4GA2A

Structure of the n-terminal domain of nup358
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
144
structure length
144
Chain Sequence
RRSKADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERAAKLFPGSPAVYKLKEQLLDCEGED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of Nup358/RanBP2.
pubmed doi rcsb
source organism Pan troglodytes
molecule tags Transport protein
molecule keywords E3 SUMO-PROTEIN LIGASE RANBP2
total genus 56
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2012-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ga2A00
3VTXA 2Y4UA 4KYOB 2LSUA 3CVPA 3KAEA 3PE3A 4JL0A 4BT9A 4F3VA 3S7FA 4WNEA 3RKVA 2LSVA 1KT0A 3Q4AB 3CV0A 2UY1B 4HOUA 5EKQD 2NC9A 4KBQA 3CK7A 4B94A 4WUYA 2VYIA 3LCAA 2Y4TA 3N71A 5D0OD 4I1AA 4AM9A 4J0UA 1B89A 2KCLA 2KC7A 1IHGA 1HXIA 1IYGA 2GW1A 2UWJG 1FCHA 2WPVA 3AS8A 3KS2A 4JA9A 4BWRA 2Q7FA 5G04C 3AS4A 4G24A 2FEZA 2L6JA 2P58C 3FP3A 3QKYA 4GA1A 2HO1A 5M72A 5JJ7A 2BUGA 3Q49B 1P5QA 2XPIA 2PZIA 5BNWA 3TGOA 4N2SA 3MA5A 3QOUA 5CCLA 3EDTB 1HH8A 2XCBA 4LEUA 4H7YA 4WNGA 4U0ZA 4BT8A 4EQFA 3HYMB 4G23A 4GCNA 1WM5A 2LNIA 4I2ZA 5C1DA 1NZNA 4XI9A 3S7BA 3URZA 2E2EA 1KT1A 3KD7A 1ZBPA 1OUVA 3LY8A 3QDNA 3TG5A 5LCWJ 4GYOA 3ASHA 4GPKA 4GA2A 4HOSA 4HOQA 3GW4A 4YVQC 3ASDA 4O6FA 3QWVA 5FZQA 1ELRA 4NRHB 5EX0A 3IEGA 1E96B 2WQHA 2XGSA 5CHEE 5AYWD 2C2LA 4GZ5A 3ZHEB 4CDRA 5A6CA 4G2VA 4GA0A 5FZSA 4HORA 4KXKB 2VGXB 3CVQA 4HOTA 2VSNA 3RO2A 2XCCA 4JHRA 5JJ6A 3UPVA 1W3BA 1Y8MA 4Y6WA 4YVOA 4AY5A 2C0LA 5ARGA 3WXXA 1NA3A 2VQ2A 4G25A 4H7XA 3SF4A 1NA0A 1TJCA 4GZ3A 4UQZA 4AIFA 4UI9K 4I2WA 2PQRA 4UI9J 3TAXA 2QFCA 5A7DB 4NQ0A 4N2QA 3MV3B 4GCOA 5BW8C 2FF4A 3AS5A 3Q15A 3FWVA 4U0UA 4U0SA 3RU0A 4G26A 5HI7A 5DBKA 2HR2A 2VGYA 2FBNA 2PQNA 2XEVA 3CEQA 3JYSA 4I9CA 4XIFA 3TG4A 2XGOA 3E4BA 3CVNA 2FI7A 4I9EA 4ABNA 2YQ8A 1WAO1 4YNDA 5FJYA 5FZRA 3ZPJA 1ELWA 4WNFA 4WNDA 2I6HA 5G04J 3R9AB 4Y6CA 3MV2B 2FO7A 3VTYA 2JLBA 3QWWA 5DIZA 4BTBA 2MHKA 3ASGA 3Q5MA 1YA0A 5D0QD 2YHCA 4RG9A 5KJKA 4CGVA 3ULQA 4UQYA 2UY1A 3OXLA 4IN3B 3LPZA 4J8FA 4N5CA 2KCVA 4U07A 3OXFA 3UQ3A 3UUXA 4CGWA 3CVLA 3CK8A 1ZU2A 4GZ6A 4N3CA 3NF1A 3CK9A 3LKUA 3RJVA 3RO3A 5KJMA 5FTPA 4AY6A 4GYYA 4JA7A 3CKBA 1A17A 1QZ2A 3RIBA 3S7JA 3PE4A 5G05C 4UI9C 4UQXA 5KJLA 4APOA 3OXGA 4ME2A 5G05J 2HYZA 3ZFWA 3U4TA 4J8DA 4I17A 4RG6A 5LCWC 3MEKA 3LY7A 4N39A 3O48A 4XI0A 3ASFA 2VGXA 3LY9A 4N3BA 4U04A 2C0MA 3BEEA 2J9QA 2XGMA 3ESKA 2ONDA 1XNFA 4J8EA 5EX3A 5ARFA 3SZ7A 1QQEA 2VSYA 3ZN3A 5KJNA 2PL2A 3K9IA 2V5FA 2IFUA 3MKRA 2R5SA 3PDNA 4G1TA 4N3AA 5FT9A 3ZHEA 1KLXA 3GYZA 4BTAA 5CCMA 5JJTA 2IF4A 1HZ4A 3GZ1A 3LYAA 3QWPA 4W9RA 2AVPA 2DBAA 5BT1A 3S7DA 2OOEA 2KCKA 3ZGQA 3Q47B 4GYWA 3GZ2A 1PC2A 5HQ8A 3CKCA 2KATA 4A1SA 3FFLA 3U3WA
chains in the Genus database with same CATH superfamily
4BSXA 4JC8A 5AQAA 5H7PA 3QC1A 2NC9A 5D0OD 3DXMG 1INZA 4I1OB 3CHMA 4TXRA 3CQCB 2XS1A 3PEUB 4UWGA 4BFRA 4A63B 4TUUA 4U95D 4HRLA 3QKYA 2JABA 3V2OA 3EUVA 1WG0A 2XCBA 4XZ4A 4O60A 4UWFA 1OUVA 1N54A 4U8VD 2X38A 3FUJA 1HX8A 3FUDA 1TEZA 1S70B 2L0IA 5LP0A 2KM4A 2XCCA 1OCOE 2J49A 3FY4A 2HM8A 4LNBA 3PS6A 3MV3B 5ENRD 2FBNA 1JUQA 1OWPA 5FZRA 2JLBA 5CEDB 4HI9A 1MQSA 5T3RA 3SFYA 4Z68A 3HRAA 3GZSA 4HI8A 3UQ3A 4EBAA 3W9FA 2Y1LE 4GYYA 1UJKA 2P9NG 3L13A 3ASFA 4FA6A 3PEVB 1IQUA 1LF8A 4G1TA 1DCQA 2IFUA 2R5SA 3APFA 4XE0A 2GRNB 4FP7A 1ELKA 5E76A 2GRQB 1JCRA 3LVRE 2GRRB 4U8HA 3N71A 3IXEA 2PNNA 3FUHA 4L23A 1MX2A 2DYRE 4DX7D 4F1PA 4JPSA 5AQBA 4L7TA 2GGFA 3CSTA 3DSTA 3DEPA 2WM9A 1SW6A 3CR3A 1MX6A 3D9OA 3UM3A 2XQ0A 3R7QA 2EIKE 2I2OA 2WMNA 3V79K 3L08A 3FUNA 4I1MA 2VGXB 5BUZA 4HLLA 1Y8MA 2WXGA 3E34A 2C0LA 3Q9UC 5ARGA 2RG8A 1TJCA 4EPZA 4UI9J 4A1GA 5BW8C 4EHMA 2HR2A 3FDHA 5FINA 3C3OA 2OVFA 4WNFA 2I1JA 5G04J 3NBNB 4MRUA 5ANLA 4EZLA 3HG0D 4B89A 1EF1C 2J08A 2VSXE 3NF1A 3HXCA 3UIOC 2IOLA 3FUFA 3S7JA 4HB5A 4L9PA 4ME2A 2VGEA 4TUMA 3ONLA 5EX3A 2WMOA 2IO2C 5KJNA 2PL2A 1OCZE 3G2UA 4KT6B 2WXRA 1N4RA 3U3WA 1N9AA 4JHKA 3LDZA 4WNEA 2XPZA 2KZTA 5CMWA 2VYIA 3CVXA 4AM9A 2P9IG 2KC7A 1FVHA 4GZCA 4DUIA 2WXHA 4DPRA 3ZEFA 2LUHA 5AJDA 1E8WA 3FEXA 4E6HA 3D3MA 4F6RD 3D9IA 2IU1A 2DIWA 2BUGA 3HVEA 2XPIA 2H6HA 4XI9A 3S7BA 3KD7A 4HOSA 4ZHBA 2J09A 3ZHEB 4MBGA 4HORA 4V3IA 1BD8A 2A4ZA 4G8LA 4IULA 3NOCD 4GTVA 5IY5E 1NA3A 2PQRA 2XHEA 1BI7B 4N2QA 2R17C 1X81A 2FI7A 3U64A 3I3NA 2E0IA 2FO7A 3JQ0A 2R59A 3IBEA 5J90A 1OCRE 4J8FA 3IHVA 1KPSB 3SBSA 2X6HA 3FTYA 3BG1B 3PE4A 1BLXB 3OXGA 3U4TA 2F37A 2P9SG 3EIJA 2HE0A 2XZTG 2J9QA 1S64A 2RFAA 3ONKA 4HS2A 3FULA 3S2AA 2AVPA 3SQVA 3UKRG 3W9GA 3DBSA 3UM2A 5HQ8A 3VTXA 1OY3D 3KEZA 4DX5D 2LSVA 1KT0A 4WWOA 3Q4AB 5EILA 3AJIA 4J8YA 3JUEA 1HXIA 4NACA 2P9PG 4CDNA 4G24A 3TWQA 4GA1A 1E90A 1D9SA 1TR4A 3EU5A 5AQ9A 4H7YA 2IJGX 3V30A 1WM5A 5C1DA 2V4LA 3FU0A 3U66A 1ZBPA 3PNTB 5KNGA 2LAIA 3IEGA 5FZSA 3U9WA 4K03A 4DI3A 3RO2A 4GTSA 2X6IA 2XENA 4HLEA 3MGBA 1NA0A 3FU6A 4UI9K 1H0AA 4CRWA 2VJ8A 3J5QB 3JYSA 2PQNA 4XIFA 4ABNA 5FJYA 3MKQA 1N0QA 1K3ZD 1IXVA 4FADA 2P9LG 4BTBA 3EHMA 2UY1A 3UUXA 4ACLA 4BETA 3RK6A 5G05C 4UQXA 4APOA 1XGWA 3CHQA 5D2MC 1ZB1A 3ZYKA 2XGMA 3B7UX 5FQ6A 2VSOE 3LEWA 3BG0B 1KLXA 3FTXA 2CG2A 3LYAA 2V0PA 3B7TA 4O1PA 2CFUA 4OAUC 3GZ2A 2DZNA 4ATGA 1TN7A 3SGHA 3D9JA 1QYMA 4KBQA 2Y4TA 2OEWA 4RVBA 1SZAA 4JA9A 4ILIA 4LSZE 4C9BB 2YNQA 2WXIA 1JPLA 4ANWA 4JVSA 2J8SD 4DI4A 4OAVB 3URZA 4J7WA 2VTBA 1E8XA 1MHQA 3ASDA 3D9PA 4YDOA 1Z3XA 1SA5A 1IHBA 3ZU7B 3B7BA 1E7UA 