2QY7A

Crystal structure of human epsinr enth domain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
136
structure length
136
Chain Sequence
NYSEIESKVREATNDDPWGPSGQLMGEIAKATFMYEQFPELMNMLWSRMLKDNKKNWRRVYKSLLLLAYLIRNGSERVVTSAREHIYDLRSLENYHFVDEHGKDQGINIRQKVKELVEFAQDDDRLREERKKAKKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Clathrin interactor 1
publication title A SNARE-adaptor interaction is a new mode of cargo recognition in clathrin-coated vesicles.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 136
sequence length 136
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2qy7A00
2QY7A 4GZDA 3CLJA 5J08A 2DCPA 1UJJA 4FU3A 3D9IA 1EDUA 3D9JA 1JWGA 1HFAA 1X5BA 3G2VA 3ONKA 3ONLA 1EYHA 3G2TA 3ZYKA 1PY1A 1SZAA 5CMYA 4AVXA 1HG2A 5LOZA 4GZCA 4Q96A 1LF8A 1JUQA 3D9KA 1MHQA 5CMWA 1HF8A 1VDYA 1DVPA 3G2UA 3D9PA 4JXTA 1INZA 3ZYMA 1ELKA 2LO6A 3D9LA 2MOWA 2BF0X 1H0AA 1XGWA 3D9NA 1UJKA 3ZYQA 1HG5A 2V8SE 2L0TB 3RRUA 4Q94A 1JPLA 2L0IA 4FLBA 3D9MA 3D9OA 2KM4A 1JWFA 1SZ9A 3G2WA 2DIWA 3G2SA 3LDZA 3ZYLA 4HFGA 5LP0A 4NACA 1HX8A
chains in the Genus database with same CATH superfamily
4U7EB 2C0LA 5AAOA 1U2VG 3Q9NC 1BPOA 1TYQG 3TGOA 1K1AA 4UI9C 3APFA 4JL0A 1D8DA 3Q7AA 2J08A 1UG3A 3EHNA 4PH4B 1HZ4A 3GZ2A 3OXGA 4FULA 4I9CA 3DBSA 3PZDA 3ZW3A 3Q5MA 1ZBPA 2WXQA 3W9GA 3ZRHA 2V5FA 5JMND 2PQRA 3SI5A 5HI7A 4J0UA 3U66A 1TNZA 2OEVA 1SVXA 1N4RA 4GTTA 3RIBA 4APOA 2YQ8A 3FDHA 5IY5E 2DVWA 4FJZA 1E90A 3ZPJA 5B1BE 5KCMA 5AARA 4N3CA 5CRUA 3DXMG 2YHCA 4B89A 5LX8A 2XZDG 4L2YA 3W9FA 4X8QA 4NRHB 1MX2A 4F1PA 5J08A 3IHYA 4XI9A 4FC8A 3UM1A 1JCSA 1ELRA 5AENA 3SGHA 4C48B 5BV0A 3CQCB 3L6AA 4KVOA 3ULEG 2LSUA 3O48A 3QKYA 2J09A 4NACA 3C3QA 4GA2A 2CFZA 4GB9A 3T5XA 2B0OE 4B94A 3UUXA 3LXUX 3MGBA 3CR3A 4U0SA 2KZTB 3UIOC 4I6GA 2PZIA 5JA4D 3ZYMA 2ZGGA 4ZFHA 1G3NB 2XPIA 4BERA 3AS4A 2XHEA 5JJ6A 4M7CA 2GRNB 3C98A 3KSLA 3FWVA 2AJAA 3IXEA 2DBAA 2IEJA 2IFUA 5T3RA 1ELKA 2FO1E 3JQ1A 1QNFA 3V30A 3ML8A 4RQIA 3U4TA 1H6KA 4U8YD 3KEZA 1UOHA 3IEGA 2WQ6A 3D9HA 5T8IA 3QB2A 3Q47B 3S7FA 3J5QB 3MV3B 1E8YA 3SNXA 2LSVA 3JUIA 4C0MA 4O1OA 3CSFA 1K1BA 3JCKC 4I17A 3FULA 3NBNB 3QC1A 2PQNA 4BFRA 3MJWA 3CVWA 2QC9A 2IOLA 5HS0A 3EDTB 3UINC 4EZKA 4O1PA 2R5SA 2WXLA 5CRVA 5BNWA 1FCHA 3BU8A 5AIJA 3ABKE 3SO8A 4PS3A 3NZUA 1O5MA 4GYOA 1EF1C 1Z5SC 4AOFA 4GA1A 4ILIA 2CG2A 4N39A 3CHPA 3PE3A 5AQ7A 4JZYA 3RO2A 4Y6WA 1OCCE 3CVXA 5ENQD 4I2ZA 4XKBA 3ML9A 4C9BB 2FO7A 3NAWA 3Q7FA 3J5PA 5LCWC 2P9IG 2HM8A 3CV0A 4K03A 2DZNA 4OYSA 4G11A 1TR4A 2P9UG 5BXUA 3MZLB 3SFYA 2F8YA 5FT9A 2VJ8A 5KJKA 1X5BA 4GPKA 3GW4A 1HO8A 2EIKE 4GAAA 5DBKA 1MHQA 3CHQA 2HYZA 4JHJA 4G2VA 3UT8A 2XENA 3RAUA 3WXXA 5A7DB 1KZPA 3UM3A 2WXIA 1NA3A 3FTZA 2ZU6B 2A4ZA 2E0IA 4G23A 5G05J 5KNGA 4WWOA 4IULA 2LXLA 4BEPA 1LD8A 4CRWA 2AW6A 2XZTG 5KJLA 1JPLA 4FLBA 4ACKA 4LNBA 2I6HA 3CVQA 1MQSA 4GZDA 2P9LG 4OAUC 3HVEB 3JQ0A 3TWXA 3B7UX 4C0EA 3UXGA 3URZA 1KLXA 3AG3E 1FPPA 3FUFA 3PE4A 1HG5A 2L0TB 1UN9A 4U07A 4K5BA 3CLJA 3LJ3A 4NURA 3EHQA 4UUCA 3E30A 2DWZA 1WY6A 2QFCA 5AYWD 4K5CA 4UWGA 3PUJA 1JCQA 4FP7A 5EIDA 3BUAA 3SHFA 4F7AA 5J90A 2JLBA 3AG4E 3UKUG 3SY2A 1P5QA 2VYIA 4I6JA 3ASDA 3FEYA 4GZ5A 3LVQE 3AJIA 2V0PA 4P29A 5G55A 5CCMA 4YDWA 3PNLB 2DIWA 4GPMA 2UY1A 3ESLA 4DI3A 3FUIA 4F6RD 4CDNA 1EDUA 3U3WA 2X6IA 4U96D 1FVFA 2EILE 2IJGX 3BEEA 5ENTD 1IQRA 2XRYA 2WXKA 1RW2A 4A63B 4I1MA 4TUMA 4HLEA 3OXLA 4BWRA 2AXZA 1TN6A 2VSXE 1YYHA 4MS6A 2MHKA 4HRMB 4YDEA 3SBTB 5KWDA 5CCLA 4ME2A 1N4QA 3FUDA 1UJKA 4HVBA 2Y0BG 3FU6A 3CKCA 1N52A 5G04C 5ANLA 3L9TA 1O1TA 2DCPA 4GU5A 2VSNA 4O60A 4UQYA 2RFMA 2IY0C 2V4LA 1SA4A 2AVPA 3P2BA 3LY8A 1DNPA 1QBQA 4CDMA 4AY5A 1TN7A 5KBAA 4ATGA 2VQ2A 4HOQA 4L23A 3FUMA 4FU3A 1E96B 2H6GA 3QWWA 2RD0A 3DPDA 5JHAA 2E2EA 2VTBB 1FT1A 3T9KA 4ANVA 2KC7A 3ASNE 3RSEG 3PREA 4ACLA 4FHKA 2AXVA 5FZSA 5CERB 2GRRB 1OWNA 3F6QA 4OVVA 5D66A 