2NC9A

Apo solution structure of hop tpr2a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
131
structure length
131
Chain Sequence
ENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the Hop TPR 2A domain and validation of novel approaches to inhibitor indentification by NMR, biochemical and in silico screening
rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Stress-induced-phosphoprotein 1
total genus 49
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2nc9A00
3VTYA 3QOUA 3ZHEA 4NQ0A 5FZSA 4NRHB 5M72A 3ZGQA 2KCVA 1KT1A 5BW8C 2XCBA 3CKCA 3LCAA 1E96B 3WXXA 4CGVA 1NZNA 2XGSA 3S7JA 3OXFA 3VTXA 2HR2A 1IHGA 2PL2A 2VGXA 4CDRA 2XGMA 5BT1A 2LSUA 5BNWA 5KJMA 5KJKA 2C0LA 2XGOA 4KYOB 3R9AB 4N3CA 5G04C 3S7FA 3ZFWA 5D0OD 4AIFA 3FP3A 2V5FA 3S7DA 4G26A 4H7XA 3UQ3A 3Q47B 4U04A 4WNFA 1NA0A 2FEZA 2WQHA 5G04J 4I1AA 2PQNA 1B89A 5EKQD 2FBNA 2FO7A 5G05J 2J9QA 4G2VA 4GYWA 4W9RA 3N71A 5FT9A 3MV2B 2L6JA 2XPIA 4J8EA 3ESKA 3TGOA 3RU0A 3UUXA 4G23A 4WUYA 1HH8A 4ABNA 2VSYA 1KT0A 3ASGA 4XI9A 3RJVA 3Q5MA 3TAXA 4CGWA 4UQYA 2VQ2A 3CVNA 2VGXB 4G1TA 3HYMB 4AY5A 4AY6A 1HXIA 4UQXA 3URZA 5HI7A 3EDTB 4RG9A 4JA9A 3LY8A 5EX0A 5ARGA 3RO3A 1FCHA 2OOEA 1ZBPA 2IF4A 4BTBA 3PE3A 2KC7A 2IFUA 4IN3B 3KD7A 1WAO1 3E4BA 4YVQC 5G05C 2KATA 2PZIA 3GYZA 3ZPJA 4I17A 2LSVA 3QDNA 4GYYA 3AS4A 3CK7A 2UY1B 3KS2A 4GCNA 4UI9C 4WNEA 5EX3A 3RIBA 4BWRA 2VGYA 2HYZA 1Y8MA 2VYIA 4GA1A 3ULQA 2LNIA 2VSNA 2XEVA 4GZ6A 4O6FA 3ZN3A 4EQFA 2WPVA 2KCLA 5KJLA 2BUGA 4RG6A 3PE4A 4U07A 1KLXA 2KCKA 3CK9A 3AS5A 4HOQA 3MA5A 5KJNA 1YA0A 4YNDA 4BT9A 3ASDA 3CVPA 4LEUA 3Q15A 5JJ6A 4BTAA 4GPKA 3FFLA 5ARFA 4J8FA 2GW1A 5CCLA 3K9IA 5FZQA 2DBAA 4GZ3A 3QWVA 3FWVA 1PC2A 2FI7A 3Q4AB 2JLBA 4JA7A 3ASHA 4N2QA 3IEGA 4J8DA 5JJTA 4UI9J 3MV3B 3U4TA 4B94A 3O48A 4N2SA 2R5SA 1HZ4A 3LY9A 1QZ2A 3QKYA 4XIFA 5C1DA 4WNGA 2UWJG 5A6CA 3CK8A 4J0UA 3S7BA 5LCWJ 5AYWD 1IYGA 4HORA 5CHEE 2NC9A 3NF1A 4UQZA 3QWPA 1ZU2A 3LPZA 4I9CA 1W3BA 2XCCA 2Y4UA 4UI9K 4XI0A 3PDNA 4Y6CA 3Q49B 3TG5A 2YQ8A 3MEKA 4I9EA 5A7DB 3BEEA 3GW4A 2ONDA 5LCWC 1ELWA 3CVLA 4Y6WA 4APOA 2Q7FA 4GCOA 4KXKB 3U3WA 4N3AA 4GYOA 4H7YA 4HOUA 4JHRA 4U0ZA 3AS8A 5FTPA 5D0QD 4AM9A 4HOTA 4N3BA 4U0SA 2PQRA 5DBKA 3RKVA 5DIZA 1TJCA 3ZHEB 4GZ5A 1WM5A 4ME2A 1ELRA 3CV0A 4I2WA 3TG4A 3SZ7A 4A1SA 4F3VA 3UPVA 2AVPA 2FF4A 1OUVA 1QQEA 2C2LA 3JYSA 2HO1A 3SF4A 4GA2A 5JJ7A 5FZRA 2I6HA 3GZ1A 4JL0A 3OXGA 5HQ8A 3ASFA 3CEQA 3GZ2A 4I2ZA 3RO2A 3QWWA 2YHCA 1XNFA 3LKUA 3LYAA 4G24A 4N39A 4U0UA 3CKBA 5FJYA 5CCMA 3CVQA 1NA3A 1P5QA 4WNDA 4HOSA 3MKRA 2Y4TA 3LY7A 3OXLA 4YVOA 4GA0A 2MHKA 2UY1A 4KBQA 4G25A 1A17A 2C0MA 2P58C 2E2EA 3KAEA 2QFCA 4BT8A 4N5CA
chains in the Genus database with same CATH superfamily
4APFA 3Q78A 5CECB 5EYLA 1E8XA 4ACKA 1N4RA 3MGBA 2I9CA 3R9AB 2DWZA 2V5FA 3FP3A 2P9IG 1OWNA 1YCSB 5G04J 4HVBA 4W9RA 1SVXA 3N71A 2KZTB 2WXKA 4UQXA 1N0QA 3CHPA 1JCRA 2DYSE 5ARGA 5D66A 1FCHA 2KC7A 1O1TA 3E4BA 4C9BB 4U63A 1Y8MA 3ZUVB 2GRPB 5EN5D 3LEWA 1K8KG 5FQ7A 3OAWA 3QARA 3BG0B 3FUKA 1TN7A 3QK0A 3PREA 3FUEA 2NXPA 1OWMA 3FTWA 4ACLA 2EIME 3UT4A 2PM7A 4HQDA 4BEPA 4GU5A 2X6JA 3SBSA 3LPZA 3HHMA 4MS6A 2ZU6B 4BSZB 2V8SE 3DSWA 3TWVA 3G2WA 4HOUA 4N3BA 3E37A 4ME2A 3Q9NC 2AVPA 3DEOA 5HKPA 3ZKJA 1TNZA 4AP2A 2HM8A 2J49A 2OEWA 3OXLA 3KAEA 4I6EA 4XE0A 3V31A 5KBAA 4CEMA 3HXFA 3S2AA 1BU9A 4HLLA 5EIDA 3FTVA 4N3CA 3FEXA 4OAVB 3SHFA 4C0MA 2B0OE 4WNFA 2WQHA 4G23A 4HI8A 1ELKA 4GTOA 1IQRA 2ILRA 4J6IA 2X6IA 4ILIA 4IULA 3CVWA 4GTTA 2XEVA 2VSNA 3CHMA 3FH8A 2WXGA 3IKOB 1TNOA 4XKBA 3B7SA 1E90A 4ATGA 3MV3B 2H6FA 3CHQA 4WWNA 1HZ4A 4N2SA 2UWJG 3EU5A 5EYPF 4EBAG 4XZ4A 2GGFA 4A3TA 1U3CA 4GZCA 1MX6A 2YQ8A 5CEAA 2WB2A 4APOA 5ITZF 4GYOA 3AS8A 4FLHA 2IONA 3KSQA 2ZXWE 3SF4A 1X5BA 5AENA 4EZLA 2IEJA 3V2XA 1S63A 3IHVA 4HNAD 3ZVVA 1N95A 2LAHA 3L82A 3QOUA 2CHZA 3UT7A 2J4DA 1UN8A 4FC8A 3F6QA 1D8DA 3ZYKA 5ENQD 2WVIA 5B1BE 5BPPA 4J8SA 2P9UG 4OVUA 4WWOA 4K5CA 2RG8A 4AXHA 4L2LA 3RO3A 2XENA 1E7VA 5AQBA 2PZIA 3JXJA 4AJWA 4GYYA 2VGYA 4N5QA 3SBTB 3RRNB 2B6CA 3QJZA 1MX4A 4HOQA 3D9NA 1EYHA 3FUHA 4F6RD 2KM4A 4KMOA 1MX2A 3LY9A 2FO1E 4B93B 1VDYA 2A5UA 4I9EA 2WQ6A 5ENRD 4U8HA 4HRNA 4HOTA 5BV1A 1OWLA 4EHMA 3TWXA 4IRUA 5AJLA 3JYSA 3FUFA 5FZRA 4TRQA 1FVHA 2CFZA 2ZIRA 3ASFA 1GW6A 5FQ4A 1XNFA 1SA4A 1V55E 4DI4A 2F37A 3MCXA 4PS8A 5JHBA 3KSLA 3AG3E 1AWCB 3L9TA 4CZ2D 2LSUA 2QZAA 2I1KA 4RVBA 4FHKA 3U9WA 4EECA 4HRLA 4YDWA 3Q75A 3VLDA 2FO7A 3HG0D 4GYWA 2ETCA 4J8EA 4UWHA 1KT0A 3ASGA 1NL4A 3Q5MA 2DIWA 3UIPC 4ANWA 2OV8A 1QNFA 2IO2C 1OY3D 3E34A 4OAUC 5CCLA 2GRQB 1IXVA 1HU3A 3PE4A 1MZCA 3ZYMA 2X38A 1NFIE 4UWLA 4FADA 4WWPA 3FFLA 2DBAA 4MRUA 3CLJA 4G11A 1QZ2A 4FA6A 5AYWD 2IJGX 4U7EB 4UWKA 4Y6CA 1BI7B 1O1RA 3EHRA 4HI9A 3ML8A 2F0YA 3FUJA 5FTPA 4H7YA 4XKCA 5D0QD 4F53A 1WDYA 3TWTA 3AG4E 1ELRA 1QQEA 4HXIA 1E7UA 3ZNGA 4K5BA 4N39A 1P5QA 4MBGA 5CEDB 2MHKA 4G25A 3BQOA 1O5MA 3R9MA 3QB2A 1N52A 2OVBA 2XZDG 2XHEA 2XCBA 1E96B 4GTPA 3T8MA 1G3NB 1JPLA 2VGEA 2WXPA 4G26A 2J09A 1SA5A 1NA0A 2GRRB 2BEDA 2BKKB 3HRAA 3HYMB 3ZIMA 3IXEA 4IN3B 4O1OA 2CFUA 5BXUA 3ULYA 3AS5A 2GROB 2IO3C 3LXUX 5ARFA 3K9IA 1HF8A 4LUNU 2HE0A 3NQPA 3QWVA 2EINE 3CIAA 4XEIG 4FP7A 2F8XK 3UXGA 5FINA 1HO8A 5LP0A 4A3VA 3UM1A 2FULA 3CR3A 3QWPA 4I9CA 3PDNA 3TG5A 4A1GA 1H6KA 2WMNA 3U3WA 1NI1A 2Y1LE 4LNGA 5DBKA 1OT8A 2WXIA 1E8WA 3D9IA 3GZ1A 5HQ8A 3Q7FA 3D9LA 4G24A 1SW6A 2IU1A 3FTXA 4JEHA 1QYMA 3BG1B 4NIKA 2IQCA 