2NC9A

Apo solution structure of hop tpr2a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
131
structure length
131
Chain Sequence
b'ENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced-phosphoprotein 1
publication title Solution structure of the Hop TPR 2A domain and validation of novel approaches to inhibitor indentification by NMR, biochemical and in silico screening
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 49
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nc9A00
1YA0A 4UI9J 2Q7FA 1P5QA 3AS4A 4N3BA 3RO3A 4I9CA 5CCLA 4BWRA 3K9IA 2KCKA 4AY6A 3O48A 3ZPJA 3QWWA 4LEUA 4N2QA 4IN3B 4G2VA 3S7FA 2FO7A 4YNDA 4GYWA 3MKRA 3QKYA 4GZ5A 1QZ2A 2HYZA 4J8EA 2VGXB 1PC2A 4JHRA 3AS8A 3AS5A 3SF4A 5A6CA 4I2ZA 3S7DA 2R5SA 3QOUA 3TG4A 5KJNA 5KJLA 2FF4A 3LKUA 2UY1B 4GZ6A 2JLBA 3CKBA 3RJVA 4H7YA 4G26A 4XI0A 1NA0A 3QDNA 5G04J 4ME2A 3Q49B 3LY8A 3UUXA 3TG5A 5JJTA 3CVNA 5D0QD 3ZHEA 3E4BA 3OXFA 4YVQC 2LNIA 2Y4UA 2AVPA 2WPVA 3ZFWA 2PQNA 5BW8C 4HOTA 3BEEA 1ZBPA 1Y8MA 3RU0A 4GA0A 2XPIA 4HOUA 4ABNA 5DBKA 4U0SA 5KJKA 3QWPA 1IHGA 4N3AA 2VYIA 2E2EA 3VTYA 1ELWA 2FEZA 4NRHB 4GCNA 3FFLA 3CK8A 4RG9A 4H7XA 3KS2A 5G05J 5CHEE 3LCAA 3TAXA 1HZ4A 2XEVA 5AYWD 5FZQA 2J9QA 3TGOA 3CKCA 4XIFA 4EQFA 3PE4A 2IFUA 4G24A 5A7DB 4U04A 2PQRA 1QQEA 3RO2A 2PZIA 4J8FA 3PDNA 4N3CA 4Y6WA 4GYYA 1IYGA 1WAO1 2VGXA 5KJMA 2MHKA 2LSVA 2BUGA 4UI9K 5EX3A 2V5FA 1NA3A 4UI9C 2XCCA 2UY1A 5JJ6A 3FP3A 5BT1A 2KATA 3EDTB 3CK7A 3MA5A 3ZN3A 3CK9A 4WUYA 4I2WA 2KCVA 3QWVA 4HORA 4HOQA 4KBQA 4Y6CA 4N39A 2WQHA 3GYZA 3PE3A 4UQYA 1NZNA 4J8DA 2FI7A 5JJ7A 2HO1A 4HOSA 2HR2A 5CCMA 5ARGA 4BTBA 5LCWJ 1A17A 2LSUA 2VSNA 4G23A 4A1SA 4WNGA 2XCBA 4U0ZA 4WNDA 4XI9A 3CEQA 3KD7A 4GCOA 1E96B 3ASHA 4JA7A 4BT9A 3FWVA 3SZ7A 1OUVA 2ONDA 3CV0A 4B94A 4RG6A 5ARFA 5HI7A 3ZGQA 4WNFA 1W3BA 4KXKB 2P58C 3RIBA 4CGWA 4JA9A 3CVPA 2KCLA 3JYSA 4I9EA 1FCHA 2I6HA 3GZ2A 3U3WA 4KYOB 5EX0A 2L6JA 1XNFA 5DIZA 3NF1A 2KC7A 4GZ3A 4CDRA 5M72A 2FBNA 2XGOA 5G05C 2IF4A 3S7JA 3N71A 4YVOA 1HH8A 3MEKA 4UQXA 5C1DA 3CVQA 4GA1A 3Q15A 4APOA 4AM9A 3GZ1A 2QFCA 5FT9A 2C0MA 5EKQD 2VGYA 3RKVA 1ZU2A 3UQ3A 4G1TA 4W9RA 5FZRA 3ASFA 3R9AB 1ELRA 4GPKA 4O6FA 2VSYA 4CGVA 4BTAA 3OXGA 3LY9A 3OXLA 3ESKA 1WM5A 2VQ2A 4AIFA 2YQ8A 2GW1A 3S7BA 2YHCA 3IEGA 4N2SA 5BNWA 3LPZA 2DBAA 1KT0A 4U07A 3Q4AB 4GA2A 2OOEA 3ULQA 3U4TA 3MV2B 3CVLA 1TJCA 1KLXA 1B89A 4NQ0A 3ZHEB 4I1AA 3Q5MA 5FTPA 4JL0A 5G04C 5FZSA 3UPVA 3MV3B 4G25A 5FJYA 3LYAA 4N5CA 4UQZA 4WNEA 4BT8A 2C2LA 5HQ8A 4F3VA 2C0LA 4J0UA 3VTXA 2XGSA 2PL2A 3LY7A 1HXIA 3HYMB 1KT1A 3ASGA 2UWJG 5D0OD 2XGMA 2NC9A 3Q47B 4GYOA 3KAEA 2Y4TA 5LCWC 4U0UA 3URZA 3GW4A 4I17A 3WXXA 4AY5A 3ASDA
chains in the Genus database with same CATH superfamily
3I3NA 4UI9J 1TJFA 2F8XK 1N9AA 3RO3A 2B6CA 5EIDA 1H2VC 2RG8A 2KM4A 3FTYA 4N2QA 4V3IA 5ENSD 2M63A 4IN3B 3NOGD 4JC8A 3MKRA 4JHJA 4HI9A 1QZ2A 2HYZA 5BV0A 2VGXB 3EHQA 3ONKA 2Y1LE 3SF4A 3UKUG 3ENEA 2E0IA 1HE8A 4ANVA 1UG3A 2P9SG 2JLBA 4RVBA 3RJVA 4H7YA 4XI0A 4EECA 3JQ1A 5G04J 3Q49B 3ZVVA 3C98A 1JCRA 3UT8A 4JEHA 4EZKA 5KNHD 3LEWA 4OVVA 4PDXA 2LNIA 2Y4UA 2BKGA 2WPVA 3ZFWA 3KEZA 3CSTA 3DEPA 3SFZA 5KJKA 1WY6A 3FU6A 3CHOA 4N3AA 1X5BA 4PS8A 2IO3C 2FEZA 3FTUA 3FFLA 2OCCE 3PRZA 4GTPA 3AG1E 3DPDA 4XZ4A 4APFA 3FUNA 1Z3XA 5AQAA 2F0YA 2QYJA 3J5QB 5FZQA 2J9QA 3CKCA 3DSWA 3C3QA 2AXZA 2EIJE 2LXLA 3Q7FA 4GU5A 4CDNA 2XS1A 1YCSB 3JUEA 4BSXA 4UUCA 2NXPA 1QQEA 4GTTA 1EF1C 3CHPA 1BI8B 3V30A 1IHBA 1IYGA 3HXCA 2WQ6A 1WAO1 1K1BA 2WM9A 3NZUA 3TWTA 3EU9A 2LSVA 3UM3A 1EDUA 4UI9K 2WXQA 1RZ4A 2H6IA 2H6GA 2KZTA 3W9GA 1JWFA 2XCCA 2UY1A 4U8YD 5JJ6A 3FP3A 1SVXA 5BT1A 3ABKE 1O1RA 1FVHA 1S70B 3ZN3A 2DZOA 5AIJA 4J7WA 3Q9UC 1JPLA 3QWVA 2GGFA 4WAFA 5B1BE 5J08A 4HB5A 5AAOA 3T9KA 4RSYA 4J8DA 3V2XA 1DVPA 4C0EA 4HOSA 5ARGA 4U96D 1SZAA 1E7VA 2LSUA 3E30A 3F6QA 4A1SA 1N11A 2XCBA 3AU5A 4O60A 2VTBA 4U0ZA 4I6GA 4WNDA 3AAAC 2XPZA 1OWNA 4A63B 1OUVA 4B94A 3PH0C 2XZDG 4ILGA 1U3DA 5BXUA 4KXKB 4DX7D 2VSOE 3CVPA 3JYSA 4EZJA 3QB2A 2VGEA 3ZRHA 2LUHA 5CRVA 4HVBA 3BUAA 3SO8A 2L6JA 3HXEA 3LVQE 4PH4B 4OAUC 2GRMA 2X6FA 4DJAA 3D9OA 5M72A 3I5PA 1FVFA 4O1PA 5IY5E 3HXDA 3G2SA 3TXMA 4B0ZA 3S7JA 3JXJA 2CG2A 1SQMA 4YVOA 3VLDA 2NYJA 3CVQA 2WXLA 1A5EA 3Q15A 1HG2A 4APOA 2XS8A 3EIQC 3BQOA 4JW1A 3UQ3A 1D9SA 2QZAA 3B7UX 4PS3A 4MKTA 3JXIA 3FH7A 1INZA 1N4RA 2RD0A 4GPKA 3FUJA 3L13A 4I6JA 4O6FA 1N52A 2GRLA 4DRXE 2P9KG 3CIAA 4BTAA 4Q69A 2V4HC 3OXGA 3ESKA 3ZKJA 4ZHBA 3AG4E 3S2AA 4AIFA 2YQ8A 2V0PA 3J5PA 2GW1A 5EYLA 3SY2A 3S7BA 4HXIA 5BNWA 5H7PA 2WVIA 3ASOE 2DZNA 2IONA 3U4TA 3MV2B 4R7LA 1TJCA 2DIWA 3ESLA 5E75A 4NQ0A 2I1JA 5G04C 5ENRD 4G25A 3LYAA 3KSQA 3PEUB 4N5CA 3QJZA 5KNGA 1LD7A 5HQ8A 4A3VA 3B7BA 3MYVA 2J4BA 2PL2A 4ATZD 5FQ6A 3JQ0A 1HXIA 3HYMB 2UWJG 1HFAA 2XHEA 3Q47B 3IXEA 2J8SD 2Y4TA 2WXFA 2F8YA 1V54E 3OAWA 2MOWA 4CZ2D 4BESA 3DBSA 1TN7A 2X6JA 3T5XA 4L23A 3RSEG 3AS4A 3IV0A 3QC1A 3HHMA 2PNNA 4BWRA 1O5MA 1MQSA 4J6IA 3ZPJA 3AJIA 3ZEFA 3EUVA 1BD8A 4JD2G 3B7SA 4K5CA 5JMND 4E6HA 3L82A 1DCEA 3S7FA 1HO8A 3FU5A 4GYWA 3QKYA 3L54A 4GZ5A 5CBOA 2CHWA 1IQRA 2Y0BG 2R05A 1PC2A 4JHRA 3UM0A 3D9IA 3AS5A 5A6CA 2WXGA 2R5SA 3QOUA 3TJPA 1N95A 2R59A 4C0MA 2KZTB 4MRUA 2L0IA 3EHRA 4JB8P 3UM2A 3EHMA 1MHQA 5KJLA 4I43A 2UY1B 3HXBA 4AEZC 1HF8A 3CKBA 4KVMA 3IBEA 4XKBA 4XEIG 1BI7B 2R03A 1LF8A 4I1OB 3FTWA 3UUXA 4UWHA 2GRRB 5JJTA 3LXUX 1ZB1A 3ZXSA 3ZXPA 3CVNA 2J07A 4L1BA 5D0QD 3PREA 