3LDZA

Crystal structure of human stam1 vhs domain in complex with ubiquitin
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
140
structure length
140
Chain Sequence
FATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title VHS domains of ESCRT-0 cooperate in high-avidity binding to polyubiquitinated cargo.
pubmed doi rcsb
molecule tags Protein transport
molecule keywords Ubiquitin
total genus 57
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ldzA00
3D9MA 1SZ9A 1PY1A 3ONKA 4HFGA 2DCPA 1JPLA 5CMYA 3ZYLA 1JWGA 3LDZA 1ELKA 2QY7A 1UJKA 3ZYQA 4AVXA 3D9LA 3G2TA 4FU3A 4Q94A 1UJJA 4NACA 3D9OA 1HFAA 1HG5A 1HF8A 3G2VA 1DVPA 1HX8A 1SZAA 4FLBA 1H0AA 2L0IA 2V8SE 1EYHA 1JUQA 3D9JA 3D9PA 3G2UA 4JXTA 3ZYMA 1JWFA 1MHQA 1EDUA 3CLJA 5CMWA 3RRUA 3D9KA 3G2SA 1LF8A 3D9NA 1HG2A 1XGWA 2BF0X 2LO6A 4GZDA 3ZYKA 1VDYA 3G2WA 1INZA 5LP0A 2KM4A 2MOWA 3D9IA 1X5BA 3ONLA 4Q96A 2DIWA 5LOZA 5J08A 2L0TB 4GZCA
chains in the Genus database with same CATH superfamily
4UWKA 4UQYA 3CQGB 2CHXA 3J5QB 5ENQD 5EIDA 3ZN3A 3DXKG 2KCLA 3ZW3A 3ZPJA 3EHNA 4K5BA 4JC8A 4ILGA 1BPOA 4A3VA 2M63A 2J08A 5D0OD 3CVVA 4TXRA 2KATA 3CQCB 3ZHEB 2WXGA 3QC1A 4IYPA 4D10C 3L6AA 1HG5A 4XI0A 4DLOA 3C3QA 3UKRG 4U07A 3CVNA 1V54E 4J8SA 4J6IA 2I9CA 4F3VA 2GRRB 3FUNA 5JMND 4AOFA 2XEVA 4NURA 4U8HA 3ASFA 4MKTA 4ZHBA 1E8YA 3AS5A 2VTBA 1MZCA 2IO3C 2XPZA 4WNFA 4EBAA 4I6JA 4K0RA 2AJAA 2WMNA 4IN3B 3TWUA 3FTVA 3UIOC 4OVUA 2WMOA 5EX0A 4ZFHA 2X6FA 3CEQA 3MGBA 4A63B 1OY3D 1X5BA 3ULQA 3D9MA 3ASOE 2OEVA 3Q9UC 4GA1A 2IEJA 3B7SA 5ANLA 1IHBA 1OCCE 4CT4A 1FPPA 1DNPA 4GZ6A 3N71A 4BT8A 4AJWA 5J08A 3ASDA 1H2TC 1RZ4A 2A4ZA 4U8YD 1JCRA 4Q94A 2XGSA 5D66A 4YDOA 4BETA 2PL2A 2FEZA 4G2VA 2V4LA 1BI8B 3DXMG 3TJPA 4G26A 2WXPA 5JA4D 4TRQA 3J5PA 4G8KA 2DVWA 3CHRA 3MV2B 4JHRA 2Y4UA 3JQ1A 1NA3A 3GZ1A 3ZYLA 2QY7A 3AJIA 4GPMA 2FF4A 2ZGGA 5HRYA 1Q2ZA 3IKOB 1JCQA 5KJKA 4WWNA 1JCSA 1UN9A 4JZYA 3CKCA 3BQOA 4XZ4A 3FTZA 4UWFA 2FO7A 4BSZB 2VSOE 3R9AB 2IOLA 5AQBA 4FU3A 4ILHB 2QYJA 2L0IA 3S7BA 3RAUA 5A6CA 3EIQC 4ILIA 4PS7A 5D2MC 5CHEE 5JHAA 1S0PA 1FCHA 3JXJA 3OXLA 5BPPA 3TAXA 3MZLB 4FJZA 3ASNE 4M7CA 2FULA 4GTVA 4DLQA 4JHJA 4JHKA 5BXOA 5DIZA 3JXIA 1TNUA 3QDNA 3MKQA 2I1KA 3VLDA 4OAVB 1TNBA 5KWDA 3IHVA 5EX3A 1H2VC 3NQPA 2YINA 3FTWA 2R03A 4NACA 3S2AA 2IJGX 3DSVA 1Z6TA 3HG0D 2E2EA 1U2VG 1JWFA 4L2LA 1H6KA 4WWPA 1AWCB 3LKUA 4NQ0A 3SGHA 4GZCA 3GW4A 1OWLA 2BEDA 4PDXA 3FU0A 2A5EA 1UN8A 2AXVA 4I6GA 5C1DA 3LS8A 3G2VA 3ABKE 3Q4AB 4F6RD 4BWRA 4DI3A 2J09A 2MHKA 3FEXA 4OVVA 3NF1A 5FQ8A 3APCA 2WB2A 4WNGA 2VGXB 1E8ZA 4MLPA 1KT0A 2GRLA 1TEZA 5HI7A 5CRVA 4J8EA 4B93B 4ANUA 3L22A 4UWHA 3TWSA 4UUCA 4GTPA 2DWZA 2Q7FA 3UT8A 1SA4A 3W9GA 3CVQA 1K1BA 4N5QA 3ZKJA 1TR4A 3D9OA 1OWOA 4KMOA 3FUHA 3RJVA 2GRQB 4GU5A 2WPVA 4GA2A 3Q15A 3UT7A 3ISMC 3SHFA 3AG1E 5AYWD 4EECA 3EU5A 3IHYA 2DYSE 5FTPA 2EIKE 1TN6A 3IBEA 4GMJA 1HO8A 3FH8A 3FHEA 2VSXE 3DSUA 2OVFA 4TXPA 4MBGA 2OV8A 3PREA 2E0IA 3EHRA 4ABNA 2VGYA 5FQ4A 3B7UX 3C72A 4ATZD 3FUIA 3MEKA 1S64A 2JLBA 2DZNA 4HRNA 1OCRE 3ULYA 3HDXA 4AVXA 4XI9A 2OCCE 3LDZA 1QBQA 4DX2A 3DEPA 4AXHA 5JJTA 3L54A 3OTNA 4G11A 5IY5E 3PEVB 4L7TA 4UI9C 3FUKA 5CMWA 4G23A 1LF8A 3G2WA 4AY6A 4YDWA 3F6QA 5JJ6A 1HH8A 2ZU6B 4BEPA 4CCAA 4RG9A 4EHMA 2KZTA 3DBSA 2R17C 2PZIA 4I43A 3T9KA 2UY1A 3ZEFA 4HB5A 2WXIA 3LEWA 3LY7A 2HM8A 2WQ7A 3FTYA 5ENSD 2KC7A 5AARA 2CFUA 2X6KA 3ESLA 3BU8A 3R9MA 2PM6A 3QJZA 4HORA 2LSVA 4ACLA 5ENPD 3MKQB 2CHZA 3QWPA 4O1PA 3OXFA 3SF4A 4O60A 3V79K 4ME2A 3ULEG 3Q47B 2Y69E 2UWJG 5AENA 1V55E 5AN8A 2X6IA 2RFMA 1OWNA 2XPIA 4HRLA 1H2UA 2EIJE 5ARFA 4G1TA 3PZ3A 2WXKA 3K9IA 3FU3A 3EHQA 4GCNA 5HQ8A 3QNKA 1FT2A 1S63A 4YDYA 2QC9A 2XEHA 1EF1C 3JQ0A 1A5EA 3DPDA 3SFZA 3ZRHA 3APFA 4BERA 4PS8A 4GZ3A 1H6PA 3CVYA 2YNQA 4H7XA 3BEEA 1AP7A 3CHMA 3RIBA 1TN8A 3D9KA 2VGXA 4N3AA 2LAHA 3ASGA 4KZCA 1WAO1 2X38A 2UY1B 3UM3A 4J8DA 3CK7A 4JD2G 3SBSA 3SD5A 3CVPA 4KBQA 4A1GA 3PE4A 2EINE 1YYHA 1G3NB 4Q96A 5KBAA 3TGOA 4U8VD 1E8XA 4UWGA 1Y6IA 1KLXA 1UJKA 4G25A 4DRXE 1H19A 4BTAA 3CVUA 3QKYA 2L9BA 3LYAA 3DEOA 2ILRA 3S7DA 5B1BE 4UI9J 4DX6D 1O1SA 4ANWA 2IY0C 2L6BA 3V2XA 3ONKA 1QNFA 4B94A 3MCXA 4FJYA 1N4PA 4HRMB 1O1RA 2F8YA 2ZISA 2ZGDA 3EJNA 3D9HA 3SY2A 3LJ3A 1IQRA 3E37A 3PEUB 4U0UA 4QQIA 2WQ6A 2XS8A 3EU9A 4GB9A 4B8CB 4J8YA 2XGOA 1NI1A 4EPZA 4AP2A 2NXPA 4RVBA 1MJ0A 3VLEA 3MJWA 4RLYA 5FZQA 3AU4A 3U66A 4HOQA 4CGWA 2F0YA 3UTMA 1GW6A 4HS2A 3UIPC 3QARA 2KCKA 3C3RA 4BESA 1N0QA 4ANVA 5ENRD 1EYHA 2LXMA 3FTXA 3IV0A 3PNLB 4N39A 5AQAA 2BF0X 3HHMA 3FFLA 1N4SA 4J7WA 3PH0C 2R5SA 2IF4A 4MS6A 4YNDA 3D9LA 1BI7B 2JABA 3ASHA 4J8FA 5FZSA 3O48A 4CDMA 1HX8A 2KZTB 4LERA 1N95A 2XCBA 3UXGA 2EQXA 2GRPB 1QZ2A 4GA0A 4I9EA 3AS4A 2ETBA 3ZHEA 5ANRA 5KJLA 4GZDA 4JA9A 1WDYA 4HI9A 4GMRA 5LP0A 2AW6A 1UOHA 1TJCA 3MYVA 1RW2A 3I4GA 4PH4B 2CG3A 3DPYA 2WXNA 3RSEG 3FDHA 1U3DA 3NOGD 4U0ZA 3NOCD 4DJAA 