4X8QA 3UM2A 3DPYA 3GZSA 3LCAA 1E8YA 3S7JA 3UI2A 3VTXA 3X2QE 4K03A 3O4ZA 1OXJA 3Q79A 3LVRE 1EPUA 3EHMA 3TWRA 1SQMA 5EKQD 2J9QA 2L6BA 4G2VA 4GMJA 1HH8A 3J5QB 3ABLE 2ZISA 3CVNA 1LTXA 2PM6A 1HXIA 2P9SG 3URZA 4K5AB 1ZBPA 1FPPA 1FT1A 1MYOA 1WAO1 3PRZA 2J4BA 3EIQC 4GB9A 5EX3A 1KPSB 2VYIA 2IOSA 3ULQA 4O6FA 2XS1A 4GZDA 3RRMB 3D9OA 4U07A 3FULA 3PUJA 1D8EA 5T4YA 2Y3AA 3FWVA 4Q69A 5ENOD 4B8CB 4JA7A 5JJTA 1SZAA 4UWFA 4J0UA 2DYRE 4F1PA 4BX8A 3DRAA 3FDHA 4PUCA 3DPDA 4M7CA 4XI0A 2ONDA 3DXMG 4M3OA 2H6IA 2WM9A 3CSFA 2MOWA 5T3RA 3NBNB 5DIZA 1N4SA 3TG4A 2FF4A 1OUVA 3FHEA 3L54A 4J8YA 3LYAA 4L23A 3I5PA 1H6PA 4EZJA 5E76A 4KBQA 5FQ8A 1A17A 3FUDA 1SZ9A 3ZW3A 3ZHEA 4B89A 3OXFA 3VLEA 2XGOA 2X6HA 5LFAA 3Q47B 5H7PA 4DRXE 2DVWA 2CHWA 2L6JA 4JXTA 5CERB 3FTZA 4I1MA 4PS7A 3ASOE 2DCPA 5AJDA 3TXNA 4AVXA 2EIKE 3NZUA 4G1TA 3G2SA 3AJIA 3AG1E 5HI7A 4F7AA 3I3NA 4LG6A 4HBDA 4C48B 4DJAA 3JQ0A 3DSSA 2VTBB 3RIBA 3KEZA 4J7WA 4EQFA 2P9NG 4MKTA 4O60A 2VTBA 1TN8A 4IYPA 1L5JA 3I4GA 4L2YA 2NYJA 3CVUA 5JJ6A 2ZGDA 4JHKA 1MJ0A 3QC1A 1RW2A 4QQIA 4HORA 2Y69E 3QNKA 2IY0C 3SFZA 4OYSA 1HS6A 2J08A 4KVOA 5J08A 1JCSA 5ENNA 2HO1A 3TL5A 3PZ1A 5CCMA 1NA3A 3MKRA 1Z6TA 3MZLB 2XEEA 4TXRA 3G2VA 1INZA 4DX6D 4DX1A 2CG2A 5KNHD 3SFXA 3VTYA 4NQ0A 4A55A 1K1AA 1H2TC 3L17A 4BX9A 2XGMA 2C0LA 1JUQA 4AIFA 3DWLG 3ONKA 3FU5A 2AXZA 1EDUA 3HDXA 2PQNA 1B89A 4JW1A 3MV2B 2XRZA 3TAXA 1JWFA 3HXEA 3WG7E 1TJFA 2OCCE 1Z3YA 5EDSA 2X6FA 2Y0BG 3AS4A 3KS2A 2L9BA 4CRWA 1HG2A 3SI5A 2WXNA 1KLXA 4KZ0A 4CDMA 3EIJA 3UM0A 1YA0A 4GPKA 3ZYLA 3UIOC 4JVSA 4B94A 1H19A 1BPOA 4RLYA 1DCQA 5CRUA 3S7BA 3L16A 1IYGA 2NC9A 1UN9A 3U66A 3W9GA 3CVLA 4AOFA 3KEAA 5AQ7A 3CVYA 1K1BA 2L0IA 2PQRA 3U64A 4Q94A 4PS3A 1JCQA 4JL0A 3OXGA 3RO2A 2YHCA 3J5PA 3TWSA 4R7LA 1K3ZD 4DX7D 1XGWA 5KWDA 1DCEA 3TWUA 5CHEE 2P58C 5CRVA 1UJJA 2VSXE 5AAOA 3RK6A 4CT4A 2ETAA 5ENPD 3CVVA 1OWOA 4FHJA 3B13A 3FH7A 4GTSA 4JZYA 2LUHA 5BXOA 2AW6A 2CG3A 4HRMB 1H0AA 1U3DA 3C98A 3EDTB 5A23A 4CDNA 3D9MA 1TN6A 4UI9C 3V79K 3APDA 4JHJA 4AM9A 2HYZA 4AV7A 4HS2A 4GZ6A 4BSXA 2KCKA 3DSUA 4YNDA 1DC2A 1MQSA 4LEUA 3Q15A 1TNYA 1ZB1A 5FZQA 3MYVA 1DVPA 2OVFA 3ZXPA 3T8KA 2EILE 5CBOA 3IEGA 5E75A 1OCCE 5FQ6A 4GTQA 2QYJA 4WNGA 2LXLA 3Q9UC 4FU3A 4F1SA 2XPZA 3FTUA 4ATZD 1ZU2A 2XCCA 2Y4UA 1KZOA 4QFVA 2A4ZA 3GW4A 3DSXA 3SGHA 1OCRE 1KZPA 3CVXA 4JC8A 3UPVA 3UINC 3MJWA 3C3QA 3I4RB 2RD0A 3FEYA 3EHNA 2Y4TA 4WAFA 3E32A 1JWGA 2ZGGA 4NRHB 5BW8C 3CKCA 2P9PG 4BFRA 3HIZA 4CGVA 2X6KA 3CQGB 1WG0A 5BT1A 5BNWA 3ZFWA 4BERA 3PZ3A 3IHYA 3S7DA 4I1AA 3UKUG 2I2OA 3PEVB 2QYUA 5D2MC 3FTSA 2VSYA 2VQ2A 3SFYA 3TXMA 3PNTB 3R7QA 4KZCA 2WXFA 5EIBE 3NZSA 4E6HA 2NSZA 2E0IA 3CK9A 3MA5A 4G8LA 4GTVA 1PC2A 3AU5A 1PAQA 4A63B 4U8YD 2GRMA 3JUIA 3PNLB 3UT8A 1UW4B 2RFAA 3MEKA 4CCAA 3HVEA 4N3AA 4JB8P 4DI3A 3RKVA 4I2WA 4A1SA 3SZ7A 4ANVA 3C72A 3PUKA 1TNBA 4DPRA 3UMVA 1LD8A 3PZDA 3BU8A 3UUXA 4I43A 4N5CA 3DSTA 2R02A 3DEPA 4GMLA 4LNBA 3HXDA 1WY6A 4TXPA 5KJKA 4DX5D 2F8YA 4P29A 1AP7A 1N4QA 4ANUA 4ILGA 3PH0C 2AJAA 2R59A 3B7UX 3FU6A 3ESKA 4WUYA 4XI9A 2VJ8A 4AY5A 3PVLA 2WXLA 5IY5E 1HG5A 2V4LA 4B8AA 2IFUA 4LSZE 5LX8A 4GA1A 4TUUA 4YDYA 3ZU7B 3PS6A 3FUMA 4GPMA 4GZ3A 3Q4AB 1N11A 3NOGD 4PDXA 3O48A 5A6CA 1Z5SC 1QBQA 1W3BA 2JABA 3AG2E 4Q96A 3Q49B 1YYHA 4JPSA 4Y6WA 2KZTA 3D9HA 3ZEFA 1N9AA 4CYMD 2R2LA 4E85A 1HX8A 1BI8B 3CEQA 4OVVA 3MX3A 2R03A 3CKBA 2YINA 3CVQA 4DK5A 3LY7A 2GRNB 4FJZA 3D9PA 4DX2A 3IBEA 4JEUA 3HVEB 4RSYA 2QC9A 3UQ3A 1A5EA 5CMWA 3UTMA 2FBNA 5FT9A 2XPIA 3FU0A 3RU0A 3T5XA 1FT2A 2YNQA 4BY6A 3Q7AA 2LXMA 4CGWA 2VGXB 4HFGA 3RSEG 3LY8A 2XPYA 1X81A 4BTBA 2IF4A 3CQCB 2UY1B 3UKRG 1TEZA 2L0TB 1OWPA 2XS8A 3LDZA 4BTAA 4BETA 3SQVA 4NURA 2WXJA 3D9JA 2LAIA 5AN8A 4J8DA 3EU9A 3P2BA 3DBSA 1S70B 3NOCD 3SD5A 1Y6IA 3ABKE 5HS0A 3NF1A 4PH4B 1HFAA 3SNXA 2Q7FA 4GCOA 4KXKB 3CHSA 3EHQA 3Q73A 2J07A 4TUMA 4GZ5A 2C2LA 3W9FA 1LD7A 3D9KA 2RFMA 3MKQA 3V30A 2BKGA 5CMYA 2AXVA 3UM3A 5J90A 4B0ZA 3PZ4A 3HXBA 1FVFA 4NACA 1S64A 4L9PA 3WXXA 4HB5A 1IHGA 5KJMA 3B7RL 5G04C 5CBNA 3FTYA 5BV0A 4L1BA 2OEVA 2X3MA 2WXQA 3RJVA 4L7TA 1TYQG 1IHBA 4RG9A 2VSOE 3L13A 3PE3A 4U8VD 4UUCA 4I17A 2LSVA 4GCNA 4F3VA 3ZRHA 5JA4D 3ZN3A 2LNIA 3JXIA 5KJLA 2WPVA 3ULEG 2RKKA 5KJNA 3FUIA 3ASDA 1MHQA 5LOZA 4J8FA 4URKA 2AXUA 4XX5A 2JLBA 4XIFA 3OTNA 3QKYA 4KT6B 3T9KA 3ENEA 1H2UA 4UQZA 4TXQA 2LO6A 5ANRA 4U95D 3RAUA 1H6OA 4FLBA 4U0SA 2WXHA 1S0PA 1Q2ZA 1OCOE 4LERA 3E33A 4K0RA 4EPZA 2H6HA 4LRZA 3ASNE 2I6HA 3FY4A 3B7TA 1TNUA 4GAAA 3V2OA 3LKUA 2DZOA 4ZFHA 4EBAA 3EUVA 2E2EA 2QFCA 4GMRA 2MRIA 5M72A 3ABME 2KCVA 1KT1A 2EQXA 5ENSD 1UG3A 2HR2A 4DLOA 2P2CP 4KYOB 4H7XA 5G2NA 5BUZA 4I6JA 3CHRA 5G05J 5JMND 5AQ9A 3TGOA 1RZ4A 1UJKA 1E8ZA 3FU3A 5ENTD 4UQYA 3JQ1A 4V3IA 3R7RA 2XRYA 2R17C 2OOEA 2GRLA 4ZHBA 1BLXB 3ZPJA 4I1OB 3T5VA 4ANXA 3APCA 1TR4A 2AWIA 4HLEA 4O1PA 4EZKA 3CVPA 5C2YA 2JEKA 3C5RA 3P1UA 1IQUA 3RRUA 2H6GA 2WXMA 3C3RA 3ML9A 4UI9J 3AAAC 1IKND 2WXOA 3B7BA 1V54E 2M63A 5A7DB 1ELWA 3C3OA 4U0ZA 4JHRA 1YMPA 3B95A 1WM5A 4FULA 4ILHB 5JJ7A 2WXRA 2P9KG 4KVMA 4WNDA 4HOSA 4YVOA 1N4PA 3CGHA 4GA0A 3PEUB 4BWRA 3NAWA 5FZSA 2PL2A 4JD2G 4RQIA 2V0PA 1N54A 3ISMC 4DLQA 2XQ0A 1U2VG 4TV3A 5B3SE 5AQAA 4U04A 2FEZA 3HXCA 3L08A 3G2TA 3ZXSA 4ABNA 3VLFA 2V5QC 4AY6A 2PNNA 3ONLA 4JA9A 2A5EA 5G05C 3KD7A 4YVQC 3GYZA 3CK7A 1OCZE 3LJ3A 2KCLA 3UX4A 4RG6A 3NB2A 3MKQB 3CSTA 4BT9A 1PY1A 2GW1A 2EIJE 4U96D 1DNPA 2FI7A 5T8IA 3ESLA 3PZ2A 3BUAA 2R5SA 5C1DA 1NP7A 2QY7A 2KBXA 3DXKG 2V4HC 3TWQA 3ZHEB 2DZNA 1TJCA 2KXPC 2I1JA 3G2UA 5EILA 2P9LG 3QWWA 1UOHA 2ETBA 5KNGA 1H2VC 5KCMA 3JUEA 1LF8A 2R05A 5HRYA 4YDOA 3JCKC 2UY1A 3EJNA 1N0RA 3GZ2A 4I2ZA 4BT8A 2BTDA 4C0EA 5B1AE 2YHEA 2XEHA 4CT0A 3LJNA 3ZGQA 1NZNA 2XGSA 4CDRA 2WMOA 4MLPA 2VGXA 3LS8A 3S7FA 1BD8A 5D0OD 3TJPA 4DUIA 3LVQE 3AU4A 1EF1C 5EX0A 2KATA 4D10C 3IV0A 3QDNA 4WNEA 3QAQA 1Z3XA 2MYOA 2XZTG 2BUGA 4GTMA 3APFA 2J8SD 2CHXA 3L22A 4UWGA 5ANLA 5FIOA 5AIJA 5AARA 3ASHA 4N2QA 1N94A 4I6GA 3SY2A 4LCTA 3U4TA 3DSVA 3CHOA 5FWQA 3CK8A 5LCWJ 4YDEA 4UI9K 3D3MA 5JHAA 5LCWC 4G8KA 3BEEA 2IOLA 3FH5A 4FJYA 1D9SA 1O1SA 3CV0A 4GTRA 4Z68A 3ZYQA 2BF0X 3E30A 4GA2A 3FUNA 4AEZC 2WQ7A 4LNUD 4U0UA 5G55A 5FJYA 3SO8A 4BESA 1HE8A 2C0MA 3L6AA 3TWWA