3ZHEA 1U3CA 2BEDA 1E8XA 4YVQC 3UT7A 3JCKC 4XKCA 5FQ8A 2PQNA 4ACLA 1Y8MA 3FEYA 3ULEG 4GZDA 4GA0A 3DXMG 1TNBA 1X81A 4HOUA 5DBKA 4U0SA 3U64A 3R9MA 3QWPA 4ILIA 1UW4B 2VYIA 2E2EA 3CVUA 2QC9A 2VTBB 3IKOB 4NRHB 4GCNA 3V79K 2MRIA 4ATGA 1MX4A 3CK8A 3TWQA 3KS2A 1N4PA 5CMWA 3TAXA 4GTRA 4HRLA 3G2WA 3CR3A 4CDMA 2QY7A 2ZGDA 3UX4A 3FUFA 4OVUA 5C2YA 1OWMA 2AW6A 1TNUA 5A7DB 4U04A 4BETA 5AARA 5CBNA 4B8CB 2OEWA 4G11A 3FU3A 4DX6D 5AQ7A 3RO2A 1UOHA 5CECB 3DSUA 3NBNB 3L08A 3Q7AA 3UTMA 2OV8A 3TWSA 1V55E 5T3RA 5JHBA 3B13A 4K0RA 5EX3A 4KZCA 2DYRE 1BLXB 5EIBE 4TUUA 4GTVA 1HS6A 2X3MA 3PS6A 1BPOA 4I1MA 1H19A 4GPMA 4EHMA 1KPSB 4IYPA 3EDTB 3CK7A 4J8SA 3ZIMA 3PZDA 4JHKA 3NOCD 2VJ8A 3MA5A 5CEDB 3KSLA 3WG7E 1ELKA 4GMLA 2P9NG 4YDOA 5BUZA 2LAIA 1TNYA 1Z3YA 1KZOA 3SD5A 4HOQA 3L22A 4HS2A 2IOLA 2WXRA 2ZGGA 2FULA 4F7AA 1HX8A 4N39A 3D9JA 4JEUA 3QARA 3APDA 2HO1A 2H6FA 2HR2A 2WXJA 2QYUA 1A17A 3NB2A 4G23A 4WNGA 5T8IA 4UWGA 4FJZA 3FHEA 4DX5D 3ONLA 2L6BA 2DCPA 4DLQA 1TEZA 1H6PA 5ENNA 3FWVA 5KWDA 3ZGQA 4GB9A 2CFUA 1W3BA 3RIBA 4CGWA 2KCLA 3APCA 3UI2A 3KEAA 3NAWA 1FCHA 3DPYA 2ILRA 3UIPC 3FY4A 5JA4D 4UWLA 3ASNE 4KYOB 3ZW3A 3FTVA 1NFIE 3HDXA 3DSVA 1XNFA 4QFVA 3NF1A 2PM7A 4TXPA 3SQVA 3L16A 3P1UA 4BFRA 5AJLA 4HI8A 4Q94A 2XQ0A 4KVOA 3ML8A 4C48B 4UQXA 4HBDA 4WWOA 5C1DA 5BV1A 3PEVB 3CLJA 3UKRG 4HRMB 1DC2A 3ISMC 4AM9A 3GZ1A 2QFCA 2WB2A 4TUMA 4XX5A 2LO6A 4A1GA 4L2LA 4M3OA 2VGYA 1MX6A 1ZU2A 1TNOA 2RFMA 4BX9A 4AJWA 3Q79A 5FINA 4L7TA 5FZRA 3ASFA 4FLHA 4ILHB 3R9AB 5G2NA 1N4QA 2WXNA 3E34A 4GAAA 2CG3A 4CGVA 4LCTA 2R02A 1OT8A 1IKND 5B1AE 4GTOA 3T5VA 2GRPB 4N2SA 4TV3A 1KT0A 1S63A 3T8MA 3ULQA 4RQIA 4F1PA 3SFXA 1K3ZD 3R7RA 4URKA 2LAHA 1B89A 3ZHEB 3GZSA 4TXRA 4JL0A 5ITZF 1UN9A 5FZSA 3MV3B 3D9PA 5HS0A 5FJYA 3HVEB 3MJWA 4UQZA 4WNEA 5CEAA 4YDYA 2KBXA 3L17A 3HRAA 1SZ9A 3LJNA 2JEKA 3VTXA 2XGSA 4BEPA 5FIOA 2ZISA 4A3TA 2XGMA 1OCZE 1FT2A 3LDZA 4A55A 4U0UA 3IHYA 3ZYQA 3UMVA 3GW4A 4CYMD 3WXXA 1YMPA 3PNLB 5FWQA 1YA0A 2MYOA 2R17C 1P5QA 3RRMB 4N3BA 3HXFA 4U8VD 1L5JA 2P9UG 2KCKA 4AY6A 4LSZE 3QWWA 5LFAA 4DX2A 4LUNU 2I1KA 2FO7A 3C3OA 3SGHA 3CVYA 3FU0A 4O1OA 4HRNA 5D66A 3DEOA 3AS8A 2EQXA 3S7DA 5LOZA 4DI3A 3E37A 5ENQD 4AV7A 4JPSA 3CGHA 5KJNA 1EPUA 4FA6A 2FF4A 3LKUA 4GZ6A 3FUKA 3ABLE 4G26A 4Z68A 4GMRA 5FQ7A 2J08A 4L2YA 2EILE 4ANWA 3P2BA 4JZYA 1G3NB 2J49A 4P29A 2ZIRA 1ZBPA 3VLFA 4EBAA 3RU0A 1IHGA 4JXTA 4K03A 4MLPA 1MYOA 5AJDA 4TXQA 3U9WA 3VTYA 1OWLA 4J8YA 4OAVB 4XE0A 3QAQA 3C5RA 3FH5A 1NI1A 3Q73A 4H7XA 3SHFA 5CHEE 5ANLA 3C3RA 1HZ4A 3R7QA 1K1AA 5AQBA 2FO1E 2WXOA 1H6KA 4XIFA 3RAUA 3B95A 2CHZA 3SBSA 3QNKA 4EQFA 3HG0D 4PS7A 2IFUA 4G24A 5CERB 2GROB 1OWOA 4HLLA 2XRYA 1H6OA 2PQRA 1Y6IA 3G2TA 1H2UA 2WXHA 3OTNA 5ANRA 2Y69E 3Q75A 3PDNA 2IO2C 4F1SA 1UJKA 2MHKA 1OCCE 1Q2ZA 1UN8A 2V5FA 4HLEA 3CVXA 2OVFA 1MX2A 5BPPA 4ANUA 2IEJA 2KATA 1D8DA 2HE0A 4LRZA 3ZYLA 2BTDA 4LNUD 5KBAA 1PAQA 1H2TC 3CQGB 4WUYA 2KCVA 3L6AA 4IULA 2P9PG 1TN8A 3PZ3A 2AWIA 2YHEA 4ZFHA 4QQIA 2WQHA 2XENA 3PE3A 3ZNGA 3FUEA 4UQYA 4BX8A 1NZNA 4UWFA 3RK6A 5CCMA 4FHKA 4DUIA 4GMJA 2VSNA 2YINA 1PY1A 3EU5A 5AENA 2GRNB 1O1SA 2X6HA 3D9HA 1OY3D 4XI9A 4K5BA 2DVWA 4GCOA 2XRZA 3ASHA 2WXKA 2BF0X 4JA7A 4BT9A 2WXIA 4RG6A 1JWGA 5HI7A 2P9IG 1SA4A 3FUDA 2P58C 4FLBA 1IXVA 3PZ1A 1S0PA 2IQCA 3SI5A 4D10C 2KXPC 2I6HA 4F53A 4DI4A 3GZ2A 2I9CA 2I2OA 5EX0A 4PUCA 1D8EA 3NQPA 3G2UA 5DIZA 3TWXA 4GZ3A 1N0QA 4KMOA 3CHSA 4ACKA 2FBNA 5G05C 1HH8A 3MEKA 1SW6A 3L9TA 5FT9A 4RLYA 3I4RB 5EKQD 4EBAG 1SA5A 5E76A 3BG1B 4G1TA 4FU3A 4W9RA 5AQ9A 1GW6A 2HM8A 3DSTA 2VSYA 5HKPA 4GZCA 3D9KA 3OXLA 3MKQA 1WM5A 2VQ2A 3PUKA 1JCSA 2YHCA 3IEGA 3LPZA 2EINE 3ZYKA 2DBAA 4U07A 3Q4AB 2OOEA 2V8SE 1N0RA 3T8KA 4GTSA 3O4ZA 3MZLB 1KLXA 1NP7A 3PVLA 3UINC 4I1AA 3Q5MA 5FTPA 1E8ZA 4DK5A 3UPVA 4WWNA 3PUJA 2P9LG 3FH8A 3D9NA 4BT8A 2C2LA 1NL4A 3PZ2A 2C0LA 3B7TA 3IHVA 4J0UA 1FPPA 3B7RL 5CMYA 2X6KA 3LY7A 1KT1A 5D0OD 2Y3AA 4GYOA 4AOFA 5LX8A 2IY0C 5A23A 5LCWC 4HNAD 3V2OA 3URZA 1JUQA 3BU8A 3E32A 2ETAA 4I17A 4N5QA 3BG0B 4AY5A 3ASDA 2F37A 2Q7FA 2PM6A 3CHQA 1Z6TA 2L0TB 4I9CA 5CCLA 3SNXA 3K9IA 5ENPD 2OEVA 4OYSA 3O48A 4LEUA 3CVWA 2A5UA 2IU1A 3QK0A 1WDYA 5EDSA 4G2VA 1TR4A 2CHXA 4YNDA 4B89A 2R2LA 4HFGA 3NZSA 4K5AB 1O1TA 4J8EA 4FHJA 3TWRA 3CVVA 4M7CA 2NSZA 4NURA 1Z5SC 4I2ZA 4EZLA 3CHRA 1QNFA 3TG4A 4BERA 1EYHA 4B93B 4WWPA 1BU9A 1YYHA 3LVRE 1NA0A 5AN8A 2AXUA 1U2VG 3QDNA 4ME2A 3LY8A 3TG5A 3FTZA 3PZ4A 4MS6A 1E8YA 1K8KG 3ABME 4YDEA 3E4BA 3EHNA 1E7UA 3OXFA 4CRWA 2AVPA 3V31A 5BW8C 4HOTA 3W9FA 3BEEA 4U8HA 1RW2A 3HIZA 2XPIA 4ABNA 3MX3A 3TL5A 5ENOD 1HG5A 4TRQA 5KCMA 2VSXE 4IRUA 5JHAA 1ELWA 2WMOA 2A4ZA 3FTSA 3RRUA 5EILA 1VDYA 3PNTB 4G8KA 4RG9A 5G05J 3LCAA 4AVXA 3MCXA 2A5EA 1KZPA 2XEVA 2XEHA 5AYWD 2X38A 3AG2E 3TGOA 2BKKB 4FULA 4DLOA 3CHMA 4G8LA 1IQUA 3G2VA 3PE4A 3E33A 3D9LA 3FEXA 3LS8A 1N94A 1QBQA 3APFA 4FJYA 4B8AA 3AG3E 5EN5D 3Q9NC 1N4SA 2OVBA 2P2CP 2ETCA 2PZIA 4CCAA 4J8FA 2DWZA 4N3CA 4Y6WA 4FADA 4GYYA 5D2MC 1QYMA 1TN6A 2VGXA 5KJMA 3DXKG 1LTXA 4GTQA 2B0OE 3UIOC 1E90A 2BUGA 2XEEA 3EJNA 4JVSA 4MBGA 4CT0A 4CEMA 5BXOA 1NA3A 4UI9C 2WXPA 5G55A 2H6HA 3AU4A 3Q78A 4DPRA 3D9MA 4BSZB 1HU3A 4E85A 4FC8A 3CK9A 1OCRE 4I2WA 3DWLG 4UWKA 1N54A 1OCOE 4HORA 4HQDA 3SFYA 3UM1A 3MKQB 4KBQA 4Y6CA 3GYZA 4AXHA 2FI7A 5JJ7A 1H0AA 5ENTD 3MGBA 4BTBA 5LCWJ 1UJJA 1S64A 1FT1A 2WXMA 5T4YA 4LNBA 2WQ7A 1TNZA 3FUMA 3CEQA 3KD7A 1E96B 3I4GA 2WMNA 2RKKA 1AP7A 5J90A 3SZ7A 2ONDA 3CV0A 5ARFA 4WNFA 3FULA 4GTMA 4F6RD 4LERA 3ZU7B 4JA9A 3FUHA 1OWPA 1E8WA 4I9EA 2XZTG 3CSFA 1JCQA 3U3WA 5FQ4A 2KC7A 4X8QA 4CDRA 2ZXWE 2X6IA 2J09A 2XGOA 4KT6B 2IF4A 3UT4A 1MJ0A 2J4DA 3EIJA 3TWUA 1DCQA 2LXMA 3N71A 1DNPA 3FUIA 2ZU6B 4GA1A 4U7EB 4BY6A 1WG0A 2C0MA 4LNGA 4CT4A 2DYSE 2RFAA 3C72A 3RKVA 3SBTB 2GRQB 2XPYA 5HRYA 3JUIA 1TYQG 4DX1A 1MZCA 4Q96A 2AJAA 3RRNB 3U66A 1ELRA 4LG6A 3TXNA 4U63A 3TWVA 2IOSA 1XGWA 4FP7A 3ZYMA 2JABA 1OXJA 3CQCB 5EYPF 3VLEA 3LY9A 4KZ0A 5CRUA 3D3MA 3FTXA 4C9BB 4NACA 3TWWA 3DRAA 4GA2A 2EIME 2ETBA 3CVLA 3X2QE 2CFZA 2YNQA 5B3SE 2V4LA 4NIKA 3ULYA 4YDWA 3HVEA 3FDHA 4L9PA 4I6EA 3ML9A 4F3VA 3DSXA 2AXVA 1LD8A 2EIKE 2V5QC 4ANXA 2L9BA 3DSSA 2IJGX 3LJ3A 3ZUVB 3ASGA 4EPZA 2NC9A 4U95D 3KAEA 5LP0A 3UXGA 4AP2A 1AWCB
