3LDZA

Crystal structure of human stam1 vhs domain in complex with ubiquitin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
140
structure length
140
Chain Sequence
b'FATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin
publication title VHS domains of ESCRT-0 cooperate in high-avidity binding to polyubiquitinated cargo.
pubmed doi rcsb
molecule tags Protein transport
total genus 57
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ldzA00
3CLJA 3ONKA 4Q96A 3ZYQA 4AVXA 1DVPA 1SZAA 3D9MA 1UJKA 1INZA 2L0IA 3D9OA 3D9IA 2DCPA 5CMWA 1X5BA 3D9PA 4FU3A 4JXTA 3ZYMA 1JPLA 2QY7A 3G2TA 1HG2A 1JWFA 1XGWA 4GZDA 1PY1A 2LO6A 1H0AA 2KM4A 3LDZA 4GZCA 3G2UA 1LF8A 3D9JA 1HF8A 5CMYA 1HFAA 5J08A 3ZYKA 1ELKA 1VDYA 1HX8A 4FLBA 1MHQA 5LP0A 3G2SA 3ZYLA 3D9NA 1JWGA 2V8SE 3D9KA 3ONLA 3G2VA 2L0TB 1UJJA 1SZ9A 1EDUA 4NACA 5LOZA 2DIWA 3G2WA 1HG5A 4HFGA 2BF0X 4Q94A 1JUQA 3D9LA 2MOWA 3RRUA 1EYHA
chains in the Genus database with same CATH superfamily
3W9GA 2QZAA 1O1SA 4NRHB 3LCAA 5KNGA 3UT8A 4LNBA 2R2LA 2BKKB 3QAQA 4C9BB 3T5VA 1HF8A 4JPSA 1NP7A 1K1BA 3IHYA 5B1BE 3C3RA 1Z5SC 3L17A 1TYQG 4NQ0A 5ENRD 3EHRA 3TAXA 2C2LA 3UXGA 5FZSA 3PNTB 5HI7A 3Q78A 2KCVA 3LKUA 3FTYA 1TR4A 5BXOA 1UW4B 2F0YA 3IV0A 3FH7A 2I9CA 4G23A 4B8CB 3AU4A 3SBSA 2BUGA 4AY6A 3CK9A 3UM0A 3U66A 3Q49B 4H7XA 1OUVA 4KYOB 5G04C 3TWQA 2IU1A 1IKND 3ZKJA 3FWVA 3CHMA 4LERA 3ZNGA 1S64A 3CSTA 3S2AA 3IEGA 3ZXPA 3SI5A 1IHGA 3HXFA 3I4RB 2YHCA 3PUJA 2KCLA 4O1OA 3PH0C 2HM8A 2XCBA 3R9MA 4N2QA 3FP3A 2IY0C 2P9UG 2I6HA 3RSEG 2GRPB 2IEJA 4M3OA 2DZNA 1DC2A 3FH5A 4BSZB 3SFZA 4CDRA 3QWPA 1DCQA 3U64A 5AARA 3BQOA 3ZVVA 4ATGA 4TXRA 4Y6WA 2R17C 3QWWA 2XHEA 1LD8A 4OYSA 1LF8A 4G1TA 3UPVA 4IYPA 2I1KA 3FDHA 2RD0A 3RRUA 3QJZA 2OVFA 2RFAA 4UWKA 4BY6A 3FTZA 4HLEA 1D9SA 3DRAA 1HG2A 2ILRA 2VJ8A 2V5QC 4UWHA 1EPUA 1TN6A 4LEUA 5T8IA 2DIWA 2XCCA 4HRNA 3FUEA 3WXXA 1S70B 5A7DB 1O1RA 3MCXA 4ILIA 5LFAA 1LTXA 1NZNA 4JHRA 2YHEA 1NL4A 3O48A 3FY4A 5T3RA 4Q94A 1BI8B 4BSXA 2LAHA 3SFYA 3SFXA 4RG6A 3ZGQA 2DCPA 1O1TA 2EQXA 2VYIA 4F6RD 2WXPA 3PZ3A 3HIZA 2J07A 4NACA 1HG5A 4BT8A 2OEWA 2CG3A 4HBDA 4JXTA 3RJVA 3QDNA 2WXFA 4YVQC 2GRNB 1TNOA 4FJYA 4HRLA 3BEEA 3FUHA 3HHMA 4K5CA 1MX4A 2ZU6B 4GCNA 1GW6A 4R7LA 2PQRA 2LUHA 3SZ7A 3GZ1A 3C3QA 2IO2C 5G2NA 3PDNA 1E8YA 3ZXSA 2XEHA 2F8YA 4UQXA 2XZTG 4K0RA 3ZUVB 2HO1A 2AXUA 2LSVA 2LXLA 3FTUA 3MKQA 4J7WA 4KT6B 4DX6D 3AJIA 5FQ8A 2IF4A 3EHNA 2AXZA 4IN3B 3ISMC 2P58C 3FUIA 4CYMD 3RO3A 3E30A 3MGBA 2VGEA 3L9TA 5EIDA 1H2VC 2WMOA 3PE3A 3IXEA 3CHPA 3UX4A 4EBAA 4J8DA 2BTDA 4YDOA 4OVVA 3DSSA 1TNYA 2MOWA 5CHEE 4FJZA 5G04J 3RAUA 4LCTA 4JHKA 4GTOA 3EDTB 5D2MC 4GU5A 2KXPC 4JL0A 5LP0A 2LXMA 4BERA 3IBEA 1KT1A 3C5RA 4XI0A 4L2YA 4M7CA 3ASGA 3QK0A 1JWFA 4AP2A 3CV0A 2P9LG 4EQFA 2V4LA 3S7JA 1HS6A 5EDSA 4LG6A 1TNUA 3QNKA 2OOEA 1RZ4A 2R02A 3MZLB 3NQPA 2CHWA 3D9LA 3TG5A 3TG4A 3FHEA 4HORA 3Q79A 4AJWA 4HOSA 5G55A 2DYSE 3TWTA 1NFIE 1N94A 3ENEA 4TV3A 3CVQA 5C1DA 4B0ZA 4KVOA 2GW1A 4G8LA 4GTVA 1HE8A 3QB2A 2X6HA 1OCRE 4U0UA 4N5QA 1XGWA 3RRNB 4G8KA 4I9CA 1E7UA 3KEAA 2WXOA 3RK6A 4GYOA 2WXRA 4I1OB 3AU5A 3BG0B 4GPMA 3SD5A 4U8HA 2KZTA 3KAEA 1OWOA 3HXDA 3Q15A 3P2BA 3FU0A 3QOUA 5AN8A 1TN8A 3NZSA 2X6FA 1K1AA 3KD7A 3P1UA 2J4BA 1E8ZA 3JUEA 1N4SA 3QC1A 4CGWA 3FUNA 3CLJA 5CEAA 2VGXB 4C48B 4OAVB 2WXNA 1OCCE 2NSZA 4LUNU 2WXLA 3L6AA 2XGOA 4HS2A 5A6CA 2VSNA 5EX3A 4FHJA 3E4BA 3MV3B 3NAWA 2C0MA 3HXEA 1WM5A 1UN8A 4YDWA 5LX8A 4ILGA 3EHMA 5ARGA 2WXJA 1EDUA 2KBXA 2XQ0A 2XGSA 3AG1E 1ELRA 3EIQC 4ACLA 3O4ZA 4QQIA 3I3NA 2R59A 4JD2G 3EU5A 3LDZA 4KMOA 5FQ4A 2P9PG 1YCSB 5FZRA 3DXMG 4BX8A 2JEKA 3G2VA 3FTVA 4HFGA 3T8MA 4HNAD 3ULYA 4DX1A 4J8EA 3UIOC 4TXPA 3KS2A 4HI9A 4TUUA 2Y0BG 3PEVB 5CMYA 2XPZA 4AIFA 5KBAA 1L5JA 1IQRA 1TNZA 1YA0A 4I1AA 3C98A 4G25A 4CT4A 2L0IA 1SA4A 3OAWA 3UI2A 5E75A 3JUIA 2ETAA 1HX8A 4N3BA 4DLQA 3Q7AA 5CBOA 5CECB 1TN7A 1HH8A 3JQ1A 4RLYA 3JYSA 3T9KA 2PM7A 4EZKA 4WWNA 4D10C 1INZA 3EJNA 3QARA 4WUYA 3MV2B 4QFVA 3CQGB 4YNDA 4GYYA 3ZEFA 2FEZA 1VDYA 2GRRB 1BD8A 4J8FA 4ME2A 1MJ0A 1ZBPA 4K5AB 3G2WA 1OWLA 2EILE 4BTAA 2MYOA 3DPDA 1JCRA 4CRWA 4I9EA 2WVIA 4EZJA 3I5PA 3LPZA 4E85A 2FI7A 5G05C 3TL5A 4G2VA 3D9KA 3HVEA 4XZ4A 3V2XA 4AXHA 4X8QA 5ARFA 2P9SG 4GA1A 4HLLA 5KNHD 4WAFA 2B0OE 4F3VA 4RG9A 2C0LA 3ZHEB 3L82A 3VTXA 1K3ZD 1H2TC 1N9AA 3ZPJA 2X38A 3UT4A 2Y4TA 4U07A 4A55A 2ETCA 2GRLA 2Y4UA 3PEUB 3TWSA 3N71A 2QC9A 3APDA 4JA9A 3ZRHA 1UN9A 5CCMA 1SZ9A 2A5EA 5LOZA 3VLFA 4F53A 2XZDG 4C0MA 2P2CP 3PREA 2PZIA 3E34A 5FWQA 1H6PA 2HR2A 3CK7A 2VSYA 3QKYA 3SY2A 2PQNA 3FEXA 2J49A 3G2SA 3D9NA 5DIZA 3ULQA 3LS8A 2BF0X 3CVWA 4MKTA 3ONKA 3UINC 5KCMA 4DRXE 2DVWA 3U9WA 4BT9A 1WDYA 1KZPA 3ASDA 2NXPA 2GRMA 3LY9A 1MHQA 4MBGA 3ZYLA 1JWGA 2E2EA 2ZGDA 5IY5E 4GPKA 5CRUA 1O5MA 5C2YA 1B89A 4Q96A 4I43A 3VLDA 2IOSA 3UTMA 2OVBA 3EUVA 3JQ0A 5BW8C 3Q9UC 4TRQA 1Z3XA 3EU9A 1HFAA 3FU3A 1OY3D 2AWIA 4UWLA 3ZYQA 2UWJG 1HU3A 3CVYA 2E0IA 1FCHA 2WQ6A 4XE0A 3CHOA 4YVOA 3Q75A 2KZTB 5DBKA 1N54A 4XX5A 3RRMB 3ML9A 3NF1A 4K5BA 4XIFA 4ABNA 1QYMA 3Q73A 4XKCA 4HOQA 5HKPA 2KATA 4JZYA 4N3AA 4JC8A 3B7RL 1E96B 4J8YA 4JA7A 2XPIA 4ANUA 2OEVA 1X5BA 3R9AB 2ONDA 3S7DA 4CEMA 4DK5A 2F37A 4GCOA 1XNFA 5AYWD 2OV8A 3PVLA 3BG1B 1NA3A 5HS0A 2BKGA 4L23A 3ASHA 4KXKB 4CT0A 5LCWJ 4N5CA 3ZW3A 4I6JA 3LJ3A 4DI4A 3FTWA 3FTSA 5FIOA 2IQCA 4MRUA 4IRUA 3CVVA 3SGHA 3GYZA 3FUJA 2VTBB 3UM1A 3OTNA 1UOHA 5D0QD 2QYJA 3F6QA 2WXKA 2WXQA 2Q7FA 2WM9A 4UI9C 3JXJA 3ULEG 4N39A 1OT8A 5KJNA 5KJLA 3D9OA 1FT2A 2AJAA 3ABLE 3CK8A 3PZ2A 3MEKA 1KT0A 2M63A 2IFUA 5E76A 2OCCE 3EIJA 4APOA 3APCA 3DWLG 3FEYA 4I6EA 2JABA 2DWZA 2PM6A 3CGHA 4DJAA 4PS8A 4WNEA 3Q9NC 1FPPA 3QWVA 3I4GA 4N3CA 2P9KG 2L6JA 2LNIA 4JHJA 4U8VD 2NC9A 3TWXA 3L22A 1BI7B 5KJMA 3TXNA 4GZ6A 3L16A 1N4QA 3DEPA 3FH8A 4J6IA 3PE4A 5BPPA 2MHKA 4F1SA 2XPYA 3CSFA 3PZDA 2J9QA 4HOUA 2H6FA 5D0OD 4G24A 3IKOB 3HDXA 5EYLA 4ACKA 4WWPA 3S7BA 2L0TB 4I2ZA 2CFZA 2IOLA 2V5FA 2GRQB 1D8DA 4XEIG 2CHZA 3FULA 2RFMA 3D9PA 1N0QA 1MX6A 3UUXA 1SVXA 2ETBA 3ZN3A 2L9BA 4JW1A 3D9JA 1PC2A 3C72A 3DSVA 4IULA 2RG8A 3ZFWA 3ZYKA 5ITZF 5JJTA 1QNFA 1YMPA 2LSUA 4L2LA 1MYOA 4HB5A 5AIJA 3DSWA 4O6FA 4Y6CA 1NI1A 1FT1A 5M72A 4GB9A 5AJDA 3V30A 1H0AA 3SNXA 2WXHA 5BXUA 4F7AA 4P29A 2WQHA 4B93B 4Q69A 3PZ1A 3GZ2A 1OWNA 5BT1A 2R03A 5JHBA 3LVRE 1WAO1 3AG4E 4FC8A 3MJWA 1S63A 1K8KG 3VLEA 4BETA 4J8SA 4UWFA 1JCSA 4OAUC 3CVXA 3LY8A 1H19A 5JMND 1KLXA 4UQYA 4ZHBA 5BNWA 3MYVA 1NA0A 4FULA 1BLXB 5FT9A 3D9HA 4H7YA 4GTTA 3DPYA 3B95A 3Q47B 1SW6A 4ANWA 4AEZC 3CVUA 1KPSB 4Z68A 4GZ5A 2WXMA 1OCOE 4AM9A 4AY5A 3ESKA 3J5PA 1Q2ZA 2MRIA 5CEDB 3E33A 2P9IG 1HXIA 1QBQA 3K9IA 2H6HA 2J4DA 2EIJE 3HYMB 3LXUX 4TXQA 5CRVA 5EYPF 1U3CA 2XS8A 2KM4A 1WG0A 5AAOA 5J08A 4CGVA 4GTMA 3DXKG 5JA4D 5CBNA 2J09A 5EX0A 1OXJA 3TXMA 5B3SE 3FU6A 1S0PA 5EILA 4A1GA 2J8SD 1TEZA 4K03A 3RU0A 3T5XA 5H7PA 4HVBA 1N4RA 2V0PA 4HXIA 3R7RA 4CDNA 4JVSA 1AP7A 5CERB 3U3WA 2GROB 2EIME 2VSOE 2PL2A 2ZISA 4WNGA 1E90A 5FQ6A 4FHKA 3L54A 4DLOA 1ELKA 2FO7A 1KZOA 5JHAA 3CHRA 1UJJA 2WQ7A 1P5QA 3SBTB 4GYWA 4EZLA 3TGOA 2A5UA 3V2OA 1ELWA 4BESA 4GTPA 3D9IA 5KJKA 3UT7A 2X6IA 2QY7A 5HRYA 3CHSA 1PY1A 3DEOA 3B13A 3FUFA 4EBAG 4BX9A 1JUQA 3BUAA 4HOTA 4EHMA 1EYHA 5JJ7A 3CVLA 2XGMA 3LY7A 1WY6A 3MKQB 3LVQE 3GW4A 2NYJA 3AG2E 4FP7A 1IQUA 4WNDA 4OVUA 1DNPA 2P9NG 2CHXA 3HG0D 4PS7A 4LNUD 3FFLA 5AQAA 3ASFA 3G2TA 3V79K 3V31A 2XRYA 4MS6A 5EIBE 4ZFHA 3VTYA 2ZGGA 2H6GA 3TJPA 4ANXA 1A17A 3SQVA 4UI9K 3NOCD 2VQ2A 1BPOA 5T4YA 2WXGA 3JCKC 4GTSA 5FJYA 2XS1A 3AAAC 4FLBA 4BWRA 1OCZE 2V8SE 4DX2A 1FVHA 1QZ2A 3CKBA 1MX2A 1N0RA 3B7TA 3NZUA 3JXIA 3DSUA 4AVXA 3LYAA 4FU3A 3TWRA 1D8EA 4PH4B 5AJLA 3J5QB 2IO3C 4U96D 2QFCA 5EN5D 2VSXE 5FTPA 3UKRG 5FQ7A 4DX7D 1ZB1A 1Y8MA 5ENPD 4EECA 4LSZE 3CVNA 4U0ZA 4LNGA 4FLHA 4C0EA 4PS3A 2LO6A 1SQMA 3DBSA 5J90A 5FINA 1SA5A 2VGYA 3FU5A 2X3MA 4NURA 2VGXA 2EIKE 1N95A 4YDEA 3D3MA 3LJNA 2AW6A 4GZDA 4L9PA 2ZXWE 4GZCA 5D66A 3EHQA 3MA5A 3ASNE 2PNNA 3DSXA 4A1SA 2X6JA 4I17A 2RKKA 4DUIA 4F1PA 5ENOD 1Z6TA 1MQSA 3E37A 3AS5A 3W9FA 1A5EA 3APFA 2AVPA 1E8WA 4JB8P 4AOFA 2YNQA 3UMVA 2CFUA 4U63A 3HXBA 3TWVA 2Y3AA 4GMLA 4GTRA 2DYRE 3TWWA 3L13A 3HXCA 3FTXA 5KWDA 3UM3A 3ML8A 4UWGA 1X81A 3UIPC 2LAIA 3MX3A 4KVMA 3B7BA 3TWUA 4DI3A 3DSTA 4J0UA 5ANLA 4G26A 2UY1A 2IJGX 4W9RA 1DVPA 3LEWA 3SF4A 3UQ3A 3Q5MA 3E32A 4CZ2D 4XI9A 5BUZA 3WG7E 4CCAA 2DBAA 3PUKA 1W3BA 4KBQA 2V4HC 3GZSA 4DPRA 1Z3YA 3PRZA 2BEDA 3RO2A 2AXVA 3SO8A 4HRMB 1LD7A 1MZCA 1HZ4A 2HYZA 5B1AE 2YQ8A 4I2WA 4DX5D 3CKCA 5G05J 3Q4AB 4AV7A 4URKA 4GAAA 2WXIA 1TJFA 2IONA 1Y6IA 5AQ7A 3CHQA 4JEHA 1DCEA 3D9MA 2HE0A 4RSYA 3ZHEA 4FADA 1N11A 2Y69E 4GA0A 1YYHA 2WB2A 3PS6A 4E6HA 3CVPA 2J08A 3T8KA 2DZOA 3ZYMA 1V55E 1QQEA 3HRAA 3AG3E 2WMNA 1BU9A 3HVEB 3BU8A 4BFRA 1PAQA 4HI8A 5ENSD 3U4TA 4RVBA 2I2OA 2CG2A 4BEPA 2KC7A 3OXFA 2I1JA 2YINA 4JEUA 5AQ9A 2EINE 2XEVA 2FULA 3OXLA 3FUMA 1AWCB 2ZIRA 5BV1A 5BV0A 1TJCA 4ANVA 2F8XK 3NOGD 4V3IA 1EF1C 4APFA 4LRZA 2FF4A 3CEQA 1E8XA 1OWMA 3CIAA 3URZA 4N2SA 1U2VG 2X6KA 5FZQA 2H6IA 3X2QE 4U04A 3AS4A 4B8AA 3RIBA 1H6OA 2XEEA 1JPLA 4UUCA 2L6BA 1OWPA 4GMRA 3ASOE 4EPZA 3L08A 2XENA 1UG3A 5ENQD 1HO8A 4RQIA 5HQ8A 3UKUG 4B94A 1TNBA 4PUCA 4O60A 3MKRA 1RW2A 1N4PA 2A4ZA 1IYGA 4G11A 4I1MA 4A3VA 1U3DA 4CDMA 4L1BA 4ATZD 3FUKA 4PDXA 3RKVA 1IHBA 3FUDA 2QYUA 4TUMA 2R05A 3IHVA 3ZU7B 2R5SA 3PNLB 4ILHB 5CMWA 3CR3A 4A3TA 1IXVA 4WWOA 4B89A 2GGFA 1E7VA 4FA6A 4KZCA 4GZ3A 2Y1LE 3ABME 3B7SA 3NBNB 1ZU2A 3SHFA 4U7EB 4U8YD 1SZAA 2JLBA 1V54E 4XKBA 5JJ6A 3ABKE 3ESLA 5AQBA 3AS8A 5CCLA 3KSLA 4UQZA 2VTBA 4UI9J 4U0SA 4YDYA 2FO1E 3NB2A 3UM2A 3KSQA 4BTBA 3KEZA 4MLPA 1UJKA 4HQDA 4GMJA 3CQCB 1N52A 3Q7FA 1FVFA 5ENTD 4GTQA 2XRZA 5ANRA 3ZIMA 4L7TA 4I6GA 5ENNA 2B6CA 5EKQD 2UY1B 1JCQA 4WNFA 5LCWC 5AENA 3OXGA 2KCKA 3B7UX 2WPVA 4A63B 4NIKA 3R7QA 4U95D 3G2UA 1G3NB 5A23A 3PZ4A 3S7FA 3C3OA 4GA2A 1H6KA 3ONLA 4O1PA 1H2UA 2FBNA 4KZ0A
chains in the Genus database with same CATH topology
4PS8A 4NURA 3SD5A 2VGXA 4U8HA 4WNEA 2KZTA 3QWVA 3I4GA 3D3MA 4NRHB 4N3CA 3KAEA 1OWOA 2L6JA 2LNIA 3LCAA 2AW6A 3Q15A 3UT8A 4GZDA 4JHJA 4GZCA 2NC9A 3QAQA 3P2BA 3FU0A 3L22A 3QOUA 1HF8A 4C9BB 3T5VA 3MA5A 4JPSA 5KJMA 3TXNA 1NP7A 3NZSA 4A1SA 3IHYA 4GZ6A 2X6JA 3L16A 4I17A 2X6FA 3L17A 3KD7A 3P1UA 3FH8A 4J6IA 1E8ZA 2J4BA 1Z6TA 3PE4A 1MQSA 4NQ0A 3TAXA 5BPPA 3AS5A 2MHKA 3QC1A 4CGWA 3FUNA 4F1SA 3CLJA 2XPYA 2C2LA 2VGXB 2WXNA 3CSFA 5FZSA 2NSZA 2AVPA 3APFA 1E8WA 3PZDA 2WXLA 2J9QA 3L6AA 4HOUA 2XGOA 4HS2A 4LUNU 5A6CA 3PNTB 5D0OD 2VSNA 4G24A 5EX3A 4AOFA 4FHJA 2YNQA 3E4BA 3IKOB 5HI7A 3HDXA 3MV3B 2C0MA 2KCVA 3UMVA 2CFUA 3LKUA 3FTYA 4ACKA 4U63A 1WM5A 4WWPA 1UN8A 3S7BA 4ILGA 5LX8A 3EHMA 5ARGA 1UW4B 2L0TB 2WXJA 2Y3AA 1EDUA 4GMLA 4I2ZA 2CFZA 2IOLA 2V5FA 2XQ0A 3IV0A 3FH7A 2I9CA 2XGSA 3L13A 4G23A 4B8CB 3AU4A 1ELRA 3EIQC 3SBSA 2CHZA 3FULA 4ACLA 2BUGA 4AY6A 3D9PA 3CK9A 3U66A 3Q49B 3O4ZA 3FTXA 4H7XA 3UUXA 1OUVA 3ML8A 3I3NA 4UWGA 2R59A 4KYOB 2LAIA 3MX3A 4KVMA 5G04C 3LDZA 4KMOA 3ZN3A 2L9BA 4JW1A 2IU1A 3D9JA 1PC2A 3ZFWA 3FWVA 4IULA 2RG8A 3ZYKA 5FQ4A 5JJTA 3CHMA 1QNFA 4LERA 5FZRA 4BX8A 2JEKA 2LSUA 4DI3A 4J0UA 3G2VA 4L2LA 5ANLA 3FTVA 4G26A 3CSTA 3S2AA 4HFGA 5AIJA 3IEGA 3SI5A 1IHGA 3T8MA 2UY1A 3I4RB 2YHCA 4J8EA 2IJGX 3PUJA 4W9RA 1DVPA 2KCLA 3LEWA 3PH0C 2HM8A 4O6FA 4Y6CA 3SF4A 3UQ3A 3Q5MA 2XCBA 4N2QA 3FP3A 5M72A 4GB9A 4XI9A 3KS2A 4TUUA 2I6HA 5AJDA 5BUZA 3PEVB 4M3OA 1H0AA 4CCAA 5CMYA 2XPZA 3SNXA 3FH5A 2WXHA 4AIFA 4F7AA 3SFZA 2DBAA 4P29A 1L5JA 1IQRA 3PUKA 4CDRA 1W3BA 2WQHA 4KBQA 1YA0A 3QWPA 4I1AA 3C98A 4G25A 4Q69A 3GZSA 4CT4A 3GZ2A 3U64A 2L0IA 4DPRA 3OAWA 1OWNA 5BT1A 3ZVVA 4ATGA 1Z3YA 3PRZA 4Y6WA 5JHBA 5E75A 3RO2A 3LVRE 2R17C 2AXVA 3QWWA 1WAO1 3JUIA 2XHEA 4FC8A 3MJWA 4OYSA 1LF8A 3VLEA 4G1TA 4J8SA 3UPVA 1HX8A 4N3BA 4UWFA 4DLQA 4IYPA 1HZ4A 2I1KA 2HYZA 1HH8A 3JQ1A 3FDHA 3JYSA 2PM7A 2RD0A 3RRUA 2YQ8A 3QJZA 3CVXA 2OVFA 4I2WA 4EZKA 3LY8A 4UWKA 4WWNA 1H19A 4D10C 1INZA 4BY6A 3FTZA 4HLEA 1KLXA 3CKCA 4UQYA 3EJNA 3QARA 3MYVA 4WUYA 5BNWA 1HG2A 2ILRA 5G05J 3MV2B 2VJ8A 3Q4AB 3CQGB 4QFVA 4YNDA 4AV7A 4URKA 4UWHA 4GYYA 1NA0A 3ZEFA 2FEZA 4GAAA 1EPUA 4LEUA 1VDYA 5T8IA 4FULA 5FT9A 4J8FA 2WXIA 4H7YA 1TJFA 4ME2A 2IONA 1ZBPA 2DIWA 3G2WA 1OWLA 2XCCA 1Y6IA 3FUEA 4BTAA 3CHQA 4JEHA 3WXXA 3D9MA 3DPDA 5A7DB 4RSYA 3Q47B 4CRWA 4ANWA 4AEZC 3MCXA 4ILIA 4I9EA 3CVUA 5LFAA 4GZ5A 2WVIA 3ZHEA 4EZJA 3I5PA 4FADA 1NZNA 2WXMA 4GA0A 4JHRA 2YHEA 4AM9A 4AY5A 2WB2A 3LPZA 3ESKA 3O48A 4E85A 2FI7A 5G05C 3FY4A 3TL5A 2MRIA 4G2VA 3D9KA 3HVEA 4XZ4A 3PS6A 4E6HA 5T3RA 4AXHA 1HXIA 4Q94A 3CVPA 5ARFA 4BSXA 3K9IA 2LAHA 2J08A 4GA1A 4RG6A 2J4DA 3ZGQA 2DCPA 3HYMB 3LXUX 3ZYMA 4WAFA 4F3VA 1U3CA 4RG9A 2C0LA 3ZHEB 2KM4A 1QQEA 2EQXA 2VYIA 4CGVA 5J08A 3VTXA 2WMNA 2WXPA 1H2TC 3HIZA 3HVEB 2J07A 4NACA 2J09A 5EX0A 1HG5A 3ZPJA 4BT8A 3TXMA 4BFRA 2X38A 3FU6A 3UT4A 2Y4TA 1S0PA 4U07A 4A55A 1PAQA 4A1GA 2CG3A 4JXTA 3U4TA 1TEZA 4RVBA 4K03A 2I2OA 3RJVA 3RU0A 2GRLA 3T5XA 4HVBA 2CG2A 3QDNA 2Y4UA 2WXFA 4YVQC 2KC7A 2V0PA 3OXFA 3PEUB 4HXIA 3N71A 3R7RA 2I1JA 2YINA 4JEUA 4CDNA 4FJYA 2XEVA 4JVSA 2FULA 3U3WA 3BEEA 3APDA 4JA9A 3FUHA 3HHMA 1UN9A 3OXLA 3ZRHA 3FUMA 5CCMA 1SZ9A 5LOZA 5BV1A 5BV0A 3VLFA 4DJAA 4F53A 2ZU6B 4GCNA 4C0MA 2VSOE 1TJCA 2PL2A 4ANVA 1GW6A 3PREA 2PZIA 4V3IA 1EF1C 4WNGA 5FWQA 2HR2A 1E90A 4R7LA 4APFA 2PQRA 3CK7A 4LRZA 3SZ7A 2VSYA 3GZ1A 2FF4A 3QKYA 5FQ6A 3CEQA 4FHKA 1E8XA 5G2NA 3L54A 2PQNA 4DLOA 3FEXA 1ELKA 5AYWD 2FO7A 3PDNA 1OWMA 2J49A 3CIAA 3G2SA 1E8YA 3D9NA 5JHAA 5DIZA 3URZA 3ZXSA 3CHRA 4N2SA 3ULQA 3LS8A 1UJJA 2WQ7A 2X6KA 5FZQA 1P5QA 2BF0X 3CVWA 4MKTA 4UQXA 3SBTB 4U04A 3AS4A 3ONKA 4GYWA 4K0RA 5KCMA 4B8AA 2A5UA 4EZLA 3TGOA 1ELWA 3U9WA 4BT9A 3RIBA 3D9IA 3ASDA 5KJKA 3UT7A 1JPLA 2X6IA 2QY7A 2HO1A 2AXUA 3CHSA 2NXPA 1PY1A 2LSVA 3FTUA 3MKQA 2GRMA 4KT6B 1OWPA 3B13A 3LY9A 4EPZA 3FUFA 1MHQA 3L08A 4EBAG 3ZYLA 1JWGA 2E2EA 1UG3A 1HO8A 5FQ8A 2IF4A 4BX9A 1JUQA 5HQ8A 4GPKA 3EHNA 2AXZA 4IN3B 4HOTA 1EYHA 1B89A 4Q96A 5C2YA 4B94A 4PUCA 2P58C 3FUIA 4I43A 5JJ7A 3MKRA 3CVLA 3VLDA 2IOSA 2XGMA 3LY7A 3RO3A 2A4ZA 1IYGA 2OVBA 4G11A 3JQ0A 3MGBA 1WY6A 4I1MA 4A3VA 1H2VC 2WMOA 3MKQB 5BW8C 3LVQE 4TRQA 3GW4A 3PE3A 1Z3XA 3CHPA 1HFAA 3UX4A 1U3DA 3FU3A 4CDMA 4EBAA 4L1BA 4J8DA 3FUKA 4PDXA 3RKVA 3FUDA 2BTDA 2AWIA 4UWLA 4OVVA 4FP7A 3ZYQA 1IQUA 2UWJG 1HU3A 4WNDA 4OVUA 1DNPA 3CVYA 2E0IA 1FCHA 2CHXA 3IHVA 2MOWA 5CHEE 2WQ6A 4XE0A 2R5SA 3CHOA 3PNLB 4PS7A 4YVOA 4FJZA 5G04J 2KZTB 4ILHB 5DBKA 4LCTA 1N54A 5CMWA 3CR3A 3FFLA 4A3TA 3ASFA 4JHKA 3G2TA 4XX5A 3RRMB 4WWOA 4B89A 2XRYA 4MS6A 2GGFA 3ML9A 3NF1A 1E7VA 3EDTB 4XIFA 4GU5A 4FA6A 4ABNA 4KZCA 4GZ3A 4XKCA 3VTYA 3B7SA 4HOQA 4JL0A 5LP0A 2KATA 4JZYA 4N3AA 1ZU2A 3TJPA 