3FUJA 4LEUA 4XIFA 1S63A 4YVQC 1HG2A 3TXMA 3CHRA 3GZSA 2XGMA 2C2LA 1W3BA 5HKPA 2KCKA 3AS8A 2DYRE 3PZ4A 5D2MC 3VTYA 2IONA 4CEMA 4BTAA 4TV3A 3OAWA 4H7YA 3UIPC 4U04A 5CECB 4AIFA 3PEVB 2GROB 4WWPA 3PS6A 3NF1A 5FZRA 2RG8A 4N2QA 3Q9UC 3B95A 3ZVVA 5CEAA 4XZ4A 5B1AE 4J8EA 5EX3A 2NC9A 3I3NA 4JEUA 4LERA 3HG0D 1BLXB 2L6JA 1N94A 2R17C 4DJAA 2J07A 1H6OA 1LD7A 3AU4A 3MKQA 1MX6A 4TUUA 4F1SA 1Z6TA 3PZ1A 4HOUA 5CMWA 4DX6D 3DXKG 5EILA 3EIJA 4DLQA 3DRAA 4UWHA 4APFA 3HIZA 1SQMA 2R05A 3PZ3A 4AJWA 3FHEA 1N0QA 4U0UA 2FBNA 3TXNA 4JW1A 3L17A 1BD8A 4GZ3A 3AS5A 2WB2A 5KNHD 2ONDA 5DIZA 4ILGA 4EZJA 3S7BA 2MOWA 3AU5A 3I5PA 4CZ2D 4AY6A 5LCWJ 4A3TA 3FH7A 3PZ2A 2FEZA 3L16A 4L1BA 4UQXA 3ASGA 3VLEA 3D9LA 5FIOA 2RKKA 3D9MA 2MRIA 2IF4A 1UN8A 4WWNA 3NOCD 4XE0A 1Q2ZA 3AG1E 4AV7A 4AM9A 5CEDB 2ZISA 3B7BA 3LCAA 3CGHA 2JEKA 2V8SE 1YA0A 3HXDA 5H7PA 4BY6A 3LS8A 3IHVA 1TJCA 3FUHA 5D0OD 3R7RA 3CK7A 3Q79A 2P58C 3UI2A 3EU5A 3U9WA 4AXHA 1Y8MA 4LNUD 1A17A 3QARA 1IHGA 4FLHA 3CKBA 1XNFA 2L0IA 2H6HA 1TNYA 4GYWA 2WXHA 4JA9A 1UW4B 3MYVA 1WM5A 4B8AA 4DX2A 2ILRA 3JXJA 3S7JA 1IYGA 2XPZA 3QNKA 4EQFA 1H2TC 4B8CB 5A23A 4BSXA 3PRZA 3T8MA 3DWLG 1LTXA 2IOSA 2XQ0A 4AEZC 2X6HA 2GRMA 3EHRA 5E75A 1U3CA 3PH0C 2WXFA 2B6CA 4HLLA 2ZGDA 2WXGA 4QQIA 1N4PA 2A5EA 2X6KA 3QAQA 2KZTA 4ANUA 2VGYA 3LY9A 4N5QA 5CBOA 2X6JA 2DYSE 2KBXA 1NA0A 3FH5A 1E7VA 2I1JA 1WAO1 4I1AA 4URKA 2LXMA 3CVYA 4PUCA 3D9OA 3E37A 3ZYLA 2IO2C 3FTYA 1RZ4A 4WNEA 3TG4A 4LSZE 4GTSA 1N9AA 5EKQD 1NZNA 4R7LA 1ZU2A 3ONKA 1Z3XA 3QWVA 5CMYA 4M3OA 2J9QA 2VGXB 3HXBA 3QDNA 3ABLE 3CVVA 2WXOA 5G2NA 4YVOA 3GZ1A 2J4BA 3D9IA 5G04J 5AQAA 1HXIA 3E33A 2PL2A 4DX5D 1MYOA 4HRLA 1ELWA 2PM6A 4U0ZA 3HXFA 1N4SA 4HFGA 2FULA 3D3MA 1QZ2A 2NSZA 2ETCA 2WVIA 2Y69E 3OXFA 3CVUA 4XKCA 1V54E 3KS2A 3IV0A 5ENRD 4I9EA 3UM0A 4A3VA 3FU3A 4CYMD 5FWQA 2HE0A 4YDYA 3WG7E 5FQ7A 3UKRG 4KZCA 4TXRA 2NXPA 2CHWA 5EIBE 3V31A 2BF0X 4HI8A 3FTXA 1DCQA 4ATZD 2XPYA 2WQHA 2LNIA 3HXCA 4JC8A 4U8HA 3RRNB 3TWQA 3BG0B 4WNGA 4UWKA 2L9BA 3HDXA 2VGXA 4IRUA 4AVXA 3D9KA 5C1DA 3RJVA 4U63A 4K0RA 5HRYA 4JPSA 4DX1A 3S2AA 2X38A 2P2CP 3Q78A 4UI9J 2H6FA 3ZHEB 4HRNA 1HH8A 1D9SA 3RK6A 3ASOE 1N0RA 4FJYA 4W9RA 1JCRA 5ARGA 4RG6A 3EIQC 3Q49B 4DLOA 4BT8A 1OWMA 4TXQA 1S0PA 1BI8B 1UJJA 4GTVA 4Y6CA 2KATA 1BU9A 3ZN3A 2YNQA 5LFAA 5JJTA 1MJ0A 5BW8C 2LAIA 3L13A 4GZCA 5BPPA 2V4HC 3FTVA 3E4BA 3HVEA 4NIKA 4EBAA 3APDA 3MA5A 5ENSD 3G2VA 4RVBA 4GYYA 1HE8A 1PY1A 3UT4A 5ENPD 1WG0A 1YCSB 5HQ8A 1ZB1A 3V79K 4RG9A 3FFLA 1AP7A 2BKGA 5CHEE 4DPRA 2VSOE 1X81A 3SF4A 4HOSA 5ITZF 2P9SG 4Z68A 5T4YA 4CT4A 3IKOB 3QK0A 3G2TA 2NYJA 4WAFA 3B7RL 1SW6A 3L22A 3ABME 3CVLA 3L54A 3UQ3A 5ENNA 2BTDA 3R9AB 3TWUA 4WNFA 3T8KA 1HU3A 5FINA 2ZXWE 1L5JA 2WXRA 4GZ6A 1MZCA 3HXEA 5FQ6A 5AJDA 4E85A 3DSTA 2WQ7A 3E32A 4MKTA 4GMJA 3Q73A 4J6IA 4FA6A 2GRLA 3ZXSA 4HS2A 3C3OA 4JD2G 2AXUA 4EHMA 3DEPA 2XCCA 4L9PA 5EN5D 4PDXA 3B7SA 5JHBA 1VDYA 4XX5A 1IQUA 4U95D 4A55A 2OEWA 3NZSA 4MLPA 3BG1B 2CG3A 4BSZB 3D9JA 4L7TA 4B0ZA 2R03A 3MCXA 1OWOA 4CCAA 4Q69A 1INZA 2X3MA 3SFXA 3CQGB 2LAHA 2KM4A 3U64A 5LP0A 3LPZA 1D8EA 5EYPF 5FJYA 1K8KG 3TWRA 4GCNA 4ZHBA 4BETA 3LEWA 3UTMA 1NL4A 2YHEA 2OCCE 2OVBA 1S64A 3TWVA 1EPUA 3AG2E 3CIAA 4GCOA 3TWWA 3PNTB 1QQEA 3DPYA 2OOEA 4G24A 3UT7A 3VLFA 2VTBA 1NFIE 3ZEFA 2FI7A 1B89A 3CEQA 3DSVA 5EDSA 3PDNA 3D9PA 2BKKB 2C0MA 2CHXA 4J8FA 3DSXA 4LRZA 2F8XK 1H2UA 4E6HA 3FEXA 2EINE 2ZIRA 3ASHA 3C72A 3ULYA 2L6BA 4BT9A 3RKVA 3MX3A 2CHZA 2LO6A 1S70B 5CBNA 4GTMA 3C5RA 5FQ8A 4EPZA 3G2SA 3AAAC 3MKRA 3Q15A 3LYAA 4LNGA 1SA5A 3PVLA 5ANRA 4HOTA 4JA7A 4HXIA 5BXOA 3CK9A 4J8DA 3GYZA 2BEDA 3TWTA 2QYJA 4IN3B 1PAQA 3SZ7A 4JHRA 2Y4TA 1N95A 1TNUA 5KJMA 5BT1A 2XRZA 2KCVA 3FTSA 2EQXA 4OAVB 2CFUA 2J49A 3EJNA 1DVPA 3G2UA 4WNDA 4DUIA 1DCEA 1TJFA 1QYMA 1OY3D 3FTUA 1OCRE 1YMPA 1O1SA 3DSUA 1IXVA 4ANWA 4G8LA 2M63A 2Q7FA 2F0YA 4EZLA 1H0AA 2WXNA 3DSWA 3SFZA 