4KVOA 4KT6B 4B8AA 4FA6A 4QFVA 1N54A 3B7BA 4GMLA 4Y6WA 3EHMA 1HE8A 5T8IA 4DI4A 4O1OA 3WG7E 4GPKA 3JYSA 5CBNA 4DX1A 3ONLA 4WWOA 2R2LA 3DSWA 1BU9A 4E85A 4KZ0A 4LNGA 4F1PA 1B89A 2P9PG 4HLLA 4WAFA 1HU3A 3AU5A 4LSZE 2XZTG 3ZU7B 1SZ9A 4AIFA 2CFZA 2DZOA 3FTUA 4A55A 2B0OE 4YVOA 3Q7AA 1D8DA 3URZA 1NA0A 5KJNA 3R7QA 5BV1A 4EZKA 3ZUVB 3Q78A 3CIAA 2MOWA 4H7YA 4LNBA 3T8KA 3APDA 4HFGA 2P9IG 3TL5A 4YDEA 1NP7A 4AEZC 3B7TA 2WXLA 3KD7A 2J4BA 4KYOB 3ZYMA 2J49A 3ZGQA 3PNTB 4K5AB 4JEHA 3UUXA 2JEKA 3VTYA 3QOUA 1SW6A 3P1UA 2XRYA 1DC2A 5CECB 4BTBA 3LVQE 4G24A 2DBAA 2IO2C 3FTSA 2XQ0A 4U63A 1L5JA 4B0ZA 3SFYA 2F37A 5LCWC 3JCKC 3KEAA 1SZAA 3ENEA 4JL0A 3CGHA 3I5PA 5BT1A 3E32A 1MHQA 1XGWA 3KS2A 2WXFA 2LNIA 2WXJA 4TUMA 3E33A 2P9SG 3BUAA 3KSLA 4R7LA 1HFAA 5LX8A 4ACKA 3FP3A 4FP7A 4AV7A 3RO2A 1MX6A 5CCLA 1PAQA 4EBAG 4HXIA 3ZFWA 5BV0A 4MRUA 3DWLG 3NZUA 4U04A 2R05A 4AM9A 4FULA 2GW1A 4TXQA 5AJLA 5FT9A 3CSFA 3ZYKA 2VGEA 3S7FA 4EQFA 2FO1E 1X81A 4GTQA 4LUNU 4GYWA 5LFAA 5E75A 5A23A 2AVPA 3MA5A 4XIFA 3RRMB 2QFCA 3ZNGA 1PC2A 4F1SA 3TWWA 3Q9NC 1IQUA 4XEIG 4JEUA 3D9IA 4TV3A 2HE0A 5A7DB 3BG0B 4F7AA 4HOSA 3CKBA 3RKVA 2V4HC 4FHKA 2PNNA 2P9LG 4FLHA 3FUDA 5AQ7A 2WXOA 1K8KG 3VTXA 4BFRA 2WXQA 5M72A 1LTXA 3AG4E 2CHWA 3U3WA 2B6CA 1E7UA 2BKKB 2LSUA 1Y8MA 3HYMB 2YQ8A 3TG5A 2EIME 1E90A 2XEEA 1S70B 4LG6A 1JUQA 2ONDA 3Q79A 3CK8A 1EDUA 4I1OB 2X6HA 3R7RA 2IQCA 1INZA 4W9RA 2X3MA 2IONA 3QWVA 2WM9A 4JW1A 3DRAA 4IULA 2VQ2A 5FQ7A 1SQMA 5ARGA 3HRAA 3ZIMA 4JPSA 2XENA 3CLJA 2AWIA 4HQDA 4M3OA 4DK5A 2VSNA 3UMVA 4X8QA 2XCCA 1ZU2A 1OCZE 1ELKA 2FI7A 1UG3A 4I2WA 2WXMA 3MV3B 4NIKA 4FLBA 5G2NA 4N5CA 5LCWJ 3MKRA 3I4RB 3C3OA 4CT0A 2H6GA 4GTRA 1Z3XA 3UQ3A 1KZPA 5KCMA 4OAUC 2WXRA 3UINC 1NZNA 1E96B 3UM0A 1JPLA 4Z68A 3HXCA 5G04J 1QQEA 1DVPA 1HS6A 4APOA 3Q5MA 4PS3A 3PZ2A 3TWVA 1Z3YA 4KVMA 3E4BA 5J90A 5EYLA 2KM4A 2I6HA 3PDNA 3HXFA 3HXDA 2FBNA 1OT8A 4YVQC 4V3IA 4DPRA 4HLEA 3FEYA 3QB2A 2QZAA 4HI8A 2NC9A 1D8EA 4BX8A 1KT1A 3D9NA 1HG2A 4L2YA 2VSYA 1PY1A 4AY5A 5T3RA 1JWGA 3RO3A 3W9FA 3FUMA 4GTTA 1EPUA 3CK9A 2OOEA 3DSXA 1YMPA 2LAIA 3GYZA 3L08A 2H6HA 3TG4A 4UQZA 4JXTA 3OXGA 5E76A 4LRZA 5AIJA 3AAAC 2P9KG 4GYYA 2BUGA 5KNHD 5DBKA 4CEMA 5ENNA 5ENOD 3KAEA 2X6JA 4GZ5A 4K5CA 3S7JA 4LCTA 4O6FA 5EYPF 1WY6A 1ZBPA 4CRWA 2RG8A 3L17A 3LPZA 1OCOE 3E34A 2C0LA 3UT4A 4I6EA 4XE0A 3HXEA 1FT1A 3CHPA 1IKND 2P9UG 2KCVA 3X2QE 1TYQG 4L9PA 4EZJA 3TWXA 3ZVVA 5C2YA 3HVEB 5EIBE 1O1TA 2OEWA 2VJ8A 4BT9A 4L23A 3L9TA 3I3NA 4BY6A 2Y4TA 2YHEA 2DCPA 3LJNA 3U64A 1DCEA 1ELWA 3RRNB 1UJJA 1NL4A 3CVXA 3B95A 3EUVA 4FC8A 5FINA 3CHQA 3JUIA 1SVXA 3CR3A 5EILA 3G2UA 4LNUD 3FY4A 3B7RL 2XRZA 3T5VA 3PZ4A 1E8WA 2L0TB 2XGMA 5CMYA 5CEDB 3BG1B 2IOSA 3JUEA 2ZIRA 4XKCA 3U9WA 3UM2A 4TUUA 4WNEA 5FQ6A 2NYJA 1N94A 5FJYA 4UI9K 4JB8P 5LOZA 4E6HA 4CYMD 3EDTB 3UI2A 4BSXA 3LXUX 3PVLA 2GRMA 1H0AA 3RU0A 4HBDA 3D9PA 2J07A 3TWTA 5FWQA 1IHGA 1VDYA 1OWMA 3PZDA 3NBNB 2IU1A 3FH5A 5EN5D 5G05J 3C5RA 4LEUA 3D9JA 1HZ4A 2LUHA 1O5MA 1ELRA 3T5XA 3FH7A 4U7EB 3FU5A 3HIZA 2AXZA 1E7VA 5BNWA 5FZRA 3E30A 2P9NG 1A17A 4HVBA 1ZB1A 2H6IA 4JA7A 4I1MA 4A1SA 3TXMA 5KJMA 1TJFA 1N52A 1K3ZD 4XX5A 2GGFA 3MX3A 2NSZA 3SBTB 3ZXPA 2KXPC 4N2QA 1LD7A 2Y0BG 4PUCA 1MQSA 4JVSA 4GTSA 4CDNA 3LY9A 2HR2A 3KEZA 3LCAA 2ETAA 5AJDA 4U96D 3L16A 4A3TA 2L6JA 5BXUA 5B3SE 1WM5A 3SO8A 1BLXB 2J9QA 2V5QC 4N3CA 5ENTD 3FUEA 1OXJA 2J8SD 3PZ1A 2XS1A 1WG0A 3HXBA 4C48B 2XPYA 2WVIA 5G04C 5EKQD 4C0MA 4B89A 4RG6A 1LD8A 3G2SA 3IEGA 3V2OA 4OYSA 4Y6CA 2F8XK 4CGVA 4RSYA 3L82A 1OUVA 3ZXSA 1FVFA 3QK0A 4KXKB 3V30A 3PE3A 4C9BB 3UKUG 4APFA 5CEAA 2R59A 2AXUA 3SFXA 4UWLA 1UW4B 3SNXA 1NFIE 2RD0A 3QWWA 3Q7FA 3CSTA 2RKKA 3UM1A 5BW8C 3PUKA 4WUYA 3Q75A 4F53A 3SZ7A 3V31A 1KPSB 3B13A 1SA5A 5CCMA 1W3BA 3UX4A 3TWRA 3FUFA 1TN7A 4CZ2D 3TXNA 4WNDA 5D0QD 1IYGA 5JHBA 3AS8A 3CV0A 4FADA 1N4RA 3IXEA 4DX7D 1BD8A 1N9AA 4U0SA 4C0EA 2PQNA 4DUIA 4GTMA 3AG2E 1IXVA 1D9SA 5FIOA 1YCSB 1P5QA 2C0MA 3D3MA 3Q73A 3FUJA 4I17A 2VTBB 4U95D 5AAOA 5G05C 2H6FA 3ML9A 3QAQA 3FU6A 3WXXA 3O4ZA 3NB2A 3NZSA 4CDRA 4RQIA 3EIJA 4Q69A 4GAAA 3ZYQA 4HOUA 4L1BA 1HF8A 3Q49B 2IFUA 3UPVA 4J0UA 1FVHA 5HS0A 4XKBA 2Y3AA 5CRUA 3LY8A 3ESKA 5B1AE 5T4YA 1MX2A 1H6OA 3VLFA 3ABLE 3ABME 5H7PA 2GRNB 4K03A 3CVLA 4ANXA 4I9CA 3DSTA 2LXLA 5AQ9A 2P2CP 1KZOA 1DCQA 5ITZF 2WXHA 2HYZA 2V5FA 2OVBA 3ML8A 1TNYA 3RK6A 4P29A 3OAWA 2BTDA 4GYOA 3PS6A 2CG2A 3U4TA 3NAWA 1MX4A 4NRHB 3P2BA 2PM7A 1YA0A 2YHCA 3GZSA 3CHSA 2ETCA 3CHOA 3HVEA 3LVRE 2HO1A 2A5UA 2C2LA 3SQVA 2DYRE 4URKA 2XZDG 2WQHA 5HKPA 4G8LA 5KNGA 4IRUA 2R02A 4GTOA 1OWPA 1MYOA 2P58C 3SI5A 5CBOA 1TNOA 2VYIA 4N2SA 2LO6A 2Y1LE 3PUJA 2I2OA 2DIWA 2XHEA 1K1AA 1N4QA 2MYOA 3FULA 3TWQA 4HNAD 2V8SE 4EZLA 3CVWA 2GROB 4BX9A 3FWVA 2QYUA 5JJ7A 3RRUA 3GZ2A 4ATGA 5BUZA 4UQXA 4DX5D 4HOTA 2EILE 3PRZA 2KBXA 1U3CA 3G2TA 4N3BA 2MRIA 4FHJA 4I2ZA 1XNFA 1QYMA 4I1AA 5CERB 2J4DA 5G55A 1Z5SC 4GCOA 3KSQA 3C98A 2V0PA 1TNZA 2ZXWE 3AG3E 2BKGA 1HXIA 2PQRA 1N11A 3T8MA 5EDSA 3L13A 2RFAA 1N0RA 2I1JA 3DSSA