4JC8A 3B7RL 4ANXA 1A17A 1E96B 3SHFA 4UI9K 4JA7A 1SZAA 2XPIA 2JLBA 3IBEA 1KT1A 4XI0A 4ANUA 1X5BA 4XKBA 3R9AB 4L2YA 2ONDA 2VQ2A 3S7DA 5JJ6A 4CEMA 4DK5A 3ASGA 3ESLA 4GCOA 1XNFA 3QK0A 3AS8A 1BPOA 2OV8A 1JWFA 2WXGA 3BG1B 3JCKC 3PVLA 4UQZA 5T4YA 4AP2A 5CCLA 2VTBA 1NA3A 5FJYA 3CV0A 4L23A 3ASHA 4KXKB 4UI9J 4EQFA 4U0SA 2V4LA 4FLBA 4CT0A 4BWRA 3S7JA 1HS6A 5LCWJ 5EDSA 2V8SE 4N5CA 3ZW3A 3QNKA 2OOEA 1FVHA 3MZLB 1QZ2A 2CHWA 3NQPA 3D9LA 3CKBA 3TG5A 3NZUA 3B7TA 3LJ3A 4I6JA 3FTWA 3FTSA 3TG4A 4DI4A 3FHEA 4AVXA 4BTBA 2IQCA 4HORA 3KEZA 4IRUA 4MRUA 4MLPA 3CVVA 1UJKA 4GMJA 4AJWA 3SGHA 4HOSA 5G55A 3LYAA 4FU3A 3CQCB 3GYZA 1N52A 3FUJA 1FVFA 4PH4B 2VTBB 5AJLA 3ENEA 2XRZA 4TV3A 3OTNA 3CVQA 5C1DA 2QFCA 5D0QD 5ANRA 4B0ZA 4KVOA 2VSXE 3ZIMA 4L7TA 2GW1A 2WXKA 2WXQA 5FTPA 2Q7FA 4I6GA 5FQ7A 5ENNA 1HE8A 2WM9A 4UI9C 5EKQD 2UY1B 4N39A 3QB2A 4WNFA 1Y8MA 2X6HA 5LCWC 5KJNA 5KJLA 5AENA 3OXGA 4EECA 2KCKA 3D9OA 3CVNA 4U0UA 4U0ZA 3B7UX 2WPVA 4FLHA 3CK8A 4C0EA 1XGWA 4PS3A 3RRNB 3R7QA 2LO6A 1SQMA 3MEKA 3G2UA 4I9CA 5A23A 1KT0A 2M63A 1E7UA 3DBSA 5J90A 2WXOA 3S7FA 3RK6A 2IFUA 5E76A 3EIJA 3APCA 1H6KA 4GA2A 3ONLA 4GYOA 2WXRA 3FEYA 4APOA 2VGYA 4I1OB 4I6EA 3AU5A 3FU5A 2X3MA 1H2UA 2FBNA 2PM6A 4KZ0A 3BG0B 3CGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CLJ A;  3ONK A;  4Q96 A;  3ZYQ A;  4AVX A;  1DVP A;  1SZA A;  3D9M A;  1UJK A;  1INZ A;  2L0I A;  3D9O A;  3D9I A;  2DCP A;  5CMW A;  1X5B A;  3D9P A;  4FU3 A;  4JXT A;  3ZYM A;  1JPL A;  2QY7 A;  3G2T A;  1HG2 A;  1JWF A;  1XGW A;  4GZD A;  1PY1 A;  2LO6 A;  1H0A A;  2KM4 A;  3LDZ A;  4GZC A;  3G2U A;  1LF8 A;  3D9J A;  1HF8 A;  5CMY A;  1HFA A;  5J08 A;  3ZYK A;  1ELK A;  1VDY A;  1HX8 A;  4FLB A;  1MHQ A;  5LP0 A;  3G2S A;  3ZYL A;  3D9N A;  1JWG A;  2V8S E;  3D9K A;  3ONL A;  3G2V A;  2L0T B;  1UJJ A;  1SZ9 A;  1EDU A;  4NAC A;  5LOZ A;  2DIW A;  3G2W A;  1HG5 A;  4HFG A;  2BF0 X;  4Q94 A;  1JUQ A;  3D9L A;  2MOW A;  3RRU A;  1EYH A; 
#chains in the Genus database with same CATH topology
 3W9G A;  2QZA A;  1O1S A;  4NRH B;  3LCA A;  5KNG A;  3UT8 A;  4LNB A;  2R2L A;  2BKK B;  3QAQ A;  4C9B B;  3T5V A;  1HF8 A;  4JPS A;  1NP7 A;  1K1B A;  3IHY A;  5B1B E;  3C3R A;  1Z5S C;  3L17 A;  1TYQ G;  4NQ0 A;  5ENR D;  3EHR A;  3TAX A;  2C2L A;  3UXG A;  5FZS A;  3PNT B;  5HI7 A;  3Q78 A;  2KCV A;  3LKU A;  3FTY A;  1TR4 A;  5BXO A;  1UW4 B;  2F0Y A;  3IV0 A;  3FH7 A;  2I9C A;  4G23 A;  4B8C B;  3AU4 A;  3SBS A;  2BUG A;  4AY6 A;  3CK9 A;  3UM0 A;  3U66 A;  3Q49 B;  4H7X A;  1OUV A;  4KYO B;  5G04 C;  3TWQ A;  2IU1 A;  1IKN D;  3ZKJ A;  3FWV A;  3CHM A;  4LER A;  3ZNG A;  1S64 A;  3CST A;  3S2A A;  3IEG A;  3ZXP A;  3SI5 A;  1IHG A;  3HXF A;  3I4R B;  2YHC A;  3PUJ A;  2KCL A;  4O1O A;  3PH0 C;  2HM8 A;  2XCB A;  3R9M A;  4N2Q A;  3FP3 A;  2IY0 C;  2P9U G;  2I6H A;  3RSE G;  2GRP B;  2IEJ A;  4M3O A;  2DZN A;  1DC2 A;  3FH5 A;  4BSZ B;  3SFZ A;  4CDR A;  3QWP A;  1DCQ A;  3U64 A;  5AAR A;  3BQO A;  3ZVV A;  4ATG A;  4TXR A;  4Y6W A;  2R17 C;  3QWW A;  2XHE A;  1LD8 A;  4OYS A;  1LF8 A;  4G1T A;  3UPV A;  4IYP A;  2I1K A;  3FDH A;  2RD0 A;  3RRU A;  3QJZ A;  2OVF A;  2RFA A;  4UWK A;  4BY6 A;  3FTZ A;  4HLE A;  1D9S A;  3DRA A;  1HG2 A;  2ILR A;  2VJ8 A;  2V5Q C;  4UWH A;  1EPU A;  1TN6 A;  4LEU A;  5T8I A;  2DIW A;  2XCC A;  4HRN A;  3FUE A;  3WXX A;  1S70 B;  5A7D B;  1O1R A;  3MCX A;  4ILI A;  5LFA A;  1LTX A;  1NZN A;  4JHR A;  2YHE A;  1NL4 A;  3O48 A;  3FY4 A;  5T3R A;  4Q94 A;  1BI8 B;  4BSX A;  2LAH A;  3SFY A;  3SFX A;  4RG6 A;  3ZGQ A;  2DCP A;  1O1T A;  2EQX A;  2VYI A;  4F6R D;  2WXP A;  3PZ3 A;  3HIZ A;  2J07 A;  4NAC A;  1HG5 A;  4BT8 A;  2OEW A;  2CG3 A;  4HBD A;  4JXT A;  3RJV A;  3QDN A;  2WXF A;  4YVQ C;  2GRN B;  1TNO A;  4FJY A;  4HRL A;  3BEE A;  3FUH A;  3HHM A;  4K5C A;  1MX4 A;  2ZU6 B;  4GCN A;  1GW6 A;  4R7L A;  2PQR A;  2LUH A;  3SZ7 A;  3GZ1 A;  3C3Q A;  2IO2 C;  5G2N A;  3PDN A;  1E8Y A;  3ZXS A;  2XEH A;  2F8Y A;  4UQX A;  2XZT G;  4K0R A;  3ZUV B;  2HO1 A;  2AXU A;  2LSV A;  2LXL A;  3FTU A;  3MKQ A;  4J7W A;  4KT6 B;  4DX6 D;  3AJI A;  5FQ8 A;  2IF4 A;  3EHN A;  2AXZ A;  4IN3 B;  3ISM C;  2P58 C;  3FUI A;  4CYM D;  3RO3 A;  3E30 A;  3MGB A;  2VGE A;  3L9T A;  5EID A;  1H2V C;  2WMO A;  3PE3 A;  3IXE A;  3CHP A;  3UX4 A;  4EBA A;  4J8D A;  2BTD A;  4YDO A;  4OVV A;  3DSS A;  1TNY A;  2MOW A;  5CHE E;  4FJZ A;  5G04 J;  3RAU A;  4LCT A;  4JHK A;  4GTO A;  3EDT B;  5D2M C;  4GU5 A;  2KXP C;  4JL0 A;  5LP0 A;  2LXM A;  4BER A;  3IBE A;  1KT1 A;  3C5R A;  4XI0 A;  4L2Y A;  4M7C A;  3ASG A;  3QK0 A;  1JWF A;  4AP2 A;  3CV0 A;  2P9L G;  4EQF A;  2V4L A;  3S7J A;  1HS6 A;  5EDS A;  4LG6 A;  1TNU A;  3QNK A;  2OOE A;  1RZ4 A;  2R02 A;  3MZL B;  3NQP A;  2CHW A;  3D9L A;  3TG5 A;  3TG4 A;  