3CIAA 3ZIMA 5J08A 4B89A 3FUHA 1NL4A 3CVWA 3JYSA 4Y6CA 4TUUA 4JA7A 1QQEA 3CVYA 4H7YA 3SNXA 2XENA 3TG4A 4N2SA 3QB2A 5KJKA 2F0YA 4XIFA 3CVQA 2BUGA 5CEAA 1UJJA 3WXXA 4AOFA 3HG0D 3QAQA 3L16A 4RLYA 2Y4UA 5AJLA 4C9BB 5JMND 5FIOA 2VGYA 1LF8A 2I1KA 4HOQA 5EKQD 3S7BA 3BU8A 5FT9A 5ARFA 3QC1A 4DUIA 3B13A 3EUVA 3AJIA 5CHEE 1NI1A 4UI9K 1X81A 1N9AA 3SI5A 4GTPA 4AEZC 2BKGA 1NFIE 2KM4A 4AIFA 4HXIA 4UQZA 3R9MA 3HXBA 3QKYA 3TWSA 3S7DA 4PS3A 5KJNA 2B0OE 3UM0A 3D9LA 1H6KA 1SQMA 2ZIRA 2R03A 2EINE 4BFRA 3HYMB 1E8ZA 4U07A 2AJAA 4GCNA 1BI8B 3JUIA 2KC7A 3AAAC 5M72A 4V3IA 3T9KA 1IHGA 1IXVA 2GRQB 5FZQA 4EHMA 3V31A 4B93B 3HIZA 2IO2C 5BPPA 1OWPA 1O1TA 4GYWA 2LAIA 4J8YA 4ATZD 2MRIA 1E90A 3IHYA 3ZFWA 3DPDA 3OXFA 5CECB 4GTOA 2ETCA 4GA1A 3MKQB 4KXKB 3TWUA 3CHPA 3BG0B 4BERA 1QBQA 3EJNA 2LO6A 5CEDB 5ARGA 3UMVA 2AWIA 2WXFA 3CEQA 2DZOA 3CGHA 3HHMA 3TXMA 1KT0A 4HOSA 3LJ3A 1YA0A 4WUYA 1XGWA 3PNTB 4LNUD 2XRZA 4XI9A 1MQSA 2ETBA 3ZHEB 1IHBA 4CRWA 4GB9A 3GZ2A 1MZCA 3B7RL 2CHXA 1E7VA 4NACA 5KBAA 4YDYA 2FO1E 4G8KA 2XGOA 3JXIA 2WPVA 3KAEA 5AQBA 5C1DA 1NZNA 5T8IA 3JXJA 2X6IA 1EF1C 1BLXB 4CDMA 1Y6IA 1WAO1 4EBAA 5KJMA 1FT2A 3TWWA 3MKQA 5BV0A 2ZU6B 5FQ6A 1E8WA 3Q9NC 4F6RD 5G2NA 1TNBA 2IOSA 1EYHA 4GTVA 4YVQC 3TWTA 3V2OA 4DLOA 4L2LA 2AXVA 4K5BA 2J09A 3FU3A 4CYMD 2VSNA 4B8CB 3D9NA 3CHQA 3Q78A 3DSTA 4L9PA 3TJPA 1TNZA 3D9HA 4BTBA 2FF4A 5C2YA 3ZYKA 2MYOA 3Q9UC 4GMJA 3SF4A 2XGSA 4CCAA 4HRNA 3DSUA 3CVNA 4LRZA 4R7LA 4DX2A 3ZHEA 1N0RA 2WXNA 4N3AA 1LTXA 1IKND 3VLDA 4U8YD 2I6HA 2WQHA 4CGVA 3O4ZA 4HRLA 2DCPA 1TN7A 2BF0X 3CR3A 4WNFA 2YQ8A 1OUVA 3FTUA 2IY0C 3UIOC 3SZ7A 4BX9A 1FVFA 3LVRE 4HB5A 4HORA 2VJ8A 1SZAA 1RZ4A 4K0RA 1YCSB 2V4LA 3OTNA 4PH4B 3S7JA 1JWFA 1Z3XA 3E30A 4WWOA 2A4ZA 5E76A 4I9CA 3ABLE 1DCQA 4G2VA 4RVBA 2YHCA 1A5EA 2NYJA 3RJVA 4J8EA 2WXRA 4G23A 4RQIA 1DCEA 1Z6TA 1U2VG 4CT0A 5BUZA 2J8SD 3U64A 3UT4A 1MX4A 3GYZA 1MX2A 3PVLA 3RU0A 4I17A 4ANXA 3B7SA 3RO2A 4TXQA 3FUFA 2KBXA 4MBGA 3ASHA 3V2XA 1WG0A 4RSYA 4U8HA 3P1UA 4JW1A 1SA4A 4L2YA 2CG3A 5KNGA 4GCOA 5EIDA 5JJTA 4C48B 1HXIA 1K8KG 3FEYA 4JC8A 5EN5D 4B8AA 1HU3A 4HI9A 3R7QA 3ZPJA 1IQUA 4GZDA 4JPSA 1FCHA 5JJ7A 3EHMA 3VTYA 4A3TA 3CKBA 2Y4TA 4C0MA 4YVOA 5HRYA 3SGHA 4B94A 2YNQA 2IJGX 2PM7A 3NZSA 3PE3A 3Q7AA 2KXPC 2GRRB 2IFUA 3AS8A 4DJAA 4YDEA 5EILA 2CHZA 3OXGA 2OVBA 4ACLA 4FHJA 3SBSA 3CVVA 2P9PG 3FTZA 2F8XK 4JHJA 2IO3C 2FBNA 1G3NB 1N54A 1P5QA 4GTTA 4UWLA 4G11A 3KS2A 3PEVB 2GRNB 2JEKA 3DSWA 4I6GA 3X2QE 4F7AA 4N5QA 4M7CA 4ILIA 4UWKA 3NF1A 3AU5A 1MJ0A 2R05A 2L6JA 1UN9A 4HQDA 3TGOA 5DIZA 3T5VA 1ELKA 4NURA 3FUNA 3FEXA 3UQ3A 4GZ3A 3E33A 3I4RB 3GZ1A 3F6QA 4B0ZA 3ZGQA 4N3BA 4BX8A 4JVSA 1O1RA 4N5CA 4NRHB 3Q49B 1O5MA 3BQOA 1FVHA 4XEIG 2ETAA 3LDZA 2IEJA 1E8XA 1JCSA 4AV7A 2FEZA 1SA5A 2V0PA 5AENA 4BESA 3MV2B 1PAQA 4FU3A 3ASFA 3FHEA 5KCMA 3MX3A 3CK7A 5CRUA 3FH5A 4OAVB 3T8MA 2OEWA 2IF4A 2LXMA 1S70B 3FP3A 2DWZA 1SVXA 2MHKA 3FH7A 1BI7B 4MS6A 3UUXA 3LY9A 1AWCB 3MEKA 1JCQA 4DPRA 4BSZB 5AIJA 3E32A 4XKBA 2RD0A 1INZA 4U63A 2H6GA 4A3VA 5FJYA 4CZ2D 4Q96A 3FU0A 4LEUA 4YDWA 1H0AA 2LXLA 3ML8A 5JJ6A 4I2ZA 1TNUA 3QARA 4JEUA 2H6HA 1EPUA 3ASDA 3V30A 4JZYA 4TRQA 2C2LA 3SFZA 4EBAG 1OWLA 2FULA 4DX1A 2VSXE 2V8SE 2J49A 5BT1A 4L23A 1ELRA 4GMRA 3TWVA 4OAUC 3AG2E 2EIME 2J9QA 3LYAA 2ZXWE 3LY7A 2PNNA 3DXMG 5EYLA 2VGXB 3CSTA 3NOGD 5ANLA 5FINA 3S7FA 4GTSA 4XZ4A 4ILHB 2QYJA 3ASGA 3UX4A 3G2VA 3L82A 3SBTB 4DX5D 4G8LA 4FC8A 2VGEA 4C0EA
chains in the Genus database with same CATH topology
3PZDA 3OAWA 4EBAA 5BNWA 5KJMA 3CVLA 4EZKA 4HS2A 3MKQA 3CHOA 3QWWA 3FTVA 3FTWA 2ZU6B 5BV0A 1JPLA 5FQ6A 1E8WA 4EZLA 3U9WA 5G2NA 2WXHA 3L08A 4KVMA 2IOSA 1EYHA 2J4DA 2L0IA 4YVQC 4DLOA 4L2LA 2XCBA 3E4BA 2PL2A 2AXVA 2NSZA 3APDA 3G2UA 4HOTA 4EPZA 3PS6A 2J09A 2X6KA 2J4BA 4FJYA 2VTBB 3CSFA 3FU3A 2QY7A 4I43A 2VSNA 2IONA 4IYPA 4B8CB 2L0TB 3PUJA 3KD7A 3D9NA 5A23A 3CHQA 5FWQA 2WXLA 3TJPA 2XPYA 4FULA 4UWGA 4CGWA 3CLJA 4WNEA 3L6AA 4BTBA 2PQRA 2FF4A 5C2YA 4I9EA 3ZYKA 2IU1A 4WNDA 5LX8A 5A7DB 1BPOA 2PQNA 1PC2A 5CMYA 4PS7A 2KZTB 2WXMA 3EDTB 2XGSA 4GMJA 4KBQA 5LOZA 3SF4A 4CCAA 3ZEFA 3ZXSA 1SZ9A 3JQ0A 4CT4A 3ML9A 3AS5A 3QWPA 3ONKA 3CVNA 3CQCB 4FHKA 3JQ1A 4J8FA 1H19A 4LRZA 4R7LA 2V5FA 3MCXA 3ZHEA 5G04J 4WWNA 2PZIA 2WXNA 5BV1A 4N3AA 4UQXA 4WAFA 2X3MA 3ULQA 2VGXA 3RRUA 4KYOB 3VLDA 2NC9A 5G05J 3ZW3A 2I6HA 3FUJA 2WQHA 4G25A 4AVXA 4CGVA 5HQ8A 3LS8A 3L22A 5FTPA 