chains in the Genus database with same CATH topology
4UWKA 4JEHA 5JJ6A 2JEKA 3UUXA 4UQYA 1HH8A 3CQGB 4BSXA 2CHXA 3VTYA 2ZU6B 3LXUX 3QOUA 4CCAA 4RG9A 3P1UA 3PVLA 2KZTA 3DBSA 2GRMA 1H0AA 2XRYA 2R17C 3RU0A 2PZIA 3ZN3A 4I43A 2KCLA 3ZW3A 3ZPJA 3EHNA 4BTBA 3D9PA 2J07A 4JC8A 3LVQE 4ILGA 4G24A 1BPOA 4A3VA 2UY1A 3ZEFA 2DBAA 5FWQA 2M63A 2WXIA 2J08A 5D0OD 3CVVA 1IHGA 1VDYA 3LEWA 2KATA 3LY7A 3FTSA 2XQ0A 4U63A 1L5JA 2HM8A 3CQCB 3ZHEB 3FTYA 4B0ZA 2KC7A 2WQ7A 2CFUA 2X6KA 2WXGA 1OWMA 3ESLA 3PZDA 2IU1A 3FH5A 3QC1A 4IYPA 5LCWC 3JCKC 4D10C 2PM6A 3L6AA 5G05J 1HG5A 4XI0A 4DLOA 1SZAA 3ENEA 4U07A 3CVNA 4LEUA 3QJZA 4JL0A 3CGHA 3I5PA 5BT1A 4HORA 2LSVA 4J8SA 4ACLA 3D9JA 1HZ4A 3MKQB 2CHZA 4J6IA 3QWPA 2I9CA 1ELRA 1MHQA 3T5XA 3FH7A 4F3VA 3FU5A 3HIZA 1XGWA 2AXZA 1E7VA 3KS2A 3OXFA 3SF4A 2WXFA 2LNIA 3FUNA 4ME2A 2WXJA 3Q47B 5BNWA 5FZRA 2UWJG 4AOFA 2XEVA 5AENA 4NURA 4U8HA 3ASFA 4MKTA 4R7LA 1E8YA 3AS5A 1HFAA 5LX8A 1A17A 2VTBA 4HVBA 4ACKA 2XPZA 2X6IA 4WNFA 4EBAA 4JA7A 4I1MA 4I6JA 1OWNA 4A1SA 4K0RA 3FP3A 4FP7A 4AV7A 3TXMA 2XPIA 5KJMA 1TJFA 2WMNA 1N52A 4IN3B 3FTVA 3RO2A 4OVUA 5CCLA 1PAQA 4XX5A 2GGFA 2WMOA 3MX3A 2NSZA 5EX0A 3SBTB 4EBAG 1H2UA 5ARFA 2X6FA 3CEQA 3MGBA 4G1TA 4N2QA 1X5BA 3ULQA 4HXIA 3D9MA 3ZFWA 2WXKA 3K9IA 3FU3A 5BV0A 4MRUA 4GCNA 5HQ8A 4PUCA 3NZUA 1MQSA 4GA1A 4JVSA 3QNKA 4CDNA 3LY9A 2HR2A 3KEZA 3LCAA 4U04A 3B7SA 5ANLA 5AJDA 4CT4A 3L16A 4A3TA 4AM9A 2L6JA 1DNPA 4GZ6A 4FULA 1EF1C 2GW1A 3JQ0A 3N71A 5AJLA 1WM5A 3DPDA 5FT9A 3CSFA 3ZYKA 4BT8A 3SFZA 3ZRHA 3APFA 4AJWA 3S7FA 5J08A 2J9QA 4N3CA 3ASDA 4EQFA 4PS8A 1H2TC 3FUEA 4LUNU 4GYWA 2A4ZA 5LFAA 4GZ3A 4Q94A 2XGSA 2XPYA 5E75A 5A23A 2AVPA 3MA5A 2WVIA 3CVYA 5G04C 5EKQD 2PL2A 4C0MA 2FEZA 4XIFA 3RRMB 2YNQA 4G2VA 2QFCA 2V4LA 4H7XA 3BEEA 4RG6A 3TJPA 4G26A 1PC2A 4B89A 3CHMA 3RIBA 4F1SA 2WXPA 1IQUA 3D9KA 3G2SA 2VGXA 3IEGA 4N3AA 4JEUA 4OYSA 2LAHA 4TRQA 4Y6CA 3ASGA 3D9IA 3CHRA 3MV2B 4JHRA 4TV3A 4KZCA 5A7DB 2Y4UA 3BG0B 1WAO1 2X38A 3JQ1A 4F7AA 1NA3A 2UY1B 3GZ1A 4RSYA 3ZYLA 4CGVA 1OUVA 2QY7A 4HOSA 3CKBA 3RKVA 4J8DA 3ZXSA 1FVFA 3CK7A 3QK0A 4KXKB 4FHKA 3SBSA 3SD5A 2FF4A 3PE3A 3CVPA 4KBQA 3IKOB 4C9BB 4APFA 4A1GA 3PE4A 5KJKA 4FLHA 4WWNA 2R59A 3FUDA 2AXUA 4UWLA 1UN9A 1UW4B 4JZYA 3SNXA 2RD0A 2WXOA 3CKCA 4XZ4A 3VTXA 3QWWA 4BFRA 4Q96A 3FTZA 2WXQA 3TGOA 1E8XA 4UWFA 2FO7A 5M72A 4UWGA 2CHWA 3CSTA 2VSOE 3R9AB 1Y6IA 1KLXA 1UJKA 4G25A 2IOLA 3U3WA 1H19A 1E7UA 2LSUA 4FU3A 4BTAA 1Y8MA 3HYMB 3CVUA 3QKYA 4ILHB 2YQ8A 3TG5A 2L9BA 2L0IA 5BW8C 3S7BA 1E90A 3PUKA 4WUYA 4F53A 3SZ7A 1JUQA 2ONDA 3LYAA 5A6CA 3CK8A 3EIQC 3B13A 4ILIA 4PS7A 1EDUA 5CHEE 5CCMA 2ILRA 4I1OB 3S7DA 1W3BA 2X6HA 3R7RA 2IQCA 5JHAA 1S0PA 1INZA 4UI9J 4W9RA 3UX4A 3FUFA 1FCHA 4ANWA 3ONKA 3OXLA 1QNFA 2X3MA 3MCXA 3MZLB 2IONA 3TAXA 3TXNA 4B94A 5BPPA 4FJZA 3QWVA 4FJYA 2WM9A 4WNDA 5D0QD 2FULA 5JHBA 4JW1A 1IYGA 4IULA 3AS8A 3CV0A 4FADA 2VQ2A 5FQ7A 4DLQA 1SQMA 3EJNA 4JHJA 4JHKA 5ARGA 3LJ3A 5DIZA 3QDNA 3ZIMA 1IQRA 3MKQA 4JPSA 4U0SA 4C0EA 3PEUB 2I1KA 2PQNA 3CLJA 3VLDA 2AWIA 4U0UA 2WQ6A 4M3OA 4DK5A 3IHVA 2VSNA 5EX3A 3UMVA 1H2VC 2XCCA 2YINA 1ZU2A 3FTWA 3NQPA 4GB9A 4B8CB 2XGOA 1ELKA 1P5QA 2FI7A 2C0MA 3D3MA 4NACA 4EPZA 1UG3A 3S2AA 4AP2A 4I2WA 2IJGX 2NXPA 2WXMA 3MV3B 4RVBA 3FUJA 4I17A 2VTBB 4FLBA 1Z6TA 3VLEA 5G2NA 4N5CA 5LCWJ 3MKRA 2E2EA 3I4RB 3MJWA 5G05C 5FZQA 3AU4A 4CT0A 3ML9A 3U66A 4HOQA 1JWFA 4CGWA 4L2LA 3QAQA 3FU6A 1GW6A 1H6KA 4WWPA 3WXXA 3O4ZA 1Z3XA 3LKUA 3NZSA 4NQ0A 3UQ3A 5KCMA 4CDRA 4HS2A 3EIJA 3SGHA 4Q69A 4GZCA 2WXRA 4GAAA 3GW4A 1OWLA 1NZNA 1E96B 2KCKA 3QARA 1JPLA 4PDXA 3FU0A 3ZYQA 5G04J 1UN8A 2AXVA 4HOUA 4I6GA 5C1DA 1QQEA 4L1BA 1HF8A 3LS8A 3G2VA 1DVPA 3Q49B 2IFUA 3Q4AB 4BWRA 1HS6A 4APOA 4ANVA 3Q5MA 4DI3A 3UPVA 1EYHA 2J09A 2MHKA 4J0UA 4PS3A 1FVHA 3FTXA 3IV0A 4XKBA 3FEXA 3PNLB 4N39A 1Z3YA 4OVVA 2Y3AA 3NF1A 5FQ8A 3APCA 4KVMA 2WB2A 2BF0X 3HHMA 3E4BA 3FFLA 4WNGA 5J90A 2KM4A 3LY8A 2VGXB 2I6HA 3PDNA 3ESKA 3PH0C 5T4YA 1E8ZA 4MLPA 1KT0A 2GRLA 2R5SA 1TEZA 2IF4A 5HI7A 4MS6A 4YNDA 3VLFA 3D9LA 2FBNA 3ASHA 4J8EA 4J8FA 4YVQC 5FZSA 4ANUA 3O48A 3L22A 4V3IA 4CDMA 4DPRA 1HX8A 2KZTB 4LERA 4HLEA 2XCBA 4UWHA 2EQXA 4K03A 3FEYA 3CVLA 3QB2A 4ANXA 4I9CA 1QZ2A 4GA0A 4I9EA 2Q7FA 2NC9A 3AS4A 3UT8A 4BX8A 3ZHEA 2WXHA 1KT1A 5ANRA 5KJLA 3D9NA 3CVQA 1HG2A 2HYZA 4GZDA 4JA9A 5LP0A 2AW6A 2V5FA 4L2YA 2OVBA 3ML8A 2VSYA 1PY1A 3RK6A 4AY5A 1TJCA 4P29A 5T3RA 3MYVA 3OAWA 1JWGA 3RO3A 2BTDA 4GYOA 3PS6A 2CG2A 3FUMA 3D9OA 3U4TA 4NRHB 1EPUA 3P2BA 3CK9A 1OWOA 2PM7A 1YA0A 2YHCA 2OOEA 3I4GA 4KMOA 4PH4B 2LAIA 2CG3A 3FUHA 3GYZA 3GZSA 3L08A 3RJVA 2WXNA 3TG4A 4UQZA 4JXTA 3CHSA 3OXGA 3FDHA 3CHOA 3HVEA 3LVRE 1U3DA 4GU5A 5E76A 2HO1A 2A5UA 2C2LA 4LRZA 5AIJA 2WPVA 4U0ZA 4DJAA 4GA2A 4KT6B 4KVOA 4URKA 4B8AA 2WQHA 3Q15A 3UT7A 