chains in the Genus database with same CATH topology
5FWQA 1YA0A 3I3NA 4UI9J 2X6JA 2Q7FA 2PM6A 1TJFA 3CHQA 3T5XA 1Z6TA 2R17C 1P5QA 3AS4A 2L0TB 3IV0A 3QC1A 4N3BA 4L23A 3RO3A 3HHMA 4I9CA 5CCLA 4BWRA 3SNXA 1L5JA 3K9IA 2KCKA 4AY6A 1H2VC 2RG8A 4OYSA 1MQSA 2KM4A 4J6IA 3O48A 3ZPJA 3QWWA 5LFAA 4LEUA 3ZEFA 3FTYA 3CVWA 4N2QA 4V3IA 2A5UA 2IU1A 2M63A 4LUNU 4IN3B 3B7SA 4E6HA 3QK0A 5EDSA 4G2VA 2I1KA 2CHXA 3S7FA 1HO8A 2FO7A 3FU5A 4JC8A 4YNDA 4B89A 4GYWA 3MKRA 3QKYA 4JHJA 3L54A 4GZ5A 3SGHA 4HFGA 3NZSA 1QZ2A 2HYZA 2CHWA 4J8EA 4FHJA 1IQRA 3CVYA 3FU0A 5BV0A 3CVVA 2VGXB 2NSZA 1PC2A 4JHRA 3ONKA 4NURA 3AS8A 3D9IA 3AS5A 3SF4A 5A6CA 2EQXA 4I2ZA 2WXGA 2R5SA 3QOUA 3S7DA 5LOZA 3ENEA 4DI3A 2E0IA 3TJPA 3CHRA 4EZLA 2R59A 1QNFA 3TG4A 4C0MA 1HE8A 4ANVA 1UG3A 2KZTB 4MRUA 4AV7A 4JPSA 3CGHA 5KJNA 1EPUA 2L0IA 4FA6A 3EHMA 1MHQA 5KJLA 2FF4A 3LKUA 4I43A 1EYHA 2UY1B 4GZ6A 1HF8A 2JLBA 3CKBA 3FUKA 4KVMA 3IBEA 4RVBA 4WWPA 4AEZC 3RJVA 4XKBA 4H7YA 4G26A 4XI0A 3LVRE 1NA0A 2AXUA 4EECA 3JQ1A 5FQ7A 3QDNA 5G04J 1LF8A 4I1OB 4ME2A 3Q49B 3LY8A 3FTWA 3UUXA 4UWHA 2J08A 4L2YA 3TG5A 3ZVVA 4ANWA 3FTZA 3C98A 5JJTA 3LXUX 3UT8A 4MS6A 3ZXSA 3P2BA 4JEHA 1E8YA 3CVNA 4EZKA 2J07A 4L1BA 5D0QD 3PREA 3ZHEA 3LEWA 1U3CA 3E4BA 3EHNA 4JZYA 4OVVA 1E7UA 3OXFA 2J49A 4CRWA 1E8XA 4P29A 4YVQC 4PDXA 3UT7A 2LNIA 2Y4UA 3JCKC 2AVPA 4XKCA 2WPVA 5FQ8A 3ZFWA 2PQNA 3KEZA 5BW8C 4ACLA 4HOTA 3CSTA 3BEEA 1ZBPA 4U8HA 3VLFA 1Y8MA 3FEYA 3RU0A 4GZDA 4EBAA 4GA0A 3HIZA 2XPIA 4HOUA 5DBKA 4ABNA 4U0SA 3SFZA 5KJKA 3MX3A 1WY6A 3FU6A 3U64A 3TL5A 3QWPA 1IHGA 4ILIA 4JXTA 3CHOA 4K03A 4N3AA 1HG5A 4MLPA 1UW4B 1X5BA 5AJDA 2VYIA 4TRQA 5KCMA 2VSXE 3U9WA 4PS8A 4IRUA 2E2EA 3VTYA 1OWLA 3CVUA 5JHAA 1ELWA 2WMOA 2A4ZA 3FTSA 4XE0A 2FEZA 3RRUA 2VTBB 3IKOB 3QAQA 4NRHB 4GCNA 3FH5A 3FTUA 3FFLA 1VDYA 2MRIA 3PRZA 3PNTB 4ATGA 3CK8A 3DPDA 4H7XA 4RG9A 3KS2A 4XZ4A 5G05J 3SHFA 4APFA 5CHEE 5ANLA 3LCAA 3FUNA 1Z3XA 5CMWA 4AVXA 3TAXA 1HZ4A 3MCXA 2XEVA 5AYWD 2X38A 5FZQA 2J9QA 3R7QA 3G2WA 3CR3A 3TGOA 3CKCA 4FULA 2AXZA 2WXOA 1H6KA 4GU5A 4XIFA 4CDMA 2QY7A 4DLOA 3CHMA 2CHZA 4CDNA 3SBSA 3QNKA 3UX4A 1IQUA 3FUFA 3G2VA 4PS7A 4OVUA 3PE4A 5C2YA 4EQFA 2IFUA 4G24A 1OWMA 2AW6A 5A7DB 4U04A 3D9LA 3FEXA 3LS8A 3APFA 1OWOA 4FJYA 2XRYA 4B8AA 4BSXA 2PQRA 1Y6IA 2NXPA 1QQEA 4G11A 3G2TA 4B8CB 1EF1C 3FU3A 1H2UA 2OVBA 3RO2A 2PZIA 3CHPA 2WXHA 3OTNA 5ANRA 4CCAA 4J8FA 3L08A 3PDNA 2OV8A 5T3RA 4N3CA 5JHBA 4Y6WA 4FADA 4GYYA 3B13A 1IYGA 2WQ6A 1WAO1 2VGXA 4K0RA 4F1SA 5KJMA 2WM9A 1UJKA 3NZUA 2MHKA 1E90A 2LSVA 2BUGA 3EJNA 4JVSA 1EDUA 4UI9K 2WXQA 4CEMA 4CT0A 5EX3A 2V5FA 1NA3A 1UN8A 4KZCA 4HLEA 2KZTA 4UI9C 2WXPA 4TUUA 3CVXA 1HS6A 5G55A 1JWFA 2X3MA 2OVFA 3PS6A 1BPOA 4I1MA 2XCCA 5BPPA 2UY1A 4ANUA 1H19A 3AU4A 5JJ6A 3FP3A 4DPRA 5BT1A 2KATA 3D9MA 4IYPA 3EDTB 1HU3A 3CK7A 4J8SA 4LRZA 3ZYLA 3ZIMA 1FVHA 3PZDA 4E85A 2BTDA 4JHKA 2VJ8A 3MA5A 1PAQA 3ZN3A 1H2TC 5AIJA 1ELKA 4FC8A 4GMLA 3CK9A 3CQGB 4WUYA 4I2WA 2KCVA 3L6AA 4IULA 5BUZA 2LAIA 4UWKA 1JPLA 1Z3YA 1N54A 3QWVA 4HORA 3SD5A 4HOQA 2GGFA 3L22A 4WAFA 3MKQB 4HS2A 2IOLA 2WXRA 2AWIA 2YHEA 2FULA 4KBQA 5J08A 4F7AA 1HX8A 4Y6CA 4N39A 2WQHA 3GYZA 3PE3A 3FUEA 4RSYA 4UQYA 4BX8A 1NZNA 4J8DA 4AXHA 1DVPA 2FI7A 3D9JA 5JJ7A 4UWFA 4C0EA 1H0AA 4JEUA 3QARA 3APDA 2HO1A 3RK6A 4HOSA 2HR2A 5CCMA 2WXJA 5ARGA 3MGBA 4BTBA 5LCWJ 4FHKA 1A17A 1SZAA 1E7VA 1UJJA 4GMJA 2LSUA 2VSNA 2YINA 4G23A 4A1SA 2WXMA 4WNGA 1PY1A 2XCBA 3AU5A 2VTBA 5AENA 5T8IA 4U0ZA 5T4YA 2X6HA 4UWGA 4FJZA 3FHEA 4I6GA 2WQ7A 4WNDA 3ONLA 4XI9A 2DCPA 3FUMA 3CEQA 2XPZA 4DLQA 3KD7A 4GCOA 2XRZA 1TEZA 1E96B 3I4GA 3ASHA 5ENNA 2WMNA 2WXKA 1OWNA 2BF0X 4JA7A 4BT9A 3FWVA 5J90A 3SZ7A 1OUVA 2ONDA 2WXIA 3CV0A 3RRMB 4B94A 4RG6A 3PH0C 1JWGA 5ARFA 5HI7A 4GB9A 4WNFA 3FULA 4ILGA 2CFUA 3ZGQA 1U3DA 1W3BA 3FUDA 4KXKB 4LERA 2P58C 4FLBA 3RIBA 4CGWA 2VSOE 4JA9A 3FUHA 1OWPA 3CVPA 2KCLA 3JYSA 4EZJA 3QB2A 3APCA 1E8WA 1S0PA 4I9EA 3ZRHA 1FCHA 3CSFA 2IQCA 3SI5A 4D10C 2ILRA 2I6HA 4F53A 3FY4A 4DI4A 4HVBA 4UWLA 3GZ2A 3U3WA 2I9CA 4KYOB 3HDXA 2I2OA 3FTVA 3ZW3A 5EX0A 2L6JA 4PUCA 3LVQE 5FQ4A 4PH4B 1XNFA 3NQPA 4QFVA 2GRMA 2X6FA 3G2UA 5DIZA 3NF1A 2KC7A 4GZ3A 4CDRA 2PM7A 3L16A 4DJAA 3D9OA 3P1UA 5M72A 3I5PA 4KMOA 1FVFA 2X6IA 4BFRA 5AJLA 3CHSA 4ACKA 2J09A 4Q94A 2FBNA 2XGOA 2XQ0A 3G2SA 4KT6B 5G05C 2IF4A 3UT4A 4KVOA 2J4DA 3TXMA 3EIJA 4B0ZA 3S7JA 3ML8A 3N71A 2CG2A 1DNPA 1SQMA 4YVOA 1HH8A 3MEKA 3VLDA 3FUIA 4UQXA 4WWOA 3CVQA 2WXLA 5C1DA 2ZU6B 4GA1A 3PEVB 3Q15A 5BV1A 3CLJA 1HG2A 4APOA 4AM9A 3GZ1A 2QFCA 5FT9A 2WB2A 3EIQC 4BY6A 2C0MA 4XX5A 2LO6A 4CT4A 3I4RB 4L2LA 5EKQD 4M3OA 4A1GA 2VGYA 4EBAG 3RKVA 3SBTB 1ZU2A 4BX9A 2XPYA 