3LDZA

Crystal structure of human stam1 vhs domain in complex with ubiquitin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
140
structure length
140
Chain Sequence
FATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Ubiquitin
publication title VHS domains of ESCRT-0 cooperate in high-avidity binding to polyubiquitinated cargo.
pubmed doi rcsb
total genus 57
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ldzA00
2V8SE 3D9NA 1EYHA 1H0AA 2LO6A 2MOWA 3ZYLA 3D9OA 1HF8A 4Q96A 2QY7A 1HX8A 1JPLA 4GZCA 3G2TA 1SZAA 3D9LA 3ONLA 3G2UA 4HFGA 3RRUA 1HG2A 1SZ9A 1PY1A 1HG5A 1JWFA 2L0IA 2BF0X 3G2VA 3ZYKA 3G2WA 5LOZA 2DIWA 4Q94A 3D9IA 1JUQA 3D9KA 1EDUA 2L0TB 3CLJA 3ONKA 5CMYA 1ELKA 4FU3A 1HFAA 3D9PA 3G2SA 3LDZA 1UJJA 1XGWA 3D9MA 4NACA 1LF8A 2KM4A 1JWGA 4FLBA 3ZYQA 5J08A 1X5BA 3D9JA 1MHQA 4GZDA 4AVXA 5LP0A 4JXTA 1INZA 1UJKA 3ZYMA 1DVPA 1VDYA 5CMWA 2DCPA
chains in the Genus database with same CATH superfamily
2XS1A 1EYHA 2HM8A 3S7FA 4L23A 3G2UA 4UQYA 4HVBA 3PZ1A 2WXIA 2F37A 3ZW3A 1YYHA 4HOQA 2X6JA 3IXEA 2XCCA 4YDOA 4H7YA 4Z68A 3Q75A 2R17C 1N52A 3D9NA 3SNXA 4N5CA 4OVVA 3FUNA 4JA9A 2F8YA 4DJAA 2WXLA 4HS2A 3AG2E 3SO8A 4TV3A 1W3BA 2IQCA 2R2LA 4J0UA 2WQ6A 4B0ZA 5AJDA 4IYPA 3ZEFA 2V8SE 4BY6A 3DEPA 3LCAA 3L82A 3TWXA 2WXMA 3Q15A 4IN3B 5JHBA 4J8EA 3TWRA 3E37A 3Q79A 4N3BA 4B8CB 1X5BA 4LNUD 3AG3E 4AVXA 4GZDA 4PS8A 1MYOA 4ZFHA 2FBNA 5EYPF 4R7LA 2OVBA 3PDNA 1HF8A 3D9LA 4LCTA 2WXNA 4DX7D 1NA3A 4CDRA 4TUUA 2NC9A 4FJZA 2WVIA 4HRMB 3CK8A 4GAAA 2IOSA 5LCWC 3Q49B 1O5MA 3GW4A 4B8AA 3ABKE 3BQOA 4BETA 1H6KA 1BLXB 4GA0A 4U8YD 4WWNA 4GCNA 3T9KA 2H6IA 3C98A 1WY6A 3CVLA 3JYSA 4CT0A 3FH8A 5AENA 3CVWA 3TWTA 3APDA 5CMYA 2L0TB 4FU3A 3TWSA 1D8DA 1WG0A 4J8DA 4X8QA 4UWKA 1SVXA 3SBTB 4JEHA 5CEAA 3PNLB 5DBKA 1DCQA 3MCXA 3MV2B 2PM7A 3AJIA 3I5PA 3PUKA 4I1AA 1SQMA 3V30A 3BU8A 4K0RA 4W9RA 3C3OA 4L9PA 4C0EA 1KPSB 4G24A 4G11A 4LEUA 2OEVA 3L16A 3FUIA 3NB2A 4TXQA 4DX6D 3NQPA 3IHYA 3D9PA 5CHEE 4IRUA 3AG1E 1E7VA 2WQHA 4EZLA 1U3DA 5ENRD 4TUMA 3AG4E 4NURA 3MKRA 2B0OE 4CDMA 3J5QB 5FQ7A 4AV7A 2CG2A 3QJZA 4F6RD 5KWDA 4O1OA 2IO3C 1IHGA 5AJLA 2JEKA 1VDYA 3FWVA 2NSZA 2VQ2A 2VSNA 4YVOA 1QYMA 4PS7A 4ABNA 3ASOE 3G2TA 2DZNA 3MV3B 4N3AA 3LS8A 2IJGX 3PS6A 4O6FA 3SD5A 2P9PG 4ILGA 5D0OD 3ZYQA 5AQBA 2P9KG 3RAUA 3UQ3A 2BKKB 3KD7A 3NZSA 4HORA 2IF4A 2AW6A 3T5VA 5FZQA 3U3WA 4A55A 2V5QC 3FHEA 2WXQA 1UW4B 3ASHA 3UM2A 2V4HC 3T5XA 4GPMA 1DC2A 3AU4A 2FI7A 5T8IA 3ZRHA 4J6IA 2ONDA 5KNHD 2JABA 2YHCA 4WWOA 4M3OA 1OWPA 2KBXA 2VGYA 3NAWA 4N2SA 2Y0BG 5C2YA 5EILA 3W9FA 1IQRA 3VLEA 4GTRA 3VTXA 3FU0A 4U95D 4NIKA 1MZCA 5A6CA 3QDNA 2EILE 3FU3A 1JCRA 2XZDG 3Q5MA 3ESLA 3RO3A 1WDYA 1MX4A 5EYLA 4CCAA 5BV1A 4MLPA 1UOHA 2XPYA 3C72A 3CVUA 3Q9UC 4FHKA 1MQSA 2HO1A 4WWPA 3JXIA 1E8XA 4Q96A 1BI8B 3L9TA 4O60A 1Z5SC 4UQZA 3GZ1A 3TJPA 2OV8A 4XKCA 4WNDA 4F1SA 3C5RA 3R7RA 2VGEA 3UIPC 4F3VA 4HRLA 3CIAA 2FF4A 4CYMD 3CVXA 5BPPA 3LY9A 4BFRA 3TWWA 2VYIA 1K3ZD 3CSFA 3UUXA 1IKND 2IONA 1B89A 3ML8A 3PE3A 1A17A 4XX5A 5KJKA 4IULA 1S64A 1SA5A 1JPLA 2AVPA 4QQIA 2R03A 5FIOA 4CDNA 1FVFA 2X38A 3SFYA 3OXFA 4KZCA 4FP7A 3UIOC 3SY2A 1EDUA 4BT9A 4YNDA 2L9BA 1N54A 5G05J 3FTXA 4D10C 3L6AA 3TWQA 3ESKA 3HRAA 2PZIA 1YMPA 3Q7FA 3PZ3A 5EX3A 3TWVA 4FJYA 3TWUA 2QC9A 3ISMC 2KXPC 2L0IA 3MYVA 3E34A 4JL0A 3FUJA 3D9MA 4KXKB 3DSUA 2M63A 3HHMA 4U63A 3DEOA 4YDEA 4B93B 2ZU6B 4HI8A 4GMJA 1UN8A 3V31A 5BXOA 1U3CA 4GTVA 4B94A 4AM9A 5LP0A 4C9BB 1JCSA 1TN6A 1DNPA 1EPUA 1BU9A 4JHKA 3RRNB 3CGHA 4AP2A 1Q2ZA 5G2NA 3L08A 1H6PA 4BESA 3CLJA 4L1BA 3FH7A 3SI5A 1JWGA 3EHRA 2GROB 3UMVA 3UT7A 3PEUB 4GZ5A 4BSXA 3EU9A 5LX8A 1NFIE 4YDYA 2KCKA 3ZKJA 4HRNA 1SZAA 4A63B 3AS8A 5AQ9A 5ARFA 1H19A 4LNBA 2P9IG 3HXDA 4UUCA 2MOWA 4RG9A 3I3NA 3D3MA 3T8MA 2LUHA 3PNTB 5FQ6A 3CKCA 5BV0A 4B89A 2DVWA 3HXCA 4GTMA 2P9UG 5FQ8A 3S7JA 1KLXA 2P9SG 4CGVA 2XRZA 5EKQD 2XEEA 3CHPA 2UWJG 4HLLA 4PDXA 4GTOA 1HG5A 3AU5A 2P2CP 5EX0A 4J7WA 5D0QD 2Y4UA 4GZ3A 3QNKA 2GRMA 1KZPA 1IHBA 4I2ZA 1N11A 2J9QA 4TRQA 4ME2A 1S63A 2VTBB 5JA4D 4U07A 1TN7A 2EINE 5H7PA 3CEQA 3LJNA 2YHEA 2ETCA 3BG1B 3EJNA 4E85A 4XI0A 1XNFA 2VSXE 4N2QA 1Z3YA 4HOUA 4WAFA 5ENPD 1SW6A 4GA1A 4BEPA 2EIKE 3UM3A 5AYWD 1D9SA 4CT4A 2AWIA 2GGFA 4BWRA 4TXRA 1E7UA 3Q9NC 4AEZC 3FP3A 4G23A 4BTAA 3ZIMA 1HZ4A 3RJVA 3ULYA 2DYRE 2OEWA 3SGHA 1OCOE 4CRWA 2Y1LE 3E30A 5HQ8A 5FJYA 3ZVVA 5CCMA 1A5EA 3MX3A 3E32A 1LTXA 5DIZA 4GMRA 4A1SA 3LKUA 1N95A 3ZYMA 2DBAA 3LY7A 4ZHBA 2FEZA 3ZGQA 3LVRE 4N39A 3JXJA 4BX9A 4ANXA 1HX8A 4G1TA 4LERA 4GYYA 1L5JA 3FUEA 5CERB 3DWLG 5G05C 1IXVA 4J8FA 3PUJA 3AS4A 1K8KG 2EIJE 4HLEA 2H6FA 4U0UA 4DX2A 4CEMA 2BKGA 2GRPB 3WG7E 2Y3AA 4I6JA 1RZ4A 4ANWA 3ULEG 2MHKA 4Y6WA 4H7XA 2X6HA 3GZ2A 5AN8A 5E76A 4HOTA 1U2VG 1OWNA 1N4RA 3CV0A 1H2VC 3RSEG 1WM5A 3UI2A 1FT1A 4NACA 5KNGA 5JJ7A 4WNGA 4GZ6A 2WXRA 3QOUA 4PH4B 4JHJA 5FTPA 2WMNA 4RQIA 5CMWA 3W9GA 