chains in the Genus database with same CATH topology
1UJJA 1N52A 2OVBA 2VSXE 4APFA 3RK6A 2XHEA 2XCBA 4CT4A 1E96B 3WXXA 1E8XA 3T8MA 1JPLA 4ACKA 1IHGA 3MGBA 5KJMA 2I9CA 3B7RL 2WXPA 3R9AB 3CVVA 1OWOA 5G04C 4FHJA 3B13A 3FP3A 2V5FA 1OWNA 3FH7A 4G26A 3FTYA 4JZYA 2J09A 5G04J 1NA0A 4HVBA 4W9RA 4L1BA 5BV0A 3N71A 2AW6A 2X3MA 2KZTB 2WXQA 2CG3A 3RJVA 4L7TA 1H0AA 2WXKA 1U3DA 3HYMB 4UQXA 3CHPA 3C98A 3EDTB 4RG9A 5ARGA 3ZIMA 5A23A 2VSOE 1FCHA 3L13A 3PE3A 2KC7A 4IN3B 4CDNA 3E4BA 3D9MA 4I17A 2LSVA 4UI9C 4C9BB 4GCNA 4F3VA 3APDA 4JHJA 3ZRHA 4U63A 4AM9A 2HYZA 1Y8MA 4AV7A 3ZN3A 4HS2A 2LNIA 2CFUA 4GZ6A 5KJLA 2WPVA 4BSXA 3LEWA 2KCKA 3AS5A 5KJNA 5FQ7A 3OAWA 4YNDA 3QARA 3BG0B 1MQSA 3FUIA 3ASDA 4LEUA 3LXUX 3Q15A 3FUKA 1MHQA 5ARFA 5LOZA 4J8FA 3QK0A 3K9IA 1HF8A 1DVPA 3MYVA 3PREA 3NQPA 3QWVA 2OVFA 3FUEA 2NXPA 3CIAA 4LUNU 1OWMA 2AXUA 3FTWA 4XX5A 4ACLA 2JLBA 4FP7A 3IEGA 5E75A 3UT4A 2PM7A 5FQ6A 1HO8A 4XIFA 3OTNA 3QKYA 4A3VA 4GU5A 4WNGA 5LP0A 4KT6B 4FU3A 2FULA 3ENEA 1H2UA 2XPZA 3FTUA 2X6JA 3CR3A 3SBSA 4F1SA 4UQZA 3QWPA 5ANRA 1ZU2A 2LO6A 3LPZA 4I9CA 2XCCA 2Y4UA 3HHMA 3PDNA 4MS6A 2A4ZA 2ZU6B 4QFVA 3TG5A 4A1GA 3GW4A 2V8SE 1H6KA 2WMNA 4FLBA 3U3WA 3G2WA 4HOUA 3SGHA 4N3BA 4U0SA 5DBKA 2WXHA 1S0PA 4ME2A 3CVXA 4JC8A 4LERA 3UPVA 4K0RA 2AVPA 4EPZA 2WXIA 1E8WA 3MJWA 4LRZA 3D9IA 2I6HA 3FY4A 3GZ1A 5HQ8A 3D9LA 3B7TA 3I4RB 4AP2A 2HM8A 4GAAA 3LKUA 2RD0A 4G24A 2J49A 2IU1A 3FEYA 3FTXA 4EBAA 3EHNA 2Y4TA 3OXLA 4JEHA 4WAFA 3BG1B 2IQCA 2E2EA 3KAEA 2QFCA 2MRIA 1JWGA 4I6EA 4NRHB 4XE0A 5M72A 2KCVA 1KT1A 3GZSA 3CKCA 5BW8C 3LCAA 1E8YA 4CEMA 4BFRA 3HIZA 4CGVA 2EQXA 2X6KA 3CQGB 3S7JA 3VTXA 1UG3A 2HR2A 4K03A 3S2AA 4DLOA 5BT1A 5BNWA 3O4ZA 4KYOB 3FTVA 3LVRE 4N3CA 3ZFWA 3IHYA 1EPUA 3FEXA 3EHMA 4H7XA 3S7DA 5G2NA 3SHFA 4C0MA 4WNFA 1SQMA 2WQHA 4I1AA 5BUZA 5EKQD 4I6JA 3CHRA 5G05J 2J9QA 4G2VA 4GMJA 3TGOA 2I2OA 3PEVB 4G23A 1HH8A 1UJKA 1ELKA 1E8ZA 2VSYA 3FTSA 3FU3A 4UQYA 2VQ2A 1IQRA 2ILRA 2PM6A 3CVNA 4J6IA 1HXIA 3URZA 3JQ1A 2X6IA 4V3IA 3R7RA 4ILIA 3TXMA 2XRYA 2R17C 2OOEA 1ZBPA 2GRLA 3PNTB 4IULA 3CVWA 3PRZA 1WAO1 2J4BA 3EIQC 3R7QA 4KZCA 3ZPJA 2WXFA 4GB9A 4I1OB 5EX3A 2VYIA 2IOSA 3ULQA 2XEVA 2VSNA 4O6FA 3NZSA 3T5VA 4GZDA 3APCA 4ANXA 4E6HA 2NSZA 3D9OA 3RRMB 4U07A 2AWIA 2E0IA 3CHMA 3CK9A 3FH8A 3FULA 3MA5A 2WXGA 4HLEA 4EZKA 3CVPA 5C2YA 3IKOB 2JEKA 3PUJA 3P1UA 1IQUA 5T4YA 2Y3AA 3FWVA 4XKBA 3B7SA 1PC2A 2WXMA 3AU5A 4JA7A 3RRUA 4B8CB 1E90A 1PAQA 3ML9A 5JJTA 1SZAA 4UI9J 4ATGA 3MV3B 4N2SA 3CHQA 2WXOA 1HZ4A 4UWFA 4WWNA 2GRMA 2UWJG 3JUIA 4J0UA 4EBAG 3PNLB 3UT8A 1UW4B 4XZ4A 2GGFA 3FDHA 2M63A 4PUCA 4A3TA 4BX8A 3DPDA 1U3CA 4XI0A 4GZCA 2YQ8A 3MEKA 5A7DB 4CCAA 2ONDA 2WB2A 4M3OA 2WM9A 1ELWA 4APOA 3HVEA 3CSFA 2MOWA 4GYOA 4N3AA 4JHRA 4U0ZA 3AS8A 5T3RA 4DI3A 4FLHA 2IONA 3RKVA 5DIZA 1WM5A 4I2WA 4A1SA 3TG4A 3SZ7A 4ANVA 2FF4A 1OUVA 3FHEA 3SF4A 4FULA 4ILHB 1X5BA 5AENA 5JJ7A 2WXRA 4EZLA 3L54A 3PUKA 3IHVA 3LYAA 3I5PA 4L23A 3UMVA 4DPRA 4KVMA 4EZJA 4WNDA 4HOSA 3ZVVA 4YVOA 3CGHA 4Q69A 2LAHA 4GA0A 3PZDA 5E76A 4KBQA 3PEUB 5FQ8A 1A17A 3UUXA 4I43A 3FUDA 1SZ9A 4BWRA 4N5CA 3ZW3A 3QOUA 3ZHEA 5FZSA 4GMLA 4B89A 2CHZA 3OXFA 2PL2A 1WY6A 2V0PA 3UT7A 1N54A 3VLEA 4DLQA 2XGOA 5KJKA 2X6HA 2XQ0A 2J4DA 5LFAA 1UN8A 3Q47B 4P29A 4TV3A 4U04A 2FEZA 4FC8A 4ILGA 4ANUA 4URKA 3PH0C 2R59A 3ZYKA 2CHWA 3B7UX 3L08A 2WVIA 2L6JA 3FU6A 4JXTA 3ESKA 3FTZA 3G2TA 4I1MA 4WUYA 4PS7A 3ZXSA 4ABNA 2DCPA 4XI9A 5AJDA 3TXNA 3VLFA 4AVXA 5BPPA 4J8SA 3NZUA 2VJ8A 4G1TA 4AY5A 4AY6A 3G2SA 3PVLA 4OVUA 2WXLA 5HI7A 4F7AA 3ONLA 3I3NA 1HG5A 4JA9A 2RG8A 4WWOA 4L2LA 3RO3A 4AXHA 2V4LA 4B8AA 2IFUA 5G05C 3KD7A 4YVQC 1E7VA 4DJAA 2PZIA 3JQ0A 3GYZA 4AJWA 2VTBB 4GYYA 3CK7A 3RIBA 3LJ3A 2VGYA 3KEZA 4GA1A 5LX8A 4TUUA 4EQFA 4MKTA 2KCLA 3UX4A 4RG6A 2VTBA 3SBTB 4IYPA 3RRNB 1L5JA 3I4GA 4L2YA 3QJZA 3MKQB 4HOQA 3CSTA 4BT9A 3CVUA 3D9NA 1EYHA 5JJ6A 1PY1A 3FUHA 3PS6A 3FUMA 2KM4A 2GW1A 4JHKA 4GZ3A 1DNPA 2FI7A 5T8IA 3Q4AB 3QC1A 3ESLA 4KMOA 4PDXA 3O48A 2R5SA 3LY9A 5C1DA 5A6CA 4HORA 5CHEE 1NP7A 1VDYA 1W3BA 2QY7A 2A5UA 4Q96A 3Q49B 4I9EA 2WQ6A 3QNKA 4JPSA 4Y6WA 4U8HA 3SFZA 2KZTA 4OYSA 4HOTA 1HS6A 5BV1A 3ZHEB 1TJCA 2I1JA 2J08A 3G2UA 1OWLA 4KVOA 3ZEFA 5J08A 4IRUA 5AJLA 5ENNA 3JYSA 2HO1A 3FUFA 1HX8A 4E85A 3TL5A 5FZRA 4TRQA 1FVHA 2CFZA 3ASFA 3CEQA 3QWWA 1GW6A 4OVVA 5FQ4A 1H2VC 1XNFA 3MX3A 5KCMA 3CKBA 2YINA 3CVQA 1NA3A 5CCMA 4DK5A 1LF8A 3MKRA 1Z6TA 3LY7A 4DI4A 3MZLB 5FZQA 3JCKC 2UY1A 3EJNA 3G2VA 3GZ2A 3MCXA 4I2ZA 1INZA 4PS8A 4BT8A 4FJZA 3D9PA 2CG2A 2BTDA 5JHBA 3VTYA 4C0EA 4NQ0A 2YHEA 4CT0A 3ZGQA 4A55A 3IBEA 1H2TC 4JEUA 3HVEB 1NZNA 2XGSA 4RSYA 3L17A 4CDRA 2WMOA 4MLPA 2VGXA 4BX9A 3LS8A 