4GYYA 2BUGA 4IRUA 4FA6A 4QFVA 5DBKA 4CEMA 3SHFA 1OWPA 5ENNA 1N54A 3KAEA 2X6JA 4GZ5A 2P58C 3SI5A 4GMLA 4Y6WA 3EHMA 1HE8A 5T8IA 3S7JA 4LCTA 4O6FA 5AYWD 4EECA 4DI4A 1WY6A 1ZBPA 2VYIA 4CRWA 3IHYA 2RG8A 4GPKA 3L17A 3JYSA 5FTPA 4N2SA 2LO6A 3IBEA 3PUJA 3LPZA 4GMJA 3ONLA 2C0LA 1HO8A 2DIWA 2I2OA 3FH8A 4WWOA 3UT4A 4I6EA 4XE0A 3FHEA 2VSXE 2XHEA 3CHPA 3FULA 2KCVA 4E85A 4KZ0A 2OVFA 4EZJA 3ZVVA 2V8SE 4EZLA 5C2YA 3HVEB 3CVWA 1B89A 4BX9A 2VJ8A 3FWVA 2OV8A 4WAFA 1HU3A 3PREA 5JJ7A 3RRUA 2E0IA 3GZ2A 4ATGA 5BUZA 4BT9A 3AU5A 4UQXA 4L23A 4ABNA 3I3NA 2VGYA 4BY6A 5FQ4A 2Y4TA 2YHEA 4HOTA 1SZ9A 3PRZA 4AIFA 2DCPA 2CFZA 3B7UX 3FTUA 3U64A 1U3CA 4A55A 1ELWA 3G2TA 3FUIA 3RRNB 1UJJA 3MEKA 4YVOA 4N3BA 3CVXA 2MRIA 4FHJA 4I2ZA 1XNFA 2JLBA 3URZA 4I1AA 4FC8A 1NA0A 3CHQA 3JUIA 5KJNA 3CR3A 3R7QA 2J4DA 3G2UA 5G55A 3FY4A 3B7RL 5BV1A 2XRZA 3T5VA 4GCOA 4EZKA 3CIAA 3C98A 2MOWA 4H7YA 3HDXA 1E8WA 2V0PA 4AVXA 3APDA 2L0TB 2XGMA 4XI9A 4HFGA 5CMYA 3LDZA 3TL5A 3BG1B 1HXIA 2PQRA 1NP7A 2IOSA 4AEZC 3B7TA 3T8MA 4AXHA 2WXLA 5JJTA 3L54A 3KD7A 3OTNA 4G11A 3L13A 4XKCA 5EDSA 2J4BA 3PEVB 4KYOB 3U9WA 4L7TA 4UI9C 3ZYMA 3FUKA 4TUUA 4WNEA 5CMWA 5FQ6A 2J49A 4G23A 1LF8A 5FJYA 2I1JA 4UI9K 3G2WA 3ZGQA 3PNTB 5LOZA 4E6HA 4AY6A 3EDTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9M A;  1SZ9 A;  1PY1 A;  3ONK A;  4HFG A;  2DCP A;  1JPL A;  5CMY A;  3ZYL A;  1JWG A;  3LDZ A;  1ELK A;  2QY7 A;  1UJK A;  3ZYQ A;  4AVX A;  3D9L A;  3G2T A;  4FU3 A;  4Q94 A;  1UJJ A;  4NAC A;  3D9O A;  1HFA A;  1HG5 A;  1HF8 A;  3G2V A;  1DVP A;  1HX8 A;  1SZA A;  4FLB A;  1H0A A;  2L0I A;  2V8S E;  1EYH A;  1JUQ A;  3D9J A;  3D9P A;  3G2U A;  4JXT A;  3ZYM A;  1JWF A;  1MHQ A;  1EDU A;  3CLJ A;  5CMW A;  3RRU A;  3D9K A;  3G2S A;  1LF8 A;  3D9N A;  1HG2 A;  1XGW A;  2BF0 X;  2LO6 A;  4GZD A;  3ZYK A;  1VDY A;  3G2W A;  1INZ A;  5LP0 A;  2KM4 A;  2MOW A;  3D9I A;  1X5B A;  3ONL A;  4Q96 A;  2DIW A;  5LOZ A;  5J08 A;  2L0T B;  4GZC A; 
#chains in the Genus database with same CATH topology
 4UWK A;  4UQY A;  3CQG B;  2CHX A;  3J5Q B;  5ENQ D;  5EID A;  3ZN3 A;  3DXK G;  2KCL A;  3ZW3 A;  3ZPJ A;  3EHN A;  4K5B A;  4JC8 A;  4ILG A;  1BPO A;  4A3V A;  2M63 A;  2J08 A;  5D0O D;  3CVV A;  4TXR A;  2KAT A;  3CQC B;  3ZHE B;  2WXG A;  3QC1 A;  4IYP A;  4D10 C;  3L6A A;  1HG5 A;  4XI0 A;  4DLO A;  3C3Q A;  3UKR G;  4U07 A;  3CVN A;  1V54 E;  4J8S A;  4J6I A;  2I9C A;  4F3V A;  2GRR B;  3FUN A;  5JMN D;  4AOF A;  2XEV A;  4NUR A;  4U8H A;  3ASF A;  4MKT A;  4ZHB A;  1E8Y A;  3AS5 A;  2VTB A;  1MZC A;  2IO3 C;  2XPZ A;  4WNF A;  4EBA A;  4I6J A;  4K0R A;  2AJA A;  2WMN A;  4IN3 B;  3TWU A;  3FTV A;  3UIO C;  4OVU A;  2WMO A;  5EX0 A;  4ZFH A;  2X6F A;  3CEQ A;  3MGB A;  4A63 B;  1OY3 D;  1X5B A;  3ULQ A;  3D9M A;  3ASO E;  2OEV A;  3Q9U C;  4GA1 A;  2IEJ A;  3B7S A;  5ANL A;  1IHB A;  1OCC E;  4CT4 A;  1FPP A;  1DNP A;  4GZ6 A;  3N71 A;  4BT8 A;  4AJW A;  5J08 A;  3ASD A;  1H2T C;  1RZ4 A;  2A4Z A;  4U8Y D;  1JCR A;  4Q94 A;  2XGS A;  5D66 A;  4YDO A;  4BET A;  2PL2 A;  2FEZ A;  4G2V A;  2V4L A;  1BI8 B;  3DXM G;  3TJP A;  4G26 A;  2WXP A;  5JA4 D;  4TRQ A;  3J5P A;  4G8K A;  2DVW A;  3CHR A;  3MV2 B;  4JHR A;  2Y4U A;  3JQ1 A;  1NA3 A;  3GZ1 A;  3ZYL A;  2QY7 A;  3AJI A;  4GPM A;  2FF4 A;  2ZGG A;  5HRY A;  1Q2Z A;  3IKO B;  1JCQ A;  5KJK A;  4WWN A;  1JCS A;  1UN9 A;  4JZY A;  3CKC A;  3BQO A;  4XZ4 A;  3FTZ A;  4UWF A;  2FO7 A;  4BSZ B;  2VSO E;  3R9A B;  2IOL A;  5AQB A;  4FU3 A;  4ILH B;  2QYJ A;  2L0I A;  3S7B A;  3RAU A;  5A6C A;  3EIQ C;  4ILI A;  4PS7 A;  5D2M C;  5CHE E;  5JHA A;  1S0P A;  1FCH A;  3JXJ A;  3OXL A;  5BPP A;  3TAX A;  3MZL B;  4FJZ A;  3ASN E;  4M7C A;  2FUL A;  4GTV A;  4DLQ A;  4JHJ A;  4JHK A;  5BXO A;  5DIZ A;  3JXI A;  1TNU A;  3QDN A;  3MKQ A;  2I1K A;  3VLD A;  4OAV B;  1TNB A;  5KWD A;  3IHV A;  5EX3 A;  1H2V C;  3NQP A;  2YIN A;  3FTW A;  2R03 A;  4NAC A;  3S2A A;  2IJG X;  3DSV A;  1Z6T A;  3HG0 D;  2E2E A;  1U2V G;  1JWF A;  4L2L A;  1H6K A;  4WWP A;  1AWC B;  3LKU A;  4NQ0 A;  3SGH A;  4GZC A;  3GW4 A;  1OWL A;  2BED A;  4PDX A;  3FU0 A;  2A5E A;  1UN8 A;  2AXV A;  4I6G A;  5C1D A;  3LS8 A;  3G2V A;  3ABK E;  3Q4A B;  4F6R D;  4BWR A;  4DI3 A;  2J09 A;  2MHK A;  3FEX A;  4OVV A;  3NF1 A;  5FQ8 A;  3APC A;  2WB2 A;  4WNG A;  2VGX B;  1E8Z A;  4MLP A;  1KT0 A;  2GRL A;  1TEZ A;  5HI7 A;  5CRV A;  4J8E A;  4B93 B;  4ANU A;  3L22 A;  4UWH A;  3TWS A;  4UUC A;  4GTP A;  2DWZ A;  2Q7F A;  3UT8 A;  1SA4 A;  3W9G A;  3CVQ A;  1K1B A;  4N5Q A;  3ZKJ A;  1TR4 A;  3D9O A;  1OWO A;  4KMO A;  3FUH A;  3RJV A;  2GRQ B;  4GU5 A;  2WPV A;  4GA2 A;  3Q15 A;  3UT7 A;  3ISM C;  3SHF A;  3AG1 E;  5AYW D;  4EEC A;  3EU5 A;  3IHY A;  2DYS E;  5FTP A;  2EIK E;  1TN6 A;  3IBE A;  4GMJ A;  1HO8 