3Q7AA 4BERA 3I5PA 3CVWA 4L2LA 4YDYA 5KNHD 2XEEA 3AS5A 4LUNU 4G26A 1FT2A 3PUJA 1UN8A 4I9CA 3CVNA 1H2UA 1FT1A 3VTYA 3JQ1A 3L82A 3HXFA 2XS8A 3T5VA 4UQYA 3RO3A 3WG7E 4ZFHA 3CKBA 3RIBA 4WWPA 1OWOA 4PS3A 3SI5A 5G05J 4RG6A 4CDMA 3DEOA 2F8YA 4GTPA 2WQ7A 5T4YA 2IF4A 1HZ4A 4CYMD 3ZGQA 3Q47B 4DRXE 2MRIA 3TJPA 5JA4D 4RQIA 4BT9A 3PE3A 1QNFA 3CK7A 4J0UA 2KCLA 4JW1A 4HVBA 4QQIA 5AARA 4FULA 3EHQA 3AS8A 3PZ3A 2Q7FA 3BUAA 2RD0A 1JCQA 5M72A 5JJ7A 3TWRA 4N2SA 4WNGA 4B93B 4EQFA 4U8YD 1NZNA 3BQOA 1KT1A 3R9MA 5LCWJ 4YVQC 3VLEA 1OWLA 2VSNA 3PNLB 4A3VA 1H6KA 5BPPA 1MYOA 3D9NA 4YDEA 1OCCE 4AIFA 3ULEG 3ZNGA 2V4HC 3RU0A 2CG3A 1SVXA 2XEVA 3E4BA 3TWXA 3CQGB 3SHFA 2EIME 5DIZA 2YHCA 2B6CA 3ZRHA 3CVLA 3LKUA 1DNPA 3SFZA 2OV8A 2ZXWE 3ZFWA 4GMJA 4J8DA 4BX8A 3BEEA 1V55E 4Q96A 5A23A 1O1SA 4GTQA 3CHRA 3DXKG 2P9KG 1YMPA 2UY1B 4HOUA 1BU9A 4AEZC 1Z6TA 1FCHA 2X6KA 4JZYA 2HO1A 1JWFA 3CHPA 3MA5A 2DVWA 3AG1E 4GTOA 3QARA 5BV0A 2X6JA 3UINC 4GZ5A 3CVQA 2ZGDA 1TNZA 2VQ2A 4H7XA 5CRUA 3TAXA 3B7SA 5EIDA 1NI1A 2FF4A 3ULYA 2XEHA 4PUCA 2QYJA 4K0RA 2AXZA 3TWUA 4Y6CA 1RZ4A 1NP7A 1YCSB 5D66A 5CBOA 3ULQA 1E7VA 3CHSA 4U07A 3HHMA 2J07A 4GMRA 3HXEA 3I4RB 3L9TA 4UI9C 4I17A 5CMYA 3MEKA 4XI0A 2VGXA 2C0MA 3ABLE 4FHJA 2DWZA 3FTUA 3GYZA 1GW6A 2LXMA 2DBAA 4O1OA 3T8MA 1Q2ZA 2B0OE 5HS0A 4F53A 4NIKA 1N0RA 4DLOA 2Y4UA 3QK0A 4KYOB 1S0PA 1K1AA 3RRNB 2NXPA 2L9BA 2ETCA 4XKBA 4TXQA 1BI8B 5FQ4A 4HFGA 2IONA 2PM7A 4BEPA 1P5QA 1S63A 2RFMA 5G55A 3TWSA 1N4SA 3LY8A 3TXMA 3APCA 4GA2A 5HRYA 4UUCA 1UW4B 4HOQA 4C0EA 4GB9A 4FLHA 4KXKB 2ZU6B 1YYHA 3CVYA 2ETAA 4HRNA 3UPVA 1W3BA 4Y6WA 2IY0C 4JEUA 3AG3E 5ENTD 2WXPA 4U96D 5HKPA 5HI7A 3UM1A 2X6FA 3EJNA 2VTBB 2BKKB 2WXFA 5BV1A 1BPOA 3L22A 3CGHA 3QWWA 2MHKA 3AAAC 3OXLA 2J4BA 3EHRA 3OXFA 4XKCA 4L1BA 1MZCA 3FUEA 1JWGA 1WDYA 3NZUA 4IRUA 3CIAA 3ML9A 2R02A 3CVUA 4ANUA 5LCWC 3S7DA 4J8EA 3FTWA 5BNWA 5CCMA 5JJTA 5T8IA 3EU9A 4DX6D 4YDWA 2FULA 4I6GA 4F3VA 4B8CB 4EZKA 3Q73A 3FU3A 2GW1A 3TXNA 2UWJG 3UXGA 3DPYA 3TWTA 2AJAA 1MX4A 4OVVA 3HVEB 3RSEG 3G2SA 3VLFA 3B13A 2IQCA 4G8KA 3SBTB 5AYWD 3ENEA 4KZCA 1SQMA 3SFXA 2A5UA 3UTMA 2WXNA 3KSLA 4LNGA 4I2WA 3MJWA 3Q15A 3FWVA 4U0SA 4U7EB 4LRZA 2EQXA 2YQ8A 1N11A 3MV2B 4CT0A 4AVXA 3Q5MA 3NOGD 1YA0A 2ZGGA 1L5JA 2QY7A 3TWWA 3Q78A 2KBXA 2P9UG 4CGWA 1TNBA 1ZU2A 2I1KA 3SNXA 2WXLA 3L16A 2H6FA 4HBDA 3FH8A 2HYZA 3ML8A 4R7LA 4OVUA 2Y69E 3IKOB 1XNFA 5AQ7A 5ARFA 1KZPA 3ZN3A 2V5FA 1U3DA 5BT1A 1U3CA 4Q94A 4GYWA 3LJNA 3S7FA 1HE8A 4TRQA 2R2LA 3KSQA 2QZAA 3FTZA 2WPVA 4ANVA 4KZ0A 5E75A 3FP3A 5AAOA 1VDYA 4JXTA 1Z5SC 4U0ZA 3HYMB 4G23A 4WAFA 3ZIMA 2WVIA 5KBAA 2WXQA 3MYVA 4GPKA 2XPYA 4FJYA 4DX1A 2BEDA 3QWVA 5EX0A 1E8YA 1O5MA 4CDRA 2WQHA 3ZYMA 4C48B 3NQPA 3RRMB 4G25A 3SF4A 3RRUA 3EIQC 4AOFA 2EINE 3CEQA 2VGYA 4JEHA 5JHAA 3PVLA 3V2XA 5LFAA 2KZTB 3ASNE 2M63A 3ZKJA 3P1UA 3ASGA 3BU8A 3PRZA 3DPDA 2IOSA 1DC2A 1KZOA 3L6AA 4B0ZA 4IN3B 2KCVA 4N3CA 3DWLG 2GRMA 4AY6A 4M3OA 1HS6A 4TXPA 4BX9A 1UOHA 3QJZA 3K9IA 4JHJA 2YHEA 3EHNA 3QWPA 3CKCA 2KATA 3J5PA 3DRAA 3UT7A 3CVPA 3RKVA 5KWDA 2CHXA 3MZLB 1EYHA 3Q9NC 3PZ2A 3LXUX 3SO8A 1DCEA 3ESLA 1NL4A 1H6PA 1FPPA 1Y6IA 3Q49B 3EDTB 3PH0C 3PREA 5ENPD 4GMLA 4RSYA 1AP7A 4I2ZA 3UI2A 3C3QA 2E2EA 5FWQA 3TL5A 1ELRA 3JUIA 1IYGA 2C2LA 5JJ6A 4IYPA 4Q69A 4I6EA 1UJJA 2Y0BG 4FLBA 5J08A 4M7CA 4B8AA 2I6HA 4BESA 3DSXA 5D0QD 4HNAD 3D9KA 5CRVA 1HG2A 4AP2A 1LTXA 3LPZA 3FTSA 2IEJA 4QFVA 5FTPA 1A17A 5B3SE 5EYPF 4PDXA 5JHBA 4AV7A 1TNOA 5B1AE 3C5RA 1O1TA 2YINA 4N3BA 1OXJA 3SZ7A 2VSYA 4U63A 1RW2A 3MKRA 1TNYA 2NSZA 4TV3A 5B1BE 2KCKA 4UWHA 1HG5A 4J6IA 1EPUA 4E85A 1H2VC 4LCTA 3AU5A 1H6OA 3CV0A 3UIPC 4CCAA 1HU3A 2J4DA 3SY2A 4DK5A 4PS8A 1HH8A 4LEUA 3RAUA 3O4ZA 4HRMB 5AN8A 3P2BA 4GAAA 3E37A 4DX2A 4UWKA 2GROB 4O6FA 1SA4A 5FZQA 4GA0A 4APFA 3QAQA 3ZYLA 1N52A 4GZ3A 4C0MA 2XGOA 4MLPA 3I4GA 1Z3YA 1WAO1 2WXOA 3B95A 2NYJA 5BXUA 2ZIRA 3G2TA 3DSUA 3B7RL 4MS6A 2DZOA 1OT8A 4F7AA 4ATZD 1TN6A 1K1BA 3MX3A 2DYSE 4ILGA 1H2TC 1IQRA 3CK9A 2PM6A 5EIBE 1O1RA 1AWCB 1N94A 3ZYQA 1N4QA 1HF8A 2V8SE 3LY9A 2OCCE 3ISMC 4U04A 4CT4A 4BTAA 3Q7FA 3ZVVA 3ZW3A 4D10C 3AG4E 3G2WA 3PZ4A 4XX5A 3F6QA 1JCSA 5ENOD 2LSUA 4I43A 1TYQG 4K5AB 1N4PA 2FO1E 4WUYA 1B89A 4BY6A 3LS8A 4PH4B 3C98A 2EIJE 4A3TA 3JCKC 2FEZA 2L6JA 2PZIA 5FQ8A 3DSWA 2QYUA 4BT8A 4EZJA 3OTNA 2LNIA 3PUKA 4KVOA 4ACKA 5C2YA 2L0TB 4N5QA 3GW4A 1MJ0A 5CHEE 3Q75A 3ABKE 1IKND 4HOTA 4JHRA 3E33A 3APDA 2R03A 3WXXA 4UQZA 2BF0X 3L54A 3PZ1A 4GCOA 1PAQA 4U0UA 1E8ZA 5ENQD 5DBKA 2ZISA 3ZPJA 4J8SA 5AIJA 1ELWA 3D9HA 4WNDA 3E30A 1FVFA 4G11A 2LAHA 4CGVA 3MKQB 3OAWA 4N5CA 3HXBA 3NB2A 3R7RA 4JD2G 3RJVA 2WXJA 1WY6A 2DCPA 4LNUD 3FUMA 5ITZF 3FHEA 2WB2A 4LERA 3O48A 4F1SA 4BSZB 1X5BA 4W9RA 3V31A 2OOEA 1V54E 4GTMA 2ETBA 3ZXSA 4FC8A 1D8DA 2ILRA 3AU4A 5AENA 5EKQD 4B94A 2AXVA 1TNUA 4BWRA 2XRYA 2P58C 2F0YA 3ABME 3TGOA 5G2NA 2CHWA 2XZDG 1TJFA 3QDNA 3ASHA 1D8EA 3LJ3A 1HO8A 1QBQA 3PZDA 5A6CA 2AXUA 2OEVA 5EN5D 4AY5A 1NFIE 3D9LA 3IV0A 4NQ0A 3UM0A 3T8KA 5LOZA 3D9MA 4YNDA 2A5EA 4EBAG 4URKA 3CHOA 4FJZA 5CERB 1HFAA 5KJKA 2CFZA 2MOWA 4X8QA 3MCXA 3CK8A 4GZ6A 2H6GA 3TWVA 5KJMA 5AJLA 3FH7A 3L17A 3FU5A 3NAWA 4AJWA 5EDSA 5CECB 2JEKA 4DLQA 3LY7A 3NZSA 4GZDA 2AW6A 4JB8P 4MKTA 2AWIA 2XRZA 1QQEA 5CBNA 4N3AA 5FT9A 2V5QC 3ZHEA 2BTDA 5KCMA 3GZ1A 4K5CA 4KVMA 5FIOA 3T5XA 2RKKA 3KAEA 3FTVA 4JL0A 5EYLA 2QC9A 4I1AA 3CLJA 1IHGA 4HQDA 3FUIA 3QB2A 4CZ2D 5LX8A 3VLDA 2R05A 3UKUG 1SZ9A 1LD8A 3IHYA 