2NC9A

Apo solution structure of hop tpr2a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
131
structure length
131
Chain Sequence
ENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced-phosphoprotein 1
publication title Solution structure of the Hop TPR 2A domain and validation of novel approaches to inhibitor indentification by NMR, biochemical and in silico screening
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 49
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nc9A00
2L6JA 3Q5MA 2PZIA 5KJLA 4I2WA 5M72A 4HOSA 2PL2A 1KT0A 5A6CA 3Q49B 5ARGA 5ARFA 4JA7A 3LCAA 2XGOA 4NQ0A 5KJMA 2BUGA 4O6FA 4H7YA 3AS4A 2PQRA 4I1AA 4EQFA 5BNWA 1HH8A 5EX3A 5CCLA 1NZNA 4HOUA 2R5SA 3CVLA 1PC2A 3CKCA 3K9IA 2VGXA 3ZN3A 3OXFA 2LNIA 3EDTB 5G05J 3ESKA 1IHGA 5G05C 3CVNA 4IN3B 3UUXA 4G26A 4H7XA 2VGXB 2FBNA 2XCBA 3R9AB 3VTXA 3NF1A 4HOQA 4G1TA 5BW8C 3O48A 4BWRA 3JYSA 5G04C 2I6HA 5JJ6A 2PQNA 1ELWA 3KS2A 3TAXA 4YVOA 4WNEA 4CDRA 3RJVA 3LY7A 4LEUA 2XGSA 3RKVA 2FEZA 3S7DA 5KJKA 3PE4A 3QOUA 4G24A 3QWWA 2IF4A 4JL0A 3ZGQA 2XGMA 2HO1A 4AY5A 4N5CA 3FWVA 1FCHA 3U4TA 3CVPA 3OXLA 4RG9A 1W3BA 3LY9A 5D0QD 2C0MA 2LSUA 3GYZA 5C1DA 2VSYA 3LYAA 4YNDA 4GYOA 4BT8A 1QZ2A 4GZ6A 3MEKA 4RG6A 4WNGA 4AM9A 5FTPA 3CVQA 2WQHA 2XPIA 2UWJG 3CEQA 4I9CA 4U0ZA 3ZFWA 4BTBA 2VGYA 3CK7A 1KT1A 2AVPA 4ABNA 4N3CA 3SZ7A 4U0UA 3FP3A 5FZRA 4HOTA 4UQZA 2XCCA 1ZBPA 2KCVA 2VSNA 3TG4A 4UI9J 3CKBA 4UI9C 3SF4A 3MKRA 3MV2B 3S7BA 3UQ3A 3TGOA 1OUVA 3CK9A 3KD7A 4BT9A 4A1SA 4GZ3A 4GA0A 5BT1A 2OOEA 3Q4AB 4F3VA 1NA0A 1ZU2A 4GCNA 5EX0A 5G04J 4U07A 2NC9A 2VQ2A 5KJNA 4J8DA 1A17A 5DIZA 2YHCA 3U3WA 2DBAA 3ZPJA 4J8FA 5DBKA 4G25A 1HZ4A 1IYGA 4GPKA 3S7FA 2Y4UA 3ASFA 3Q15A 1HXIA 2HR2A 1WAO1 3RU0A 4GA1A 4GZ5A 4N2QA 2Q7FA 3TG5A 4WNDA 4UI9K 4N2SA 4Y6CA 4JHRA 1WM5A 4W9RA 3UPVA 1B89A 3RIBA 4I2ZA 3ASGA 2J9QA 4APOA 4G2VA 1YA0A 4XI0A 3KAEA 4GA2A 2XEVA 5A7DB 4CGWA 5CHEE 4WNFA 5EKQD 4KXKB 1NA3A 4AIFA 2WPVA 3FFLA 4AY6A 3WXXA 3OXGA 2FO7A 1P5QA 3VTYA 3HYMB 2FF4A 3ULQA 1XNFA 4Y6WA 2C2LA 4GYYA 4WUYA 3QDNA 2E2EA 3LPZA 2HYZA 3CV0A 2KCLA 3CK8A 3QKYA 1Y8MA 4U0SA 3GZ1A 5FT9A 1QQEA 5FJYA 3ASDA 3RO2A 2KC7A 2UY1A 4B94A 4I9EA 1TJCA 2ONDA 3QWPA 4KBQA 5D0OD 3Q47B 4N39A 2V5FA 2GW1A 3URZA 5CCMA 3LY8A 3S7JA 4I17A 2UY1B 3GW4A 3ZHEA 3RO3A 2KCKA 3BEEA 1E96B 2C0LA 4UQXA 3QWVA 4U04A 4N3AA 4BTAA 2IFUA 4GCOA 2JLBA 4JA9A 3PE3A 3IEGA 5JJTA 4J8EA 5HI7A 1ELRA 4YVQC 2YQ8A 2Y4TA 2MHKA 3ZHEB 4G23A 2KATA 3MA5A 5AYWD 4CGVA 3AS5A 4XIFA 3ASHA 3PDNA 5FZSA 4NRHB 5JJ7A 4GYWA 4N3BA 2VYIA 4XI9A 5FZQA 5HQ8A 3N71A 2LSVA 4ME2A 2QFCA 3E4BA 4HORA 4J0UA 4KYOB 4UQYA 2P58C 2FI7A 3AS8A 3LKUA 3MV3B 3GZ2A 5LCWJ 5LCWC 1KLXA
chains in the Genus database with same CATH superfamily
1Z3XA 4HLLA 4E85A 2PZIA 2B0OE 3FTWA 4I2WA 4MLPA 3UT8A 1O1RA 4HOSA 3FTXA 5A6CA 2VJ8A 3FDHA 1O1TA 4JA7A 2VTBB 1IQRA 1DNPA 2X6HA 3DXMG 3QNKA 3PZ2A 5AJDA 4L23A 2PQRA 4I1AA 1UOHA 4EQFA 4JEUA 2BKKB 2YNQA 1N11A 4WWNA 4KZCA 4DUIA 4JB8P 1OCCE 3CVLA 3CKCA 4U95D 4AV7A 3TJPA 1NL4A 1BD8A 3KSQA 3FY4A 3UTMA 2NYJA 4DK5A 5G05C 4IN3B 4FHKA 3UUXA 4G26A 3L13A 4ILIA 2DWZA 1EYHA 4CRWA 2XCBA 3R9AB 3PZDA 4DLOA 1TN6A 1MHQA 2V5QC 3UT7A 4KMOA 4LG6A 3JYSA 1DCQA 3NOGD 2PQNA 4KVOA 4EBAG 4EHMA 3LVQE 5BUZA 4NURA 2F0YA 3D9PA 4CDRA 4GU5A 4TUMA 2F8YA 4AJWA 3RJVA 3D9JA 3LY7A 2XGSA 1OCZE 1OWPA 4MBGA 3DSUA 3QWWA 3ESLA 2IF4A 4JL0A 2HO1A 2I9CA 1EPUA 3CQGB 4OYSA 2ZXWE 3L17A 1AWCB 3MGBA 3TXNA 2EILE 4OVUA 2XPZA 1W3BA 3NB2A 1AP7A 3LY9A 2LSUA 2RD0A 2IQCA 5IY5E 1Z3YA 5ENOD 4TRQA 5C2YA 4FLBA 4FLHA 2VSYA 1DC2A 5CEDB 4YNDA 4GTSA 4LNGA 4HBDA 5AQBA 4GZ6A 4RG6A 3FU0A 5FIOA 3SD5A 1BU9A 3CVQA 5CRUA 4GAAA 2UWJG 1E90A 4I9CA 4PS8A 2VGYA 3CK7A 1H2VC 5CECB 3U64A 5AQ7A 1KT1A 3SHFA 3ZEFA 4N3CA 1OY3D 5EDSA 4JEHA 4U0UA 3ZUVB 2GRMA 3ZYMA 4HOTA 5BV0A 3FU6A 4CT0A 3JUIA 2L0TB 4F6RD 4UI9C 3CHRA 3SF4A 3T8MA 3PNTB 3TGOA 4DX2A 4GTRA 1MX6A 4GA0A 5BT1A 3JCKC 3FUEA 3PUKA 2RFMA 1NA0A 4CYMD 1E8YA 5G04J 4DI4A 2NC9A 3T8KA 5KJNA 4J8DA 3C72A 5ENTD 3IXEA 4ATZD 2BF0X 1HU3A 4HS2A 5B3SE 1OWOA 3CSFA 4LCTA 3FU5A 4DI3A 3MKQB 3Q15A 2HR2A 1WAO1 3Q73A 4GA1A 3FTZA 3TWTA 4JVSA 5LP0A 1JCSA 1SW6A 4DJAA 4U8YD 4HRMB 1H19A 4WAFA 4W9RA 3UPVA 5JHBA 1BPOA 3PH0C 4I2ZA 2J9QA 2DYRE 3FH7A 5FWQA 3KAEA 4GA2A 3ML8A 2WQ6A 2MYOA 1ELKA 4CDNA 2IO2C 4C0EA 4IULA 4DLQA 4BSXA 4KXKB 1NA3A 2X6IA 4AY6A 2FO7A 4F7AA 1QBQA 5AIJA 3VTYA 4C48B 1UW4B 4TXQA 3O4ZA 1MZCA 4IRUA 3FEYA 1TNZA 4I1OB 4GTPA 4GZDA 4PS7A 3C3RA 3UM2A 2C2LA 4GYYA 2WMOA 3FUNA 4L7TA 3J5QB 1SQMA 2J08A 4PUCA 3CK8A 1IHBA 1Y8MA 3R7RA 4U0SA 3DSTA 4A3VA 4ANWA 2XEHA 3QARA 4BY6A 2ONDA 3CR3A 2Y69E 3FUIA 3Q47B 2QZAA 2OEVA 4GPMA 3D3MA 2MOWA 3UXGA 3S7JA 4ZFHA 3ZHEA 2KCKA 3BEEA 3QWVA 4GTVA 4JW1A 3D9LA 3C98A 2XENA 2JLBA 2ZISA 4JA9A 4G11A 2WXHA 1UN8A 5KCMA 2XRZA 3IEGA 4PH4B 5ANLA 3PRZA 3PEVB 3ZVVA 2WXNA 2M63A 2MHKA 2BKGA 1YCSB 4G8LA 3MA5A 4HI9A 3G2SA 2WXKA 4L2YA 4XIFA 2V4LA 4NRHB 2VYIA 5HQ8A 2A5UA 2QFCA 2OCCE 4HORA 4J0UA 3B7RL 3ONLA 3FH5A 3MV3B 3EU5A 3GZ2A 1SA5A 5HRYA 1TNUA 5BXOA 3IV0A 3G2UA 5M72A 2PL2A 3FULA 4U63A 4I6GA 4CCAA 4GTOA 5ARFA 3BG1B 2IU1A 3FTSA 3RRUA 4TV3A 3SBSA 5KJMA 3V2XA 3UINC 3QJZA 3KSLA 3DEOA 3U66A 3AS4A 3RSEG 3ASNE 1KZPA 4P29A 3V2OA 5BNWA 3HHMA 1JCQA 5EX3A 3NAWA 4N5QA 1H6PA 1NZNA 4HOUA 4FC8A 4M3OA 3ZN3A 5JMND 3OXFA 4DPRA 2LNIA 1HX8A 2P9IG 2RKKA 2ZIRA 2AWIA 3L22A 5FINA 5G05J 1IHGA 3AG3E 1QYMA 3FTYA 2XZTG 3HRAA 3TWQA 