5E76A 4AJWA 4JW1A 3UQ3A 3JUIA 3BG1B 4G1TA 4FU3A 4L7TA 3B7UX 4PS3A 4W9RA 5FZRA 4MKTA 3ASFA 4FLHA 3FH7A 1INZA 4ILHB 4Q96A 1GW6A 3U66A 2RD0A 3R9AB 3RRNB 2HM8A 1ELRA 4GPKA 3FUJA 3L13A 4I6JA 1N52A 2GRLA 2WXNA 4GAAA 4O6FA 4U63A 5G2NA 3TXNA 2IOSA 2VSYA 3CIAA 1XGWA 2CG3A 4FP7A 3ZYMA 4GZCA 4LCTA 4CGVA 4BTAA 4Q69A 3OXGA 3CQCB 3D9KA 3VLEA 3LY9A 3OXLA 4KZ0A 3MKQA 3ESKA 3D3MA 1WM5A 2VQ2A 3S2AA 4AIFA 2YQ8A 3FTXA 3PUKA 2V0PA 2GW1A 4C9BB 4NACA 3S7BA 2YHCA 3T5VA 3IEGA 4N2SA 4HXIA 5BNWA 3LPZA 4TV3A 3ZYKA 2DBAA 1KT0A 4U07A 2WVIA 3Q4AB 4GA2A 2OOEA 3T8MA 3ULQA 2IONA 2V8SE 3U4TA 3MV2B 3CVLA 4R7LA 1TJCA 3O4ZA 2DIWA 3R7RA 3ESLA 3MZLB 5E75A 4URKA 2CFZA 1KLXA 1B89A 1NP7A 2LAHA 3PVLA 4NQ0A 3ZHEB 2YNQA 3GZSA 3Q5MA 4I1AA 5FTPA 1E8ZA 2V4LA 4JL0A 4DK5A 1UN9A 2I1JA 5G04C 5FZSA 3UPVA 3HVEA 3MV3B 4G25A 3D9PA 5FJYA 3LYAA 3PEUB 3HVEB 4WWNA 3MJWA 4N5CA 3PUJA 3QJZA 4UQZA 3FH8A 4WNEA 3D9NA 3FDHA 2C2LA 4A3VA 4BT8A 5HQ8A 4I6EA 3ML9A 4F3VA 2AXVA 3L17A 3MYVA 1SZ9A 4ANXA 2C0LA 3B7TA 3IHVA 4J0UA 2JEKA 3VTXA 2J4BA 2XGSA 2L9BA 2PL2A 3B7RL 5CMYA 5FQ6A 2X6KA 3JQ0A 2IJGX 1HXIA 3LY7A 3HYMB 3LJ3A 1KT1A 3ASGA 2UWJG 5D0OD 1HFAA 2Y3AA 4A3TA 4EPZA 2XHEA 2NC9A 2XGMA 3Q47B 4GYOA 3KAEA 4AOFA 5LX8A 5A23A 2Y4TA 3LDZA 4A55A 4U0UA 3IHYA 5LCWC 3ZYQA 2WXFA 3URZA 1JUQA 3UMVA 3GW4A 5LP0A 4AP2A 4I17A 3WXXA 3OAWA 2MOWA 3BG0B 4AY5A 3ASDA 3PNLB 3DBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YA0 A;  4UI9 J;  2Q7F A;  1P5Q A;  3AS4 A;  4N3B A;  3RO3 A;  4I9C A;  5CCL A;  4BWR A;  3K9I A;  2KCK A;  4AY6 A;  3O48 A;  3ZPJ A;  3QWW A;  4LEU A;  4N2Q A;  4IN3 B;  4G2V A;  3S7F A;  2FO7 A;  4YND A;  4GYW A;  3MKR A;  3QKY A;  4GZ5 A;  1QZ2 A;  2HYZ A;  4J8E A;  2VGX B;  1PC2 A;  4JHR A;  3AS8 A;  3AS5 A;  3SF4 A;  5A6C A;  4I2Z A;  3S7D A;  2R5S A;  3QOU A;  3TG4 A;  5KJN A;  5KJL A;  2FF4 A;  3LKU A;  2UY1 B;  4GZ6 A;  2JLB A;  3CKB A;  3RJV A;  4H7Y A;  4G26 A;  4XI0 A;  1NA0 A;  3QDN A;  5G04 J;  4ME2 A;  3Q49 B;  3LY8 A;  3UUX A;  3TG5 A;  5JJT A;  3CVN A;  5D0Q D;  3ZHE A;  3E4B A;  3OXF A;  4YVQ C;  2LNI A;  2Y4U A;  2AVP A;  2WPV A;  3ZFW A;  2PQN A;  5BW8 C;  4HOT A;  3BEE A;  1ZBP A;  1Y8M A;  3RU0 A;  4GA0 A;  2XPI A;  4HOU A;  4ABN A;  5DBK A;  4U0S A;  5KJK A;  3QWP A;  1IHG A;  4N3A A;  2VYI A;  2E2E A;  3VTY A;  1ELW A;  2FEZ A;  4NRH B;  4GCN A;  3FFL A;  3CK8 A;  4RG9 A;  4H7X A;  3KS2 A;  5G05 J;  5CHE E;  3LCA A;  3TAX A;  1HZ4 A;  2XEV A;  5AYW D;  5FZQ A;  2J9Q A;  3TGO A;  3CKC A;  4XIF A;  4EQF A;  3PE4 A;  2IFU A;  4G24 A;  5A7D B;  4U04 A;  2PQR A;  1QQE A;  3RO2 A;  2PZI A;  4J8F A;  3PDN A;  4N3C A;  4Y6W A;  4GYY A;  1IYG A;  1WAO 1;  2VGX A;  5KJM A;  2MHK A;  2LSV A;  2BUG A;  4UI9 K;  5EX3 A;  2V5F A;  1NA3 A;  4UI9 C;  2XCC A;  2UY1 A;  5JJ6 A;  3FP3 A;  5BT1 A;  2KAT A;  3EDT B;  3CK7 A;  3MA5 A;  3ZN3 A;  3CK9 A;  4WUY A;  4I2W A;  2KCV A;  3QWV A;  4HOR A;  4HOQ A;  4KBQ A;  4Y6C A;  4N39 A;  2WQH A;  3GYZ A;  3PE3 A;  4UQY A;  1NZN A;  4J8D A;  2FI7 A;  5JJ7 A;  2HO1 A;  4HOS A;  2HR2 A;  5CCM A;  5ARG A;  4BTB A;  5LCW J;  1A17 A;  2LSU A;  2VSN A;  4G23 A;  4A1S A;  4WNG A;  2XCB A;  4U0Z A;  4WND A;  4XI9 A;  3CEQ A;  3KD7 A;  4GCO A;  1E96 B;  3ASH A;  4JA7 A;  4BT9 A;  3FWV A;  3SZ7 A;  1OUV A;  2OND A;  3CV0 A;  4B94 A;  4RG6 A;  5ARF A;  5HI7 A;  3ZGQ A;  4WNF A;  1W3B A;  4KXK B;  2P58 C;  3RIB A;  4CGW A;  4JA9 A;  3CVP A;  2KCL A;  3JYS A;  4I9E A;  1FCH A;  2I6H A;  3GZ2 A;  3U3W A;  4KYO B;  5EX0 A;  2L6J A;  1XNF A;  5DIZ A;  3NF1 A;  2KC7 A;  4GZ3 A;  4CDR A;  5M72 A;  2FBN A;  2XGO A;  5G05 C;  2IF4 A;  3S7J A;  3N71 A;  4YVO A;  1HH8 A;  3MEK A;  4UQX A;  5C1D A;  3CVQ A;  4GA1 A;  3Q15 A;  4APO A;  4AM9 A;  3GZ1 A;  2QFC A;  5FT9 A;  2C0M A;  5EKQ D;  2VGY A;  3RKV A;  1ZU2 A;  3UQ3 A;  4G1T A;  4W9R A;  5FZR A;  3ASF A;  3R9A B;  1ELR A;  4GPK A;  4O6F A;  2VSY A;  4CGV A;  4BTA A;  3OXG A;  3LY9 A;  3OXL A;  3ESK A;  1WM5 A;  2VQ2 A;  4AIF A;  2YQ8 A;  2GW1 A;  3S7B A;  2YHC A;  3IEG A;  4N2S A;  5BNW A;  3LPZ A;  2DBA A;  1KT0 A;  4U07 A;  3Q4A B;  4GA2 A;  2OOE A;  3ULQ A;  3U4T A;  3MV2 B;  3CVL A;  1TJC A;  1KLX A;  1B89 A;  4NQ0 A;  3ZHE B;  4I1A A;  3Q5M A;  5FTP A;  4JL0 A;  5G04 C;  5FZS A;  3UPV A;  3MV3 B;  4G25 A;  5FJY A;  3LYA A;  4N5C A;  4UQZ A;  4WNE A;  4BT8 A;  2C2L A;  5HQ8 A;  4F3V A;  2C0L A;  4J0U A;  3VTX A;  2XGS A;  2PL2 A;  3LY7 A;  1HXI A;  3HYM B;  1KT1 A;  3ASG A;  2UWJ G;  5D0O D;  2XGM A;  2NC9 A;  3Q47 B;  4GYO A;  3KAE A;  2Y4T A;  5LCW C;  4U0U A;  3URZ A;  3GW4 A;  4I17 A;  3WXX A;  4AY5 A;  3ASD A; 
#chains in the Genus database with same CATH topology