3R7RA 3O4ZA 3R9AB 3LVQE 4IN3B 1H2TC 4U0UA 3CVPA 2DCPA 2BF0X 4K03A 3CR3A 4WNFA 3I4GA 2YQ8A 4DI4A 1OUVA 4RG6A 2AW6A 3D9OA 3FTUA 3FUIA 3O48A 3MZLB 4KZCA 1UJKA 4YNDA 3SZ7A 4BX9A 1FVFA 1TJCA 3LVRE 4HORA 2VJ8A 3QNKA 5A6CA 3KEZA 1SZAA 4G24A 4K0RA 4LUNU 4RG9A 2YHEA 4IULA 1E8YA 3D3MA 1EDUA 2WQ7A 5ANRA 3CHRA 2AVPA 2Q7FA 2V4LA 3CQGB 3MKRA 2GGFA 2KCKA 3OTNA 4KMOA 4PH4B 2CG2A 3S7JA 4D10C 2I1JA 4PDXA 5JHAA 3FUDA 1JWFA 2OVFA 1Z3XA 3MYVA 3P2BA 3MA5A 3CK9A 3URZA 4F3VA 1U3CA 2I2OA 3PE4A 4EZJA 1HH8A 4J8DA 3GZSA 4ANWA 3PRZA 4XE0A 4FADA 4I6EA 4WWOA 2XPZA 3C98A 4OVUA 2A4ZA 5E76A 3D9JA 4I9CA 4I1MA 3CHMA 4JL0A 4EQFA 2VTBA 2CFUA 5CMWA 3D9PA 4APFA 4G2VA 2J08A 3G2WA 4RVBA 2YHCA 1QNFA 4GZ6A 1TEZA 2J07A 3RJVA 2WXQA 3G2SA 4J8EA 2UY1B 2WXRA 2Y3AA 3VLEA 4W9RA 1WY6A 3QJZA 4DI3A 4G23A 4ILGA 1E96B 2XRYA 5DBKA 1HO8A 1Z6TA 4CT0A 4BSXA 5BUZA 2KZTA 2AXUA 3U64A 3UT4A 4UWHA 3IKOB 1B89A 3IEGA 5T3RA 2LSUA 4ATGA 3GYZA 3PVLA 3RU0A 4BY6A 4I17A 1HS6A 4ANXA 3B7SA 1L5JA 2GW1A 3GW4A 3RO2A 5FZRA 3HDXA 5D0QD 2VSYA 3Q4AB 4AP2A 1OWNA 4GAAA 4G26A 3FUFA 4G1TA 4F53A 4L7TA 2OV8A 3FY4A 3ASHA 2WM9A 4FLBA 4J6IA 3ZYLA 5LFAA 4A55A 4RSYA 3APCA 3L13A 4HVBA 3FUMA 4U8HA 3P1UA 1E7UA 5ENNA 4JW1A 3CK8A 4L2YA 4U0ZA 2A5UA 2CG3A 2DIWA 3ZVVA 5E75A 4GCOA 3RKVA 5CCMA 5G04C 5JJTA 2LAHA 2WXOA 2WXPA 4N3CA 4ANUA 4AJWA 2XQ0A 1HXIA 4GA0A 3FEYA 1KLXA 3PNLB 5FQ7A 4JC8A 2R17C 2R59A 3VTXA 5G05C 4B8AA 3QWVA 3ZN3A 1HU3A 1ZBPA 4Q69A 1OWMA 3QDNA 3R7QA 4XKCA 4E85A 4KZ0A 3IBEA 3FH8A 3FUEA 3MJWA 3ZPJA 5EX3A 4GPKA 1IQUA 1NP7A 4GZDA 4JHRA 3FDHA 3G2TA 4JPSA 2E2EA 1FCHA 3BG1B 4FP7A 5JJ7A 1GW6A 2X38A 3HVEB 5LCWJ 1A17A 3EHMA 3VTYA 1VDYA 2XHEA 4JA9A 2HR2A 4GU5A 2VQ2A 3CKBA 4A3TA 4Y6WA 3UT8A 2Y4TA 2WQ6A 4OVVA 5FQ4A 4J0UA 3LKUA 4C0MA 3ZRHA 5EX0A 3UT7A 4TV3A 3RK6A 4YVOA 2R5SA 3ENEA 4QFVA 1S0PA 4EECA 3SGHA 4L1BA 2HO1A 3T5XA 1DNPA 4B94A 2YNQA 2ILRA 4APOA 4I2WA 4BWRA 2X6JA 5LP0A 2FI7A 1HG2A 4LCTA 1IQRA 1HZ4A 3PUKA 2IJGX 3MV3B 4JXTA 3PDNA 2PM7A 2UY1A 3NZSA 2WB2A 3PE3A 4NQ0A 4BTAA 2IFUA 3FTYA 3AS8A 4DJAA 2PM6A 3LY8A 3K9IA 2X6FA 3TG5A 2FO7A 3CV0A 3D9KA 4I6JA 1U3DA 3OXLA 2CHZA 1JWGA 3OXGA 4JHKA 1HG5A 2OVBA 1H2UA 2I9CA 5AYWD 4ACLA 3L17A 4FHJA 5FQ8A 3SBSA 3SD5A 4DLQA 3FU5A 3FTZA 3CVVA 3UPVA 3CVXA 3U3WA 4URKA 5AJDA 3BEEA 3ZYMA 2VSOE 3CIAA 1DVPA 3ZIMA 2XPIA 5CCLA 5J08A 4JHJA 3FTXA 2FBNA 4BT9A 3L54A 4GA2A 5KJLA 4P29A 1IYGA 1W3BA 4B89A 1UN8A 3FUHA 1N54A 3SHFA 1P5QA 3EHNA 3FTSA 3CVWA 3JYSA 4Y6CA 2XGMA 4GZ5A 4UWLA 2GRMA 4WWPA 4TUUA 4G11A 4KT6B 3KS2A 4JA7A 1QQEA 3CVYA 3PEVB 4H7YA 2JEKA 3SNXA 4LERA 3TG4A 4N2SA 3QB2A 5KJKA 5HI7A 4I6GA 3APFA 4XIFA 1ZU2A 2BUGA 3CVQA 3ZYQA 4F7AA 1UJJA 4HFGA 4FJZA 3WXXA 4ILIA 4UWKA 3NF1A 4AOFA 3AU5A 3DBSA 2L6JA 4AM9A 3QAQA 3L16A 2Y4UA 5AJLA 4C9BB 2OOEA 1UN9A 3HVEA 2RG8A 3TGOA 3VLFA 2WXJA 3IV0A 3Q15A 1PY1A 3AS4A 5DIZA 1ELKA 3T5VA 2AXZA 2VGYA 1HE8A 4NURA 1LF8A 4UWFA 4A1SA 2KATA 3AU4A 2XCCA 3Q5MA 3FUNA 2I1KA 4CDRA 2P58C 3D9IA 2QFCA 3FEXA 4HOQA 3UQ3A 4F1SA 2WVIA 4GZ3A 3PH0C 5EKQD 3I4RB 3GZ1A 3TXNA 3S7BA 4B0ZA 3ZGQA 3NQPA 5FT9A 5ARFA 3QC1A 4N3BA 5LCWC 4A1GA 4BX8A 3B13A 4JVSA 1HFAA 5CHEE 4WNGA 4N5CA 4NRHB 4UI9K 3Q49B 5T4YA 2C0MA 4UI9J 3N71A 3SI5A 2IOLA 1FVHA 3LXUX 4XI0A 3LDZA 1Y8MA 4AEZC 2KM4A 4AIFA 4HXIA 4UQZA 1ELWA 3S2AA 1E8XA 3FFLA 3ESLA 4AV7A 2FEZA 4CEMA 3QKYA 3B7TA 2V0PA 1XNFA 5AENA 4AY5A 3S7DA 3MV2B 4GYOA 4PS3A 1PAQA 5KJNA 3D9LA 1HF8A 1H6KA 3ASFA 4FU3A 3FHEA 1OWOA 3CKCA 1SQMA 2NXPA 5KCMA 3B7UX 3RIBA 5BW8C 4H7XA 3MX3A 3CK7A 4KVOA 3FH5A 4BFRA 2WXKA 3HYMB 4M3OA 1E8ZA 2KCLA 4O6FA 3T8MA 4U07A 3FUKA 4GCNA 2LNIA 2IF4A 3JUIA 2KC7A 2CFZA 4V3IA 5M72A 1IHGA 4PS8A 3FP3A 4GMLA 4ABNA 4ANVA 5FZQA 4U0SA 5G55A 4MRUA 2MHKA 3FH7A 4BT8A 1KT1A 3HIZA 1N52A 1Z3YA 1UG3A 4ACKA 2M63A 5BPPA 4MS6A 3UUXA 4CDNA 3ONLA 3LY9A 3EIQC 1OWPA 2HM8A 3MEKA 3TL5A 3U66A 3LCAA 3PREA 4GYWA 2LAIA 3I3NA 4DPRA 4I1OB 2MRIA 4FA6A 5AIJA 4HOUA 1E90A 4XKBA 3IHYA 3ZFWA 2RD0A 2XEVA 3DPDA 3U4TA 3FWVA 3OXFA 4U63A 1INZA 3LPZA 2WXGA 4A3VA 5FJYA 4GA1A 3MKQB 2HYZA 2E0IA 4Q96A 4KXKB 3FU0A 4DK5A 3CHPA 4N39A 3BG0B 3I5PA 2KCVA 4MKTA 2WMOA 3RRMB 3RRNB 1NA0A 3ESKA 1HX8A 4LEUA 1H0AA 3EJNA 4PUCA 1NA3A 2LO6A 2ONDA 3JCKC 3ML8A 4GYYA 2YINA 5ARGA 2LSVA 2JLBA 5JJ6A 4I2ZA 3UMVA 2AWIA 2WXFA 3CEQA 3PEUB 3D9MA 3QARA 4JEUA 2WMNA 2UWJG 4U04A 2MOWA 5D0OD 3CGHA 3HHMA 4IRUA 3QK0A 3TXMA 1EPUA 3ASDA 4JEHA 3CVUA 1QZ2A 4JZYA 3TAXA 4TRQA 