2XGMA 2LSUA 2C0LA 1JUQA 2I1KA 3S7FA 5D0OD 4AIFA 4RVBA 3ONKA 3UQ3A 4FHKA 3U9WA 4EECA 3FU5A 2AXZA 1EDUA 3HDXA 5CMWA 2PQNA 3TJPA 3VLDA 1B89A 2FBNA 2FO7A 4GYWA 3LVQE 4JW1A 3MV2B 2XPIA 4J8EA 5FT9A 4UWHA 3FU0A 3RU0A 2XRZA 3T5XA 2YNQA 4BY6A 1KT0A 3ASGA 3TAXA 1JWFA 3AU4A 3Q5MA 4CGWA 2DIWA 2VGXB 4HFGA 1TJFA 1EF1C 3LY8A 2XPYA 5EX0A 1Z3YA 2OV8A 4ANWA 4BTBA 2IF4A 1QNFA 3CQCB 5EDSA 2KATA 2X6FA 4D10C 3IV0A 3QDNA 3AS4A 2UY1B 3KS2A 4WNEA 5CCLA 3QAQA 1Z3XA 2L9BA 1TEZA 1HU3A 2BUGA 2L0TB 4CRWA 1HG2A 3APFA 3PE4A 3SI5A 2WXNA 1KLXA 4KZ0A 3ZYMA 4CDMA 3EIJA 2X38A 1YA0A 4UWLA 4FADA 1OWPA 4WWPA 2CHXA 3L22A 3LDZA 4BTAA 4UWGA 3FFLA 4GPKA 5ANLA 2DBAA 5AIJA 4NURA 2WXJA 4MRUA 3D9JA 2LAIA 3ASHA 3CLJA 4G11A 3ZYLA 4N2QA 4I6GA 4J8DA 4JVSA 4LCTA 3P2BA 3DBSA 3U4TA 4B94A 1QZ2A 3SD5A 1H19A 1BPOA 1Y6IA 3CHOA 5FWQA 3CK8A 4FA6A 3S7BA 3L16A 5AYWD 5LCWJ 1IYGA 2IJGX 2NC9A 3NF1A 4UWKA 4Y6CA 1UN9A 4PH4B 4UI9K 3D3MA 5JHAA 5LCWC 3U66A 3BEEA 2IOLA 3ML8A 3CVLA 1HFAA 3FH5A 3SNXA 2Q7FA 4GCOA 3FUJA 3CHSA 4KXKB 5FTPA 4AOFA 4H7YA 3CVYA 2J07A 4FJYA 4XKCA 5D0QD 4F53A 2L0IA 2PQRA 3U64A 4GZ5A 1ELRA 3CV0A 3ZYQA 2BF0X 1QQEA 2C2LA 4Q94A 4PS3A 4HXIA 1E7UA 4GA2A 4JL0A 3OXGA 3FUNA 3RO2A 3D9KA 2YHCA 3MKQA 4AEZC 4R7LA 2WQ7A 4N39A 5CMYA 4U0UA 5G55A 5FJYA 1XGWA 2AXVA 5J90A 1P5QA 4B0ZA 2MHKA 1HE8A 1FVFA 4G25A 2C0MA 4NACA 2P58C 3L6AA 3QB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTY A;  3QOU A;  3ZHE A;  4NQ0 A;  5FZS A;  4NRH B;  5M72 A;  3ZGQ A;  2KCV A;  1KT1 A;  5BW8 C;  2XCB A;  3CKC A;  3LCA A;  1E96 B;  3WXX A;  4CGV A;  1NZN A;  2XGS A;  3S7J A;  3OXF A;  3VTX A;  2HR2 A;  1IHG A;  2PL2 A;  2VGX A;  4CDR A;  2XGM A;  5BT1 A;  2LSU A;  5BNW A;  5KJM A;  5KJK A;  2C0L A;  2XGO A;  4KYO B;  3R9A B;  4N3C A;  5G04 C;  3S7F A;  3ZFW A;  5D0O D;  4AIF A;  3FP3 A;  2V5F A;  3S7D A;  4G26 A;  4H7X A;  3UQ3 A;  3Q47 B;  4U04 A;  4WNF A;  1NA0 A;  2FEZ A;  2WQH A;  5G04 J;  4I1A A;  2PQN A;  1B89 A;  5EKQ D;  2FBN A;  2FO7 A;  5G05 J;  2J9Q A;  4G2V A;  4GYW A;  4W9R A;  3N71 A;  5FT9 A;  3MV2 B;  2L6J A;  2XPI A;  4J8E A;  3ESK A;  3TGO A;  3RU0 A;  3UUX A;  4G23 A;  4WUY A;  1HH8 A;  4ABN A;  2VSY A;  1KT0 A;  3ASG A;  4XI9 A;  3RJV A;  3Q5M A;  3TAX A;  4CGW A;  4UQY A;  2VQ2 A;  3CVN A;  2VGX B;  4G1T A;  3HYM B;  4AY5 A;  4AY6 A;  1HXI A;  4UQX A;  3URZ A;  5HI7 A;  3EDT B;  4RG9 A;  4JA9 A;  3LY8 A;  5EX0 A;  5ARG A;  3RO3 A;  1FCH A;  2OOE A;  1ZBP A;  2IF4 A;  4BTB A;  3PE3 A;  2KC7 A;  2IFU A;  4IN3 B;  3KD7 A;  1WAO 1;  3E4B A;  4YVQ C;  5G05 C;  2KAT A;  2PZI A;  3GYZ A;  3ZPJ A;  4I17 A;  2LSV A;  3QDN A;  4GYY A;  3AS4 A;  3CK7 A;  2UY1 B;  3KS2 A;  4GCN A;  4UI9 C;  4WNE A;  5EX3 A;  3RIB A;  4BWR A;  2VGY A;  2HYZ A;  1Y8M A;  2VYI A;  4GA1 A;  3ULQ A;  2LNI A;  2VSN A;  2XEV A;  4GZ6 A;  4O6F A;  3ZN3 A;  4EQF A;  2WPV A;  2KCL A;  5KJL A;  2BUG A;  4RG6 A;  3PE4 A;  4U07 A;  1KLX A;  2KCK A;  3CK9 A;  3AS5 A;  4HOQ A;  3MA5 A;  5KJN A;  1YA0 A;  4YND A;  4BT9 A;  3ASD A;  3CVP A;  4LEU A;  3Q15 A;  5JJ6 A;  4BTA A;  4GPK A;  3FFL A;  5ARF A;  4J8F A;  2GW1 A;  5CCL A;  3K9I A;  5FZQ A;  2DBA A;  4GZ3 A;  3QWV A;  3FWV A;  1PC2 A;  2FI7 A;  3Q4A B;  2JLB A;  4JA7 A;  3ASH A;  4N2Q A;  3IEG A;  4J8D A;  5JJT A;  4UI9 J;  3MV3 B;  3U4T A;  4B94 A;  3O48 A;  4N2S A;  2R5S A;  1HZ4 A;  3LY9 A;  1QZ2 A;  3QKY A;  4XIF A;  5C1D A;  4WNG A;  2UWJ G;  5A6C A;  3CK8 A;  4J0U A;  3S7B A;  5LCW J;  5AYW D;  1IYG A;  4HOR A;  5CHE E;  2NC9 A;  3NF1 A;  4UQZ A;  3QWP A;  1ZU2 A;  3LPZ A;  4I9C A;  1W3B A;  2XCC A;  2Y4U A;  4UI9 K;  4XI0 A;  3PDN A;  4Y6C A;  3Q49 B;  3TG5 A;  2YQ8 A;  3MEK A;  4I9E A;  5A7D B;  3BEE A;  3GW4 A;  2OND A;  5LCW C;  1ELW A;  3CVL A;  4Y6W A;  4APO A;  2Q7F A;  4GCO A;  4KXK B;  3U3W A;  4N3A A;  4GYO A;  4H7Y A;  4HOU A;  4JHR A;  4U0Z A;  3AS8 A;  5FTP A;  5D0Q D;  4AM9 A;  4HOT A;  4N3B A;  4U0S A;  2PQR A;  5DBK A;  3RKV A;  5DIZ A;  1TJC A;  3ZHE B;  4GZ5 A;  1WM5 A;  4ME2 A;  1ELR A;  3CV0 A;  4I2W A;  3TG4 A;  3SZ7 A;  4A1S A;  4F3V A;  3UPV A;  2AVP A;  2FF4 A;  1OUV A;  1QQE A;  2C2L A;  3JYS A;  2HO1 A;  3SF4 A;  4GA2 A;  5JJ7 A;  5FZR A;  2I6H A;  3GZ1 A;  4JL0 A;  3OXG A;  5HQ8 A;  3ASF A;  3CEQ A;  3GZ2 A;  4I2Z A;  3RO2 A;  3QWW A;  2YHC A;  1XNF A;  3LKU A;  3LYA A;  4G24 A;  4N39 A;  4U0U A;  3CKB A;  5FJY A;  5CCM A;  3CVQ A;  1NA3 A;  1P5Q A;  4WND A;  4HOS A;  3MKR A;  2Y4T A;  3LY7 A;  3OXL A;  4YVO A;  4GA0 A;  2MHK A;  2UY1 A;  4KBQ A;  4G25 A;  1A17 A;  2C0M A;  2P58 C;  2E2E A;  3KAE A;  2QFC A;  4BT8 A;  4N5C A; 
#chains in the Genus database with same CATH topology