2QY7A 4AJWA 5B1AE 1TNYA 3VTYA 4AIFA 3CSTA 5BUZA 5BT1A 2VJ8A 1ZU2A 4OVUA 2AJAA 5AARA 5G04J 5EIBE 2FO7A 2LO6A 2QFCA 4G8KA 2VGXB 1OWLA 5BXUA 5J90A 2GRNB 5AAOA 2BTDA 1BI7B 2UY1B 1NP7A 2WXJA 1AWCB 3APCA 1FVHA 3P2BA 3QAQA 1H2TC 3SF4A 3UPVA 1INZA 1H2UA 4HXIA 4U8HA 3L17A 3VLFA 3UX4A 1TEZA 1O1RA 2WXHA 3ZYLA 1KT1A 2HR2A 3FH5A 3EIQC 3CVVA 4ATGA 2I2OA 3JCKC 4I1OB 2L6BA 1P5QA 2IO2C 2KM4A 1TNUA 3DXKG 4DRXE 1QNFA 3QWWA 3TG4A 3ENEA 3QC1A 2Y69E 4K5BA 5KJLA 3SFZA 3ZU7B 4XE0A 2LAIA 1SZ9A 1ELRA 5AIJA 3IKOB 2XPZA 3ZUVB 2XCBA 2LXMA 3NF1A 1S70B 2MRIA 4O1PA 3MZLB 2RFMA 3DBSA 1NI1A 3FTYA 5FQ4A 1SA4A 3MJWA 4JC8A 3ASGA 3BUAA 2VSOE 3UKRG 3ZFWA 2ETAA 4LSZE 2CFZA 1E8YA 1LD8A 3SFXA 2C2LA 2P9NG 4JB8P 2DYSE 3IHVA 5LFAA 2DCPA 5C1DA 3HXBA 3ZHEB 2NXPA 1WAO1 4EZKA 5EIDA 4EECA 2X6IA 3B7UX 3RRUA 1V55E 4HQDA 4HI9A 3ONKA 4UI9J 4K5CA 5ENSD 5CEDB 2GW1A 1FT2A 4UQXA 4OAUC 4I6GA 1MJ0A 2XQ0A 3DXMG 4JEUA 3R9MA 3IBEA 3R9AB 2DWZA 3GYZA 2DIWA 3RO2A 5ARGA 3HYMB 1IQUA 2YQ8A 3FTZA 2IU1A 2J49A 2HYZA 2A4ZA 2IEJA 2XGOA 3PVLA 2GRRB 3DSTA 3LEWA 5B3SE 5G55A 2VSYA 5ITZF 4G8LA 2RG8A 5AQAA 2LSUA 2E2EA 3SQVA 4HOSA 1OXJA 3CHRA 3MA5A 3D9OA 4URKA 4GPKA 2BUGA 4YVQC 3PE4A 3B7TA 4NRHB 2XGMA 4XEIG 3ZXSA 4ATZD 5BW8C 1HH8A 4KVOA 1O1SA 3BEEA 3FUMA 4ACKA 3IV0A 3K9IA 1MHQA 3CHSA 4LG6A 1HO8A 3B7SA 1N0QA 3UT4A 3V2XA 4GTQA 3EHQA 5LCWJ 2V5FA 3U4TA 4WUYA 4ACLA 2ZIRA 4LUNU 3UTMA 4GYOA 1QBQA 4AY5A 3FU6A 5ENNA 5EDSA 5IY5E 2OVFA 3LVQE 3NOGD 3DSWA 2BEDA 4HBDA 4KVMA 1PAQA 2IY0C 2KZTB 1NZNA 5KCMA 3MKQB 3GZSA 3WXXA 2RD0A 3HDXA 4LRZA 1TYQG 5G04C 1MX6A 2P58C 2NYJA 2CHZA 2EQXA 4CGWA 3MGBA 3QKYA 1OY3D 4DUIA 5KJNA 2IFUA 3SHFA 4GCOA 3DPDA 2L6JA 3BG0B 1PC2A 3UXGA 5ANRA 3LPZA 3D9IA 4RG6A 1HE8A 3JQ1A 4XZ4A 4DK5A 4F53A 3OTNA 4RVBA 4FA6A 3FDHA 4DX1A 4AY6A 4A3VA 2VGXA 3ZNGA 3RU0A 3CHMA 3ONLA 3OXGA 2XS8A 1PY1A 4RLYA 4JHRA 2I1KA 2CFUA 4J8YA 5FINA 1N9AA 3DPYA 3PH0C 4MS6A 3FUDA 4UWHA 2HE0A 3ABLE 4U0ZA 3CVYA 4GMLA 3FFLA 4ILIA 2X6KA 4JPSA 4J8SA 4L7TA 3CK7A 2PQRA 3DSSA 1AP7A 3L54A 4MBGA 3TXNA 2XRYA 1HFAA 3LDZA 1N4PA 3PRZA 4BERA 4JXTA 3FTVA 4XIFA 2WXKA 4AOFA 3APFA 3R7QA 2V4LA 4APOA 1HG2A 2DZOA 3SBSA 2A5EA 4MKTA 4GU5A 2R59A 2F8XK 5JMND 1QZ2A 3RRMB 3TG5A 4G25A 2H6GA 3HVEB 5J08A 1G3NB 1Z3XA 4U7EB 2ZXWE 3UINC 1DVPA 4ANVA 3LYAA 1HS6A 5ENTD 3L22A 1OUVA 2ILRA 4FC8A 4PS3A 1FCHA 4G2VA 2LAHA 1HXIA 4UI9C 2I1JA 3C3RA 3QB2A 3X2QE 1UN9A 2KCVA 1E90A 3KS2A 5ENQD 2WB2A 4L2LA 4DI4A 3ABME 3TXMA 1MX2A 5D2MC 3ZHEA 2LSVA 3FULA 2Y4TA 4N5QA 4OYSA 3QK0A 1NA0A 4HFGA 1E96B 1E8ZA 2XEVA 4M7CA 4I43A 3CHQA 3JUIA 2C0MA 3E4BA 4FLBA 2ZISA 2J08A 1OCCE 1UJKA 4YDWA 4NQ0A 3KSLA 2MYOA 2RKKA 1HU3A 2CHWA 3EHMA 3Q78A 2PL2A 1Z6TA 3URZA 3U66A 3U9WA 2YNQA 3Q73A 2QYUA 3P1UA 3KSQA 3ZN3A 2V0PA 3PZ2A 3FUKA 4I9EA 4JA7A 1FPPA 2WXOA 3OXLA 3HXEA 3NBNB 2LNIA 3HXFA 5FZSA 2WQ7A 3ZYKA 4U96D 4KZ0A 3ULQA 4GTSA 2H6HA 3D9JA 4EHMA 3QWVA 3PREA 2AXVA 3TAXA 4XKBA 4N3CA 3HIZA 3TGOA 2KCLA 4JD2G 3KEAA 1BPOA 5AQ7A 2EIME 4KT6B 4EBAG 3V79K 2YINA 2AXZA 2RFAA 5FT9A 4HNAD 4BX8A 1XGWA 1V54E 5T4YA 3RK6A 3DRAA 2J8SD 4KBQA 2J09A 4FHJA 3UM1A 3DSVA 2XHEA 4Q69A 3ML9A 1X81A 2KZTA 2J4DA 3CKBA 3MKQA 3FY4A 1Y8MA 3L13A 3Q7AA 1N4QA 4FADA 3FTSA 5JJTA 4U0SA 3N71A 5CRUA 4TXPA 1IYGA 1O1TA 4I17A 3O4ZA 2XPIA 2PNNA 1N94A 3D9HA 5CECB 4K5AB 4ANUA 1DCEA 1UJJA 2J4BA 4A3TA 4GTPA 4UWGA 5CBOA 4DLOA 1GW6A 1Y6IA 2OCCE 3ASNE 2WXGA 5A7DB 4LNGA 3FTWA 4BTBA 2J07A 5KJMA 3C3QA 2CHXA 1TJCA 2B6CA 3B7RL 5M72A 2X6FA 4K03A 5D66A 2WM9A 2E0IA 1ZBPA 2QYJA 3UT8A 3LXUX 1E8WA 1OT8A 2OOEA 1YCSB 3ZPJA 5CBNA 2QZAA 1TNOA 3LJ3A 4KMOA 2JLBA 2PM6A 3TL5A 3PEVB 4U8VD 4I1MA 5LOZA 3OAWA 1OWOA 1YA0A 5HRYA 3HVEA 3QWPA 5HS0A 4UWLA 2GRQB 3FUFA 1ZB1A 3I4GA 3JQ0A 3T8KA 1TNBA 4RSYA 4KYOB 3B13A 1ELWA 5ANLA 1K1AA 5HKPA 4FULA 3AS5A 3SZ7A 5A23A 3HG0D 5T3RA 1LD7A 3EDTB 4PUCA 3CVNA 3FU5A 3UKUG 4I2WA 3E33A 2VTBA 4I6EA 5FZRA 5KBAA 3CK9A 4GZCA 5EN5D 3RIBA 1TNZA 2C0LA 3CVPA 5HI7A 1EF1C 2A5UA 1BD8A 1RW2A 3B7BA 3UM0A 3EUVA 1H0AA 1NL4A 4Y6CA 1OCRE 3LY8A 4GA2A 4V3IA 4WNFA 2XEHA 3B95A 3JUEA 2ZGGA 3J5PA 3ZXPA 2R05A 4EQFA 5CCLA 3EIJA 3D9KA 4WNEA 2P9LG 1OCZE 3S2AA 5JHAA 3EU5A 2I6HA 3CQCB 3EHNA 1TJFA 3FEXA 3RKVA 4E6HA 4GB9A 4C48B 2FO1E 3V2OA 3FTUA 4C0MA 1S0PA 1JUQA 1N4SA 4JZYA 2WXPA 4F1PA 4UI9K 3S7BA 1D8EA 3NZUA 4DI3A 2GRLA 4OAVB 4DPRA 4DX5D 4UWFA 4FLHA 2R02A 1H6OA 3FEYA 2KATA 2X3MA 1OWMA 1TN8A 4BSZB 1JCQA 3CR3A 1UG3A 2ETBA 4AXHA 3O48A 2KC7A 2FULA 2XGSA 3I4RB 4I9CA 4P29A 4QFVA 4GYWA 4EPZA 2WPVA 4XI9A 1K1BA 3G2WA 3NOCD 3CQGB 3Q4AB 2I9CA 4L2YA 4A1GA 2R5SA 1JWFA 3G2VA 3CVQA 2XZTG 1N0RA 4JW1A 3IEGA 3ASFA 4CZ2D 3MEKA 1QQEA 2LXLA 3PZDA 3F6QA 2XENA 5FWQA 3AAAC 2F0YA 3DSXA 4EBAA 4EZJA 4DLQA 3PZ4A 3FUHA 5CRVA 2ZGDA 2UY1A 1KZOA 4Q94A 1ELKA 2WXFA 5B1BE 4U04A 1KT0A 3U64A 4F7AA 3KAEA 4MRUA 3CHOA 3KEZA 2PQNA 2Q7FA 3S7DA 5JJ6A 5ENOD 4JVSA 3G2SA 3Q47B 1LF8A 2WMOA 5BNWA 4ILHB 2AXUA 4HB5A 2IOLA 3VLDA 3QARA 4GTTA 3ASDA 1TR4A 2BF0X 4BT8A 2CG3A 5E75A 4APFA 4G26A
