2NC9A

Apo solution structure of hop tpr2a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
131
structure length
131
Chain Sequence
ENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Stress-induced-phosphoprotein 1
publication title Solution structure of the Hop TPR 2A domain and validation of novel approaches to inhibitor indentification by NMR, biochemical and in silico screening
rcsb
source organism Homo sapiens
total genus 49
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nc9A00
3Q49B 4G24A 4CGWA 3LY8A 4U0ZA 2VGXB 4I2ZA 1B89A 4LEUA 4G26A 5KJKA 4EQFA 2AVPA 4BTBA 4N3AA 5AYWD 2UWJG 4WNEA 4N3BA 3S7DA 2XGSA 4JA9A 4UQXA 4H7YA 2C2LA 4KXKB 1HH8A 4AY5A 2R5SA 3RO3A 4Y6WA 2KATA 4GA0A 3LCAA 4J8EA 3E4BA 3HYMB 3RO2A 1WAO1 4G2VA 2FI7A 1ELWA 1KLXA 1KT0A 5D0QD 3CVNA 3ASFA 3R9AB 2UY1A 1TJCA 2NC9A 4GYYA 5BT1A 3MV3B 4HOTA 3GZ1A 2PL2A 2V5FA 3FWVA 3IEGA 4WUYA 2L6JA 2LSVA 3QWWA 4JA7A 4IN3B 4UQZA 3NF1A 3Q4AB 3LY7A 4HOQA 4AIFA 2PQRA 5A6CA 2XGMA 2JLBA 4I9CA 4I1AA 4YVOA 3ZFWA 3CEQA 3MKRA 3FFLA 3CKCA 2OOEA 3CV0A 3GW4A 4ME2A 5BNWA 3ZN3A 2VYIA 4N5CA 3JYSA 5D0OD 4WNDA 4U04A 2LNIA 5FT9A 3TGOA 1P5QA 3O48A 3S7JA 3TG5A 4AM9A 4GYWA 1IYGA 5FJYA 1A17A 3KS2A 4GYOA 2XCBA 1ZBPA 5A7DB 4HOSA 3OXGA 2FF4A 2PQNA 5BW8C 1NZNA 4WNGA 2MHKA 3AS5A 4APOA 3KAEA 4I9EA 3LKUA 2PZIA 2GW1A 4RG9A 3U3WA 2IF4A 5KJNA 4B94A 1QZ2A 3CK9A 2UY1B 3SZ7A 1PC2A 1FCHA 2Y4TA 4RG6A 5LCWJ 4G1TA 2HO1A 2DBAA 3GZ2A 4XI0A 4KYOB 3QWVA 4WNFA 5C1DA 4GZ6A 3BEEA 2P58C 3N71A 3RKVA 5HQ8A 4XIFA 3UQ3A 4W9RA 1ELRA 4F3VA 3RIBA 3ESKA 1NA3A 5G05J 2XCCA 2XGOA 4U0SA 2VGYA 3TG4A 1OUVA 5G04J 2YHCA 1IHGA 4KBQA 3ZPJA 3AS8A 1WM5A 3ULQA 4J8DA 4ABNA 3CVQA 2XEVA 3CK7A 3OXFA 4NQ0A 3Q47B 3TAXA 2KC7A 4J0UA 4J8FA 3PE4A 3CKBA 4N3CA 3RJVA 2IFUA 5CHEE 5LCWC 5KJLA 2XPIA 4BWRA 5DIZA 3EDTB 1HXIA 5EX0A 4O6FA 3CK8A 4NRHB 4Y6CA 4GZ5A 2YQ8A 5JJ7A 1ZU2A 2ONDA 3ASHA 4YNDA 2HYZA 3ZHEA 5G05C 1Y8MA 4I17A 3S7BA 3Q15A 2VQ2A 4BTAA 5G04C 3MA5A 3MEKA 3PE3A 3PDNA 4UI9J 5M72A 4GPKA 1XNFA 4N39A 3GYZA 4U0UA 4N2QA 4JHRA 4GZ3A 5DBKA 2HR2A 3MV2B 1QQEA 2Q7FA 2VSYA 4AY6A 4N2SA 1KT1A 5JJTA 3VTYA 3Q5MA 4UQYA 5CCMA 5JJ6A 2VGXA 4I2WA 2LSUA 3CVPA 2Y4UA 2WPVA 3LPZA 3LYAA 2FBNA 3AS4A 3CVLA 1E96B 2WQHA 4BT9A 4JL0A 3WXXA 4GA1A 3FP3A 4HORA 5FZSA 5ARFA 4A1SA 3QWPA 5EKQD 2FEZA 4GCOA 1HZ4A 4G23A 2C0MA 4UI9K 3ASDA 4CDRA 4CGVA 1NA0A 4HOUA 5FZRA 3LY9A 2J9QA 2VSNA 5EX3A 4GCNA 3S7FA 4H7XA 4UI9C 4YVQC 3ASGA 3OXLA 4U07A 5KJMA 5HI7A 3URZA 3QOUA 3RU0A 4XI9A 5ARGA 3ZHEB 3K9IA 3UPVA 3ZGQA 2BUGA 5FZQA 1YA0A 2I6HA 3KD7A 3SF4A 4GA2A 2C0LA 2QFCA 3QDNA 5FTPA 2KCLA 1W3BA 2E2EA 3QKYA 2KCKA 5CCLA 3UUXA 3U4TA 4G25A 4BT8A 2KCVA 2FO7A 3VTXA
chains in the Genus database with same CATH superfamily
3Q49B 4G24A 1RW2A 3PREA 2P9NG 4HRNA 1TNZA 1U3DA 4JW1A 4FJYA 2AVPA 5AYWD 3EIQC 3L17A 4GTPA 4WNEA 2BKKB 1DNPA 4H7YA 3ZU7B 4HRMB 3UX4A 2LUHA 1SVXA 1JPLA 5FINA 3JQ1A 1INZA 4J8SA 1ELWA 2IEJA 2AWIA 3MJWA 1KLXA 4JHJA 5BV0A 4JD2G 3ZVVA 3AU5A 2WM9A 2UY1A 1TJCA 4GYYA 2QY7A 4BY6A 3FY4A 4B93B 1KZPA 3FU3A 1RZ4A 4HOTA 1UN9A 3LVRE 2V4LA 3C3QA 4K5CA 1TN7A 3ZIMA 2IQCA 3LY7A 3E33A 1TNBA 4BFRA 4A55A 3ZFWA 3AG2E 3CEQA 4GU5A 2WXIA 2MOWA 1HU3A 4L7TA 2I1KA 3L13A 3CV0A 2ZU6B 4TV3A 1ELKA 1FT1A 4F6RD 3B7SA 4F53A 5D0OD 4WNDA 1LD7A 3IKOB 3TGOA 3O48A 4GYWA 1A17A 1TYQG 2RD0A 3B7BA 3CHQA 3HG0D 5A7DB 4HOSA 3DSWA 3EU5A 1SW6A 2QYUA 2LXMA 4ANVA 3ISMC 3HDXA 3I5PA 4CEMA 3U64A 3C72A 4RG9A 4LUNU 3PZ4A 4C0MA 1KPSB 2UY1B 2BKGA 4C9BB 4EZKA 3FDHA 3ZEFA 1PC2A 2Y4TA 1UG3A 3DPDA 4G1TA 3GZ2A 3TWUA 2WXJA 4KYOB 1D8EA 1TNYA 3R7QA 4F1SA 2P58C 3IBEA 3UTMA 1TR4A 5HQ8A 5KWDA 3ML8A 3NQPA 3OAWA 4Q94A 3UKUG 4FULA 2BEDA 3FTWA 2XQ0A 1NA3A 4GPMA 5G05J 3IHYA 4A3VA 4KT6B 2PM6A 3CHSA 4BETA 4U0SA 4L2YA 3TG4A 2H6FA 4KZ0A 5ENRD 3QAQA 1IHGA 4JHKA 4KBQA 4XE0A 1X81A 3AS8A 2XPZA 4G8LA 5D2MC 3SD5A 2DZOA 1HF8A 4J8FA 3PE4A 3DWLG 3QARA 5ANRA 2L0IA 4Z68A 5CHEE 1HFAA 4R7LA 4YDYA 4DX6D 3TWRA 3D3MA 4WWOA 2WB2A 5C2YA 1OXJA 1FT2A 2R2LA 4L1BA 3CK8A 5EN5D 1AP7A 1N4SA 3FUKA 5CEDB 3SFZA 5JJ7A 3HRAA 3CVVA 1TEZA 1IQUA 5G05C 1S70B 3ZXPA 1LD8A 5G55A 4E6HA 3MA5A 3T8KA 2AW6A 1WDYA 3DXMG 3B7TA 2CHZA 5CECB 2RG8A 3JXJA 2DWZA 4BX9A 3KEZA 4IULA 4BERA 3MV2B 4N2SA 5JJTA 5T8IA 4UQYA 5ANLA 5CCMA 2GRMA 5JJ6A 4ZFHA 5LX8A 3TXNA 3TJPA 3V2XA 5ENQD 3ABLE 2IU1A 1N4RA 3PVLA 3AS4A 3CVLA 1TN6A 3TWQA 2P9IG 5CBOA 5FIOA 1MQSA 4BT9A 1IQRA 4P29A 2Y1LE 3FUNA 3HXBA 1N94A 1MZCA 1EDUA 4GMJA 5FZSA 3QWPA 2FEZA 1Z3YA 1IXVA 2YINA 2C0MA 2IOLA 1L5JA 4CDRA 4OVVA 4HOUA 2LO6A 3D9IA 4G11A 2VSNA 3HXEA 3CSTA 4ANXA 4O60A 1OWNA 4YVQC 3PZ2A 1OCOE 3OXLA 4U07A 1OWPA 2XS8A 2EIJE 3Q75A 1IKND 3R9MA 4CDNA 1H2TC 4QFVA 2WXFA 1UW4B 1TJFA 3UPVA 4BX8A 1N54A 1NFIE 1E90A 4QQIA 1E8XA 4UWGA 1OWOA 3L6AA 3E32A 3J5QB 3QDNA 2IY0C 3S2AA 5ITZF 2Y3AA 5CCLA 3CVWA 2YHEA 3V31A 2KCVA 2FO7A 3VTXA 4PDXA 4CGWA 1D9SA 4K5BA 4HRLA 4I1OB 3T9KA 5CRVA 4DPRA 5HKPA 2J08A 3C3OA 3PUJA 1E8YA 3FU6A 3KEAA 4G26A 4B89A 1OT8A 4XX5A 2FULA 4N3BA 3S7DA 3W9FA 2R02A 4JA9A 4UQXA 4KZCA 4DX2A 1OCZE 4AY5A 3MKQA 4TUUA 1TN8A 3RO3A 4Y6WA 4GA0A 3LCAA 2R03A 4J8EA 3BU8A 4G2VA 4UWHA 3RAUA 1JWFA 2HE0A 4A1GA 3VLEA 4ANUA 2CHXA 1S64A 3CVNA 4CCAA 2OCCE 1MJ0A 5BT1A 4IRUA 3UIPC 4AV7A 3CSFA 3FWVA 4YDWA 3ML9A 2DIWA 1BU9A 5HRYA 3JUEA 5BUZA 5JHBA 3UIOC 2PM7A 4HOQA 3V30A 1UJJA 3FUFA 4DJAA 2JLBA 3TWSA 4I1AA 3SBTB 2F0YA 2VTBB 5CBNA 4HVBA 3CKCA 3ONLA 2X3MA 1S0PA 3C98A 