 4APF A;  3Q78 A;  5CEC B;  5EYL A;  1E8X A;  4ACK A;  1N4R A;  3MGB A;  2I9C A;  3R9A B;  2DWZ A;  2V5F A;  3FP3 A;  2P9I G;  1OWN A;  1YCS B;  5G04 J;  4HVB A;  4W9R A;  1SVX A;  3N71 A;  2KZT B;  2WXK A;  4UQX A;  1N0Q A;  3CHP A;  1JCR A;  2DYS E;  5ARG A;  5D66 A;  1FCH A;  2KC7 A;  1O1T A;  3E4B A;  4C9B B;  4U63 A;  1Y8M A;  3ZUV B;  2GRP B;  5EN5 D;  3LEW A;  1K8K G;  5FQ7 A;  3OAW A;  3QAR A;  3BG0 B;  3FUK A;  1TN7 A;  3QK0 A;  3PRE A;  3FUE A;  2NXP A;  1OWM A;  3FTW A;  4ACL A;  2EIM E;  3UT4 A;  2PM7 A;  4HQD A;  4BEP A;  4GU5 A;  2X6J A;  3SBS A;  3LPZ A;  3HHM A;  4MS6 A;  2ZU6 B;  4BSZ B;  2V8S E;  3DSW A;  3TWV A;  3G2W A;  4HOU A;  4N3B A;  3E37 A;  4ME2 A;  3Q9N C;  2AVP A;  3DEO A;  5HKP A;  3ZKJ A;  1TNZ A;  4AP2 A;  2HM8 A;  2J49 A;  2OEW A;  3OXL A;  3KAE A;  4I6E A;  4XE0 A;  3V31 A;  5KBA A;  4CEM A;  3HXF A;  3S2A A;  1BU9 A;  4HLL A;  5EID A;  3FTV A;  4N3C A;  3FEX A;  4OAV B;  3SHF A;  4C0M A;  2B0O E;  4WNF A;  2WQH A;  4G23 A;  4HI8 A;  1ELK A;  4GTO A;  1IQR A;  2ILR A;  4J6I A;  2X6I A;  4ILI A;  4IUL A;  3CVW A;  4GTT A;  2XEV A;  2VSN A;  3CHM A;  3FH8 A;  2WXG A;  3IKO B;  1TNO A;  4XKB A;  3B7S A;  1E90 A;  4ATG A;  3MV3 B;  2H6F A;  3CHQ A;  4WWN A;  1HZ4 A;  4N2S A;  2UWJ G;  3EU5 A;  5EYP F;  4EBA G;  4XZ4 A;  2GGF A;  4A3T A;  1U3C A;  4GZC A;  1MX6 A;  2YQ8 A;  5CEA A;  2WB2 A;  4APO A;  5ITZ F;  4GYO A;  3AS8 A;  4FLH A;  2ION A;  3KSQ A;  2ZXW E;  3SF4 A;  1X5B A;  5AEN A;  4EZL A;  2IEJ A;  3V2X A;  1S63 A;  3IHV A;  4HNA D;  3ZVV A;  1N95 A;  2LAH A;  3L82 A;  3QOU A;  2CHZ A;  3UT7 A;  2J4D A;  1UN8 A;  4FC8 A;  3F6Q A;  1D8D A;  3ZYK A;  5ENQ D;  2WVI A;  5B1B E;  5BPP A;  4J8S A;  2P9U G;  4OVU A;  4WWO A;  4K5C A;  2RG8 A;  4AXH A;  4L2L A;  3RO3 A;  2XEN A;  1E7V A;  5AQB A;  2PZI A;  3JXJ A;  4AJW A;  4GYY A;  2VGY A;  4N5Q A;  3SBT B;  3RRN B;  2B6C A;  3QJZ A;  1MX4 A;  4HOQ A;  3D9N A;  1EYH A;  3FUH A;  4F6R D;  2KM4 A;  4KMO A;  1MX2 A;  3LY9 A;  2FO1 E;  4B93 B;  1VDY A;  2A5U A;  4I9E A;  2WQ6 A;  5ENR D;  4U8H A;  4HRN A;  4HOT A;  5BV1 A;  1OWL A;  4EHM A;  3TWX A;  4IRU A;  5AJL A;  3JYS A;  3FUF A;  5FZR A;  4TRQ A;  1FVH A;  2CFZ A;  2ZIR A;  3ASF A;  1GW6 A;  5FQ4 A;  1XNF A;  1SA4 A;  1V55 E;  4DI4 A;  2F37 A;  3MCX A;  4PS8 A;  5JHB A;  3KSL A;  3AG3 E;  1AWC B;  3L9T A;  4CZ2 D;  2LSU A;  2QZA A;  2I1K A;  4RVB A;  4FHK A;  3U9W A;  4EEC A;  4HRL A;  4YDW A;  3Q75 A;  3VLD A;  2FO7 A;  3HG0 D;  4GYW A;  2ETC A;  4J8E A;  4UWH A;  1KT0 A;  3ASG A;  1NL4 A;  3Q5M A;  2DIW A;  3UIP C;  4ANW A;  2OV8 A;  1QNF A;  2IO2 C;  1OY3 D;  3E34 A;  4OAU C;  5CCL A;  2GRQ B;  1IXV A;  1HU3 A;  3PE4 A;  1MZC A;  3ZYM A;  2X38 A;  1NFI E;  4UWL A;  4FAD A;  4WWP A;  3FFL A;  2DBA A;  4MRU A;  3CLJ A;  4G11 A;  1QZ2 A;  4FA6 A;  5AYW D;  2IJG X;  4U7E B;  4UWK A;  4Y6C A;  1BI7 B;  1O1R A;  3EHR A;  4HI9 A;  3ML8 A;  2F0Y A;  3FUJ A;  5FTP A;  4H7Y A;  4XKC A;  5D0Q D;  4F53 A;  1WDY A;  3TWT A;  3AG4 E;  1ELR A;  1QQE A;  4HXI A;  1E7U A;  3ZNG A;  4K5B A;  4N39 A;  1P5Q A;  4MBG A;  5CED B;  2MHK A;  4G25 A;  3BQO A;  1O5M A;  3R9M A;  3QB2 A;  1N52 A;  2OVB A;  2XZD G;  2XHE A;  2XCB A;  1E96 B;  4GTP A;  3T8M A;  1G3N B;  1JPL A;  2VGE A;  2WXP A;  4G26 A;  2J09 A;  1SA5 A;  1NA0 A;  2GRR B;  2BED A;  2BKK B;  3HRA A;  3HYM B;  3ZIM A;  3IXE A;  4IN3 B;  4O1O A;  2CFU A;  5BXU A;  3ULY A;  3AS5 A;  2GRO B;  2IO3 C;  3LXU X;  5ARF A;  3K9I A;  1HF8 A;  4LUN U;  2HE0 A;  3NQP A;  3QWV A;  2EIN E;  3CIA A;  4XEI G;  4FP7 A;  2F8X K;  3UXG A;  5FIN A;  1HO8 A;  5LP0 A;  4A3V A;  3UM1 A;  2FUL A;  3CR3 A;  3QWP A;  4I9C A;  3PDN A;  3TG5 A;  4A1G A;  1H6K A;  2WMN A;  3U3W A;  1NI1 A;  2Y1L E;  4LNG A;  5DBK A;  1OT8 A;  2WXI A;  1E8W A;  3D9I A;  3GZ1 A;  5HQ8 A;  3Q7F A;  3D9L A;  4G24 A;  1SW6 A;  2IU1 A;  3FTX A;  4JEH A;  1QYM A;  3BG1 B;  4NIK A;  2IQC A;  4X8Q A;  3UM2 A;  3DPY A;  3GZS A;  3LCA A;  1E8Y A;  3S7J A;  3UI2 A;  3VTX A;  3X2Q E;  4K03 A;  3O4Z A;  1OXJ A;  3Q79 A;  3LVR E;  1EPU A;  3EHM A;  3TWR A;  1SQM A;  5EKQ D;  2J9Q A;  2L6B A;  4G2V A;  4GMJ A;  1HH8 A;  3J5Q B;  3ABL E;  2ZIS A;  3CVN A;  1LTX A;  2PM6 A;  1HXI A;  2P9S G;  3URZ A;  4K5A B;  1ZBP A;  1FPP A;  1FT1 A;  1MYO A;  1WAO 1;  3PRZ A;  2J4B A;  3EIQ C;  4GB9 A;  5EX3 A;  1KPS B;  2VYI A;  2IOS A;  3ULQ A;  4O6F A;  2XS1 A;  4GZD A;  3RRM B;  3D9O A;  4U07 A;  3FUL A;  3PUJ A;  1D8E A;  5T4Y A;  2Y3A A;  3FWV A;  4Q69 A;  5ENO D;  4B8C B;  4JA7 A;  5JJT A;  1SZA A;  4UWF A;  4J0U A;  2DYR E;  4F1P A;  4BX8 A;  3DRA A;  3FDH A;  4PUC A;  3DPD A;  4M7C A;  4XI0 A;  2OND A;  3DXM G;  4M3O A;  2H6I A;  2WM9 A;  3CSF A;  2MOW A;  5T3R A;  3NBN B;  5DIZ A;  1N4S A;  3TG4 A;  2FF4 A;  1OUV A;  3FHE A;  3L54 A;  4J8Y A;  3LYA A;  4L23 A;  3I5P A;  1H6P A;  4EZJ A;  5E76 A;  4KBQ A;  5FQ8 A;  1A17 A;  3FUD A;  1SZ9 A;  3ZW3 A;  3ZHE A;  4B89 A;  3OXF A;  3VLE A;  2XGO A;  2X6H A;  5LFA A;  3Q47 B;  5H7P A;  4DRX E;  2DVW A;  2CHW A;  2L6J A;  4JXT A;  5CER B;  3FTZ A;  4I1M A;  4PS7 A;  3ASO E;  2DCP A;  5AJD A;  3TXN A;  4AVX A;  2EIK E;  3NZU A;  4G1T A;  3G2S A;  3AJI A;  3AG1 E;  5HI7 A;  4F7A A;  3I3N A;  4LG6 A;  4HBD A;  4C48 B;  4DJA A;  3JQ0 A;  3DSS A;  2VTB B;  3RIB A;  3KEZ A;  4J7W A;  4EQF A;  2P9N G;  4MKT A;  4O60 A;  2VTB A;  1TN8 A;  4IYP A;  1L5J A;  3I4G A;  4L2Y A;  2NYJ A;  3CVU A;  5JJ6 A;  2ZGD A;  4JHK A;  1MJ0 A;  3QC1 A;  1RW2 A;  4QQI A;  4HOR A;  2Y69 E;  3QNK A;  2IY0 C;  3SFZ A;  4OYS A;  1HS6 A;  2J08 A;  4KVO A;  5J08 A;  1JCS A;  5ENN A;  2HO1 A;  3TL5 A;  3PZ1 A;  5CCM A;  1NA3 A;  3MKR A;  1Z6T A;  3MZL B;  2XEE A;  4TXR A;  3G2V A;  1INZ A;  4DX6 D;  4DX1 A;  2CG2 A;  5KNH D;  3SFX A;  3VTY A;  4NQ0 A;  4A55 A;  1K1A A;  1H2T C;  3L17 A;  4BX9 A;  2XGM A;  2C0L A;  1JUQ A;  4AIF A;  3DWL G;  3ONK A;  3FU5 A;  2AXZ A;  1EDU A;  3HDX A;  2PQN A;  1B89 A;  4JW1 A;  3MV2 B;  2XRZ A;  3TAX A;  1JWF A;  3HXE A;  3WG7 E;  1TJF A;  2OCC E;  1Z3Y A;  5EDS A;  2X6F A;  2Y0B G;  3AS4 A;  3KS2 A;  2L9B A;  4CRW A;  1HG2 A;  3SI5 A;  2WXN A;  1KLX A;  4KZ0 A;  4CDM A;  3EIJ A;  3UM0 A;  1YA0 A;  4GPK A;  3ZYL A;  3UIO C;  4JVS A;  4B94 A;  1H19 A;  1BPO A;  4RLY A;  1DCQ A;  5CRU A;  3S7B A;  3L16 A;  1IYG A;  2NC9 A;  1UN9 A;  3U66 A;  3W9G A;  3CVL A;  4AOF A;  3KEA A;  5AQ7 A;  3CVY A;  1K1B A;  2L0I A;  2PQR A;  3U64 A;  4Q94 A;  4PS3 A;  1JCQ A;  4JL0 A;  3OXG A;  3RO2 A;  2YHC A;  3J5P A;  3TWS A;  4R7L A;  1K3Z D;  4DX7 D;  1XGW A;  5KWD A;  1DCE A;  3TWU A;  5CHE E;  2P58 C;  5CRV A;  1UJJ A;  2VSX E;  5AAO A;  3RK6 A;  4CT4 A;  2ETA A;  5ENP D;  3CVV A;  1OWO A;  4FHJ A;  3B13 A;  3FH7 A;  4GTS A;  4JZY A;  2LUH A;  5BXO A;  2AW6 A;  2CG3 A;  4HRM B;  1H0A A;  1U3D A;  3C98 A;  3EDT B;  5A23 A;  4CDN A;  3D9M A;  1TN6 A;  4UI9 C;  3V79 K;  3APD A;  4JHJ A;  4AM9 A;  2HYZ A;  4AV7 A;  4HS2 A;  4GZ6 A;  4BSX A;  2KCK A;  3DSU A;  4YND A;  1DC2 A;  1MQS A;  4LEU A;  3Q15 A;  1TNY A;  1ZB1 A;  5FZQ A;  3MYV A;  1DVP A;  2OVF A;  3ZXP A;  3T8K A;  2EIL E;  5CBO A;  3IEG A;  5E75 A;  1OCC E;  5FQ6 A;  4GTQ A;  2QYJ A;  4WNG A;  2LXL A;  3Q9U C;  4FU3 A;  4F1S A;  2XPZ A;  3FTU A;  4ATZ D;  1ZU2 A;  2XCC A;  2Y4U A;  1KZO A;  4QFV A;  2A4Z A;  3GW4 A;  3DSX A;  3SGH A;  1OCR E;  1KZP A;  3CVX A;  4JC8 A;  3UPV A;  3UIN C;  3MJW A;  3C3Q A;  3I4R B;  2RD0 A;  3FEY A;  3EHN A;  2Y4T A;  4WAF A;  3E32 A;  1JWG A;  2ZGG A;  4NRH B;  5BW8 C;  3CKC A;  2P9P G;  4BFR A;  3HIZ A;  4CGV A;  2X6K A;  3CQG B;  1WG0 A;  5BT1 A;  5BNW A;  3ZFW A;  4BER A;  3PZ3 A;  3IHY A;  3S7D A;  4I1A A;  3UKU G;  2I2O A;  3PEV B;  2QYU A;  5D2M C;  3FTS A;  2VSY A;  2VQ2 A;  3SFY A;  3TXM A;  3PNT B;  3R7Q A;  4KZC A;  2WXF A;  5EIB E;  3NZS A;  4E6H A;  2NSZ A;  2E0I A;  3CK9 A;  3MA5 A;  4G8L A;  4GTV A;  1PC2 A;  3AU5 A;  1PAQ A;  4A63 B;  4U8Y D;  2GRM A;  3JUI A;  3PNL B;  3UT8 A;  1UW4 B;  2RFA A;  3MEK A;  4CCA A;  3HVE A;  4N3A A;  4JB8 P;  4DI3 A;  3RKV A;  4I2W A;  4A1S A;  3SZ7 A;  4ANV A;  3C72 A;  3PUK A;  1TNB A;  4DPR A;  3UMV A;  1LD8 A;  3PZD A;  3BU8 A;  3UUX A;  4I43 A;  4N5C A;  3DST A;  2R02 A;  3DEP A;  4GML A;  4LNB A;  3HXD A;  1WY6 A;  4TXP A;  5KJK A;  4DX5 D;  2F8Y A;  4P29 A;  1AP7 A;  1N4Q A;  4ANU A;  4ILG A;  3PH0 C;  2AJA A;  2R59 A;  3B7U X;  3FU6 A;  3ESK A;  4WUY A;  4XI9 A;  2VJ8 A;  4AY5 A;  3PVL A;  2WXL A;  5IY5 E;  1HG5 A;  2V4L A;  4B8A A;  2IFU A;  4LSZ E;  5LX8 A;  4GA1 A;  4TUU A;  4YDY A;  3ZU7 B;  3PS6 A;  3FUM A;  4GPM A;  4GZ3 A;  3Q4A B;  1N11 A;  3NOG D;  4PDX A;  3O48 A;  5A6C A;  1Z5S C;  1QBQ A;  1W3B A;  2JAB A;  3AG2 E;  4Q96 A;  3Q49 B;  1YYH A;  4JPS A;  4Y6W A;  2KZT A;  3D9H A;  3ZEF A;  1N9A A;  4CYM D;  2R2L A;  4E85 A;  1HX8 A;  1BI8 B;  3CEQ A;  4OVV A;  3MX3 A;  2R03 A;  3CKB A;  2YIN A;  3CVQ A;  4DK5 A;  3LY7 A;  2GRN B;  4FJZ A;  3D9P A;  4DX2 A;  3IBE A;  4JEU A;  3HVE B;  4RSY A;  2QC9 A;  3UQ3 A;  1A5E A;  5CMW A;  3UTM A;  2FBN A;  5FT9 A;  2XPI A;  3FU0 A;  3RU0 A;  3T5X A;  1FT2 A;  2YNQ A;  4BY6 A;  3Q7A A;  2LXM A;  4CGW A;  2VGX B;  4HFG A;  3RSE G;  3LY8 A;  2XPY A;  1X81 A;  4BTB A;  2IF4 A;  3CQC B;  2UY1 B;  3UKR G;  1TEZ A;  2L0T B;  1OWP A;  2XS8 A;  3LDZ A;  4BTA A;  4BET A;  3SQV A;  4NUR A;  2WXJ A;  3D9J A;  2LAI A;  5AN8 A;  4J8D A;  3EU9 A;  3P2B A;  3DBS A;  1S70 B;  3NOC D;  3SD5 A;  1Y6I A;  3ABK E;  5HS0 A;  3NF1 A;  4PH4 B;  1HFA A;  3SNX A;  2Q7F A;  4GCO A;  4KXK B;  3CHS A;  3EHQ A;  3Q73 A;  2J07 A;  4TUM A;  4GZ5 A;  2C2L A;  3W9F A;  1LD7 A;  3D9K A;  2RFM A;  3MKQ A;  3V30 A;  2BKG A;  5CMY A;  2AXV A;  3UM3 A;  5J90 A;  4B0Z A;  3PZ4 A;  3HXB A;  1FVF A;  4NAC A;  1S64 A;  4L9P A;  3WXX A;  4HB5 A;  1IHG A;  5KJM A;  3B7R L;  5G04 C;  5CBN A;  3FTY A;  5BV0 A;  4L1B A;  2OEV A;  2X3M A;  2WXQ A;  3RJV A;  4L7T A;  1TYQ G;  1IHB A;  4RG9 A;  2VSO E;  3L13 A;  3PE3 A;  4U8V D;  4UUC A;  4I17 A;  2LSV A;  4GCN A;  4F3V A;  3ZRH A;  5JA4 D;  3ZN3 A;  2LNI A;  3JXI A;  5KJL A;  2WPV A;  3ULE G;  2RKK A;  5KJN A;  3FUI A;  3ASD A;  1MHQ A;  5LOZ A;  4J8F A;  4URK A;  2AXU A;  4XX5 A;  2JLB A;  4XIF A;  3OTN A;  3QKY A;  4KT6 B;  3T9K A;  3ENE A;  1H2U A;  4UQZ A;  4TXQ A;  2LO6 A;  5ANR A;  4U95 D;  3RAU A;  1H6O A;  4FLB A;  4U0S A;  2WXH A;  1S0P A;  1Q2Z A;  1OCO E;  4LER A;  3E33 A;  4K0R A;  4EPZ A;  2H6H A;  4LRZ A;  3ASN E;  2I6H A;  3FY4 A;  3B7T A;  1TNU A;  4GAA A;  3V2O A;  3LKU A;  2DZO A;  4ZFH A;  4EBA A;  3EUV A;  2E2E A;  2QFC A;  4GMR A;  2MRI A;  5M72 A;  3ABM E;  2KCV A;  1KT1 A;  2EQX A;  5ENS D;  1UG3 A;  2HR2 A;  4DLO A;  2P2C P;  4KYO B;  4H7X A;  5G2N A;  5BUZ A;  4I6J A;  3CHR A;  5G05 J;  5JMN D;  5AQ9 A;  3TGO A;  1RZ4 A;  1UJK A;  1E8Z A;  3FU3 A;  5ENT D;  4UQY A;  3JQ1 A;  4V3I A;  3R7R A;  2XRY A;  2R17 C;  2OOE A;  2GRL A;  4ZHB A;  1BLX B;  3ZPJ A;  4I1O B;  3T5V A;  4ANX A;  3APC A;  1TR4 A;  2AWI A;  4HLE A;  4O1P A;  4EZK A;  3CVP A;  5C2Y A;  2JEK A;  3C5R A;  3P1U A;  1IQU A;  3RRU A;  2H6G A;  2WXM A;  3C3R A;  3ML9 A;  4UI9 J;  3AAA C;  1IKN D;  2WXO A;  3B7B A;  1V54 E;  2M63 A;  5A7D B;  1ELW A;  3C3O A;  4U0Z A;  4JHR A;  1YMP A;  3B95 A;  1WM5 A;  4FUL A;  4ILH B;  5JJ7 