2C2LA 2IQCA 3SFZA 1KT0A 2WXIA 4EBAG 4HOSA 1OWLA 4Q94A 3LJ3A 2FULA 3RO3A 1YA0A 3LEWA 4WUYA 4E6HA 2VSXE 2V8SE 2J49A 5BT1A 4J8SA 1XGWA 3Q47B 4OYSA 2CHWA 4L23A 3PNTB 4ME2A 2XRZA 1ELRA 1TJFA 4UI9C 4N2QA 3CHSA 4XI9A 1H2VC 1MQSA 2C0LA 3ZHEB 2J9QA 2GRLA 3LYAA 4GZCA 4CRWA 3LY7A 1UW4B 4GB9A 5EDSA 3GZ2A 2VGXB 3FU6A 2BTDA 4AY6A 3IHVA 3CSTA 3B7RL 2CHXA 1X5BA 1E7VA 2VYIA 4NACA 5J90A 4I1AA 5ANLA 1WM5A 2X6HA 3NZUA 3S7FA 2XGOA 4UQYA 4XZ4A 2L9BA 4ILHB 4AXHA 5JHBA 3EIJA 3QOUA 4MLPA 5FZSA 1MHQA 3ASGA 2WPVA 3UX4A 3KAEA 2EQXA 3G2VA 4HLEA 3SBTB 5C1DA 3FULA 2DBAA 1NZNA 1JUQA 4FLHA 5T8IA 4FC8A 4XX5A 3MGBA 2X6IA 1EF1C 4C0EA 4CDMA 1Y6IA 1WAO1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJM A;  5BNW A;  3CVL A;  3QWW A;  4YVQ C;  2XCB A;  3E4B A;  2PL2 A;  4HOT A;  2VSN A;  3KD7 A;  4CGW A;  4WNE A;  4BTB A;  2PQR A;  2FF4 A;  4I9E A;  4WND A;  5A7D B;  2PQN A;  1PC2 A;  3EDT B;  4KBQ A;  3SF4 A;  2XGS A;  3AS5 A;  3QWP A;  3CVN A;  4J8F A;  2V5F A;  3ZHE A;  5G04 J;  2PZI A;  4N3A A;  4UQX A;  3ULQ A;  2VGX A;  4KYO B;  2NC9 A;  5G05 J;  2I6H A;  2WQH A;  4G25 A;  4CGV A;  5HQ8 A;  5FTP A;  3R9A B;  4IN3 B;  4U0U A;  3CVP A;  4WNF A;  2YQ8 A;  1OUV A;  4RG6 A;  3O48 A;  4YND A;  3SZ7 A;  1TJC A;  4HOR A;  5A6C A;  4G24 A;  4RG9 A;  2AVP A;  2Q7F A;  3MKR A;  2KCK A;  3S7J A;  3MA5 A;  3CK9 A;  3URZ A;  4F3V A;  3PE4 A;  1HH8 A;  4J8D A;  4I9C A;  4JL0 A;  4EQF A;  4G2V A;  2YHC A;  4GZ6 A;  3RJV A;  4J8E A;  2UY1 B;  4W9R A;  4G23 A;  5DBK A;  1E96 B;  1B89 A;  3IEG A;  2LSU A;  3GYZ A;  3RU0 A;  4I17 A;  3GW4 A;  2GW1 A;  3RO2 A;  5FZR A;  5D0Q D;  2VSY A;  3Q4A B;  4G26 A;  4G1T A;  3ASH A;  3CK8 A;  4U0Z A;  5CCM A;  4GCO A;  3RKV A;  5G04 C;  5JJT A;  4N3C A;  1HXI A;  4GA0 A;  1KLX A;  3VTX A;  5G05 C;  3QWV A;  3ZN3 A;  1ZBP A;  3QDN A;  4GPK A;  3ZPJ A;  5EX3 A;  4JHR A;  2E2E A;  1FCH A;  5JJ7 A;  5LCW J;  1A17 A;  3VTY A;  4JA9 A;  2HR2 A;  2VQ2 A;  3CKB A;  4Y6W A;  2Y4T A;  4J0U A;  3LKU A;  5EX0 A;  4YVO A;  2R5S A;  2HO1 A;  4B94 A;  4APO A;  4BWR A;  4I2W A;  2FI7 A;  1HZ4 A;  3MV3 B;  3PDN A;  2UY1 A;  3PE3 A;  4NQ0 A;  4BTA A;  2IFU A;  3AS8 A;  3LY8 A;  3K9I A;  3TG5 A;  2FO7 A;  3CV0 A;  3OXL A;  3OXG A;  5AYW D;  3UPV A;  3U3W A;  3BEE A;  2XPI A;  5CCL A;  2FBN A;  4BT9 A;  4GA2 A;  5KJL A;  1IYG A;  1W3B A;  1P5Q A;  3JYS A;  4Y6C A;  2XGM A;  4GZ5 A;  3KS2 A;  4JA7 A;  1QQE A;  4H7Y A;  3TG4 A;  4N2S A;  5KJK A;  5HI7 A;  4XIF A;  1ZU2 A;  2BUG A;  3CVQ A;  3WXX A;  3NF1 A;  2L6J A;  4AM9 A;  2Y4U A;  2OOE A;  3TGO A;  3Q15 A;  5DIZ A;  3AS4 A;  2VGY A;  4A1S A;  2KAT A;  2XCC A;  3Q5M A;  2P58 C;  2QFC A;  4HOQ A;  3UQ3 A;  4GZ3 A;  5EKQ D;  3GZ1 A;  3S7B A;  3ZGQ A;  5FT9 A;  5LCW C;  5ARF A;  4N3B A;  5CHE E;  4WNG A;  4N5C A;  4NRH B;  4UI9 K;  3Q49 B;  2C0M A;  4UI9 J;  3N71 A;  4XI0 A;  1Y8M A;  4AIF A;  4UQZ A;  1ELW A;  3FFL A;  2FEZ A;  3QKY A;  1XNF A;  4AY5 A;  3S7D A;  3MV2 B;  4GYO A;  5KJN A;  3ASF A;  3CKC A;  3RIB A;  5BW8 C;  4H7X A;  3CK7 A;  3HYM B;  4O6F A;  2KCL A;  4U07 A;  4GCN A;  2LNI A;  2IF4 A;  2KC7 A;  5M72 A;  1IHG A;  3FP3 A;  4ABN A;  5FZQ A;  4U0S A;  2MHK A;  4BT8 A;  1KT1 A;  3UUX A;  3LY9 A;  3MEK A;  3LCA A;  4GYW A;  4HOU A;  3ZFW A;  2XEV A;  3U4T A;  3FWV A;  3OXF A;  3LPZ A;  5FJY A;  4GA1 A;  2HYZ A;  4KXK B;  4N39 A;  2KCV A;  1NA0 A;  3ESK A;  4LEU A;  1NA3 A;  2OND A;  5JJ6 A;  4CDR A;  4GYY A;  5ARG A;  2LSV A;  2JLB A;  4I2Z A;  3CEQ A;  2UWJ G;  4U04 A;  5D0O D;  3ASD A;  1QZ2 A;  3TAX A;  2C2L A;  1KT0 A;  4HOS A;  3RO3 A;  1YA0 A;  4WUY A;  5BT1 A;  3Q47 B;  4ME2 A;  1ELR A;  4UI9 C;  4N2Q A;  4XI9 A;  2C0L A;  3ZHE B;  2J9Q A;  3LYA A;  3LY7 A;  3GZ2 A;  2VGX B;  4AY6 A;  2VYI A;  4I1A A;  1WM5 A;  3S7F A;  2XGO A;  4UQY A;  3QOU A;  5FZS A;  3ASG A;  2WPV A;  3KAE A;  5C1D A;  2DBA A;  1NZN A;  1WAO 1; 
#chains in the Genus database with same CATH topology