 3I3N A;  4UI9 J;  1TJF A;  2F8X K;  1N9A A;  3RO3 A;  2B6C A;  5EID A;  1H2V C;  2RG8 A;  2KM4 A;  3FTY A;  4N2Q A;  4V3I A;  5ENS D;  2M63 A;  4IN3 B;  3NOG D;  4JC8 A;  3MKR A;  4JHJ A;  4HI9 A;  1QZ2 A;  2HYZ A;  5BV0 A;  2VGX B;  3EHQ A;  3ONK A;  2Y1L E;  3SF4 A;  3UKU G;  3ENE A;  2E0I A;  1HE8 A;  4ANV A;  1UG3 A;  2P9S G;  2JLB A;  4RVB A;  3RJV A;  4H7Y A;  4XI0 A;  4EEC A;  3JQ1 A;  5G04 J;  3Q49 B;  3ZVV A;  3C98 A;  1JCR A;  3UT8 A;  4JEH A;  4EZK A;  5KNH D;  3LEW A;  4OVV A;  4PDX A;  2LNI A;  2Y4U A;  2BKG A;  2WPV A;  3ZFW A;  3KEZ A;  3CST A;  3DEP A;  3SFZ A;  5KJK A;  1WY6 A;  3FU6 A;  3CHO A;  4N3A A;  1X5B A;  4PS8 A;  2IO3 C;  2FEZ A;  3FTU A;  3FFL A;  2OCC E;  3PRZ A;  4GTP A;  3AG1 E;  3DPD A;  4XZ4 A;  4APF A;  3FUN A;  1Z3X A;  5AQA A;  2F0Y A;  2QYJ A;  3J5Q B;  5FZQ A;  2J9Q A;  3CKC A;  3DSW A;  3C3Q A;  2AXZ A;  2EIJ E;  2LXL A;  3Q7F A;  4GU5 A;  4CDN A;  2XS1 A;  1YCS B;  3JUE A;  4BSX A;  4UUC A;  2NXP A;  1QQE A;  4GTT A;  1EF1 C;  3CHP A;  1BI8 B;  3V30 A;  1IHB A;  1IYG A;  3HXC A;  2WQ6 A;  1WAO 1;  1K1B A;  2WM9 A;  3NZU A;  3TWT A;  3EU9 A;  2LSV A;  3UM3 A;  1EDU A;  4UI9 K;  2WXQ A;  1RZ4 A;  2H6I A;  2H6G A;  2KZT A;  3W9G A;  1JWF A;  2XCC A;  2UY1 A;  4U8Y D;  5JJ6 A;  3FP3 A;  1SVX A;  5BT1 A;  3ABK E;  1O1R A;  1FVH A;  1S70 B;  3ZN3 A;  2DZO A;  5AIJ A;  4J7W A;  3Q9U C;  1JPL A;  3QWV A;  2GGF A;  4WAF A;  5B1B E;  5J08 A;  4HB5 A;  5AAO A;  3T9K A;  4RSY A;  4J8D A;  3V2X A;  1DVP A;  4C0E A;  4HOS A;  5ARG A;  4U96 D;  1SZA A;  1E7V A;  2LSU A;  3E30 A;  3F6Q A;  4A1S A;  1N11 A;  2XCB A;  3AU5 A;  4O60 A;  2VTB A;  4U0Z A;  4I6G A;  4WND A;  3AAA C;  2XPZ A;  1OWN A;  4A63 B;  1OUV A;  4B94 A;  3PH0 C;  2XZD G;  4ILG A;  1U3D A;  5BXU A;  4KXK B;  4DX7 D;  2VSO E;  3CVP A;  3JYS A;  4EZJ A;  3QB2 A;  2VGE A;  3ZRH A;  2LUH A;  5CRV A;  4HVB A;  3BUA A;  3SO8 A;  2L6J A;  3HXE A;  3LVQ E;  4PH4 B;  4OAU C;  2GRM A;  2X6F A;  4DJA A;  3D9O A;  5M72 A;  3I5P A;  1FVF A;  4O1P A;  5IY5 E;  3HXD A;  3G2S A;  3TXM A;  4B0Z A;  3S7J A;  3JXJ A;  2CG2 A;  1SQM A;  4YVO A;  3VLD A;  2NYJ A;  3CVQ A;  2WXL A;  1A5E A;  3Q15 A;  1HG2 A;  4APO A;  2XS8 A;  3EIQ C;  3BQO A;  4JW1 A;  3UQ3 A;  1D9S A;  2QZA A;  3B7U X;  4PS3 A;  4MKT A;  3JXI A;  3FH7 A;  1INZ A;  1N4R A;  2RD0 A;  4GPK A;  3FUJ A;  3L13 A;  4I6J A;  4O6F A;  1N52 A;  2GRL A;  4DRX E;  2P9K G;  3CIA A;  4BTA A;  4Q69 A;  2V4H C;  3OXG A;  3ESK A;  3ZKJ A;  4ZHB A;  3AG4 E;  3S2A A;  4AIF A;  2YQ8 A;  2V0P A;  3J5P A;  2GW1 A;  5EYL A;  3SY2 A;  3S7B A;  4HXI A;  5BNW A;  5H7P A;  2WVI A;  3ASO E;  2DZN A;  2ION A;  3U4T A;  3MV2 B;  4R7L A;  1TJC A;  2DIW A;  3ESL A;  5E75 A;  4NQ0 A;  2I1J A;  5G04 C;  5ENR D;  4G25 A;  3LYA A;  3KSQ A;  3PEU B;  4N5C A;  3QJZ A;  5KNG A;  1LD7 A;  5HQ8 A;  4A3V A;  3B7B A;  3MYV A;  2J4B A;  2PL2 A;  4ATZ D;  5FQ6 A;  3JQ0 A;  1HXI A;  3HYM B;  2UWJ G;  1HFA A;  2XHE A;  3Q47 B;  3IXE A;  2J8S D;  2Y4T A;  2WXF A;  2F8Y A;  1V54 E;  3OAW A;  2MOW A;  4CZ2 D;  4BES A;  3DBS A;  1TN7 A;  2X6J A;  3T5X A;  4L23 A;  3RSE G;  3AS4 A;  3IV0 A;  3QC1 A;  3HHM A;  2PNN A;  4BWR A;  1O5M A;  1MQS A;  4J6I A;  3ZPJ A;  3AJI A;  3ZEF A;  3EUV A;  1BD8 A;  4JD2 G;  3B7S A;  4K5C A;  5JMN D;  4E6H A;  3L82 A;  1DCE A;  3S7F A;  1HO8 A;  3FU5 A;  4GYW A;  3QKY A;  3L54 A;  4GZ5 A;  5CBO A;  2CHW A;  1IQR A;  2Y0B G;  2R05 A;  1PC2 A;  4JHR A;  3UM0 A;  3D9I A;  3AS5 A;  5A6C A;  2WXG A;  2R5S A;  3QOU A;  3TJP A;  1N95 A;  2R59 A;  4C0M A;  2KZT B;  4MRU A;  2L0I A;  3EHR A;  4JB8 P;  3UM2 A;  3EHM A;  1MHQ A;  5KJL A;  4I43 A;  2UY1 B;  3HXB A;  4AEZ C;  1HF8 A;  3CKB A;  4KVM A;  3IBE A;  4XKB A;  4XEI G;  1BI7 B;  2R03 A;  1LF8 A;  4I1O B;  3FTW A;  3UUX A;  4UWH A;  2GRR B;  5JJT A;  3LXU X;  1ZB1 A;  3ZXS A;  3ZXP A;  3CVN A;  2J07 A;  4L1B A;  5D0Q D;  3PRE A;  3ZHE A;  1U3C A;  2BED A;  1E8X A;  4YVQ C;  3UT7 A;  3JCK C;  4XKC A;  5FQ8 A;  2PQN A;  4ACL A;  1Y8M A;  3FEY A;  3ULE G;  4GZD A;  4GA0 A;  3DXM G;  1TNB A;  1X81 A;  4HOU A;  5DBK A;  4U0S A;  3U64 A;  3R9M A;  3QWP A;  4ILI A;  1UW4 B;  2VYI A;  2E2E A;  3CVU A;  2QC9 A;  2VTB B;  3IKO B;  4NRH B;  4GCN A;  3V79 K;  2MRI A;  4ATG A;  1MX4 A;  3CK8 A;  3TWQ A;  3KS2 A;  1N4P A;  5CMW A;  3TAX A;  4GTR A;  4HRL A;  3G2W A;  3CR3 A;  4CDM A;  2QY7 A;  2ZGD A;  3UX4 A;  3FUF A;  4OVU A;  5C2Y A;  1OWM A;  2AW6 A;  1TNU A;  5A7D B;  4U04 A;  4BET A;  5AAR A;  5CBN A;  4B8C B;  2OEW A;  4G11 A;  3FU3 A;  4DX6 D;  5AQ7 A;  3RO2 A;  1UOH A;  5CEC B;  3DSU A;  3NBN B;  3L08 A;  3Q7A A;  3UTM A;  2OV8 A;  3TWS A;  1V55 E;  5T3R A;  5JHB A;  3B13 A;  4K0R A;  5EX3 A;  4KZC A;  2DYR E;  1BLX B;  5EIB E;  4TUU A;  4GTV A;  1HS6 A;  2X3M A;  3PS6 A;  1BPO A;  4I1M A;  1H19 A;  4GPM A;  4EHM A;  1KPS B;  4IYP A;  3EDT B;  3CK7 A;  4J8S A;  3ZIM A;  3PZD A;  4JHK A;  3NOC D;  2VJ8 A;  3MA5 A;  5CED B;  3KSL A;  3WG7 E;  1ELK A;  4GML A;  2P9N G;  4YDO A;  5BUZ A;  2LAI A;  1TNY A;  1Z3Y A;  1KZO A;  3SD5 A;  4HOQ A;  3L22 A;  4HS2 A;  2IOL A;  2WXR A;  2ZGG A;  2FUL A;  4F7A A;  1HX8 A;  4N39 A;  3D9J A;  4JEU A;  3QAR A;  3APD A;  2HO1 A;  2H6F A;  2HR2 A;  2WXJ A;  2QYU A;  1A17 A;  3NB2 A;  4G23 A;  4WNG A;  5T8I A;  4UWG A;  4FJZ A;  3FHE A;  4DX5 D;  3ONL A;  2L6B A;  2DCP A;  4DLQ A;  1TEZ A;  1H6P A;  5ENN A;  3FWV A;  5KWD A;  3ZGQ A;  4GB9 A;  2CFU A;  1W3B A;  3RIB A;  4CGW A;  2KCL A;  3APC A;  3UI2 A;  3KEA A;  3NAW A;  1FCH A;  3DPY A;  2ILR A;  3UIP C;  3FY4 A;  5JA4 D;  4UWL A;  3ASN E;  4KYO B;  3ZW3 A;  3FTV A;  1NFI E;  3HDX A;  3DSV A;  1XNF A;  4QFV A;  3NF1 A;  2PM7 A;  4TXP A;  3SQV A;  3L16 A;  3P1U A;  4BFR A;  5AJL A;  4HI8 A;  4Q94 A;  2XQ0 A;  4KVO A;  3ML8 A;  4C48 B;  4UQX A;  4HBD A;  4WWO A;  5C1D A;  5BV1 A;  3PEV B;  3CLJ A;  3UKR G;  4HRM B;  1DC2 A;  3ISM C;  4AM9 A;  3GZ1 A;  2QFC A;  2WB2 A;  4TUM A;  4XX5 A;  2LO6 