chains in the Genus database with same CATH topology
3TAXA 4XX5A 1EYHA 3MJWA 4JC8A 3ASGA 2HM8A 4XKBA 5KJKA 4IULA 3S7FA 2VSOE 4N3CA 3HIZA 3TGOA 2KCLA 1JPLA 2AVPA 4L23A 3G2UA 1BPOA 4UQYA 4HVBA 2WXIA 4CDNA 3ZW3A 1FVFA 2X38A 4KT6B 3ZFWA 4EBAG 3OXFA 2YINA 4KZCA 2AXZA 4FP7A 4HOQA 5FT9A 2X6JA 1EDUA 4BT9A 4BX8A 4YNDA 2CFZA 2L9BA 1XGWA 1E8YA 1N54A 5G05J 3FTXA 2XCCA 5T4YA 4D10C 3L6AA 2C2LA 4H7YA 3RK6A 4KBQA 3IHVA 3ESKA 5LFAA 2PZIA 2J09A 4FHJA 2DCPA 5C1DA 2R17C 1N52A 3D9NA 3SNXA 3ZHEB 2NXPA 2XHEA 1WAO1 4EZKA 5EX3A 4N5CA 4OVVA 3FUNA 4JA9A 4EECA 2X6IA 3B7UX 4FJYA 3ML9A 4Q69A 3RRUA 2KZTA 2J4DA 3CKBA 4DJAA 2L0IA 3MKQA 2WXLA 4HS2A 3MYVA 3ONKA 4UI9J 4JL0A 3FUJA 1Y8MA 3FY4A 3L13A 3D9MA 4KXKB 4TV3A 1W3BA 4FADA 3FTSA 2IQCA 4J0UA 5JJTA 2WQ6A 4U0SA 2GW1A 4B0ZA 3N71A 4UQXA 4IYPA 5AJDA 3ZEFA 2V8SE 1IYGA 4I6GA 2M63A 4BY6A 4I17A 3LCAA 3HHMA 3O4ZA 4U63A 2XPIA 2XQ0A 2WXMA 3Q15A 4IN3B 4JEUA 4ANUA 5JHBA 3IBEA 3R9AB 2ZU6B 3GYZA 4J8EA 2DIWA 4GMJA 1UN8A 3RO2A 5ARGA 3HYMB 1U3CA 1IQUA 1UJJA 4N3BA 4B94A 2YQ8A 4B8CB 2J4BA 1X5BA 4AM9A 4AVXA 4GZDA 4PS8A 4C9BB 5LP0A 3FTZA 2IU1A 4A3TA 4UWGA 2J49A 2FBNA 1DNPA 2HYZA 4R7LA 2A4ZA 2OVBA 1EPUA 3PDNA 1HF8A 2XGOA 3PVLA 4JHKA 3RRNB 3LEWA 3D9LA 3CGHA 1GW6A 4DLOA 4LCTA 5G55A 2VSYA 2WXNA 4AP2A 1Y6IA 2RG8A 1NA3A 2WXGA 4CDRA 5G2NA 2LSUA 3L08A 4TUUA 2E2EA 3CLJA 4L1BA 5A7DB 3FH7A 2NC9A 3FTWA 3SI5A 4FJZA 1JWGA 4BTBA 4HOSA 2WVIA 3UMVA 3UT7A 2J07A 5KJMA 3CK8A 4GAAA 2CHXA 1TJCA 2IOSA 3PEUB 3CHRA 4GZ5A 5LCWC 4BSXA 3MA5A 3D9OA 5LX8A 3B7RL 4URKA 5M72A 4GPKA 2BUGA 2X6FA 2KCKA 4K03A 3Q49B 4YVQC 2WM9A 1SZAA 3GW4A 3PE4A 4B8AA 3B7TA 2E0IA 4NRHB 2XGMA 3AS8A 3ZXSA 1ZBPA 1H6KA 5BW8C 1HH8A 4KVOA 3UT8A 3BEEA 1H19A 3FUMA 3LXUX 5ARFA 4ACKA 4GA0A 1E8WA 2OOEA 3IV0A 3ZPJA 3K9IA 1MHQA 3CHSA 4WWNA 1HO8A 4GCNA 2MOWA 3B7SA 3LJ3A 4KMOA 3UT4A 4RG9A 2JLBA 2PM6A 3I3NA 3D3MA 5LCWJ 3C98A 1WY6A 2V5FA 3T8MA 3U4TA 3CVLA 3TL5A 4WUYA 4ACLA 3PNTB 3JYSA 4CT0A 3FH8A 3PEVB 5FQ6A 3CKCA 5AENA 5BV0A 3CVWA 4I1MA 4LUNU 5LOZA 3APDA 3OAWA 4GYOA 5CMYA 1OWOA 1YA0A 2L0TB 4B89A 3FU6A 5ENNA 4FU3A 4AY5A 3HVEA 3QWPA 5EDSA 4UWLA 5FQ8A 3S7JA 3FUFA 1KLXA 2OVFA 3LVQE 3I4GA 3JQ0A 4CGVA 2XRZA 5EKQD 4J8DA 4RSYA 3CHPA 3PE3A 4KYOB 2UWJG 3B13A 4PDXA 4KVMA 1PAQA 4UWKA 3SBTB 4JEHA 3PNLB 2KZTB 1ELWA 5DBKA 5ANLA 1HG5A 3AU5A 5EX0A 1NZNA 3MCXA 5KCMA 3MKQB 3GZSA 5D0QD 3WXXA 2Y4UA 3MV2B 3QNKA 4GZ3A 4FULA 2RD0A 2GRMA 3AS5A 4I2ZA 3HDXA 4LRZA 2PM7A 5G04C 3SZ7A 5T3RA 3I5PA 5A23A 2P58C 3PUKA 3EDTB 4PUCA 2J9QA 3CVNA 3FU5A 2CHZA 2EQXA 4TRQA 4I2WA 3MGBA 4I1AA 4ME2A 1SQMA 4CGWA 3QKYA 4K0RA 5KJNA 2VTBB 4W9RA 2VTBA 4U07A 2IFUA 4I6EA 4C0EA 5FZRA 3CK9A 3CEQA 4GZCA 4G24A 3SHFA 4G11A 4GCOA 4LEUA 3RIBA 2YHEA 3BG1B 3DPDA 2L6JA 3EJNA 3BG0B 2C0LA 3L16A 3FUIA 4E85A 3CVPA 5HI7A 1PC2A 5ANRA 3LPZA 3NQPA 1EF1C 4XI0A 3D9IA 4RG6A 1XNFA 2A5UA 2VSXE 3IHYA 3D9PA 5CHEE 1HE8A 4N2QA 3JQ1A 4XZ4A 4DK5A 4IRUA 4F53A 3OTNA 4RVBA 1Z3YA 1E7VA 2WQHA 4FA6A 4HOUA 3FDHA 4EZLA 4WAFA 4GA1A 4AY6A 1H0AA 4A3VA 1U3DA 2VGXA 5AYWD 4CT4A 3ML8A 4Y6CA 3RU0A 3CHMA 2AWIA 3LY8A 4GA2A 2GGFA 4V3IA 3ONLA 4NURA 3OXGA 4WNFA 3MKRA 4BWRA 1PY1A 4JHRA 2I1KA 2CFUA 4CDMA 4EQFA 5CCLA 1E7UA 3EIJA 5FQ7A 4AEZC 3D9KA 3FP3A 3PH0C 4AV7A 2CG2A 4G23A 4WNEA 4BTAA 3QJZA 3FUDA 4MS6A 3ZIMA 3S2AA 1HZ4A 3RJVA 1IHGA 4UWHA 5JHAA 5AJLA 2JEKA 1VDYA 3FWVA 2NSZA 4U0ZA 3CVYA 2VQ2A 2VSNA 3FFLA 4GMLA 4ILIA 4YVOA 2I6HA 2X6KA 4JPSA 3CQCB 4PS7A 3SGHA 4ABNA 3EHNA 3G2TA 1TJFA 3FEXA 4CRWA 3MV3B 4J8SA 3RKVA 4E6HA 4L7TA 3CK7A 4GB9A 2PQRA 4N3AA 3LS8A 2IJGX 5HQ8A 5FJYA 3L54A 3FTUA 3PS6A 3ZVVA 4O6FA 5CCMA 3SD5A 4C0MA 1S0PA 3MX3A 1JUQA 4ILGA 5D0OD 5DIZA 3TXNA 2XRYA 1HFAA 3LDZA 4A1SA 3LKUA 4JZYA 3ZYQA 3PRZA 2WXPA 3UQ3A 4JXTA 3ZYMA 4UI9K 3S7BA 3FTVA 2DBAA 3KD7A 3LY7A 4XIFA 2WXKA 4AOFA 3NZUA 3NZSA 2FEZA 4DI3A 2GRLA 3APFA 3ZGQA 4HORA 2IF4A 3LVRE 4DPRA 4N39A 4BX9A 2AW6A 4ANXA 3R7QA 1HX8A 3T5VA 4G1TA 4UWFA 5FZQA 4FLHA 3U3WA 2V4LA 4GYYA 4LERA 4A55A 4APOA 1L5JA 3FUEA 1HG2A 3FHEA 4MKTA 3FEYA 2KATA 3SBSA 5G05C 4GU5A 2X3MA 2R59A 1OWMA 2WXQA 4J8FA 1UW4B 1QZ2A 3PUJA 3AS4A 3ASHA 3RRMB 3TG5A 4G25A 4HLEA 3HVEB 5J08A 1Z3XA 3CR3A 4U0UA 1UG3A 4CEMA 4AXHA 3T5XA 3O48A 2KC7A 1DVPA 3AU4A 2FULA 2Y3AA 2FI7A 3LYAA 2XGSA 4ANVA 1HS6A 4I6JA 3I4RB 4ANWA 3L22A 2MHKA 5T8IA 4Y6WA 1OUVA 2ILRA 4FC8A 4PS3A 4H7XA 2X6HA 4I9CA 4P29A 3ZRHA 1FCHA 3GZ2A 4G2VA 2LAHA 5E76A 1HXIA 4QFVA 4HOTA 4UI9C 1OWNA 2I1JA 3QB2A 4J6IA 3CV0A 1H2VC 1UN9A 2KCVA 4GYWA 2ONDA 1E90A 4EPZA 3KS2A 1WM5A 4NACA 2YHCA 5JJ7A 4WWOA 4L2LA 4WNGA 4GZ6A 2WXRA 3QOUA 2WPVA 4PH4B 2WB2A 4DI4A 4JHJA 4XI9A 4M3OA 5FTPA 3G2WA 1OWPA 2WMNA 3TXMA 5CMWA 3ZHEA 2VGYA 2LSVA 3CQGB 3FULA 2Y4TA 4OYSA 2QY7A 3QK0A 3Q4AB 4AJWA 4N2SA 1NA0A 2I9CA 4HFGA 1E96B 4L2YA 3VTYA 4AIFA 4A1GA 5C2YA 2R5SA 1E8ZA 