A;  3FH8 A;  3FHE A;  2VSX E;  3DSU A;  2OVF A;  4TXP A;  4MBG A;  2OV8 A;  3PRE A;  2E0I A;  3EHR A;  4ABN A;  2VGY A;  5FQ4 A;  3B7U X;  3C72 A;  4ATZ D;  3FUI A;  3MEK A;  1S64 A;  2JLB A;  2DZN A;  4HRN A;  1OCR E;  3ULY A;  3HDX A;  4AVX A;  4XI9 A;  2OCC E;  3LDZ A;  1QBQ A;  4DX2 A;  3DEP A;  4AXH A;  5JJT A;  3L54 A;  3OTN A;  4G11 A;  5IY5 E;  3PEV B;  4L7T A;  4UI9 C;  3FUK A;  5CMW A;  4G23 A;  1LF8 A;  3G2W A;  4AY6 A;  4YDW A;  3F6Q A;  5JJ6 A;  1HH8 A;  2ZU6 B;  4BEP A;  4CCA A;  4RG9 A;  4EHM A;  2KZT A;  3DBS A;  2R17 C;  2PZI A;  4I43 A;  3T9K A;  2UY1 A;  3ZEF A;  4HB5 A;  2WXI A;  3LEW A;  3LY7 A;  2HM8 A;  2WQ7 A;  3FTY A;  5ENS D;  2KC7 A;  5AAR A;  2CFU A;  2X6K A;  3ESL A;  3BU8 A;  3R9M A;  2PM6 A;  3QJZ A;  4HOR A;  2LSV A;  4ACL A;  5ENP D;  3MKQ B;  2CHZ A;  3QWP A;  4O1P A;  3OXF A;  3SF4 A;  4O60 A;  3V79 K;  4ME2 A;  3ULE G;  3Q47 B;  2Y69 E;  2UWJ G;  5AEN A;  1V55 E;  5AN8 A;  2X6I A;  2RFM A;  1OWN A;  2XPI A;  4HRL A;  1H2U A;  2EIJ E;  5ARF A;  4G1T A;  3PZ3 A;  2WXK A;  3K9I A;  3FU3 A;  3EHQ A;  4GCN A;  5HQ8 A;  3QNK A;  1FT2 A;  1S63 A;  4YDY A;  2QC9 A;  2XEH A;  1EF1 C;  3JQ0 A;  1A5E A;  3DPD A;  3SFZ A;  3ZRH A;  3APF A;  4BER A;  4PS8 A;  4GZ3 A;  1H6P A;  3CVY A;  2YNQ A;  4H7X A;  3BEE A;  1AP7 A;  3CHM A;  3RIB A;  1TN8 A;  3D9K A;  2VGX A;  4N3A A;  2LAH A;  3ASG A;  4KZC A;  1WAO 1;  2X38 A;  2UY1 B;  3UM3 A;  4J8D A;  3CK7 A;  4JD2 G;  3SBS A;  3SD5 A;  3CVP A;  4KBQ A;  4A1G A;  3PE4 A;  2EIN E;  1YYH A;  1G3N B;  4Q96 A;  5KBA A;  3TGO A;  4U8V D;  1E8X A;  4UWG A;  1Y6I A;  1KLX A;  1UJK A;  4G25 A;  4DRX E;  1H19 A;  4BTA A;  3CVU A;  3QKY A;  2L9B A;  3LYA A;  3DEO A;  2ILR A;  3S7D A;  5B1B E;  4UI9 J;  4DX6 D;  1O1S A;  4ANW A;  2IY0 C;  2L6B A;  3V2X A;  3ONK A;  1QNF A;  4B94 A;  3MCX A;  4FJY A;  1N4P A;  4HRM B;  1O1R A;  2F8Y A;  2ZIS A;  2ZGD A;  3EJN A;  3D9H A;  3SY2 A;  3LJ3 A;  1IQR A;  3E37 A;  3PEU B;  4U0U A;  4QQI A;  2WQ6 A;  2XS8 A;  3EU9 A;  4GB9 A;  4B8C B;  4J8Y A;  2XGO A;  1NI1 A;  4EPZ A;  4AP2 A;  2NXP A;  4RVB A;  1MJ0 A;  3VLE A;  3MJW A;  4RLY A;  5FZQ A;  3AU4 A;  3U66 A;  4HOQ A;  4CGW A;  2F0Y A;  3UTM A;  1GW6 A;  4HS2 A;  3UIP C;  3QAR A;  2KCK A;  3C3R A;  4BES A;  1N0Q A;  4ANV A;  5ENR D;  1EYH A;  2LXM A;  3FTX A;  3IV0 A;  3PNL B;  4N39 A;  5AQA A;  2BF0 X;  3HHM A;  3FFL A;  1N4S A;  4J7W A;  3PH0 C;  2R5S A;  2IF4 A;  4MS6 A;  4YND A;  3D9L A;  1BI7 B;  2JAB A;  3ASH A;  4J8F A;  5FZS A;  3O48 A;  4CDM A;  1HX8 A;  2KZT B;  4LER A;  1N95 A;  2XCB A;  3UXG A;  2EQX A;  2GRP B;  1QZ2 A;  4GA0 A;  4I9E A;  3AS4 A;  2ETB A;  3ZHE A;  5ANR A;  5KJL A;  4GZD A;  4JA9 A;  1WDY A;  4HI9 A;  4GMR A;  5LP0 A;  2AW6 A;  1UOH A;  1TJC A;  3MYV A;  1RW2 A;  3I4G A;  4PH4 B;  2CG3 A;  3DPY A;  2WXN A;  3RSE G;  3FDH A;  1U3D A;  3NOG D;  4U0Z A;  3NOC D;  4DJA A;  4KVO A;  4KT6 B;  4B8A A;  4FA6 A;  4QFV A;  1N54 A;  3B7B A;  4GML A;  4Y6W A;  3EHM A;  1HE8 A;  5T8I A;  4DI4 A;  4O1O A;  3WG7 E;  4GPK A;  3JYS A;  5CBN A;  4DX1 A;  3ONL A;  4WWO A;  2R2L A;  3DSW A;  1BU9 A;  4E85 A;  4KZ0 A;  4LNG A;  4F1P A;  1B89 A;  2P9P G;  4HLL A;  4WAF A;  1HU3 A;  3AU5 A;  4LSZ E;  2XZT G;  3ZU7 B;  1SZ9 A;  4AIF A;  2CFZ A;  2DZO A;  3FTU A;  4A55 A;  2B0O E;  4YVO A;  3Q7A A;  1D8D A;  3URZ A;  1NA0 A;  5KJN A;  3R7Q A;  5BV1 A;  4EZK A;  3ZUV B;  3Q78 A;  3CIA A;  2MOW A;  4H7Y A;  4LNB A;  3T8K A;  3APD A;  4HFG A;  2P9I G;  3TL5 A;  4YDE A;  1NP7 A;  4AEZ C;  3B7T A;  2WXL A;  3KD7 A;  2J4B A;  4KYO B;  3ZYM A;  2J49 A;  3ZGQ A;  3PNT B;  4K5A B;  4JEH A;  3UUX A;  2JEK A;  3VTY A;  3QOU A;  1SW6 A;  3P1U A;  2XRY A;  1DC2 A;  5CEC B;  4BTB A;  3LVQ E;  4G24 A;  2DBA A;  2IO2 C;  3FTS A;  2XQ0 A;  4U63 A;  1L5J A;  4B0Z A;  3SFY A;  2F37 A;  5LCW C;  3JCK C;  3KEA A;  1SZA A;  3ENE A;  4JL0 A;  3CGH A;  3I5P A;  5BT1 A;  3E32 A;  1MHQ A;  1XGW A;  3KS2 A;  2WXF A;  2LNI A;  2WXJ A;  4TUM A;  3E33 A;  2P9S G;  3BUA A;  3KSL A;  4R7L A;  1HFA A;  5LX8 A;  4ACK A;  3FP3 A;  4FP7 A;  4AV7 A;  3RO2 A;  1MX6 A;  5CCL A;  1PAQ A;  4EBA G;  4HXI A;  3ZFW A;  5BV0 A;  4MRU A;  3DWL G;  3NZU A;  4U04 A;  2R05 A;  4AM9 A;  4FUL A;  2GW1 A;  4TXQ A;  5AJL A;  5FT9 A;  3CSF A;  3ZYK A;  2VGE A;  3S7F A;  4EQF A;  2FO1 E;  1X81 A;  4GTQ A;  4LUN U;  4GYW A;  5LFA A;  5E75 A;  5A23 A;  2AVP A;  3MA5 A;  4XIF A;  3RRM B;  2QFC A;  3ZNG A;  1PC2 A;  4F1S A;  3TWW A;  3Q9N C;  1IQU A;  4XEI G;  4JEU A;  3D9I A;  4TV3 A;  2HE0 A;  5A7D B;  3BG0 B;  4F7A A;  4HOS A;  3CKB A;  3RKV A;  2V4H C;  4FHK A;  2PNN A;  2P9L G;  4FLH A;  3FUD A;  5AQ7 A;  2WXO A;  1K8K G;  3VTX A;  4BFR A;  2WXQ A;  5M72 A;  1LTX A;  3AG4 E;  2CHW A;  3U3W A;  2B6C A;  1E7U A;  