2ETBA 4H7XA 1FT2A 2VGXB 1PAQA 2AXZA 4XKBA 3R9MA 2R05A 5ENSD 3UMVA 4BESA 3NF1A 1N0RA 4HOQA 2ETAA 3RK6A 3IHVA 2Y1LE 2I6HA 3SBTB 4J8SA 3JUEA 2ILRA 2OEWA 4C0MA 5KBAA 4EZKA 2J07A 1TNYA 4LEUA 2X3MA 4FA6A 2WB2A 3PE4A 3QOUA 5KNGA 2P9SG 4J6IA 3FTVA 3FUHA 4U96D 3CHPA 2FULA 5HS0A 3SFZA 1OCRE 2XZDG 4N5CA 3FWVA 3UKUG 4L1BA 3ABKE 4AVXA 3SO8A 1NI1A 3OXLA 4U8HA 4XX5A 2WXMA 4RG9A 3TL5A 5D0QD 3GYZA 2FO1E 5C1DA 3LYAA 2IOLA 3Q9NC 2IOSA 1EDUA 2X6FA 3ZIMA 1MX4A 2WXJA 4GYOA 4BT8A 1SZ9A 3UIOC 2GRNB 4AM9A 4YDYA 4RSYA 2XEEA 4K5CA 4GMLA 2WXOA 3JQ0A 3CEQA 3LEWA 3ZFWA 1S63A 1E7VA 1X5BA 3QC1A 3ZXSA 4ABNA 2P9PG 4BEPA 3B7SA 1OWNA 4TXPA 4DRXE 3FP3A 5AARA 4UQZA 2XCCA 2KCVA 2VSNA 3MCXA 3TG4A 4LERA 4UI9J 1HF8A 4DX7D 3UIPC 3KD7A 4I1MA 3HVEB 4WWPA 4A1SA 4TUUA 4L9PA 3Q4AB 4F3VA 3VLEA 3EJNA 1LF8A 5EX0A 5E76A 3EIJA 1A17A 4MS6A 2YHCA 4K5BA 4BFRA 4GTMA 2NSZA 1OCOE 1KPSB 5DBKA 4G25A 1HZ4A 1IYGA 3HXFA 4GPKA 1UG3A 3S7FA 3IHYA 5ENNA 5CRVA 3ENEA 4KZ0A 2Y0BG 1HXIA 1TNOA 3RU0A 1H2TC 4N2QA 2WM9A 2Q7FA 1DVPA 3UM1A 4WNDA 5AQAA 3D9MA 2CG2A 3E37A 4Y6CA 5AJLA 4JHKA 3RIBA 2WMNA 3KEZA 4X8QA 4G2VA 1BLXB 4LRZA 4FP7A 4FULA 3L08A 2DCPA 1N4PA 4BERA 2A5EA 1N52A 1Y6IA 3NOCD 3MYVA 5EKQD 1N4SA 1S70B 2DVWA 3WXXA 3OXGA 3Q7FA 2F37A 4HLEA 1XNFA 3GZSA 4B0ZA 3E33A 3W9GA 1G3NB 2JEKA 4BX9A 2P9UG 3DSWA 3DSVA 4WUYA 2OV8A 4FJZA 2AXVA 1WG0A 5CEAA 4A55A 4Q96A 3APDA 1DCEA 3DXKG 3QKYA 4HFGA 3NZSA 1O1SA 2AJAA 1QQEA 5FJYA 3ASDA 3RO2A 2WXRA 3PUJA 2UY1A 3DSXA 4I9EA 1TJCA 1N0QA 3HXEA 4EZJA 3QWPA 4DX1A 4KBQA 3PZ4A 4A63B 5CCMA 1EF1C 4V3IA 3D9IA 2GROB 2LXMA 3RO3A 3BU8A 4ANVA 2KZTB 1MQSA 2C0LA 4UQXA 1N4QA 4GCOA 2IONA 4J7WA 2LO6A 5HI7A 3ML9A 2GRRB 4YVQC 2YQ8A 5D66A 2L9BA 3HIZA 4JXTA 1S0PA 4RQIA 1GW6A 1Z5SC 3AG4E 3TWSA 1D8DA 3I5PA 3PDNA 1OT8A 1TR4A 3Q79A 5FZQA 3N71A 5LX8A 3MZLB 3HDXA 2AW6A 4U7EB 3SQVA 2VTBA 4MRUA 2AXUA 2L6JA 3Q5MA 4B8AA 5KJLA 2CG3A 2IO3C 3J5PA 2XQ0A 1E8WA 4AOFA 3UM0A 1KT0A 1HG5A 1U3DA 3NQPA 3Q49B 5ARGA 3LCAA 2XGOA 3EHMA 2BTDA 1OWMA 1HO8A 4O6FA 4D10C 3CLJA 5J08A 5CMYA 3U9WA 2GRPB 3TWUA 4URKA 4UWLA 3ZXPA 1U3CA 5EYLA 1FVHA 2HM8A 4O60A 3FUFA 1PC2A 4CEMA 1TYQG 3K9IA 2PM7A 1JPLA 3C3QA 1JWFA 3ESKA 5EYPF 2ZGDA 3CVNA 3MJWA 3FTUA 4OAVB 2QYUA 4BX8A 2YHEA 2CHWA 3SFXA 2J09A 2H6IA 1H2UA 3ZYLA 5G55A 2DZNA 2GRLA 4YDOA 2X6KA 1BI8B 3UI2A 3O48A 4BWRA 5G04C 1N54A 5JJ6A 1U2VG 1MX2A 3LDZA 5T4YA 3KS2A 3TAXA 3HXCA 1UN9A 4EZLA 4YVOA 4WNEA 1Z6TA 1OWLA 4AXHA 3JQ1A 4ANUA 1WY6A 3RKVA 3AJIA 3ISMC 4G24A 2R2LA 2F8XK 4K03A 3ZGQA 2NXPA 1V55E 4XE0A 4U8VD 1K8KG 3L54A 1FCHA 3APCA 3U4TA 1FT1A 2LAIA 3CVPA 4DX5D 2P2CP 4O1PA 3APFA 4AEZC 2H6FA 5CERB 1HG2A 2LXLA 3I3NA 5EIDA 1D8EA 1E8ZA 4QFVA 5AN8A 4HVBA 3CVWA 1K1BA 2IJGX 1H0AA 2H6GA 2WXQA 3EHQA 1QZ2A 3DBSA 2R02A 5FTPA 2V4HC 2WQHA 2KM4A 3S2AA 4ACLA 3T5XA 4PS3A 3DPYA 2EINE 2A4ZA 4BTBA 4JHJA 2OVBA 1O5MA 3PZ3A 2AVPA 3X2QE 1SZAA 3UM3A 2GGFA 3KEAA 3SZ7A 2HE0A 5FZRA 3D9HA 3ZU7B 2J4DA 2DZOA 5CBOA 3PZ1A 3MKRA 1OUVA 2CHXA 4LNUD 2R59A 4TXRA 4GZ3A 2WXGA 2OOEA 1ZU2A 3ABLE 4GCNA 1HS6A 4KVMA 3MKQA 4U07A 3RAUA 1IKND 3QK0A 1YYHA 5DIZA 3RRMB 3U3WA 4J8FA 3W9FA 4FADA 3ULEG 5T3RA 1E8XA 1NP7A 3ASFA 4I43A 4C9BB 1JCRA 1E7UA 2XRYA 4HI8A 2P9KG 3ZNGA 4UWGA 3FUJA 3CVXA 3T5VA 4N2SA 1HFAA 3SNXA 4Q94A 1B89A 1X81A 4B93B 4APOA 1YA0A 4XEIG 4XI0A 3AG2E 3HG0D 4HRLA 1FPPA 3VLDA 5JA4D 4F1PA 3NBNB 2WVIA 3FFLA 3ZKJA 1SVXA 2KXPC 4UUCA 3HYMB 2LAHA 2FF4A 2X6JA 3E34A 4HXIA 4JC8A 4WWOA 2IEJA 1YMPA 3PNLB 4Y6WA 2Y3AA 3QDNA 2E2EA 4I6JA 2HYZA 3CV0A 4JPSA 3WG7E 3FHEA 2X38A 5FT9A 4BETA 1D9SA 3DRAA 5KNHD 1FVFA 4B94A 4QQIA 2XS8A 2R03A 3V30A 3I4GA 1S64A 5J90A 3SI5A 3DPDA 4N39A 2V5FA 4APFA 3PVLA 3URZA 2R17C 3HXDA 3LY8A 4I17A 3EHRA 3GW4A 4LSZE 3G2VA 3AU4A 1E96B 4U04A 4N3AA 5D2MC 4BTAA 1N94A 2IFUA 3OTNA 2B6CA 3PE3A 5JJTA 4J8EA 3ZHEB 3C3OA 4G23A 3EU9A 5AYWD 4NACA 1OXJA 3CHMA 5ENQD 1H6KA 3UT4A 5JJ7A 4N3BA 3SGHA 2LSVA 1IXVA 1N4RA 4ACKA 4KYOB 4LNBA 4F1SA 2P58C 2FI7A 3LKUA 3PEUB 3L16A 5LCWC 3CHOA 1KZOA 5HKPA 2MRIA 4Q69A 5AAOA 4HB5A 3EHNA 3C5RA 2YINA 4NQ0A 2BUGA 4CZ2D 3BQOA 4H7YA 1RZ4A 3D9OA 5FQ4A 4JZYA 1HE8A 1N9AA 5H7PA 1VDYA 1HH8A 2OVFA 2V8SE 3DWLG 5EN5D 3IBEA 3TWRA 1UJJA 2I2OA 4EECA 5CCLA 5CMWA 4F53A 2R5SA 2JABA 2ZU6B 3PREA 2VGXA 4JD2G 3R7QA 4ILHB 3TWVA 2V0PA 3EDTB 3OAWA 1PY1A 1L5JA 4GMJA 2XS1A 1BI7B 1JWGA 4GMRA 3TXMA 1JUQA 3D9NA 2RG8A 2FBNA 2E0IA 3LXUX 3SFYA 5BV1A 3VTXA 1MJ0A 3JXIA 4G1TA 5BW8C 5KWDA 3NZUA 3DEPA 4GTQA 3CVYA 3VLFA 2I1JA 2KBXA 3BUAA 1H6OA 2QY7A 3G2WA 1V54E 1ELWA 3UX4A 2DYSE 3QAQA 1NFIE 1XGWA 5EIBE 4M7CA 3HXBA 4O1OA 2FEZA 5B1BE 4A1GA 3S7DA 5KJKA 3CIAA 2XGMA 4PDXA 3B95A 4OVVA 3P1UA 4AY5A 3L6AA 3Q75A 3PS6A 4MKTA 4FJYA 2WQ7A 4J8YA 4AP2A 3CSTA 4HQDA 3DSSA 4Z68A 4KT6B 3BG0B 2C0MA 1K3ZD 2CFUA 2VSOE 3UKRG 1Q2ZA 3L9TA 1LTXA 3RRNB 2QYJA 2WXIA 1TNBA 3MEKA 2P9NG 3CHQA 3ZYKA 4WNGA 3LJNA 3CVVA 4B89A 4CT4A 2QC9A 2XPIA 5EILA 4E6HA 4FHJA 3T9KA 4R7LA 2WXLA 4U0ZA 1WDYA 5FQ7A 5ENPD 3EUVA 3E32A 2RFAA 1TJFA 2LUHA 2ZGGA 1IQUA 3HVEA 3LJ3A 1K1AA 2EQXA 2WXPA 1ZBPA 5G2NA 4UWKA 1RW2A 2P9LG 3QB2A 3B13A 4GTTA 2EIJE 2ETCA 2L0IA 3CKBA 2H6HA 3S7BA 3MV2B 3UQ3A 3EIQC 3E30A 3ZYQA 3CK9A 4CDMA 4BT9A 3L82A 4ILGA 3B7BA 1TN7A 3ZW3A 1TN8A 1TEZA 2VQ2A 2DIWA 3AG1E 1SA4A 5JHAA 2DBAA 3ZPJA 4GB9A 3FUDA 2Y4UA 4RVBA 4OAUC 3ABME 5A23A 3P2BA 4G8KA 4DX6D 4GZ5A 3TWWA 4HRNA 3TG5A 5T8IA 4UI9K 3Q7AA 4JHRA 2CFZA 2L6BA 4RLYA 1WM5A 3SY2A 5CBNA 2WXFA 3ASGA 5BXUA 4ATGA 4ZHBA 3LS8A 3ULYA 5AENA 2XEVA 2PM6A 1UJKA 5AQ9A 3JXJA 5A7DB 4CGWA 3ZRHA 1ZB1A 5CHEE 1N95A 2IY0C 4WNFA 1MYOA 4AIFA 2WPVA 3FH8A 4FU3A 5FQ8A 1P5QA 4XKCA 3FUKA 2J4BA 3B7TA 3ULQA 5LOZA 3IKOB 3ONKA 2J49A 4GZCA 4K5AB 3MX3A 5E75A 3Q9UC 5ANRA 4L2LA 3LPZA 2CHZA 2KCLA 1LD8A 5ITZF 4B8CB 1INZA 3GZ1A 3V31A 5BPPA 3FU3A 2KC7A 2XPYA 2KZTA 4XZ4A 3CGHA 1QNFA 5D0OD 3B7UX 4UWHA 4YDWA 2GW1A 5LFAA 3I4RB 2PNNA 3FUMA 4NIKA 2UY1B 2EIME 3FEXA 4K0RA 3AU5A 4LUNU 4BSZB 3D9KA 3AAAC 3ASOE 3F6QA 1LD7A 4ANXA 2GRQB 1ELRA 4EBAA 4IYPA 4EPZA 2Y4TA 5ENRD 3CHSA 2VGEA 2KATA 3CQCB 4UWFA 4A3TA 4CGVA 3TWXA 3AS5A 1A5EA 3ASHA 5FZSA 2J8SD 4GYWA 3CVUA 3G2TA 4XI9A 4ME2A 4I6EA 3Q78A 2EIKE 3LVRE 3E4BA 3V79K 5FQ6A 4UQYA 5B1AE 3AS8A 2XHEA 5LCWJ 2VSXE 2BEDA 2I1KA 1KLXA 4YDEA 4HNAD