3CSTA 2XEVA 1JWFA 5BUZA 3G2VA 3CVQA 4I43A 5BT1A 1IQRA 3CHQA 3JUIA 4JW1A 3VLEA 3IEGA 2C0MA 3ASFA 3E4BA 2VJ8A 4FLBA 1ZU2A 2J08A 4OVUA 3MEKA 1UJKA 1QQEA 3VTXA 3FU0A 4NQ0A 3PZDA 5G04J 2FO7A 2LO6A 2QFCA 5A6CA 3QDNA 2VGXB 1OWLA 5FWQA 1HU3A 3FU3A 5J90A 4EBAA 4EZJA 4DLQA 3Q5MA 3FUHA 2CHWA 3EHMA 2BTDA 3ESLA 3RO3A 2UY1B 1NP7A 2UY1A 2WXJA 4Q94A 3APCA 1FVHA 3P2BA 3QAQA 1ELKA 4CCAA 2WXFA 5BV1A 2PL2A 4MLPA 2XPYA 4U04A 1KT0A 3U64A 1H2TC 3SF4A 4F7AA 3UPVA 3CVUA 1INZA 1H2UA 4HXIA 4U8HA 1Z6TA 3L17A 3VLFA 3UX4A 1TEZA 2WXHA 3KAEA 4FHKA 3URZA 1MQSA 2HO1A 3ZYLA 1KT1A 2HR2A 3FH5A 4MRUA 4WWPA 3U9WA 3U66A 1E8XA 2YNQA 3EIQC 3CHOA 4Q96A 3CVVA 3KEZA 3P1UA 4ATGA 2PQNA 2Q7FA 2I2OA 3JCKC 4I1OB 3S7DA 3ZN3A 2V0PA 5JJ6A 3FUKA 4I9EA 1P5QA 4UQZA 3GZ1A 4JVSA 3G2SA 3TJPA 2OV8A 3Q47B 1LF8A 2KM4A 2WMOA 4XKCA 5BNWA 4WNDA 1QNFA 3QWWA 4ILHB 4JA7A 4F1SA 3R7RA 2AXUA 3TG4A 2WXOA 2IOLA 3OXLA 4F3VA 2LNIA 3CIAA 3ENEA 2FF4A 3QC1A 5KJLA 3VLDA 3QARA 3SFZA 3CVXA 5FZSA 5BPPA 3ASDA 4XE0A 2WQ7A 2LAIA 1SZ9A 1ELRA 3LY9A 5AIJA 3IKOB 2BF0X 3ZYKA 4BT8A 2CG3A 2XPZA 2XCBA 4BFRA 3NF1A 4KZ0A 2VYIA 5E75A 2MRIA 3MZLB 3ULQA 4APFA 3CSFA 3D9JA 3DBSA 3QWVA 3FTYA 5FQ4A 3PREA 3UUXA 4G26A 2IONA 1B89A 1A17A 2AXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V8S E;  3D9N A;  1EYH A;  1H0A A;  2LO6 A;  2MOW A;  3ZYL A;  3D9O A;  1HF8 A;  4Q96 A;  2QY7 A;  1HX8 A;  1JPL A;  4GZC A;  3G2T A;  1SZA A;  3D9L A;  3ONL A;  3G2U A;  4HFG A;  3RRU A;  1HG2 A;  1SZ9 A;  1PY1 A;  1HG5 A;  1JWF A;  2L0I A;  2BF0 X;  3G2V A;  3ZYK A;  3G2W A;  5LOZ A;  2DIW A;  4Q94 A;  3D9I A;  1JUQ A;  3D9K A;  1EDU A;  2L0T B;  3CLJ A;  3ONK A;  5CMY A;  1ELK A;  4FU3 A;  1HFA A;  3D9P A;  3G2S A;  3LDZ A;  1UJJ A;  1XGW A;  3D9M A;  4NAC A;  1LF8 A;  2KM4 A;  1JWG A;  4FLB A;  3ZYQ A;  5J08 A;  1X5B A;  3D9J A;  1MHQ A;  4GZD A;  4AVX A;  5LP0 A;  4JXT A;  1INZ A;  1UJK A;  3ZYM A;  1DVP A;  1VDY A;  5CMW A;  2DCP A; 
#chains in the Genus database with same CATH topology
 2XS1 A;  1EYH A;  2HM8 A;  3S7F A;  4L23 A;  3G2U A;  4UQY A;  4HVB A;  3PZ1 A;  2WXI A;  2F37 A;  3ZW3 A;  1YYH A;  4HOQ A;  2X6J A;  3IXE A;  2XCC A;  4YDO A;  4H7Y A;  4Z68 A;  3Q75 A;  2R17 C;  1N52 A;  3D9N A;  3SNX A;  4N5C A;  4OVV A;  3FUN A;  4JA9 A;  2F8Y A;  4DJA A;  2WXL A;  4HS2 A;  3AG2 E;  3SO8 A;  4TV3 A;  1W3B A;  2IQC A;  2R2L A;  4J0U A;  2WQ6 A;  4B0Z A;  5AJD A;  4IYP A;  3ZEF A;  2V8S E;  4BY6 A;  3DEP A;  3LCA A;  3L82 A;  3TWX A;  2WXM A;  3Q15 A;  4IN3 B;  5JHB A;  4J8E A;  3TWR A;  3E37 A;  3Q79 A;  4N3B A;  4B8C B;  1X5B A;  4LNU D;  3AG3 E;  4AVX A;  4GZD A;  4PS8 A;  1MYO A;  4ZFH A;  2FBN A;  5EYP F;  4R7L A;  2OVB A;  3PDN A;  1HF8 A;  3D9L A;  4LCT A;  2WXN A;  4DX7 D;  1NA3 A;  4CDR A;  4TUU A;  2NC9 A;  4FJZ A;  2WVI A;  4HRM B;  3CK8 A;  4GAA A;  2IOS A;  5LCW C;  3Q49 B;  1O5M A;  3GW4 A;  4B8A A;  3ABK E;  3BQO A;  4BET A;  1H6K A;  1BLX B;  4GA0 A;  4U8Y D;  4WWN A;  4GCN A;  3T9K A;  2H6I A;  3C98 A;  1WY6 A;  3CVL A;  3JYS A;  4CT0 A;  3FH8 A;  5AEN A;  3CVW A;  3TWT A;  3APD A;  5CMY A;  2L0T B;  4FU3 A;  3TWS A;  1D8D A;  1WG0 A;  4J8D A;  4X8Q A;  4UWK A;  1SVX A;  3SBT B;  4JEH A;  5CEA A;  3PNL B;  5DBK A;  1DCQ A;  3MCX A;  3MV2 B;  2PM7 A;  3AJI A;  3I5P A;  3PUK A;  4I1A A;  1SQM A;  3V30 A;  3BU8 A;  4K0R A;  4W9R A;  3C3O A;  4L9P A;  4C0E A;  1KPS B;  4G24 A;  4G11 A;  4LEU A;  2OEV A;  3L16 A;  3FUI A;  3NB2 A;  4TXQ A;  4DX6 D;  3NQP A;  3IHY A;  3D9P A;  5CHE E;  4IRU A;  3AG1 E;  1E7V A;  2WQH A;  4EZL A;  1U3D A;  5ENR D;  4TUM A;  3AG4 E;  4NUR A;  3MKR A;  2B0O E;  4CDM A;  3J5Q B;  5FQ7 A;  4AV7 A;  2CG2 A;  3QJZ A;  4F6R D;  5KWD A;  4O1O A;  2IO3 C;  1IHG A;  5AJL A;  2JEK A;  1VDY A;  3FWV A;  2NSZ A;  2VQ2 A;  2VSN A;  4YVO A;  1QYM A;  4PS7 A;  4ABN A;  3ASO E;  3G2T A;  2DZN A;  3MV3 B;  4N3A A;  3LS8 A;  2IJG X;  3PS6 A;  4O6F A;  3SD5 A;  2P9P G;  4ILG A;  5D0O D;  3ZYQ A;  5AQB A;  2P9K G;  3RAU A;  3UQ3 A;  2BKK B;  3KD7 A;  3NZS A;  4HOR A;  2IF4 A;  2AW6 A;  3T5V A;  5FZQ A;  3U3W A;  4A55 A;  2V5Q C;  3FHE A;  2WXQ A;  1UW4 B;  3ASH A;  3UM2 A;  2V4H C;  3T5X A;  4GPM A;  1DC2 A;  3AU4 A;  2FI7 A;  5T8I A;  3ZRH A;  4J6I A;  2OND A;  5KNH D;  2JAB A;  2YHC A;  4WWO A;  4M3O A;  1OWP A;  2KBX A;  2VGY A;  3NAW A;  4N2S A;  2Y0B G;  5C2Y A;  5EIL A;  3W9F A;  1IQR A;  3VLE A;  4GTR A;  3VTX A;  3FU0 A;  4U95 D;  4NIK A;  1MZC A;  5A6C A;  3QDN A;  2EIL E;  3FU3 A;  1JCR A;  2XZD G;  3Q5M A;  3ESL A;  3RO3 A;  1WDY A;  1MX4 A;  5EYL A;  4CCA A;  5BV1 A;  4MLP A;  1UOH A;  2XPY A;  3C72 A;  3CVU A;  3Q9U C;  4FHK A;  1MQS A;  2HO1 A;  4WWP A;  3JXI A;  1E8X A;  4Q96 A;  1BI8 B;  3L9T A;  4O60 A;  1Z5S C;  4UQZ A;  3GZ1 A;  3TJP A;  2OV8 A;  4XKC A;  4WND A;  4F1S