2KXPC 4K5BA 1LD7A 3JXJA 2L6BA 4GCNA 3G2VA 4AXHA 1TN8A 3CVVA 3TG5A 4GYOA 3HDXA 1E96B 2XGSA 2IO3C 2EILE 4A55A 4G2VA 1PY1A 5CCLA 4PS7A 3JXIA 4L2YA 2H6IA 3UT8A 3Q79A 5A7DB 2WXMA 4HXIA 2WQ6A 3TG4A 2GRLA 4I9EA 5ENNA 2X3MA 2Y3AA 3R9AB 1H19A 4GU5A 4RG9A 4FU3A 3DSSA 1G3NB 3ASOE 3T9KA 4KMOA 2OVBA 5KJLA 5ENSD 4OYSA 2CHZA 1N95A 5G04C 3ESKA 2ONDA 3PDNA 1OWMA 1U2VG 3LVQE 4I6JA 4A1SA 1EDUA 4CEMA 4UWLA 2LXLA 3LCAA 5JMND 3C72A 4RLYA 1K8KG 4GTRA 2GRPB 3KS2A 3UT4A 3UX4A 3AS4A 3FH5A 5CEAA 3ZUVB 1UN9A 2WXKA 3QOUA 4ILHB 2F8XK 3HXDA 1DVPA 3KEAA 4NRHB 3ZXPA 1A5EA 4GPMA 5BXOA 4YVOA 1UG3A 4P29A 5ANRA 2QFCA 4GTTA 2I9CA 3HIZA 2P2CP 4XEIG 4NURA 3C3RA 4EECA 2MYOA 3E32A 2LO6A 2BKGA 3SD5A 3AG2E 3FEYA 4JA7A 1QZ2A 3FUKA 1OWNA 4N39A 4LG6A 3UMVA 3X2QE 3DSVA 4WWNA 4ANXA 4DJAA 3CSFA 4FHKA 1PC2A 3QNKA 3FFLA 5FQ7A
chains in the Genus database with same CATH topology
4BSXA 2LSUA 4JC8A 4F3VA 3D9JA 4I43A 3QC1A 2NC9A 4KBQA 4B8CB 4EZKA 4WUYA 2Y4TA 5D0OD 1B89A 4BY6A 4RVBA 3FU3A 1INZA 4I1OB 3CHMA 3LS8A 2GW1A 3CQCB 4PH4B 3C98A 3PEUB 3TXNA 2UWJG 4A3TA 4UWGA 1SZAA 4BFRA 4JA9A 4TUUA 4ILIA 3JCKC 2FEZA 2L6JA 3QKYA 4C9BB 4OVVA 2PZIA 3HVEB 5FQ8A 2YNQA 2WXIA 1JPLA 3G2SA 4ANWA 2XCBA 4XZ4A 3VLFA 4BT8A 4JVSA 3B13A 4EZJA 3OTNA 2LNIA 2IQCA 4UWFA 4DI4A 3URZA 3PUKA 4KVOA 1OUVA 4ACKA 5C2YA 1N54A 2VTBA 2L0TB 1E8XA 2X38A 3GW4A 1MHQA 3ASDA 3D9PA 3SBTB 1Z3XA 1HX8A 3FUJA 3ENEA 5CHEE 5AYWD 3FUDA 1TEZA 4KZCA 2L0IA 5LP0A 4HOTA 1SQMA 2KM4A 2XCCA 4JHRA 2A5UA 1E7UA 2J49A 3FY4A 3APDA 3I5PA 2HM8A 3WXXA 2WXNA 4UQZA 3CVWA 2BF0X 4I2WA 3MJWA 4L2LA 3L54A 3PS6A 3MV3B 4GCOA 1PAQA 3Q15A 3AS5A 4U0UA 3FWVA 1E8ZA 4LUNU 4U0SA 4G26A 5DBKA 3PUJA 1UN8A 2FBNA 4I9CA 4LRZA 1JUQA 3CVNA 2EQXA 2YQ8A 3ZPJA 1OWPA 4J8SA 5FZRA 5AIJA 1ELWA 1H2UA 4WNDA 3MV2B 3VTYA 4CT0A 4AVXA 2JLBA 3JQ1A 1FVFA 3Q5MA 4G11A 1YA0A 1MQSA 5T3RA 2LAHA 1L5JA 2QY7A 3T5VA 4CGVA 3MKQB 3OAWA 4DPRA 4UQYA 4N5CA 3GZSA 3UQ3A 4EBAA 4CGWA 3R7RA 1ZU2A 3RO3A 2I1KA 3RJVA 2WXJA 3SNXA 2WXLA 1WY6A 2DCPA 4GYYA 3CKBA 3L16A 4WWPA 3RIBA 1OWOA 4PS3A 3FUMA 3FH8A 3SI5A 5G05J 2HYZA 1UJKA 3FHEA 3ML8A 4RG6A 2WB2A 4CDMA 4R7LA 4LERA 4OVUA 3L13A 3O48A 4F1SA 3ASFA 3IKOB 1XNFA 2WQ7A 5ARFA 4FA6A 3PEVB 1IQUA 3ZN3A 1LF8A 2V5FA 2IFUA 4G1TA 2R5SA 3APFA 1X5BA 4XE0A 5T4YA 2IF4A 1HZ4A 4W9RA 4FP7A 1U3DA 5BT1A 1U3CA 2OOEA 3ZGQA 1ELKA 4Q94A 3Q47B 5E76A 4GYWA 2MRIA 3TJPA 4FC8A 3ZXSA 3LVRE 4BT9A 3PE3A 2ILRA 3AU4A 3S7FA 5AENA 1QNFA 1HE8A 4TRQA 5EKQD 3CK7A 4B94A 4U8HA 3N71A 4J0UA 2AXVA 2KCLA 4JW1A 4HVBA 3FTZA 3FUHA 4L23A 4FULA 3AS8A 2WPVA 4ANVA 4BWRA 2XRYA 2Q7FA 4KZ0A 5E75A 2P58C 3FP3A 2RD0A 4JPSA 5M72A 1VDYA 5JJ7A 4JXTA 3TGOA 4N2SA 4L7TA 2GGFA 5G2NA 3CSTA 2CHWA 4WNGA 4EQFA 4U0ZA 3HYMB 4G23A 4WAFA 2WM9A 3ZIMA 2WVIA 3CR3A 2WXQA 1NZNA 3MYVA 3D9OA 2XQ0A 1KT1A 1TJFA 3QDNA 3R7QA 5LCWJ 4GPKA 2I2OA 2XPYA 3ASHA 4FJYA 2WMNA 3LJ3A 4YVQC 3QWVA 3VLEA 3L08A 1E8YA 1HO8A 5EX0A 2WQHA 3ZYMA 4CDRA 3PZDA 3FUNA 5A6CA 4I1MA 2VGXB 1OWLA 2AXUA 2VSNA 5BUZA 3PNLB 4A3VA 1H6KA 5BPPA 1Y8MA 2WXGA 3D9NA 4AY5A 3NQPA 2C0LA 3RRMB 5ARGA 2RG8A 4G25A 3SF4A 4AIFA 1TJCA 3RRUA 4EPZA 3D9LA 4UI9J 3IV0A 4NQ0A 4A1GA 5BW8C 3EIQC 4AOFA 3RU0A 2CG3A 3CEQA 2HR2A 2VGYA 4JEHA 2XEVA 4ATGA 5LOZA 5JHAA 3FDHA 3E4BA 3PVLA 3D9MA 4YNDA 3CQGB 2OVFA 4EBAG 5LFAA 3SHFA 2KZTB 4WNFA 3CHOA 4FJZA 2I1JA 5G04J 4URKA 2M63A 4MRUA 3P1UA 5ANLA 5DIZA 4EZLA 3ASGA 3PRZA 2YHCA 1HFAA 3DPDA 2IOSA 5KJKA 2CFZA 2MOWA 3L6AA 4B0ZA 1EF1C 3ZRHA 4B89A 4IN3B 3MCXA 2KCVA 2J08A 3CVLA 3CK8A 4N3CA 4GZ6A 2GRMA 2VSXE 3LKUA 3NF1A 5AJLA 5KJMA 4AY6A 2IOLA 4M3OA 3FUFA 1DNPA 1HS6A 3S7JA 3FH7A 3SFZA 3L17A 2OV8A 3FU5A 4ME2A 3ZFWA 4GMJA 4AJWA 4J8DA 5EDSA 4BX8A 4BX9A 2JEKA 4DLQA 3LY7A 3NZSA 4GZDA 3ONLA 2AW6A 3BEEA 3QJZA 2AWIA 4MKTA 2WMOA 4Q96A 5EX3A 5A23A 2XRZA 1QQEA 5KJNA 2PL2A 3K9IA 4N3AA 5FT9A 3ZHEA 4JHJA 2YHEA 2BTDA 3EHNA 5KCMA 3GZ1A 3QWPA 3G2UA 4KVMA 4KT6B 2WXRA 3CHRA 3CKCA 2KATA 3U3WA 3T5XA 4JHKA 3UT7A 3CVPA 3FTVA 3KAEA 3LDZA 4JL0A 4WNEA 3RKVA 2UY1B 2KZTA 2CHXA 2XPZA 4HOUA 5CMWA 4AEZC 3MZLB 2VYIA 1EYHA 3CVXA 4I1AA 4AM9A 2KC7A 3CLJA 1IHGA 3LXUX 1FVHA 4GZCA 1Z6TA 2WXHA 1FCHA 2X6KA 3ESLA 3FUIA 3QB2A 4JZYA 3VLDA 5AJDA 3ZEFA 1E8WA 5LX8A 3FEXA 4E6HA 3D3MA 1SZ9A 3D9IA 1Y6IA 2IU1A 2HO1A 1JWFA 2DIWA 2BUGA 3HVEA 3Q49B 2XPIA 3IHYA 3CHPA 3MA5A 3EDTB 3PH0C 3PREA 4GMLA 4RSYA 4GCNA 3G2VA 4I2ZA 4AXHA 4XI9A 3QARA 3CVVA 3S7BA 2E2EA 5FWQA 5BV0A 3KD7A 3TG5A 4GYOA 4HOSA 2X6JA 2J09A 3TL5A 3HDXA 1ELRA 3JUIA 1E96B 2XGSA 3ZHEB 1IYGA 2C2LA 4GZ5A 4A55A 4G2VA 4HORA 3CVQA 4V3IA 5JJ6A 2A4ZA 4IYPA 1PY1A 4IULA 4Q69A 1NA3A 2VQ2A 5CCLA 4H7XA 4PS7A 4L2YA 4I6EA 2PQRA 2XHEA 3TAXA 3UT8A 5A7DB 2WXMA 4N2QA 3B7SA 1UJJA 2FF4A 4PUCA 4HXIA 2WQ6A 3TG4A 2R17C 2GRLA 4FLBA 5J08A 4I9EA 2FI7A 5ENNA 2X3MA 2Y3AA 4K0RA 2AXZA 3U64A 4B8AA 2I6HA 3I3NA 3R9AB 2E0IA 4Y6CA 1H19A 2FO7A 3JQ0A 2R59A 3IBEA 4GU5A 1NP7A 5D0QD 4RG9A 3D9KA 5J90A 4FU3A 1HG2A 4AP2A 3ULQA 1E7VA 3CHSA 3FTSA 3IHVA 3LPZA 4J8FA 4U07A 3SBSA 2X6HA 4QFVA 5FTPA 3FTYA 3HHMA 4KMOA 4DLOA 1A17A 2J07A 3BG1B 3PE4A 3I4RB 2OVBA 4PDXA 4UI9C 5JHBA 5KJLA 3OXGA 3U4TA 4AV7A 4I17A 5CMYA 3MEKA 2YINA 3EIJA 2CHZA 4OYSA 4XI0A 4N3BA 2VGXA 5G04C 2C0MA 2J9QA 3ESKA 3SZ7A 2ONDA 2VSYA 4FHJA 4U63A 3MKRA 3PDNA 3ONKA 4HS2A 3FULA 3FTUA 1OWMA 3GYZA 1GW6A 2NSZA 3S2AA 2AVPA 4TV3A 2DBAA 3LVQE 3DBSA 3T8MA 4I6JA 2KCKA 4UWHA 5HQ8A 1HG5A 4J6IA 4F53A 4A1SA 1EPUA 4E85A 1EDUA 1H2VC 2Y4UA 3QK0A 4KYOB 1S0PA 