chains in the Genus database with same CATH topology
1Z3XA 2L6JA 3Q5MA 4B8AA 4E85A 2PZIA 3IV0A 5KJLA 2MRIA 2CG3A 4Q69A 2XQ0A 1E8WA 3FTWA 4I2WA 4MLPA 3UT8A 3G2UA 5M72A 4AOFA 4HOSA 2PL2A 3FULA 1KT0A 3FTXA 1HG5A 5A6CA 2VJ8A 1U3DA 4I6GA 4U63A 3EHNA 3NQPA 4CCAA 2YINA 3Q49B 3FDHA 5ARGA 5ARFA 3BG1B 4JA7A 2IU1A 3FTSA 4E6HA 1IQRA 1DNPA 2X6HA 3LCAA 3QNKA 3RRUA 2VTBB 2XGOA 3EHMA 4NQ0A 4TV3A 3SBSA 5KJMA 2BTDA 1OWMA 2BUGA 1HO8A 4O6FA 4D10C 3CLJA 3QJZA 5CMYA 5J08A 3U66A 5AJDA 3U9WA 4L23A 4H7YA 3AS4A 2PQRA 3D9OA 4I1AA 5FQ4A 4JZYA 1HE8A 4URKA 4P29A 1VDYA 4UWLA 4EQFA 4JEUA 5BNWA 1HH8A 3HHMA 2OVFA 2V8SE 1U3CA 2YNQA 5EX3A 3IBEA 4WWNA 1UJJA 4KZCA 1FVHA 2I2OA 4EECA 2HM8A 5CMWA 5CCLA 4F53A 3FUFA 1NZNA 4HOUA 2R5SA 4FC8A 2ZU6B 1PC2A 3CKCA 3CVLA 2VGXA 3K9IA 3PREA 4CEMA 2PM7A 3TJPA 4AV7A 4M3OA 3R7QA 1JPLA 3ZN3A 4ILHB 3OXFA 4DPRA 2LNIA 2V0PA 1HX8A 1JWFA 3EDTB 3OAWA 3FY4A 1PY1A 2AWIA 3ESKA 3L22A 5G05J 1IHGA 4DK5A 5G05C 1L5JA 3FTYA 3CVNA 3MJWA 3FTUA 4GMJA 4IN3B 4FHKA 3UUXA 1JWGA 4G26A 3TXMA 4BX8A 4H7XA 1JUQA 3D9NA 2VGXB 3L13A 2RG8A 2FBNA 2CHWA 2YHEA 4ILIA 1EYHA 2E0IA 3LXUX 4CRWA 5BV1A 1PAQA 2AXZA 2XCBA 2J09A 4XKBA 1H2UA 3R9AB 3VTXA 3ZYLA 5G55A 3PZDA 3UMVA 4DLOA 2GRLA 3NF1A 2X6KA 4HOQA 1MHQA 4G1TA 5BW8C 3UT7A 4KMOA 3NZUA 3CVYA 3O48A 3VLFA 4BWRA 3JYSA 2I1JA 3RK6A 3IHVA 5G04C 2QY7A 2I6HA 1N54A 3G2WA 5JJ6A 3SBTB 4J8SA 2PQNA 3LDZA 5T4YA 1ELWA 3KS2A 4KVOA 3TAXA 1UN9A 4EBAG 4EZLA 3LVQE 4YVOA 4WNEA 2ILRA 3UX4A 1Z6TA 5BUZA 1OWLA 4C0MA 4EZKA 4NURA 3D9PA 3JQ1A 3QAQA 4AXHA 4CDRA 4GU5A 1XGWA 4AJWA 4ANUA 3RJVA 2J07A 3D9JA 3LY7A 4LEUA 2XGSA 1WY6A 3RKVA 2X3MA 1OWPA 2FEZA 4FA6A 2WB2A 4A1GA 3S7DA 5KJKA 3PE4A 3QOUA 4J6IA 4G24A 3FTVA 3FUHA 3QWWA 3CIAA 3CHPA 3ESLA 4K03A 2IF4A 4JL0A 2FULA 2XGMA 2NXPA 4PDXA 3ZGQA 2HO1A 3SFZA 4XE0A 4OVVA 2I9CA 1EPUA 3CQGB 4OYSA 3P1UA 4AY5A 3L6AA 3L54A 4N5CA 3FWVA 1FCHA 3PS6A 4MKTA 3APCA 4L1BA 3L17A 4FJYA 3U4TA 2WQ7A 2LAIA 3CVPA 3MGBA 4AVXA 3TXNA 4OVUA 4AP2A 3OXLA 3CSTA 4U8HA 2XPZA 3APFA 4AEZC 4XX5A 2WXMA 4RG9A 3TL5A 1W3BA 4KT6B 1HG2A 3BG0B 3I3NA 3LY9A 5D0QD 2C0MA 2LSUA 2RD0A 2IQCA 3GYZA 1Z3YA 4TRQA 5C2YA 2CFUA 2VSOE 4FLBA 1E8ZA 4FLHA 4QFVA 5C1DA 2VSYA 4HVBA 3LYAA 2IOLA 2IOSA 1EDUA 2X6FA 3CVWA 3ZIMA 4YNDA 3RRNB 2IJGX 2WXIA 1H0AA 2WXQA 2WXJA 4GYOA 4BT8A 1QZ2A 1SZ9A 3DBSA 3MEKA 3FU0A 4GZ6A 4RG6A 3CHQA 3ZYKA 4WNGA 3SD5A 4AM9A 5FTPA 4RSYA 3CVQA 2WQHA 3CVVA 2KM4A 3S2AA 4ACLA 4GMLA 2WXOA 4B89A 4PS3A 3T5XA 2XPIA 4CT4A 3JQ0A 4FHJA 2UWJG 1E90A 4GAAA 2A4ZA 3CEQA 4R7LA 2WXLA 4I9CA 3LEWA 4U0ZA 3ZFWA 4PS8A 4BTBA 2VGYA 3CK7A 1H2VC 4JHJA 2OVBA 3U64A 1E7VA 1KT1A 2AVPA 3SHFA 1X5BA 3QC1A 5FQ7A 3ZXSA 3ZEFA 4ABNA 1SZAA 4N3CA 3B7SA 1OWNA 1TJFA 2GGFA 5EDSA 4JEHA 3SZ7A 4U0UA 3FP3A 2GRMA 1IQUA 3HVEA 5FZRA 3ZYMA 4HOTA 3LJ3A 5BV0A 4UQZA 2EQXA 2WXPA 2XCCA 1ZBPA 3FU6A 5G2NA 4UWKA 2KCVA 2J4DA 2VSNA 3MCXA 4CT0A 3JUIA 3QB2A 3B13A 3TG4A 2L0TB 4LERA 4UI9J 2L0IA 3CKBA 1HF8A 4UI9C 3CHRA 3SF4A 3T8MA 3PNTB 3MKRA 3MV2B 3S7BA 3UQ3A 3EIQC 3TGOA 3ZYQA 1OUVA 3CK9A 2CHXA 3KD7A 2R59A 4I1MA 4BT9A 4CDMA 4ILGA 3HVEB 4WWPA 4A1SA 4GZ3A 2WXGA 4GA0A 4TUUA 3JCKC 3FUEA 5BT1A 2OOEA 3Q4AB 4F3VA 3PUKA 1NA0A 3VLEA 1ZU2A 1E8YA 3EJNA 1LF8A 1HS6A 4GCNA 5EX0A 5E76A 4KVMA 3ZW3A 3MKQA 5G04J 3EIJA 4DI4A 1TEZA 4U07A 2NC9A 2VQ2A 5KJNA 3QK0A 4J8DA 1A17A 2DIWA 4MS6A 5DIZA 2YHCA 3RRMB 2BF0X 4BFRA 1HU3A 4HS2A 2NSZA 3U3WA 1OWOA 3CSFA 5JHAA 2DBAA 3ZPJA 4J8FA 5DBKA 4G25A 4GB9A 1HZ4A 1IYGA 4GPKA 3FUDA 4FADA 4LCTA 3FU5A 1UG3A 3S7FA 3IHYA 4DI3A 2Y4UA 5ENNA 4RVBA 3MKQB 3ENEA 5T3RA 1E8XA 1NP7A 3P2BA 4KZ0A 5A23A 3ASFA 3Q15A 4I43A 1HXIA 2HR2A 1WAO1 3RU0A 4GA1A 4GZ5A 1H2TC 4C9BB 4N2QA 3FTZA 2WM9A 1E7UA 2Q7FA 2XRYA 1DVPA 4JVSA 5LP0A 3TG5A 4UWGA 4WNDA 5T8IA 4UI9K 3FUJA 3CVXA 4DJAA 3D9MA 3T5VA 2CG2A 4N2SA 1HFAA 4Y6CA 4JHRA 1H19A 2CFZA 4WAFA 3SNXA 1WM5A 4W9RA 5AJLA 3UPVA 5JHBA 4Q94A 2WXFA 4JHKA 1BPOA 1B89A 3PH0C 3RIBA 2WMNA 4I2ZA 3ASGA 2J9QA 3KEZA 4G2VA 1YA0A 4APOA 4ATGA 3LS8A 4LRZA 4XI0A 4FP7A 4FULA 5AENA 3FH7A 5FWQA 3KAEA 4GA2A 2XEVA 3L08A 3ML8A 2PM6A 2WQ6A 1UJKA 1ELKA 2DCPA 5A7DB 4CDNA 4C0EA 4CGWA 1N52A 3ZRHA 3VLDA 1Y6IA 4IULA 5CHEE 4DLQA 4WNFA 4BSXA 3MYVA 5EKQD 4KXKB 1NA3A 4AIFA 2WPVA 2X6IA 3FH8A 4FU3A 2WVIA 3FFLA 5FQ8A 4AY6A 3WXXA 3OXGA 2FO7A 1P5QA 4F7AA 4XKCA 3FUKA 2J4BA 5AIJA 3VTYA 1UW4B 3HYMB 3O4ZA 2LAHA 3B7TA 2FF4A 3ULQA 1XNFA 4IRUA 2X6JA 4HLEA 3FEYA 3GZSA 4B0ZA 5LOZA 3IKOB 4HXIA 4JC8A 4I1OB 4WWOA 3PNLB 2JEKA 3ONKA 4BX9A 4GZDA 4PS7A 4Y6WA 2J49A 4GZCA 2C2LA 4GYYA 2Y3AA 2OV8A 3MX3A 4WUYA 2WMOA 3FUNA 4FJZA 5ANRA 5E75A 2XRZA 3QDNA 4L2LA 2E2EA 2AXVA 3LPZA 4I6JA 4L7TA 2HYZA 3CV0A 