A;  4A1G A;  4L2L A;  4M3O A;  2VGY A;  1MX6 A;  1ZU2 A;  1TNO A;  2RFM A;  4BX9 A;  4AJW A;  3Q79 A;  5FIN A;  4L7T A;  5FZR A;  3ASF A;  4FLH A;  4ILH B;  3R9A B;  5G2N A;  1N4Q A;  2WXN A;  3E34 A;  4GAA A;  2CG3 A;  4CGV A;  4LCT A;  2R02 A;  1OT8 A;  1IKN D;  5B1A E;  4GTO A;  3T5V A;  2GRP B;  4N2S A;  4TV3 A;  1KT0 A;  1S63 A;  3T8M A;  3ULQ A;  4RQI A;  4F1P A;  3SFX A;  1K3Z D;  3R7R A;  4URK A;  2LAH A;  1B89 A;  3ZHE B;  3GZS A;  4TXR A;  4JL0 A;  5ITZ F;  1UN9 A;  5FZS A;  3MV3 B;  3D9P A;  5HS0 A;  5FJY A;  3HVE B;  3MJW A;  4UQZ A;  4WNE A;  5CEA A;  4YDY A;  2KBX A;  3L17 A;  3HRA A;  1SZ9 A;  3LJN A;  2JEK A;  3VTX A;  2XGS A;  4BEP A;  5FIO A;  2ZIS A;  4A3T A;  2XGM A;  1OCZ E;  1FT2 A;  3LDZ A;  4A55 A;  4U0U A;  3IHY A;  3ZYQ A;  3UMV A;  3GW4 A;  4CYM D;  3WXX A;  1YMP A;  3PNL B;  5FWQ A;  1YA0 A;  2MYO A;  2R17 C;  1P5Q A;  3RRM B;  4N3B A;  3HXF A;  4U8V D;  1L5J A;  2P9U G;  2KCK A;  4AY6 A;  4LSZ E;  3QWW A;  5LFA A;  4DX2 A;  4LUN U;  2I1K A;  2FO7 A;  3C3O A;  3SGH A;  3CVY A;  3FU0 A;  4O1O A;  4HRN A;  5D66 A;  3DEO A;  3AS8 A;  2EQX A;  3S7D A;  5LOZ A;  4DI3 A;  3E37 A;  5ENQ D;  4AV7 A;  4JPS A;  3CGH A;  5KJN A;  1EPU A;  4FA6 A;  2FF4 A;  3LKU A;  4GZ6 A;  3FUK A;  3ABL E;  4G26 A;  4Z68 A;  4GMR A;  5FQ7 A;  2J08 A;  4L2Y A;  2EIL E;  4ANW A;  3P2B A;  4JZY A;  1G3N B;  2J49 A;  4P29 A;  2ZIR A;  1ZBP A;  3VLF A;  4EBA A;  3RU0 A;  1IHG A;  4JXT A;  4K03 A;  4MLP A;  1MYO A;  5AJD A;  4TXQ A;  3U9W A;  3VTY A;  1OWL A;  4J8Y A;  4OAV B;  4XE0 A;  3QAQ A;  3C5R A;  3FH5 A;  1NI1 A;  3Q73 A;  4H7X A;  3SHF A;  5CHE E;  5ANL A;  3C3R A;  1HZ4 A;  3R7Q A;  1K1A A;  5AQB A;  2FO1 E;  2WXO A;  1H6K A;  4XIF A;  3RAU A;  3B95 A;  2CHZ A;  3SBS A;  3QNK A;  4EQF A;  3HG0 D;  4PS7 A;  2IFU A;  4G24 A;  5CER B;  2GRO B;  1OWO A;  4HLL A;  2XRY A;  1H6O A;  2PQR A;  1Y6I A;  3G2T A;  1H2U A;  2WXH A;  3OTN A;  5ANR A;  2Y69 E;  3Q75 A;  3PDN A;  2IO2 C;  4F1S A;  1UJK A;  2MHK A;  1OCC E;  1Q2Z A;  1UN8 A;  2V5F A;  4HLE A;  3CVX A;  2OVF A;  1MX2 A;  5BPP A;  4ANU A;  2IEJ A;  2KAT A;  1D8D A;  2HE0 A;  4LRZ A;  3ZYL A;  2BTD A;  4LNU D;  5KBA A;  1PAQ A;  1H2T C;  3CQG B;  4WUY A;  2KCV A;  3L6A A;  4IUL A;  2P9P G;  1TN8 A;  3PZ3 A;  2AWI A;  2YHE A;  4ZFH A;  4QQI A;  2WQH A;  2XEN A;  3PE3 A;  3ZNG A;  3FUE A;  4UQY A;  4BX8 A;  1NZN A;  4UWF A;  3RK6 A;  5CCM A;  4FHK A;  4DUI A;  4GMJ A;  2VSN A;  2YIN A;  1PY1 A;  3EU5 A;  5AEN A;  2GRN B;  1O1S A;  2X6H A;  3D9H A;  1OY3 D;  4XI9 A;  4K5B A;  2DVW A;  4GCO A;  2XRZ A;  3ASH A;  2WXK A;  2BF0 X;  4JA7 A;  4BT9 A;  2WXI A;  4RG6 A;  1JWG A;  5HI7 A;  2P9I G;  1SA4 A;  3FUD A;  2P58 C;  4FLB A;  1IXV A;  3PZ1 A;  1S0P A;  2IQC A;  3SI5 A;  4D10 C;  2KXP C;  2I6H A;  4F53 A;  4DI4 A;  3GZ2 A;  2I9C A;  2I2O A;  5EX0 A;  4PUC A;  1D8E A;  3NQP A;  3G2U A;  5DIZ A;  3TWX A;  4GZ3 A;  1N0Q A;  4KMO A;  3CHS A;  4ACK A;  2FBN A;  5G05 C;  1HH8 A;  3MEK A;  1SW6 A;  3L9T A;  5FT9 A;  4RLY A;  3I4R B;  5EKQ D;  4EBA G;  1SA5 A;  5E76 A;  3BG1 B;  4G1T A;  4FU3 A;  4W9R A;  5AQ9 A;  1GW6 A;  2HM8 A;  3DST A;  2VSY A;  5HKP A;  4GZC A;  3D9K A;  3OXL A;  3MKQ A;  1WM5 A;  2VQ2 A;  3PUK A;  1JCS A;  2YHC A;  3IEG A;  3LPZ A;  2EIN E;  3ZYK A;  2DBA A;  4U07 A;  3Q4A B;  2OOE A;  2V8S E;  1N0R A;  3T8K A;  4GTS A;  3O4Z A;  3MZL B;  1KLX A;  1NP7 A;  3PVL A;  3UIN C;  4I1A A;  3Q5M A;  5FTP A;  1E8Z A;  4DK5 A;  3UPV A;  4WWN A;  3PUJ A;  2P9L G;  3FH8 A;  3D9N A;  4BT8 A;  2C2L A;  1NL4 A;  3PZ2 A;  2C0L A;  3B7T A;  3IHV A;  4J0U A;  1FPP A;  3B7R L;  5CMY A;  2X6K A;  3LY7 A;  1KT1 A;  5D0O D;  2Y3A A;  4GYO A;  4AOF A;  5LX8 A;  2IY0 C;  5A23 A;  5LCW C;  4HNA D;  3V2O A;  3URZ A;  1JUQ A;  3BU8 A;  3E32 A;  2ETA A;  4I17 A;  4N5Q A;  3BG0 B;  4AY5 A;  3ASD A;  2F37 A;  2Q7F A;  2PM6 A;  3CHQ A;  1Z6T A;  2L0T B;  4I9C A;  5CCL A;  3SNX A;  3K9I A;  5ENP D;  2OEV A;  4OYS A;  3O48 A;  4LEU A;  3CVW A;  2A5U A;  2IU1 A;  3QK0 A;  1WDY A;  5EDS A;  4G2V A;  1TR4 A;  2CHX A;  4YND A;  4B89 A;  2R2L A;  4HFG A;  3NZS A;  4K5A B;  1O1T A;  4J8E A;  4FHJ A;  3TWR A;  3CVV A;  4M7C A;  2NSZ A;  4NUR A;  1Z5S C;  4I2Z A;  4EZL A;  3CHR A;  1QNF A;  3TG4 A;  4BER A;  1EYH A;  4B93 B;  4WWP A;  1BU9 A;  1YYH A;  3LVR E;  1NA0 A;  5AN8 A;  2AXU A;  1U2V G;  3QDN A;  4ME2 A;  3LY8 A;  3TG5 A;  3FTZ A;  3PZ4 A;  4MS6 A;  1E8Y A;  1K8K G;  3ABM E;  4YDE A;  3E4B A;  3EHN A;  1E7U A;  3OXF A;  4CRW A;  2AVP A;  3V31 A;  5BW8 C;  4HOT A;  3W9F A;  3BEE A;  4U8H A;  1RW2 A;  3HIZ A;  2XPI A;  4ABN A;  3MX3 A;  3TL5 A;  5ENO D;  1HG5 A;  4TRQ A;  5KCM A;  2VSX E;  4IRU A;  5JHA A;  1ELW A;  2WMO A;  2A4Z A;  3FTS A;  3RRU A;  5EIL A;  1VDY A;  3PNT B;  4G8K A;  4RG9 A;  5G05 J;  3LCA A;  4AVX A;  3MCX A;  2A5E A;  1KZP A;  2XEV A;  2XEH A;  5AYW D;  2X38 A;  3AG2 E;  3TGO A;  2BKK B;  4FUL A;  4DLO A;  3CHM A;  4G8L A;  1IQU A;  3G2V A;  3PE4 A;  3E33 A;  3D9L A;  3FEX A;  3LS8 A;  1N94 A;  1QBQ A;  3APF A;  4FJY A;  4B8A A;  3AG3 E;  5EN5 D;  3Q9N C;  1N4S A;  2OVB A;  2P2C P;  2ETC A;  2PZI A;  4CCA A;  4J8F A;  2DWZ A;  4N3C A;  4Y6W A;  4FAD A;  4GYY A;  5D2M C;  1QYM A;  1TN6 A;  2VGX A;  5KJM A;  3DXK G;  1LTX A;  4GTQ A;  2B0O E;  3UIO C;  