3KEZA 3VTXA 4CEMA 4LCTA 3AU5A 4UWLA 2LSVA 1KT0A 4WWOA 3Q4AB 3CV0A 3RRNB 3LCAA 2NXPA 2L9BA 4CCAA 4XKBA 1HXIA 1HU3A 2J4DA 4NACA 3KS2A 5FQ4A 3UT4A 4HFGA 2IONA 3UX4A 4CDNA 3AS4A 4G24A 3FH5A 4GA1A 1E90A 2PM7A 4DK5A 1UN9A 1P5QA 2WXKA 3QOUA 4PS8A 1HH8A 4LEUA 5G55A 4H7YA 2IJGX 3O4ZA 4ILHB 3P2BA 4GAAA 1WM5A 5C1DA 2V4LA 3FU0A 1DVPA 3U66A 1ZBPA 3LY8A 3TXMA 3APCA 4GA2A 4UWKA 1UW4B 3PNTB 4HOQA 2LAIA 4O6FA 5FZQA 4NRHB 4C0EA 3IEGA 4GB9A 4FLHA 5FZSA 4GA0A 3U9WA 4KXKB 4K03A 2ZU6B 4APFA 4DI3A 3CVYA 3RO2A 3QAQA 3UPVA 1W3BA 4Y6WA 4YVOA 4JEUA 2X6IA 3ZYLA 4HLEA 1UG3A 3MGBA 1NA0A 1N52A 4GZ3A 4P29A 3FU6A 4UI9K 2WXPA 5ANRA 1H0AA 2QFCA 4CRWA 4C0MA 2VJ8A 5HI7A 2I9CA 2PQNA 3HIZA 3JYSA 4XIFA 4ABNA 2XGOA 4MLPA 2X6FA 3EJNA 1Z3YA 3I4GA 1WAO1 5FJYA 2WXOA 2VTBB 3MKQA 2WXFA 3G2TA 1BPOA 3L22A 5BV1A 4FADA 4NURA 3B7RL 4BTBA 3CGHA 3QWWA 4MS6A 2MHKA 4F7AA 3MX3A 4EECA 3EHMA 2UY1A 3OXLA 4ILGA 3UUXA 2J4BA 2LO6A 1H2TC 3OXFA 4ACLA 4XKCA 3SD5A 1IQRA 4L1BA 3CK9A 3FUEA 3RK6A 3FEYA 1JWGA 4JA7A 3NZUA 1QZ2A 2PM6A 5G05C 4UQXA 4IRUA 4APOA 1XGWA 3CHQA 3CIAA 3ML9A 3ZYQA 3CVUA 3FUKA 4ANUA 5LCWC 3ZYKA 1HF8A 1OWNA 4N39A 3UMVA 2V8SE 3LY9A 3S7DA 4U04A 2XGMA 4J8EA 3B7UX 5FQ6A 2VSOE 4WWNA 4CT4A 3FTWA 4ANXA 3LEWA 5BNWA 5CCMA 5JJTA 3BG0B 1KLXA 3FTXA 4BTAA 5T8IA 4DJAA 2CG2A 3LYAA 3ZVVA 2V0PA 3B7TA 3ZW3A 4D10C 3CSFA 2CFUA 3G2WA 4XX5A 4FHKA 3GZ2A 1PC2A 3QNKA 2FULA 4I6GA 3FFLA 5FQ7A 3SGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTX A;  2Y4U A;  4KYO B;  2LSU A;  3CVP A;  3KAE A;  3PE3 A;  4JL0 A;  4BT9 A;  4F3V A;  3S7F A;  4WNE A;  3RKV A;  2LSV A;  1KT0 A;  3Q4A B;  3CV0 A;  2UY1 B;  4HOU A;  5EKQ D;  2NC9 A;  4KBQ A;  3CK7 A;  4B94 A;  4WUY A;  2VYI A;  3LCA A;  2Y4T A;  3N71 A;  5D0O D;  4I1A A;  4AM9 A;  4J0U A;  1B89 A;  2KCL A;  2KC7 A;  1IHG A;  1HXI A;  1IYG A;  2GW1 A;  2UWJ G;  1FCH A;  2WPV A;  3AS8 A;  3KS2 A;  4JA9 A;  4BWR A;  2Q7F A;  5G04 C;  3AS4 A;  4G24 A;  2FEZ A;  2L6J A;  2P58 C;  3FP3 A;  3QKY A;  4GA1 A;  2HO1 A;  5M72 A;  5JJ7 A;  2BUG A;  3Q49 B;  1P5Q A;  2XPI A;  2PZI A;  5BNW A;  3TGO A;  4N2S A;  3MA5 A;  3QOU A;  5CCL A;  3EDT B;  1HH8 A;  2XCB A;  4LEU A;  4H7Y A;  4WNG A;  4U0Z A;  4BT8 A;  4EQF A;  3HYM B;  4G23 A;  4GCN A;  1WM5 A;  2LNI A;  4I2Z A;  5C1D A;  1NZN A;  4XI9 A;  3S7B A;  3URZ A;  2E2E A;  1KT1 A;  3KD7 A;  1ZBP A;  1OUV A;  3LY8 A;  3QDN A;  3TG5 A;  5LCW J;  4GYO A;  3ASH A;  4GPK A;  4GA2 A;  4HOS A;  4HOQ A;  3GW4 A;  4YVQ C;  3ASD A;  4O6F A;  3QWV A;  5FZQ A;  1ELR A;  4NRH B;  5EX0 A;  3IEG A;  1E96 B;  2WQH A;  2XGS A;  5CHE E;  5AYW D;  2C2L A;  4GZ5 A;  3ZHE B;  4CDR A;  5A6C A;  4G2V A;  4GA0 A;  5FZS A;  4HOR A;  4KXK B;  2VGX B;  3CVQ A;  4HOT A;  2VSN A;  3RO2 A;  2XCC A;  4JHR A;  5JJ6 A;  3UPV A;  1W3B A;  1Y8M A;  4Y6W A;  4YVO A;  4AY5 A;  2C0L A;  5ARG A;  3WXX A;  1NA3 A;  2VQ2 A;  4G25 A;  4H7X A;  3SF4 A;  1NA0 A;  1TJC A;  4GZ3 A;  4UQZ A;  4AIF A;  4UI9 K;  4I2W A;  2PQR A;  4UI9 J;  3TAX A;  2QFC A;  5A7D B;  4NQ0 A;  4N2Q A;  3MV3 B;  4GCO A;  5BW8 C;  2FF4 A;  3AS5 A;  3Q15 A;  3FWV A;  4U0U A;  4U0S A;  3RU0 A;  4G26 A;  5HI7 A;  5DBK A;  2HR2 A;  2VGY A;  2FBN A;  2PQN A;  2XEV A;  3CEQ A;  3JYS A;  4I9C A;  4XIF A;  3TG4 A;  2XGO A;  3E4B A;  3CVN A;  2FI7 A;  4I9E A;  4ABN A;  2YQ8 A;  1WAO 1;  4YND A;  5FJY A;  5FZR A;  3ZPJ A;  1ELW A;  4WNF A;  4WND A;  2I6H A;  5G04 J;  3R9A B;  4Y6C A;  3MV2 B;  2FO7 A;  3VTY A;  2JLB A;  3QWW A;  5DIZ A;  4BTB A;  2MHK A;  3ASG A;  3Q5M A;  1YA0 A;  5D0Q D;  2YHC A;  4RG9 A;  5KJK A;  4CGV A;  3ULQ A;  4UQY A;  2UY1 A;  3OXL A;  4IN3 B;  3LPZ A;  4J8F A;  4N5C A;  2KCV A;  4U07 A;  3OXF A;  3UQ3 A;  3UUX A;  4CGW A;  3CVL A;  3CK8 A;  1ZU2 A;  4GZ6 A;  4N3C A;  3NF1 A;  3CK9 A;  3LKU A;  3RJV A;  3RO3 A;  5KJM A;  5FTP A;  4AY6 A;  4GYY A;  4JA7 A;  3CKB A;  1A17 A;  1QZ2 A;  3RIB A;  3S7J A;  3PE4 A;  5G05 C;  4UI9 C;  4UQX A;  5KJL A;  4APO A;  3OXG A;  4ME2 A;  5G05 J;  2HYZ A;  3ZFW A;  3U4T A;  4J8D A;  4I17 A;  4RG6 A;  5LCW C;  3MEK A;  3LY7 A;  4N39 A;  3O48 A;  4XI0 A;  3ASF A;  2VGX A;  3LY9 A;  4N3B A;  4U04 A;  2C0M A;  3BEE A;  2J9Q A;  2XGM A;  3ESK A;  2OND A;  1XNF A;  4J8E A;  5EX3 A;  5ARF A;  3SZ7 A;  1QQE A;  2VSY A;  3ZN3 A;  5KJN A;  2PL2 A;  3K9I A;  2V5F A;  2IFU A;  3MKR A;  2R5S A;  3PDN A;  4G1T A;  4N3A A;  5FT9 A;  3ZHE A;  1KLX A;  3GYZ A;  4BTA A;  5CCM A;  5JJT A;  2IF4 A;  1HZ4 A;  3GZ1 A;  3LYA A;  3QWP A;  4W9R A;  2AVP A;  2DBA A;  5BT1 A;  3S7D A;  2OOE A;  2KCK A;  3ZGQ A;  3Q47 B;  4GYW A;  3GZ2 A;  1PC2 A;  5HQ8 A;  3CKC A;  2KAT A;  4A1S A;  3FFL A;  3U3W A; 
#chains in the Genus database with same CATH topology