 3PZD A;  3JUE A;  3CVL A;  3CHO A;  3QWW A;  3FTV A;  3FTW A;  3U9W A;  2P9I G;  4LSZ E;  2HE0 A;  2L0I A;  2PL2 A;  3APD A;  4HOT A;  2JAB A;  2QY7 A;  3C72 A;  3PUJ A;  2WXL A;  5CRV A;  4FUL A;  3CLJ A;  4WNE A;  2RFM A;  2PQR A;  4I9E A;  3DSV A;  5LX8 A;  2RKK A;  5CMY A;  3EDT B;  2WXM A;  4KBQ A;  3SO8 A;  4CT4 A;  3AS5 A;  3JQ1 A;  1H19 A;  1H6P A;  3MCX A;  4WWN A;  5AQ9 A;  3KSQ A;  4WAF A;  1TYQ G;  2X3M A;  3ULQ A;  2VGX A;  4HLL A;  4G25 A;  5HQ8 A;  5FTP A;  3R7R A;  3R9A B;  4IN3 B;  1H2T C;  4U0U A;  4U7E B;  3TWQ A;  4HBD A;  3D9O A;  4YND A;  3E37 A;  5A6C A;  3D3M A;  2WQ7 A;  5ANR A;  4KMO A;  4PDX A;  5JHA A;  3FUD A;  3MYV A;  3UIN C;  3MA5 A;  3PE4 A;  2XZD G;  4EZJ A;  1HH8 A;  1S64 A;  3PRZ A;  1OY3 D;  4I6E A;  1H6O A;  3ZU7 B;  5CMW A;  3D9P A;  2EIJ E;  3EU9 A;  3TWX A;  2WXQ A;  4O1P A;  3VLE A;  2H6F A;  4W9R A;  4ILG A;  1E96 B;  4UWH A;  3IKO B;  1B89 A;  2GRP B;  5FZR A;  4AP2 A;  3Q4A B;  1OWN A;  4GAA A;  1MX6 A;  4F53 A;  4GTM A;  2OV8 A;  3FY4 A;  4FLB A;  5CER B;  1KZO A;  4HVB A;  2OCC E;  3EHR A;  2V5Q C;  2A5U A;  1RW2 A;  5E75 A;  2WXP A;  4ANU A;  4AJW A;  3PNL B;  2R17 C;  3QWV A;  4HRM B;  1Z5S C;  2R2L A;  3PZ4 A;  4XKC A;  3IBE A;  3FUE A;  3DRA A;  5EX3 A;  1NP7 A;  1N95 A;  3HVE B;  3ABK E;  1A17 A;  1VDY A;  2XHE A;  4GTQ A;  2P9L G;  4Y6W A;  2Y0B G;  3HXF A;  4TV3 A;  3RK6 A;  1S0P A;  4JB8 P;  3T5X A;  1DNP A;  2ILR A;  4I2W A;  2X6J A;  4DX6 D;  3PUK A;  4JXT A;  3PDN A;  4ZHB A;  4HI8 A;  2WB2 A;  4BTA A;  2BED A;  3FTY A;  4HNA D;  2X6F A;  3TG5 A;  2XZT G;  2FO7 A;  1K1B A;  3RSE G;  5FQ8 A;  5B1B E;  4DLQ A;  3FU5 A;  3U3W A;  4URK A;  5AJD A;  3ZYM A;  1DVP A;  2XPI A;  2DZN A;  4BT9 A;  4GA2 A;  5KJL A;  1W3B A;  3EHQ A;  2XEE A;  4GZ5 A;  2GRM A;  2P9N G;  3ZKJ A;  1TN8 A;  5HI7 A;  3C3R A;  3ZYQ A;  3E34 A;  4HFG A;  4FJZ A;  1N0Q A;  5EYP F;  3HVE A;  2WXJ A;  4NIK A;  3Q15 A;  1PY1 A;  3AS4 A;  3AG1 E;  4A1S A;  2KAT A;  2XCC A;  3Q5M A;  2P58 C;  2QFC A;  2WVI A;  5IY5 E;  3TXN A;  1N4Q A;  4UI9 J;  4K5A B;  2H6I A;  2IOL A;  2Y1L E;  3LXU X;  4XI0 A;  1Y8M A;  3FFL A;  3ESL A;  5BXU A;  4AY5 A;  5ENS D;  4GYO A;  3ABM E;  4LG6 A;  3LJN A;  1OWO A;  3CKC A;  2NXP A;  3B7U X;  4H7X A;  4M3O A;  3ASN E;  2LNI A;  5B3S E;  4GML A;  5D2M C;  3B95 A;  4ABN A;  3NOC D;  4U0S A;  5AAO A;  5KNH D;  5G55 A;  4BT8 A;  1OXJ A;  1N52 A;  1Z3Y A;  2M63 A;  4CDN A;  3ASO E;  3EIQ C;  2HM8 A;  1AP7 A;  3TL5 A;  3LCA A;  1TR4 A;  3UIP C;  2A5E A;  4FA6 A;  3HXC A;  4HOU A;  4TXR A;  2XEV A;  5ENQ D;  3LPZ A;  2HYZ A;  2E0I A;  4DK5 A;  4N39 A;  1N4R A;  2WMO A;  3RRM B;  1HX8 A;  1BU9 A;  1ZB1 A;  2OND A;  4CDR A;  4GYY A;  3C3O A;  5D0O D;  4IRU A;  3QK0 A;  3WG7 E;  4JEH A;  1FPP A;  3CVU A;  1QZ2 A;  3TAX A;  2OEV A;  2IQC A;  2WXI A;  4Q94 A;  3RO3 A;  3LEW A;  4E6H A;  1TNO A;  4J8S A;  3Q47 B;  2CHW A;  3DSX A;  4ME2 A;  4UI9 C;  3CHS A;  1SW6 A;  1H2V C;  2C0L A;  5JA4 D;  5EDS A;  4AY6 A;  2BTD A;  4I1A A;  2RFA A;  2X6H A;  3NZU A;  4AXH A;  4UQY A;  4MLP A;  3QOU A;  5FZS A;  1MHQ A;  1S63 A;  1D8D A;  4TXP A;  4F1P A;  3FUL A;  2DBA A;  2DYR E;  1JUQ A;  5EIB E;  4QQI A;  4XX5 A;  5BNW A;  3IXE A;  1JPL A;  3UKU G;  3C5R A;  2WXH A;  3L08 A;  2XCB A;  3SFY A;  2NSZ A;  3G2U A;  4EPZ A;  2X6K A;  2J4B A;  2VTB B;  4I43 A;  2ION A;  2L0T B;  5FWQ A;  3Q79 A;  3ULY A;  3HXD A;  4CGW A;  2IU1 A;  3SFX A;  5A7D B;  1BPO A;  2PQN A;  5LOZ A;  3ZEF A;  3JQ0 A;  3ML9 A;  3QWP A;  3ONK A;  1OCO E;  3CQC B;  4FHK A;  4J8F A;  2LUH A;  5ENP D;  2R02 A;  5BV1 A;  3RRU A;  3ZW3 A;  3FUJ A;  3UM3 A;  3LS8 A;  3L22 A;  3LVQ E;  3RAU A;  1OT8 A;  4K03 A;  4DI4 A;  2ZIS A;  2AW6 A;  1OCR E;  3MZL B;  4KZC A;  1UJK A;  1TJC A;  3QNK A;  4LUN U;  2YHE A;  4IUL A;  1E8Y A;  3CHR A;  2AVP A;  2Q7F A;  3CQG B;  4D10 C;  2CG2 A;  2OVF A;  3NBN B;  3P2B A;  3CK9 A;  3URZ A;  2I2O A;  3GZS A;  3C98 A;  4OVU A;  2QYU A;  3CHM A;  4JL0 A;  3PZ2 A;  4EQF A;  2VTB A;  4APF A;  1N11 A;  1QNF A;  4GTR A;  1TEZ A;  2J07 A;  3G2S A;  2UY1 B;  3QJZ A;  4DI3 A;  5DBK A;  2XRY A;  3J5P A;  4BY6 A;  1N94 A;  1HS6 A;  3GW4 A;  3HDX A;  5D0Q D;  2VSY A;  1DC2 A;  4G1T A;  2WM9 A;  5LFA A;  1D9S A;  4BEP A;  3APC A;  1E7U A;  3CK8 A;  5CCM A;  5KWD A;  2LAH A;  2XQ0 A;  2R59 A;  1ZBP A;  4Q69 A;  1OWM A;  3QDN A;  2DVW A;  3MJW A;  4JHR A;  3G2T A;  2E2E A;  3AG3 E;  1GW6 A;  1OCZ E;  5LCW J;  2HR2 A;  3HXE A;  2VQ2 A;  4GU5 A;  3KSL A;  2WQ6 A;  4OVV A;  3LKU A;  3ZRH A;  5EX0 A;  3PZ1 A;  3UT7 A;  2R5S A;  3ENE A;  4QFV A;  4EEC A;  4L1B A;  5D66 A;  2FI7 A;  2BKK B;  1HG2 A;  4LCT A;  