3FHE A;  4HOR A;  3Q79 A;  4AJW A;  4HOS A;  5G55 A;  2DYS E;  3TWT A;  1NFI E;  1N94 A;  3ENE A;  4TV3 A;  3CVQ A;  5C1D A;  4B0Z A;  4KVO A;  2GW1 A;  4G8L A;  4GTV A;  1HE8 A;  3QB2 A;  2X6H A;  1OCR E;  4U0U A;  4N5Q A;  1XGW A;  3RRN B;  4G8K A;  4I9C A;  1E7U A;  3KEA A;  2WXO A;  3RK6 A;  4GYO A;  2WXR A;  4I1O B;  3AU5 A;  3BG0 B;  4GPM A;  3SD5 A;  4U8H A;  2KZT A;  3KAE A;  1OWO A;  3HXD A;  3Q15 A;  3P2B A;  3FU0 A;  3QOU A;  5AN8 A;  1TN8 A;  3NZS A;  2X6F A;  1K1A A;  3KD7 A;  3P1U A;  2J4B A;  1E8Z A;  3JUE A;  1N4S A;  3QC1 A;  4CGW A;  3FUN A;  3CLJ A;  5CEA A;  2VGX B;  4C48 B;  4OAV B;  2WXN A;  1OCC E;  2NSZ A;  4LUN U;  2WXL A;  3L6A A;  2XGO A;  4HS2 A;  5A6C A;  2VSN A;  5EX3 A;  4FHJ A;  3E4B A;  3MV3 B;  3NAW A;  2C0M A;  3HXE A;  1WM5 A;  1UN8 A;  4YDW A;  5LX8 A;  4ILG A;  3EHM A;  5ARG A;  2WXJ A;  1EDU A;  2KBX A;  2XQ0 A;  2XGS A;  3AG1 E;  1ELR A;  3EIQ C;  4ACL A;  3O4Z A;  4QQI A;  3I3N A;  2R59 A;  4JD2 G;  3EU5 A;  3LDZ A;  4KMO A;  5FQ4 A;  2P9P G;  1YCS B;  5FZR A;  3DXM G;  4BX8 A;  2JEK A;  3G2V A;  3FTV A;  4HFG A;  3T8M A;  4HNA D;  3ULY A;  4DX1 A;  4J8E A;  3UIO C;  4TXP A;  3KS2 A;  4HI9 A;  4TUU A;  2Y0B G;  3PEV B;  5CMY A;  2XPZ A;  4AIF A;  5KBA A;  1L5J A;  1IQR A;  1TNZ A;  1YA0 A;  4I1A A;  3C98 A;  4G25 A;  4CT4 A;  2L0I A;  1SA4 A;  3OAW A;  3UI2 A;  5E75 A;  3JUI A;  2ETA A;  1HX8 A;  4N3B A;  4DLQ A;  3Q7A A;  5CBO A;  5CEC B;  1TN7 A;  1HH8 A;  3JQ1 A;  4RLY A;  3JYS A;  3T9K A;  2PM7 A;  4EZK A;  4WWN A;  4D10 C;  1INZ A;  3EJN A;  3QAR A;  4WUY A;  3MV2 B;  4QFV A;  3CQG B;  4YND A;  4GYY A;  3ZEF A;  2FEZ A;  1VDY A;  2GRR B;  1BD8 A;  4J8F A;  4ME2 A;  1MJ0 A;  1ZBP A;  4K5A B;  3G2W A;  1OWL A;  2EIL E;  4BTA A;  2MYO A;  3DPD A;  1JCR A;  4CRW A;  4I9E A;  2WVI A;  4EZJ A;  3I5P A;  3LPZ A;  4E85 A;  2FI7 A;  5G05 C;  3TL5 A;  4G2V A;  3D9K A;  3HVE A;  4XZ4 A;  3V2X A;  4AXH A;  4X8Q A;  5ARF A;  2P9S G;  4GA1 A;  4HLL A;  5KNH D;  4WAF A;  2B0O E;  4F3V A;  4RG9 A;  2C0L A;  3ZHE B;  3L82 A;  3VTX A;  1K3Z D;  1H2T C;  1N9A A;  3ZPJ A;  2X38 A;  3UT4 A;  2Y4T A;  4U07 A;  4A55 A;  2ETC A;  2GRL A;  2Y4U A;  3PEU B;  3TWS A;  3N71 A;  2QC9 A;  3APD A;  4JA9 A;  3ZRH A;  1UN9 A;  5CCM A;  1SZ9 A;  2A5E A;  5LOZ A;  3VLF A;  4F53 A;  2XZD G;  4C0M A;  2P2C P;  3PRE A;  2PZI A;  3E34 A;  5FWQ A;  1H6P A;  2HR2 A;  3CK7 A;  2VSY A;  3QKY A;  3SY2 A;  2PQN A;  3FEX A;  2J49 A;  3G2S A;  3D9N A;  5DIZ A;  3ULQ A;  3LS8 A;  2BF0 X;  3CVW A;  4MKT A;  3ONK A;  3UIN C;  5KCM A;  4DRX E;  2DVW A;  3U9W A;  4BT9 A;  1WDY A;  1KZP A;  3ASD A;  2NXP A;  2GRM A;  3LY9 A;  1MHQ A;  4MBG A;  3ZYL A;  1JWG A;  2E2E A;  2ZGD A;  5IY5 E;  4GPK A;  5CRU A;  1O5M A;  5C2Y A;  1B89 A;  4Q96 A;  4I43 A;  3VLD A;  2IOS A;  3UTM A;  2OVB A;  3EUV A;  3JQ0 A;  5BW8 C;  3Q9U C;  4TRQ A;  1Z3X A;  3EU9 A;  1HFA A;  3FU3 A;  1OY3 D;  2AWI A;  4UWL A;  3ZYQ A;  2UWJ G;  1HU3 A;  3CVY A;  2E0I A;  1FCH A;  2WQ6 A;  4XE0 A;  3CHO A;  4YVO A;  3Q75 A;  2KZT B;  5DBK A;  1N54 A;  4XX5 A;  3RRM B;  3ML9 A;  3NF1 A;  4K5B A;  4XIF A;  4ABN A;  1QYM A;  3Q73 A;  4XKC A;  4HOQ A;  5HKP A;  2KAT A;  4JZY A;  4N3A A;  4JC8 A;  3B7R L;  1E96 B;  4J8Y A;  4JA7 A;  2XPI A;  4ANU A;  2OEV A;  1X5B A;  3R9A B;  2OND A;  3S7D A;  4CEM A;  4DK5 A;  2F37 A;  4GCO A;  1XNF A;  5AYW D;  2OV8 A;  3PVL A;  3BG1 B;  1NA3 A;  5HS0 A;  2BKG A;  4L23 A;  3ASH A;  4KXK B;  4CT0 A;  5LCW J;  4N5C A;  3ZW3 A;  4I6J A;  3LJ3 A;  4DI4 A;  3FTW A;  3FTS A;  5FIO A;  2IQC A;  4MRU A;  4IRU A;  3CVV A;  3SGH A;  3GYZ A;  3FUJ A;  2VTB B;  3UM1 A;  3OTN A;  1UOH A;  5D0Q D;  2QYJ A;  3F6Q A;  2WXK A;  2WXQ A;  2Q7F A;  2WM9 A;  4UI9 C;  3JXJ A;  3ULE G;  4N39 A;  1OT8 A;  5KJN A;  5KJL A;  3D9O A;  1FT2 A;  2AJA A;  3ABL E;  3CK8 A;  3PZ2 A;  3MEK A;  1KT0 A;  2M63 A;  2IFU A;  5E76 A;  2OCC E;  3EIJ A;  4APO A;  3APC A;  3DWL G;  3FEY A;  4I6E A;  2JAB A;  2DWZ A;  2PM6 A;  3CGH A;  4DJA A;  4PS8 A;  4WNE A;  3Q9N C;  1FPP A;  3QWV A;  3I4G A;  4N3C A;  2P9K G;  2L6J A;  2LNI A;  4JHJ A;  4U8V D;  2NC9 A;  3TWX A;  3L22 A;  1BI7 B;  5KJM A;  3TXN A;  4GZ6 A;  3L16 A;  1N4Q A;  3DEP A;  3FH8 A;  4J6I A;  3PE4 A;  5BPP A;  2MHK A;  4F1S A;  2XPY A;  3CSF A;  3PZD A;  2J9Q A;  4HOU A;  2H6F A;  5D0O D;  4G24 A;  3IKO B;  3HDX A;  5EYL A;  4ACK A;  4WWP A;  3S7B A;  2L0T B;  4I2Z A;  2CFZ A;  2IOL A;  2V5F A;  2GRQ B;  1D8D A;  4XEI G;  2CHZ A;  3FUL A;  2RFM A;  3D9P A;  1N0Q A;  1MX6 A;  3UUX A;  1SVX A;  2ETB A;  3ZN3 A;  2L9B A;  4JW1 A;  3D9J A;  1PC2 A;  3C72 A;  3DSV A;  4IUL A;  2RG8 A;  3ZFW A;  3ZYK A;  5ITZ F;  5JJT A;  1QNF A;  1YMP A;  2LSU A;  4L2L A;  1MYO A;  4HB5 A;  5AIJ A;  3DSW A;  4O6F A;  