2BKK B;  2LSU A;  1Y8M A;  3HYM B;  2YQ8 A;  3TG5 A;  2EIM E;  1E90 A;  2XEE A;  1S70 B;  4LG6 A;  1JUQ A;  2OND A;  3Q79 A;  3CK8 A;  1EDU A;  4I1O B;  2X6H A;  3R7R A;  2IQC A;  1INZ A;  4W9R A;  2X3M A;  2ION A;  3QWV A;  2WM9 A;  4JW1 A;  3DRA A;  4IUL A;  2VQ2 A;  5FQ7 A;  1SQM A;  5ARG A;  3HRA A;  3ZIM A;  4JPS A;  2XEN A;  3CLJ A;  2AWI A;  4HQD A;  4M3O A;  4DK5 A;  2VSN A;  3UMV A;  4X8Q A;  2XCC A;  1ZU2 A;  1OCZ E;  1ELK A;  2FI7 A;  1UG3 A;  4I2W A;  2WXM A;  3MV3 B;  4NIK A;  4FLB A;  5G2N A;  4N5C A;  5LCW J;  3MKR A;  3I4R B;  3C3O A;  4CT0 A;  2H6G A;  4GTR A;  1Z3X A;  3UQ3 A;  1KZP A;  5KCM A;  4OAU C;  2WXR A;  3UIN C;  1NZN A;  1E96 B;  3UM0 A;  1JPL A;  4Z68 A;  3HXC A;  5G04 J;  1QQE A;  1DVP A;  1HS6 A;  4APO A;  3Q5M A;  4PS3 A;  3PZ2 A;  3TWV A;  1Z3Y A;  4KVM A;  3E4B A;  5J90 A;  5EYL A;  2KM4 A;  2I6H A;  3PDN A;  3HXF A;  3HXD A;  2FBN A;  1OT8 A;  4YVQ C;  4V3I A;  4DPR A;  4HLE A;  3FEY A;  3QB2 A;  2QZA A;  4HI8 A;  2NC9 A;  1D8E A;  4BX8 A;  1KT1 A;  3D9N A;  1HG2 A;  4L2Y A;  2VSY A;  1PY1 A;  4AY5 A;  5T3R A;  1JWG A;  3RO3 A;  3W9F A;  3FUM A;  4GTT A;  1EPU A;  3CK9 A;  2OOE A;  3DSX A;  1YMP A;  2LAI A;  3GYZ A;  3L08 A;  2H6H A;  3TG4 A;  4UQZ A;  4JXT A;  3OXG A;  5E76 A;  4LRZ A;  5AIJ A;  3AAA C;  2P9K G;  4GYY A;  2BUG A;  5KNH D;  5DBK A;  4CEM A;  5ENN A;  5ENO D;  3KAE A;  2X6J A;  4GZ5 A;  4K5C A;  3S7J A;  4LCT A;  4O6F A;  5EYP F;  1WY6 A;  1ZBP A;  4CRW A;  2RG8 A;  3L17 A;  3LPZ A;  1OCO E;  3E34 A;  2C0L A;  3UT4 A;  4I6E A;  4XE0 A;  3HXE A;  1FT1 A;  3CHP A;  1IKN D;  2P9U G;  2KCV A;  3X2Q E;  1TYQ G;  4L9P A;  4EZJ A;  3TWX A;  3ZVV A;  5C2Y A;  3HVE B;  5EIB E;  1O1T A;  2OEW A;  2VJ8 A;  4BT9 A;  4L23 A;  3L9T A;  3I3N A;  4BY6 A;  2Y4T A;  2YHE A;  2DCP A;  3LJN A;  3U64 A;  1DCE A;  1ELW A;  3RRN B;  1UJJ A;  1NL4 A;  3CVX A;  3B95 A;  3EUV A;  4FC8 A;  5FIN A;  3CHQ A;  3JUI A;  1SVX A;  3CR3 A;  5EIL A;  3G2U A;  4LNU D;  3FY4 A;  3B7R L;  2XRZ A;  3T5V A;  3PZ4 A;  1E8W A;  2L0T B;  2XGM A;  5CMY A;  5CED B;  3BG1 B;  2IOS A;  3JUE A;  2ZIR A;  4XKC A;  3U9W A;  3UM2 A;  4TUU A;  4WNE A;  5FQ6 A;  2NYJ A;  1N94 A;  5FJY A;  4UI9 K;  4JB8 P;  5LOZ A;  4E6H A;  4CYM D;  3EDT B;  3UI2 A;  4BSX A;  3LXU X;  3PVL A;  2GRM A;  1H0A A;  3RU0 A;  4HBD A;  3D9P A;  2J07 A;  3TWT A;  5FWQ A;  1IHG A;  1VDY A;  1OWM A;  3PZD A;  3NBN B;  2IU1 A;  3FH5 A;  5EN5 D;  5G05 J;  3C5R A;  4LEU A;  3D9J A;  1HZ4 A;  2LUH A;  1O5M A;  1ELR A;  3T5X A;  3FH7 A;  4U7E B;  3FU5 A;  3HIZ A;  2AXZ A;  1E7V A;  5BNW A;  5FZR A;  3E30 A;  2P9N G;  1A17 A;  4HVB A;  1ZB1 A;  2H6I A;  4JA7 A;  4I1M A;  4A1S A;  3TXM A;  5KJM A;  1TJF A;  1N52 A;  1K3Z D;  4XX5 A;  2GGF A;  3MX3 A;  2NSZ A;  3SBT B;  3ZXP A;  2KXP C;  4N2Q A;  1LD7 A;  2Y0B G;  4PUC A;  1MQS A;  4JVS A;  4GTS A;  4CDN A;  3LY9 A;  2HR2 A;  3KEZ A;  3LCA A;  2ETA A;  5AJD A;  4U96 D;  3L16 A;  4A3T A;  2L6J A;  5BXU A;  5B3S E;  1WM5 A;  3SO8 A;  1BLX B;  2J9Q A;  2V5Q C;  4N3C A;  5ENT D;  3FUE A;  1OXJ A;  2J8S D;  3PZ1 A;  2XS1 A;  1WG0 A;  3HXB A;  4C48 B;  2XPY A;  2WVI A;  5G04 C;  5EKQ D;  4C0M A;  4B89 A;  4RG6 A;  1LD8 A;  3G2S A;  3IEG A;  3V2O A;  4OYS A;  4Y6C A;  2F8X K;  4CGV A;  4RSY A;  3L82 A;  1OUV A;  3ZXS A;  1FVF A;  3QK0 A;  4KXK B;  3V30 A;  3PE3 A;  4C9B B;  3UKU G;  4APF A;  5CEA A;  2R59 A;  2AXU A;  3SFX A;  4UWL A;  1UW4 B;  3SNX A;  1NFI E;  2RD0 A;  3QWW A;  3Q7F A;  3CST A;  2RKK A;  3UM1 A;  5BW8 C;  3PUK A;  4WUY A;  3Q75 A;  4F53 A;  3SZ7 A;  3V31 A;  1KPS B;  3B13 A;  1SA5 A;  5CCM A;  1W3B A;  3UX4 A;  3TWR A;  3FUF A;  1TN7 A;  4CZ2 D;  3TXN A;  4WND A;  5D0Q D;  1IYG A;  5JHB A;  3AS8 A;  3CV0 A;  4FAD A;  1N4R A;  3IXE A;  4DX7 D;  1BD8 A;  1N9A A;  4U0S A;  4C0E A;  2PQN A;  4DUI A;  4GTM A;  3AG2 E;  1IXV A;  1D9S A;  5FIO A;  1YCS B;  1P5Q A;  2C0M A;  3D3M A;  3Q73 A;  3FUJ A;  4I17 A;  2VTB B;  4U95 D;  5AAO A;  5G05 C;  2H6F A;  3ML9 A;  3QAQ A;  3FU6 A;  3WXX A;  3O4Z A;  3NB2 A;  3NZS A;  4CDR A;  4RQI A;  3EIJ A;  4Q69 A;  4GAA A;  3ZYQ A;  4HOU A;  4L1B A;  1HF8 A;  3Q49 B;  2IFU A;  3UPV A;  4J0U A;  1FVH A;  5HS0 A;  4XKB A;  2Y3A A;  5CRU A;  3LY8 A;  3ESK A;  5B1A E;  5T4Y A;  1MX2 A;  1H6O A;  3VLF A;  3ABL E;  3ABM E;  5H7P A;  2GRN B;  4K03 A;  3CVL A;  4ANX A;  4I9C A;  3DST A;  2LXL A;  5AQ9 A;  2P2C P;  1KZO A;  1DCQ A;  5ITZ F;  2WXH A;  2HYZ A;  2V5F A;  2OVB A;  3ML8 A;  1TNY A;  3RK6 A;  4P29 A;  3OAW A;  2BTD A;  4GYO A;  3PS6 A;  2CG2 A;  3U4T A;  3NAW A;  1MX4 A;  4NRH B;  3P2B A;  2PM7 A;  1YA0 A;  2YHC A;  3GZS A;  3CHS A;  2ETC A;  3CHO A;  3HVE A;  3LVR E;  2HO1 A;  2A5U A;  2C2L A;  3SQV A;  2DYR E;  4URK A;  2XZD G;  2WQH A;  5HKP A;  4G8L A;  5KNG A;  4IRU A;  2R02 A;  4GTO A;  1OWP A;  1MYO A;  2P58 C;  3SI5 A;  5CBO A;  1TNO A;  2VYI A;  4N2S A;  2LO6 A;  2Y1L E;  3PUJ A;  2I2O A;  2DIW A;  2XHE A;  1K1A A;  1N4Q A;  2MYO A;  3FUL A;  3TWQ A;  4HNA D;  2V8S E;  4EZL A;  3CVW A;  2GRO B;  4BX9 A;  3FWV A;  2QYU A;  5JJ7 A;  3RRU A;  3GZ2 A;  4ATG A;  5BUZ A;  4UQX A;  4DX5 D;  4HOT A;  2EIL E;  3PRZ A;  2KBX A;  1U3C A;  3G2T A;  4N3B A;  2MRI A;  4FHJ A;  4I2Z A;  1XNF A;  1QYM A;  4I1A A;  5CER B;  2J4D A;  5G55 A;  1Z5S C;  4GCO A;  3KSQ A;  3C98 A;  2V0P A;  1TNZ A;  2ZXW E;  3AG3 E;  2BKG A;  1HXI A;  2PQR A;  1N11 A;  3T8M A;  5EDS A;  3L13 A;  2RFA A;  1N0R A;  2I1J A;  3DSS A; 