1IQR A;  3MV3 B;  2QC9 A;  2UY1 A;  1Q2Z A;  3BUA A;  3LY8 A;  3K9I A;  3CV0 A;  4X8Q A;  3OXL A;  1TN6 A;  1JWG A;  1HG5 A;  2I9C A;  3L17 A;  3SD5 A;  3UPV A;  4DRX E;  2ZGD A;  5CCL A;  3FTX A;  2P9U G;  5AQ7 A;  3L54 A;  4P29 A;  1IYG A;  1UN8 A;  3SHF A;  3EHN A;  3FTS A;  1BD8 A;  2XGM A;  3ZUV B;  2XS8 A;  4WWP A;  4KT6 B;  4LER A;  3APF A;  1ZU2 A;  3TWR A;  3UKR G;  4O60 A;  3C3Q A;  3DBS A;  4AM9 A;  3UM2 A;  2OOE A;  2RG8 A;  3VLF A;  4DX7 D;  1JCR A;  3IV0 A;  2AXZ A;  1HE8 A;  4UWF A;  3AU4 A;  3D9I A;  4F1S A;  3PH0 C;  3NQP A;  5LCW C;  1N4S A;  2DYS E;  4A1G A;  1HFA A;  1LD8 A;  5ENT D;  4WNG A;  5T4Y A;  2C0M A;  3N71 A;  2GRO B;  1ELW A;  3S2A A;  4YDO A;  3DPY A;  4CEM A;  3B7T A;  1XNF A;  4TUM A;  3KEA A;  3V79 K;  1HF8 A;  3RIB A;  5AAR A;  5BW8 C;  4KVO A;  2WXK A;  3B7B A;  2P9S G;  2KCL A;  4O6F A;  3FUK A;  2CFZ A;  4PS8 A;  4LNG A;  2P2C P;  4ANV A;  3AG4 E;  2EIK E;  4MRU A;  1KT1 A;  1V55 E;  1UG3 A;  4ACK A;  3ONL A;  3HRA A;  4U95 D;  3DEP A;  3Q75 A;  2XEH A;  1N4P A;  3U66 A;  3PRE A;  3I3N A;  4I1O B;  4K5C A;  1D8E A;  3U4T A;  3FWV A;  4GPM A;  2WXG A;  4J7W A;  3I5P A;  2KCV A;  4MKT A;  3RRN B;  1NA0 A;  3ESK A;  5H7P A;  3ULE G;  5ENO D;  4PUC A;  1NA3 A;  3JCK C;  2YIN A;  2LSV A;  2JLB A;  1KZP A;  3PEU B;  3D9M A;  2V4H C;  2WMN A;  2UWJ G;  4U04 A;  2MOW A;  3UXG A;  1YMP A;  4OYS A;  1TJF A;  4N2Q A;  4JD2 G;  1KPS B;  1LD7 A;  2GRL A;  4GZC A;  1UW4 B;  3DEO A;  3FU6 A;  3IHV A;  1X5B A;  2VYI A;  5J90 A;  1WM5 A;  5JHB A;  2L9B A;  3DWL G;  3W9F A;  3EIJ A;  5HS0 A;  2EQX A;  4HLE A;  4ZFH A;  4FLH A;  3MGB A;  2F37 A;  1YYH A;  2QZA A;  3OAW A;  4EZK A;  4HS2 A;  3UI2 A;  4U8V D;  5ENR D;  5CBN A;  4EZL A;  4KVM A;  2J4D A;  3E4B A;  2XS1 A;  3PS6 A;  4FJY A;  3CSF A;  3ZXP A;  4IYP A;  3KD7 A;  5A23 A;  5AQA A;  4A63 B;  3PZ3 A;  2XPY A;  4UWG A;  3T8K A;  3L6A A;  3EU5 A;  3DXK G;  3SQV A;  4WND A;  1PC2 A;  1K3Z D;  2KZT B;  4PS7 A;  3NB2 A;  1SZ9 A;  3ZXS A;  2V5F A;  5G04 J;  2PZI A;  3UTM A;  4UQX A;  4KYO B;  2NC9 A;  5G05 J;  3L9T A;  4AVX A;  3CVP A;  3I4G A;  4RG6 A;  2Y69 E;  3FUI A;  3O48 A;  4BET A;  3KEZ A;  2ZGG A;  4G24 A;  4RG9 A;  1EDU A;  5AN8 A;  3MKR A;  2GGF A;  2KCK A;  2I1J A;  4LNB A;  3DSS A;  4F3V A;  1U3C A;  4J8D A;  4ANW A;  4XE0 A;  4FAD A;  1O1S A;  2XPZ A;  4UUC A;  3D9J A;  4I1M A;  2CFU A;  2L6B A;  2B6C A;  2J08 A;  3G2W A;  3ISM C;  4GZ6 A;  2Y3A A;  1WY6 A;  1WDY A;  1HO8 A;  1QYM A;  4BSX A;  2KZT A;  2AXU A;  4O1O A;  3IEG A;  5T3R A;  2LSU A;  4ATG A;  5CBO A;  1L5J A;  2GW1 A;  1FT1 A;  4G26 A;  3SY2 A;  4L7T A;  3NAW A;  3ZYL A;  4J6I A;  4A55 A;  3L13 A;  3UM1 A;  1TNY A;  3FUM A;  4U96 D;  5ENN A;  1UOH A;  4U0Z A;  3ZVV A;  2DIW A;  5ITZ F;  3J5Q B;  3RKV A;  5G04 C;  2P9K G;  2WXO A;  4N3C A;  4GA0 A;  1KLX A;  5FQ7 A;  3VTX A;  5BXO A;  5G05 C;  3ZN3 A;  4E85 A;  4KZ0 A;  4GPK A;  3FH8 A;  2EIL E;  3FDH A;  3BG1 B;  4FP7 A;  2X38 A;  4JA9 A;  3UT8 A;  5FQ4 A;  4J0U A;  4Z68 A;  2F8Y A;  2HO1 A;  1K1A A;  4BWR A;  4APO A;  5LP0 A;  3W9G A;  5HKP A;  1HZ4 A;  4NQ0 A;  3Q73 A;  1MYO A;  2PM6 A;  3D9K A;  4I6J A;  1U3D A;  3ZNG A;  1OCC E;  3Q7F A;  4JHK A;  5AYW D;  1H2U A;  5B1A E;  3CVX A;  3BEE A;  1V54 E;  2VSO E;  3CIA A;  3ZIM A;  5J08 A;  4B89 A;  3FUH A;  1NL4 A;  3CVW A;  3JYS A;  4Y6C A;  4TUU A;  4JA7 A;  1QQE A;  3CVY A;  4H7Y A;  3SNX A;  2XEN A;  3TG4 A;  4N2S A;  3QB2 A;  5KJK A;  2F0Y A;  4XIF A;  3CVQ A;  2BUG A;  5CEA A;  1UJJ A;  3WXX A;  4AOF A;  3HG0 D;  3QAQ A;  3L16 A;  4RLY A;  2Y4U A;  5AJL A;  4C9B B;  5JMN D;  5FIO A;  2VGY A;  1LF8 A;  2I1K A;  4HOQ A;  5EKQ D;  3S7B A;  3BU8 A;  5FT9 A;  5ARF A;  3QC1 A;  4DUI A;  3B13 A;  3EUV A;  3AJI A;  5CHE E;  1NI1 A;  4UI9 K;  1X81 A;  1N9A A;  3SI5 A;  4GTP A;  4AEZ C;  2BKG A;  1NFI E;  2KM4 A;  4AIF A;  4HXI A;  4UQZ A;  3R9M A;  3HXB A;  3QKY A;  3TWS A;  3S7D A;  4PS3 A;  5KJN A;  2B0O E;  3UM0 A;  3D9L A;  1H6K A;  1SQM A;  2ZIR A;  2R03 A;  2EIN E;  4BFR A;  3HYM B;  1E8Z A;  4U07 A;  2AJA A;  4GCN A;  1BI8 B;  3JUI A;  2KC7 A;  3AAA C;  5M72 A;  4V3I A;  3T9K A;  1IHG A;  1IXV A;  2GRQ B;  5FZQ A;  4EHM A;  3V31 A;  4B93 B;  3HIZ A;  2IO2 C;  5BPP A;  1OWP A;  1O1T A;  4GYW A;  2LAI A;  4J8Y