4A55A 2CHZA 3APDA 1SQMA 2J08A 2KCLA 3CK8A 4JPSA 4PUCA 4Q96A 3QKYA 3FHEA 1Y8MA 2X38A 3R7RA 4HFGA 4U0SA 4B8CB 3NZSA 1INZA 3GZ1A 5FT9A 4A3VA 4ANWA 1QQEA 5FJYA 3ASDA 3RO2A 5BPPA 3FU3A 2KC7A 2WXRA 1FVFA 3PUJA 2UY1A 3QARA 4B94A 4BY6A 2XPYA 4I9EA 1TJCA 2KZTA 2ONDA 4XZ4A 4EZJA 3QWPA 3CGHA 3CR3A 4KBQA 1QNFA 3I4GA 5D0OD 5J90A 3SI5A 3B7UX 3FUIA 4UWHA 3DPDA 3Q47B 4N39A 2V5FA 2GW1A 5LFAA 4APFA 3PVLA 3I4RB 3D3MA 3URZA 2R17C 1EF1C 2MOWA 3FUMA 4V3IA 5CCMA 3LY8A 3D9IA 3S7JA 4I17A 2UY1B 3GW4A 3ZHEA 3RO3A 2KCKA 3G2VA 3FEXA 4ANVA 2KZTB 1MQSA 4K0RA 3AU5A 3AU4A 3BEEA 1E96B 4LUNU 2C0LA 4UQXA 3QWVA 4U04A 4JW1A 4N3AA 3D9KA 4BTAA 3D9LA 3C98A 2IFUA 4GCOA 2JLBA 3OTNA 4JA9A 2IONA 4G11A 2WXHA 1UN8A 2LO6A 3PE3A 5KCMA 4ANXA 3IEGA 4PH4B 4J8EA 5ANLA 5JJTA 5HI7A 1ELRA 3ML9A 3PRZA 4IYPA 4YVQC 3PEVB 4EBAA 2YQ8A 3ZVVA 4EPZA 2Y4TA 2WXNA 2M63A 2MHKA 3ZHEB 2L9BA 4G23A 3CHSA 3HIZA 2KATA 3MA5A 5AYWD 3CQCB 4JXTA 4UWFA 4A3TA 3G2SA 2WXKA 1S0PA 4CGVA 4NACA 1GW6A 3AS5A 3CHMA 1H6KA 4L2YA 4XIFA 2V4LA 3ASHA 3I5PA 3UT4A 3PDNA 5FZSA 4NRHB 5JJ7A 4GYWA 4N3BA 3CVUA 3SGHA 3G2TA 2VYIA 4XI9A 5FZQA 5HQ8A 3N71A 2LSVA 3MZLB 4ME2A 5LX8A 4I6EA 2A5UA 2QFCA 3LVRE 3E4BA 2AW6A 3HDXA 4HORA 4ACKA 5FQ6A 4J0UA 3B7RL 4KYOB 4UQYA 4F1SA 2P58C 2FI7A 3AS8A 2XHEA 3FH5A 3ONLA 3LKUA 3MV3B 3PEUB 2VTBA 3GZ2A 4MRUA 2AXUA 3L16A 2VSXE 5LCWJ 2I1KA 5LCWC 1KLXA 3CHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6J A;  3Q5M A;  2PZI A;  5KJL A;  4I2W A;  5M72 A;  4HOS A;  2PL2 A;  1KT0 A;  5A6C A;  3Q49 B;  5ARG A;  5ARF A;  4JA7 A;  3LCA A;  2XGO A;  4NQ0 A;  5KJM A;  2BUG A;  4O6F A;  4H7Y A;  3AS4 A;  2PQR A;  4I1A A;  4EQF A;  5BNW A;  1HH8 A;  5EX3 A;  5CCL A;  1NZN A;  4HOU A;  2R5S A;  3CVL A;  1PC2 A;  3CKC A;  3K9I A;  2VGX A;  3ZN3 A;  3OXF A;  2LNI A;  3EDT B;  5G05 J;  3ESK A;  1IHG A;  5G05 C;  3CVN A;  4IN3 B;  3UUX A;  4G26 A;  4H7X A;  2VGX B;  2FBN A;  2XCB A;  3R9A B;  3VTX A;  3NF1 A;  4HOQ A;  4G1T A;  5BW8 C;  3O48 A;  4BWR A;  3JYS A;  5G04 C;  2I6H A;  5JJ6 A;  2PQN A;  1ELW A;  3KS2 A;  3TAX A;  4YVO A;  4WNE A;  4CDR A;  3RJV A;  3LY7 A;  4LEU A;  2XGS A;  3RKV A;  2FEZ A;  3S7D A;  5KJK A;  3PE4 A;  3QOU A;  4G24 A;  3QWW A;  2IF4 A;  4JL0 A;  3ZGQ A;  2XGM A;  2HO1 A;  4AY5 A;  4N5C A;  3FWV A;  1FCH A;  3U4T A;  3CVP A;  3OXL A;  4RG9 A;  1W3B A;  3LY9 A;  5D0Q D;  2C0M A;  2LSU A;  3GYZ A;  5C1D A;  2VSY A;  3LYA A;  4YND A;  4GYO A;  4BT8 A;  1QZ2 A;  4GZ6 A;  3MEK A;  4RG6 A;  4WNG A;  4AM9 A;  5FTP A;  3CVQ A;  2WQH A;  2XPI A;  2UWJ G;  3CEQ A;  4I9C A;  4U0Z A;  3ZFW A;  4BTB A;  2VGY A;  3CK7 A;  1KT1 A;  2AVP A;  4ABN A;  4N3C A;  3SZ7 A;  4U0U A;  3FP3 A;  5FZR A;  4HOT A;  4UQZ A;  2XCC A;  1ZBP A;  2KCV A;  2VSN A;  3TG4 A;  4UI9 J;  3CKB A;  4UI9 C;  3SF4 A;  3MKR A;  3MV2 B;  3S7B A;  3UQ3 A;  3TGO A;  1OUV A;  3CK9 A;  3KD7 A;  4BT9 A;  4A1S A;  4GZ3 A;  4GA0 A;  5BT1 A;  2OOE A;  3Q4A B;  4F3V A;  1NA0 A;  1ZU2 A;  4GCN A;  5EX0 A;  5G04 J;  4U07 A;  2NC9 A;  2VQ2 A;  5KJN A;  4J8D A;  1A17 A;  5DIZ A;  2YHC A;  3U3W A;  2DBA A;  3ZPJ A;  4J8F A;  5DBK A;  4G25 A;  1HZ4 A;  1IYG A;  4GPK A;  3S7F A;  2Y4U A;  3ASF A;  3Q15 A;  1HXI A;  2HR2 A;  1WAO 1;  3RU0 A;  4GA1 A;  4GZ5 A;  4N2Q A;  2Q7F A;  3TG5 A;  4WND A;  4UI9 K;  4N2S A;  4Y6C A;  4JHR A;  1WM5 A;  4W9R A;  3UPV A;  1B89 A;  3RIB A;  4I2Z A;  3ASG A;  2J9Q A;  4APO A;  4G2V A;  1YA0 A;  4XI0 A;  3KAE A;  4GA2 A;  2XEV A;  5A7D B;  4CGW A;  5CHE E;  4WNF A;  5EKQ D;  4KXK B;  1NA3 A;  4AIF A;  2WPV A;  3FFL A;  4AY6 A;  3WXX A;  3OXG A;  2FO7 A;  1P5Q A;  3VTY A;  3HYM B;  2FF4 A;  3ULQ A;  1XNF A;  4Y6W A;  2C2L A;  4GYY A;  4WUY A;  3QDN A;  2E2E A;  3LPZ A;  2HYZ A;  3CV0 A;  2KCL A;  3CK8 A;  3QKY A;  1Y8M A;  4U0S A;  3GZ1 A;  5FT9 A;  1QQE A;  5FJY A;  3ASD A;  3RO2 A;  2KC7 A;  2UY1 A;  4B94 A;  4I9E A;  1TJC A;  2OND A;  3QWP A;  4KBQ A;  5D0O D;  3Q47 B;  4N39 A;  2V5F A;  2GW1 A;  3URZ A;  5CCM A;  3LY8 A;  3S7J A;  4I17 A;  2UY1 B;  3GW4 A;  3ZHE A;  3RO3 A;  2KCK A;  3BEE A;  1E96 B;  2C0L A;  4UQX A;  3QWV A;  4U04 A;  4N3A A;  4BTA A;  2IFU A;  4GCO A;  2JLB A;  4JA9 A;  3PE3 A;  3IEG A;  5JJT A;  4J8E A;  5HI7 A;  1ELR A;  4YVQ C;  2YQ8 A;  2Y4T A;  2MHK A;  3ZHE B;  4G23 A;  2KAT A;  3MA5 A;  5AYW D;  4CGV A;  3AS5 A;  4XIF A;  3ASH A;  3PDN A;  5FZS A;  4NRH B;  5JJ7 A;  4GYW A;  4N3B A;  2VYI A;  4XI9 A;  5FZQ A;  5HQ8 A;  3N71 A;  2LSV A;  4ME2 A;  2QFC A;  3E4B A;  4HOR A;  4J0U A;  4KYO B;  4UQY A;  2P58 C;  2FI7 A;  3AS8 A;  3LKU A;  3MV3 B;  3GZ2 A;  5LCW J;  5LCW C;  1KLX A; 
#chains in the Genus database with same CATH topology