A;  3C5R A;  3R7R A;  2VGE A;  3UIP C;  4F3V A;  4HRL A;  3CIA A;  2FF4 A;  4CYM D;  3CVX A;  5BPP A;  3LY9 A;  4BFR A;  3TWW A;  2VYI A;  1K3Z D;  3CSF A;  3UUX A;  1IKN D;  2ION A;  1B89 A;  3ML8 A;  3PE3 A;  1A17 A;  4XX5 A;  5KJK A;  4IUL A;  1S64 A;  1SA5 A;  1JPL A;  2AVP A;  4QQI A;  2R03 A;  5FIO A;  4CDN A;  1FVF A;  2X38 A;  3SFY A;  3OXF A;  4KZC A;  4FP7 A;  3UIO C;  3SY2 A;  1EDU A;  4BT9 A;  4YND A;  2L9B A;  1N54 A;  5G05 J;  3FTX A;  4D10 C;  3L6A A;  3TWQ A;  3ESK A;  3HRA A;  2PZI A;  1YMP A;  3Q7F A;  3PZ3 A;  5EX3 A;  3TWV A;  4FJY A;  3TWU A;  2QC9 A;  3ISM C;  2KXP C;  2L0I A;  3MYV A;  3E34 A;  4JL0 A;  3FUJ A;  3D9M A;  4KXK B;  3DSU A;  2M63 A;  3HHM A;  4U63 A;  3DEO A;  4YDE A;  4B93 B;  2ZU6 B;  4HI8 A;  4GMJ A;  1UN8 A;  3V31 A;  5BXO A;  1U3C A;  4GTV A;  4B94 A;  4AM9 A;  5LP0 A;  4C9B B;  1JCS A;  1TN6 A;  1DNP A;  1EPU A;  1BU9 A;  4JHK A;  3RRN B;  3CGH A;  4AP2 A;  1Q2Z A;  5G2N A;  3L08 A;  1H6P A;  4BES A;  3CLJ A;  4L1B A;  3FH7 A;  3SI5 A;  1JWG A;  3EHR A;  2GRO B;  3UMV A;  3UT7 A;  3PEU B;  4GZ5 A;  4BSX A;  3EU9 A;  5LX8 A;  1NFI E;  4YDY A;  2KCK A;  3ZKJ A;  4HRN A;  1SZA A;  4A63 B;  3AS8 A;  5AQ9 A;  5ARF A;  1H19 A;  4LNB A;  2P9I G;  3HXD A;  4UUC A;  2MOW A;  4RG9 A;  3I3N A;  3D3M A;  3T8M A;  2LUH A;  3PNT B;  5FQ6 A;  3CKC A;  5BV0 A;  4B89 A;  2DVW A;  3HXC A;  4GTM A;  2P9U G;  5FQ8 A;  3S7J A;  1KLX A;  2P9S G;  4CGV A;  2XRZ A;  5EKQ D;  2XEE A;  3CHP A;  2UWJ G;  4HLL A;  4PDX A;  4GTO A;  1HG5 A;  3AU5 A;  2P2C P;  5EX0 A;  4J7W A;  5D0Q D;  2Y4U A;  4GZ3 A;  3QNK A;  2GRM A;  1KZP A;  1IHB A;  4I2Z A;  1N11 A;  2J9Q A;  4TRQ A;  4ME2 A;  1S63 A;  2VTB B;  5JA4 D;  4U07 A;  1TN7 A;  2EIN E;  5H7P A;  3CEQ A;  3LJN A;  2YHE A;  2ETC A;  3BG1 B;  3EJN A;  4E85 A;  4XI0 A;  1XNF A;  2VSX E;  4N2Q A;  1Z3Y A;  4HOU A;  4WAF A;  5ENP D;  1SW6 A;  4GA1 A;  4BEP A;  2EIK E;  3UM3 A;  5AYW D;  1D9S A;  4CT4 A;  2AWI A;  2GGF A;  4BWR A;  4TXR A;  1E7U A;  3Q9N C;  4AEZ C;  3FP3 A;  4G23 A;  4BTA A;  3ZIM A;  1HZ4 A;  3RJV A;  3ULY A;  2DYR E;  2OEW A;  3SGH A;  1OCO E;  4CRW A;  2Y1L E;  3E30 A;  5HQ8 A;  5FJY A;  3ZVV A;  5CCM A;  1A5E A;  3MX3 A;  3E32 A;  1LTX A;  5DIZ A;  4GMR A;  4A1S A;  3LKU A;  1N95 A;  3ZYM A;  2DBA A;  3LY7 A;  4ZHB A;  2FEZ A;  3ZGQ A;  3LVR E;  4N39 A;  3JXJ A;  4BX9 A;  4ANX A;  1HX8 A;  4G1T A;  4LER A;  4GYY A;  1L5J A;  3FUE A;  5CER B;  3DWL G;  5G05 C;  1IXV A;  4J8F A;  3PUJ A;  3AS4 A;  1K8K G;  2EIJ E;  4HLE A;  2H6F A;  4U0U A;  4DX2 A;  4CEM A;  2BKG A;  2GRP B;  3WG7 E;  2Y3A A;  4I6J A;  1RZ4 A;  4ANW A;  3ULE G;  2MHK A;  4Y6W A;  4H7X A;  2X6H A;  3GZ2 A;  5AN8 A;  5E76 A;  4HOT A;  1U2V G;  1OWN A;  1N4R A;  3CV0 A;  1H2V C;  3RSE G;  1WM5 A;  3UI2 A;  1FT1 A;  4NAC A;  5KNG A;  5JJ7 A;  4WNG A;  4GZ6 A;  2WXR A;  3QOU A;  4PH4 B;  4JHJ A;  5FTP A;  2WMN A;  4RQI A;  5CMW A;  3W9G A;  2QY7 A;  4AJW A;  5B1A E;  1TNY A;  3VTY A;  4AIF A;  3CST A;  5BUZ A;  5BT1 A;  2VJ8 A;  1ZU2 A;  4OVU A;  2AJA A;  5AAR A;  5G04 J;  5EIB E;  2FO7 A;  2LO6 A;  2QFC A;  4G8K A;  2VGX B;  1OWL A;  5BXU A;  5J90 A;  2GRN B;  5AAO A;  2BTD A;  1BI7 B;  2UY1 B;  1NP7 A;  2WXJ A;  1AWC B;  3APC A;  1FVH A;  3P2B A;  3QAQ A;  1H2T C;  3SF4 A;  3UPV A;  1INZ A;  1H2U A;  4HXI A;  4U8H A;  3L17 A;  3VLF A;  3UX4 A;  1TEZ A;  1O1R A;  2WXH A;  3ZYL A;  1KT1 A;  2HR2 A;  3FH5 A;  3EIQ C;  3CVV A;  4ATG A;  2I2O A;  3JCK C;  4I1O B;  2L6B A;  1P5Q A;  2IO2 C;  2KM4 A;  1TNU A;  3DXK G;  4DRX E;  1QNF A;  3QWW A;  3TG4 A;  3ENE A;  3QC1 A;  2Y69 E;  4K5B A;  5KJL A;  3SFZ A;  3ZU7 B;  4XE0 A;  2LAI A;  1SZ9 A;  1ELR A;  5AIJ A;  3IKO B;  2XPZ A;  3ZUV B;  2XCB A;  2LXM A;  3NF1 A;  1S70 B;  2MRI A;  4O1P A;  3MZL B;  2RFM A;  3DBS A;  1NI1 A;  3FTY A;  5FQ4 A;  1SA4 A;  3MJW A;  4JC8 A;  3ASG A;  3BUA A;  2VSO E;  3UKR G;  3ZFW A;  2ETA A;  4LSZ E;  2CFZ A;  1E8Y A;  1LD8 A;  3SFX A;  2C2L A;  2P9N G;  4JB8 P;  2DYS E;  3IHV A;  5LFA A;  2DCP A;  5C1D A;  3HXB A;  3ZHE B;  2NXP A;  1WAO 1;  4EZK A;  5EID A;  4EEC A;  2X6I A;  3B7U X;  3RRU A;  1V55 E;  4HQD A;  4HI9 A;  3ONK A;  4UI9 J;  4K5C A;  5ENS D;  5CED B;  2GW1 A;  1FT2 A;  4UQX A;  4OAU C;  4I6G A;  1MJ0 A;  2XQ0 A;  3DXM G;  4JEU A;  3R9M A;  3IBE A;  3R9A B;  2DWZ A;  3GYZ A;  2DIW A;  3RO2 A;  5ARG A;  3HYM B;  1IQU A;  2YQ8 A;  3FTZ A;  2IU1 A;  2J49 A;  2HYZ A;  2A4Z A;  2IEJ A;  2XGO A;  3PVL A;  2GRR B;  3DST A;  3LEW A;  5B3S E;  5G55 A;  2VSY A;  5ITZ F;  4G8L A;  2RG8 A;  5AQA A;  2LSU A;  2E2E A;  3SQV A;  4HOS A;  1OXJ A;  3CHR A;  3MA5 A;  3D9O A;  4URK A;  4GPK A;  2BUG A;  4YVQ C;  3PE4 A;  3B7T A;  4NRH B;  2XGM A;  4XEI G;  3ZXS A;  4ATZ D;  5BW8 C;  1HH8 A;  4KVO