1E8WA 3P1UA 4DI4A 1H19A 4A1SA 4XI0A 3ZGQA 4JVSA 1KT0A 3VLDA 5FTPA 4GTOA 2JABA 3FU5A 2VSYA 2H6IA 3UM2A 3ESKA 3HRAA 4MBGA 3FH8A 2IQCA 3RRUA 3DSSA 1HS6A 4GA0A 3TJPA 4KT6B 2FF4A 2LUHA 1BI7B 4FHJA 1HFAA 4EECA 1OT8A 4UWFA 4UI9K 3ZUVB 1TNOA 2ETBA 3TWSA 2HR2A 3LJNA 4QFVA 2GRQB 2XS8A 2PNNA 2WPVA 1H2VC 4OVUA 2DZOA 3IBEA 4KZ0A 4CGVA 1E7UA 1MX4A 2PM7A 1V55E 2XGOA 1N11A 4WUYA 3NOGD 4IYPA 4LCTA 1DC2A 2WXMA 4G25A 3JXIA 3FUKA 3ZIMA 4HB5A 4DRXE 1TN8A 2GRPB 3R9MA 5FQ4A 3ASFA 5M72A 2EIJE 2R59A 2V5QC 1Z3YA 3CSTA 3PEUB 2A5UA 2UWJG 1E8ZA 2P9NG 5C2YA 4CT0A 4BESA 4TXPA 4HBDA 3ZYKA 3DEOA 1WDYA 1NP7A 2X6FA 3UX4A 3T5VA 3E34A 4HQDA 2WXPA 4HI9A 1OUVA 4I43A 1OWLA 4JB8P 4J8YA 2QY7A 3TL5A 4N3AA 4B93B 4PS8A 2OVFA 3SBSA 4G1TA 3SQVA 3KSQA 3X2QE 4O6FA 3CVPA 3KEAA 4BX8A 3BQOA 1K3ZD 4MRUA 2XGSA 3JUEA 3CHMA 2XEEA 4YNDA 3MEKA 3APCA 4UQZA 4CGWA 3FTWA 3R7QA 3EHMA 3EUVA 3ZNGA 3ISMC 2GW1A 2XS1A 1OCOE 4I6EA 5LOZA 1Y6IA 2J8SD 3RU0A 4ANXA 3B13A 4F3VA 3C3RA 4KXKB 4FADA 2XCBA 5EX0A 3I4GA 3SD5A 3CVNA 4GTQA 4N3BA 3Q4AB 1O1RA 2UY1B 3TAXA 3L08A 4KVMA 1H6PA 4L2LA 1PC2A 4XEIG 3JYSA 4KBQA 4DK5A 1KT1A 2Y3AA 4EBAG 2VGEA 5BV1A 4N5CA 4TRQA 2WM9A 3ZFWA 3ENEA 3OTNA 4GMRA 5D0QD 2EIME 2XEHA 2KCLA 3FY4A 2BUGA 4CDRA 3ONLA 5FZQA 3TG5A 5AJLA 4Q96A 4J8SA 2F37A 3LVRE 3CHSA 1FVHA 4RSYA 5ENOD 1IHBA 3I4RB 2I2OA 4KMOA 1OXJA 3G2WA 2XEVA 3PUKA 2HO1A 4DX7D 1A5EA 4N2SA 3B7TA 4PS7A 4K5AB 5ARFA 1SZAA 3KD7A 3FU0A 1GW6A 1JWFA 4GMLA 4H7XA 2Y1LE 4UWLA 2P9PG 3UMVA 2WXJA 5B3SE 3VTXA 2I9CA 3ULQA 1HF8A 1N54A 4J7WA 1KPSB 4F53A 1KZOA 2Y4UA 2KXPC 4AP2A 3KAEA 3CK8A 3NQPA 2OV8A 3FUNA 3FUEA 3HHMA 2I1KA 3MV2B 1OWPA 2YINA 3L82A 1E8XA 4G26A 5BUZA 3K9IA 3ZKJA 3RO3A 3QJZA 1XGWA 4JEHA 2WMOA 2ETAA 5AQBA 2P9KG 3ZU7B 2QYUA 1U3DA 3V2OA 5EYLA 3QWPA 1JUQA 4JHKA 4HORA 5A6CA 4LUNU 3UPVA 2RFAA 1TNBA 3ZHEA 4G8KA 3LDZA 2IO3C 2R2LA 4HNAD 5AQ9A 4A1GA 2IU1A 3LKUA 1NI1A 3LY7A 4V3IA 1OCZE 4I1OB 3N71A 4JXTA 4YDOA 3ZYQA 3NB2A 5JJ7A 5G05C 2AWIA 3S7DA 2WMNA 2J4DA 1TEZA 4ILHB 3QOUA 2R02A 1LF8A 3MKQB 4U8VD 5KJNA 3CHOA 4KYOB 3O4ZA 4BTBA 1HX8A 1AWCB 4GTPA 1JWGA 4GTRA 1EYHA 3ZXPA 5AN8A 1FT2A 4LG6A 4BX9A 2GGFA 4D10C 1IKND 2MYOA 3EU9A 3V2XA 3D9NA 5E76A 3FP3A 4ABNA 4Q94A 3HYMB 3RRMB 2QZAA 3Q75A 4I2WA 4NQ0A 1SZ9A 4RLYA
chains in the Genus database with same CATH topology
3FUIA 2C0LA 4CDNA 3D9IA 1EDUA 3U3WA 4ANWA 2X6IA 5G04J 1FVFA 1HXIA 1BPOA 2IJGX 3BEEA 1IQRA 2M63A 2XRYA 3TGOA 2PL2A 4UI9C 3APFA 2WXKA 2Q7FA 4JL0A 4EZLA 1H0AA 1ELWA 2WXNA 2PM6A 4I1MA 4U0ZA 2J08A 3SFZA 1E8WA 4HLEA 3OXLA 1UG3A 4BWRA 2AXZA 3P1UA 2VSXE 4DI4A 4HFGA 3EHNA 2FULA 3D3MA 1H19A 4A1SA 4MS6A 4PH4B 1HZ4A 2MHKA 4XI0A 3GZ2A 3ZGQA 1QZ2A 2NSZA 4JVSA 3OXGA 2WVIA 4FULA 3SBTB 1KT0A 3VLDA 4I9CA 3DBSA 3PZDA 5CCLA 5FTPA 3ZW3A 3FU5A 3Q5MA 2VSYA 3OXFA 3ESKA 4ME2A 3CVUA 3FUDA 3FH8A 1UJKA 1ZBPA 2IQCA 3KS2A 4XKCA 3RRUA 4HVBA 3IV0A 2WXQA 3FU6A 1HS6A 3CKCA 1N52A 5G04C 4I9EA 4GA0A 4A3VA 3ZRHA 5ANLA 2V5FA 3FU3A 3TJPA 4KT6B 2FF4A 5FWQA 2DCPA 2PQRA 4GU5A 3SI5A 4FHJA 1HFAA 4EECA 5HI7A 4J0UA 3U66A 4UWFA 4UI9K 5FQ7A 2VSNA 2HR2A 4KZCA 2NXPA 2CHWA 4QFVA 4UQYA 3RIBA 4APOA 2V4LA 2WPVA 1H2VC 4OVUA 2BF0X 2YQ8A 2AVPA 3IBEA 3FDHA 3P2BA 4KZ0A 4CGVA 1E7UA 2PM7A 1DNPA 3FTXA 3LY8A 2XGOA 2WQHA 2LNIA 2XPYA 4JC8A 4U8HA 3RRNB 4CDMA 4AY5A 3BG0B 4ATGA 4WUYA 2VQ2A 4HOQA 4L23A 4FJZA 1E90A 4WNGA 3ZPJA 5KCMA 4UWKA 3FUMA 2L9BA 4FU3A 1E96B 3HDXA 4IYPA 2VGXA 3QWWA 2WXMA 4LCTA 4G25A 4N3CA 2RD0A 3DPDA 3FUKA 4IRUA 4AVXA 5JHAA 2E2EA 3ZIMA 3D9KA 2YHCA 5C1DA 4B89A 3RJVA 4U63A 5LX8A 2VTBB 4K0RA 4ANVA 2KC7A 4L2YA 3PREA 4ACLA 4FHKA 4JPSA 3ASFA 5FQ4A 3S2AA 2X38A 5M72A 2AXVA 2R59A 1Z3YA 3CSTA 3PEUB 4NRHB 5FZSA 2A5UA 1OWNA 4UI9J 5J08A 4OVVA 2UWJG 1E8ZA 3FUJA 3ZHEB 4LEUA 5C2YA 4XIFA 4CT0A 1HH8A 3RK6A 4YVQC 3IHYA 4XI9A 4FC8A 3ZYKA 4FJYA 4W9RA 1HG2A 5ARGA 3TXMA 3CHRA 3GZSA 1NP7A 2XGMA 2C2LA 1ELRA 1W3BA 5AENA 