4Y6C A;  1NI1 A;  1FT1 A;  5M72 A;  4GB9 A;  5AJD A;  3V30 A;  1H0A A;  3SNX A;  2WXH A;  5BXU A;  4F7A A;  4P29 A;  2WQH A;  4B93 B;  4Q69 A;  3PZ1 A;  3GZ2 A;  1OWN A;  5BT1 A;  2R03 A;  5JHB A;  3LVR E;  1WAO 1;  3AG4 E;  4FC8 A;  3MJW A;  1S63 A;  1K8K G;  3VLE A;  4BET A;  4J8S A;  4UWF A;  1JCS A;  4OAU C;  3CVX A;  3LY8 A;  1H19 A;  5JMN D;  1KLX A;  4UQY A;  4ZHB A;  5BNW A;  3MYV A;  1NA0 A;  4FUL A;  1BLX B;  5FT9 A;  3D9H A;  4H7Y A;  4GTT A;  3DPY A;  3B95 A;  3Q47 B;  1SW6 A;  4ANW A;  4AEZ C;  3CVU A;  1KPS B;  4Z68 A;  4GZ5 A;  2WXM A;  1OCO E;  4AM9 A;  4AY5 A;  3ESK A;  3J5P A;  1Q2Z A;  2MRI A;  5CED B;  3E33 A;  2P9I G;  1HXI A;  1QBQ A;  3K9I A;  2H6H A;  2J4D A;  2EIJ E;  3HYM B;  3LXU X;  4TXQ A;  5CRV A;  5EYP F;  1U3C A;  2XS8 A;  2KM4 A;  1WG0 A;  5AAO A;  5J08 A;  4CGV A;  4GTM A;  3DXK G;  5JA4 D;  5CBN A;  2J09 A;  5EX0 A;  1OXJ A;  3TXM A;  5B3S E;  3FU6 A;  1S0P A;  5EIL A;  4A1G A;  2J8S D;  1TEZ A;  4K03 A;  3RU0 A;  3T5X A;  5H7P A;  4HVB A;  1N4R A;  2V0P A;  4HXI A;  3R7R A;  4CDN A;  4JVS A;  1AP7 A;  5CER B;  3U3W A;  2GRO B;  2EIM E;  2VSO E;  2PL2 A;  2ZIS A;  4WNG A;  1E90 A;  5FQ6 A;  4FHK A;  3L54 A;  4DLO A;  1ELK A;  2FO7 A;  1KZO A;  5JHA A;  3CHR A;  1UJJ A;  2WQ7 A;  1P5Q A;  3SBT B;  4GYW A;  4EZL A;  3TGO A;  2A5U A;  3V2O A;  1ELW A;  4BES A;  4GTP A;  3D9I A;  5KJK A;  3UT7 A;  2X6I A;  2QY7 A;  5HRY A;  3CHS A;  1PY1 A;  3DEO A;  3B13 A;  3FUF A;  4EBA G;  4BX9 A;  1JUQ A;  3BUA A;  4HOT A;  4EHM A;  1EYH A;  5JJ7 A;  3CVL A;  2XGM A;  3LY7 A;  1WY6 A;  3MKQ B;  3LVQ E;  3GW4 A;  2NYJ A;  3AG2 E;  4FP7 A;  1IQU A;  4WND A;  4OVU A;  1DNP A;  2P9N G;  2CHX A;  3HG0 D;  4PS7 A;  4LNU D;  3FFL A;  5AQA A;  3ASF A;  3G2T A;  3V79 K;  3V31 A;  2XRY A;  4MS6 A;  5EIB E;  4ZFH A;  3VTY A;  2ZGG A;  2H6G A;  3TJP A;  4ANX A;  1A17 A;  3SQV A;  4UI9 K;  3NOC D;  2VQ2 A;  1BPO A;  5T4Y A;  2WXG A;  3JCK C;  4GTS A;  5FJY A;  2XS1 A;  3AAA C;  4FLB A;  4BWR A;  1OCZ E;  2V8S E;  4DX2 A;  1FVH A;  1QZ2 A;  3CKB A;  1MX2 A;  1N0R A;  3B7T A;  3NZU A;  3JXI A;  3DSU A;  4AVX A;  3LYA A;  4FU3 A;  3TWR A;  1D8E A;  4PH4 B;  5AJL A;  3J5Q B;  2IO3 C;  4U96 D;  2QFC A;  5EN5 D;  2VSX E;  5FTP A;  3UKR G;  5FQ7 A;  4DX7 D;  1ZB1 A;  1Y8M A;  5ENP D;  4EEC A;  4LSZ E;  3CVN A;  4U0Z A;  4LNG A;  4FLH A;  4C0E A;  4PS3 A;  2LO6 A;  1SQM A;  3DBS A;  5J90 A;  5FIN A;  1SA5 A;  2VGY A;  3FU5 A;  2X3M A;  4NUR A;  2VGX A;  2EIK E;  1N95 A;  4YDE A;  3D3M A;  3LJN A;  2AW6 A;  4GZD A;  4L9P A;  2ZXW E;  4GZC A;  5D66 A;  3EHQ A;  3MA5 A;  3ASN E;  2PNN A;  3DSX A;  4A1S A;  2X6J A;  4I17 A;  2RKK A;  4DUI A;  4F1P A;  5ENO D;  1Z6T A;  1MQS A;  3E37 A;  3AS5 A;  3W9F A;  1A5E A;  3APF A;  2AVP A;  1E8W A;  4JB8 P;  4AOF A;  2YNQ A;  3UMV A;  2CFU A;  4U63 A;  3HXB A;  3TWV A;  2Y3A A;  4GML A;  4GTR A;  2DYR E;  3TWW A;  3L13 A;  3HXC A;  3FTX A;  5KWD A;  3UM3 A;  3ML8 A;  4UWG A;  1X81 A;  3UIP C;  2LAI A;  3MX3 A;  4KVM A;  3B7B A;  3TWU A;  4DI3 A;  3DST A;  4J0U A;  5ANL A;  4G26 A;  2UY1 A;  2IJG X;  4W9R A;  1DVP A;  3LEW A;  3SF4 A;  3UQ3 A;  3Q5M A;  3E32 A;  4CZ2 D;  4XI9 A;  5BUZ A;  3WG7 E;  4CCA A;  2DBA A;  3PUK A;  1W3B A;  4KBQ A;  2V4H C;  3GZS A;  4DPR A;  1Z3Y A;  3PRZ A;  2BED A;  3RO2 A;  2AXV A;  3SO8 A;  4HRM B;  1LD7 A;  1MZC A;  1HZ4 A;  2HYZ A;  5B1A E;  2YQ8 A;  4I2W A;  4DX5 D;  3CKC A;  5G05 J;  3Q4A B;  4AV7 A;  4URK A;  4GAA A;  2WXI A;  1TJF A;  2ION A;  1Y6I A;  5AQ7 A;  3CHQ A;  4JEH A;  1DCE A;  3D9M A;  2HE0 A;  4RSY A;  3ZHE A;  4FAD A;  1N11 A;  2Y69 E;  4GA0 A;  1YYH A;  2WB2 A;  3PS6 A;  4E6H A;  3CVP A;  2J08 A;  3T8K A;  2DZO A;  3ZYM A;  1V55 E;  1QQE A;  3HRA A;  3AG3 E;  2WMN A;  1BU9 A;  3HVE B;  3BU8 A;  4BFR A;  1PAQ A;  4HI8 A;  5ENS D;  3U4T A;  4RVB A;  2I2O A;  2CG2 A;  4BEP A;  2KC7 A;  3OXF A;  2I1J A;  2YIN A;  4JEU A;  5AQ9 A;  2EIN E;  2XEV A;  2FUL A;  3OXL A;  3FUM A;  1AWC B;  2ZIR A;  5BV1 A;  5BV0 A;  1TJC A;  4ANV A;  2F8X K;  3NOG D;  4V3I A;  1EF1 C;  4APF A;  4LRZ A;  2FF4 A;  3CEQ A;  1E8X A;  1OWM A;  3CIA A;  3URZ A;  4N2S A;  1U2V G;  2X6K A;  5FZQ A;  2H6I A;  3X2Q E;  4U04 A;  3AS4 A;  4B8A A;  3RIB A;  1H6O A;  2XEE A;  1JPL A;  4UUC A;  2L6B A;  1OWP A;  4GMR A;  3ASO E;  4EPZ A;  3L08 A;  2XEN A;  1UG3 A;  5ENQ D;  1HO8 A;  4RQI A;  5HQ8 A;  3UKU G;  4B94 A;  1TNB A;  4PUC A;  4O60 A;  3MKR A;  1RW2 A;  1N4P A;  2A4Z A;  1IYG A;  4G11 A;  4I1M A;  4A3V A;  1U3D A;  4CDM A;  4L1B A;  4ATZ D;  3FUK A;  4PDX A;  3RKV A;  1IHB A;  3FUD A;  2QYU A;  4TUM A;  2R05 A;  3IHV A;  3ZU7 B;  2R5S A;  3PNL B;  4ILH B;  5CMW A;  3CR3 A;  4A3T A;  1IXV A;  4WWO A;  4B89 A;  2GGF A;  1E7V A;  4FA6 A;  4KZC A;  4GZ3 A;  2Y1L E;  3ABM E;  3B7S A;  3NBN B;  1ZU2 A;  3SHF A;  4U7E B;  4U8Y D;  1SZA A;  2JLB A;  1V54 E;  4XKB A;  5JJ6 A;  3ABK E;  3ESL A;  5AQB A;  3AS8 A;  5CCL A;  3KSL A;  4UQZ A;  2VTB A;  4UI9 J;  4U0S A;  4YDY A;  2FO1 E;  3NB2 A;  3UM2 A;  3KSQ A;  4BTB A;  3KEZ A;  4MLP A;  1UJK A;  4HQD A;  4GMJ A;  3CQC B;  1N52 A;  3Q7F A;  1FVF A;  5ENT D;  4GTQ A;  2XRZ A;  5ANR A;  3ZIM A;  4L7T A;  4I6G A;  5ENN A;  2B6C A;  5EKQ D;  2UY1 B;  1JCQ A;  4WNF A;  5LCW C;  5AEN A;  3OXG A;  2KCK A;  3B7U X;  2WPV A;  4A63 B;  4NIK A;  3R7Q A;  4U95 D;  3G2U A;  1G3N B;  5A23 A;  3PZ4 A;  3S7F A;  3C3O A;  4GA2 A;  1H6K A;  3ONL A;  4O1P A;  1H2U A;  2FBN A;  4KZ0 A; 