A;  1O1S A;  3BEE A;  3FUM A;  4ACK A;  3IV0 A;  3K9I A;  1MHQ A;  3CHS A;  4LG6 A;  1HO8 A;  3B7S A;  1N0Q A;  3UT4 A;  3V2X A;  4GTQ A;  3EHQ A;  5LCW J;  2V5F A;  3U4T A;  4WUY A;  4ACL A;  2ZIR A;  4LUN U;  3UTM A;  4GYO A;  1QBQ A;  4AY5 A;  3FU6 A;  5ENN A;  5EDS A;  5IY5 E;  2OVF A;  3LVQ E;  3NOG D;  3DSW A;  2BED A;  4HBD A;  4KVM A;  1PAQ A;  2IY0 C;  2KZT B;  1NZN A;  5KCM A;  3MKQ B;  3GZS A;  3WXX A;  2RD0 A;  3HDX A;  4LRZ A;  1TYQ G;  5G04 C;  1MX6 A;  2P58 C;  2NYJ A;  2CHZ A;  2EQX A;  4CGW A;  3MGB A;  3QKY A;  1OY3 D;  4DUI A;  5KJN A;  2IFU A;  3SHF A;  4GCO A;  3DPD A;  2L6J A;  3BG0 B;  1PC2 A;  3UXG A;  5ANR A;  3LPZ A;  3D9I A;  4RG6 A;  1HE8 A;  3JQ1 A;  4XZ4 A;  4DK5 A;  4F53 A;  3OTN A;  4RVB A;  4FA6 A;  3FDH A;  4DX1 A;  4AY6 A;  4A3V A;  2VGX A;  3ZNG A;  3RU0 A;  3CHM A;  3ONL A;  3OXG A;  2XS8 A;  1PY1 A;  4RLY A;  4JHR A;  2I1K A;  2CFU A;  4J8Y A;  5FIN A;  1N9A A;  3DPY A;  3PH0 C;  4MS6 A;  3FUD A;  4UWH A;  2HE0 A;  3ABL E;  4U0Z A;  3CVY A;  4GML A;  3FFL A;  4ILI A;  2X6K A;  4JPS A;  4J8S A;  4L7T A;  3CK7 A;  2PQR A;  3DSS A;  1AP7 A;  3L54 A;  4MBG A;  3TXN A;  2XRY A;  1HFA A;  3LDZ A;  1N4P A;  3PRZ A;  4BER A;  4JXT A;  3FTV A;  4XIF A;  2WXK A;  4AOF A;  3APF A;  3R7Q A;  2V4L A;  4APO A;  1HG2 A;  2DZO A;  3SBS A;  2A5E A;  4MKT A;  4GU5 A;  2R59 A;  2F8X K;  5JMN D;  1QZ2 A;  3RRM B;  3TG5 A;  4G25 A;  2H6G A;  3HVE B;  5J08 A;  1G3N B;  1Z3X A;  4U7E B;  2ZXW E;  3UIN C;  1DVP A;  4ANV A;  3LYA A;  1HS6 A;  5ENT D;  3L22 A;  1OUV A;  2ILR A;  4FC8 A;  4PS3 A;  1FCH A;  4G2V A;  2LAH A;  1HXI A;  4UI9 C;  2I1J A;  3C3R A;  3QB2 A;  3X2Q E;  1UN9 A;  2KCV A;  1E90 A;  3KS2 A;  5ENQ D;  2WB2 A;  4L2L A;  4DI4 A;  3ABM E;  3TXM A;  1MX2 A;  5D2M C;  3ZHE A;  2LSV A;  3FUL A;  2Y4T A;  4N5Q A;  4OYS A;  3QK0 A;  1NA0 A;  4HFG A;  1E96 B;  1E8Z A;  2XEV A;  4M7C A;  4I43 A;  3CHQ A;  3JUI A;  2C0M A;  3E4B A;  4FLB A;  2ZIS A;  2J08 A;  1OCC E;  1UJK A;  4YDW A;  4NQ0 A;  3KSL A;  2MYO A;  2RKK A;  1HU3 A;  2CHW A;  3EHM A;  3Q78 A;  2PL2 A;  1Z6T A;  3URZ A;  3U66 A;  3U9W A;  2YNQ A;  3Q73 A;  2QYU A;  3P1U A;  3KSQ A;  3ZN3 A;  2V0P A;  3PZ2 A;  3FUK A;  4I9E A;  4JA7 A;  1FPP A;  2WXO A;  3OXL A;  3HXE A;  3NBN B;  2LNI A;  3HXF A;  5FZS A;  2WQ7 A;  3ZYK A;  4U96 D;  4KZ0 A;  3ULQ A;  4GTS A;  2H6H A;  3D9J A;  4EHM A;  3QWV A;  3PRE A;  2AXV A;  3TAX A;  4XKB A;  4N3C A;  3HIZ A;  3TGO A;  2KCL A;  4JD2 G;  3KEA A;  1BPO A;  5AQ7 A;  2EIM E;  4KT6 B;  4EBA G;  3V79 K;  2YIN A;  2AXZ A;  2RFA A;  5FT9 A;  4HNA D;  4BX8 A;  1XGW A;  1V54 E;  5T4Y A;  3RK6 A;  3DRA A;  2J8S D;  4KBQ A;  2J09 A;  4FHJ A;  3UM1 A;  3DSV A;  2XHE A;  4Q69 A;  3ML9 A;  1X81 A;  2KZT A;  2J4D A;  3CKB A;  3MKQ A;  3FY4 A;  1Y8M A;  3L13 A;  3Q7A A;  1N4Q A;  4FAD A;  3FTS A;  5JJT A;  4U0S A;  3N71 A;  5CRU A;  4TXP A;  1IYG A;  1O1T A;  4I17 A;  3O4Z A;  2XPI A;  2PNN A;  1N94 A;  3D9H A;  5CEC B;  4K5A B;  4ANU A;  1DCE A;  1UJJ A;  2J4B A;  4A3T A;  4GTP A;  4UWG A;  5CBO A;  4DLO A;  1GW6 A;  1Y6I A;  2OCC E;  3ASN E;  2WXG A;  5A7D B;  4LNG A;  3FTW A;  4BTB A;  2J07 A;  5KJM A;  3C3Q A;  2CHX A;  1TJC A;  2B6C A;  3B7R L;  5M72 A;  2X6F A;  4K03 A;  5D66 A;  2WM9 A;  2E0I A;  1ZBP A;  2QYJ A;  3UT8 A;  3LXU X;  1E8W A;  1OT8 A;  2OOE A;  1YCS B;  3ZPJ A;  5CBN A;  2QZA A;  1TNO A;  3LJ3 A;  4KMO A;  2JLB A;  2PM6 A;  3TL5 A;  3PEV B;  4U8V D;  4I1M A;  5LOZ A;  3OAW A;  1OWO A;  1YA0 A;  5HRY A;  3HVE A;  3QWP A;  5HS0 A;  4UWL A;  2GRQ B;  3FUF A;  1ZB1 A;  3I4G A;  3JQ0 A;  3T8K A;  1TNB A;  4RSY A;  4KYO B;  3B13 A;  1ELW A;  5ANL A;  1K1A A;  5HKP A;  4FUL A;  3AS5 A;  3SZ7 A;  5A23 A;  3HG0 D;  5T3R A;  1LD7 A;  3EDT B;  4PUC A;  3CVN A;  3FU5 A;  3UKU G;  4I2W A;  3E33 A;  2VTB A;  4I6E A;  5FZR A;  5KBA A;  3CK9 A;  4GZC A;  5EN5 D;  3RIB A;  1TNZ A;  2C0L A;  3CVP A;  5HI7 A;  1EF1 C;  2A5U A;  1BD8 A;  1RW2 A;  3B7B A;  3UM0 A;  3EUV A;  1H0A A;  1NL4 A;  4Y6C A;  1OCR E;  3LY8 A;  4GA2 A;  4V3I A;  4WNF A;  2XEH A;  3B95 A;  3JUE A;  2ZGG A;  3J5P A;  3ZXP A;  2R05 A;  4EQF A;  5CCL A;  3EIJ A;  3D9K A;  4WNE A;  2P9L G;  1OCZ E;  3S2A A;  5JHA A;  3EU5 A;  2I6H A;  3CQC B;  3EHN A;  1TJF A;  3FEX A;  3RKV A;  4E6H A;  4GB9 A;  4C48 B;  2FO1 E;  3V2O A;  3FTU A;  4C0M A;  1S0P A;  1JUQ A;  1N4S A;  4JZY A;  2WXP A;  4F1P A;  4UI9 K;  3S7B A;  1D8E A;  3NZU A;  4DI3 A;  2GRL A;  4OAV B;  4DPR A;  4DX5 D;  4UWF A;  4FLH A;  2R02 A;  1H6O A;  3FEY A;  2KAT A;  2X3M A;  1OWM A;  1TN8 A;  4BSZ B;  1JCQ A;  3CR3 A;  1UG3 A;  2ETB A;  4AXH A;  3O48 A;  2KC7 A;  2FUL A;  2XGS A;  3I4R B;  4I9C A;  4P29 A;  4QFV A;  4GYW A;  4EPZ A;  2WPV A;  4XI9 A;  1K1B A;  3G2W A;  3NOC D;  3CQG B;  3Q4A B;  2I9C A;  4L2Y A;  4A1G A;  2R5S A;  1JWF A;  3G2V A;  3CVQ A;  2XZT G;  1N0R A;  4JW1 A;  3IEG A;  3ASF A;  4CZ2 D;  3MEK A;  1QQE A;  2LXL A;  3PZD A;  3F6Q A;  2XEN A;  5FWQ A;  3AAA C;  2F0Y A;  3DSX A;  4EBA A;  4EZJ A;  4DLQ A;  3PZ4 A;  3FUH A;  5CRV A;  2ZGD A;  2UY1 A;  1KZO A;  4Q94 A;  1ELK A;  2WXF A;  5B1B E;  4U04 A;  1KT0 A;  3U64 A;  4F7A A;  3KAE A;  4MRU A;  3CHO A;  3KEZ A;  2PQN A;  2Q7F A;  3S7D A;  5JJ6 A;  5ENO D;  4JVS A;  3G2S A;  3Q47 B;  1LF8 A;  2WMO A;  5BNW A;  4ILH B;  2AXU A;  4HB5 A;  2IOL A;  3VLD A;  3QAR A;  4GTT A;  3ASD A;  1TR4 A;  2BF0 X;  4BT8 A;  2CG3 A;  5E75 A;  4APF A;  4G26 A; 