5BXUA 3FUJA 3KSLA 4DK5A 2CFZA 3CGHA 3GW4A 3APDA 1N4QA 3C5RA 3JYSA 3IXEA 4ILHB 3B7RL 4U04A 1E7UA 2I1JA 3F6QA 5FT9A 3FTVA 1P5QA 2QZAA 3S7JA 5KNHD 3U66A 2LAIA 1OWMA 4HFGA 5LOZA 3ASNE 5FQ4A 3MKQB 2B0OE 2PQNA 3UI2A 5EIDA 5JHAA 3NBNB 4I9EA 3LKUA 4TXQA 2GW1A 2WMNA 2IF4A 4APFA 5AQAA 3ABME 4O1PA 1H0AA 3SZ7A 1G3NB 1DC2A 4Q69A 1XGWA 4XI0A 3CQCB 1JWGA 2VGEA 2WXGA 4PS3A 4EBAG 5C1DA 4GZ6A 4JB8P 3MZLB 3QC1A 4GTRA 2X6IA 1S63A 1U2VG 4W9RA 1ELRA 4F3VA 5CMWA 1N52A 3ESKA 1OY3D 4AVXA 3J5PA 3SI5A 2XGOA 3LJNA 1H19A 2GRLA 2XZTG 1QNFA 3ZPJA 3CVQA 4GTSA 4WWPA 3HXFA 5AARA 4NQ0A 4U7EB 3MGBA 4GAAA 3Q47B 2XHEA 4GTQA 5HS0A 2P9KG 4DX5D 1BLXB 4N3CA 2R59A 1Z6TA 3RJVA 2IFUA 4O1OA 5EIBE 4RSYA 2XPIA 4FHKA 3EDTB 2IOSA 3NB2A 3CR3A 5EDSA 2CG3A 2ZXWE 2YQ8A 1QBQA 1LF8A 1D8DA 3R7RA 4UWKA 5JA4D 3UT4A 2KXPC 4I17A 2DYSE 2XEEA 2YNQA 1HE8A 4HNAD 4GB9A 1H6PA 5EYLA 3CVXA 4ILGA 3JUIA 3Q78A 2H6IA 3PE3A 2AXUA 3LXUX 3PDNA 5BPPA 2AXZA 5KBAA 4NACA 3E37A 2AJAA 1TNUA 4AXHA 3GYZA 4DX1A 2WXMA 4EHMA 4U0UA 4N2QA 3ULEG 4I43A 4PS8A 4U95D 1KT1A 3G2SA 2X6JA 2DYRE 3CVPA 3G2UA 2WXNA 2E0IA 3PEUB 4U8VD 4LNBA 1YMPA 4URKA 1JUQA 5T3RA 3LYAA 2IO2C 3WXXA 3HXDA 3QB2A 5KNGA 3FP3A 1O1RA 4RLYA 5ARFA 3QNKA 5EKQD 4UWLA 4AEZC 4CYMD 2VSXE 3FUHA 1DCEA 2L6BA 3G2TA 3I4GA 2WXQA 1N95A 3Q7AA 2ILRA 3NOGD 1O1TA 3RSEG 3UT8A 1UN8A 2B6CA 4DUIA 2ETCA 1N0RA 4NURA 1WG0A 1E8ZA 4JVSA 3FTYA 5E75A 4OAVB 2IJGX 5EYPF 3RU0A 5FQ8A 5ARGA 3K9IA 2I6HA 3U9WA 2QFCA 3UMVA 2KCLA 5G2NA 4XEIG 4XKCA 2J4BA 3DXKG 2CFUA 1WY6A 3FH7A 4FLHA 3PS6A 3D9KA 3DSTA 5LP0A 3QK0A 3PH0C 3G2WA 2GRNB 1SA4A 4LG6A 1HG2A 2GRRB 3DRAA 4EECA 4A63B 4ACLA 4U96D 4CDMA 3PNLB 2GRPB 3SBSA 4WAFA 2R05A 4LEUA 5KJKA 4EQFA 4BTBA 1H2VC 2UWJG 3PUKA 4PUCA 2XGSA 3CHRA 3FEYA 1LTXA 3HIZA 5CERB 2OVFA 1E8WA 4F1PA 2KATA 3APCA 5B1AE 3LEWA 3RO2A 3E34A 3ZYKA 1KT0A 2CG2A 2RFAA 4ILIA 2X6HA 2Y69E 5AN8A 5T4YA 4Q96A 2NC9A 3UM2A 4LSZE 3D9OA 2F8YA 4HQDA 3EIJA 3FUEA 4AJWA 2LAHA 2V5FA 4EPZA 3AAAC 4KVOA 3TWTA 3QWWA 2VJ8A 3NF1A 3Q4AB 5AQBA 1MX6A 1HO8A 4HLEA 4G8KA 4AIFA 2MYOA 4YVOA 3UT7A 3HXCA 4FHJA 4OYSA 3MKRA 4L23A 3AU4A 3DSXA 3FFLA 2WXLA 3JQ0A 1X5BA 3ZRHA 4GZDA 3CLJA 2OOEA 4E85A 3ESLA 5BNWA 3RK6A 3WG7E 3ZN3A 4N5CA 4PH4B 3DSVA 3FEXA 2I2OA 3FHEA 3TWXA 4LNUD 3TG5A 4AM9A 1IYGA 3KS2A 4N5QA 1ZBPA 3D9HA 3PNTB 3OXGA 5BW8C 1NZNA 3DPYA 4CT0A 4V3IA 2J8SD 1Y6IA 2MHKA 1N11A 4APOA 2L9BA 4FADA 1K1BA 2PZIA 3B7UX 2P9SG 3RRNB 4HI9A 5JMND 3T5XA 1GW6A 1FCHA 1Z3XA 5LCWJ 3UM3A 3MCXA 2HO1A 2DBAA 4MLPA 3I4RB 3QWVA 3L08A 3X2QE 5ENPD 1SA5A 3BEEA 5J90A 1SZAA 2HM8A 4HI8A 4ATGA 2DZNA 3FTZA 2RFMA 3ONKA 3RKVA 2QC9A 4MS6A 4XIFA 2WQ6A 1MYOA 3UQ3A 3TL5A 5B1BE 3RIBA 3BG0B 4FA6A 2WXRA 1H6OA 2ETAA 3PZ3A 2EQXA 1FPPA 4MRUA 2RKKA 5CMYA 3FUIA 5G04J 2YHCA 2V5QC 2WQ7A 1U3CA 5FQ6A 4J8DA 3PRZA 5E76A 4ABNA 2XEVA 3OXFA 3FU5A 1BD8A 1Z5SC 4EBAA 3TAXA 4U8HA 4GTTA 3CHMA 4DX7D 2XRZA 1EF1C 5BV1A 5FWQA 5LCWC 5KJLA 2H6HA 4BWRA 5EX0A 1HXIA 1BPOA 1TNOA 4I6EA 4I6JA 2H6GA 2PNNA 4IYPA 3SGHA 5AQ9A 4YNDA 3ZHEA 4K0RA 1Y8MA 3Q15A 2VQ2A 4BTAA 3CHOA 2IONA 4RQIA 4NIKA 3HVEA 3AG4E 5G04C 4XKBA 4ZHBA 5M72A 4U8YD 4UI9J 3PEVB 3AG3E 4HBDA 4JHRA 4GTMA 4GZ3A 1EPUA 5DBKA 3ZKJA 4K03A 4CRWA 1E7VA 4PS7A 4D10C 3L82A 4EZJA 3SHFA 2VSYA 2FO1E 3Q5MA 2V0PA 3DEOA 2VGXA 4M3OA 4BESA 5ENOD 3SO8A 3VLDA 2WPVA 3W9GA 3LPZA 2FBNA 3GZSA 3TWWA 3ZW3A 5J08A 3LVQE 4GA1A 3CQGB 1JCQA 4HORA 3ULYA 2XENA 4I6GA 4BSZB 2X6FA 5EILA 4GCOA 3T5VA 1N4PA 3G2VA 4G23A 4JEHA 5AIJA 2A4ZA 4ACKA 4CGVA 1NA0A 1K1AA 3TWVA 3D9NA 5FZRA 4TRQA 5CEAA 5D66A 2GGFA 3S7FA 4OAUC 4UI9C 3FULA 5IY5E 3ZNGA 1DVPA 2ETBA 5HI7A 2WXKA 3URZA 1SQMA 3QOUA 3ZXSA 3RRUA 2X38A 4XI9A 3ZHEB 2BUGA 5ENSD 1YA0A 4C0EA 4LERA 4JXTA 3B13A 3ZYQA 3EHQA 4AOFA 4A3TA 5FTPA 3HVEB 2ZIRA 5AAOA 1W3BA 3FTSA 3QKYA 2KCKA 3I3NA 3SFXA 4DLOA 4GMLA 3V79K 3U4TA 2WXOA 2LXLA 3JXIA 4BT8A 4KMOA 1MX2A 2XPYA 2GRQB 3LY8A 3LJ3A 1IHBA 4U0ZA 2VGXB 4I2ZA 2DCPA 1B89A 4KVMA 2EIKE 4B0ZA 1N0QA 2R17C 2WXPA 4N3AA 3E30A 4FLBA 3RRMB 1UJKA 4RVBA 4GTVA 4B8AA 2C2LA 2ZGDA 4KXKB 1HH8A 2R5SA 3P2BA 3E4BA 3HYMB 1WAO1 2FI7A 3IV0A 2DVWA 4C48B 1MX4A 3CIAA 5D0QD 4JZYA 5AQ7A 3ASFA 3R9AB 4WWNA 5ENTD 2BF0X 2X6KA 2I9CA 3MV3B 3FH5A 3GZ1A 2PL2A 5AJLA 2OV8A 4TUMA 3HHMA 3Q73A 3IEGA 4WUYA 2J09A 2L6JA 2M63A 2LSVA 4DRXE 4JA7A 2JABA 4IN3B 4UQZA 5KCMA 4ANWA 3ZYMA 2V8SE 2GROB 2PQRA 4K5AB 5A6CA 2XGMA 3DBSA 4I9CA 4BEPA 4ATZD 2J07A 3SFYA 3CVUA 3L22A 4B8CB 3B95A 4OVUA 2ZISA 1HX8A 4TXPA 3EHNA 1YCSB 4M7CA 3T8MA 1Q2ZA 4ME2A 2VYIA 3BQOA 4HXIA 3UINC 3ZUVB 1HS6A 4GMRA 1AWCB 1V55E 3EJNA 3UM1A 2LNIA 4F7AA 4MBGA 3CHPA 5FJYA 4GYOA 2XCBA 1FVHA 2J4DA 2WMOA 1BI8B 2KZTA 2FF4A 3PZ1A 4WNGA 5BXOA 3L16A 4LCTA 3AS5A 4YDOA 2WVIA 3KAEA 3BUAA 4GZCA 1ZB1A 2NXPA 4DLQA 3LS8A 3U3WA 1VDYA 5KJNA 4B94A 3NAWA 1QZ2A 3CK9A 3FTUA 2Y0BG 3FUMA 4RG6A 5ENNA 3DSUA 2BTDA 3FU0A 4UWFA 4WNFA 2XZDG 3DEPA 4MKTA 3L9TA 4FU3A 1O5MA 3UXGA 4HB5A 3N71A 1PY1A 2J49A 3ASOE 1FVFA 3OTNA 4XZ4A 3EUVA 5LFAA 3CVYA 2IO3C 2XCCA 1JCSA 3D9MA 1OCCE 5B3SE 2VGYA 3L54A 1OUVA 3EHRA 4AP2A 2NSZA 4FJZA 4GTOA 1WM5A 3ULQA 2AXVA 2XS1A 3SY2A 4L2LA 3CK7A 5H7PA 3AJIA 3SNXA 4J7WA 2KC7A 3DSSA 4J0UA 1EYHA 1UOHA 1HG5A 3CKBA 3FH8A 4FC8A 4EZLA 4CT4A 2KZTB 1OCRE 3TXMA 1JCRA 3D9PA 2JEKA 5DIZA 1DCQA 3MX3A 3LDZA 3Q79A 4O6FA 1MHQA 1QYMA 3NOCD 4L9PA 4NRHB 1PAQA 4TXRA 4Y6CA 3ABKE 4GZ5A 1V54E 2L0TB 2VTBA 4FP7A 1ZU2A 2ONDA 3ASHA 2HYZA 1YYHA 2A5EA 3S7BA 3P1UA 3IHVA 3MYVA 2P9LG 4BSXA 3AG1E 2KM4A 3MEKA 1K8KG 2V4HC 3V2OA 4LRZA 4GPKA 1XNFA 4JEUA 3Q9NC 4HLLA 4N39A 4X8QA 1KZOA 3BG1B 2F8XK 4HS2A 3EU9A 2WXHA 2ZGGA 2HR2A 1QQEA 4CZ2D 4J8YA 2Q7FA 4AY6A 3VTYA 1H6KA 3PZDA 4I2WA 2KBXA 2LSUA 5FQ7A 2Y4UA 2EIME 3FUDA 2CHWA 2P9PG 3KSQA 1E96B 2WQHA 1A5EA 4JL0A 3SQVA 2XEHA 4A1SA 1SZ9A 2P9UG 2OVBA 3NZUA 1HZ4A 3C3RA 4UI9K 3FTXA 3ASDA 3LY9A 2J9QA 3APFA 2XRYA 4LNGA 4JPSA 5EX3A 4GCNA 2EINE 4H7XA 4I1MA 5AJDA 3Q9UC 3VLFA 4JC8A 3ASGA 3EHMA 3Q7FA 5KJMA 1OWLA 3UKRG 3ENEA 2OEVA 3D9JA 1O1SA 3JCKC 5CRUA 4J6IA 2P2CP 3ZGQA 5FZQA 1N9AA 1K3ZD 2VSOE 2A5UA 2MRIA 5AENA 4DI3A 1NI1A 3KD7A 3SF4A 4GA2A 2F37A 1H2UA 3NZSA 2C0LA 4U63A 1NL4A 5A23A 2E2EA 3O4ZA 2OEWA 4YDEA 3D9LA 4DI4A 2QYJA 3UUXA 3UM0A 1BI7B 3ZYLA 4G25A 4UUCA 2NYJA 3QJZA 2EILE 1NP7A