A;  4ATZ D;  2MRI A;  1E90 A;  3IHY A;  3ZFW A;  3DPD A;  3OXF A;  5CEC B;  4GTO A;  2ETC A;  4GA1 A;  3MKQ B;  4KXK B;  3TWU A;  3CHP A;  3BG0 B;  4BER A;  1QBQ A;  3EJN A;  2LO6 A;  5CED B;  5ARG A;  3UMV A;  2AWI A;  2WXF A;  3CEQ A;  2DZO A;  3CGH A;  3HHM A;  3TXM A;  1KT0 A;  4HOS A;  3LJ3 A;  1YA0 A;  4WUY A;  1XGW A;  3PNT B;  4LNU D;  2XRZ A;  4XI9 A;  1MQS A;  2ETB A;  3ZHE B;  1IHB A;  4CRW A;  4GB9 A;  3GZ2 A;  1MZC A;  3B7R L;  2CHX A;  1E7V A;  4NAC A;  5KBA A;  4YDY A;  2FO1 E;  4G8K A;  2XGO A;  3JXI A;  2WPV A;  3KAE A;  5AQB A;  5C1D A;  1NZN A;  5T8I A;  3JXJ A;  2X6I A;  1EF1 C;  1BLX B;  4CDM A;  1Y6I A;  1WAO 1;  4EBA A;  5KJM A;  1FT2 A;  3TWW A;  3MKQ A;  5BV0 A;  2ZU6 B;  5FQ6 A;  1E8W A;  3Q9N C;  4F6R D;  5G2N A;  1TNB A;  2IOS A;  1EYH A;  4GTV A;  4YVQ C;  3TWT A;  3V2O A;  4DLO A;  4L2L A;  2AXV A;  4K5B A;  2J09 A;  3FU3 A;  4CYM D;  2VSN A;  4B8C B;  3D9N A;  3CHQ A;  3Q78 A;  3DST A;  4L9P A;  3TJP A;  1TNZ A;  3D9H A;  4BTB A;  2FF4 A;  5C2Y A;  3ZYK A;  2MYO A;  3Q9U C;  4GMJ A;  3SF4 A;  2XGS A;  4CCA A;  4HRN A;  3DSU A;  3CVN A;  4LRZ A;  4R7L A;  4DX2 A;  3ZHE A;  1N0R A;  2WXN A;  4N3A A;  1LTX A;  1IKN D;  3VLD A;  4U8Y D;  2I6H A;  2WQH A;  4CGV A;  3O4Z A;  4HRL A;  2DCP A;  1TN7 A;  2BF0 X;  3CR3 A;  4WNF A;  2YQ8 A;  1OUV A;  3FTU A;  2IY0 C;  3UIO C;  3SZ7 A;  4BX9 A;  1FVF A;  3LVR E;  4HB5 A;  4HOR A;  2VJ8 A;  1SZA A;  1RZ4 A;  4K0R A;  1YCS B;  2V4L A;  3OTN A;  4PH4 B;  3S7J A;  1JWF A;  1Z3X A;  3E30 A;  4WWO A;  2A4Z A;  5E76 A;  4I9C A;  3ABL E;  1DCQ A;  4G2V A;  4RVB A;  2YHC A;  1A5E A;  2NYJ A;  3RJV A;  4J8E A;  2WXR A;  4G23 A;  4RQI A;  1DCE A;  1Z6T A;  1U2V G;  4CT0 A;  5BUZ A;  2J8S D;  3U64 A;  3UT4 A;  1MX4 A;  3GYZ A;  1MX2 A;  3PVL A;  3RU0 A;  4I17 A;  4ANX A;  3B7S A;  3RO2 A;  4TXQ A;  3FUF A;  2KBX A;  4MBG A;  3ASH A;  3V2X A;  1WG0 A;  4RSY A;  4U8H A;  3P1U A;  4JW1 A;  1SA4 A;  4L2Y A;  2CG3 A;  5KNG A;  4GCO A;  5EID A;  5JJT A;  4C48 B;  1HXI A;  1K8K G;  3FEY A;  4JC8 A;  5EN5 D;  4B8A A;  1HU3 A;  4HI9 A;  3R7Q A;  3ZPJ A;  1IQU A;  4GZD A;  4JPS A;  1FCH A;  5JJ7 A;  3EHM A;  3VTY A;  4A3T A;  3CKB A;  2Y4T A;  4C0M A;  4YVO A;  5HRY A;  3SGH A;  4B94 A;  2YNQ A;  2IJG X;  2PM7 A;  3NZS A;  3PE3 A;  3Q7A A;  2KXP C;  2GRR B;  2IFU A;  3AS8 A;  4DJA A;  4YDE A;  5EIL A;  2CHZ A;  3OXG A;  2OVB A;  4ACL A;  4FHJ A;  3SBS A;  3CVV A;  2P9P G;  3FTZ A;  2F8X K;  4JHJ A;  2IO3 C;  2FBN A;  1G3N B;  1N54 A;  1P5Q A;  4GTT A;  4UWL A;  4G11 A;  3KS2 A;  3PEV B;  2GRN B;  2JEK A;  3DSW A;  4I6G A;  3X2Q E;  4F7A A;  4N5Q A;  4M7C A;  4ILI A;  4UWK A;  3NF1 A;  3AU5 A;  1MJ0 A;  2R05 A;  2L6J A;  1UN9 A;  4HQD A;  3TGO A;  5DIZ A;  3T5V A;  1ELK A;  4NUR A;  3FUN A;  3FEX A;  3UQ3 A;  4GZ3 A;  3E33 A;  3I4R B;  3GZ1 A;  3F6Q A;  4B0Z A;  3ZGQ A;  4N3B A;  4BX8 A;  4JVS A;  1O1R A;  4N5C A;  4NRH B;  3Q49 B;  1O5M A;  3BQO A;  1FVH A;  4XEI G;  2ETA A;  3LDZ A;  2IEJ A;  1E8X A;  1JCS A;  4AV7 A;  2FEZ A;  1SA5 A;  2V0P A;  5AEN A;  4BES A;  3MV2 B;  1PAQ A;  4FU3 A;  3ASF A;  3FHE A;  5KCM A;  3MX3 A;  3CK7 A;  5CRU A;  3FH5 A;  4OAV B;  3T8M A;  2OEW A;  2IF4 A;  2LXM A;  1S70 B;  3FP3 A;  2DWZ A;  1SVX A;  2MHK A;  3FH7 A;  1BI7 B;  4MS6 A;  3UUX A;  3LY9 A;  1AWC B;  3MEK A;  1JCQ A;  4DPR A;  4BSZ B;  5AIJ A;  3E32 A;  4XKB A;  2RD0 A;  1INZ A;  4U63 A;  2H6G A;  4A3V A;  5FJY A;  4CZ2 D;  4Q96 A;  3FU0 A;  4LEU A;  4YDW A;  1H0A A;  2LXL A;  3ML8 A;  5JJ6 A;  4I2Z A;  1TNU A;  3QAR A;  4JEU A;  2H6H A;  1EPU A;  3ASD A;  3V30 A;  4JZY A;  4TRQ A;  2C2L A;  3SFZ A;  4EBA G;  1OWL A;  2FUL A;  4DX1 A;  2VSX E;  2V8S E;  2J49 A;  5BT1 A;  4L23 A;  1ELR A;  4GMR A;  3TWV A;  4OAU C;  3AG2 E;  2EIM E;  2J9Q A;  3LYA A;  2ZXW E;  3LY7 A;  2PNN A;  3DXM G;  5EYL A;  2VGX B;  3CST A;  3NOG D;  5ANL A;  5FIN A;  3S7F A;  4GTS A;  4XZ4 A;  4ILH B;  2QYJ A;  3ASG A;  3UX4 A;  3G2V A;  3L82 A;  3SBT B;  4DX5 D;  4G8L A;  4FC8 A;  2VGE A;  4C0E A; 
#chains in the Genus database with same CATH homology