2X6FA 3SGHA 5BV0A 4RG6A 3EIQC 3CQCB 3Q49B 3L6AA 3UX4A 4DLOA 3T5VA 2KCKA 3AS8A 4KVOA 4BT8A 2LSUA 2WXPA 1OUVA 1OWMA 3O48A 3VTYA 2IONA 3QKYA 4I43A 2J09A 1S0PA 4NACA 1OWLA 4GA2A 2QY7A 3TL5A 4N3AA 2CFZA 4GB9A 4CEMA 4BTAA 1UJJA 2OVFA 4PS8A 4TV3A 4Y6CA 3SBSA 2KATA 4G1TA 3T5XA 4B94A 3OAWA 4H7YA 3ZN3A 2YNQA 5LFAA 5JJTA 4U04A 3UUXA 5BW8C 3LXUX 4AIFA 3MGBA 2LAIA 3PEVB 3CR3A 3L13A 4GZCA 4O6FA 2KZTB 4U0SA 4I6GA 3CVPA 2PZIA 4BX8A 4WWPA 3ZYMA 5BPPA 3PS6A 3NF1A 4MRUA 5FZRA 2XGSA 3CHMA 2RG8A 3FTVA 3E4BA 4N2QA 3HVEA 4EBAA 2XPIA 4YNDA 3MEKA 3AS4A 3APDA 3APCA 3MA5A 4UQZA 4CGWA 3FTWA 2XHEA 5JJ6A 3ZVVA 3R7QA 3EHMA 4XZ4A 4J8EA 3C98A 3G2VA 4RVBA 4GYYA 1HE8A 2GW1A 1PY1A 3FWVA 4I6EA 3UT4A 5EX3A 5LOZA 2NC9A 1Y6IA 2DBAA 3I3NA 4JEUA 4LERA 3RU0A 4ANXA 5HQ8A 2IFUA 5T3RA 1ELKA 4RG9A 3FFLA 3B13A 4F3VA 2L6JA 3JQ1A 1QNFA 4KXKB 4FADA 5CHEE 2XCBA 4DPRA 3ML8A 2R17C 2VSOE 5EX0A 3I4GA 3SF4A 4DJAA 4HOSA 3SD5A 3U4TA 1H6KA 2J07A 3KEZA 3CVNA 3IEGA 4N3BA 2WQ6A 3AU4A 5T4YA 4CT4A 3IKOB 3MKQA 3Q4AB 2UY1B 3QK0A 3L08A 5T8IA 3QB2A 3Q47B 3TAXA 3G2TA 3S7FA 4KVMA 4TUUA 4WAFA 1Z6TA 4F1SA 4L2LA 1PC2A 3B7RL 3MV3B 3JYSA 4HOUA 4KBQA 3L22A 5CMWA 1E8YA 3CVLA 3SNXA 4DK5A 2LSVA 1KT1A 3L54A 3UQ3A 2Y3AA 5ENNA 3JUIA 3EIJA 4C0MA 4DLQA 4EBAG 4UWHA 4N5CA 2BTDA 4APFA 5BV1A 3HIZA 3R9AB 1SQMA 4TRQA 2WM9A 3CSFA 3ZFWA 4WNFA 3ENEA 3OTNA 3JCKC 4I17A 1HU3A 4AJWA 5D0QD 3FULA 3FHEA 3QC1A 2PQNA 2KCLA 2FBNA 4U0UA 3TXNA 3FY4A 4BFRA 4JW1A 2BUGA 3L17A 4CDRA 4GZ3A 1L5JA 3ONLA 5FZQA 3MJWA 3AS5A 2WB2A 3CVWA 3TG5A 5AJLA 2ONDA 2IOLA 4Q96A 4J8SA 2WXRA 5DIZA 3EDTB 4GZ6A 4ILGA 4EZKA 3LVRE 4EZJA 2R5SA 3CHSA 3S7BA 2MOWA 1FVHA 2WXLA 3AU5A 5FQ6A 5AJDA 4E85A 4RSYA 3I4RB 2WQ7A 5BNWA 4MKTA 3I5PA 1FCHA 2I2OA 5AIJA 4KMOA 3G2WA 4GMJA 4AY6A 5LCWJ 4J6IA 2XEVA 3PUKA 2HO1A 4PS3A 3NZUA 4FA6A 2GRLA 3ZXSA 4HS2A 2AXUA 4GYOA 4A3TA 4N2SA 3B7TA 3FH7A 1EF1C 2XCCA 4AOFA 4PS7A 2FEZA 3L16A 3B7SA 4GA1A 4PDXA 1SZAA 5ARFA 5JHBA 4ILIA 2CG2A 4L1BA 4N39A 1VDYA 4UQXA 4XX5A 3ASGA 1IQUA 3VLEA 3CHPA 3D9LA 3PE3A 4A55A 3KD7A 4JZYA 3FU0A 1GW6A 3D9MA 3RO2A 2MRIA 3NZSA 4MLPA 1JWFA 2CG3A 3BG1B 4Y6WA 2IF4A 3CVXA 4GMLA 4I2ZA 4H7XA 1UN8A 4UWLA 4XKBA 4WWNA 3UMVA 4XE0A 3D9JA 2WXJA 3ML9A 4C9BB 3VTXA 4AV7A 4AM9A 4L7TA 4B0ZA 2FO7A 3MCXA 1OWOA 4CCAA 2I9CA 5LCWC 3ULQA 1HF8A 1N54A 3LCAA 4Q69A 2HM8A 3CGHA 2X3MA 2JEKA 3CV0A 4K03A 1INZA 4F53A 4OYSA 2V8SE 2Y4UA 1YA0A 4G11A 3CQGB 2LAHA 4BY6A 2KM4A 3LS8A 4AP2A 3KAEA 3U64A 5LP0A 3CK8A 3IHVA 3LPZA 3NQPA 1TJCA 3FUHA 3MZLB 5FJYA 5D0OD 5FT9A 2VJ8A 3R7RA 2OV8A 3FUNA 3FUEA 5KJKA 3CK7A 4GCNA 1X5BA 2P58C 3HHMA 2I1KA 3MV2B 1OWPA 4GPKA 3GW4A 1HO8A 2YINA 4GAAA 3U9WA 4AXHA 5DBKA 1Y8MA 3LEWA 1E8XA 1A17A 3QARA 1MHQA 1IHGA 2HYZA 3CHQA 3CKBA 3K9IA 4FLHA 4G26A 4JHJA 2YHEA 5BUZA 4G2VA 3RO3A 3UT8A 2OVBA 1XGWA 3QJZA 4JEHA 3WXXA 2WMOA 5A7DB 1XNFA 2L0IA 1EPUA 3CIAA 2WXIA 4GYWA 1NA3A 4GCOA 2WXHA 3FTZA 4JA9A 3PNTB 1QQEA 2ZU6B 2A4ZA 2OOEA 1UW4B 3MYVA 4G24A 1WM5A 2E0IA 4G23A 3UT7A 5G05J 3VLFA 4B8AA 2ILRA 2VTBA 1U3DA 3ZEFA 2FI7A 3S7JA 1B89A 1IYGA 3CEQA 4WWOA 2XPZA 3QWPA 4IULA 1JUQA 4JHKA 5EDSA 3PDNA 4HORA 3QNKA 4CRWA 5A6CA 3D9PA 4EQFA 2AW6A 1H2TC 4LUNU 4B8CB 3UPVA 5A23A 5KJLA 1JPLA 4FLBA 2C0MA 2CHXA 4ACKA 4J8FA 3ZHEA 4BSXA 3PRZA 3LDZA 3T8MA 2I6HA 3CVQA 4LRZA 1MQSA 2IOSA 4GZDA 2XQ0A 1H2UA 4E6HA 4AEZC 2X6HA 3FEXA 3HVEB 3JQ0A 2GRMA 4A1GA 5E75A 3B7UX 4C0EA 1U3CA 2IU1A 3PH0C 2WXFA 3URZA 3ASHA 3LKUA 1KLXA 3LY7A 4BT9A 4V3IA 3RKVA 4I1OB 3MX3A 3FUFA 3N71A 4JXTA 2CHZA 3PE4A 2LO6A 3ZYQA 2WXGA 1HG5A 2L0TB 5JJ7A 5G05C 1UN9A 4U07A 5FQ8A 4EPZA 2AWIA 3G2SA 3S7DA 2WMNA 3MKRA 3CLJA 3LYAA 2X6KA 3Q15A 2J4DA 3LJ3A 3QAQA 3PVLA 1TEZA 2KZTA 5ANRA 4NURA 4ANUA 2VGYA 3LY9A 4HOTA 4JA7A 4HXIA 2X6JA 1WY6A 3CK9A 4ILHB 3QOUA 2QFCA 1NA0A 3FH5A 3GYZA 4J8DA 5AYWD 1LF8A 4UWGA 3MKQB 3PUJA 1E7VA 2I1JA 1WAO1 4I1AA 4FP7A 3CHOA 5KJNA 4IN3B 1PAQA 