chains in the Genus database with same CATH topology
3Q49B 4EECA 2XPYA 4G24A 4CGWA 4ACLA 3LY8A 3LJ3A 4CDMA 3PREA 4I1OB 4U0ZA 2VGXB 4I2ZA 4DPRA 2DCPA 3PNLB 1B89A 1U3DA 2J08A 4KVMA 3PUJA 4WAFA 3SBSA 4JW1A 1E8YA 3FU6A 4G26A 4FJYA 4LEUA 4B89A 5KJKA 4B0ZA 2WXPA 2R17C 4EQFA 2AVPA 4BTBA 1H2VC 4N3AA 5AYWD 3EIQC 2UWJG 3L17A 3PUKA 4XX5A 2FULA 4WNEA 4N3BA 3S7DA 4PUCA 2XGSA 4JA9A 4FLBA 4UQXA 3RRMB 3CHRA 1UJKA 4KZCA 4RVBA 3FEYA 4B8AA 1DNPA 4H7YA 2C2LA 3UX4A 4KXKB 1HH8A 3HIZA 4AY5A 2R5SA 1JPLA 3MKQA 3P2BA 2OVFA 4TUUA 1E8WA 3JQ1A 3RO3A 4Y6WA 2KATA 4GA0A 3APCA 3LCAA 3LEWA 4J8EA 3E4BA 3HYMB 3RO2A 1WAO1 4G2VA 2FI7A 4UWHA 3IV0A 4J8SA 1ELWA 1INZA 1JWFA 2AWIA 3MJWA 1KLXA 4A1GA 4JHJA 3ZYKA 5BV0A 3VLEA 4ANUA 1KT0A 2CG2A 3CIAA 3ZVVA 5D0QD 2CHXA 3AU5A 4JZYA 3CVNA 4CCAA 2WM9A 3ASFA 2UY1A 4ILIA 3R9AB 2X6HA 5T4YA 1TJCA 4Q96A 2NC9A 4GYYA 4WWNA 2QY7A 4BY6A 5BT1A 4IRUA 2BF0X 2X6KA 3FY4A 2I9CA 3D9OA 3MV3B 3FU3A 4HOTA 3FH5A 3GZ1A 2PL2A 5AJLA 2OV8A 3EIJA 3FUEA 4AJWA 3CSFA 4AV7A 2LAHA 2V5FA 4EPZA 3FWVA 3HHMA 4KVOA 3ML9A 1UN9A 3IEGA 3LVRE 4WUYA 2V4LA 2J09A 2L6JA 2DIWA 2M63A 2LSVA 3QWWA 2VJ8A 4JA7A 4IN3B 4UQZA 5KCMA 3NF1A 5BUZA 4ANWA 3Q4AB 3ZIMA 3ZYMA 5JHBA 1HO8A 2IQCA 2V8SE 2PM7A 3LY7A 4HOQA 4HLEA 4AIFA 2PQRA 1UJJA 5A6CA 2XGMA 3FUFA 4DJAA 3DBSA 2JLBA 4I9CA 4BFRA 4I1AA 3SBTB 4YVOA 4A55A 3UT7A 3ZFWA 3CEQA 2J07A 4FHJA 4OYSA 4GU5A 3MKRA 4L23A 2WXIA 3AU4A 2VTBB 3CVUA 3L22A 3FFLA 4HVBA 3CKCA 2WXLA 4B8CB 3JQ0A 3ONLA 4OVUA 2MOWA 1X5BA 2X3MA 3ZRHA 1S0PA 3C98A 1HX8A 1HU3A 3FUJA 4L7TA 4GZDA 3CLJA 2CFZA 3CGHA 2OOEA 4DK5A 2I1KA 3EHNA 3L13A 4E85A 3T8MA 3CV0A 2ZU6B 3GW4A 4TV3A 3APDA 1ELKA 4ME2A 3ESLA 5BNWA 3RK6A 3ZN3A 2VYIA 4HXIA 4N5CA 3B7SA 3JYSA 1HS6A 4ILHB 4F53A 4PH4B 5D0OD 4WNDA 3EJNA 3FEXA 3B7RL 4U04A 1E7UA 2I1JA 2I2OA 3FHEA 2LNIA 3IKOB 5FT9A 3FTVA 4F7AA 3TGOA 1P5QA 3O48A 3S7JA 3TG5A 3CHPA 4AM9A 4GYWA 3U66A 1IYGA 2LAIA 1OWMA 1A17A 5FJYA 3KS2A 4GYOA 4KMOA 2XCBA 1FVHA 1ZBPA 2J4DA 3PNTB 4HFGA 5LOZA 2WMOA 5FQ4A 3MKQB 2RD0A 3CHQA 2KZTA 5A7DB 4HOSA 3OXGA 2FF4A 2PQNA 5BW8C 1NZNA 4CT0A 4V3IA 1Y6IA 4WNGA 4ANVA 3L16A 2MHKA 4LCTA 5JHAA 3AS5A 3HDXA 2WVIA 3I5PA 4APOA 2L9BA 4CEMA 4FADA 3KAEA 4I9EA 3LKUA 4GZCA 2NXPA 2PZIA 4DLQA 2GW1A 3U64A 4RG9A 3LS8A 3U3WA 1VDYA 3B7UX 2WMNA 2IF4A 5KJNA 4LUNU 3RRNB 4C0MA 4B94A 4APFA 3T5XA 1QZ2A 3CK9A 1GW6A 2UY1B 4C9BB 4EZKA 3FDHA 1H0AA 3SZ7A 3ZEFA 1PC2A 3FTUA 1FCHA 2Y4TA 3FUMA 1UG3A 1Z3XA 4RG6A 5ENNA 3DPDA 5LCWJ 4G1TA 2BTDA 3MCXA 4Q69A 2HO1A 2DBAA 3GZ2A 1XGWA 4XI0A 2WXJA 4KYOB 3CQCB 3FU0A 1JWGA 4MLPA 4UWFA 3R7QA 4F1SA 3I4RB 3QWVA 3L08A 2WXGA 4WNFA 4PS3A 4EBAG 4MKTA 5C1DA 4GZ6A 3MZLB 3BEEA 3QC1A 4FU3A 5J90A 1SZAA 2HM8A 2P58C 3IBEA 4ATGA 3FTZA 3ONKA 3N71A 3RKVA 1PY1A 2X6IA 2J49A 4MS6A 5HQ8A 4XIFA 2WQ6A 3ML8A 3NQPA 3OAWA 3UQ3A 1FVFA 3OTNA 1ELRA 4Q94A 4W9RA 4XZ4A 4F3VA 5LFAA 3TL5A 3RIBA 3BG0B 5CMWA 1N52A 3ESKA 4FULA 2WXRA 4FA6A 3CVYA 3FTWA 2XQ0A 4AVXA 1NA3A 5G05J 2XCCA 3SI5A 2XGOA 3IHYA 3D9MA 4A3VA 4KT6B 2PM6A 2EQXA 3CHSA 4U0SA 1H19A 2VGYA 4MRUA 4L2YA 3L54A 3TG4A 1OUVA 5CMYA 3FUIA 2GRLA 4AP2A 4KZ0A 2NSZA 4FJZA 5G04J 1QNFA 2YHCA 3QAQA 1IHGA 4JHKA 4KBQA 2WQ7A 3ZPJA 4XE0A 1U3CA 3AS8A 1WM5A 3ULQA 5FQ6A 4J8DA 3PRZA 2AXVA 5E76A 4ABNA 3CVQA 2XEVA 4L2LA 3CK7A 3OXFA 4WWPA 2XPZA 3FU5A 4NQ0A 3MGBA 3SD5A 4GAAA 4EBAA 3Q47B 2XHEA 3SNXA 3TAXA 4U8HA 2KC7A 1HF8A 1EYHA 4J0UA 4J8FA 1HG5A 3CHMA 3PE4A 2XRZA 1EF1C 5BV1A 3CKBA 3FH8A 3QARA 4N3CA 2R59A 5ANRA 2L0IA 1Z6TA 4FC8A 3RJVA 2IFUA 5FWQA 4EZLA 5CHEE 5LCWC 1HFAA 4R7LA 4CT4A 2KZTB 5KJLA 4RSYA 2XPIA 3TXMA 3D3MA 4WWOA 4FHKA 3D9PA 2JEKA 5C2YA 4BWRA 2WB2A 5DIZA 3EDTB 1HXIA 5EX0A 2IOSA 4L1BA 3CR3A 3MX3A 3LDZA 4O6FA 1MHQA 5EDSA 3CK8A 1BPOA 2CG3A 4I6EA 4NRHB 1PAQA 4I6JA 4Y6CA 3FUKA 4GZ5A 2YQ8A 1LF8A 2L0TB 3SFZA 5JJ7A 3R7RA 4IYPA 3SGHA 2VTBA 4FP7A 1ZU2A 2ONDA 4UWKA 3CVVA 3ASHA 4YNDA 2HYZA 3ZHEA 3UT4A 1TEZA 1IQUA 5G05C 4K0RA 1Y8MA 4I17A 3S7BA 2YNQA 3Q15A 3P1UA 3IHVA 1HE8A 2VQ2A 4GB9A 4BTAA 3MYVA 3CHOA 2IONA 5G55A 4ILGA 3CVXA 3JUIA 4E6HA 4BSXA 3HVEA 5G04C 2KM4A 3MA5A 4XKBA 3MEKA 3PE3A 2AW6A 2AXUA 3LXUX 3PDNA 4UI9J 5BPPA 5M72A 4LRZA 2AXZA 4GPKA 4NACA 1XNFA 4JEUA 3B7TA 4N39A 2CHZA 4AXHA 2RG8A 3GYZA 3PEVB 2WXMA 3BG1B 4U0UA 4N2QA 4HS2A 4BX9A 4JHRA 4GZ3A 1EPUA 5DBKA 2WXHA 3KEZA 4IULA 4K03A 4CRWA 1E7VA 2HR2A 3MV2B 1QQEA 4I43A 4PS7A 4D10C 4PS8A 4EZJA 3SHFA 2Q7FA 2VSYA 4AY6A 4N2SA 1KT1A 5JJTA 3VTYA 1H6KA 3Q5MA 2V0PA 4UQYA 3G2SA 5ANLA 5T8IA 5CCMA 2GRMA 3PZDA 5JJ6A 2VGXA 4M3OA 5LX8A 4I2WA 2X6JA 3TXNA 3TJPA 2LSUA 3CVPA 3G2UA 5FQ7A 2IU1A 2E0IA 2WXNA 2Y4UA 3PEUB 3VLDA 3FUDA 2WPVA 3PVLA 4URKA 1JUQA 3LPZA 