 1Z3X A;  4HLL A;  4E85 A;  2PZI A;  2B0O E;  3FTW A;  4I2W A;  4MLP A;  3UT8 A;  1O1R A;  4HOS A;  3FTX A;  5A6C A;  2VJ8 A;  3FDH A;  1O1T A;  4JA7 A;  2VTB B;  1IQR A;  1DNP A;  2X6H A;  3DXM G;  3QNK A;  3PZ2 A;  5AJD A;  4L23 A;  2PQR A;  4I1A A;  1UOH A;  4EQF A;  4JEU A;  2BKK B;  2YNQ A;  1N11 A;  4WWN A;  4KZC A;  4DUI A;  4JB8 P;  1OCC E;  3CVL A;  3CKC A;  4U95 D;  4AV7 A;  3TJP A;  1NL4 A;  1BD8 A;  3KSQ A;  3FY4 A;  3UTM A;  2NYJ A;  4DK5 A;  5G05 C;  4IN3 B;  4FHK A;  3UUX A;  4G26 A;  3L13 A;  4ILI A;  2DWZ A;  1EYH A;  4CRW A;  2XCB A;  3R9A B;  3PZD A;  4DLO A;  1TN6 A;  1MHQ A;  2V5Q C;  3UT7 A;  4KMO A;  4LG6 A;  3JYS A;  1DCQ A;  3NOG D;  2PQN A;  4KVO A;  4EBA G;  4EHM A;  3LVQ E;  5BUZ A;  4NUR A;  2F0Y A;  3D9P A;  4CDR A;  4GU5 A;  4TUM A;  2F8Y A;  4AJW A;  3RJV A;  3D9J A;  3LY7 A;  2XGS A;  1OCZ E;  1OWP A;  4MBG A;  3DSU A;  3QWW A;  3ESL A;  2IF4 A;  4JL0 A;  2HO1 A;  2I9C A;  1EPU A;  3CQG B;  4OYS A;  2ZXW E;  3L17 A;  1AWC B;  3MGB A;  3TXN A;  2EIL E;  4OVU A;  2XPZ A;  1W3B A;  3NB2 A;  1AP7 A;  3LY9 A;  2LSU A;  2RD0 A;  2IQC A;  5IY5 E;  1Z3Y A;  5ENO D;  4TRQ A;  5C2Y A;  4FLB A;  4FLH A;  2VSY A;  1DC2 A;  5CED B;  4YND A;  4GTS A;  4LNG A;  4HBD A;  5AQB A;  4GZ6 A;  4RG6 A;  3FU0 A;  5FIO A;  3SD5 A;  1BU9 A;  3CVQ A;  5CRU A;  4GAA A;  2UWJ G;  1E90 A;  4I9C A;  4PS8 A;  2VGY A;  3CK7 A;  1H2V C;  5CEC B;  3U64 A;  5AQ7 A;  1KT1 A;  3SHF A;  3ZEF A;  4N3C A;  1OY3 D;  5EDS A;  4JEH A;  4U0U A;  3ZUV B;  2GRM A;  3ZYM A;  4HOT A;  5BV0 A;  3FU6 A;  4CT0 A;  3JUI A;  2L0T B;  4F6R D;  4UI9 C;  3CHR A;  3SF4 A;  3T8M A;  3PNT B;  3TGO A;  4DX2 A;  4GTR A;  1MX6 A;  4GA0 A;  5BT1 A;  3JCK C;  3FUE A;  3PUK A;  2RFM A;  1NA0 A;  4CYM D;  1E8Y A;  5G04 J;  4DI4 A;  2NC9 A;  3T8K A;  5KJN A;  4J8D A;  3C72 A;  5ENT D;  3IXE A;  4ATZ D;  2BF0 X;  1HU3 A;  4HS2 A;  5B3S E;  1OWO A;  3CSF A;  4LCT A;  3FU5 A;  4DI3 A;  3MKQ B;  3Q15 A;  2HR2 A;  1WAO 1;  3Q73 A;  4GA1 A;  3FTZ A;  3TWT A;  4JVS A;  5LP0 A;  1JCS A;  1SW6 A;  4DJA A;  4U8Y D;  4HRM B;  1H19 A;  4WAF A;  4W9R A;  3UPV A;  5JHB A;  1BPO A;  3PH0 C;  4I2Z A;  2J9Q A;  2DYR E;  3FH7 A;  5FWQ A;  3KAE A;  4GA2 A;  3ML8 A;  2WQ6 A;  2MYO A;  1ELK A;  4CDN A;  2IO2 C;  4C0E A;  4IUL A;  4DLQ A;  4BSX A;  4KXK B;  1NA3 A;  2X6I A;  4AY6 A;  2FO7 A;  4F7A A;  1QBQ A;  5AIJ A;  3VTY A;  4C48 B;  1UW4 B;  4TXQ A;  3O4Z A;  1MZC A;  4IRU A;  3FEY A;  1TNZ A;  4I1O B;  4GTP A;  4GZD A;  4PS7 A;  3C3R A;  3UM2 A;  2C2L A;  4GYY A;  2WMO A;  3FUN A;  4L7T A;  3J5Q B;  1SQM A;  2J08 A;  4PUC A;  3CK8 A;  1IHB A;  1Y8M A;  3R7R A;  4U0S A;  3DST A;  4A3V A;  4ANW A;  2XEH A;  3QAR A;  4BY6 A;  2OND A;  3CR3 A;  2Y69 E;  3FUI A;  3Q47 B;  2QZA A;  2OEV A;  4GPM A;  3D3M A;  2MOW A;  3UXG A;  3S7J A;  4ZFH A;  3ZHE A;  2KCK A;  3BEE A;  3QWV A;  4GTV A;  4JW1 A;  3D9L A;  3C98 A;  2XEN A;  2JLB A;  2ZIS A;  4JA9 A;  4G11 A;  2WXH A;  1UN8 A;  5KCM A;  2XRZ A;  3IEG A;  4PH4 B;  5ANL A;  3PRZ A;  3PEV B;  3ZVV A;  2WXN A;  2M63 A;  2MHK A;  2BKG A;  1YCS B;  4G8L A;  3MA5 A;  4HI9 A;  3G2S A;  2WXK A;  4L2Y A;  4XIF A;  2V4L A;  4NRH B;  2VYI A;  5HQ8 A;  2A5U A;  2QFC A;  2OCC E;  4HOR A;  4J0U A;  3B7R L;  3ONL A;  3FH5 A;  3MV3 B;  3EU5 A;  3GZ2 A;  1SA5 A;  5HRY A;  1TNU A;  5BXO A;  3IV0 A;  3G2U A;  5M72 A;  2PL2 A;  3FUL A;  4U63 A;  4I6G A;  4CCA A;  4GTO A;  5ARF A;  3BG1 B;  2IU1 A;  3FTS A;  3RRU A;  4TV3 A;  3SBS A;  5KJM A;  3V2X A;  3UIN C;  3QJZ A;  3KSL A;  3DEO A;  3U66 A;  3AS4 A;  3RSE G;  3ASN E;  1KZP A;  4P29 A;  3V2O A;  5BNW A;  3HHM A;  1JCQ A;  5EX3 A;  3NAW A;  4N5Q A;  1H6P A;  1NZN A;  4HOU A;  4FC8 A;  4M3O A;  3ZN3 A;  5JMN D;  3OXF A;  4DPR A;  2LNI A;  1HX8 A;  2P9I G;  2RKK A;  2ZIR A;  2AWI A;  3L22 A;  5FIN A;  5G05 J;  1IHG A;  3AG3 E;  1QYM A;  3FTY A;  2XZT G;  3HRA A;  3TWQ A;  2ETB A;  4H7X A;  1FT2 A;  2VGX B;  1PAQ A;  2AXZ A;  4XKB A;  3R9M A;  2R05 A;  5ENS D;  3UMV A;  4BES A;  3NF1 A;  1N0R A;  4HOQ A;  2ETA A;  3RK6 A;  3IHV A;  2Y1L E;  2I6H A;  3SBT B;  4J8S A;  3JUE A;  2ILR A;  2OEW A;  4C0M A;  5KBA A;  4EZK A;  2J07 A;  1TNY A;  4LEU A;  2X3M A;  4FA6 A;  2WB2 A;  3PE4 A;  3QOU A;  5KNG A;  2P9S G;  4J6I A;  3FTV A;  3FUH A;  4U96 D;  3CHP A;  2FUL A;  5HS0 A;  3SFZ A;  1OCR E;  2XZD G;  4N5C A;  3FWV A;  3UKU G;  4L1B A;  3ABK E;  4AVX A;  3SO8 A;  1NI1 A;  3OXL A;  4U8H A;  4XX5 A;  2WXM A;  4RG9 A;  3TL5 A;  5D0Q D;  3GYZ A;  2FO1 E;  5C1D A;  3LYA A;  2IOL A;  3Q9N C;  2IOS A;  1EDU A;  2X6F A;  3ZIM A;  1MX4 A;  2WXJ A;  4GYO A;  4BT8 A;  1SZ9 A;  3UIO C;  2GRN B;  4AM9 A;  4YDY A;  4RSY A;  2XEE A;  4K5C A;  4GML A;  2WXO A;  3JQ0 A;  3CEQ A;  3LEW A;  3ZFW A;  1S63 A;  1E7V A;  1X5B A;  3QC1 A;  3ZXS A;  4ABN A;  2P9P G;  4BEP A;  3B7S A;  1OWN A;  4TXP A;  4DRX E;  3FP3 A;  5AAR A;  4UQZ A;  2XCC A;  2KCV A;  2VSN A;  3MCX A;  3TG4 A;  4LER A;  4UI9 J;  1HF8 A;  4DX7 D;  3UIP C;  3KD7 A;  4I1M A;  3HVE B;  4WWP A;  4A1S A;  4TUU A;  4L9P A;  3Q4A B;  4F3V A;  3VLE A;  3EJN A;  1LF8 A;  5EX0 A;  5E76 A;  3EIJ A;  1A17 A;  4MS6 A;  2YHC A;  4K5B A;  4BFR A;  4GTM A;  2NSZ A;  1OCO E;  1KPS B;  5DBK A;  4G25 A;  1HZ4 A;  1IYG A;  3HXF A;  4GPK A;  1UG3 A;  3S7F A;  3IHY A;  5ENN A;  5CRV A;  3ENE A;  4KZ0 A;  2Y0B G;  1HXI A;  1TNO A;  3RU0 A;  1H2T C;  4N2Q A;  2WM9 A;  2Q7F A;  1DVP A;  3UM1 A;  4WND A;  5AQA A;  3D9M A;  2CG2 A;  3E37 A;  4Y6C A;  5AJL A;  4JHK A;  3RIB A;  2WMN A;  3KEZ A;  4X8Q A;  4G2V A;  1BLX B;  4LRZ A;  4FP7 A;  4FUL A;  3L08 A;  2DCP A;  1N4P A;  4BER A;  2A5E A;  1N52 A;  1Y6I A;  3NOC D;  3MYV A;  5EKQ D;  1N4S A;  1S70 B;  2DVW A;  3WXX A;  3OXG A;  3Q7F A;  2F37 A;  4HLE A;  1XNF A;  3GZS A;  4B0Z A;  3E33 A;  3W9G A;  1G3N B;  2JEK A;  4BX9 A;  2P9U G;  3DSW A;  3DSV A;  4WUY A;  2OV8 A;  4FJZ A;  2AXV A;  1WG0 A;  5CEA A;  4A55 A;  4Q96 A;  3APD A;  1DCE A;  3DXK