 3PZD A;  3OAW A;  4EBA A;  5BNW A;  5KJM A;  3CVL A;  4EZK A;  4HS2 A;  3MKQ A;  3CHO A;  3QWW A;  3FTV A;  3FTW A;  2ZU6 B;  5BV0 A;  1JPL A;  5FQ6 A;  1E8W A;  4EZL A;  3U9W A;  5G2N A;  2WXH A;  3L08 A;  4KVM A;  2IOS A;  1EYH A;  2J4D A;  2L0I A;  4YVQ C;  4DLO A;  4L2L A;  2XCB A;  3E4B A;  2PL2 A;  2AXV A;  2NSZ A;  3APD A;  3G2U A;  4HOT A;  4EPZ A;  3PS6 A;  2J09 A;  2X6K A;  2J4B A;  4FJY A;  2VTB B;  3CSF A;  3FU3 A;  2QY7 A;  4I43 A;  2VSN A;  2ION A;  4IYP A;  4B8C B;  2L0T B;  3PUJ A;  3KD7 A;  3D9N A;  5A23 A;  3CHQ A;  5FWQ A;  2WXL A;  3TJP A;  2XPY A;  4FUL A;  4UWG A;  4CGW A;  3CLJ A;  4WNE A;  3L6A A;  4BTB A;  2PQR A;  2FF4 A;  5C2Y A;  4I9E A;  3ZYK A;  2IU1 A;  4WND A;  5LX8 A;  5A7D B;  1BPO A;  2PQN A;  1PC2 A;  5CMY A;  4PS7 A;  2KZT B;  2WXM A;  3EDT B;  2XGS A;  4GMJ A;  4KBQ A;  5LOZ A;  3SF4 A;  4CCA A;  3ZEF A;  3ZXS A;  1SZ9 A;  3JQ0 A;  4CT4 A;  3ML9 A;  3AS5 A;  3QWP A;  3ONK A;  3CVN A;  3CQC B;  4FHK A;  3JQ1 A;  4J8F A;  1H19 A;  4LRZ A;  4R7L A;  2V5F A;  3MCX A;  3ZHE A;  5G04 J;  4WWN A;  2PZI A;  2WXN A;  5BV1 A;  4N3A A;  4UQX A;  4WAF A;  2X3M A;  3ULQ A;  2VGX A;  3RRU A;  4KYO B;  3VLD A;  2NC9 A;  5G05 J;  3ZW3 A;  2I6H A;  3FUJ A;  2WQH A;  4G25 A;  4AVX A;  4CGV A;  5HQ8 A;  3LS8 A;  3L22 A;  5FTP A;  3R7R A;  3O4Z A;  3R9A B;  3LVQ E;  4IN3 B;  1H2T C;  4U0U A;  3CVP A;  2DCP A;  2BF0 X;  4K03 A;  3CR3 A;  4WNF A;  3I4G A;  2YQ8 A;  4DI4 A;  1OUV A;  4RG6 A;  2AW6 A;  3D9O A;  3FTU A;  3FUI A;  3O48 A;  3MZL B;  4KZC A;  1UJK A;  4YND A;  3SZ7 A;  4BX9 A;  1FVF A;  1TJC A;  3LVR E;  4HOR A;  2VJ8 A;  3QNK A;  5A6C A;  3KEZ A;  1SZA A;  4G24 A;  4K0R A;  4LUN U;  4RG9 A;  2YHE A;  4IUL A;  1E8Y A;  3D3M A;  1EDU A;  2WQ7 A;  5ANR A;  3CHR A;  2AVP A;  2Q7F A;  2V4L A;  3CQG B;  3MKR A;  2GGF A;  2KCK A;  3OTN A;  4KMO A;  4PH4 B;  2CG2 A;  3S7J A;  4D10 C;  2I1J A;  4PDX A;  5JHA A;  3FUD A;  1JWF A;  2OVF A;  1Z3X A;  3MYV A;  3P2B A;  3MA5 A;  3CK9 A;  3URZ A;  4F3V A;  1U3C A;  2I2O A;  3PE4 A;  4EZJ A;  1HH8 A;  4J8D A;  3GZS A;  4ANW A;  3PRZ A;  4XE0 A;  4FAD A;  4I6E A;  4WWO A;  2XPZ A;  3C98 A;  4OVU A;  2A4Z A;  5E76 A;  3D9J A;  4I9C A;  4I1M A;  3CHM A;  4JL0 A;  4EQF A;  2VTB A;  2CFU A;  5CMW A;  3D9P A;  4APF A;  4G2V A;  2J08 A;  3G2W A;  4RVB A;  2YHC A;  1QNF A;  4GZ6 A;  1TEZ A;  2J07 A;  3RJV A;  2WXQ A;  3G2S A;  4J8E A;  2UY1 B;  2WXR A;  2Y3A A;  3VLE A;  4W9R A;  1WY6 A;  3QJZ A;  4DI3 A;  4G23 A;  4ILG A;  1E96 B;  2XRY A;  5DBK A;  1HO8 A;  1Z6T A;  4CT0 A;  4BSX A;  5BUZ A;  2KZT A;  2AXU A;  3U64 A;  3UT4 A;  4UWH A;  3IKO B;  1B89 A;  3IEG A;  5T3R A;  2LSU A;  4ATG A;  3GYZ A;  3PVL A;  3RU0 A;  4BY6 A;  4I17 A;  1HS6 A;  4ANX A;  3B7S A;  1L5J A;  2GW1 A;  3GW4 A;  3RO2 A;  5FZR A;  3HDX A;  5D0Q D;  2VSY A;  3Q4A B;  4AP2 A;  1OWN A;  4GAA A;  4G26 A;  3FUF A;  4G1T A;  4F53 A;  4L7T A;  2OV8 A;  3FY4 A;  3ASH A;  2WM9 A;  4FLB A;  4J6I A;  3ZYL A;  5LFA A;  4A55 A;  4RSY A;  3APC A;  3L13 A;  4HVB A;  3FUM A;  4U8H A;  3P1U A;  1E7U A;  5ENN A;  4JW1 A;  3CK8 A;  4L2Y A;  4U0Z A;  2A5U A;  2CG3 A;  2DIW A;  3ZVV A;  5E75 A;  4GCO A;  3RKV A;  5CCM A;  5G04 C;  5JJT A;  2LAH A;  2WXO A;  2WXP A;  4N3C A;  4ANU A;  4AJW A;  2XQ0 A;  1HXI A;  4GA0 A;  3FEY A;  1KLX A;  3PNL B;  5FQ7 A;  4JC8 A;  2R17 C;  2R59 A;  3VTX A;  5G05 C;  4B8A A;  3QWV A;  3ZN3 A;  1HU3 A;  1ZBP A;  4Q69 A;  1OWM A;  3QDN A;  3R7Q A;  4XKC A;  4E85 A;  4KZ0 A;  3IBE A;  3FH8 A;  3FUE A;  3MJW A;  3ZPJ A;  5EX3 A;  4GPK A;  1IQU A;  1NP7 A;  4GZD A;  4JHR A;  3FDH A;  3G2T A;  4JPS A;  2E2E A;  1FCH A;  3BG1 B;  4FP7 A;  5JJ7 A;  1GW6 A;  2X38 A;  3HVE B;  5LCW J;  1A17 A;  3EHM A;  3VTY A;  1VDY A;  2XHE A;  4JA9 A;  2HR2 A;  4GU5 A;  2VQ2 A;  3CKB A;  4A3T A;  4Y6W A;  3UT8 A;  2Y4T A;  2WQ6 A;  4OVV A;  5FQ4 A;  4J0U A;  3LKU A;  4C0M A;  3ZRH A;  5EX0 A;  3UT7 A;  4TV3 A;  3RK6 A;  4YVO A;  2R5S A;  3ENE A;  4QFV A;  1S0P A;  4EEC A;  3SGH A;  4L1B A;  2HO1 A;  3T5X A;  1DNP A;  4B94 A;  2YNQ A;  2ILR A;  4APO A;  4I2W A;  4BWR A;  2X6J A;  5LP0 A;  2FI7 A;  1HG2 A;  4LCT A;  1IQR A;  1HZ4 A;  3PUK A;  2IJG X;  3MV3 B;  4JXT A;  3PDN A;  2PM7 A;  2UY1 A;  3NZS A;  2WB2 A;  3PE3 A;  4NQ0 A;  4BTA A;  2IFU A;  3FTY A;  3AS8 A;  4DJA A;  2PM6 A;  3LY8 A;  3K9I A;  2X6F A;  3TG5 A;  2FO7 A;  3CV0 A;  3D9K A;  4I6J A;  1U3D A;  3OXL A;  2CHZ A;  1JWG A;  3OXG A;  4JHK A;  1HG5 A;  2OVB A;  1H2U A;  