3SZ7A 3SHFA 4F7AA 4URKA 5J90A 2JLBA 3CVYA 4PUCA 3D9OA 4JHRA 2Y4TA 4KYOB 3ZYLA 3O4ZA 3FTYA 1P5QA 4BTBA 1HX8A 5KJMA 4WNEA 3TG4A 5BT1A 2XRZA 5EKQD 2KCVA 2VYIA 1NZNA 4R7LA 4I6JA 1ZU2A 1JWGA 3FTSA 3ONKA 1Z3XA 3QWVA 2EQXA 3ASDA 1EYHA 2CFUA 3FEYA 2J49A 5CMYA 3EJNA 4M3OA 4BX9A 1DVPA 2GGFA 3G2UA 4D10C 4WNDA 2J9QA 2VGXB 3QDNA 4GZ5A 3D9NA 1TJFA 5E76A 3LVQE 3FP3A 4ABNA 3CVVA 2WXOA 4Q94A 3HYMB 2V0PA 4P29A 5G2NA 4YVOA 5G55A 3RRMB 5CCMA 4I2WA 4NQ0A 1SZ9A 3GZ1A 3PNLB 2DIWA 3FTUA 2UY1A 3ESLA 4DI3A 2J4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QY7 A;  4GZD A;  3CLJ A;  5J08 A;  2DCP A;  1UJJ A;  4FU3 A;  3D9I A;  1EDU A;  3D9J A;  1JWG A;  1HFA A;  1X5B A;  3G2V A;  3ONK A;  3ONL A;  1EYH A;  3G2T A;  3ZYK A;  1PY1 A;  1SZA A;  5CMY A;  4AVX A;  1HG2 A;  5LOZ A;  4GZC A;  4Q96 A;  1LF8 A;  1JUQ A;  3D9K A;  1MHQ A;  5CMW A;  1HF8 A;  1VDY A;  1DVP A;  3G2U A;  3D9P A;  4JXT A;  1INZ A;  3ZYM A;  1ELK A;  2LO6 A;  3D9L A;  2MOW A;  2BF0 X;  1H0A A;  1XGW A;  3D9N A;  1UJK A;  3ZYQ A;  1HG5 A;  2V8S E;  2L0T B;  3RRU A;  4Q94 A;  1JPL A;  2L0I A;  4FLB A;  3D9M A;  3D9O A;  2KM4 A;  1JWF A;  1SZ9 A;  3G2W A;  2DIW A;  3G2S A;  3LDZ A;  3ZYL A;  4HFG A;  5LP0 A;  4NAC A;  1HX8 A; 
#chains in the Genus database with same CATH topology
 4U7E B;  2C0L A;  5AAO A;  1U2V G;  3Q9N C;  1BPO A;  1TYQ G;  3TGO A;  1K1A A;  4UI9 C;  3APF A;  4JL0 A;  1D8D A;  3Q7A A;  2J08 A;  1UG3 A;  3EHN A;  4PH4 B;  1HZ4 A;  3GZ2 A;  3OXG A;  4FUL A;  4I9C A;  3DBS A;  3PZD A;  3ZW3 A;  3Q5M A;  1ZBP A;  2WXQ A;  3W9G A;  3ZRH A;  2V5F A;  5JMN D;  2PQR A;  3SI5 A;  5HI7 A;  4J0U A;  3U66 A;  1TNZ A;  2OEV A;  1SVX A;  1N4R A;  4GTT A;  3RIB A;  4APO A;  2YQ8 A;  3FDH A;  5IY5 E;  2DVW A;  4FJZ A;  1E90 A;  3ZPJ A;  5B1B E;  5KCM A;  5AAR A;  4N3C A;  5CRU A;  3DXM G;  2YHC A;  4B89 A;  5LX8 A;  2XZD G;  4L2Y A;  3W9F A;  4X8Q A;  4NRH B;  1MX2 A;  4F1P A;  5J08 A;  3IHY A;  4XI9 A;  4FC8 A;  3UM1 A;  1JCS A;  1ELR A;  5AEN A;  3SGH A;  4C48 B;  5BV0 A;  3CQC B;  3L6A A;  4KVO A;  3ULE G;  2LSU A;  3O48 A;  3QKY A;  2J09 A;  4NAC A;  3C3Q A;  4GA2 A;  2CFZ A;  4GB9 A;  3T5X A;  2B0O E;  4B94 A;  3UUX A;  3LXU X;  3MGB A;  3CR3 A;  4U0S A;  2KZT B;  3UIO C;  4I6G A;  2PZI A;  5JA4 D;  3ZYM A;  2ZGG A;  4ZFH A;  1G3N B;  2XPI A;  4BER A;  3AS4 A;  2XHE A;  5JJ6 A;  4M7C A;  2GRN B;  3C98 A;  3KSL A;  3FWV A;  2AJA A;  3IXE A;  2DBA A;  2IEJ A;  2IFU A;  5T3R A;  1ELK A;  2FO1 E;  3JQ1 A;  1QNF A;  3V30 A;  3ML8 A;  4RQI A;  3U4T A;  1H6K A;  4U8Y D;  3KEZ A;  1UOH A;  3IEG A;  2WQ6 A;  3D9H A;  5T8I A;  3QB2 A;  3Q47 B;  3S7F A;  3J5Q B;  3MV3 B;  1E8Y A;  3SNX A;  2LSV A;  3JUI A;  4C0M A;  4O1O A;  3CSF A;  1K1B A;  3JCK C;  4I17 A;  3FUL A;  3NBN B;  3QC1 A;  2PQN A;  4BFR A;  3MJW A;  3CVW A;  2QC9 A;  2IOL A;  5HS0 A;  3EDT B;  3UIN C;  4EZK A;  4O1P A;  2R5S A;  2WXL A;  5CRV A;  5BNW A;  1FCH A;  3BU8 A;  5AIJ A;  3ABK E;  3SO8 A;  4PS3 A;  3NZU A;  1O5M A;  4GYO A;  1EF1 C;  1Z5S C;  4AOF A;  4GA1 A;  4ILI A;  2CG2 A;  4N39 A;  3CHP A;  3PE3 A;  5AQ7 A;  4JZY A;  3RO2 A;  4Y6W A;  1OCC E;  3CVX A;  5ENQ D;  4I2Z A;  4XKB A;  3ML9 A;  4C9B B;  2FO7 A;  3NAW A;  3Q7F A;  3J5P A;  5LCW C;  2P9I G;  2HM8 A;  3CV0 A;  4K03 A;  2DZN A;  4OYS A;  4G11 A;  1TR4 A;  2P9U G;  5BXU A;  3MZL B;  3SFY A;  2F8Y A;  5FT9 A;  2VJ8 A;  5KJK A;  1X5B A;  4GPK A;  3GW4 A;  1HO8 A;  2EIK E;  4GAA A;  5DBK A;  1MHQ A;  3CHQ A;  2HYZ A;  4JHJ A;  4G2V A;  3UT8 A;  2XEN A;  3RAU A;  3WXX A;  5A7D B;  1KZP A;  3UM3 A;  2WXI A;  1NA3 A;  3FTZ A;  2ZU6 B;  2A4Z A;  2E0I A;  4G23 A;  5G05 J;  5KNG A;  4WWO A;  4IUL A;  2LXL A;  4BEP A;  1LD8 A;  4CRW A;  2AW6 A;  2XZT G;  5KJL A;  1JPL A;  4FLB A;  4ACK A;  4LNB A;  2I6H A;  3CVQ A;  1MQS