G;  3QKY A;  4HFG A;  3NZS A;  1O1S A;  2AJA A;  1QQE A;  5FJY A;  3ASD A;  3RO2 A;  2WXR A;  3PUJ A;  2UY1 A;  3DSX A;  4I9E A;  1TJC A;  1N0Q A;  3HXE A;  4EZJ A;  3QWP A;  4DX1 A;  4KBQ A;  3PZ4 A;  4A63 B;  5CCM A;  1EF1 C;  4V3I A;  3D9I A;  2GRO B;  2LXM A;  3RO3 A;  3BU8 A;  4ANV A;  2KZT B;  1MQS A;  2C0L A;  4UQX A;  1N4Q A;  4GCO A;  2ION A;  4J7W A;  2LO6 A;  5HI7 A;  3ML9 A;  2GRR B;  4YVQ C;  2YQ8 A;  5D66 A;  2L9B A;  3HIZ A;  4JXT A;  1S0P A;  4RQI A;  1GW6 A;  1Z5S C;  3AG4 E;  3TWS A;  1D8D A;  3I5P A;  3PDN A;  1OT8 A;  1TR4 A;  3Q79 A;  5FZQ A;  3N71 A;  5LX8 A;  3MZL B;  3HDX A;  2AW6 A;  4U7E B;  3SQV A;  2VTB A;  4MRU A;  2AXU A;  2L6J A;  3Q5M A;  4B8A A;  5KJL A;  2CG3 A;  2IO3 C;  3J5P A;  2XQ0 A;  1E8W A;  4AOF A;  3UM0 A;  1KT0 A;  1HG5 A;  1U3D A;  3NQP A;  3Q49 B;  5ARG A;  3LCA A;  2XGO A;  3EHM A;  2BTD A;  1OWM A;  1HO8 A;  4O6F A;  4D10 C;  3CLJ A;  5J08 A;  5CMY A;  3U9W A;  2GRP B;  3TWU A;  4URK A;  4UWL A;  3ZXP A;  1U3C A;  5EYL A;  1FVH A;  2HM8 A;  4O60 A;  3FUF A;  1PC2 A;  4CEM A;  1TYQ G;  3K9I A;  2PM7 A;  1JPL A;  3C3Q A;  1JWF A;  3ESK A;  5EYP F;  2ZGD A;  3CVN A;  3MJW A;  3FTU A;  4OAV B;  2QYU A;  4BX8 A;  2YHE A;  2CHW A;  3SFX A;  2J09 A;  2H6I A;  1H2U A;  3ZYL A;  5G55 A;  2DZN A;  2GRL A;  4YDO A;  2X6K A;  1BI8 B;  3UI2 A;  3O48 A;  4BWR A;  5G04 C;  1N54 A;  5JJ6 A;  1U2V G;  1MX2 A;  3LDZ A;  5T4Y A;  3KS2 A;  3TAX A;  3HXC A;  1UN9 A;  4EZL A;  4YVO A;  4WNE A;  1Z6T A;  1OWL A;  4AXH A;  3JQ1 A;  4ANU A;  1WY6 A;  3RKV A;  3AJI A;  3ISM C;  4G24 A;  2R2L A;  2F8X K;  4K03 A;  3ZGQ A;  2NXP A;  1V55 E;  4XE0 A;  4U8V D;  1K8K G;  3L54 A;  1FCH A;  3APC A;  3U4T A;  1FT1 A;  2LAI A;  3CVP A;  4DX5 D;  2P2C P;  4O1P A;  3APF A;  4AEZ C;  2H6F A;  5CER B;  1HG2 A;  2LXL A;  3I3N A;  5EID A;  1D8E A;  1E8Z A;  4QFV A;  5AN8 A;  4HVB A;  3CVW A;  1K1B A;  2IJG X;  1H0A A;  2H6G A;  2WXQ A;  3EHQ A;  1QZ2 A;  3DBS A;  2R02 A;  5FTP A;  2V4H C;  2WQH A;  2KM4 A;  3S2A A;  4ACL A;  3T5X A;  4PS3 A;  3DPY A;  2EIN E;  2A4Z A;  4BTB A;  4JHJ A;  2OVB A;  1O5M A;  3PZ3 A;  2AVP A;  3X2Q E;  1SZA A;  3UM3 A;  2GGF A;  3KEA A;  3SZ7 A;  2HE0 A;  5FZR A;  3D9H A;  3ZU7 B;  2J4D A;  2DZO A;  5CBO A;  3PZ1 A;  3MKR A;  1OUV A;  2CHX A;  4LNU D;  2R59 A;  4TXR A;  4GZ3 A;  2WXG A;  2OOE A;  1ZU2 A;  3ABL E;  4GCN A;  1HS6 A;  4KVM A;  3MKQ A;  4U07 A;  3RAU A;  1IKN D;  3QK0 A;  1YYH A;  5DIZ A;  3RRM B;  3U3W A;  4J8F A;  3W9F A;  4FAD A;  3ULE G;  5T3R A;  1E8X A;  1NP7 A;  3ASF A;  4I43 A;  4C9B B;  1JCR A;  1E7U A;  2XRY A;  4HI8 A;  2P9K G;  3ZNG A;  4UWG A;  3FUJ A;  3CVX A;  3T5V A;  4N2S A;  1HFA A;  3SNX A;  4Q94 A;  1B89 A;  1X81 A;  4B93 B;  4APO A;  1YA0 A;  4XEI G;  4XI0 A;  3AG2 E;  3HG0 D;  4HRL A;  1FPP A;  3VLD A;  5JA4 D;  4F1P A;  3NBN B;  2WVI A;  3FFL A;  3ZKJ A;  1SVX A;  2KXP C;  4UUC A;  3HYM B;  2LAH A;  2FF4 A;  2X6J A;  3E34 A;  4HXI A;  4JC8 A;  4WWO A;  2IEJ A;  1YMP A;  3PNL B;  4Y6W A;  2Y3A A;  3QDN A;  2E2E A;  4I6J A;  2HYZ A;  3CV0 A;  4JPS A;  3WG7 E;  3FHE A;  2X38 A;  5FT9 A;  4BET A;  1D9S A;  3DRA A;  5KNH D;  1FVF A;  4B94 A;  4QQI A;  2XS8 A;  2R03 A;  3V30 A;  3I4G A;  1S64 A;  5J90 A;  3SI5 A;  3DPD A;  4N39 A;  2V5F A;  4APF A;  3PVL A;  3URZ A;  2R17 C;  3HXD A;  3LY8 A;  4I17 A;  3EHR A;  3GW4 A;  4LSZ E;  3G2V A;  3AU4 A;  1E96 B;  4U04 A;  4N3A A;  5D2M C;  4BTA A;  1N94 A;  2IFU A;  3OTN A;  2B6C A;  3PE3 A;  5JJT A;  4J8E A;  3ZHE B;  3C3O A;  4G23 A;  3EU9 A;  5AYW D;  4NAC A;  1OXJ A;  3CHM A;  5ENQ D;  1H6K A;  3UT4 A;  5JJ7 A;  4N3B A;  3SGH A;  2LSV A;  1IXV A;  1N4R A;  4ACK A;  4KYO B;  4LNB A;  4F1S A;  2P58 C;  2FI7 A;  3LKU A;  3PEU B;  3L16 A;  5LCW C;  3CHO A;  1KZO A;  5HKP A;  2MRI A;  4Q69 A;  5AAO A;  4HB5 A;  3EHN A;  3C5R A;  2YIN A;  4NQ0 A;  2BUG A;  4CZ2 D;  3BQO A;  4H7Y A;  1RZ4 A;  3D9O A;  5FQ4 A;  4JZY A;  1HE8 A;  1N9A A;  5H7P A;  1VDY A;  1HH8 A;  2OVF A;  2V8S E;  3DWL G;  5EN5 D;  3IBE A;  3TWR A;  1UJJ A;  2I2O A;  4EEC A;  5CCL A;  5CMW A;  4F53 A;  2R5S A;  2JAB A;  2ZU6 B;  3PRE A;  2VGX A;  4JD2 G;  3R7Q A;  4ILH B;  3TWV A;  2V0P A;  3EDT B;  3OAW A;  1PY1 A;  1L5J A;  4GMJ A;  2XS1 A;  1BI7 B;  1JWG A;  4GMR A;  3TXM A;  1JUQ A;  3D9N A;  2RG8 A;  2FBN A;  2E0I A;  3LXU X;  3SFY A;  5BV1 A;  3VTX A;  1MJ0 A;  3JXI A;  4G1T A;  5BW8 C;  5KWD A;  3NZU A;  3DEP A;  4GTQ A;  3CVY A;  3VLF A;  2I1J A;  2KBX A;  3BUA A;  1H6O A;  2QY7 A;  3G2W A;  1V54 E;  1ELW A;  3UX4 A;  2DYS E;  3QAQ A;  1NFI E;  1XGW A;  5EIB E;  4M7C A;  3HXB A;  4O1O A;  2FEZ A;  5B1B E;  4A1G A;  3S7D A;  5KJK A;  3CIA A;  2XGM A;  4PDX A;  3B95 A;  4OVV A;  3P1U A;  4AY5 A;  3L6A A;  3Q75 A;  3PS6 A;  4MKT A;  4FJY A;  2WQ7 A;  4J8Y A;  4AP2 A;  3CST A;  4HQD A;  3DSS A;  4Z68 A;  4KT6 B;  3BG0 B;  2C0M A;  1K3Z D;  2CFU A;  2VSO E;  3UKR G;  1Q2Z A;  3L9T A;  1LTX A;  3RRN B;  2QYJ A;  2WXI A;  1TNB A;  3MEK A;  2P9N G;  3CHQ A;  3ZYK A;  4WNG A;  3LJN A;  3CVV A;  4B89 A;  4CT4 A;  2QC9 A;  2XPI A;  5EIL A;  4E6H A;  4FHJ A;  3T9K A;  4R7L A;  2WXL A;  4U0Z A;  1WDY A;  5FQ7 A;  5ENP D;  3EUV A;  3E32 A;  2RFA A;  1TJF A;  2LUH A;  2ZGG A;  1IQU A;  3HVE A;  3LJ3 A;  1K1A A;  2EQX A;  2WXP A;  1ZBP A;  