 4BSX A;  4JC8 A;  5AQA A;  5H7P A;  3QC1 A;  2NC9 A;  5D0O D;  3DXM G;  1INZ A;  4I1O B;  3CHM A;  4TXR A;  3CQC B;  2XS1 A;  3PEU B;  4UWG A;  4BFR A;  4A63 B;  4TUU A;  4U95 D;  4HRL A;  3QKY A;  2JAB A;  3V2O A;  3EUV A;  1WG0 A;  2XCB A;  4XZ4 A;  4O60 A;  4UWF A;  1OUV A;  1N54 A;  4U8V D;  2X38 A;  3FUJ A;  1HX8 A;  3FUD A;  1TEZ A;  1S70 B;  2L0I A;  5LP0 A;  2KM4 A;  2XCC A;  1OCO E;  2J49 A;  3FY4 A;  2HM8 A;  4LNB A;  3PS6 A;  3MV3 B;  5ENR D;  2FBN A;  1JUQ A;  1OWP A;  5FZR A;  2JLB A;  5CED B;  4HI9 A;  1MQS A;  5T3R A;  3SFY A;  4Z68 A;  3HRA A;  3GZS A;  4HI8 A;  3UQ3 A;  4EBA A;  3W9F A;  2Y1L E;  4GYY A;  1UJK A;  2P9N G;  3L13 A;  3ASF A;  4FA6 A;  3PEV B;  1IQU A;  1LF8 A;  4G1T A;  1DCQ A;  2IFU A;  2R5S A;  3APF A;  4XE0 A;  2GRN B;  4FP7 A;  1ELK A;  5E76 A;  2GRQ B;  1JCR A;  3LVR E;  2GRR B;  4U8H A;  3N71 A;  3IXE A;  2PNN A;  3FUH A;  4L23 A;  1MX2 A;  2DYR E;  4DX7 D;  4F1P A;  4JPS A;  5AQB A;  4L7T A;  2GGF A;  3CST A;  3DST A;  3DEP A;  2WM9 A;  1SW6 A;  3CR3 A;  1MX6 A;  3D9O A;  3UM3 A;  2XQ0 A;  3R7Q A;  2EIK E;  2I2O A;  2WMN A;  3V79 K;  3L08 A;  3FUN A;  4I1M A;  2VGX B;  5BUZ A;  4HLL A;  1Y8M A;  2WXG A;  3E34 A;  2C0L A;  3Q9U C;  5ARG A;  2RG8 A;  1TJC A;  4EPZ A;  4UI9 J;  4A1G A;  5BW8 C;  4EHM A;  2HR2 A;  3FDH A;  5FIN A;  3C3O A;  2OVF A;  4WNF A;  2I1J A;  5G04 J;  3NBN B;  4MRU A;  5ANL A;  4EZL A;  3HG0 D;  4B89 A;  1EF1 C;  2J08 A;  2VSX E;  3NF1 A;  3HXC A;  3UIO C;  2IOL A;  3FUF A;  3S7J A;  4HB5 A;  4L9P A;  4ME2 A;  2VGE A;  4TUM A;  3ONL A;  5EX3 A;  2WMO A;  2IO2 C;  5KJN A;  2PL2 A;  1OCZ E;  3G2U A;  4KT6 B;  2WXR A;  1N4R A;  3U3W A;  1N9A A;  4JHK A;  3LDZ A;  4WNE A;  2XPZ A;  2KZT A;  5CMW A;  2VYI A;  3CVX A;  4AM9 A;  2P9I G;  2KC7 A;  1FVH A;  4GZC A;  4DUI A;  2WXH A;  4DPR A;  3ZEF A;  2LUH A;  5AJD A;  1E8W A;  3FEX A;  4E6H A;  3D3M A;  4F6R D;  3D9I A;  2IU1 A;  2DIW A;  2BUG A;  3HVE A;  2XPI A;  2H6H A;  4XI9 A;  3S7B A;  3KD7 A;  4HOS A;  4ZHB A;  2J09 A;  3ZHE B;  4MBG A;  4HOR A;  4V3I A;  1BD8 A;  2A4Z A;  4G8L A;  4IUL A;  3NOC D;  4GTV A;  5IY5 E;  1NA3 A;  2PQR A;  2XHE A;  1BI7 B;  4N2Q A;  2R17 C;  1X81 A;  2FI7 A;  3U64 A;  3I3N A;  2E0I A;  2FO7 A;  3JQ0 A;  2R59 A;  3IBE A;  5J90 A;  1OCR E;  4J8F A;  3IHV A;  1KPS B;  3SBS A;  2X6H A;  3FTY A;  3BG1 B;  3PE4 A;  1BLX B;  3OXG A;  3U4T A;  2F37 A;  2P9S G;  3EIJ A;  2HE0 A;  2XZT G;  2J9Q A;  1S64 A;  2RFA A;  3ONK A;  4HS2 A;  3FUL A;  3S2A A;  2AVP A;  3SQV A;  3UKR G;  3W9G A;  3DBS A;  3UM2 A;  5HQ8 A;  3VTX A;  1OY3 D;  3KEZ A;  4DX5 D;  2LSV A;  1KT0 A;  4WWO A;  3Q4A B;  5EIL A;  3AJI A;  4J8Y A;  3JUE A;  1HXI A;  4NAC A;  2P9P G;  4CDN A;  4G24 A;  3TWQ A;  4GA1 A;  1E90 A;  1D9S A;  1TR4 A;  3EU5 A;  5AQ9 A;  4H7Y A;  2IJG X;  3V30 A;  1WM5 A;  5C1D A;  2V4L A;  3FU0 A;  3U66 A;  1ZBP A;  3PNT B;  5KNG A;  2LAI A;  3IEG A;  5FZS A;  3U9W A;  4K03 A;  4DI3 A;  3RO2 A;  4GTS A;  2X6I A;  2XEN A;  4HLE A;  3MGB A;  1NA0 A;  3FU6 A;  4UI9 K;  1H0A A;  4CRW A;  2VJ8 A;  3J5Q B;  3JYS A;  2PQN A;  4XIF A;  4ABN A;  5FJY A;  3MKQ A;  1N0Q A;  1K3Z D;  1IXV A;  4FAD A;  2P9L G;  4BTB A;  3EHM A;  2UY1 A;  3UUX A;  4ACL A;  4BET A;  3RK6 A;  5G05 C;  4UQX A;  4APO A;  1XGW A;  3CHQ A;  5D2M C;  1ZB1 A;  3ZYK A;  2XGM A;  3B7U X;  5FQ6 A;  2VSO E;  3LEW A;  3BG0 B;  1KLX A;  3FTX A;  2CG2 A;  3LYA A;  2V0P A;  3B7T A;  4O1P A;  2CFU A;  4OAU C;  3GZ2 A;  2DZN A;  4ATG A;  1TN7 A;  3SGH A;  3D9J A;  1QYM A;  4KBQ A;  2Y4T A;  2OEW A;  4RVB A;  1SZA A;  4JA9 A;  4ILI A;  4LSZ E;  4C9B B;  2YNQ A;  2WXI A;  1JPL A;  4ANW A;  4JVS A;  2J8S D;  4DI4 A;  4OAV B;  3URZ A;  4J7W A;  2VTB A;  1E8X A;  1MHQ A;  3ASD A;  3D9P A;  4YDO A;  1Z3X A;  1SA5 A;  1IHB A;  3ZU7 B;  3B7B A;  1E7U A;  3Q7A A;  4BER A;  3I5P A;  3CVW A;  4L2L A;  4YDY A;  5KNH D;  2XEE A;  3AS5 A;  4LUN U;  4G26 A;  1FT2 A;  3PUJ A;  1UN8 A;  4I9C A;  3CVN A;  1H2U A;  1FT1 A;  3VTY A;  3JQ1 A;  3L82 A;  3HXF A;  2XS8 A;  3T5V A;  4UQY A;  3RO3 A;  3WG7 E;  4ZFH A;  3CKB A;  3RIB A;  4WWP A;  1OWO A;  4PS3 A;  3SI5 A;  5G05 J;  4RG6 A;  4CDM A;  3DEO A;  2F8Y A;  4GTP A;  2WQ7 A;  5T4Y A;  2IF4 A;  1HZ4 A;  4CYM D;  3ZGQ A;  3Q47 B;  4DRX E;  2MRI A;  3TJP A;  5JA4 D;  4RQI A;  4BT9 A;  3PE3 A;  1QNF A;  3CK7 A;  4J0U A;  2KCL A;  4JW1 A;  4HVB A;  4QQI A;  5AAR A;  4FUL A;  3EHQ A;  3AS8 A;  3PZ3 A;  2Q7F A;  3BUA A;  2RD0 A;  1JCQ A;  5M72 A;  5JJ7 A;  3TWR A;  4N2S A;  4WNG A;  4B93 B;  4EQF A;  4U8Y D;  1NZN A;  3BQO A;  1KT1 A;  3R9M A;  5LCW J;  4YVQ C;  3VLE A;  1OWL A;  2VSN A;  3PNL B;  4A3V A;  1H6K A;  5BPP A;  1MYO A;  3D9N A;  4YDE A;  1OCC E;  4AIF A;  3ULE G;  3ZNG A;  2V4H C;  3RU0 A;  2CG3 A;  1SVX A;  2XEV A;  3E4B A;  3TWX A;  3CQG B;  3SHF A;  2EIM E;  5DIZ A;  2YHC A;  2B6C A;  3ZRH A;  3CVL A;  3LKU A;  1DNP A;  3SFZ A;  2OV8 A;  2ZXW E;  3ZFW A;  4GMJ A;  4J8D A;  4BX8 A;  3BEE A;  1V55 E;  4Q96 A;  5A23 A;  1O1S A;  4GTQ A;  3CHR A;  3DXK G;  2P9K G;  1YMP A;  2UY1 B;  4HOU A;  1BU9 A;  4AEZ C;  1Z6T A;  1FCH A;  2X6K A;  4JZY A;  2HO1 A;  1JWF A;  3CHP A;  3MA5 A;  2DVW A;  3AG1 E;  4GTO A;  3QAR A;  5BV0 A;  2X6J A;  3UIN C;  4GZ5 A;  3CVQ A;  2ZGD A;  1TNZ A;  2VQ2 A;  4H7X A;  5CRU A;  3TAX A;  3B7S A;  5EID A;  1NI1 A;  2FF4 A;  3ULY A;  2XEH A;  4PUC A;  2QYJ A;  4K0R A;  2AXZ A;  3TWU A;  4Y6C A;  1RZ4 A;  1NP7 A;  1YCS B;  5D66 A;  5CBO A;  3ULQ A;  1E7V A;  3CHS A;  4U07 A;  3HHM A;  2J07 A;  4GMR A;  3HXE A;  3I4R B;  3L9T A;  4UI9 C;  4I17 A;  5CMY A;  3MEK A;  4XI0 A;  2VGX A;  2C0M A;  3ABL E;  4FHJ A;  2DWZ A;  3FTU A;  3GYZ A;  1GW6 A;  2LXM A;  2DBA A;  4O1O A;  3T8M A;  1Q2Z A;  2B0O E;  5HS0 A;  4F53 A;  4NIK A;  1N0R A;  4DLO A;  2Y4U A;  3QK0 A;  4KYO B;  1S0P A;  1K1A A;  3RRN B;  2NXP A;  2L9B A;  2ETC A;  4XKB A;  4TXQ A;  1BI8 B;  5FQ4 A;  4HFG A;  2ION A;  2PM7 A;  