1E90 A;  2BUG A;  2XEE A;  3EJN A;  4JVS A;  4MBG A;  4CT0 A;  4CEM A;  5BXO A;  1NA3 A;  4UI9 C;  2WXP A;  5G55 A;  2H6H A;  3AU4 A;  3Q78 A;  4DPR A;  3D9M A;  4BSZ B;  1HU3 A;  4E85 A;  4FC8 A;  3CK9 A;  1OCR E;  4I2W A;  3DWL G;  4UWK A;  1N54 A;  1OCO E;  4HOR A;  4HQD A;  3SFY A;  3UM1 A;  3MKQ B;  4KBQ A;  4Y6C A;  3GYZ A;  4AXH A;  2FI7 A;  5JJ7 A;  1H0A A;  5ENT D;  3MGB A;  4BTB A;  5LCW J;  1UJJ A;  1S64 A;  1FT1 A;  2WXM A;  5T4Y A;  4LNB A;  2WQ7 A;  1TNZ A;  3FUM A;  3CEQ A;  3KD7 A;  1E96 B;  3I4G A;  2WMN A;  2RKK A;  1AP7 A;  5J90 A;  3SZ7 A;  2OND A;  3CV0 A;  5ARF A;  4WNF A;  3FUL A;  4GTM A;  4F6R D;  4LER A;  3ZU7 B;  4JA9 A;  3FUH A;  1OWP A;  1E8W A;  4I9E A;  2XZT G;  3CSF A;  1JCQ A;  3U3W A;  5FQ4 A;  2KC7 A;  4X8Q A;  4CDR A;  2ZXW E;  2X6I A;  2J09 A;  2XGO A;  4KT6 B;  2IF4 A;  3UT4 A;  1MJ0 A;  2J4D A;  3EIJ A;  3TWU A;  1DCQ A;  2LXM A;  3N71 A;  1DNP A;  3FUI A;  2ZU6 B;  4GA1 A;  4U7E B;  4BY6 A;  1WG0 A;  2C0M A;  4LNG A;  4CT4 A;  2DYS E;  2RFA A;  3C72 A;  3RKV A;  3SBT B;  2GRQ B;  2XPY A;  5HRY A;  3JUI A;  1TYQ G;  4DX1 A;  1MZC A;  4Q96 A;  2AJA A;  3RRN B;  3U66 A;  1ELR A;  4LG6 A;  3TXN A;  4U63 A;  3TWV A;  2IOS A;  1XGW A;  4FP7 A;  3ZYM A;  2JAB A;  1OXJ A;  3CQC B;  5EYP F;  3VLE A;  3LY9 A;  4KZ0 A;  5CRU A;  3D3M A;  3FTX A;  4C9B B;  4NAC A;  3TWW A;  3DRA A;  4GA2 A;  2EIM E;  2ETB A;  3CVL A;  3X2Q E;  2CFZ A;  2YNQ A;  5B3S E;  2V4L A;  4NIK A;  3ULY A;  4YDW A;  3HVE A;  3FDH A;  4L9P A;  4I6E A;  3ML9 A;  4F3V A;  3DSX A;  2AXV A;  1LD8 A;  2EIK E;  2V5Q C;  4ANX A;  2L9B A;  3DSS A;  2IJG X;  3LJ3 A;  3ZUV B;  3ASG A;  4EPZ A;  2NC9 A;  4U95 D;  3KAE A;  5LP0 A;  3UXG A;  4AP2 A;  1AWC B; 
#chains in the Genus database with same CATH homology
 5FWQ A;  1YA0 A;  3I3N A;  4UI9 J;  2X6J A;  2Q7F A;  2PM6 A;  1TJF A;  3CHQ A;  3T5X A;  1Z6T A;  2R17 C;  1P5Q A;  3AS4 A;  2L0T B;  3IV0 A;  3QC1 A;  4N3B A;  4L23 A;  3RO3 A;  3HHM A;  4I9C A;  5CCL A;  4BWR A;  3SNX A;  1L5J A;  3K9I A;  2KCK A;  4AY6 A;  1H2V C;  2RG8 A;  4OYS A;  1MQS A;  2KM4 A;  4J6I A;  3O48 A;  3ZPJ A;  3QWW A;  5LFA A;  4LEU A;  3ZEF A;  3FTY A;  3CVW A;  4N2Q A;  4V3I A;  2A5U A;  2IU1 A;  2M63 A;  4LUN U;  4IN3 B;  3B7S A;  4E6H A;  3QK0 A;  5EDS A;  4G2V A;  2I1K A;  2CHX A;  3S7F A;  1HO8 A;  2FO7 A;  3FU5 A;  4JC8 A;  4YND A;  4B89 A;  4GYW A;  3MKR A;  3QKY A;  4JHJ A;  3L54 A;  4GZ5 A;  3SGH A;  4HFG A;  3NZS A;  1QZ2 A;  2HYZ A;  2CHW A;  4J8E A;  4FHJ A;  1IQR A;  3CVY A;  3FU0 A;  5BV0 A;  3CVV A;  2VGX B;  2NSZ A;  1PC2 A;  4JHR A;  3ONK A;  4NUR A;  3AS8 A;  3D9I A;  3AS5 A;  3SF4 A;  5A6C A;  2EQX A;  4I2Z A;  2WXG A;  2R5S A;  3QOU A;  3S7D A;  5LOZ A;  3ENE A;  4DI3 A;  2E0I A;  3TJP A;  3CHR A;  4EZL A;  2R59 A;  1QNF A;  3TG4 A;  4C0M A;  1HE8 A;  4ANV A;  1UG3 A;  2KZT B;  4MRU A;  4AV7 A;  4JPS A;  3CGH A;  5KJN A;  1EPU A;  2L0I A;  4FA6 A;  3EHM A;  1MHQ A;  5KJL A;  2FF4 A;  3LKU A;  4I43 A;  1EYH A;  2UY1 B;  4GZ6 A;  1HF8 A;  2JLB A;  3CKB A;  3FUK A;  4KVM A;  3IBE A;  4RVB A;  4WWP A;  4AEZ C;  3RJV A;  4XKB A;  4H7Y A;  4G26 A;  4XI0 A;  3LVR E;  1NA0 A;  2AXU A;  4EEC A;  3JQ1 A;  5FQ7 A;  3QDN A;  5G04 J;  1LF8 A;  4I1O B;  4ME2 A;  3Q49 B;  3LY8 A;  3FTW A;  3UUX A;  4UWH A;  2J08 A;  4L2Y A;  3TG5 A;  3ZVV A;  4ANW A;  3FTZ A;  3C98 A;  5JJT A;  3LXU X;  3UT8 A;  4MS6 A;  3ZXS A;  3P2B A;  4JEH A;  1E8Y A;  3CVN A;  4EZK A;  2J07 A;  4L1B A;  5D0Q D;  3PRE A;  3ZHE A;  3LEW A;  1U3C A;  3E4B A;  3EHN A;  4JZY A;  4OVV A;  1E7U A;  3OXF A;  2J49 A;  4CRW A;  1E8X A;  4P29 A;  4YVQ C;  4PDX A;  3UT7 A;  2LNI A;  2Y4U A;  3JCK C;  2AVP A;  4XKC A;  2WPV A;  5FQ8 A;  3ZFW A;  2PQN A;  3KEZ A;  5BW8 C;  4ACL A;  4HOT A;  3CST A;  3BEE A;  1ZBP A;  4U8H A;  3VLF A;  1Y8M A;  3FEY A;  3RU0 A;  4GZD A;  4EBA A;  4GA0 A;  3HIZ A;  2XPI A;  4HOU A;  5DBK A;  4ABN A;  4U0S A;  3SFZ A;  5KJK A;  3MX3 A;  1WY6 A;  3FU6 A;  3U64 A;  3TL5 A;  3QWP A;  1IHG A;  4ILI A;  4JXT A;  3CHO A;  4K03 A;  4N3A A;  1HG5 A;  4MLP A;  1UW4 B;  1X5B A;  5AJD A;  2VYI A;  4TRQ A;  5KCM A;  2VSX E;  3U9W A;  4PS8 A;  4IRU A;  2E2E A;  3VTY A;  1OWL A;  3CVU A;  5JHA A;  1ELW A;  2WMO A;  2A4Z A;  3FTS A;  4XE0 A;  2FEZ A;  3RRU A;  2VTB B;  3IKO B;  3QAQ A;  4NRH B;  4GCN A;  3FH5 A;  3FTU A;  3FFL A;  1VDY A;  2MRI A;  3PRZ A;  3PNT B;  4ATG A;  3CK8 A;  3DPD A;  4H7X A;  4RG9 A;  3KS2 A;  4XZ4 A;  5G05 J;  3SHF A;  4APF A;  5CHE E;  5ANL A;  3LCA A;  3FUN A;  1Z3X A;  5CMW A;  4AVX A;  3TAX A;  1HZ4 A;  3MCX A;  2XEV A;  5AYW D;  2X38 A;  5FZQ A;  2J9Q A;  3R7Q A;  3G2W A;  3CR3 A;  3TGO A;  3CKC A;  4FUL A;  2AXZ A;  2WXO A;  1H6K A;  4GU5 A;  4XIF A;  4CDM A;  2QY7 A;  4DLO A;  3CHM A;  2CHZ A;  4CDN A;  3SBS A;  3QNK A;  3UX4 A;  1IQU A;  3FUF A;  3G2V A;  4PS7 A;  4OVU A;  3PE4 A;  5C2Y A;  4EQF A;  2IFU A;  4G24 A;  1OWM A;  2AW6 A;  5A7D B;  4U04 A;  3D9L A;  3FEX A;  3LS8 A;  3APF A;  1OWO A;  4FJY A;  2XRY A;  4B8A A;  4BSX A;  2PQR A;  1Y6I A;  2NXP A;  1QQE A;  4G11 A;  3G2T A;  4B8C B;  1EF1 C;  3FU3 A;  1H2U A;  2OVB A;  3RO2 A;  2PZI A;  3CHP A;  2WXH A;  3OTN A;  5ANR A;  4CCA A;  4J8F A;  3L08 A;  3PDN A;  2OV8 A;  5T3R A;  4N3C A;  5JHB A;  4Y6W A;  4FAD A;  