5G2N A;  4UWK A;  1RW2 A;  2P9L G;  3QB2 A;  3B13 A;  4GTT A;  2EIJ E;  2ETC A;  2L0I A;  3CKB A;  2H6H A;  3S7B A;  3MV2 B;  3UQ3 A;  3EIQ C;  3E30 A;  3ZYQ A;  3CK9 A;  4CDM A;  4BT9 A;  3L82 A;  4ILG A;  3B7B A;  1TN7 A;  3ZW3 A;  1TN8 A;  1TEZ A;  2VQ2 A;  2DIW A;  3AG1 E;  1SA4 A;  5JHA A;  2DBA A;  3ZPJ A;  4GB9 A;  3FUD A;  2Y4U A;  4RVB A;  4OAU C;  3ABM E;  5A23 A;  3P2B A;  4G8K A;  4DX6 D;  4GZ5 A;  3TWW A;  4HRN A;  3TG5 A;  5T8I A;  4UI9 K;  3Q7A A;  4JHR A;  2CFZ A;  2L6B A;  4RLY A;  1WM5 A;  3SY2 A;  5CBN A;  2WXF A;  3ASG A;  5BXU A;  4ATG A;  4ZHB A;  3LS8 A;  3ULY A;  5AEN A;  2XEV A;  2PM6 A;  1UJK A;  5AQ9 A;  3JXJ A;  5A7D B;  4CGW A;  3ZRH A;  1ZB1 A;  5CHE E;  1N95 A;  2IY0 C;  4WNF A;  1MYO A;  4AIF A;  2WPV A;  3FH8 A;  4FU3 A;  5FQ8 A;  1P5Q A;  4XKC A;  3FUK A;  2J4B A;  3B7T A;  3ULQ A;  5LOZ A;  3IKO B;  3ONK A;  2J49 A;  4GZC A;  4K5A B;  3MX3 A;  5E75 A;  3Q9U C;  5ANR A;  4L2L A;  3LPZ A;  2CHZ A;  2KCL A;  1LD8 A;  5ITZ F;  4B8C B;  1INZ A;  3GZ1 A;  3V31 A;  5BPP A;  3FU3 A;  2KC7 A;  2XPY A;  2KZT A;  4XZ4 A;  3CGH A;  1QNF A;  5D0O D;  3B7U X;  4UWH A;  4YDW A;  2GW1 A;  5LFA A;  3I4R B;  2PNN A;  3FUM A;  4NIK A;  2UY1 B;  2EIM E;  3FEX A;  4K0R A;  3AU5 A;  4LUN U;  4BSZ B;  3D9K A;  3AAA C;  3ASO E;  3F6Q A;  1LD7 A;  4ANX A;  2GRQ B;  1ELR A;  4EBA A;  4IYP A;  4EPZ A;  2Y4T A;  5ENR D;  3CHS A;  2VGE A;  2KAT A;  3CQC B;  4UWF A;  4A3T A;  4CGV A;  3TWX A;  3AS5 A;  1A5E A;  3ASH A;  5FZS A;  2J8S D;  4GYW A;  3CVU A;  3G2T A;  4XI9 A;  4ME2 A;  4I6E A;  3Q78 A;  2EIK E;  3LVR E;  3E4B A;  3V79 K;  5FQ6 A;  4UQY A;  5B1A E;  3AS8 A;  2XHE A;  5LCW J;  2VSX E;  2BED A;  2I1K A;  1KLX A;  4YDE A;  4HNA D; 
#chains in the Genus database with same CATH homology
 1Z3X A;  2L6J A;  3Q5M A;  4B8A A;  4E85 A;  2PZI A;  3IV0 A;  5KJL A;  2MRI A;  2CG3 A;  4Q69 A;  2XQ0 A;  1E8W A;  3FTW A;  4I2W A;  4MLP A;  3UT8 A;  3G2U A;  5M72 A;  4AOF A;  4HOS A;  2PL2 A;  3FUL A;  1KT0 A;  3FTX A;  1HG5 A;  5A6C A;  2VJ8 A;  1U3D A;  4I6G A;  4U63 A;  3EHN A;  3NQP A;  4CCA A;  2YIN A;  3Q49 B;  3FDH A;  5ARG A;  5ARF A;  3BG1 B;  4JA7 A;  2IU1 A;  3FTS A;  4E6H A;  1IQR A;  1DNP A;  2X6H A;  3LCA A;  3QNK A;  3RRU A;  2VTB B;  2XGO A;  3EHM A;  4NQ0 A;  4TV3 A;  3SBS A;  5KJM A;  2BTD A;  1OWM A;  2BUG A;  1HO8 A;  4O6F A;  4D10 C;  3CLJ A;  3QJZ A;  5CMY A;  5J08 A;  3U66 A;  5AJD A;  3U9W A;  4L23 A;  4H7Y A;  3AS4 A;  2PQR A;  3D9O A;  4I1A A;  5FQ4 A;  4JZY A;  1HE8 A;  4URK A;  4P29 A;  1VDY A;  4UWL A;  4EQF A;  4JEU A;  5BNW A;  1HH8 A;  3HHM A;  2OVF A;  2V8S E;  1U3C A;  2YNQ A;  5EX3 A;  3IBE A;  4WWN A;  1UJJ A;  4KZC A;  1FVH A;  2I2O A;  4EEC A;  2HM8 A;  5CMW A;  5CCL A;  4F53 A;  3FUF A;  1NZN A;  4HOU A;  2R5S A;  4FC8 A;  2ZU6 B;  1PC2 A;  3CKC A;  3CVL A;  2VGX A;  3K9I A;  3PRE A;  4CEM A;  2PM7 A;  3TJP A;  4AV7 A;  4M3O A;  3R7Q A;  1JPL A;  3ZN3 A;  4ILH B;  3OXF A;  4DPR A;  2LNI A;  2V0P A;  1HX8 A;  1JWF A;  3EDT B;  3OAW A;  3FY4 A;  1PY1 A;  2AWI A;  3ESK A;  3L22 A;  5G05 J;  1IHG A;  4DK5 A;  5G05 C;  1L5J A;  3FTY A;  3CVN A;  3MJW A;  3FTU A;  4GMJ A;  4IN3 B;  4FHK A;  3UUX A;  1JWG A;  4G26 A;  3TXM A;  4BX8 A;  4H7X A;  1JUQ A;  3D9N A;  2VGX B;  3L13 A;  2RG8 A;  2FBN A;  2CHW A;  2YHE A;  4ILI A;  1EYH A;  2E0I A;  3LXU X;  4CRW A;  5BV1 A;  1PAQ A;  2AXZ A;  2XCB A;  2J09 A;  4XKB A;  1H2U A;  3R9A B;  3VTX A;  3ZYL A;  5G55 A;  3PZD A;  3UMV A;  4DLO A;  2GRL A;  3NF1 A;  2X6K A;  4HOQ A;  1MHQ A;  4G1T A;  5BW8 C;  3UT7 A;  4KMO A;  3NZU A;  3CVY A;  3O48 A;  3VLF A;  4BWR A;  3JYS A;  2I1J A;  3RK6 A;  3IHV A;  5G04 C;  2QY7 A;  2I6H A;  1N54 A;  3G2W A;  5JJ6 A;  3SBT B;  4J8S A;  2PQN A;  3LDZ A;  5T4Y A;  1ELW A;  3KS2 A;  4KVO A;  3TAX A;  1UN9 A;  4EBA G;  4EZL A;  3LVQ E;  4YVO A;  4WNE A;  2ILR A;  3UX4 A;  1Z6T A;  5BUZ A;  1OWL A;  4C0M A;  4EZK A;  4NUR A;  3D9P A;  3JQ1 A;  3QAQ A;  4AXH A;  4CDR A;  4GU5 A;  1XGW A;  4AJW A;  4ANU A;  3RJV A;  2J07 A;  3D9J A;  3LY7 A;  4LEU A;  2XGS A;  1WY6 A;  3RKV A;  2X3M A;  1OWP A;  2FEZ A;  4FA6 A;  2WB2 A;  4A1G A;  3S7D A;  5KJK A;  3PE4 A;  3QOU A;  4J6I A;  4G24 A;  3FTV A;  3FUH A;  3QWW A;  3CIA A;  3CHP A;  3ESL A;  4K03 A;  2IF4 A;  4JL0 A;  2FUL A;  2XGM A;  2NXP A;  4PDX A;  3ZGQ A;  2HO1 A;  3SFZ A;  4XE0 A;  4OVV A;  2I9C A;  1EPU A;  3CQG B;  4OYS A;  3P1U A;  4AY5 A;  3L6A A;  3L54 A;  4N5C A;  3FWV A;  1FCH A;  3PS6 A;  4MKT A;  3APC A;  4L1B A;  3L17 A;  4FJY A;  3U4T A;  2WQ7 A;  2LAI A;  3CVP A;  3MGB A;  4AVX A;  3TXN A;  4OVU A;  4AP2 A;  3OXL A;  3CST A;  4U8H A;  2XPZ A;  3APF A;  4AEZ C;  4XX5 A;  2WXM A;  4RG9 A;  3TL5 A;  1W3B A;  4KT6 B;  1HG2 A;  3BG0 B;  3I3N A;  3LY9 A;  5D0Q D;  2C0M A;  2LSU A;  2RD0 A;  2IQC A;  3GYZ A;  1Z3Y A;  4TRQ A;  5C2Y A;  2CFU A;  2VSO E;  4FLB A;  1E8Z A;  4FLH A;  4QFV A;  5C1D A;  2VSY A;  4HVB A;  3LYA A;  2IOL A;  2IOS A;  1EDU A;  2X6F A;  3CVW A;  3ZIM A;  4YND A;  3RRN B;  2IJG X;  2WXI A;  1H0A A;  2WXQ A;  2WXJ A;  4GYO A;  4BT8 A;  1QZ2 A;  1SZ9 A;  3DBS A;  3MEK A;  3FU0 A;  4GZ6 A;  4RG6 A;  3CHQ A;  3ZYK A;  4WNG A;  3SD5 A;  4AM9 A;  5FTP A;  4RSY A;  3CVQ A;  2WQH A;  3CVV A;  2KM4 A;  3S2A A;  4ACL A;  4GML A;  