#chains in the Genus database with same CATH homology
 4UWK A;  4JEH A;  5JJ6 A;  2JEK A;  3UUX A;  4UQY A;  1HH8 A;  3CQG B;  4BSX A;  2CHX A;  3VTY A;  2ZU6 B;  3LXU X;  3QOU A;  4CCA A;  4RG9 A;  3P1U A;  3PVL A;  2KZT A;  3DBS A;  2GRM A;  1H0A A;  2XRY A;  2R17 C;  3RU0 A;  2PZI A;  3ZN3 A;  4I43 A;  2KCL A;  3ZW3 A;  3ZPJ A;  3EHN A;  4BTB A;  3D9P A;  2J07 A;  4JC8 A;  3LVQ E;  4ILG A;  4G24 A;  1BPO A;  4A3V A;  2UY1 A;  3ZEF A;  2DBA A;  5FWQ A;  2M63 A;  2WXI A;  2J08 A;  5D0O D;  3CVV A;  1IHG A;  1VDY A;  3LEW A;  2KAT A;  3LY7 A;  3FTS A;  2XQ0 A;  4U63 A;  1L5J A;  2HM8 A;  3CQC B;  3ZHE B;  3FTY A;  4B0Z A;  2KC7 A;  2WQ7 A;  2CFU A;  2X6K A;  2WXG A;  1OWM A;  3ESL A;  3PZD A;  2IU1 A;  3FH5 A;  3QC1 A;  4IYP A;  5LCW C;  3JCK C;  4D10 C;  2PM6 A;  3L6A A;  5G05 J;  1HG5 A;  4XI0 A;  4DLO A;  1SZA A;  3ENE A;  4U07 A;  3CVN A;  4LEU A;  3QJZ A;  4JL0 A;  3CGH A;  3I5P A;  5BT1 A;  4HOR A;  2LSV A;  4J8S A;  4ACL A;  3D9J A;  1HZ4 A;  3MKQ B;  2CHZ A;  4J6I A;  3QWP A;  2I9C A;  1ELR A;  1MHQ A;  3T5X A;  3FH7 A;  4F3V A;  3FU5 A;  3HIZ A;  1XGW A;  2AXZ A;  1E7V A;  3KS2 A;  3OXF A;  3SF4 A;  2WXF A;  2LNI A;  3FUN A;  4ME2 A;  2WXJ A;  3Q47 B;  5BNW A;  5FZR A;  2UWJ G;  4AOF A;  2XEV A;  5AEN A;  4NUR A;  4U8H A;  3ASF A;  4MKT A;  4R7L A;  1E8Y A;  3AS5 A;  1HFA A;  5LX8 A;  1A17 A;  2VTB A;  4HVB A;  4ACK A;  2XPZ A;  2X6I A;  4WNF A;  4EBA A;  4JA7 A;  4I1M A;  4I6J A;  1OWN A;  4A1S A;  4K0R A;  3FP3 A;  4FP7 A;  4AV7 A;  3TXM A;  2XPI A;  5KJM A;  1TJF A;  2WMN A;  1N52 A;  4IN3 B;  3FTV A;  3RO2 A;  4OVU A;  5CCL A;  1PAQ A;  4XX5 A;  2GGF A;  2WMO A;  3MX3 A;  2NSZ A;  5EX0 A;  3SBT B;  4EBA G;  1H2U A;  5ARF A;  2X6F A;  3CEQ A;  3MGB A;  4G1T A;  4N2Q A;  1X5B A;  3ULQ A;  4HXI A;  3D9M A;  3ZFW A;  2WXK A;  3K9I A;  3FU3 A;  5BV0 A;  4MRU A;  4GCN A;  5HQ8 A;  4PUC A;  3NZU A;  1MQS A;  4GA1 A;  4JVS A;  3QNK A;  4CDN A;  3LY9 A;  2HR2 A;  3KEZ A;  3LCA A;  4U04 A;  3B7S A;  5ANL A;  5AJD A;  4CT4 A;  3L16 A;  4A3T A;  4AM9 A;  2L6J A;  1DNP A;  4GZ6 A;  4FUL A;  1EF1 C;  2GW1 A;  3JQ0 A;  3N71 A;  5AJL A;  1WM5 A;  3DPD A;  5FT9 A;  3CSF A;  3ZYK A;  4BT8 A;  3SFZ A;  3ZRH A;  3APF A;  4AJW A;  3S7F A;  5J08 A;  2J9Q A;  4N3C A;  3ASD A;  4EQF A;  4PS8 A;  1H2T C;  3FUE A;  4LUN U;  4GYW A;  2A4Z A;  5LFA A;  4GZ3 A;  4Q94 A;  2XGS A;  2XPY A;  5E75 A;  5A23 A;  2AVP A;  3MA5 A;  2WVI A;  3CVY A;  5G04 C;  5EKQ D;  2PL2 A;  4C0M A;  2FEZ A;  4XIF A;  3RRM B;  2YNQ A;  4G2V A;  2QFC A;  2V4L A;  4H7X A;  3BEE A;  4RG6 A;  3TJP A;  4G26 A;  1PC2 A;  4B89 A;  3CHM A;  3RIB A;  4F1S A;  2WXP A;  1IQU A;  3D9K A;  3G2S A;  2VGX A;  3IEG A;  4N3A A;  4JEU A;  4OYS A;  2LAH A;  4TRQ A;  4Y6C A;  3ASG A;  3D9I A;  3CHR A;  3MV2 B;  4JHR A;  4TV3 A;  4KZC A;  5A7D B;  2Y4U A;  3BG0 B;  1WAO 1;  2X38 A;  3JQ1 A;  4F7A A;  1NA3 A;  2UY1 B;  3GZ1 A;  4RSY A;  3ZYL A;  4CGV A;  1OUV A;  2QY7 A;  4HOS A;  3CKB A;  3RKV A;  4J8D A;  3ZXS A;  1FVF A;  3CK7 A;  3QK0 A;  4KXK B;  4FHK A;  3SBS A;  3SD5 A;  2FF4 A;  3PE3 A;  3CVP A;  4KBQ A;  3IKO B;  4C9B B;  4APF A;  4A1G A;  3PE4 A;  5KJK A;  4FLH A;  4WWN A;  2R59 A;  3FUD A;  2AXU A;  4UWL A;  1UN9 A;  1UW4 B;  4JZY A;  3SNX A;  2RD0 A;  2WXO A;  3CKC A;  4XZ4 A;  3VTX A;  3QWW A;  4BFR A;  4Q96 A;  3FTZ A;  2WXQ A;  3TGO A;  1E8X A;  4UWF A;  2FO7 A;  5M72 A;  4UWG A;  2CHW A;  3CST A;  2VSO E;  3R9A B;  1Y6I A;  1KLX A;  1UJK A;  4G25 A;  2IOL A;  3U3W A;  1H19 A;  1E7U A;  2LSU A;  4FU3 A;  4BTA A;  1Y8M A;  3HYM B;  3CVU A;  3QKY A;  4ILH B;  2YQ8 A;  3TG5 A;  2L9B A;  2L0I A;  5BW8 C;  3S7B A;  1E90 A;  3PUK A;  4WUY A;  4F53 A;  3SZ7 A;  1JUQ A;  2OND A;  3LYA A;  5A6C A;  3CK8 A;  3EIQ C;  3B13 A;  4ILI A;  4PS7 A;  1EDU A;  5CHE E;  5CCM A;  2ILR A;  4I1O B;  3S7D A;  1W3B A;  2X6H A;  3R7R A;  2IQC A;  5JHA A;  1S0P A;  1INZ A;  4UI9 J;  4W9R A;  3UX4 A;  3FUF A;  1FCH A;  4ANW A;  3ONK A;  3OXL A;  1QNF A;  2X3M A;  3MCX A;  3MZL B;  2ION A;  3TAX A;  3TXN A;  4B94 A;  5BPP A;  4FJZ A;  3QWV A;  4FJY A;  2WM9 A;  4WND A;  5D0Q D;  2FUL A;  5JHB A;  4JW1 A;  1IYG A;  4IUL A;  3AS8 A;  3CV0 A;  4FAD A;  2VQ2 A;  5FQ7 A;  4DLQ A;  1SQM A;  3EJN A;  4JHJ A;  4JHK A;  5ARG A;  3LJ3 A;  5DIZ A;  3QDN A;  3ZIM A;  1IQR A;  3MKQ A;  4JPS A;  4U0S A;  4C0E A;  3PEU B;  2I1K A;  2PQN A;  3CLJ A;  3VLD A;  2AWI A;  4U0U A;  2WQ6 A;  4M3O A;  4DK5 A;  3IHV A;  2VSN A;  5EX3 A;  3UMV A;  1H2V C;  2XCC A;  2YIN A;  1ZU2 A;  3FTW A;  3NQP A;  4GB9 A;  4B8C B;  2XGO A;  1ELK A;  1P5Q A;  2FI7 A;  2C0M A;  3D3M A;  4NAC A;  4EPZ A;  1UG3 A;  3S2A A;  4AP2 A;  4I2W A;  2IJG X;  2NXP A;  2WXM A;  3MV3 B;  4RVB A;  3FUJ A;  4I17 A;  2VTB B;  4FLB A;  1Z6T A;  3VLE A;  5G2N A;  4N5C A;  5LCW J;  3MKR A;  2E2E A;  3I4R B;  3MJW A;  5G05 C;  5FZQ A;  3AU4 A;  4CT0 A;  3ML9 A;  3U66 A;  4HOQ A;  1JWF A;  4CGW A;  4L2L A;  3QAQ A;  3FU6 A;  1GW6 A;  1H6K A;  4WWP A;  3WXX A;  3O4Z A;  1Z3X A;  3LKU A;  3NZS A;  4NQ0 A;  3UQ3 A;  5KCM A;  4CDR A;  4HS2 A;  3EIJ A;  3SGH A;  4Q69 A;  4GZC A;  2WXR A;  4GAA A;  3GW4 A;  1OWL A;  1NZN A;  1E96 B;  2KCK A;  3QAR A;  1JPL A;  4PDX A;  3FU0 A;  3ZYQ A;  5G04 J;  1UN8 A;  2AXV A;  4HOU A;  4I6G A;  5C1D A;  1QQE A;  4L1B A;  1HF8 A;  3LS8 A;  3G2V A;  1DVP A;  3Q49 B;  2IFU A;  3Q4A B;  4BWR A;  1HS6 A;  4APO A;  4ANV A;  3Q5M A;  4DI3 A;  3UPV A;  1EYH A;  2J09 A;  2MHK A;  4J0U A;  4PS3 A;  1FVH A;  3FTX A;  3IV0 A;  4XKB A;  3FEX A;  3PNL B;  4N39 A;  1Z3Y A;  4OVV A;  2Y3A A;  3NF1 A;  5FQ8 A;  3APC A;  4KVM A;  2WB2 A;  2BF0 X;  3HHM A;  3E4B A;  3FFL A;  4WNG A;  5J90 A;  2KM4 A;  3LY8 A;  2VGX B;  2I6H A;  3PDN A;  3ESK A;  3PH0 C;  5T4Y A;  1E8Z A;  4MLP A;  1KT0 A;  2GRL A;  2R5S A;  1TEZ A;  2IF4 A;  5HI7 A;  4MS6 A;  4YND A;  3VLF A;  3D9L A;  2FBN A;  3ASH A;  4J8E A;  4J8F A;  4YVQ C;  5FZS A;  4ANU A;  3O48 A;  3L22 A;  4V3I A;  4CDM A;  4DPR A;  1HX8 A;  2KZT B;  4LER A;  4HLE A;  2XCB A;  4UWH A;  2EQX A;  4K03 A;  3FEY A;  3CVL A;  3QB2 A;  4ANX A;  4I9C A;  1QZ2 A;  4GA0 A;  4I9E A;  2Q7F A;  2NC9 A;  3AS4 A;  3UT8 A;  4BX8 A;  3ZHE A;  2WXH A;  1KT1 A;  5ANR A;  5KJL A;  3D9N A;  3CVQ A;  1HG2 A;  2HYZ A;  4GZD A;  4JA9 A;  5LP0 A;  2AW6 A;  2V5F A;  4L2Y A;  2OVB A;  3ML8 A;  2VSY A;  1PY1 A;  3RK6 A;  4AY5 A;  1TJC A;  4P29 A;  5T3R A;  3MYV A;  3OAW A;  1JWG A;  3RO3 A;  2BTD A;  4GYO A;  3PS6 A;  2CG2 A;  3FUM A;  3D9O A;  3U4T A;  4NRH B;  1EPU A;  3P2B A;  3CK9 A;  1OWO A;  2PM7 A;  1YA0 A;  2YHC A;  2OOE A;  3I4G A;  4KMO A;  4PH4 B;  2LAI A;  2CG3 A;  3FUH A;  3GYZ A;  3GZS A;  3L08 A;  3RJV A;  2WXN A;  3TG4 A;  4UQZ A;  4JXT A;  3CHS A;  3OXG A;  3FDH A;  3CHO A;  3HVE A;  3LVR E;  1U3D A;  4GU5 A;  5E76 A;  2HO1 A;  2A5U A;  2C2L A;  4LRZ A;  5AIJ A;  2WPV A;  4U0Z A;  4DJA A;  4GA2 A;  4KT6 B;  4KVO A;  4URK A;  4B8A A;  2WQH A;  3Q15 A;  3UT7 A;  4GYY A;  2BUG A;  4IRU A;  4FA6 A;  4QFV A;  5DBK A;  4CEM A;  3SHF A;  1OWP A;  5ENN A;  1N54 A;  3KAE A;  2X6J A;  4GZ5 A;  2P58 C;  3SI5 A;  4GML A;  4Y6W A;  3EHM A;  1HE8 A;  5T8I A;  3S7J A;  4LCT A;  4O6F A;  5AYW D;  4EEC A;  4DI4 A;  1WY6 A;  1ZBP A;  2VYI A;  4CRW A;  3IHY A;  2RG8 A;  4GPK A;  3L17 A;  3JYS A;  5FTP A;  4N2S A;  2LO6 A;  3IBE A;  3PUJ A;  3LPZ A;  4GMJ A;  3ONL A;  2C0L A;  1HO8 A;  2DIW A;  2I2O A;  3FH8 A;  4WWO A;  3UT4 A;  4I6E A;  4XE0 A;  3FHE A;  2VSX E;  2XHE A;  3CHP A;  3FUL A;  2KCV A;  4E85 A;  4KZ0 A;  2OVF A;  4EZJ A;  3ZVV A;  2V8S E;  4EZL A;  5C2Y A;  3HVE B;  3CVW A;  1B89 A;  4BX9 A;  2VJ8 A;  3FWV A;  2OV8 A;  4WAF A;  1HU3 A;  3PRE A;  5JJ7 A;  3RRU A;  2E0I A;  3GZ2 A;  4ATG A;  5BUZ A;  4BT9 A;  3AU5 A;  4UQX A;  4L23 A;  4ABN A;  3I3N A;  2VGY A;  4BY6 A;  5FQ4 A;  2Y4T A;  2YHE A;  4HOT A;  1SZ9 A;  3PRZ A;  4AIF A;  2DCP A;  2CFZ A;  3B7U X;  3FTU A;  3U64 A;  1U3C A;  4A55 A;  1ELW A;  3G2T A;  3FUI A;  3RRN B;  1UJJ A;  3MEK A;  4YVO A;  4N3B A;  3CVX A;  2MRI A;  4FHJ A;  4I2Z A;  1XNF A;  2JLB A;  3URZ A;  4I1A A;  4FC8 A;  1NA0 A;  3CHQ A;  3JUI A;  5KJN A;  3CR3 A;  3R7Q A;  2J4D A;  3G2U A;  5G55 A;  3FY4 A;  3B7R L;  5BV1 A;  2XRZ A;  3T5V A;  4GCO A;  4EZK A;  3CIA A;  3C98 A;  2MOW A;  4H7Y A;  3HDX A;  1E8W A;  2V0P A;  4AVX A;  3APD A;  2L0T B;  2XGM A;  4XI9 A;  4HFG A;  5CMY A;  3LDZ A;  3TL5 A;  3BG1 B;  1HXI A;  2PQR A;  1NP7 A;  2IOS A;  4AEZ C;  3B7T A;  3T8M A;  4AXH A;  2WXL A;  5JJT A;  3L54 A;  3KD7 A;  3OTN A;  4G11 A;  3L13 A;  4XKC A;  5EDS A;  2J4B A;  3PEV B;  4KYO B;  3U9W A;  4L7T A;  4UI9 C;  3ZYM A;  3FUK A;  4TUU A;  4WNE A;  5CMW A;  5FQ6 A;  2J49 A;  4G23 A;  1LF8 A;  5FJY A;  2I1J A;  4UI9 K;  3G2W A;  3ZGQ A;  3PNT B;  5LOZ A;  4E6H A;  4AY6 A;  3EDT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...