4GYY A;  3B13 A;  1IYG A;  2WQ6 A;  1WAO 1;  2VGX A;  4K0R A;  4F1S A;  5KJM A;  2WM9 A;  1UJK A;  3NZU A;  2MHK A;  1E90 A;  2LSV A;  2BUG A;  3EJN A;  4JVS A;  1EDU A;  4UI9 K;  2WXQ A;  4CEM A;  4CT0 A;  5EX3 A;  2V5F A;  1NA3 A;  1UN8 A;  4KZC A;  4HLE A;  2KZT A;  4UI9 C;  2WXP A;  4TUU A;  3CVX A;  1HS6 A;  5G55 A;  1JWF A;  2X3M A;  2OVF A;  3PS6 A;  1BPO A;  4I1M A;  2XCC A;  5BPP A;  2UY1 A;  4ANU A;  1H19 A;  3AU4 A;  5JJ6 A;  3FP3 A;  4DPR A;  5BT1 A;  2KAT A;  3D9M A;  4IYP A;  3EDT B;  1HU3 A;  3CK7 A;  4J8S A;  4LRZ A;  3ZYL A;  3ZIM A;  1FVH A;  3PZD A;  4E85 A;  2BTD A;  4JHK A;  2VJ8 A;  3MA5 A;  1PAQ A;  3ZN3 A;  1H2T C;  5AIJ A;  1ELK A;  4FC8 A;  4GML A;  3CK9 A;  3CQG B;  4WUY A;  4I2W A;  2KCV A;  3L6A A;  4IUL A;  5BUZ A;  2LAI A;  4UWK A;  1JPL A;  1Z3Y A;  1N54 A;  3QWV A;  4HOR A;  3SD5 A;  4HOQ A;  2GGF A;  3L22 A;  4WAF A;  3MKQ B;  4HS2 A;  2IOL A;  2WXR A;  2AWI A;  2YHE A;  2FUL A;  4KBQ A;  5J08 A;  4F7A A;  1HX8 A;  4Y6C A;  4N39 A;  2WQH A;  3GYZ A;  3PE3 A;  3FUE A;  4RSY A;  4UQY A;  4BX8 A;  1NZN A;  4J8D A;  4AXH A;  1DVP A;  2FI7 A;  3D9J A;  5JJ7 A;  4UWF A;  4C0E A;  1H0A A;  4JEU A;  3QAR A;  3APD A;  2HO1 A;  3RK6 A;  4HOS A;  2HR2 A;  5CCM A;  2WXJ A;  5ARG A;  3MGB A;  4BTB A;  5LCW J;  4FHK A;  1A17 A;  1SZA A;  1E7V A;  1UJJ A;  4GMJ A;  2LSU A;  2VSN A;  2YIN A;  4G23 A;  4A1S A;  2WXM A;  4WNG A;  1PY1 A;  2XCB A;  3AU5 A;  2VTB A;  5AEN A;  5T8I A;  4U0Z A;  5T4Y A;  2X6H A;  4UWG A;  4FJZ A;  3FHE A;  4I6G A;  2WQ7 A;  4WND A;  3ONL A;  4XI9 A;  2DCP A;  3FUM A;  3CEQ A;  2XPZ A;  4DLQ A;  3KD7 A;  4GCO A;  2XRZ A;  1TEZ A;  1E96 B;  3I4G A;  3ASH A;  5ENN A;  2WMN A;  2WXK A;  1OWN A;  2BF0 X;  4JA7 A;  4BT9 A;  3FWV A;  5J90 A;  3SZ7 A;  1OUV A;  2OND A;  2WXI A;  3CV0 A;  3RRM B;  4B94 A;  4RG6 A;  3PH0 C;  1JWG A;  5ARF A;  5HI7 A;  4GB9 A;  4WNF A;  3FUL A;  4ILG A;  2CFU A;  3ZGQ A;  1U3D A;  1W3B A;  3FUD A;  4KXK B;  4LER A;  2P58 C;  4FLB A;  3RIB A;  4CGW A;  2VSO E;  4JA9 A;  3FUH A;  1OWP A;  3CVP A;  2KCL A;  3JYS A;  4EZJ A;  3QB2 A;  3APC A;  1E8W A;  1S0P A;  4I9E A;  3ZRH A;  1FCH A;  3CSF A;  2IQC A;  3SI5 A;  4D10 C;  2ILR A;  2I6H A;  4F53 A;  3FY4 A;  4DI4 A;  4HVB A;  4UWL A;  3GZ2 A;  3U3W A;  2I9C A;  4KYO B;  3HDX A;  2I2O A;  3FTV A;  3ZW3 A;  5EX0 A;  2L6J A;  4PUC A;  3LVQ E;  5FQ4 A;  4PH4 B;  1XNF A;  3NQP A;  4QFV A;  2GRM A;  2X6F A;  3G2U A;  5DIZ A;  3NF1 A;  2KC7 A;  4GZ3 A;  4CDR A;  2PM7 A;  3L16 A;  4DJA A;  3D9O A;  3P1U A;  5M72 A;  3I5P A;  4KMO A;  1FVF A;  2X6I A;  4BFR A;  5AJL A;  3CHS A;  4ACK A;  2J09 A;  4Q94 A;  2FBN A;  2XGO A;  2XQ0 A;  3G2S A;  4KT6 B;  5G05 C;  2IF4 A;  3UT4 A;  4KVO A;  2J4D A;  3TXM A;  3EIJ A;  4B0Z A;  3S7J A;  3ML8 A;  3N71 A;  2CG2 A;  1DNP A;  1SQM A;  4YVO A;  1HH8 A;  3MEK A;  3VLD A;  3FUI A;  4UQX A;  4WWO A;  3CVQ A;  2WXL A;  5C1D A;  2ZU6 B;  4GA1 A;  3PEV B;  3Q15 A;  5BV1 A;  3CLJ A;  1HG2 A;  4APO A;  4AM9 A;  3GZ1 A;  2QFC A;  5FT9 A;  2WB2 A;  3EIQ C;  4BY6 A;  2C0M A;  4XX5 A;  2LO6 A;  4CT4 A;  3I4R B;  4L2L A;  5EKQ D;  4M3O A;  4A1G A;  2VGY A;  4EBA G;  3RKV A;  3SBT B;  1ZU2 A;  4BX9 A;  2XPY A;  5E76 A;  4AJW A;  4JW1 A;  3UQ3 A;  3JUI A;  3BG1 B;  4G1T A;  4FU3 A;  4L7T A;  3B7U X;  4PS3 A;  4W9R A;  5FZR A;  4MKT A;  3ASF A;  4FLH A;  3FH7 A;  1INZ A;  4ILH B;  4Q96 A;  1GW6 A;  3U66 A;  2RD0 A;  3R9A B;  3RRN B;  2HM8 A;  1ELR A;  4GPK A;  3FUJ A;  3L13 A;  4I6J A;  1N52 A;  2GRL A;  2WXN A;  4GAA A;  4O6F A;  4U63 A;  5G2N A;  3TXN A;  2IOS A;  2VSY A;  3CIA A;  1XGW A;  2CG3 A;  4FP7 A;  3ZYM A;  4GZC A;  4LCT A;  4CGV A;  4BTA A;  4Q69 A;  3OXG A;  3CQC B;  3D9K A;  3VLE A;  3LY9 A;  3OXL A;  4KZ0 A;  3MKQ A;  3ESK A;  3D3M A;  1WM5 A;  2VQ2 A;  3S2A A;  4AIF A;  2YQ8 A;  3FTX A;  3PUK A;  2V0P A;  2GW1 A;  4C9B B;  4NAC A;  3S7B A;  2YHC A;  3T5V A;  3IEG A;  4N2S A;  4HXI A;  5BNW A;  3LPZ A;  4TV3 A;  3ZYK A;  2DBA A;  1KT0 A;  4U07 A;  2WVI A;  3Q4A B;  4GA2 A;  2OOE A;  3T8M A;  3ULQ A;  2ION A;  2V8S E;  3U4T A;  3MV2 B;  3CVL A;  4R7L A;  1TJC A;  3O4Z A;  2DIW A;  3R7R A;  3ESL A;  3MZL B;  5E75 A;  4URK A;  2CFZ A;  1KLX A;  1B89 A;  1NP7 A;  2LAH A;  3PVL A;  4NQ0 A;  3ZHE B;  2YNQ A;  3GZS A;  3Q5M A;  4I1A A;  5FTP A;  1E8Z A;  2V4L A;  4JL0 A;  4DK5 A;  1UN9 A;  2I1J A;  5G04 C;  5FZS A;  3UPV A;  3HVE A;  3MV3 B;  4G25 A;  3D9P A;  5FJY A;  3LYA A;  3PEU B;  3HVE B;  4WWN A;  3MJW A;  4N5C A;  3PUJ A;  3QJZ A;  4UQZ A;  3FH8 A;  4WNE A;  3D9N A;  3FDH A;  2C2L A;  4A3V A;  4BT8 A;  5HQ8 A;  4I6E A;  3ML9 A;  4F3V A;  2AXV A;  3L17 A;  3MYV A;  1SZ9 A;  4ANX A;  2C0L A;  3B7T A;  3IHV A;  4J0U A;  2JEK A;  3VTX A;  2J4B A;  2XGS A;  2L9B A;  2PL2 A;  3B7R L;  5CMY A;  5FQ6 A;  2X6K A;  3JQ0 A;  2IJG X;  1HXI A;  3LY7 A;  3HYM B;  3LJ3 A;  1KT1 A;  3ASG A;  2UWJ G;  5D0O D;  1HFA A;  2Y3A A;  4A3T A;  4EPZ A;  2XHE A;  2NC9 A;  2XGM A;  3Q47 B;  4GYO A;  3KAE A;  4AOF A;  5LX8 A;  5A23 A;  2Y4T A;  3LDZ A;  4A55 A;  4U0U A;  3IHY A;  5LCW C;  3ZYQ A;  2WXF A;  3URZ A;  1JUQ A;  3UMV A;  3GW4 A;  5LP0 A;  4AP2 A;  4I17 A;  3WXX A;  3OAW A;  2MOW A;  3BG0 B;  4AY5 A;  3ASD A;  3PNL B;  3DBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...