3LYAA 5T3RA 2FBNA 2CHWA 3AS4A 3CVLA 3GZSA 3ZW3A 5J08A 1E96B 1MQSA 2WQHA 4BT9A 1IQRA 3LVQE 4JL0A 4P29A 3FUNA 3WXXA 4GA1A 3QB2A 3CQGB 3FP3A 4HORA 4I6GA 1EDUA 4GMJA 5FZSA 5ARFA 4A1SA 3QNKA 3QWPA 4UWLA 5EKQD 2FEZA 4AEZC 1Z3YA 2X6FA 2VSXE 2YINA 1SZ9A 3NZUA 2OVBA 3FUHA 4GCOA 3T5VA 1HZ4A 3G2TA 3G2VA 3I4GA 2WXQA 4G23A 2C0MA 2IOLA 4UI9K 3FTXA 4JEHA 1L5JA 3ASDA 5AIJA 2A4ZA 4CDRA 4ACKA 4CGVA 4OVVA 1NA0A 3D9NA 2ILRA 4HOUA 5FZRA 3LY9A 2J9QA 2LO6A 3D9IA 4G11A 3APFA 2XRYA 2VSNA 4TRQA 4JPSA 3UT8A 5EX3A 3CSTA 1UN8A 2GGFA 4GCNA 3S7FA 4ANXA 4H7XA 4I1MA 4UI9C 5AJDA 3VLFA 1OWNA 4JC8A 4YVQC 3ASGA 3EHMA 3FULA 3OXLA 4U07A 4NURA 1OWPA 5KJMA 1DVPA 1OWLA 3ENEA 1E8ZA 4JVSA 5HI7A 3FTYA 5E75A 2WXKA 3URZA 1SQMA 4CDNA 2IJGX 3D9JA 1H2TC 4QFVA 3JCKC 3QOUA 3ZXSA 2WXFA 3RRUA 1UW4B 3RU0A 2X38A 1TJFA 4XI9A 5FQ8A 5ARGA 3ZHEB 3K9IA 3UPVA 4J6IA 3ZGQA 2BUGA 1N54A 5FZQA 4BX8A 2VSOE 1YA0A 1E90A 2A5UA 2I6HA 4C0EA 2MRIA 5AENA 4DI3A 4LERA 1E8XA 4UWGA 3KD7A 3SF4A 4GA2A 1OWOA 1H2UA 4JXTA 3NZSA 2C0LA 3B13A 3L6AA 4U63A 2QFCA 3U9WA 3ZYQA 3QDNA 4A3TA 4AOFA 5FTPA 2KCLA 3UMVA 3HVEB 5A23A 5G2NA 4XKCA 1W3BA 2E2EA 3FTSA 3O4ZA 3S2AA 3QKYA 2Y3AA 2J4BA 2KCKA 5CCLA 2CFUA 1WY6A 3I3NA 4DLOA 3D9LA 3CVWA 4GMLA 4DI4A 3FH7A 3UUXA 4FLHA 3ZYLA 3PS6A 2YHEA 3D9KA 3U4TA 2WXOA 4G25A 5LP0A 3QK0A 3PH0C 3G2WA 3QJZA 1HG2A 4BT8A 2KCVA 1NP7A 2FO7A 3VTXA 4PDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q49 B;  4G24 A;  4CGW A;  3LY8 A;  4U0Z A;  2VGX B;  4I2Z A;  1B89 A;  4LEU A;  4G26 A;  5KJK A;  4EQF A;  2AVP A;  4BTB A;  4N3A A;  5AYW D;  2UWJ G;  4WNE A;  4N3B A;  3S7D A;  2XGS A;  4JA9 A;  4UQX A;  4H7Y A;  2C2L A;  4KXK B;  1HH8 A;  4AY5 A;  2R5S A;  3RO3 A;  4Y6W A;  2KAT A;  4GA0 A;  3LCA A;  4J8E A;  3E4B A;  3HYM B;  3RO2 A;  1WAO 1;  4G2V A;  2FI7 A;  1ELW A;  1KLX A;  1KT0 A;  5D0Q D;  3CVN A;  3ASF A;  3R9A B;  2UY1 A;  1TJC A;  2NC9 A;  4GYY A;  5BT1 A;  3MV3 B;  4HOT A;  3GZ1 A;  2PL2 A;  2V5F A;  3FWV A;  3IEG A;  4WUY A;  2L6J A;  2LSV A;  3QWW A;  4JA7 A;  4IN3 B;  4UQZ A;  3NF1 A;  3Q4A B;  3LY7 A;  4HOQ A;  4AIF A;  2PQR A;  5A6C A;  2XGM A;  2JLB A;  4I9C A;  4I1A A;  4YVO A;  3ZFW A;  3CEQ A;  3MKR A;  3FFL A;  3CKC A;  2OOE A;  3CV0 A;  3GW4 A;  4ME2 A;  5BNW A;  3ZN3 A;  2VYI A;  4N5C A;  3JYS A;  5D0O D;  4WND A;  4U04 A;  2LNI A;  5FT9 A;  3TGO A;  1P5Q A;  3O48 A;  3S7J A;  3TG5 A;  4AM9 A;  4GYW A;  1IYG A;  5FJY A;  1A17 A;  3KS2 A;  4GYO A;  2XCB A;  1ZBP A;  5A7D B;  4HOS A;  3OXG A;  2FF4 A;  2PQN A;  5BW8 C;  1NZN A;  4WNG A;  2MHK A;  3AS5 A;  4APO A;  3KAE A;  4I9E A;  3LKU A;  2PZI A;  2GW1 A;  4RG9 A;  3U3W A;  2IF4 A;  5KJN A;  4B94 A;  1QZ2 A;  3CK9 A;  2UY1 B;  3SZ7 A;  1PC2 A;  1FCH A;  2Y4T A;  4RG6 A;  5LCW J;  4G1T A;  2HO1 A;  2DBA A;  3GZ2 A;  4XI0 A;  4KYO B;  3QWV A;  4WNF A;  5C1D A;  4GZ6 A;  3BEE A;  2P58 C;  3N71 A;  3RKV A;  5HQ8 A;  4XIF A;  3UQ3 A;  4W9R A;  1ELR A;  4F3V A;  3RIB A;  3ESK A;  1NA3 A;  5G05 J;  2XCC A;  2XGO A;  4U0S A;  2VGY A;  3TG4 A;  1OUV A;  5G04 J;  2YHC A;  1IHG A;  4KBQ A;  3ZPJ A;  3AS8 A;  1WM5 A;  3ULQ A;  4J8D A;  4ABN A;  3CVQ A;  2XEV A;  3CK7 A;  3OXF A;  4NQ0 A;  3Q47 B;  3TAX A;  2KC7 A;  4J0U A;  4J8F A;  3PE4 A;  3CKB A;  4N3C A;  3RJV A;  2IFU A;  5CHE E;  5LCW C;  5KJL A;  2XPI A;  4BWR A;  5DIZ A;  3EDT B;  1HXI A;  5EX0 A;  4O6F A;  3CK8 A;  4NRH B;  4Y6C A;  4GZ5 A;  2YQ8 A;  5JJ7 A;  1ZU2 A;  2OND A;  3ASH A;  4YND A;  2HYZ A;  3ZHE A;  5G05 C;  1Y8M A;  4I17 A;  3S7B A;  3Q15 A;  2VQ2 A;  4BTA A;  5G04 C;  3MA5 A;  3MEK A;  3PE3 A;  3PDN A;  4UI9 J;  5M72 A;  4GPK A;  1XNF A;  4N39 A;  3GYZ A;  4U0U A;  4N2Q A;  4JHR A;  4GZ3 A;  5DBK A;  2HR2 A;  3MV2 B;  1QQE A;  2Q7F A;  2VSY A;  4AY6 A;  4N2S A;  1KT1 A;  5JJT A;  3VTY A;  3Q5M A;  4UQY A;  5CCM A;  5JJ6 A;  2VGX A;  4I2W A;  2LSU A;  3CVP A;  2Y4U A;  2WPV A;  3LPZ A;  3LYA A;  2FBN A;  3AS4 A;  3CVL A;  1E96 B;  2WQH A;  4BT9 A;  4JL0 A;  3WXX A;  4GA1 A;  3FP3 A;  4HOR A;  5FZS A;  5ARF A;  4A1S A;  3QWP A;  5EKQ D;  2FEZ A;  4GCO A;  1HZ4 A;  4G23 A;  2C0M A;  4UI9 K;  3ASD A;  4CDR A;  4CGV A;  1NA0 A;  4HOU A;  5FZR A;  3LY9 A;  2J9Q A;  2VSN A;  5EX3 A;  4GCN A;  3S7F A;  4H7X A;  4UI9 C;  4YVQ C;  3ASG A;  3OXL A;  4U07 A;  5KJM A;  5HI7 A;  3URZ A;  3QOU A;  3RU0 A;  4XI9 A;  5ARG A;  3ZHE B;  3K9I A;  3UPV A;  3ZGQ A;  2BUG A;  5FZQ A;  1YA0 A;  2I6H A;  3KD7 A;  3SF4 A;  4GA2 A;  2C0L A;  2QFC A;  3QDN A;  5FTP A;  2KCL A;  1W3B A;  2E2E A;  3QKY A;  2KCK A;  5CCL A;  3UUX A;  3U4T A;  4G25 A;  4BT8 A;  2KCV A;  2FO7 A;  3VTX A; 
#chains in the Genus database with same CATH topology