A;  4GZD A;  2P9L G;  4OAU C;  3HVE B;  3JQ0 A;  3TWX A;  3B7U X;  4C0E A;  3UXG A;  3URZ A;  1KLX A;  3AG3 E;  1FPP A;  3FUF A;  3PE4 A;  1HG5 A;  2L0T B;  1UN9 A;  4U07 A;  4K5B A;  3CLJ A;  3LJ3 A;  4NUR A;  3EHQ A;  4UUC A;  3E30 A;  2DWZ A;  1WY6 A;  2QFC A;  5AYW D;  4K5C A;  4UWG A;  3PUJ A;  1JCQ A;  4FP7 A;  5EID A;  3BUA A;  3SHF A;  4F7A A;  5J90 A;  2JLB A;  3AG4 E;  3UKU G;  3SY2 A;  1P5Q A;  2VYI A;  4I6J A;  3ASD A;  3FEY A;  4GZ5 A;  3LVQ E;  3AJI A;  2V0P A;  4P29 A;  5G55 A;  5CCM A;  4YDW A;  3PNL B;  2DIW A;  4GPM A;  2UY1 A;  3ESL A;  4DI3 A;  3FUI A;  4F6R D;  4CDN A;  1EDU A;  3U3W A;  2X6I A;  4U96 D;  1FVF A;  2EIL E;  2IJG X;  3BEE A;  5ENT D;  1IQR A;  2XRY A;  2WXK A;  1RW2 A;  4A63 B;  4I1M A;  4TUM A;  4HLE A;  3OXL A;  4BWR A;  2AXZ A;  1TN6 A;  2VSX E;  1YYH A;  4MS6 A;  2MHK A;  4HRM B;  4YDE A;  3SBT B;  5KWD A;  5CCL A;  4ME2 A;  1N4Q A;  3FUD A;  1UJK A;  4HVB A;  2Y0B G;  3FU6 A;  3CKC A;  1N52 A;  5G04 C;  5ANL A;  3L9T A;  1O1T A;  2DCP A;  4GU5 A;  2VSN A;  4O60 A;  4UQY A;  2RFM A;  2IY0 C;  2V4L A;  1SA4 A;  2AVP A;  3P2B A;  3LY8 A;  1DNP A;  1QBQ A;  4CDM A;  4AY5 A;  1TN7 A;  5KBA A;  4ATG A;  2VQ2 A;  4HOQ A;  4L23 A;  3FUM A;  4FU3 A;  1E96 B;  2H6G A;  3QWW A;  2RD0 A;  3DPD A;  5JHA A;  2E2E A;  2VTB B;  1FT1 A;  3T9K A;  4ANV A;  2KC7 A;  3ASN E;  3RSE G;  3PRE A;  4ACL A;  4FHK A;  2AXV A;  5FZS A;  5CER B;  2GRR B;  1OWN A;  3F6Q A;  4OVV A;  5D66 A;  3FUJ A;  4LEU A;  4XIF A;  1S63 A;  4YVQ C;  1HG2 A;  3TXM A;  3CHR A;  3GZS A;  2XGM A;  2C2L A;  1W3B A;  5HKP A;  2KCK A;  3AS8 A;  2DYR E;  3PZ4 A;  5D2M C;  3VTY A;  2ION A;  4CEM A;  4BTA A;  4TV3 A;  3OAW A;  4H7Y A;  3UIP C;  4U04 A;  5CEC B;  4AIF A;  3PEV B;  2GRO B;  4WWP A;  3PS6 A;  3NF1 A;  5FZR A;  2RG8 A;  4N2Q A;  3Q9U C;  3B95 A;  3ZVV A;  5CEA A;  4XZ4 A;  5B1A E;  4J8E A;  5EX3 A;  2NC9 A;  3I3N A;  4JEU A;  4LER A;  3HG0 D;  1BLX B;  2L6J A;  1N94 A;  2R17 C;  4DJA A;  2J07 A;  1H6O A;  1LD7 A;  3AU4 A;  3MKQ A;  1MX6 A;  4TUU A;  4F1S A;  1Z6T A;  3PZ1 A;  4HOU A;  5CMW A;  4DX6 D;  3DXK G;  5EIL A;  3EIJ A;  4DLQ A;  3DRA A;  4UWH A;  4APF A;  3HIZ A;  1SQM A;  2R05 A;  3PZ3 A;  4AJW A;  3FHE A;  1N0Q A;  4U0U A;  2FBN A;  3TXN A;  4JW1 A;  3L17 A;  1BD8 A;  4GZ3 A;  3AS5 A;  2WB2 A;  5KNH D;  2OND A;  5DIZ A;  4ILG A;  4EZJ A;  3S7B A;  2MOW A;  3AU5 A;  3I5P A;  4CZ2 D;  4AY6 A;  5LCW J;  4A3T A;  3FH7 A;  3PZ2 A;  2FEZ A;  3L16 A;  4L1B A;  4UQX A;  3ASG A;  3VLE A;  3D9L A;  5FIO A;  2RKK A;  3D9M A;  2MRI A;  2IF4 A;  1UN8 A;  4WWN A;  3NOC D;  4XE0 A;  1Q2Z A;  3AG1 E;  4AV7 A;  4AM9 A;  5CED B;  2ZIS A;  3B7B A;  3LCA A;  3CGH A;  2JEK A;  2V8S E;  1YA0 A;  3HXD A;  5H7P A;  4BY6 A;  3LS8 A;  3IHV A;  1TJC A;  3FUH A;  5D0O D;  3R7R A;  3CK7 A;  3Q79 A;  2P58 C;  3UI2 A;  3EU5 A;  3U9W A;  4AXH A;  1Y8M A;  4LNU D;  1A17 A;  3QAR A;  1IHG A;  4FLH A;  3CKB A;  1XNF A;  2L0I A;  2H6H A;  1TNY A;  4GYW A;  2WXH A;  4JA9 A;  1UW4 B;  3MYV A;  1WM5 A;  4B8A A;  4DX2 A;  2ILR A;  3JXJ A;  3S7J A;  1IYG A;  2XPZ A;  3QNK A;  4EQF A;  1H2T C;  4B8C B;  5A23 A;  4BSX A;  3PRZ A;  3T8M A;  3DWL G;  1LTX A;  2IOS A;  2XQ0 A;  4AEZ C;  2X6H A;  2GRM A;  3EHR A;  5E75 A;  1U3C A;  3PH0 C;  2WXF A;  2B6C A;  4HLL A;  2ZGD A;  2WXG A;  4QQI A;  1N4P A;  2A5E A;  2X6K A;  3QAQ A;  2KZT A;  4ANU A;  2VGY A;  3LY9 A;  4N5Q A;  5CBO A;  2X6J A;  2DYS E;  2KBX A;  1NA0 A;  3FH5 A;  1E7V A;  2I1J A;  1WAO 1;  4I1A A;  4URK A;  2LXM A;  3CVY A;  4PUC A;  3D9O A;  3E37 A;  3ZYL A;  2IO2 C;  3FTY A;  1RZ4 A;  4WNE A;  3TG4 A;  4LSZ E;  4GTS A;  1N9A A;  5EKQ D;  1NZN A;  4R7L A;  1ZU2 A;  3ONK A;  1Z3X A;  3QWV A;  5CMY A;  4M3O A;  2J9Q A;  2VGX B;  3HXB A;  3QDN A;  3ABL E;  