2WXO A;  4B89 A;  4PS3 A;  3T5X A;  2XPI A;  4CT4 A;  3JQ0 A;  4FHJ A;  2UWJ G;  1E90 A;  4GAA A;  2A4Z A;  3CEQ A;  4R7L A;  2WXL A;  4I9C A;  3LEW A;  4U0Z A;  3ZFW A;  4PS8 A;  4BTB A;  2VGY A;  3CK7 A;  1H2V C;  4JHJ A;  2OVB A;  3U64 A;  1E7V A;  1KT1 A;  2AVP A;  3SHF A;  1X5B A;  3QC1 A;  5FQ7 A;  3ZXS A;  3ZEF A;  4ABN A;  1SZA A;  4N3C A;  3B7S A;  1OWN A;  1TJF A;  2GGF A;  5EDS A;  4JEH A;  3SZ7 A;  4U0U A;  3FP3 A;  2GRM A;  1IQU A;  3HVE A;  5FZR A;  3ZYM A;  4HOT A;  3LJ3 A;  5BV0 A;  4UQZ A;  2EQX A;  2WXP A;  2XCC A;  1ZBP A;  3FU6 A;  5G2N A;  4UWK A;  2KCV A;  2J4D A;  2VSN A;  3MCX A;  4CT0 A;  3JUI A;  3QB2 A;  3B13 A;  3TG4 A;  2L0T B;  4LER A;  4UI9 J;  2L0I A;  3CKB A;  1HF8 A;  4UI9 C;  3CHR A;  3SF4 A;  3T8M A;  3PNT B;  3MKR A;  3MV2 B;  3S7B A;  3UQ3 A;  3EIQ C;  3TGO A;  3ZYQ A;  1OUV A;  3CK9 A;  2CHX A;  3KD7 A;  2R59 A;  4I1M A;  4BT9 A;  4CDM A;  4ILG A;  3HVE B;  4WWP A;  4A1S A;  4GZ3 A;  2WXG A;  4GA0 A;  4TUU A;  3JCK C;  3FUE A;  5BT1 A;  2OOE A;  3Q4A B;  4F3V A;  3PUK A;  1NA0 A;  3VLE A;  1ZU2 A;  1E8Y A;  3EJN A;  1LF8 A;  1HS6 A;  4GCN A;  5EX0 A;  5E76 A;  4KVM A;  3ZW3 A;  3MKQ A;  5G04 J;  3EIJ A;  4DI4 A;  1TEZ A;  4U07 A;  2NC9 A;  2VQ2 A;  5KJN A;  3QK0 A;  4J8D A;  1A17 A;  2DIW A;  4MS6 A;  5DIZ A;  2YHC A;  3RRM B;  2BF0 X;  4BFR A;  1HU3 A;  4HS2 A;  2NSZ A;  3U3W A;  1OWO A;  3CSF A;  5JHA A;  2DBA A;  3ZPJ A;  4J8F A;  5DBK A;  4G25 A;  4GB9 A;  1HZ4 A;  1IYG A;  4GPK A;  3FUD A;  4FAD A;  4LCT A;  3FU5 A;  1UG3 A;  3S7F A;  3IHY A;  4DI3 A;  2Y4U A;  5ENN A;  4RVB A;  3MKQ B;  3ENE A;  5T3R A;  1E8X A;  1NP7 A;  3P2B A;  4KZ0 A;  5A23 A;  3ASF A;  3Q15 A;  4I43 A;  1HXI A;  2HR2 A;  1WAO 1;  3RU0 A;  4GA1 A;  4GZ5 A;  1H2T C;  4C9B B;  4N2Q A;  3FTZ A;  2WM9 A;  1E7U A;  2Q7F A;  2XRY A;  1DVP A;  4JVS A;  5LP0 A;  3TG5 A;  4UWG A;  4WND A;  5T8I A;  4UI9 K;  3FUJ A;  3CVX A;  4DJA A;  3D9M A;  3T5V A;  2CG2 A;  4N2S A;  1HFA A;  4Y6C A;  4JHR A;  1H19 A;  2CFZ A;  4WAF A;  3SNX A;  1WM5 A;  4W9R A;  5AJL A;  3UPV A;  5JHB A;  4Q94 A;  2WXF A;  4JHK A;  1BPO A;  1B89 A;  3PH0 C;  3RIB A;  2WMN A;  4I2Z A;  3ASG A;  2J9Q A;  3KEZ A;  4G2V A;  1YA0 A;  4APO A;  4ATG A;  3LS8 A;  4LRZ A;  4XI0 A;  4FP7 A;  4FUL A;  5AEN A;  3FH7 A;  5FWQ A;  3KAE A;  4GA2 A;  2XEV A;  3L08 A;  3ML8 A;  2PM6 A;  2WQ6 A;  1UJK A;  1ELK A;  2DCP A;  5A7D B;  4CDN A;  4C0E A;  4CGW A;  1N52 A;  3ZRH A;  3VLD A;  1Y6I A;  4IUL A;  5CHE E;  4DLQ A;  4WNF A;  4BSX A;  3MYV A;  5EKQ D;  4KXK B;  1NA3 A;  4AIF A;  2WPV A;  2X6I A;  3FH8 A;  4FU3 A;  2WVI A;  3FFL A;  5FQ8 A;  4AY6 A;  3WXX A;  3OXG A;  2FO7 A;  1P5Q A;  4F7A A;  4XKC A;  3FUK A;  2J4B A;  5AIJ A;  3VTY A;  1UW4 B;  3HYM B;  3O4Z A;  2LAH A;  3B7T A;  2FF4 A;  3ULQ A;  1XNF A;  4IRU A;  2X6J A;  4HLE A;  3FEY A;  3GZS A;  4B0Z A;  5LOZ A;  3IKO B;  4HXI A;  4JC8 A;  4I1O B;  4WWO A;  3PNL B;  2JEK A;  3ONK A;  4BX9 A;  4GZD A;  4PS7 A;  4Y6W A;  2J49 A;  4GZC A;  2C2L A;  4GYY A;  2Y3A A;  2OV8 A;  3MX3 A;  4WUY A;  2WMO A;  3FUN A;  4FJZ A;  5ANR A;  5E75 A;  2XRZ A;  3QDN A;  4L2L A;  2E2E A;  2AXV A;  3LPZ A;  4I6J A;  4L7T A;  2HYZ A;  3CV0 A;  4A55 A;  2CHZ A;  3APD A;  1SQM A;  2J08 A;  2KCL A;  3CK8 A;  4JPS A;  4PUC A;  4Q96 A;  3QKY A;  3FHE A;  1Y8M A;  2X38 A;  3R7R A;  4HFG A;  4U0S A;  4B8C B;  3NZS A;  1INZ A;  3GZ1 A;  5FT9 A;  4A3V A;  4ANW A;  1QQE A;  5FJY A;  3ASD A;  3RO2 A;  5BPP A;  3FU3 A;  2KC7 A;  2WXR A;  1FVF A;  3PUJ A;  2UY1 A;  3QAR A;  4B94 A;  4BY6 A;  2XPY A;  4I9E A;  1TJC A;  2KZT A;  2OND A;  4XZ4 A;  4EZJ A;  3QWP A;  3CGH A;  3CR3 A;  4KBQ A;  1QNF A;  3I4G A;  5D0O D;  5J90 A;  3SI5 A;  3B7U X;  3FUI A;  4UWH A;  3DPD A;  3Q47 B;  4N39 A;  2V5F A;  2GW1 A;  5LFA A;  4APF A;  3PVL A;  3I4R B;  3D3M A;  3URZ A;  2R17 C;  1EF1 C;  2MOW A;  3FUM A;  4V3I A;  5CCM A;  3LY8 A;  3D9I A;  3S7J A;  4I17 A;  2UY1 B;  3GW4 A;  3ZHE A;  3RO3 A;  2KCK A;  3G2V A;  3FEX A;  4ANV A;  2KZT B;  1MQS A;  4K0R A;  3AU5 A;  3AU4 A;  3BEE A;  1E96 B;  4LUN U;  2C0L A;  4UQX A;  3QWV A;  4U04 A;  4JW1 A;  4N3A A;  3D9K A;  4BTA A;  3D9L A;  3C98 A;  2IFU A;  4GCO A;  2JLB A;  3OTN A;  4JA9 A;  2ION A;  4G11 A;  2WXH A;  1UN8 A;  2LO6 A;  3PE3 A;  5KCM A;  4ANX A;  3IEG A;  4PH4 B;  4J8E A;  5ANL A;  5JJT A;  5HI7 A;  1ELR A;  3ML9 A;  3PRZ A;  4IYP A;  4YVQ C;  3PEV B;  4EBA A;  2YQ8 A;  3ZVV A;  4EPZ A;  2Y4T A;  2WXN A;  2M63 A;  2MHK A;  3ZHE B;  2L9B A;  4G23 A;  3CHS A;  3HIZ A;  2KAT A;  3MA5 A;  5AYW D;  3CQC B;  4JXT A;  4UWF A;  4A3T A;  3G2S A;  2WXK A;  1S0P A;  4CGV A;  4NAC A;  1GW6 A;  3AS5 A;  3CHM A;  1H6K A;  4L2Y A;  4XIF A;  2V4L A;  3ASH A;  3I5P A;  3UT4 A;  3PDN A;  5FZS A;  4NRH B;  5JJ7 A;  4GYW A;  4N3B A;  3CVU A;  3SGH A;  3G2T A;  2VYI A;  4XI9 A;  5FZQ A;  5HQ8 A;  3N71 A;  2LSV A;  3MZL B;  4ME2 A;  5LX8 A;  4I6E A;  2A5U A;  2QFC A;  3LVR E;  3E4B A;  2AW6 A;  3HDX A;  4HOR A;  4ACK A;  5FQ6 A;  4J0U A;  3B7R L;  4KYO B;  4UQY A;  4F1S A;  2P58 C;  2FI7 A;  3AS8 A;  2XHE A;  3FH5 A;  3ONL A;  3LKU A;  3MV3 B;  3PEU B;  2VTB A;  3GZ2 A;  4MRU A;  2AXU A;  3L16 A;  2VSX E;  5LCW J;  2I1K A;  5LCW C;  1KLX A;  3CHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...