 3Q49 B;  4G24 A;  1RW2 A;  3PRE A;  2P9N G;  4HRN A;  1TNZ A;  1U3D A;  4JW1 A;  4FJY A;  2AVP A;  5AYW D;  3EIQ C;  3L17 A;  4GTP A;  4WNE A;  2BKK B;  1DNP A;  4H7Y A;  3ZU7 B;  4HRM B;  3UX4 A;  2LUH A;  1SVX A;  1JPL A;  5FIN A;  3JQ1 A;  1INZ A;  4J8S A;  1ELW A;  2IEJ A;  2AWI A;  3MJW A;  1KLX A;  4JHJ A;  5BV0 A;  4JD2 G;  3ZVV A;  3AU5 A;  2WM9 A;  2UY1 A;  1TJC A;  4GYY A;  2QY7 A;  4BY6 A;  3FY4 A;  4B93 B;  1KZP A;  3FU3 A;  1RZ4 A;  4HOT A;  1UN9 A;  3LVR E;  2V4L A;  3C3Q A;  4K5C A;  1TN7 A;  3ZIM A;  2IQC A;  3LY7 A;  3E33 A;  1TNB A;  4BFR A;  4A55 A;  3ZFW A;  3AG2 E;  3CEQ A;  4GU5 A;  2WXI A;  2MOW A;  1HU3 A;  4L7T A;  2I1K A;  3L13 A;  3CV0 A;  2ZU6 B;  4TV3 A;  1ELK A;  1FT1 A;  4F6R D;  3B7S A;  4F53 A;  5D0O D;  4WND A;  1LD7 A;  3IKO B;  3TGO A;  3O48 A;  4GYW A;  1A17 A;  1TYQ G;  2RD0 A;  3B7B A;  3CHQ A;  3HG0 D;  5A7D B;  4HOS A;  3DSW A;  3EU5 A;  1SW6 A;  2QYU A;  2LXM A;  4ANV A;  3ISM C;  3HDX A;  3I5P A;  4CEM A;  3U64 A;  3C72 A;  4RG9 A;  4LUN U;  3PZ4 A;  4C0M A;  1KPS B;  2UY1 B;  2BKG A;  4C9B B;  4EZK A;  3FDH A;  3ZEF A;  1PC2 A;  2Y4T A;  1UG3 A;  3DPD A;  4G1T A;  3GZ2 A;  3TWU A;  2WXJ A;  4KYO B;  1D8E A;  1TNY A;  3R7Q A;  4F1S A;  2P58 C;  3IBE A;  3UTM A;  1TR4 A;  5HQ8 A;  5KWD A;  3ML8 A;  3NQP A;  3OAW A;  4Q94 A;  3UKU G;  4FUL A;  2BED A;  3FTW A;  2XQ0 A;  1NA3 A;  4GPM A;  5G05 J;  3IHY A;  4A3V A;  4KT6 B;  2PM6 A;  3CHS A;  4BET A;  4U0S A;  4L2Y A;  3TG4 A;  2H6F A;  4KZ0 A;  5ENR D;  3QAQ A;  1IHG A;  4JHK A;  4KBQ A;  4XE0 A;  1X81 A;  3AS8 A;  2XPZ A;  4G8L A;  5D2M C;  3SD5 A;  2DZO A;  1HF8 A;  4J8F A;  3PE4 A;  3DWL G;  3QAR A;  5ANR A;  2L0I A;  4Z68 A;  5CHE E;  1HFA A;  4R7L A;  4YDY A;  4DX6 D;  3TWR A;  3D3M A;  4WWO A;  2WB2 A;  5C2Y A;  1OXJ A;  1FT2 A;  2R2L A;  4L1B A;  3CK8 A;  5EN5 D;  1AP7 A;  1N4S A;  3FUK A;  5CED B;  3SFZ A;  5JJ7 A;  3HRA A;  3CVV A;  1TEZ A;  1IQU A;  5G05 C;  1S70 B;  3ZXP A;  1LD8 A;  5G55 A;  4E6H A;  3MA5 A;  3T8K A;  2AW6 A;  1WDY A;  3DXM G;  3B7T A;  2CHZ A;  5CEC B;  2RG8 A;  3JXJ A;  2DWZ A;  4BX9 A;  3KEZ A;  4IUL A;  4BER A;  3MV2 B;  4N2S A;  5JJT A;  5T8I A;  4UQY A;  5ANL A;  5CCM A;  2GRM A;  5JJ6 A;  4ZFH A;  5LX8 A;  3TXN A;  3TJP A;  3V2X A;  5ENQ D;  3ABL E;  2IU1 A;  1N4R A;  3PVL A;  3AS4 A;  3CVL A;  1TN6 A;  3TWQ A;  2P9I G;  5CBO A;  5FIO A;  1MQS A;  4BT9 A;  1IQR A;  4P29 A;  2Y1L E;  3FUN A;  3HXB A;  1N94 A;  1MZC A;  1EDU A;  4GMJ A;  5FZS A;  3QWP A;  2FEZ A;  1Z3Y A;  1IXV A;  2YIN A;  2C0M A;  2IOL A;  1L5J A;  4CDR A;  4OVV A;  4HOU A;  2LO6 A;  3D9I A;  4G11 A;  2VSN A;  3HXE A;  3CST A;  4ANX A;  4O60 A;  1OWN A;  4YVQ C;  3PZ2 A;  1OCO E;  3OXL A;  4U07 A;  1OWP A;  2XS8 A;  2EIJ E;  3Q75 A;  1IKN D;  3R9M A;  4CDN A;  1H2T C;  4QFV A;  2WXF A;  1UW4 B;  1TJF A;  3UPV A;  4BX8 A;  1N54 A;  1NFI E;  1E90 A;  4QQI A;  1E8X A;  4UWG A;  1OWO A;  3L6A A;  3E32 A;  3J5Q B;  3QDN A;  2IY0 C;  3S2A A;  5ITZ F;  2Y3A A;  5CCL A;  3CVW A;  2YHE A;  3V31 A;  2KCV A;  2FO7 A;  3VTX A;  4PDX A;  4CGW A;  1D9S A;  4K5B A;  4HRL A;  4I1O B;  3T9K A;  5CRV A;  4DPR A;  5HKP A;  2J08 A;  3C3O A;  3PUJ A;  1E8Y A;  3FU6 A;  3KEA A;  4G26 A;  4B89 A;  1OT8 A;  4XX5 A;  2FUL A;  4N3B A;  3S7D A;  3W9F A;  2R02 A;  4JA9 A;  4UQX A;  4KZC A;  4DX2 A;  1OCZ E;  4AY5 A;  3MKQ A;  4TUU A;  1TN8 A;  3RO3 A;  4Y6W A;  4GA0 A;  3LCA A;  2R03 A;  4J8E A;  3BU8 A;  4G2V A;  4UWH A;  3RAU A;  1JWF A;  2HE0 A;  4A1G A;  3VLE A;  4ANU A;  2CHX A;  1S64 A;  3CVN A;  4CCA A;  2OCC E;  1MJ0 A;  5BT1 A;  4IRU A;  3UIP C;  4AV7 A;  3CSF A;  3FWV A;  4YDW A;  3ML9 A;  2DIW A;  1BU9 A;  5HRY A;  3JUE A;  5BUZ A;  5JHB A;  3UIO C;  2PM7 A;  4HOQ A;  3V30 A;  1UJJ A;  3FUF A;  4DJA A;  2JLB A;  3TWS A;  4I1A A;  3SBT B;  2F0Y A;  2VTB B;  5CBN A;  4HVB A;  3CKC A;  3ONL A;  2X3M A;  1S0P A;  3C98 A;  5BXU A;  3FUJ A;  3KSL A;  4DK5 A;  2CFZ A;  3CGH A;  3GW4 A;  3APD A;  1N4Q A;  3C5R A;  3JYS A;  3IXE A;  4ILH B;  3B7R L;  4U04 A;  1E7U A;  2I1J A;  3F6Q A;  5FT9 A;  3FTV A;  1P5Q A;  2QZA A;  3S7J A;  5KNH D;  3U66 A;  2LAI A;  1OWM A;  4HFG A;  5LOZ A;  3ASN E;  5FQ4 A;  3MKQ B;  2B0O E;  2PQN A;  3UI2 A;  5EID A;  5JHA A;  3NBN B;  4I9E A;  3LKU A;  4TXQ A;  2GW1 A;  2WMN A;  2IF4 A;  4APF A;  5AQA A;  3ABM E;  4O1P A;  1H0A A;  3SZ7 A;  1G3N B;  1DC2 A;  4Q69 A;  1XGW A;  4XI0 A;  3CQC B;  1JWG A;  2VGE A;  2WXG A;  4PS3 A;  4EBA G;  5C1D A;  4GZ6 A;  4JB8 P;  3MZL B;  3QC1 A;  4GTR A;  2X6I A;  1S63 A;  1U2V G;  4W9R A;  1ELR A;  4F3V A;  5CMW A;  1N52 A;  3ESK A;  1OY3 D;  4AVX A;  3J5P A;  3SI5 A;  2XGO A;  3LJN A;  1H19 A;  2GRL A;  2XZT G;  1QNF A;  3ZPJ A;  3CVQ A;  4GTS A;  4WWP A;  3HXF A;  5AAR A;  4NQ0 A;  4U7E B;  3MGB A;  4GAA A;  3Q47 B;  2XHE A;  4GTQ A;  5HS0 A;  2P9K G;  4DX5 D;  1BLX B;  4N3C A;  2R59 A;  1Z6T A;  3RJV A;  2IFU A;  4O1O A;  5EIB E;  4RSY A;  2XPI A;  4FHK A;  3EDT B;  2IOS A;  3NB2 A;  3CR3 A;  5EDS A;  2CG3 A;  2ZXW E;  2YQ8 A;  1QBQ A;  1LF8 A;  1D8D A;  3R7R A;  4UWK A;  5JA4 D;  3UT4 A;  2KXP C;  4I17 A;  2DYS E;  2XEE A;  2YNQ A;  1HE8 A;  4HNA D;  4GB9 A;  1H6P A;  5EYL A;  3CVX A;  4ILG A;  3JUI A;  3Q78 A;  2H6I A;  3PE3 A;  2AXU A;  3LXU X;  3PDN A;  5BPP A;  2AXZ A;  5KBA A;  4NAC A;  3E37 A;  2AJA A;  1TNU A;  4AXH A;  3GYZ A;  4DX1 A;  2WXM A;  4EHM A;  4U0U A;  4N2Q A;  3ULE G;  4I43 A;  4PS8 A;  4U95 D;  1KT1 A;  3G2S A;  2X6J A;  2DYR E;  3CVP A;  3G2U A;  2WXN A;  2E0I A;  3PEU B;  4U8V D;  4LNB A;  1YMP A;  4URK A;  1JUQ A;  5T3R A;  3LYA A;  2IO2 C;  3WXX A;  3HXD A;  3QB2 A;  5KNG A;  3FP3 A;  1O1R A;  4RLY A;  5ARF A;  3QNK A;  5EKQ D;  4UWL A;  4AEZ C;  4CYM D;  2VSX E;  3FUH A;  1DCE A;  2L6B A;  3G2T A;  3I4G A;  2WXQ A;  1N95 A;  3Q7A A;  2ILR A;  3NOG D;  1O1T A;  3RSE G;  3UT8 A;  1UN8 A;  2B6C A;  4DUI A;  2ETC A;  1N0R A;  4NUR A;  1WG0 A;  1E8Z A;  4JVS A;  3FTY A;  5E75 