4BEP A;  1P5Q A;  1S63 A;  2RFM A;  5G55 A;  3TWS A;  1N4S A;  3LY8 A;  3TXM A;  3APC A;  4GA2 A;  5HRY A;  4UUC A;  1UW4 B;  4HOQ A;  4C0E A;  4GB9 A;  4FLH A;  4KXK B;  2ZU6 B;  1YYH A;  3CVY A;  2ETA A;  4HRN A;  3UPV A;  1W3B A;  4Y6W A;  2IY0 C;  4JEU A;  3AG3 E;  5ENT D;  2WXP A;  4U96 D;  5HKP A;  5HI7 A;  3UM1 A;  2X6F A;  3EJN A;  2VTB B;  2BKK B;  2WXF A;  5BV1 A;  1BPO A;  3L22 A;  3CGH A;  3QWW A;  2MHK A;  3AAA C;  3OXL A;  2J4B A;  3EHR A;  3OXF A;  4XKC A;  4L1B A;  1MZC A;  3FUE A;  1JWG A;  1WDY A;  3NZU A;  4IRU A;  3CIA A;  3ML9 A;  2R02 A;  3CVU A;  4ANU A;  5LCW C;  3S7D A;  4J8E A;  3FTW A;  5BNW A;  5CCM A;  5JJT A;  5T8I A;  3EU9 A;  4DX6 D;  4YDW A;  2FUL A;  4I6G A;  4F3V A;  4B8C B;  4EZK A;  3Q73 A;  3FU3 A;  2GW1 A;  3TXN A;  2UWJ G;  3UXG A;  3DPY A;  3TWT A;  2AJA A;  1MX4 A;  4OVV A;  3HVE B;  3RSE G;  3G2S A;  3VLF A;  3B13 A;  2IQC A;  4G8K A;  3SBT B;  5AYW D;  3ENE A;  4KZC A;  1SQM A;  3SFX A;  2A5U A;  3UTM A;  2WXN A;  3KSL A;  4LNG A;  4I2W A;  3MJW A;  3Q15 A;  3FWV A;  4U0S A;  4U7E B;  4LRZ A;  2EQX A;  2YQ8 A;  1N11 A;  3MV2 B;  4CT0 A;  4AVX A;  3Q5M A;  3NOG D;  1YA0 A;  2ZGG A;  1L5J A;  2QY7 A;  3TWW A;  3Q78 A;  2KBX A;  2P9U G;  4CGW A;  1TNB A;  1ZU2 A;  2I1K A;  3SNX A;  2WXL A;  3L16 A;  2H6F A;  4HBD A;  3FH8 A;  2HYZ A;  3ML8 A;  4R7L A;  4OVU A;  2Y69 E;  3IKO B;  1XNF A;  5AQ7 A;  5ARF A;  1KZP A;  3ZN3 A;  2V5F A;  1U3D A;  5BT1 A;  1U3C A;  4Q94 A;  4GYW A;  3LJN A;  3S7F A;  1HE8 A;  4TRQ A;  2R2L A;  3KSQ A;  2QZA A;  3FTZ A;  2WPV A;  4ANV A;  4KZ0 A;  5E75 A;  3FP3 A;  5AAO A;  1VDY A;  4JXT A;  1Z5S C;  4U0Z A;  3HYM B;  4G23 A;  4WAF A;  3ZIM A;  2WVI A;  5KBA A;  2WXQ A;  3MYV A;  4GPK A;  2XPY A;  4FJY A;  4DX1 A;  2BED A;  3QWV A;  5EX0 A;  1E8Y A;  1O5M A;  4CDR A;  2WQH A;  3ZYM A;  4C48 B;  3NQP A;  3RRM B;  4G25 A;  3SF4 A;  3RRU A;  3EIQ C;  4AOF A;  2EIN E;  3CEQ A;  2VGY A;  4JEH A;  5JHA A;  3PVL A;  3V2X A;  5LFA A;  2KZT B;  3ASN E;  2M63 A;  3ZKJ A;  3P1U A;  3ASG A;  3BU8 A;  3PRZ A;  3DPD A;  2IOS A;  1DC2 A;  1KZO A;  3L6A A;  4B0Z A;  4IN3 B;  2KCV A;  4N3C A;  3DWL G;  2GRM A;  4AY6 A;  4M3O A;  1HS6 A;  4TXP A;  4BX9 A;  1UOH A;  3QJZ A;  3K9I A;  4JHJ A;  2YHE A;  3EHN A;  3QWP A;  3CKC A;  2KAT A;  3J5P A;  3DRA A;  3UT7 A;  3CVP A;  3RKV A;  5KWD A;  2CHX A;  3MZL B;  1EYH A;  3Q9N C;  3PZ2 A;  3LXU X;  3SO8 A;  1DCE A;  3ESL A;  1NL4 A;  1H6P A;  1FPP A;  1Y6I A;  3Q49 B;  3EDT B;  3PH0 C;  3PRE A;  5ENP D;  4GML A;  4RSY A;  1AP7 A;  4I2Z A;  3UI2 A;  3C3Q A;  2E2E A;  5FWQ A;  3TL5 A;  1ELR A;  3JUI A;  1IYG A;  2C2L A;  5JJ6 A;  4IYP A;  4Q69 A;  4I6E A;  1UJJ A;  2Y0B G;  4FLB A;  5J08 A;  4M7C A;  4B8A A;  2I6H A;  4BES A;  3DSX A;  5D0Q D;  4HNA D;  3D9K A;  5CRV A;  1HG2 A;  4AP2 A;  1LTX A;  3LPZ A;  3FTS A;  2IEJ A;  4QFV A;  5FTP A;  1A17 A;  5B3S E;  5EYP F;  4PDX A;  5JHB A;  4AV7 A;  1TNO A;  5B1A E;  3C5R A;  1O1T A;  2YIN A;  4N3B A;  1OXJ A;  3SZ7 A;  2VSY A;  4U63 A;  1RW2 A;  3MKR A;  1TNY A;  2NSZ A;  4TV3 A;  5B1B E;  2KCK A;  4UWH A;  1HG5 A;  4J6I A;  1EPU A;  4E85 A;  1H2V C;  4LCT A;  3AU5 A;  1H6O A;  3CV0 A;  3UIP C;  4CCA A;  1HU3 A;  2J4D A;  3SY2 A;  4DK5 A;  4PS8 A;  1HH8 A;  4LEU A;  3RAU A;  3O4Z A;  4HRM B;  5AN8 A;  3P2B A;  4GAA A;  3E37 A;  4DX2 A;  4UWK A;  2GRO B;  4O6F A;  1SA4 A;  5FZQ A;  4GA0 A;  4APF A;  3QAQ A;  3ZYL A;  1N52 A;  4GZ3 A;  4C0M A;  2XGO A;  4MLP A;  3I4G A;  1Z3Y A;  1WAO 1;  2WXO A;  3B95 A;  2NYJ A;  5BXU A;  2ZIR A;  3G2T A;  3DSU A;  3B7R L;  4MS6 A;  2DZO A;  1OT8 A;  4F7A A;  4ATZ D;  1TN6 A;  1K1B A;  3MX3 A;  2DYS E;  4ILG A;  1H2T C;  1IQR A;  3CK9 A;  2PM6 A;  5EIB E;  1O1R A;  1AWC B;  1N94 A;  3ZYQ A;  1N4Q A;  1HF8 A;  2V8S E;  3LY9 A;  2OCC E;  3ISM C;  4U04 A;  4CT4 A;  4BTA A;  3Q7F A;  3ZVV A;  3ZW3 A;  4D10 C;  3AG4 E;  3G2W A;  3PZ4 A;  4XX5 A;  3F6Q A;  1JCS A;  5ENO D;  2LSU A;  4I43 A;  1TYQ G;  4K5A B;  1N4P A;  2FO1 E;  4WUY A;  1B89 A;  4BY6 A;  3LS8 A;  4PH4 B;  3C98 A;  2EIJ E;  4A3T A;  3JCK C;  2FEZ A;  2L6J A;  2PZI A;  5FQ8 A;  3DSW A;  2QYU A;  4BT8 A;  4EZJ A;  3OTN A;  2LNI A;  3PUK A;  4KVO A;  4ACK A;  5C2Y A;  2L0T B;  4N5Q A;  3GW4 A;  1MJ0 A;  5CHE E;  3Q75 A;  3ABK E;  1IKN D;  4HOT A;  4JHR A;  3E33 A;  3APD A;  2R03 A;  3WXX A;  4UQZ A;  2BF0 X;  3L54 A;  3PZ1 A;  4GCO A;  1PAQ A;  4U0U A;  1E8Z A;  5ENQ D;  5DBK A;  2ZIS A;  3ZPJ A;  4J8S A;  5AIJ A;  1ELW A;  3D9H A;  4WND A;  3E30 A;  1FVF A;  4G11 A;  2LAH A;  4CGV A;  3MKQ B;  3OAW A;  4N5C A;  3HXB A;  3NB2 A;  3R7R A;  4JD2 G;  3RJV A;  2WXJ A;  1WY6 A;  2DCP A;  4LNU D;  3FUM A;  5ITZ F;  3FHE A;  2WB2 A;  4LER A;  3O48 A;  4F1S A;  4BSZ B;  1X5B A;  4W9R A;  3V31 A;  2OOE A;  1V54 E;  4GTM A;  2ETB A;  3ZXS A;  4FC8 A;  1D8D A;  2ILR A;  3AU4 A;  5AEN A;  5EKQ D;  4B94 A;  2AXV A;  1TNU A;  4BWR A;  2XRY A;  2P58 C;  2F0Y A;  3ABM E;  3TGO A;  5G2N A;  2CHW A;  2XZD G;  1TJF A;  3QDN A;  3ASH A;  1D8E A;  3LJ3 A;  1HO8 A;  1QBQ A;  3PZD A;  5A6C A;  2AXU A;  2OEV A;  5EN5 D;  4AY5 A;  1NFI E;  3D9L A;  3IV0 A;  4NQ0 A;  3UM0 A;  3T8K A;  5LOZ A;  3D9M A;  4YND A;  2A5E A;  4EBA G;  4URK A;  3CHO A;  4FJZ A;  5CER B;  1HFA A;  5KJK A;  2CFZ A;  2MOW A;  4X8Q A;  