2I9C A;  5AYW D;  4ACL A;  3L17 A;  4FHJ A;  5FQ8 A;  3SBS A;  3SD5 A;  4DLQ A;  3FU5 A;  3FTZ A;  3CVV A;  3UPV A;  3CVX A;  3U3W A;  4URK A;  5AJD A;  3BEE A;  3ZYM A;  2VSO E;  3CIA A;  1DVP A;  3ZIM A;  2XPI A;  5CCL A;  5J08 A;  4JHJ A;  3FTX A;  2FBN A;  4BT9 A;  3L54 A;  4GA2 A;  5KJL A;  4P29 A;  1IYG A;  1W3B A;  4B89 A;  1UN8 A;  3FUH A;  1N54 A;  3SHF A;  1P5Q A;  3EHN A;  3FTS A;  3CVW A;  3JYS A;  4Y6C A;  2XGM A;  4GZ5 A;  4UWL A;  2GRM A;  4WWP A;  4TUU A;  4G11 A;  4KT6 B;  3KS2 A;  4JA7 A;  1QQE A;  3CVY A;  3PEV B;  4H7Y A;  2JEK A;  3SNX A;  4LER A;  3TG4 A;  4N2S A;  3QB2 A;  5KJK A;  5HI7 A;  4I6G A;  3APF A;  4XIF A;  1ZU2 A;  2BUG A;  3CVQ A;  3ZYQ A;  4F7A A;  1UJJ A;  4HFG A;  4FJZ A;  3WXX A;  4ILI A;  4UWK A;  3NF1 A;  4AOF A;  3AU5 A;  3DBS A;  2L6J A;  4AM9 A;  3QAQ A;  3L16 A;  2Y4U A;  5AJL A;  4C9B B;  2OOE A;  1UN9 A;  3HVE A;  2RG8 A;  3TGO A;  3VLF A;  2WXJ A;  3IV0 A;  3Q15 A;  1PY1 A;  3AS4 A;  5DIZ A;  1ELK A;  3T5V A;  2AXZ A;  2VGY A;  1HE8 A;  4NUR A;  1LF8 A;  4UWF A;  4A1S A;  2KAT A;  3AU4 A;  2XCC A;  3Q5M A;  3FUN A;  2I1K A;  4CDR A;  2P58 C;  3D9I A;  2QFC A;  3FEX A;  4HOQ A;  3UQ3 A;  4F1S A;  2WVI A;  4GZ3 A;  3PH0 C;  5EKQ D;  3I4R B;  3GZ1 A;  3TXN A;  3S7B A;  4B0Z A;  3ZGQ A;  3NQP A;  5FT9 A;  5ARF A;  3QC1 A;  4N3B A;  5LCW C;  4A1G A;  4BX8 A;  3B13 A;  4JVS A;  1HFA A;  5CHE E;  4WNG A;  4N5C A;  4NRH B;  4UI9 K;  3Q49 B;  5T4Y A;  2C0M A;  4UI9 J;  3N71 A;  3SI5 A;  2IOL A;  1FVH A;  3LXU X;  4XI0 A;  3LDZ A;  1Y8M A;  4AEZ C;  2KM4 A;  4AIF A;  4HXI A;  4UQZ A;  1ELW A;  3S2A A;  1E8X A;  3FFL A;  3ESL A;  4AV7 A;  2FEZ A;  4CEM A;  3QKY A;  3B7T A;  2V0P A;  1XNF A;  5AEN A;  4AY5 A;  3S7D A;  3MV2 B;  4GYO A;  4PS3 A;  1PAQ A;  5KJN A;  3D9L A;  1HF8 A;  1H6K A;  3ASF A;  4FU3 A;  3FHE A;  1OWO A;  3CKC A;  1SQM A;  2NXP A;  5KCM A;  3B7U X;  3RIB A;  5BW8 C;  4H7X A;  3MX3 A;  3CK7 A;  4KVO A;  3FH5 A;  4BFR A;  2WXK A;  3HYM B;  4M3O A;  1E8Z A;  2KCL A;  4O6F A;  3T8M A;  4U07 A;  3FUK A;  4GCN A;  2LNI A;  2IF4 A;  3JUI A;  2KC7 A;  2CFZ A;  4V3I A;  5M72 A;  1IHG A;  4PS8 A;  3FP3 A;  4GML A;  4ABN A;  4ANV A;  5FZQ A;  4U0S A;  5G55 A;  4MRU A;  2MHK A;  3FH7 A;  4BT8 A;  1KT1 A;  3HIZ A;  1N52 A;  1Z3Y A;  1UG3 A;  4ACK A;  2M63 A;  5BPP A;  4MS6 A;  3UUX A;  4CDN A;  3ONL A;  3LY9 A;  3EIQ C;  1OWP A;  2HM8 A;  3MEK A;  3TL5 A;  3U66 A;  3LCA A;  3PRE A;  4GYW A;  2LAI A;  3I3N A;  4DPR A;  4I1O B;  2MRI A;  4FA6 A;  5AIJ A;  4HOU A;  1E90 A;  4XKB A;  3IHY A;  3ZFW A;  2RD0 A;  2XEV A;  3DPD A;  3U4T A;  3FWV A;  3OXF A;  4U63 A;  1INZ A;  3LPZ A;  2WXG A;  4A3V A;  5FJY A;  4GA1 A;  3MKQ B;  2HYZ A;  2E0I A;  4Q96 A;  4KXK B;  3FU0 A;  4DK5 A;  3CHP A;  4N39 A;  3BG0 B;  3I5P A;  2KCV A;  4MKT A;  2WMO A;  3RRM B;  3RRN B;  1NA0 A;  3ESK A;  1HX8 A;  4LEU A;  1H0A A;  3EJN A;  4PUC A;  1NA3 A;  2LO6 A;  2OND A;  3JCK C;  3ML8 A;  4GYY A;  2YIN A;  5ARG A;  2LSV A;  2JLB A;  5JJ6 A;  4I2Z A;  3UMV A;  2AWI A;  2WXF A;  3CEQ A;  3PEU B;  3D9M A;  3QAR A;  4JEU A;  2WMN A;  2UWJ G;  4U04 A;  2MOW A;  5D0O D;  3CGH A;  3HHM A;  4IRU A;  3QK0 A;  3TXM A;  1EPU A;  3ASD A;  4JEH A;  3CVU A;  1QZ2 A;  4JZY A;  3TAX A;  4TRQ A;  2C2L A;  2IQC A;  3SFZ A;  1KT0 A;  2WXI A;  4EBA G;  4HOS A;  1OWL A;  4Q94 A;  3LJ3 A;  2FUL A;  3RO3 A;  1YA0 A;  3LEW A;  4WUY A;  4E6H A;  2VSX E;  2V8S E;  2J49 A;  5BT1 A;  4J8S A;  1XGW A;  3Q47 B;  4OYS A;  2CHW A;  4L23 A;  3PNT B;  4ME2 A;  2XRZ A;  1ELR A;  1TJF A;  4UI9 C;  4N2Q A;  3CHS A;  4XI9 A;  1H2V C;  1MQS A;  2C0L A;  3ZHE B;  2J9Q A;  2GRL A;  3LYA A;  4GZC A;  4CRW A;  3LY7 A;  1UW4 B;  4GB9 A;  5EDS A;  3GZ2 A;  2VGX B;  3FU6 A;  2BTD A;  4AY6 A;  3IHV A;  3CST A;  3B7R L;  2CHX A;  1X5B A;  1E7V A;  2VYI A;  4NAC A;  5J90 A;  4I1A A;  5ANL A;  1WM5 A;  2X6H A;  3NZU A;  3S7F A;  2XGO A;  4UQY A;  4XZ4 A;  2L9B A;  4ILH B;  4AXH A;  5JHB A;  3EIJ A;  3QOU A;  4MLP A;  5FZS A;  1MHQ A;  3ASG A;  2WPV A;  3UX4 A;  3KAE A;  2EQX A;  3G2V A;  4HLE A;  3SBT B;  5C1D A;  3FUL A;  2DBA A;  1NZN A;  1JUQ A;  4FLH A;  5T8I A;  4FC8 A;  4XX5 A;  3MGB A;  2X6I A;  1EF1 C;  4C0E A;  4CDM A;  1Y6I A;  1WAO 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...