A;  4OAV B;  2IJG X;  5EYP F;  3RU0 A;  5FQ8 A;  5ARG A;  3K9I A;  2I6H A;  3U9W A;  2QFC A;  3UMV A;  2KCL A;  5G2N A;  4XEI G;  4XKC A;  2J4B A;  3DXK G;  2CFU A;  1WY6 A;  3FH7 A;  4FLH A;  3PS6 A;  3D9K A;  3DST A;  5LP0 A;  3QK0 A;  3PH0 C;  3G2W A;  2GRN B;  1SA4 A;  4LG6 A;  1HG2 A;  2GRR B;  3DRA A;  4EEC A;  4A63 B;  4ACL A;  4U96 D;  4CDM A;  3PNL B;  2GRP B;  3SBS A;  4WAF A;  2R05 A;  4LEU A;  5KJK A;  4EQF A;  4BTB A;  1H2V C;  2UWJ G;  3PUK A;  4PUC A;  2XGS A;  3CHR A;  3FEY A;  1LTX A;  3HIZ A;  5CER B;  2OVF A;  1E8W A;  4F1P A;  2KAT A;  3APC A;  5B1A E;  3LEW A;  3RO2 A;  3E34 A;  3ZYK A;  1KT0 A;  2CG2 A;  2RFA A;  4ILI A;  2X6H A;  2Y69 E;  5AN8 A;  5T4Y A;  4Q96 A;  2NC9 A;  3UM2 A;  4LSZ E;  3D9O A;  2F8Y A;  4HQD A;  3EIJ A;  3FUE A;  4AJW A;  2LAH A;  2V5F A;  4EPZ A;  3AAA C;  4KVO A;  3TWT A;  3QWW A;  2VJ8 A;  3NF1 A;  3Q4A B;  5AQB A;  1MX6 A;  1HO8 A;  4HLE A;  4G8K A;  4AIF A;  2MYO A;  4YVO A;  3UT7 A;  3HXC A;  4FHJ A;  4OYS A;  3MKR A;  4L23 A;  3AU4 A;  3DSX A;  3FFL A;  2WXL A;  3JQ0 A;  1X5B A;  3ZRH A;  4GZD A;  3CLJ A;  2OOE A;  4E85 A;  3ESL A;  5BNW A;  3RK6 A;  3WG7 E;  3ZN3 A;  4N5C A;  4PH4 B;  3DSV A;  3FEX A;  2I2O A;  3FHE A;  3TWX A;  4LNU D;  3TG5 A;  4AM9 A;  1IYG A;  3KS2 A;  4N5Q A;  1ZBP A;  3D9H A;  3PNT B;  3OXG A;  5BW8 C;  1NZN A;  3DPY A;  4CT0 A;  4V3I A;  2J8S D;  1Y6I A;  2MHK A;  1N11 A;  4APO A;  2L9B A;  4FAD A;  1K1B A;  2PZI A;  3B7U X;  2P9S G;  3RRN B;  4HI9 A;  5JMN D;  3T5X A;  1GW6 A;  1FCH A;  1Z3X A;  5LCW J;  3UM3 A;  3MCX A;  2HO1 A;  2DBA A;  4MLP A;  3I4R B;  3QWV A;  3L08 A;  3X2Q E;  5ENP D;  1SA5 A;  3BEE A;  5J90 A;  1SZA A;  2HM8 A;  4HI8 A;  4ATG A;  2DZN A;  3FTZ A;  2RFM A;  3ONK A;  3RKV A;  2QC9 A;  4MS6 A;  4XIF A;  2WQ6 A;  1MYO A;  3UQ3 A;  3TL5 A;  5B1B E;  3RIB A;  3BG0 B;  4FA6 A;  2WXR A;  1H6O A;  2ETA A;  3PZ3 A;  2EQX A;  1FPP A;  4MRU A;  2RKK A;  5CMY A;  3FUI A;  5G04 J;  2YHC A;  2V5Q C;  2WQ7 A;  1U3C A;  5FQ6 A;  4J8D A;  3PRZ A;  5E76 A;  4ABN A;  2XEV A;  3OXF A;  3FU5 A;  1BD8 A;  1Z5S C;  4EBA A;  3TAX A;  4U8H A;  4GTT A;  3CHM A;  4DX7 D;  2XRZ A;  1EF1 C;  5BV1 A;  5FWQ A;  5LCW C;  5KJL A;  2H6H A;  4BWR A;  5EX0 A;  1HXI A;  1BPO A;  1TNO A;  4I6E A;  4I6J A;  2H6G A;  2PNN A;  4IYP A;  3SGH A;  5AQ9 A;  4YND A;  3ZHE A;  4K0R A;  1Y8M A;  3Q15 A;  2VQ2 A;  4BTA A;  3CHO A;  2ION A;  4RQI A;  4NIK A;  3HVE A;  3AG4 E;  5G04 C;  4XKB A;  4ZHB A;  5M72 A;  4U8Y D;  4UI9 J;  3PEV B;  3AG3 E;  4HBD A;  4JHR A;  4GTM A;  4GZ3 A;  1EPU A;  5DBK A;  3ZKJ A;  4K03 A;  4CRW A;  1E7V A;  4PS7 A;  4D10 C;  3L82 A;  4EZJ A;  3SHF A;  2VSY A;  2FO1 E;  3Q5M A;  2V0P A;  3DEO A;  2VGX A;  4M3O A;  4BES A;  5ENO D;  3SO8 A;  3VLD A;  2WPV A;  3W9G A;  3LPZ A;  2FBN A;  3GZS A;  3TWW A;  3ZW3 A;  5J08 A;  3LVQ E;  4GA1 A;  3CQG B;  1JCQ A;  4HOR A;  3ULY A;  2XEN A;  4I6G A;  4BSZ B;  2X6F A;  5EIL A;  4GCO A;  3T5V A;  1N4P A;  3G2V A;  4G23 A;  4JEH A;  5AIJ A;  2A4Z A;  4ACK A;  4CGV A;  1NA0 A;  1K1A A;  3TWV A;  3D9N A;  5FZR A;  4TRQ A;  5CEA A;  5D66 A;  2GGF A;  3S7F A;  4OAU C;  4UI9 C;  3FUL A;  5IY5 E;  3ZNG A;  1DVP A;  2ETB A;  5HI7 A;  2WXK A;  3URZ A;  1SQM A;  3QOU A;  3ZXS A;  3RRU A;  2X38 A;  4XI9 A;  3ZHE B;  2BUG A;  5ENS D;  1YA0 A;  4C0E A;  4LER A;  4JXT A;  3B13 A;  3ZYQ A;  3EHQ A;  4AOF A;  4A3T A;  5FTP A;  3HVE B;  2ZIR A;  5AAO A;  1W3B A;  3FTS A;  3QKY A;  2KCK A;  3I3N A;  3SFX A;  4DLO A;  4GML A;  3V79 K;  3U4T A;  2WXO A;  2LXL A;  3JXI A;  4BT8 A;  4KMO A;  1MX2 A;  2XPY A;  2GRQ B;  3LY8 A;  3LJ3 A;  1IHB A;  4U0Z A;  2VGX B;  4I2Z A;  2DCP A;  1B89 A;  4KVM A;  2EIK E;  4B0Z A;  1N0Q A;  2R17 C;  2WXP A;  4N3A A;  3E30 A;  4FLB A;  3RRM B;  1UJK A;  4RVB A;  4GTV A;  4B8A A;  2C2L A;  2ZGD A;  4KXK B;  1HH8 A;  2R5S A;  3P2B A;  3E4B A;  3HYM B;  1WAO 1;  2FI7 A;  3IV0 A;  2DVW A;  4C48 B;  1MX4 A;  3CIA A;  5D0Q D;  4JZY A;  5AQ7 A;  3ASF A;  3R9A B;  4WWN A;  5ENT D;  2BF0 X;  2X6K A;  2I9C A;  3MV3 B;  3FH5 A;  3GZ1 A;  2PL2 A;  5AJL A;  2OV8 A;  4TUM A;  3HHM A;  3Q73 A;  3IEG A;  4WUY A;  2J09 A;  2L6J A;  2M63 A;  2LSV A;  4DRX E;  4JA7 A;  2JAB A;  4IN3 B;  4UQZ A;  5KCM A;  4ANW A;  3ZYM A;  2V8S E;  2GRO B;  2PQR A;  4K5A B;  5A6C A;  2XGM A;  3DBS A;  4I9C A;  4BEP A;  4ATZ D;  2J07 A;  3SFY A;  3CVU A;  3L22 A;  4B8C B;  3B95 A;  4OVU A;  2ZIS A;  1HX8 A;  4TXP A;  3EHN A;  1YCS B;  4M7C A;  3T8M A;  1Q2Z A;  4ME2 A;  2VYI A;  3BQO A;  4HXI A;  3UIN C;  3ZUV B;  1HS6 A;  4GMR A;  1AWC B;  1V55 E;  3EJN A;  3UM1 A;  2LNI A;  4F7A A;  4MBG A;  3CHP A;  5FJY A;  4GYO A;  2XCB A;  1FVH A;  2J4D A;  2WMO A;  1BI8 B;  2KZT A;  2FF4 A;  3PZ1 A;  4WNG A;  5BXO A;  3L16 A;  4LCT A;  3AS5 A;  4YDO A;  2WVI A;  3KAE A;  3BUA A;  4GZC A;  1ZB1 A;  2NXP A;  4DLQ A;  3LS8 A;  3U3W A;  1VDY A;  5KJN A;  4B94 A;  3NAW A;  1QZ2 A;  3CK9 A;  3FTU A;  2Y0B G;  3FUM A;  4RG6 A;  5ENN A;  3DSU A;  2BTD A;  3FU0 A;  4UWF A;  4WNF A;  2XZD G;  3DEP A;  4MKT A;  3L9T A;  4FU3 A;  1O5M A;  3UXG A;  4HB5 A;  3N71 A;  1PY1 A;  2J49 A;  3ASO E;  1FVF A;  3OTN A;  4XZ4 A;  3EUV A;  5LFA A;  3CVY A;  2IO3 C;  2XCC A;  1JCS A;  3D9M A;  1OCC E;  5B3S E;  2VGY A;  3L54 A;  1OUV A;  3EHR A;  