3MCX A;  3CK8 A;  4GZ6 A;  2H6G A;  3TWV A;  5KJM A;  5AJL A;  3FH7 A;  3L17 A;  3FU5 A;  3NAW A;  4AJW A;  5EDS A;  5CEC B;  2JEK A;  4DLQ A;  3LY7 A;  3NZS A;  4GZD A;  2AW6 A;  4JB8 P;  4MKT A;  2AWI A;  2XRZ A;  1QQE A;  5CBN A;  4N3A A;  5FT9 A;  2V5Q C;  3ZHE A;  2BTD A;  5KCM A;  3GZ1 A;  4K5C A;  4KVM A;  5FIO A;  3T5X A;  2RKK A;  3KAE A;  3FTV A;  4JL0 A;  5EYL A;  2QC9 A;  4I1A A;  3CLJ A;  1IHG A;  4HQD A;  3FUI A;  3QB2 A;  4CZ2 D;  5LX8 A;  3VLD A;  2R05 A;  3UKU G;  1SZ9 A;  1LD8 A;  3IHY A;  2KXP C;  4K5B A;  1LD7 A;  3JXJ A;  2L6B A;  4GCN A;  3G2V A;  4AXH A;  1TN8 A;  3CVV A;  3TG5 A;  4GYO A;  3HDX A;  1E96 B;  2XGS A;  2IO3 C;  2EIL E;  4A55 A;  4G2V A;  1PY1 A;  5CCL A;  4PS7 A;  3JXI A;  4L2Y A;  2H6I A;  3UT8 A;  3Q79 A;  5A7D B;  2WXM A;  4HXI A;  2WQ6 A;  3TG4 A;  2GRL A;  4I9E A;  5ENN A;  2X3M A;  2Y3A A;  3R9A B;  1H19 A;  4GU5 A;  4RG9 A;  4FU3 A;  3DSS A;  1G3N B;  3ASO E;  3T9K A;  4KMO A;  2OVB A;  5KJL A;  5ENS D;  4OYS A;  2CHZ A;  1N95 A;  5G04 C;  3ESK A;  2OND A;  3PDN A;  1OWM A;  1U2V G;  3LVQ E;  4I6J A;  4A1S A;  1EDU A;  4CEM A;  4UWL A;  2LXL A;  3LCA A;  5JMN D;  3C72 A;  4RLY A;  1K8K G;  4GTR A;  2GRP B;  3KS2 A;  3UT4 A;  3UX4 A;  3AS4 A;  3FH5 A;  5CEA A;  3ZUV B;  1UN9 A;  2WXK A;  3QOU A;  4ILH B;  2F8X K;  3HXD A;  1DVP A;  3KEA A;  4NRH B;  3ZXP A;  1A5E A;  4GPM A;  5BXO A;  4YVO A;  1UG3 A;  4P29 A;  5ANR A;  2QFC A;  4GTT A;  2I9C A;  3HIZ A;  2P2C P;  4XEI G;  4NUR A;  3C3R A;  4EEC A;  2MYO A;  3E32 A;  2LO6 A;  2BKG A;  3SD5 A;  3AG2 E;  3FEY A;  4JA7 A;  1QZ2 A;  3FUK A;  1OWN A;  4N39 A;  4LG6 A;  3UMV A;  3X2Q E;  3DSV A;  4WWN A;  4ANX A;  4DJA A;  3CSF A;  4FHK A;  1PC2 A;  3QNK A;  3FFL A;  5FQ7 A; 
#chains in the Genus database with same CATH homology
 4BSX A;  2LSU A;  4JC8 A;  4F3V A;  3D9J A;  4I43 A;  3QC1 A;  2NC9 A;  4KBQ A;  4B8C B;  4EZK A;  4WUY A;  2Y4T A;  5D0O D;  1B89 A;  4BY6 A;  4RVB A;  3FU3 A;  1INZ A;  4I1O B;  3CHM A;  3LS8 A;  2GW1 A;  3CQC B;  4PH4 B;  3C98 A;  3PEU B;  3TXN A;  2UWJ G;  4A3T A;  4UWG A;  1SZA A;  4BFR A;  4JA9 A;  4TUU A;  4ILI A;  3JCK C;  2FEZ A;  2L6J A;  3QKY A;  4C9B B;  4OVV A;  2PZI A;  3HVE B;  5FQ8 A;  2YNQ A;  2WXI A;  1JPL A;  3G2S A;  4ANW A;  2XCB A;  4XZ4 A;  3VLF A;  4BT8 A;  4JVS A;  3B13 A;  4EZJ A;  3OTN A;  2LNI A;  2IQC A;  4UWF A;  4DI4 A;  3URZ A;  3PUK A;  4KVO A;  1OUV A;  4ACK A;  5C2Y A;  1N54 A;  2VTB A;  2L0T B;  1E8X A;  2X38 A;  3GW4 A;  1MHQ A;  3ASD A;  3D9P A;  3SBT B;  1Z3X A;  1HX8 A;  3FUJ A;  3ENE A;  5CHE E;  5AYW D;  3FUD A;  1TEZ A;  4KZC A;  2L0I A;  5LP0 A;  4HOT A;  1SQM A;  2KM4 A;  2XCC A;  4JHR A;  2A5U A;  1E7U A;  2J49 A;  3FY4 A;  3APD A;  3I5P A;  2HM8 A;  3WXX A;  2WXN A;  4UQZ A;  3CVW A;  2BF0 X;  4I2W A;  3MJW A;  4L2L A;  3L54 A;  3PS6 A;  3MV3 B;  4GCO A;  1PAQ A;  3Q15 A;  3AS5 A;  4U0U A;  3FWV A;  1E8Z A;  4LUN U;  4U0S A;  4G26 A;  5DBK A;  3PUJ A;  1UN8 A;  2FBN A;  4I9C A;  4LRZ A;  1JUQ A;  3CVN A;  2EQX A;  2YQ8 A;  3ZPJ A;  1OWP A;  4J8S A;  5FZR A;  5AIJ A;  1ELW A;  1H2U A;  4WND A;  3MV2 B;  3VTY A;  4CT0 A;  4AVX A;  2JLB A;  3JQ1 A;  1FVF A;  3Q5M A;  4G11 A;  1YA0 A;  1MQS A;  5T3R A;  2LAH A;  1L5J A;  2QY7 A;  3T5V A;  4CGV A;  3MKQ B;  3OAW A;  4DPR A;  4UQY A;  4N5C A;  3GZS A;  3UQ3 A;  4EBA A;  4CGW A;  3R7R A;  1ZU2 A;  3RO3 A;  2I1K A;  3RJV A;  2WXJ A;  3SNX A;  2WXL A;  1WY6 A;  2DCP A;  4GYY A;  3CKB A;  3L16 A;  4WWP A;  3RIB A;  1OWO A;  4PS3 A;  3FUM A;  3FH8 A;  3SI5 A;  5G05 J;  2HYZ A;  1UJK A;  3FHE A;  3ML8 A;  4RG6 A;  2WB2 A;  4CDM A;  4R7L A;  4LER A;  4OVU A;  3L13 A;  3O48 A;  4F1S A;  3ASF A;  3IKO B;  1XNF A;  2WQ7 A;  5ARF A;  4FA6 A;  3PEV B;  1IQU A;  3ZN3 A;  1LF8 A;  2V5F A;  2IFU A;  4G1T A;  2R5S A;  3APF A;  1X5B A;  4XE0 A;  5T4Y A;  2IF4 A;  1HZ4 A;  4W9R A;  4FP7 A;  1U3D A;  5BT1 A;  1U3C A;  2OOE A;  3ZGQ A;  1ELK A;  4Q94 A;  3Q47 B;  5E76 A;  4GYW A;  2MRI A;  3TJP A;  4FC8 A;  3ZXS A;  3LVR E;  4BT9 A;  3PE3 A;  2ILR A;  3AU4 A;  3S7F A;  5AEN A;  1QNF A;  1HE8 A;  4TRQ A;  5EKQ D;  3CK7 A;  4B94 A;  4U8H A;  3N71 A;  4J0U A;  2AXV A;  2KCL A;  4JW1 A;  4HVB A;  3FTZ A;  3FUH A;  4L23 A;  4FUL A;  3AS8 A;  2WPV A;  4ANV A;  4BWR A;  2XRY A;  2Q7F A;  4KZ0 A;  5E75 A;  2P58 C;  3FP3 A;  2RD0 A;  4JPS A;  5M72 A;  1VDY A;  5JJ7 A;  4JXT A;  3TGO A;  4N2S A;  4L7T A;  2GGF A;  5G2N A;  3CST A;  2CHW A;  4WNG A;  4EQF A;  4U0Z A;  3HYM B;  4G23 A;  4WAF A;  2WM9 A;  3ZIM A;  2WVI A;  3CR3 A;  2WXQ A;  1NZN A;  3MYV A;  3D9O A;  2XQ0 A;  1KT1 A;  1TJF A;  3QDN A;  3R7Q A;  5LCW J;  4GPK A;  2I2O A;  2XPY A;  3ASH A;  4FJY A;  2WMN A;  3LJ3 A;  4YVQ C;  3QWV A;  3VLE A;  3L08 A;  1E8Y A;  1HO8 A;  5EX0 A;  2WQH A;  3ZYM A;  4CDR A;  3PZD A;  3FUN A;  5A6C A;  4I1M A;  2VGX B;  1OWL A;  2AXU A;  2VSN A;  5BUZ A;  3PNL B;  4A3V A;  1H6K A;  5BPP A;  1Y8M A;  2WXG A;  3D9N A;  4AY5 A;  3NQP A;  2C0L A;  3RRM B;  5ARG A;  2RG8 A;  4G25 A;  3SF4 A;  4AIF A;  1TJC A;  3RRU A;  4EPZ A;  3D9L A;  4UI9 J;  3IV0 A;  4NQ0 A;  4A1G A;  5BW8 C;  3EIQ C;  4AOF A;  3RU0 A;  2CG3 A;  3CEQ A;  2HR2 A;  2VGY A;  4JEH A;  2XEV A;  4ATG A;  5LOZ A;  5JHA A;  3FDH A;  3E4B A;  3PVL A;  3D9M A;  4YND A;  3CQG B;  2OVF A;  4EBA