#chains in the Genus database with same CATH homology
 4PS8 A;  4NUR A;  3SD5 A;  2VGX A;  4U8H A;  4WNE A;  2KZT A;  3QWV A;  3I4G A;  3D3M A;  4NRH B;  4N3C A;  3KAE A;  1OWO A;  2L6J A;  2LNI A;  3LCA A;  2AW6 A;  3Q15 A;  3UT8 A;  4GZD A;  4JHJ A;  4GZC A;  2NC9 A;  3QAQ A;  3P2B A;  3FU0 A;  3L22 A;  3QOU A;  1HF8 A;  4C9B B;  3T5V A;  3MA5 A;  4JPS A;  5KJM A;  3TXN A;  1NP7 A;  3NZS A;  4A1S A;  3IHY A;  4GZ6 A;  2X6J A;  3L16 A;  4I17 A;  2X6F A;  3L17 A;  3KD7 A;  3P1U A;  3FH8 A;  4J6I A;  1E8Z A;  2J4B A;  1Z6T A;  3PE4 A;  1MQS A;  4NQ0 A;  3TAX A;  5BPP A;  3AS5 A;  2MHK A;  3QC1 A;  4CGW A;  3FUN A;  4F1S A;  3CLJ A;  2XPY A;  2C2L A;  2VGX B;  2WXN A;  3CSF A;  5FZS A;  2NSZ A;  2AVP A;  3APF A;  1E8W A;  3PZD A;  2WXL A;  2J9Q A;  3L6A A;  4HOU A;  2XGO A;  4HS2 A;  4LUN U;  5A6C A;  3PNT B;  5D0O D;  2VSN A;  4G24 A;  5EX3 A;  4AOF A;  4FHJ A;  2YNQ A;  3E4B A;  3IKO B;  5HI7 A;  3HDX A;  3MV3 B;  2C0M A;  2KCV A;  3UMV A;  2CFU A;  3LKU A;  3FTY A;  4ACK A;  4U63 A;  1WM5 A;  4WWP A;  1UN8 A;  3S7B A;  4ILG A;  5LX8 A;  3EHM A;  5ARG A;  1UW4 B;  2L0T B;  2WXJ A;  2Y3A A;  1EDU A;  4GML A;  4I2Z A;  2CFZ A;  2IOL A;  2V5F A;  2XQ0 A;  3IV0 A;  3FH7 A;  2I9C A;  2XGS A;  3L13 A;  4G23 A;  4B8C B;  3AU4 A;  1ELR A;  3EIQ C;  3SBS A;  2CHZ A;  3FUL A;  4ACL A;  2BUG A;  4AY6 A;  3D9P A;  3CK9 A;  3U66 A;  3Q49 B;  3O4Z A;  3FTX A;  4H7X A;  3UUX A;  1OUV A;  3ML8 A;  3I3N A;  4UWG A;  2R59 A;  4KYO B;  2LAI A;  3MX3 A;  4KVM A;  5G04 C;  3LDZ A;  4KMO A;  3ZN3 A;  2L9B A;  4JW1 A;  2IU1 A;  3D9J A;  1PC2 A;  3ZFW A;  3FWV A;  4IUL A;  2RG8 A;  3ZYK A;  5FQ4 A;  5JJT A;  3CHM A;  1QNF A;  4LER A;  5FZR A;  4BX8 A;  2JEK A;  2LSU A;  4DI3 A;  4J0U A;  3G2V A;  4L2L A;  5ANL A;  3FTV A;  4G26 A;  3CST A;  3S2A A;  4HFG A;  5AIJ A;  3IEG A;  3SI5 A;  1IHG A;  3T8M A;  2UY1 A;  3I4R B;  2YHC A;  4J8E A;  2IJG X;  3PUJ A;  4W9R A;  1DVP A;  2KCL A;  3LEW A;  3PH0 C;  2HM8 A;  4O6F A;  4Y6C A;  3SF4 A;  3UQ3 A;  3Q5M A;  2XCB A;  4N2Q A;  3FP3 A;  5M72 A;  4GB9 A;  4XI9 A;  3KS2 A;  4TUU A;  2I6H A;  5AJD A;  5BUZ A;  3PEV B;  4M3O A;  1H0A A;  4CCA A;  5CMY A;  2XPZ A;  3SNX A;  3FH5 A;  2WXH A;  4AIF A;  4F7A A;  3SFZ A;  2DBA A;  4P29 A;  1L5J A;  1IQR A;  3PUK A;  4CDR A;  1W3B A;  2WQH A;  4KBQ A;  1YA0 A;  3QWP A;  4I1A A;  3C98 A;  4G25 A;  4Q69 A;  3GZS A;  4CT4 A;  3GZ2 A;  3U64 A;  2L0I A;  4DPR A;  3OAW A;  1OWN A;  5BT1 A;  3ZVV A;  4ATG A;  1Z3Y A;  3PRZ A;  4Y6W A;  5JHB A;  5E75 A;  3RO2 A;  3LVR E;  2R17 C;  2AXV A;  3QWW A;  1WAO 1;  3JUI A;  2XHE A;  4FC8 A;  3MJW A;  4OYS A;  1LF8 A;  3VLE A;  4G1T A;  4J8S A;  3UPV A;  1HX8 A;  4N3B A;  4UWF A;  4DLQ A;  4IYP A;  1HZ4 A;  2I1K A;  2HYZ A;  1HH8 A;  3JQ1 A;  3FDH A;  3JYS A;  2PM7 A;  2RD0 A;  3RRU A;  2YQ8 A;  3QJZ A;  3CVX A;  2OVF A;  4I2W A;  4EZK A;  3LY8 A;  4UWK A;  4WWN A;  1H19 A;  4D10 C;  1INZ A;  4BY6 A;  3FTZ A;  4HLE A;  1KLX A;  3CKC A;  4UQY A;  3EJN A;  3QAR A;  3MYV A;  4WUY A;  5BNW A;  1HG2 A;  2ILR A;  5G05 J;  3MV2 B;  2VJ8 A;  3Q4A B;  3CQG B;  4QFV A;  4YND A;  4AV7 A;  4URK A;  4UWH A;  4GYY A;  1NA0 A;  3ZEF A;  2FEZ A;  4GAA A;  1EPU A;  4LEU A;  1VDY A;  5T8I A;  4FUL A;  5FT9 A;  4J8F A;  2WXI A;  4H7Y A;  1TJF A;  4ME2 A;  2ION A;  1ZBP A;  2DIW A;  3G2W A;  1OWL A;  2XCC A;  1Y6I A;  3FUE A;  4BTA A;  3CHQ A;  4JEH A;  3WXX A;  3D9M A;  3DPD A;  5A7D B;  4RSY A;  3Q47 B;  4CRW A;  4ANW A;  4AEZ C;  3MCX A;  4ILI A;  4I9E A;  3CVU A;  5LFA A;  4GZ5 A;  2WVI A;  3ZHE A;  4EZJ A;  3I5P A;  4FAD A;  1NZN A;  2WXM A;  4GA0 A;  4JHR A;  2YHE A;  4AM9 A;  4AY5 A;  2WB2 A;  3LPZ A;  3ESK A;  3O48 A;  4E85 A;  2FI7 A;  5G05 C;  3FY4 A;  3TL5 A;  2MRI A;  4G2V A;  3D9K A;  3HVE A;  4XZ4 A;  3PS6 A;  4E6H A;  5T3R A;  4AXH A;  1HXI A;  4Q94 A;  3CVP A;  5ARF A;  4BSX A;  3K9I A;  2LAH A;  2J08 A;  4GA1 A;  4RG6 A;  2J4D A;  3ZGQ A;  2DCP A;  3HYM B;  3LXU X;  3ZYM A;  4WAF A;  4F3V A;  1U3C A;  4RG9 A;  2C0L A;  3ZHE B;  2KM4 A;  1QQE A;  2EQX A;  2VYI A;  4CGV