4AP2 A;  2NSZ A;  4FJZ A;  4GTO A;  1WM5 A;  3ULQ A;  2AXV A;  2XS1 A;  3SY2 A;  4L2L A;  3CK7 A;  5H7P A;  3AJI A;  3SNX A;  4J7W A;  2KC7 A;  3DSS A;  4J0U A;  1EYH A;  1UOH A;  1HG5 A;  3CKB A;  3FH8 A;  4FC8 A;  4EZL A;  4CT4 A;  2KZT B;  1OCR E;  3TXM A;  1JCR A;  3D9P A;  2JEK A;  5DIZ A;  1DCQ A;  3MX3 A;  3LDZ A;  3Q79 A;  4O6F A;  1MHQ A;  1QYM A;  3NOC D;  4L9P A;  4NRH B;  1PAQ A;  4TXR A;  4Y6C A;  3ABK E;  4GZ5 A;  1V54 E;  2L0T B;  2VTB A;  4FP7 A;  1ZU2 A;  2OND A;  3ASH A;  2HYZ A;  1YYH A;  2A5E A;  3S7B A;  3P1U A;  3IHV A;  3MYV A;  2P9L G;  4BSX A;  3AG1 E;  2KM4 A;  3MEK A;  1K8K G;  2V4H C;  3V2O A;  4LRZ A;  4GPK A;  1XNF A;  4JEU A;  3Q9N C;  4HLL A;  4N39 A;  4X8Q A;  1KZO A;  3BG1 B;  2F8X K;  4HS2 A;  3EU9 A;  2WXH A;  2ZGG A;  2HR2 A;  1QQE A;  4CZ2 D;  4J8Y A;  2Q7F A;  4AY6 A;  3VTY A;  1H6K A;  3PZD A;  4I2W A;  2KBX A;  2LSU A;  5FQ7 A;  2Y4U A;  2EIM E;  3FUD A;  2CHW A;  2P9P G;  3KSQ A;  1E96 B;  2WQH A;  1A5E A;  4JL0 A;  3SQV A;  2XEH A;  4A1S A;  1SZ9 A;  2P9U G;  2OVB A;  3NZU A;  1HZ4 A;  3C3R A;  4UI9 K;  3FTX A;  3ASD A;  3LY9 A;  2J9Q A;  3APF A;  2XRY A;  4LNG A;  4JPS A;  5EX3 A;  4GCN A;  2EIN E;  4H7X A;  4I1M A;  5AJD A;  3Q9U C;  3VLF A;  4JC8 A;  3ASG A;  3EHM A;  3Q7F A;  5KJM A;  1OWL A;  3UKR G;  3ENE A;  2OEV A;  3D9J A;  1O1S A;  3JCK C;  5CRU A;  4J6I A;  2P2C P;  3ZGQ A;  5FZQ A;  1N9A A;  1K3Z D;  2VSO E;  2A5U A;  2MRI A;  5AEN A;  4DI3 A;  1NI1 A;  3KD7 A;  3SF4 A;  4GA2 A;  2F37 A;  1H2U A;  3NZS A;  2C0L A;  4U63 A;  1NL4 A;  5A23 A;  2E2E A;  3O4Z A;  2OEW A;  4YDE A;  3D9L A;  4DI4 A;  2QYJ A;  3UUX A;  3UM0 A;  1BI7 B;  3ZYL A;  4G25 A;  4UUC A;  2NYJ A;  3QJZ A;  2EIL E;  1NP7 A; 
#chains in the Genus database with same CATH homology
 3Q49 B;  4EEC A;  2XPY A;  4G24 A;  4CGW A;  4ACL A;  3LY8 A;  3LJ3 A;  4CDM A;  3PRE A;  4I1O B;  4U0Z A;  2VGX B;  4I2Z A;  4DPR A;  2DCP A;  3PNL B;  1B89 A;  1U3D A;  2J08 A;  4KVM A;  3PUJ A;  4WAF A;  3SBS A;  4JW1 A;  1E8Y A;  3FU6 A;  4G26 A;  4FJY A;  4LEU A;  4B89 A;  5KJK A;  4B0Z A;  2WXP A;  2R17 C;  4EQF A;  2AVP A;  4BTB A;  1H2V C;  4N3A A;  5AYW D;  3EIQ C;  2UWJ G;  3L17 A;  3PUK A;  4XX5 A;  2FUL A;  4WNE A;  4N3B A;  3S7D A;  4PUC A;  2XGS A;  4JA9 A;  4FLB A;  4UQX A;  3RRM B;  3CHR A;  1UJK A;  4KZC A;  4RVB A;  3FEY A;  4B8A A;  1DNP A;  4H7Y A;  2C2L A;  3UX4 A;  4KXK B;  1HH8 A;  3HIZ A;  4AY5 A;  2R5S A;  1JPL A;  3MKQ A;  3P2B A;  2OVF A;  4TUU A;  1E8W A;  3JQ1 A;  3RO3 A;  4Y6W A;  2KAT A;  4GA0 A;  3APC A;  3LCA A;  3LEW A;  4J8E A;  3E4B A;  3HYM B;  3RO2 A;  1WAO 1;  4G2V A;  2FI7 A;  4UWH A;  3IV0 A;  4J8S A;  1ELW A;  1INZ A;  1JWF A;  2AWI A;  3MJW A;  1KLX A;  4A1G A;  4JHJ A;  3ZYK A;  5BV0 A;  3VLE A;  4ANU A;  1KT0 A;  2CG2 A;  3CIA A;  3ZVV A;  5D0Q D;  2CHX A;  3AU5 A;  4JZY A;  3CVN A;  4CCA A;  2WM9 A;  3ASF A;  2UY1 A;  4ILI A;  3R9A B;  2X6H A;  5T4Y A;  1TJC A;  4Q96 A;  2NC9 A;  4GYY A;  4WWN A;  2QY7 A;  4BY6 A;  5BT1 A;  4IRU A;  2BF0 X;  2X6K A;  3FY4 A;  2I9C A;  3D9O A;  3MV3 B;  3FU3 A;  4HOT A;  3FH5 A;  3GZ1 A;  2PL2 A;  5AJL A;  2OV8 A;  3EIJ A;  3FUE A;  4AJW A;  3CSF A;  4AV7 A;  2LAH A;  2V5F A;  4EPZ A;  3FWV A;  3HHM A;  4KVO A;  3ML9 A;  1UN9 A;  3IEG A;  3LVR E;  4WUY A;  2V4L A;  2J09 A;  2L6J A;  2DIW A;  2M63 A;  2LSV A;  3QWW A;  2VJ8 A;  4JA7 A;  4IN3 B;  4UQZ A;  5KCM A;  3NF1 A;  5BUZ A;  4ANW A;  3Q4A B;  3ZIM A;  3ZYM A;  5JHB A;  1HO8 A;  2IQC A;  2V8S E;  2PM7 A;  3LY7 A;  4HOQ A;  4HLE A;  4AIF A;  2PQR A;  1UJJ A;  5A6C A;  2XGM A;  3FUF A;  4DJA A;  3DBS A;  2JLB A;  4I9C A;  4BFR A;  4I1A A;  3SBT B;  4YVO A;  4A55 A;  3UT7 A;  3ZFW A;  3CEQ A;  2J07 A;  4FHJ A;  4OYS A;  4GU5 A;  3MKR A;  4L23 A;  2WXI A;  3AU4 A;  2VTB B;  3CVU A;  3L22 A;  3FFL A;  4HVB A;  3CKC A;  2WXL A;  4B8C B;  3JQ0 A;  3ONL A;  4OVU A;  2MOW A;  1X5B A;  2X3M A;  3ZRH A;  1S0P A;  3C98 A;  1HX8 A;  1HU3 A;  3FUJ A;  4L7T A;  4GZD A;  3CLJ A;  2CFZ A;  3CGH A;  2OOE A;  4DK5 A;  2I1K A;  3EHN A;  3L13 A;  4E85 A;  3T8M A;  3CV0 A;  2ZU6 B;  3GW4 A;  4TV3 A;  3APD A;  1ELK A;  4ME2 A;  3ESL A;  5BNW A;  3RK6 A;  3ZN3 A;  2VYI A;  4HXI A;  4N5C A;  3B7S A;  3JYS A;  1HS6 A;  4ILH B;  4F53 A;  4PH4 B;  5D0O D;  4WND A;  3EJN A;  3FEX A;  3B7R L;  4U04 A;  1E7U A;  2I1J A;  2I2O A;  3FHE A;  2LNI A;  3IKO B;  5FT9 A;  3FTV A;  4F7A A;  3TGO A;  1P5Q A;  3O48 A;  3S7J A;  3TG5 A;  3CHP A;  4AM9 A;  4GYW A;  3U66 A;  1IYG A;  2LAI A;  1OWM A;  1A17 A;  5FJY A;  3KS2 A;  4GYO A;  4KMO A;  2XCB A;  1FVH A;  1ZBP A;  2J4D A;  3PNT B;  4HFG A;  5LOZ A;  2WMO A;  5FQ4 A;  3MKQ B;  2RD0 A;  3CHQ A;  2KZT A;  5A7D B;  4HOS A;  3OXG A;  2FF4 A;  2PQN A;  5BW8 C;  1NZN A;  4CT0 A;  4V3I A;  1Y6I A;  4WNG A;  4ANV A;  3L16 A;  2MHK A;  4LCT A;  5JHA A;  3AS5 A;  3HDX A;  2WVI A;  3I5P A;  4APO A;  2L9B A;  4CEM A;  4FAD A;  3KAE A;  4I9E A;  3LKU A;  4GZC A;  2NXP A;  2PZI A;  4DLQ A;  2GW1 A;  3U64 A;  4RG9 A;  3LS8 A;  3U3W A;  1VDY A;  3B7U X;  2WMN A;  2IF4 A;  5KJN A;  4LUN U;  3RRN B;  4C0M A;  4B94 A;  4APF A;  3T5X A;  1QZ2 A;  3CK9 A;  1GW6 A;  2UY1 B;  4C9B B;  4EZK A;  3FDH A;  1H0A A;  3SZ7 A;  3ZEF A;  1PC2 A;  3FTU A;  1FCH A;  2Y4T A;  3FUM A;  1UG3 A;  