G;  5LFA A;  3SHF A;  2KZT B;  4WNF A;  3CHO A;  4FJZ A;  2I1J A;  5G04 J;  4URK A;  2M63 A;  4MRU A;  3P1U A;  5ANL A;  5DIZ A;  4EZL A;  3ASG A;  3PRZ A;  2YHC A;  1HFA A;  3DPD A;  2IOS A;  5KJK A;  2CFZ A;  2MOW A;  3L6A A;  4B0Z A;  1EF1 C;  3ZRH A;  4B89 A;  4IN3 B;  3MCX A;  2KCV A;  2J08 A;  3CVL A;  3CK8 A;  4N3C A;  4GZ6 A;  2GRM A;  2VSX E;  3LKU A;  3NF1 A;  5AJL A;  5KJM A;  4AY6 A;  2IOL A;  4M3O A;  3FUF A;  1DNP A;  1HS6 A;  3S7J A;  3FH7 A;  3SFZ A;  3L17 A;  2OV8 A;  3FU5 A;  4ME2 A;  3ZFW A;  4GMJ A;  4AJW A;  4J8D A;  5EDS A;  4BX8 A;  4BX9 A;  2JEK A;  4DLQ A;  3LY7 A;  3NZS A;  4GZD A;  3ONL A;  2AW6 A;  3BEE A;  3QJZ A;  2AWI A;  4MKT A;  2WMO A;  4Q96 A;  5EX3 A;  5A23 A;  2XRZ A;  1QQE A;  5KJN A;  2PL2 A;  3K9I A;  4N3A A;  5FT9 A;  3ZHE A;  4JHJ A;  2YHE A;  2BTD A;  3EHN A;  5KCM A;  3GZ1 A;  3QWP A;  3G2U A;  4KVM A;  4KT6 B;  2WXR A;  3CHR A;  3CKC A;  2KAT A;  3U3W A;  3T5X A;  4JHK A;  3UT7 A;  3CVP A;  3FTV A;  3KAE A;  3LDZ A;  4JL0 A;  4WNE A;  3RKV A;  2UY1 B;  2KZT A;  2CHX A;  2XPZ A;  4HOU A;  5CMW A;  4AEZ C;  3MZL B;  2VYI A;  1EYH A;  3CVX A;  4I1A A;  4AM9 A;  2KC7 A;  3CLJ A;  1IHG A;  3LXU X;  1FVH A;  4GZC A;  1Z6T A;  2WXH A;  1FCH A;  2X6K A;  3ESL A;  3FUI A;  3QB2 A;  4JZY A;  3VLD A;  5AJD A;  3ZEF A;  1E8W A;  5LX8 A;  3FEX A;  4E6H A;  3D3M A;  1SZ9 A;  3D9I A;  1Y6I A;  2IU1 A;  2HO1 A;  1JWF A;  2DIW A;  2BUG A;  3HVE A;  3Q49 B;  2XPI A;  3IHY A;  3CHP A;  3MA5 A;  3EDT B;  3PH0 C;  3PRE A;  4GML A;  4RSY A;  4GCN A;  3G2V A;  4I2Z A;  4AXH A;  4XI9 A;  3QAR A;  3CVV A;  3S7B A;  2E2E A;  5FWQ A;  5BV0 A;  3KD7 A;  3TG5 A;  4GYO A;  4HOS A;  2X6J A;  2J09 A;  3TL5 A;  3HDX A;  1ELR A;  3JUI A;  1E96 B;  2XGS A;  3ZHE B;  1IYG A;  2C2L A;  4GZ5 A;  4A55 A;  4G2V A;  4HOR A;  3CVQ A;  4V3I A;  5JJ6 A;  2A4Z A;  4IYP A;  1PY1 A;  4IUL A;  4Q69 A;  1NA3 A;  2VQ2 A;  5CCL A;  4H7X A;  4PS7 A;  4L2Y A;  4I6E A;  2PQR A;  2XHE A;  3TAX A;  3UT8 A;  5A7D B;  2WXM A;  4N2Q A;  3B7S A;  1UJJ A;  2FF4 A;  4PUC A;  4HXI A;  2WQ6 A;  3TG4 A;  2R17 C;  2GRL A;  4FLB A;  5J08 A;  4I9E A;  2FI7 A;  5ENN A;  2X3M A;  2Y3A A;  4K0R A;  2AXZ A;  3U64 A;  4B8A A;  2I6H A;  3I3N A;  3R9A B;  2E0I A;  4Y6C A;  1H19 A;  2FO7 A;  3JQ0 A;  2R59 A;  3IBE A;  4GU5 A;  1NP7 A;  5D0Q D;  4RG9 A;  3D9K A;  5J90 A;  4FU3 A;  1HG2 A;  4AP2 A;  3ULQ A;  1E7V A;  3CHS A;  3FTS A;  3IHV A;  3LPZ A;  4J8F A;  4U07 A;  3SBS A;  2X6H A;  4QFV A;  5FTP A;  3FTY A;  3HHM A;  4KMO A;  4DLO A;  1A17 A;  2J07 A;  3BG1 B;  3PE4 A;  3I4R B;  2OVB A;  4PDX A;  4UI9 C;  5JHB A;  5KJL A;  3OXG A;  3U4T A;  4AV7 A;  4I17 A;  5CMY A;  3MEK A;  2YIN A;  3EIJ A;  2CHZ A;  4OYS A;  4XI0 A;  4N3B A;  2VGX A;  5G04 C;  2C0M A;  2J9Q A;  3ESK A;  3SZ7 A;  2OND A;  2VSY A;  4FHJ A;  4U63 A;  3MKR A;  3PDN A;  3ONK A;  4HS2 A;  3FUL A;  3FTU A;  1OWM A;  3GYZ A;  1GW6 A;  2NSZ A;  3S2A A;  2AVP A;  4TV3 A;  2DBA A;  3LVQ E;  3DBS A;  3T8M A;  4I6J A;  2KCK A;  4UWH A;  5HQ8 A;  1HG5 A;  4J6I A;  4F53 A;  4A1S A;  1EPU A;  4E85 A;  1EDU A;  1H2V C;  2Y4U A;  3QK0 A;  4KYO B;  1S0P A;  3KEZ A;  3VTX A;  4CEM A;  4LCT A;  3AU5 A;  4UWL A;  2LSV A;  1KT0 A;  4WWO A;  3Q4A B;  3CV0 A;  3RRN B;  3LCA A;  2NXP A;  2L9B A;  4CCA A;  4XKB A;  1HXI A;  1HU3 A;  2J4D A;  4NAC A;  3KS2 A;  5FQ4 A;  3UT4 A;  4HFG A;  2ION A;  3UX4 A;  4CDN A;  3AS4 A;  4G24 A;  3FH5 A;  4GA1 A;  1E90 A;  2PM7 A;  4DK5 A;  1UN9 A;  1P5Q A;  2WXK A;  3QOU A;  4PS8 A;  1HH8 A;  4LEU A;  5G55 A;  4H7Y A;  2IJG X;  3O4Z A;  4ILH B;  3P2B A;  4GAA A;  1WM5 A;  5C1D A;  2V4L A;  3FU0 A;  1DVP A;  3U66 A;  1ZBP A;  3LY8 A;  3TXM A;  3APC A;  4GA2 A;  4UWK A;  1UW4 B;  3PNT B;  4HOQ A;  2LAI A;  4O6F A;  5FZQ A;  4NRH B;  4C0E A;  3IEG A;  4GB9 A;  4FLH A;  5FZS A;  4GA0 A;  3U9W A;  4KXK B;  4K03 A;  2ZU6 B;  4APF A;  4DI3 A;  3CVY A;  3RO2 A;  3QAQ A;  3UPV A;  1W3B A;  4Y6W A;  4YVO A;  4JEU A;  2X6I A;  3ZYL A;  4HLE A;  1UG3 A;  3MGB A;  1NA0 A;  1N52 A;  4GZ3 A;  4P29 A;  3FU6 A;  4UI9 K;  2WXP A;  5ANR A;  1H0A A;  2QFC A;  4CRW A;  4C0M A;  2VJ8 A;  5HI7 A;  2I9C A;  2PQN A;  3HIZ A;  3JYS A;  4XIF A;  4ABN A;  2XGO A;  4MLP A;  2X6F A;  3EJN A;  1Z3Y A;  3I4G A;  1WAO 1;  5FJY A;  2WXO A;  2VTB B;  3MKQ A;  2WXF A;  3G2T A;  1BPO A;  3L22 A;  5BV1 A;  4FAD A;  4NUR A;  3B7R L;  4BTB A;  3CGH A;  3QWW A;  4MS6 A;  2MHK A;  4F7A A;  3MX3 A;  4EEC A;  3EHM A;  2UY1 A;  3OXL A;  4ILG A;  3UUX A;  2J4B A;  2LO6 A;  1H2T C;  3OXF A;  4ACL A;  4XKC A;  3SD5 A;  1IQR A;  4L1B A;  3CK9 A;  3FUE A;  3RK6 A;  3FEY A;  1JWG A;  4JA7 A;  3NZU A;  1QZ2 A;  2PM6 A;  5G05 C;  4UQX A;  4IRU A;  4APO A;  1XGW A;  3CHQ A;  3CIA A;  3ML9 A;  3ZYQ A;  3CVU A;  3FUK A;  4ANU A;  5LCW C;  3ZYK A;  1HF8 A;  1OWN A;  4N39 A;  3UMV A;  2V8S E;  3LY9 A;  3S7D A;  4U04 A;  2XGM A;  4J8E A;  3B7U X;  5FQ6 A;  2VSO E;  4WWN A;  4CT4 A;  3FTW A;  4ANX A;  3LEW A;  5BNW A;  5CCM A;  5JJT A;  3BG0 B;  1KLX A;  3FTX A;  4BTA A;  5T8I A;  4DJA A;  2CG2 A;  3LYA A;  3ZVV A;  2V0P A;  3B7T A;  3ZW3 A;  4D10 C;  3CSF A;  2CFU A;  3G2W A;  4XX5 A;  4FHK A;  3GZ2 A;  1PC2 A;  3QNK A;  2FUL A;  4I6G A;  3FFL A;  5FQ7 A;  3SGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...