#chains in the Genus database with same CATH homology
 3TAX A;  4XX5 A;  1EYH A;  3MJW A;  4JC8 A;  3ASG A;  2HM8 A;  4XKB A;  5KJK A;  4IUL A;  3S7F A;  2VSO E;  4N3C A;  3HIZ A;  3TGO A;  2KCL A;  1JPL A;  2AVP A;  4L23 A;  3G2U A;  1BPO A;  4UQY A;  4HVB A;  2WXI A;  4CDN A;  3ZW3 A;  1FVF A;  2X38 A;  4KT6 B;  3ZFW A;  4EBA G;  3OXF A;  2YIN A;  4KZC A;  2AXZ A;  4FP7 A;  4HOQ A;  5FT9 A;  2X6J A;  1EDU A;  4BT9 A;  4BX8 A;  4YND A;  2CFZ A;  2L9B A;  1XGW A;  1E8Y A;  1N54 A;  5G05 J;  3FTX A;  2XCC A;  5T4Y A;  4D10 C;  3L6A A;  2C2L A;  4H7Y A;  3RK6 A;  4KBQ A;  3IHV A;  3ESK A;  5LFA A;  2PZI A;  2J09 A;  4FHJ A;  2DCP A;  5C1D A;  2R17 C;  1N52 A;  3D9N A;  3SNX A;  3ZHE B;  2NXP A;  2XHE A;  1WAO 1;  4EZK A;  5EX3 A;  4N5C A;  4OVV A;  3FUN A;  4JA9 A;  4EEC A;  2X6I A;  3B7U X;  4FJY A;  3ML9 A;  4Q69 A;  3RRU A;  2KZT A;  2J4D A;  3CKB A;  4DJA A;  2L0I A;  3MKQ A;  2WXL A;  4HS2 A;  3MYV A;  3ONK A;  4UI9 J;  4JL0 A;  3FUJ A;  1Y8M A;  3FY4 A;  3L13 A;  3D9M A;  4KXK B;  4TV3 A;  1W3B A;  4FAD A;  3FTS A;  2IQC A;  4J0U A;  5JJT A;  2WQ6 A;  4U0S A;  2GW1 A;  4B0Z A;  3N71 A;  4UQX A;  4IYP A;  5AJD A;  3ZEF A;  2V8S E;  1IYG A;  4I6G A;  2M63 A;  4BY6 A;  4I17 A;  3LCA A;  3HHM A;  3O4Z A;  4U63 A;  2XPI A;  2XQ0 A;  2WXM A;  3Q15 A;  4IN3 B;  4JEU A;  4ANU A;  5JHB A;  3IBE A;  3R9A B;  2ZU6 B;  3GYZ A;  4J8E A;  2DIW A;  4GMJ A;  1UN8 A;  3RO2 A;  5ARG A;  3HYM B;  1U3C A;  1IQU A;  1UJJ A;  4N3B A;  4B94 A;  2YQ8 A;  4B8C B;  2J4B A;  1X5B A;  4AM9 A;  4AVX A;  4GZD A;  4PS8 A;  4C9B B;  5LP0 A;  3FTZ A;  2IU1 A;  4A3T A;  4UWG A;  2J49 A;  2FBN A;  1DNP A;  2HYZ A;  4R7L A;  2A4Z A;  2OVB A;  1EPU A;  3PDN A;  1HF8 A;  2XGO A;  3PVL A;  4JHK A;  3RRN B;  3LEW A;  3D9L A;  3CGH A;  1GW6 A;  4DLO A;  4LCT A;  5G55 A;  2VSY A;  2WXN A;  4AP2 A;  1Y6I A;  2RG8 A;  1NA3 A;  2WXG A;  4CDR A;  5G2N A;  2LSU A;  3L08 A;  4TUU A;  2E2E A;  3CLJ A;  4L1B A;  5A7D B;  3FH7 A;  2NC9 A;  3FTW A;  3SI5 A;  4FJZ A;  1JWG A;  4BTB A;  4HOS A;  2WVI A;  3UMV A;  3UT7 A;  2J07 A;  5KJM A;  3CK8 A;  4GAA A;  2CHX A;  1TJC A;  2IOS A;  3PEU B;  3CHR A;  4GZ5 A;  5LCW C;  4BSX A;  3MA5 A;  3D9O A;  5LX8 A;  3B7R L;  4URK A;  5M72 A;  4GPK A;  2BUG A;  2X6F A;  2KCK A;  4K03 A;  3Q49 B;  4YVQ C;  2WM9 A;  1SZA A;  3GW4 A;  3PE4 A;  4B8A A;  3B7T A;  2E0I A;  4NRH B;  2XGM A;  3AS8 A;  3ZXS A;  1ZBP A;  1H6K A;  5BW8 C;  1HH8 A;  4KVO A;  3UT8 A;  3BEE A;  1H19 A;  3FUM A;  3LXU X;  5ARF A;  4ACK A;  4GA0 A;  1E8W A;  2OOE A;  3IV0 A;  3ZPJ A;  3K9I A;  1MHQ A;  3CHS A;  4WWN A;  1HO8 A;  4GCN A;  2MOW A;  3B7S A;  3LJ3 A;  4KMO A;  3UT4 A;  4RG9 A;  2JLB A;  2PM6 A;  3I3N A;  3D3M A;  5LCW J;  3C98 A;  1WY6 A;  2V5F A;  3T8M A;  3U4T A;  3CVL A;  3TL5 A;  4WUY A;  4ACL A;  3PNT B;  3JYS A;  4CT0 A;  3FH8 A;  3PEV B;  5FQ6 A;  3CKC A;  5AEN A;  5BV0 A;  3CVW A;  4I1M A;  4LUN U;  5LOZ A;  3APD A;  3OAW A;  4GYO A;  5CMY A;  1OWO A;  1YA0 A;  2L0T B;  4B89 A;  3FU6 A;  5ENN A;  4FU3 A;  4AY5 A;  3HVE A;  3QWP A;  5EDS A;  4UWL A;  5FQ8 A;  3S7J A;  3FUF A;  1KLX A;  2OVF A;  3LVQ E;  3I4G A;  3JQ0 A;  4CGV A;  2XRZ A;  5EKQ D;  4J8D A;  4RSY A;  3CHP A;  3PE3 A;  4KYO B;  2UWJ G;  3B13 A;  4PDX A;  4KVM A;  1PAQ A;  4UWK A;  3SBT B;  4JEH A;  3PNL B;  2KZT B;  1ELW A;  5DBK A;  5ANL A;  1HG5 A;  3AU5 A;  5EX0 A;  1NZN A;  3MCX A;  5KCM A;  3MKQ B;  3GZS A;  5D0Q D;  3WXX A;  2Y4U A;  3MV2 B;  3QNK A;  4GZ3 A;  4FUL A;  2RD0 A;  2GRM A;  3AS5 A;  4I2Z A;  3HDX A;  4LRZ A;  2PM7 A;  5G04 C;  3SZ7 A;  5T3R A;  3I5P A;  5A23 A;  2P58 C;  3PUK A;  3EDT B;  4PUC A;  2J9Q A;  3CVN A;  3FU5 A;  2CHZ A;  2EQX A;  4TRQ A;  4I2W A;  3MGB A;  4I1A A;  4ME2 A;  1SQM A;  4CGW A;  3QKY A;  4K0R A;  5KJN A;  2VTB B;  4W9R A;  2VTB A;  4U07 A;  2IFU A;  4I6E A;  4C0E A;  5FZR A;  3CK9 A;  3CEQ A;  4GZC A;  4G24 A;  3SHF A;  4G11 A;  4GCO A;  4LEU A;  3RIB A;  2YHE A;  3BG1 B;  3DPD A;  2L6J A;  3EJN A;  3BG0 B;  2C0L A;  3L16 A;  3FUI A;  4E85 A;  3CVP A;  5HI7 A;  1PC2 A;  5ANR A;  3LPZ A;  3NQP A;  1EF1 C;  4XI0 A;  3D9I A;  4RG6 A;  1XNF A;  2A5U A;  2VSX E;  3IHY A;  3D9P A;  5CHE E;  1HE8 A;  4N2Q A;  3JQ1 A;  4XZ4 A;  4DK5 A;  4IRU A;  4F53 A;  3OTN A;  4RVB A;  1Z3Y A;  1E7V A;  2WQH A;  4FA6 A;  4HOU A;  3FDH A;  4EZL A;  4WAF A;  4GA1 A;  4AY6 A;  1H0A A;  4A3V A;  1U3D A;  2VGX A;  5AYW D;  4CT4 A;  3ML8 A;  4Y6C A;  3RU0 A;  3CHM A;  2AWI A;  3LY8 A;  4GA2 A;  2GGF A;  4V3I A;  3ONL A;  4NUR A;  3OXG A;  4WNF A;  3MKR A;  4BWR A;  1PY1 A;  4JHR A;  2I1K A;  2CFU A;  4CDM A;  4EQF A;  5CCL A;  1E7U A;  3EIJ A;  5FQ7 A;  4AEZ C;  3D9K A;  3FP3 A;  3PH0 C;  4AV7 A;  2CG2 A;  4G23 A;  4WNE A;  4BTA A;  3QJZ A;  3FUD A;  4MS6 A;  3ZIM A;  3S2A A;  1HZ4 A;  3RJV A;  1IHG A;  4UWH A;  5JHA A;  5AJL A;  2JEK A;  1VDY A;  3FWV A;  2NSZ A;  4U0Z A;  3CVY A;  2VQ2 A;  2VSN A;  3FFL A;  4GML A;  4ILI A;  4YVO A;  2I6H A;  2X6K A;  4JPS A;  3CQC B;  4PS7 A;  3SGH A;  4ABN A;  3EHN A;  3G2T A;  1TJF A;  3FEX A;  4CRW A;  3MV3 B;  4J8S A;  3RKV A;  4E6H A;  4L7T A;  3CK7 A;  4GB9 A;  2PQR A;  4N3A A;  3LS8 A;  2IJG X;  5HQ8 A;  5FJY A;  3L54 A;  3FTU A;  3PS6 A;  3ZVV A;  4O6F A;  5CCM A;  3SD5 A;  4C0M A;  1S0P A;  3MX3 A;  1JUQ A;  4ILG A;  5D0O D;  5DIZ A;  3TXN A;  2XRY A;  1HFA A;  3LDZ A;  4A1S A;  3LKU A;  4JZY A;  3ZYQ A;  3PRZ A;  2WXP A;  3UQ3 A;  4JXT A;  3ZYM A;  4UI9 K;  3S7B A;  3FTV A;  2DBA A;  3KD7 A;  3LY7 A;  4XIF A;  2WXK A;  4AOF A;  3NZU A;  3NZS A;  2FEZ A;  4DI3 A;  2GRL A;  3APF A;  3ZGQ A;  4HOR A;  2IF4 A;  3LVR E;  4DPR A;  4N39 A;  4BX9 A;  2AW6 A;  4ANX A;  3R7Q A;  1HX8 A;  3T5V A;  4G1T A;  4UWF A;  5FZQ A;  4FLH A;  3U3W A;  2V4L A;  4GYY A;  4LER A;  4A55 A;  4APO A;  1L5J A;  3FUE A;  1HG2 A;  3FHE A;  4MKT A;  3FEY A;  2KAT A;  3SBS A;  5G05 C;  4GU5 A;  2X3M A;  2R59 A;  1OWM A;  2WXQ A;  4J8F A;  1UW4 B;  1QZ2 A;  3PUJ A;  3AS4 A;  3ASH A;  3RRM B;  3TG5 A;  4G25 A;  4HLE A;  3HVE B;  5J08 A;  1Z3X A;  3CR3 A;  4U0U A;  1UG3 A;  4CEM A;  4AXH A;  3T5X A;  3O48 A;  2KC7 A;  1DVP A;  3AU4 A;  2FUL A;  2Y3A A;  2FI7 A;  3LYA A;  2XGS A;  4ANV A;  1HS6 A;  4I6J A;  3I4R B;  4ANW A;  3L22 A;  2MHK A;  5T8I A;  4Y6W A;  1OUV A;  2ILR A;  4FC8 A;  4PS3 A;  4H7X A;  2X6H A;  4I9C A;  4P29 A;  3ZRH A;  1FCH A;  3GZ2 A;  4G2V A;  2LAH A;  5E76 A;  1HXI A;  4QFV A;  4HOT A;  4UI9 C;  1OWN A;  2I1J A;  3QB2 A;  4J6I A;  3CV0 A;  1H2V C;  1UN9 A;  2KCV A;  4GYW A;  2OND A;  1E90 A;  4EPZ A;  3KS2 A;  1WM5 A;  4NAC A;  2YHC A;  5JJ7 A;  4WWO A;  4L2L A;  4WNG A;  4GZ6 A;  2WXR A;  3QOU A;  2WPV A;  4PH4 B;  2WB2 A;  4DI4 A;  4JHJ A;  4XI9 A;  4M3O A;  5FTP A;  3G2W A;  1OWP A;  2WMN A;  3TXM A;  5CMW A;  3ZHE A;  2VGY A;  2LSV A;  3CQG B;  3FUL A;  2Y4T A;  4OYS A;  2QY7 A;  3QK0 A;  3Q4A B;  4AJW A;  4N2S A;  1NA0 A;  2I9C A;  4HFG A;  1E96 B;  4L2Y A;  3VTY A;  4AIF A;  4A1G A;  5C2Y A;  2R5S A;  1E8Z A;  3CST A;  2XEV A;  1JWF A;  5BUZ A;  3G2V A;  3CVQ A;  4I43 A;  5BT1 A;  1IQR A;  3CHQ A;  3JUI A;  4JW1 A;  3VLE A;  3IEG A;  2C0M A;  3ASF A;  3E4B A;  2VJ8 A;  4FLB A;  1ZU2 A;  2J08 A;  4OVU A;  3MEK A;  1UJK A;  1QQE A;  3VTX A;  3FU0 A;  4NQ0 A;  3PZD A;  5G04 J;  2FO7 A;  2LO6 A;  2QFC A;  5A6C A;  3QDN A;  2VGX B;  1OWL A;  5FWQ A;  1HU3 A;  3FU3 A;  5J90 A;  4EBA A;  4EZJ A;  4DLQ A;  3Q5M A;  3FUH A;  2CHW A;  3EHM A;  2BTD A;  3ESL A;  3RO3 A;  2UY1 B;  1NP7 A;  2UY1 A;  2WXJ A;  4Q94 A;  3APC A;  1FVH A;  3P2B A;  3QAQ A;  1ELK A;  4CCA A;  2WXF A;  5BV1 A;  2PL2 A;  4MLP A;  2XPY A;  4U04 A;  1KT0 A;  3U64 A;  1H2T C;  3SF4 A;  4F7A A;  3UPV A;  3CVU A;  1INZ A;  1H2U A;  4HXI A;  4U8H A;  1Z6T A;  3L17 A;  3VLF A;  3UX4 A;  1TEZ A;  2WXH A;  3KAE A;  4FHK A;  3URZ A;  1MQS A;  2HO1 A;  3ZYL A;  1KT1 A;  2HR2 A;  3FH5 A;  4MRU A;  4WWP A;  3U9W A;  3U66 A;  1E8X A;  2YNQ A;  3EIQ C;  3CHO A;  4Q96 A;  3CVV A;  3KEZ A;  3P1U A;  4ATG A;  2PQN A;  2Q7F A;  2I2O A;  3JCK C;  4I1O B;  3S7D A;  3ZN3 A;  2V0P A;  5JJ6 A;  3FUK A;  4I9E A;  1P5Q A;  4UQZ A;  3GZ1 A;  4JVS A;  3G2S A;  3TJP A;  2OV8 A;  3Q47 B;  1LF8 A;  2KM4 A;  2WMO A;  4XKC A;  5BNW A;  4WND A;  1QNF A;  3QWW A;  4ILH B;  4JA7 A;  4F1S A;  3R7R A;  2AXU A;  3TG4 A;  2WXO A;  2IOL A;  3OXL A;  4F3V A;  2LNI A;  3CIA A;  3ENE A;  2FF4 A;  3QC1 A;  5KJL A;  3VLD A;  3QAR A;  3SFZ A;  3CVX A;  5FZS A;  5BPP A;  3ASD A;  4XE0 A;  2WQ7 A;  2LAI A;  1SZ9 A;  1ELR A;  3LY9 A;  5AIJ A;  3IKO B;  2BF0 X;  3ZYK A;  4BT8 A;  2CG3 A;  2XPZ A;  2XCB A;  4BFR A;  3NF1 A;  4KZ0 A;  2VYI A;  5E75 A;  2MRI A;  3MZL B;  3ULQ A;  4APF A;  3CSF A;  3D9J A;  3DBS A;  3QWV A;  3FTY A;  5FQ4 A;  3PRE A;  3UUX A;  4G26 A;  2ION A;  1B89 A;  1A17 A;  2AXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...