A;  2WXR A;  2P9K G;  4KVM A;  4WND A;  4HOS A;  4YVO A;  1N4P A;  3CGH A;  4GA0 A;  3PEU B;  4BWR A;  3NAW A;  5FZS A;  2PL2 A;  4JD2 G;  4RQI A;  2V0P A;  1N54 A;  3ISM C;  4DLQ A;  2XQ0 A;  1U2V G;  4TV3 A;  5B3S E;  5AQA A;  4U04 A;  2FEZ A;  3HXC A;  3L08 A;  3G2T A;  3ZXS A;  4ABN A;  3VLF A;  2V5Q C;  4AY6 A;  2PNN A;  3ONL A;  4JA9 A;  2A5E A;  5G05 C;  3KD7 A;  4YVQ C;  3GYZ A;  3CK7 A;  1OCZ E;  3LJ3 A;  2KCL A;  3UX4 A;  4RG6 A;  3NB2 A;  3MKQ B;  3CST A;  4BT9 A;  1PY1 A;  2GW1 A;  2EIJ E;  4U96 D;  1DNP A;  2FI7 A;  5T8I A;  3ESL A;  3PZ2 A;  3BUA A;  2R5S A;  5C1D A;  1NP7 A;  2QY7 A;  2KBX A;  3DXK G;  2V4H C;  3TWQ A;  3ZHE B;  2DZN A;  1TJC A;  2KXP C;  2I1J A;  3G2U A;  5EIL A;  2P9L G;  3QWW A;  1UOH A;  2ETB A;  5KNG A;  1H2V C;  5KCM A;  3JUE A;  1LF8 A;  2R05 A;  5HRY A;  4YDO A;  3JCK C;  2UY1 A;  3EJN A;  1N0R A;  3GZ2 A;  4I2Z A;  4BT8 A;  2BTD A;  4C0E A;  5B1A E;  2YHE A;  2XEH A;  4CT0 A;  3LJN A;  3ZGQ A;  1NZN A;  2XGS A;  4CDR A;  2WMO A;  4MLP A;  2VGX A;  3LS8 A;  3S7F A;  1BD8 A;  5D0O D;  3TJP A;  4DUI A;  3LVQ E;  3AU4 A;  1EF1 C;  5EX0 A;  2KAT A;  4D10 C;  3IV0 A;  3QDN A;  4WNE A;  3QAQ A;  1Z3X A;  2MYO A;  2XZT G;  2BUG A;  4GTM A;  3APF A;  2J8S D;  2CHX A;  3L22 A;  4UWG A;  5ANL A;  5FIO A;  5AIJ A;  5AAR A;  3ASH A;  4N2Q A;  1N94 A;  4I6G A;  3SY2 A;  4LCT A;  3U4T A;  3DSV A;  3CHO A;  5FWQ A;  3CK8 A;  5LCW J;  4YDE A;  4UI9 K;  3D3M A;  5JHA A;  5LCW C;  4G8K A;  3BEE A;  2IOL A;  3FH5 A;  4FJY A;  1D9S A;  1O1S A;  3CV0 A;  4GTR A;  4Z68 A;  3ZYQ A;  2BF0 X;  3E30 A;  4GA2 A;  3FUN A;  4AEZ C;  2WQ7 A;  4LNU D;  4U0U A;  5G55 A;  5FJY A;  3SO8 A;  4BES A;  1HE8 A;  2C0M A;  3L6A A;  3TWW A; 
#chains in the Genus database with same CATH homology
 1UJJ A;  1N52 A;  2OVB A;  2VSX E;  4APF A;  3RK6 A;  2XHE A;  2XCB A;  4CT4 A;  1E96 B;  3WXX A;  1E8X A;  3T8M A;  1JPL A;  4ACK A;  1IHG A;  3MGB A;  5KJM A;  2I9C A;  3B7R L;  2WXP A;  3R9A B;  3CVV A;  1OWO A;  5G04 C;  4FHJ A;  3B13 A;  3FP3 A;  2V5F A;  1OWN A;  3FH7 A;  4G26 A;  3FTY A;  4JZY A;  2J09 A;  5G04 J;  1NA0 A;  4HVB A;  4W9R A;  4L1B A;  5BV0 A;  3N71 A;  2AW6 A;  2X3M A;  2KZT B;  2WXQ A;  2CG3 A;  3RJV A;  4L7T A;  1H0A A;  2WXK A;  1U3D A;  3HYM B;  4UQX A;  3CHP A;  3C98 A;  3EDT B;  4RG9 A;  5ARG A;  3ZIM A;  5A23 A;  2VSO E;  1FCH A;  3L13 A;  3PE3 A;  2KC7 A;  4IN3 B;  4CDN A;  3E4B A;  3D9M A;  4I17 A;  2LSV A;  4UI9 C;  4C9B B;  4GCN A;  4F3V A;  3APD A;  4JHJ A;  3ZRH A;  4U63 A;  4AM9 A;  2HYZ A;  1Y8M A;  4AV7 A;  3ZN3 A;  4HS2 A;  2LNI A;  2CFU A;  4GZ6 A;  5KJL A;  2WPV A;  4BSX A;  3LEW A;  2KCK A;  3AS5 A;  5KJN A;  5FQ7 A;  3OAW A;  4YND A;  3QAR A;  3BG0 B;  1MQS A;  3FUI A;  3ASD A;  4LEU A;  3LXU X;  3Q15 A;  3FUK A;  1MHQ A;  5ARF A;  5LOZ A;  4J8F A;  3QK0 A;  3K9I A;  1HF8 A;  1DVP A;  3MYV A;  3PRE A;  3NQP A;  3QWV A;  2OVF A;  3FUE A;  2NXP A;  3CIA A;  4LUN U;  1OWM A;  2AXU A;  3FTW A;  4XX5 A;  4ACL A;  2JLB A;  4FP7 A;  3IEG A;  5E75 A;  3UT4 A;  2PM7 A;  5FQ6 A;  1HO8 A;  4XIF A;  3OTN A;  3QKY A;  4A3V A;  4GU5 A;  4WNG A;  5LP0 A;  4KT6 B;  4FU3 A;  2FUL A;  3ENE A;  1H2U A;  2XPZ A;  3FTU A;  2X6J A;  3CR3 A;  3SBS A;  4F1S A;  4UQZ A;  3QWP A;  5ANR A;  1ZU2 A;  2LO6 A;  3LPZ A;  4I9C A;  2XCC A;  2Y4U A;  3HHM A;  3PDN A;  4MS6 A;  2A4Z A;  2ZU6 B;  4QFV A;  3TG5 A;  4A1G A;  3GW4 A;  2V8S E;  1H6K A;  2WMN A;  4FLB A;  3U3W A;  3G2W A;  4HOU A;  3SGH A;  4N3B A;  4U0S A;  5DBK A;  2WXH A;  1S0P A;  4ME2 A;  3CVX A;  4JC8 A;  4LER A;  3UPV A;  4K0R A;  2AVP A;  4EPZ A;  2WXI A;  1E8W A;  3MJW A;  4LRZ A;  3D9I A;  2I6H A;  3FY4 A;  3GZ1 A;  5HQ8 A;  3D9L A;  3B7T A;  3I4R B;  4AP2 A;  2HM8 A;  4GAA A;  3LKU A;  2RD0 A;  4G24 A;  2J49 A;  2IU1 A;  3FEY A;  3FTX A;  4EBA A;  3EHN A;  2Y4T A;  3OXL A;  4JEH A;  4WAF A;  3BG1 B;  2IQC A;  2E2E A;  3KAE A;  2QFC A;  2MRI A;  1JWG A;  4I6E A;  4NRH B;  4XE0 A;  5M72 A;  2KCV A;  1KT1 A;  3GZS A;  3CKC A;  5BW8 C;  3LCA A;  1E8Y A;  4CEM A;  4BFR A;  3HIZ A;  4CGV A;  2EQX A;  2X6K A;  3CQG B;  3S7J A;  3VTX A;  1UG3 A;  2HR2 A;  4K03 A;  3S2A A;  4DLO A;  5BT1 A;  5BNW A;  3O4Z A;  4KYO B;  3FTV A;  3LVR E;  4N3C A;  3ZFW A;  3IHY A;  1EPU A;  3FEX A;  3EHM A;  4H7X A;  3S7D A;  5G2N A;  3SHF A;  4C0M A;  4WNF A;  1SQM A;  2WQH A;  4I1A A;  5BUZ A;  5EKQ D;  4I6J A;  3CHR A;  5G05 J;  2J9Q A;  4G2V A;  4GMJ A;  3TGO A;  2I2O A;  3PEV B;  4G23 A;  1HH8 A;  1UJK A;  1ELK A;  1E8Z A;  2VSY A;  3FTS A;  3FU3 A;  4UQY A;  2VQ2 A;  1IQR A;  2ILR A;  2PM6 A;  3CVN A;  4J6I A;  1HXI A;  3URZ A;  3JQ1 A;  2X6I A;  4V3I A;  3R7R A;  4ILI A;  3TXM A;  2XRY A;  2R17 C;  2OOE A;  1ZBP A;  2GRL A;  3PNT B;  4IUL A;  3CVW A;  3PRZ A;  1WAO 1;  2J4B A;  3EIQ C;  3R7Q A;  4KZC A;  3ZPJ A;  2WXF A;  4GB9 A;  4I1O B;  5EX3 A;  2VYI A;  2IOS A;  3ULQ A;  2XEV A;  2VSN A;  4O6F A;  3NZS A;  3T5V A;  4GZD A;  3APC A;  4ANX A;  4E6H A;  2NSZ A;  3D9O A;  3RRM B;  4U07 A;  2AWI A;  2E0I A;  3CHM A;  3CK9 A;  3FH8 A;  3FUL A;  3MA5 A;  2WXG A;  4HLE A;  4EZK A;  3CVP A;  5C2Y A;  3IKO B;  2JEK A;  3PUJ A;  3P1U A;  1IQU A;  5T4Y A;  2Y3A A;  3FWV A;  4XKB A;  3B7S A;  1PC2 A;  2WXM A;  3AU5 A;  4JA7 A;  3RRU A;  4B8C B;  1E90 A;  1PAQ A;  3ML9 A;  5JJT A;  1SZA A;  4UI9 J;  4ATG A;  3MV3 B;  4N2S A;  3CHQ A;  2WXO A;  1HZ4 A;  4UWF A;  4WWN A;  2GRM A;  2UWJ G;  3JUI A;  4J0U A;  4EBA G;  3PNL B;  3UT8 A;  1UW4 B;  4XZ4 A;  2GGF A;  3FDH A;  2M63 A;  4PUC A;  4A3T A;  4BX8 A;  3DPD A;  1U3C A;  4XI0 A;  4GZC A;  2YQ8 A;  3MEK A;  5A7D B;  4CCA A;  2OND A;  2WB2 A;  4M3O A;  2WM9 A;  1ELW A;  4APO A;  3HVE A;  3CSF A;  2MOW A;  4GYO A;  4N3A A;  4JHR A;  4U0Z A;  3AS8 A;  5T3R A;  4DI3 A;  4FLH A;  2ION A;  3RKV A;  5DIZ A;  1WM5 A;  4I2W A;  4A1S A;  3TG4 A;  3SZ7 A;  4ANV A;  2FF4 A;  1OUV A;  3FHE A;  3SF4 A;  4FUL A;  4ILH B;  1X5B A;  5AEN A;  5JJ7 A;  2WXR A;  4EZL A;  3L54 A;  3PUK A;  3IHV A;  3LYA A;  3I5P A;  4L23 A;  3UMV A;  4DPR A;  4KVM A;  4EZJ A;  4WND A;  4HOS A;  3ZVV A;  4YVO A;  3CGH A;  4Q69 A;  2LAH A;  4GA0 A;  3PZD A;  5E76 A;  4KBQ A;  3PEU B;  5FQ8 A;  1A17 A;  3UUX A;  4I43 A;  3FUD A;  1SZ9 A;  4BWR A;  4N5C A;  3ZW3 A;  3QOU A;  3ZHE A;  5FZS A;  4GML A;  4B89 A;  2CHZ A;  3OXF A;  2PL2 A;  1WY6 A;  2V0P A;  3UT7 A;  1N54 A;  3VLE A;  4DLQ A;  2XGO A;  5KJK A;  2X6H A;  2XQ0 A;  2J4D A;  5LFA A;  1UN8 A;  3Q47 B;  4P29 A;  4TV3 A;  4U04 A;  2FEZ A;  4FC8 A;  4ILG A;  4ANU A;  4URK A;  3PH0 C;  2R59 A;  3ZYK A;  2CHW A;  3B7U X;  3L08 A;  2WVI A;  2L6J A;  3FU6 A;  4JXT A;  3ESK A;  3FTZ A;  3G2T A;  4I1M A;  4WUY A;  4PS7 A;  3ZXS A;  4ABN A;  2DCP A;  4XI9 A;  5AJD A;  3TXN A;  3VLF A;  4AVX A;  5BPP A;  4J8S A;  3NZU A;  2VJ8 A;  4G1T A;  4AY5 A;  4AY6 A;  3G2S A;  3PVL A;  4OVU A;  2WXL A;  5HI7 A;  4F7A A;  3ONL A;  3I3N A;  1HG5 A;  4JA9 A;  2RG8 A;  4WWO A;  4L2L A;  3RO3 A;  4AXH A;  2V4L A;  4B8A A;  2IFU A;  5G05 C;  3KD7 A;  4YVQ C;  1E7V A;  4DJA A;  2PZI A;  3JQ0 A;  3GYZ A;  4AJW A;  2VTB B;  4GYY A;  3CK7 A;  3RIB A;  3LJ3 A;  2VGY A;  3KEZ A;  4GA1 A;  5LX8 A;  4TUU A;  4EQF A;  4MKT A;  2KCL A;  3UX4 A;  4RG6 A;  2VTB A;  3SBT B;  4IYP A;  3RRN B;  1L5J A;  3I4G A;  4L2Y A;  3QJZ A;  3MKQ B;  4HOQ A;  3CST A;  4BT9 A;  3CVU A;  3D9N A;  1EYH A;  5JJ6 A;  1PY1 A;  3FUH A;  3PS6 A;  3FUM A;  2KM4 A;  2GW1 A;  4JHK A;  4GZ3 A;  1DNP A;  2FI7 A;  5T8I A;  3Q4A B;  3QC1 A;  3ESL A;  4KMO A;  4PDX A;  3O48 A;  2R5S A;  3LY9 A;  5C1D A;  5A6C A;  4HOR A;  5CHE E;  1NP7 A;  1VDY A;  1W3B A;  2QY7 A;  2A5U A;  4Q96 A;  3Q49 B;  4I9E A;  2WQ6 A;  3QNK A;  4JPS A;  4Y6W A;  4U8H A;  3SFZ A;  2KZT A;  4OYS A;  4HOT A;  1HS6 A;  5BV1 A;  3ZHE B;  1TJC A;  2I1J A;  2J08 A;  3G2U A;  1OWL A;  4KVO A;  3ZEF A;  5J08 A;  4IRU A;  5AJL A;  5ENN A;  3JYS A;  2HO1 A;  3FUF A;  1HX8 A;  4E85 A;  3TL5 A;  5FZR A;  4TRQ A;  1FVH A;  2CFZ A;  3ASF A;  3CEQ A;  3QWW A;  1GW6 A;  4OVV A;  5FQ4 A;  1H2V C;  1XNF A;  3MX3 A;  5KCM A;  3CKB A;  2YIN A;  3CVQ A;  1NA3 A;  5CCM A;  4DK5 A;  1LF8 A;  3MKR A;  1Z6T A;  3LY7 A;  4DI4 A;  3MZL B;  5FZQ A;  3JCK C;  2UY1 A;  3EJN A;  3G2V A;  3GZ2 A;  3MCX A;  4I2Z A;  1INZ A;  4PS8 A;  4BT8 A;  4FJZ A;  3D9P A;  2CG2 A;  2BTD A;  5JHB A;  3VTY A;  4C0E A;  4NQ0 A;  2YHE A;  4CT0 A;  3ZGQ A;  4A55 A;  3IBE A;  1H2T C;  4JEU A;  3HVE B;  1NZN A;  2XGS A;  4RSY A;  3L17 A;  4CDR A;  2WMO A;  4MLP A;  2VGX A;  4BX9 A;  3LS8 A;  2XGM A;  2LSU A;  2C0L A;  1JUQ A;  2I1K A;  3S7F A;  5D0O D;  4AIF A;  4RVB A;  3ONK A;  3UQ3 A;  4FHK A;  3U9W A;  4EEC A;  3FU5 A;  2AXZ A;  1EDU A;  3HDX A;  5CMW A;  2PQN A;  3TJP A;  3VLD A;  1B89 A;  2FBN A;  2FO7 A;  4GYW A;  3LVQ E;  4JW1 A;  3MV2 B;  2XPI A;  4J8E A;  5FT9 A;  4UWH A;  3FU0 A;  3RU0 A;  2XRZ A;  3T5X A;  2YNQ A;  4BY6 A;  1KT0 A;  3ASG A;  3TAX A;  1JWF A;  3AU4 A;  3Q5M A;  4CGW A;  2DIW A;  2VGX B;  4HFG A;  1TJF A;  1EF1 C;  3LY8 A;  2XPY A;  5EX0 A;  1Z3Y A;  2OV8 A;  4ANW A;  4BTB A;  2IF4 A;  1QNF A;  3CQC B;  5EDS A;  2KAT A;  2X6F A;  4D10 C;  3IV0 A;  3QDN A;  3AS4 A;  2UY1 B;  3KS2 A;  4WNE A;  5CCL A;  3QAQ A;  1Z3X A;  2L9B A;  1TEZ A;  1HU3 A;  2BUG A;  2L0T B;  4CRW A;  1HG2 A;  3APF A;  3PE4 A;  3SI5 A;  2WXN A;  1KLX A;  4KZ0 A;  3ZYM A;  4CDM A;  3EIJ A;  2X38 A;  1YA0 A;  4UWL A;  4FAD A;  1OWP A;  4WWP A;  2CHX A;  3L22 A;  3LDZ A;  4BTA A;  4UWG A;  3FFL A;  4GPK A;  5ANL A;  2DBA A;  5AIJ A;  4NUR A;  2WXJ A;  4MRU A;  3D9J A;  2LAI A;  3ASH A;  3CLJ A;  4G11 A;  3ZYL A;  4N2Q A;  4I6G A;  4J8D A;  4JVS A;  4LCT A;  3P2B A;  3DBS A;  3U4T A;  4B94 A;  1QZ2 A;  3SD5 A;  1H19 A;  1BPO A;  1Y6I A;  3CHO A;  5FWQ A;  3CK8 A;  4FA6 A;  3S7B A;  3L16 A;  5AYW D;  5LCW J;  1IYG A;  2IJG X;  2NC9 A;  3NF1 A;  4UWK A;  4Y6C A;  1UN9 A;  4PH4 B;  4UI9 K;  3D3M A;  5JHA A;  5LCW C;  3U66 A;  3BEE A;  2IOL A;  3ML8 A;  3CVL A;  1HFA A;  3FH5 A;  3SNX A;  2Q7F A;  4GCO A;  3FUJ A;  3CHS A;  4KXK B;  5FTP A;  4AOF A;  4H7Y A;  3CVY A;  2J07 A;  4FJY A;  4XKC A;  5D0Q D;  4F53 A;  2L0I A;  2PQR A;  3U64 A;  4GZ5 A;  1ELR A;  3CV0 A;  3ZYQ A;  2BF0 X;  1QQE A;  2C2L A;  4Q94 A;  4PS3 A;  4HXI A;  1E7U A;  4GA2 A;  4JL0 A;  3OXG A;  3FUN A;  3RO2 A;  3D9K A;  2YHC A;  3MKQ A;  4AEZ C;  4R7L A;  2WQ7 A;  4N39 A;  5CMY A;  4U0U A;  5G55 A;  5FJY A;  1XGW A;  2AXV A;  5J90 A;  1P5Q A;  4B0Z A;  2MHK A;  1HE8 A;  1FVF A;  4G25 A;  2C0M A;  4NAC A;  2P58 C;  3L6A A;  3QB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...