3CVV A;  2WXO A;  5G2N A;  4YVO A;  3GZ1 A;  2J4B A;  3D9I A;  5G04 J;  5AQA A;  1HXI A;  3E33 A;  2PL2 A;  4DX5 D;  1MYO A;  4HRL A;  1ELW A;  2PM6 A;  4U0Z A;  3HXF A;  1N4S A;  4HFG A;  2FUL A;  3D3M A;  1QZ2 A;  2NSZ A;  2ETC A;  2WVI A;  2Y69 E;  3OXF A;  3CVU A;  4XKC A;  1V54 E;  3KS2 A;  3IV0 A;  5ENR D;  4I9E A;  3UM0 A;  4A3V A;  3FU3 A;  4CYM D;  5FWQ A;  2HE0 A;  4YDY A;  3WG7 E;  5FQ7 A;  3UKR G;  4KZC A;  4TXR A;  2NXP A;  2CHW A;  5EIB E;  3V31 A;  2BF0 X;  4HI8 A;  3FTX A;  1DCQ A;  4ATZ D;  2XPY A;  2WQH A;  2LNI A;  3HXC A;  4JC8 A;  4U8H A;  3RRN B;  3TWQ A;  3BG0 B;  4WNG A;  4UWK A;  2L9B A;  3HDX A;  2VGX A;  4IRU A;  4AVX A;  3D9K A;  5C1D A;  3RJV A;  4U63 A;  4K0R A;  5HRY A;  4JPS A;  4DX1 A;  3S2A A;  2X38 A;  2P2C P;  3Q78 A;  4UI9 J;  2H6F A;  3ZHE B;  4HRN A;  1HH8 A;  1D9S A;  3RK6 A;  3ASO E;  1N0R A;  4FJY A;  4W9R A;  1JCR A;  5ARG A;  4RG6 A;  3EIQ C;  3Q49 B;  4DLO A;  4BT8 A;  1OWM A;  4TXQ A;  1S0P A;  1BI8 B;  1UJJ A;  4GTV A;  4Y6C A;  2KAT A;  1BU9 A;  3ZN3 A;  2YNQ A;  5LFA A;  5JJT A;  1MJ0 A;  5BW8 C;  2LAI A;  3L13 A;  4GZC A;  5BPP A;  2V4H C;  3FTV A;  3E4B A;  3HVE A;  4NIK A;  4EBA A;  3APD A;  3MA5 A;  5ENS D;  3G2V A;  4RVB A;  4GYY A;  1HE8 A;  1PY1 A;  3UT4 A;  5ENP D;  1WG0 A;  1YCS B;  5HQ8 A;  1ZB1 A;  3V79 K;  4RG9 A;  3FFL A;  1AP7 A;  2BKG A;  5CHE E;  4DPR A;  2VSO E;  1X81 A;  3SF4 A;  4HOS A;  5ITZ F;  2P9S G;  4Z68 A;  5T4Y A;  4CT4 A;  3IKO B;  3QK0 A;  3G2T A;  2NYJ A;  4WAF A;  3B7R L;  1SW6 A;  3L22 A;  3ABM E;  3CVL A;  3L54 A;  3UQ3 A;  5ENN A;  2BTD A;  3R9A B;  3TWU A;  4WNF A;  3T8K A;  1HU3 A;  5FIN A;  2ZXW E;  1L5J A;  2WXR A;  4GZ6 A;  1MZC A;  3HXE A;  5FQ6 A;  5AJD A;  4E85 A;  3DST A;  2WQ7 A;  3E32 A;  4MKT A;  4GMJ A;  3Q73 A;  4J6I A;  4FA6 A;  2GRL A;  3ZXS A;  4HS2 A;  3C3O A;  4JD2 G;  2AXU A;  4EHM A;  3DEP A;  2XCC A;  4L9P A;  5EN5 D;  4PDX A;  3B7S A;  5JHB A;  1VDY A;  4XX5 A;  1IQU A;  4U95 D;  4A55 A;  2OEW A;  3NZS A;  4MLP A;  3BG1 B;  2CG3 A;  4BSZ B;  3D9J A;  4L7T A;  4B0Z A;  2R03 A;  3MCX A;  1OWO A;  4CCA A;  4Q69 A;  1INZ A;  2X3M A;  3SFX A;  3CQG B;  2LAH A;  2KM4 A;  3U64 A;  5LP0 A;  3LPZ A;  1D8E A;  5EYP F;  5FJY A;  1K8K G;  3TWR A;  4GCN A;  4ZHB A;  4BET A;  3LEW A;  3UTM A;  1NL4 A;  2YHE A;  2OCC E;  2OVB A;  1S64 A;  3TWV A;  1EPU A;  3AG2 E;  3CIA A;  4GCO A;  3TWW A;  3PNT B;  1QQE A;  3DPY A;  2OOE A;  4G24 A;  3UT7 A;  3VLF A;  2VTB A;  1NFI E;  3ZEF A;  2FI7 A;  1B89 A;  3CEQ A;  3DSV A;  5EDS A;  3PDN A;  3D9P A;  2BKK B;  2C0M A;  2CHX A;  4J8F A;  3DSX A;  4LRZ A;  2F8X K;  1H2U A;  4E6H A;  3FEX A;  2EIN E;  2ZIR A;  3ASH A;  3C72 A;  3ULY A;  2L6B A;  4BT9 A;  3RKV A;  3MX3 A;  2CHZ A;  2LO6 A;  1S70 B;  5CBN A;  4GTM A;  3C5R A;  5FQ8 A;  4EPZ A;  3G2S A;  3AAA C;  3MKR A;  3Q15 A;  3LYA A;  4LNG A;  1SA5 A;  3PVL A;  5ANR A;  4HOT A;  4JA7 A;  4HXI A;  5BXO A;  3CK9 A;  4J8D A;  3GYZ A;  2BED A;  3TWT A;  2QYJ A;  4IN3 B;  1PAQ A;  3SZ7 A;  4JHR A;  2Y4T A;  1N95 A;  1TNU A;  5KJM A;  5BT1 A;  2XRZ A;  2KCV A;  3FTS A;  2EQX A;  4OAV B;  2CFU A;  2J49 A;  3EJN A;  1DVP A;  3G2U A;  4WND A;  4DUI A;  1DCE A;  1TJF A;  1QYM A;  1OY3 D;  3FTU A;  1OCR E;  1YMP A;  1O1S A;  3DSU A;  1IXV A;  4ANW A;  4G8L A;  2M63 A;  2Q7F A;  2F0Y A;  4EZL A;  1H0A A;  2WXN A;  3DSW A;  3SFZ A;  1E8W A;  3P1U A;  4DI4 A;  1H19 A;  4A1S A;  4XI0 A;  3ZGQ A;  4JVS A;  1KT0 A;  3VLD A;  5FTP A;  4GTO A;  2JAB A;  3FU5 A;  2VSY A;  2H6I A;  3UM2 A;  3ESK A;  3HRA A;  4MBG A;  3FH8 A;  2IQC A;  3RRU A;  3DSS A;  1HS6 A;  4GA0 A;  3TJP A;  4KT6 B;  2FF4 A;  2LUH A;  1BI7 B;  4FHJ A;  1HFA A;  4EEC A;  1OT8 A;  4UWF A;  4UI9 K;  3ZUV B;  1TNO A;  2ETB A;  3TWS A;  2HR2 A;  3LJN A;  4QFV A;  