A;  5J08 A;  3VTX A;  2WMN A;  2WXP A;  1H2T C;  3HIZ A;  3HVE B;  2J07 A;  4NAC A;  2J09 A;  5EX0 A;  1HG5 A;  3ZPJ A;  4BT8 A;  3TXM A;  4BFR A;  2X38 A;  3FU6 A;  3UT4 A;  2Y4T A;  1S0P A;  4U07 A;  4A55 A;  1PAQ A;  4A1G A;  2CG3 A;  4JXT A;  3U4T A;  1TEZ A;  4RVB A;  4K03 A;  2I2O A;  3RJV A;  3RU0 A;  2GRL A;  3T5X A;  4HVB A;  2CG2 A;  3QDN A;  2Y4U A;  2WXF A;  4YVQ C;  2KC7 A;  2V0P A;  3OXF A;  3PEU B;  4HXI A;  3N71 A;  3R7R A;  2I1J A;  2YIN A;  4JEU A;  4CDN A;  4FJY A;  2XEV A;  4JVS A;  2FUL A;  3U3W A;  3BEE A;  3APD A;  4JA9 A;  3FUH A;  3HHM A;  1UN9 A;  3OXL A;  3ZRH A;  3FUM A;  5CCM A;  1SZ9 A;  5LOZ A;  5BV1 A;  5BV0 A;  3VLF A;  4DJA A;  4F53 A;  2ZU6 B;  4GCN A;  4C0M A;  2VSO E;  1TJC A;  2PL2 A;  4ANV A;  1GW6 A;  3PRE A;  2PZI A;  4V3I A;  1EF1 C;  4WNG A;  5FWQ A;  2HR2 A;  1E90 A;  4R7L A;  4APF A;  2PQR A;  3CK7 A;  4LRZ A;  3SZ7 A;  2VSY A;  3GZ1 A;  2FF4 A;  3QKY A;  5FQ6 A;  3CEQ A;  4FHK A;  1E8X A;  5G2N A;  3L54 A;  2PQN A;  4DLO A;  3FEX A;  1ELK A;  5AYW D;  2FO7 A;  3PDN A;  1OWM A;  2J49 A;  3CIA A;  3G2S A;  1E8Y A;  3D9N A;  5JHA A;  5DIZ A;  3URZ A;  3ZXS A;  3CHR A;  4N2S A;  3ULQ A;  3LS8 A;  1UJJ A;  2WQ7 A;  2X6K A;  5FZQ A;  1P5Q A;  2BF0 X;  3CVW A;  4MKT A;  4UQX A;  3SBT B;  4U04 A;  3AS4 A;  3ONK A;  4GYW A;  4K0R A;  5KCM A;  4B8A A;  2A5U A;  4EZL A;  3TGO A;  1ELW A;  3U9W A;  4BT9 A;  3RIB A;  3D9I A;  3ASD A;  5KJK A;  3UT7 A;  1JPL A;  2X6I A;  2QY7 A;  2HO1 A;  2AXU A;  3CHS A;  2NXP A;  1PY1 A;  2LSV A;  3FTU A;  3MKQ A;  2GRM A;  4KT6 B;  1OWP A;  3B13 A;  3LY9 A;  4EPZ A;  3FUF A;  1MHQ A;  3L08 A;  4EBA G;  3ZYL A;  1JWG A;  2E2E A;  1UG3 A;  1HO8 A;  5FQ8 A;  2IF4 A;  4BX9 A;  1JUQ A;  5HQ8 A;  4GPK A;  3EHN A;  2AXZ A;  4IN3 B;  4HOT A;  1EYH A;  1B89 A;  4Q96 A;  5C2Y A;  4B94 A;  4PUC A;  2P58 C;  3FUI A;  4I43 A;  5JJ7 A;  3MKR A;  3CVL A;  3VLD A;  2IOS A;  2XGM A;  3LY7 A;  3RO3 A;  2A4Z A;  1IYG A;  2OVB A;  4G11 A;  3JQ0 A;  3MGB A;  1WY6 A;  4I1M A;  4A3V A;  1H2V C;  2WMO A;  3MKQ B;  5BW8 C;  3LVQ E;  4TRQ A;  3GW4 A;  3PE3 A;  1Z3X A;  3CHP A;  1HFA A;  3UX4 A;  1U3D A;  3FU3 A;  4CDM A;  4EBA A;  4L1B A;  4J8D A;  3FUK A;  4PDX A;  3RKV A;  3FUD A;  2BTD A;  2AWI A;  4UWL A;  4OVV A;  4FP7 A;  3ZYQ A;  1IQU A;  2UWJ G;  1HU3 A;  4WND A;  4OVU A;  1DNP A;  3CVY A;  2E0I A;  1FCH A;  2CHX A;  3IHV A;  2MOW A;  5CHE E;  2WQ6 A;  4XE0 A;  2R5S A;  3CHO A;  3PNL B;  4PS7 A;  4YVO A;  4FJZ A;  5G04 J;  2KZT B;  4ILH B;  5DBK A;  4LCT A;  1N54 A;  5CMW A;  3CR3 A;  3FFL A;  4A3T A;  3ASF A;  4JHK A;  3G2T A;  4XX5 A;  3RRM B;  4WWO A;  4B89 A;  2XRY A;  4MS6 A;  2GGF A;  3ML9 A;  3NF1 A;  1E7V A;  3EDT B;  4XIF A;  4GU5 A;  4FA6 A;  4ABN A;  4KZC A;  4GZ3 A;  4XKC A;  3VTY A;  3B7S A;  4HOQ A;  4JL0 A;  5LP0 A;  2KAT A;  4JZY A;  4N3A A;  1ZU2 A;  3TJP A;  4JC8 A;  3B7R L;  4ANX A;  1A17 A;  1E96 B;  3SHF A;  4UI9 K;  4JA7 A;  1SZA A;  2XPI A;  2JLB A;  3IBE A;  1KT1 A;  4XI0 A;  4ANU A;  1X5B A;  4XKB A;  3R9A B;  4L2Y A;  2OND A;  2VQ2 A;  3S7D A;  5JJ6 A;  4CEM A;  4DK5 A;  3ASG A;  3ESL A;  4GCO A;  1XNF A;  3QK0 A;  3AS8 A;  1BPO A;  2OV8 A;  1JWF A;  2WXG A;  3BG1 B;  3JCK C;  3PVL A;  4UQZ A;  5T4Y A;  4AP2 A;  5CCL A;  2VTB A;  1NA3 A;  5FJY A;  3CV0 A;  4L23 A;  3ASH A;  4KXK B;  4UI9 J;  4EQF A;  4U0S A;  2V4L A;  4FLB A;  4CT0 A;  4BWR A;  3S7J A;  1HS6 A;  5LCW J;  5EDS A;  2V8S E;  4N5C A;  3ZW3 A;  3QNK A;  2OOE A;  1FVH A;  3MZL B;  1QZ2 A;  2CHW A;  3NQP A;  3D9L A;  3CKB A;  3TG5 A;  3NZU A;  3B7T A;  3LJ3 A;  4I6J A;  3FTW A;  3FTS A;  3TG4 A;  4DI4 A;  3FHE A;  4AVX A;  4BTB A;  2IQC A;  4HOR A;  3KEZ A;  4IRU A;  4MRU A;  4MLP A;  3CVV A;  1UJK A;  4GMJ A;  4AJW A;  3SGH A;  4HOS A;  5G55 A;  3LYA A;  4FU3 A;  3CQC B;  3GYZ A;  1N52 A;  3FUJ A;  1FVF A;  4PH4 B;  2VTB B;  5AJL A;  3ENE A;  2XRZ A;  4TV3 A;  3OTN A;  3CVQ A;  5C1D A;  2QFC A;  5D0Q D;  5ANR A;  4B0Z A;  4KVO A;  2VSX E;  3ZIM A;  4L7T A;  2GW1 A;  2WXK A;  2WXQ A;  5FTP A;  2Q7F A;  4I6G A;  5FQ7 A;  5ENN A;  1HE8 A;  2WM9 A;  4UI9 C;  5EKQ D;  2UY1 B;  4N39 A;  3QB2 A;  4WNF A;  1Y8M A;  2X6H A;  5LCW C;  5KJN A;  5KJL A;  5AEN A;  3OXG A;  4EEC A;  2KCK A;  3D9O A;  3CVN A;  4U0U A;  4U0Z A;  3B7U X;  2WPV A;  4FLH A;  3CK8 A;  4C0E A;  1XGW A;  4PS3 A;  3RRN B;  3R7Q A;  2LO6 A;  1SQM A;  3MEK A;  3G2U A;  4I9C A;  5A23 A;  1KT0 A;  2M63 A;  1E7U A;  3DBS A;  5J90 A;  2WXO A;  3S7F A;  3RK6 A;  2IFU A;  5E76 A;  3EIJ A;  3APC A;  1H6K A;  4GA2 A;  3ONL A;  4GYO A;  2WXR A;  3FEY A;  4APO A;  2VGY A;  4I1O B;  4I6E A;  3AU5 A;  3FU5 A;  2X3M A;  1H2U A;  2FBN A;  2PM6 A;  4KZ0 A;  3BG0 B;  3CGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...