1Z3X A;  4RG6 A;  5ENN A;  3DPD A;  5LCW J;  4G1T A;  2BTD A;  3MCX A;  4Q69 A;  2HO1 A;  2DBA A;  3GZ2 A;  1XGW A;  4XI0 A;  2WXJ A;  4KYO B;  3CQC B;  3FU0 A;  1JWG A;  4MLP A;  4UWF A;  3R7Q A;  4F1S A;  3I4R B;  3QWV A;  3L08 A;  2WXG A;  4WNF A;  4PS3 A;  4EBA G;  4MKT A;  5C1D A;  4GZ6 A;  3MZL B;  3BEE A;  3QC1 A;  4FU3 A;  5J90 A;  1SZA A;  2HM8 A;  2P58 C;  3IBE A;  4ATG A;  3FTZ A;  3ONK A;  3N71 A;  3RKV A;  1PY1 A;  2X6I A;  2J49 A;  4MS6 A;  5HQ8 A;  4XIF A;  2WQ6 A;  3ML8 A;  3NQP A;  3OAW A;  3UQ3 A;  1FVF A;  3OTN A;  1ELR A;  4Q94 A;  4W9R A;  4XZ4 A;  4F3V A;  5LFA A;  3TL5 A;  3RIB A;  3BG0 B;  5CMW A;  1N52 A;  3ESK A;  4FUL A;  2WXR A;  4FA6 A;  3CVY A;  3FTW A;  2XQ0 A;  4AVX A;  1NA3 A;  5G05 J;  2XCC A;  3SI5 A;  2XGO A;  3IHY A;  3D9M A;  4A3V A;  4KT6 B;  2PM6 A;  2EQX A;  3CHS A;  4U0S A;  1H19 A;  2VGY A;  4MRU A;  4L2Y A;  3L54 A;  3TG4 A;  1OUV A;  5CMY A;  3FUI A;  2GRL A;  4AP2 A;  4KZ0 A;  2NSZ A;  4FJZ A;  5G04 J;  1QNF A;  2YHC A;  3QAQ A;  1IHG A;  4JHK A;  4KBQ A;  2WQ7 A;  3ZPJ A;  4XE0 A;  1U3C A;  3AS8 A;  1WM5 A;  3ULQ A;  5FQ6 A;  4J8D A;  3PRZ A;  2AXV A;  5E76 A;  4ABN A;  3CVQ A;  2XEV A;  4L2L A;  3CK7 A;  3OXF A;  4WWP A;  2XPZ A;  3FU5 A;  4NQ0 A;  3MGB A;  3SD5 A;  4GAA A;  4EBA A;  3Q47 B;  2XHE A;  3SNX A;  3TAX A;  4U8H A;  2KC7 A;  1HF8 A;  1EYH A;  4J0U A;  4J8F A;  1HG5 A;  3CHM A;  3PE4 A;  2XRZ A;  1EF1 C;  5BV1 A;  3CKB A;  3FH8 A;  3QAR A;  4N3C A;  2R59 A;  5ANR A;  2L0I A;  1Z6T A;  4FC8 A;  3RJV A;  2IFU A;  5FWQ A;  4EZL A;  5CHE E;  5LCW C;  1HFA A;  4R7L A;  4CT4 A;  2KZT B;  5KJL A;  4RSY A;  2XPI A;  3TXM A;  3D3M A;  4WWO A;  4FHK A;  3D9P A;  2JEK A;  5C2Y A;  4BWR A;  2WB2 A;  5DIZ A;  3EDT B;  1HXI A;  5EX0 A;  2IOS A;  4L1B A;  3CR3 A;  3MX3 A;  3LDZ A;  4O6F A;  1MHQ A;  5EDS A;  3CK8 A;  1BPO A;  2CG3 A;  4I6E A;  4NRH B;  1PAQ A;  4I6J A;  4Y6C A;  3FUK A;  4GZ5 A;  2YQ8 A;  1LF8 A;  2L0T B;  3SFZ A;  5JJ7 A;  3R7R A;  4IYP A;  3SGH A;  2VTB A;  4FP7 A;  1ZU2 A;  2OND A;  4UWK A;  3CVV A;  3ASH A;  4YND A;  2HYZ A;  3ZHE A;  3UT4 A;  1TEZ A;  1IQU A;  5G05 C;  4K0R A;  1Y8M A;  4I17 A;  3S7B A;  2YNQ A;  3Q15 A;  3P1U A;  3IHV A;  1HE8 A;  2VQ2 A;  4GB9 A;  4BTA A;  3MYV A;  3CHO A;  2ION A;  5G55 A;  4ILG A;  3CVX A;  3JUI A;  4E6H A;  4BSX A;  3HVE A;  5G04 C;  2KM4 A;  3MA5 A;  4XKB A;  3MEK A;  3PE3 A;  2AW6 A;  2AXU A;  3LXU X;  3PDN A;  4UI9 J;  5BPP A;  5M72 A;  4LRZ A;  2AXZ A;  4GPK A;  4NAC A;  1XNF A;  4JEU A;  3B7T A;  4N39 A;  2CHZ A;  4AXH A;  2RG8 A;  3GYZ A;  3PEV B;  2WXM A;  3BG1 B;  4U0U A;  4N2Q A;  4HS2 A;  4BX9 A;  4JHR A;  4GZ3 A;  1EPU A;  5DBK A;  2WXH A;  3KEZ A;  4IUL A;  4K03 A;  4CRW A;  1E7V A;  2HR2 A;  3MV2 B;  1QQE A;  4I43 A;  4PS7 A;  4D10 C;  4PS8 A;  4EZJ A;  3SHF A;  2Q7F A;  2VSY A;  4AY6 A;  4N2S A;  1KT1 A;  5JJT A;  3VTY A;  1H6K A;  3Q5M A;  2V0P A;  4UQY A;  3G2S A;  5ANL A;  5T8I A;  5CCM A;  2GRM A;  3PZD A;  5JJ6 A;  2VGX A;  4M3O A;  5LX8 A;  4I2W A;  2X6J A;  3TXN A;  3TJP A;  2LSU A;  3CVP A;  3G2U A;  5FQ7 A;  2IU1 A;  2E0I A;  2WXN A;  2Y4U A;  3PEU B;  3VLD A;  3FUD A;  2WPV A;  3PVL A;  4URK A;  1JUQ A;  3LPZ A;  3LYA A;  5T3R A;  2FBN A;  2CHW A;  3AS4 A;  3CVL A;  3GZS A;  3ZW3 A;  5J08 A;  1E96 B;  1MQS A;  2WQH A;  4BT9 A;  1IQR A;  3LVQ E;  4JL0 A;  4P29 A;  3FUN A;  3WXX A;  4GA1 A;  3QB2 A;  3CQG B;  3FP3 A;  4HOR A;  4I6G A;  1EDU A;  4GMJ A;  5FZS A;  5ARF A;  4A1S A;  3QNK A;  3QWP A;  4UWL A;  5EKQ D;  2FEZ A;  4AEZ C;  1Z3Y A;  2X6F A;  2VSX E;  2YIN A;  1SZ9 A;  3NZU A;  2OVB A;  3FUH A;  4GCO A;  3T5V A;  1HZ4 A;  3G2T A;  3G2V A;  3I4G A;  2WXQ A;  4G23 A;  2C0M A;  2IOL A;  4UI9 K;  3FTX A;  4JEH A;  1L5J A;  3ASD A;  5AIJ A;  2A4Z A;  4CDR A;  4ACK A;  4CGV A;  4OVV A;  1NA0 A;  3D9N A;  2ILR A;  4HOU A;  5FZR A;  3LY9 A;  2J9Q A;  2LO6 A;  3D9I A;  4G11 A;  3APF A;  2XRY A;  2VSN A;  4TRQ A;  4JPS A;  3UT8 A;  5EX3 A;  3CST A;  1UN8 A;  2GGF A;  4GCN A;  3S7F A;  4ANX A;  4H7X A;  4I1M A;  4UI9 C;  5AJD A;  3VLF A;  1OWN A;  4JC8 A;  4YVQ C;  3ASG A;  3EHM A;  3FUL A;  3OXL A;  4U07 A;  4NUR A;  1OWP A;  5KJM A;  1DVP A;  1OWL A;  3ENE A;  1E8Z A;  4JVS A;  5HI7 A;  3FTY A;  5E75 A;  2WXK A;  3URZ A;  1SQM A;  4CDN A;  2IJG X;  3D9J A;  1H2T C;  4QFV A;  3JCK C;  3QOU A;  3ZXS A;  2WXF A;  3RRU A;  1UW4 B;  3RU0 A;  2X38 A;  1TJF A;  4XI9 A;  5FQ8 A;  5ARG A;  3ZHE B;  3K9I A;  3UPV A;  4J6I A;  3ZGQ A;  2BUG A;  1N54 A;  5FZQ A;  4BX8 A;  2VSO E;  1YA0 A;  1E90 A;  2A5U A;  2I6H A;  4C0E A;  2MRI A;  5AEN A;  4DI3 A;  4LER A;  1E8X A;  4UWG A;  3KD7 A;  3SF4 A;  4GA2 A;  1OWO A;  1H2U A;  4JXT A;  3NZS A;  2C0L A;  3B13 A;  3L6A A;  4U63 A;  2QFC A;  3U9W A;  3ZYQ A;  3QDN A;  4A3T A;  4AOF A;  5FTP A;  2KCL A;  3UMV A;  3HVE B;  5A23 A;  5G2N A;  4XKC A;  1W3B A;  2E2E A;  3FTS A;  3O4Z A;  3S2A A;  3QKY A;  2Y3A A;  2J4B A;  2KCK A;  5CCL A;  2CFU A;  1WY6 A;  3I3N A;  4DLO A;  3D9L A;  3CVW A;  4GML A;  4DI4 A;  3FH7 A;  3UUX A;  4FLH A;  3ZYL A;  3PS6 A;  2YHE A;  3D9K A;  3U4T A;  2WXO A;  4G25 A;  5LP0 A;  3QK0 A;  3PH0 C;  3G2W A;  3QJZ A;  1HG2 A;  4BT8 A;  2KCV A;  1NP7 A;  2FO7 A;  3VTX A;  4PDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...