2GRQ B;  2XS8 A;  2PNN A;  2WPV A;  1H2V C;  4OVU A;  2DZO A;  3IBE A;  4KZ0 A;  4CGV A;  1E7U A;  1MX4 A;  2PM7 A;  1V55 E;  2XGO A;  1N11 A;  4WUY A;  3NOG D;  4IYP A;  4LCT A;  1DC2 A;  2WXM A;  4G25 A;  3JXI A;  3FUK A;  3ZIM A;  4HB5 A;  4DRX E;  1TN8 A;  2GRP B;  3R9M A;  5FQ4 A;  3ASF A;  5M72 A;  2EIJ E;  2R59 A;  2V5Q C;  1Z3Y A;  3CST A;  3PEU B;  2A5U A;  2UWJ G;  1E8Z A;  2P9N G;  5C2Y A;  4CT0 A;  4BES A;  4TXP A;  4HBD A;  3ZYK A;  3DEO A;  1WDY A;  1NP7 A;  2X6F A;  3UX4 A;  3T5V A;  3E34 A;  4HQD A;  2WXP A;  4HI9 A;  1OUV A;  4I43 A;  1OWL A;  4JB8 P;  4J8Y A;  2QY7 A;  3TL5 A;  4N3A A;  4B93 B;  4PS8 A;  2OVF A;  3SBS A;  4G1T A;  3SQV A;  3KSQ A;  3X2Q E;  4O6F A;  3CVP A;  3KEA A;  4BX8 A;  3BQO A;  1K3Z D;  4MRU A;  2XGS A;  3JUE A;  3CHM A;  2XEE A;  4YND A;  3MEK A;  3APC A;  4UQZ A;  4CGW A;  3FTW A;  3R7Q A;  3EHM A;  3EUV A;  3ZNG A;  3ISM C;  2GW1 A;  2XS1 A;  1OCO E;  4I6E A;  5LOZ A;  1Y6I A;  2J8S D;  3RU0 A;  4ANX A;  3B13 A;  4F3V A;  3C3R A;  4KXK B;  4FAD A;  2XCB A;  5EX0 A;  3I4G A;  3SD5 A;  3CVN A;  4GTQ A;  4N3B A;  3Q4A B;  1O1R A;  2UY1 B;  3TAX A;  3L08 A;  4KVM A;  1H6P A;  4L2L A;  1PC2 A;  4XEI G;  3JYS A;  4KBQ A;  4DK5 A;  1KT1 A;  2Y3A A;  4EBA G;  2VGE A;  5BV1 A;  4N5C A;  4TRQ A;  2WM9 A;  3ZFW A;  3ENE A;  3OTN A;  4GMR A;  5D0Q D;  2EIM E;  2XEH A;  2KCL A;  3FY4 A;  2BUG A;  4CDR A;  3ONL A;  5FZQ A;  3TG5 A;  5AJL A;  4Q96 A;  4J8S A;  2F37 A;  3LVR E;  3CHS A;  1FVH A;  4RSY A;  5ENO D;  1IHB A;  3I4R B;  2I2O A;  4KMO A;  1OXJ A;  3G2W A;  2XEV A;  3PUK A;  2HO1 A;  4DX7 D;  1A5E A;  4N2S A;  3B7T A;  4PS7 A;  4K5A B;  5ARF A;  1SZA A;  3KD7 A;  3FU0 A;  1GW6 A;  1JWF A;  4GML A;  4H7X A;  2Y1L E;  4UWL A;  2P9P G;  3UMV A;  2WXJ A;  5B3S E;  3VTX A;  2I9C A;  3ULQ A;  1HF8 A;  1N54 A;  4J7W A;  1KPS B;  4F53 A;  1KZO A;  2Y4U A;  2KXP C;  4AP2 A;  3KAE A;  3CK8 A;  3NQP A;  2OV8 A;  3FUN A;  3FUE A;  3HHM A;  2I1K A;  3MV2 B;  1OWP A;  2YIN A;  3L82 A;  1E8X A;  4G26 A;  5BUZ A;  3K9I A;  3ZKJ A;  3RO3 A;  3QJZ A;  1XGW A;  4JEH A;  2WMO A;  2ETA A;  5AQB A;  2P9K G;  3ZU7 B;  2QYU A;  1U3D A;  3V2O A;  5EYL A;  3QWP A;  1JUQ A;  4JHK A;  4HOR A;  5A6C A;  4LUN U;  3UPV A;  2RFA A;  1TNB A;  3ZHE A;  4G8K A;  3LDZ A;  2IO3 C;  2R2L A;  4HNA D;  5AQ9 A;  4A1G A;  2IU1 A;  3LKU A;  1NI1 A;  3LY7 A;  4V3I A;  1OCZ E;  4I1O B;  3N71 A;  4JXT A;  4YDO A;  3ZYQ A;  3NB2 A;  5JJ7 A;  5G05 C;  2AWI A;  3S7D A;  2WMN A;  2J4D A;  1TEZ A;  4ILH B;  3QOU A;  2R02 A;  1LF8 A;  3MKQ B;  4U8V D;  5KJN A;  3CHO A;  4KYO B;  3O4Z A;  4BTB A;  1HX8 A;  1AWC B;  4GTP A;  1JWG A;  4GTR A;  1EYH A;  3ZXP A;  5AN8 A;  1FT2 A;  4LG6 A;  4BX9 A;  2GGF A;  4D10 C;  1IKN D;  2MYO A;  3EU9 A;  3V2X A;  3D9N A;  5E76 A;  3FP3 A;  4ABN A;  4Q94 A;  3HYM B;  3RRM B;  2QZA A;  3Q75 A;  4I2W A;  4NQ0 A;  1SZ9 A;  4RLY A; 
#chains in the Genus database with same CATH homology
 3FUI A;  2C0L A;  4CDN A;  3D9I A;  1EDU A;  3U3W A;  4ANW A;  2X6I A;  5G04 J;  1FVF A;  1HXI A;  1BPO A;  2IJG X;  3BEE A;  1IQR A;  2M63 A;  2XRY A;  3TGO A;  2PL2 A;  4UI9 C;  3APF A;  2WXK A;  2Q7F A;  4JL0 A;  4EZL A;  1H0A A;  1ELW A;  2WXN A;  2PM6 A;  4I1M A;  4U0Z A;  2J08 A;  3SFZ A;  1E8W A;  4HLE A;  3OXL A;  1UG3 A;  4BWR A;  2AXZ A;  3P1U A;  2VSX E;  4DI4 A;  4HFG A;  3EHN A;  2FUL A;  3D3M A;  1H19 A;  4A1S A;  4MS6 A;  4PH4 B;  1HZ4 A;  2MHK A;  4XI0 A;  3GZ2 A;  3ZGQ A;  1QZ2 A;  2NSZ A;  4JVS A;  3OXG A;  2WVI A;  4FUL A;  3SBT B;  1KT0 A;  3VLD A;  4I9C A;  3DBS A;  3PZD A;  5CCL A;  5FTP A;  3ZW3 A;  3FU5 A;  3Q5M A;  2VSY A;  3OXF A;  3ESK A;  4ME2 A;  3CVU A;  3FUD A;  3FH8 A;  1UJK A;  1ZBP A;  2IQC A;  3KS2 A;  4XKC A;  3RRU A;  4HVB A;  3IV0 A;  2WXQ A;  3FU6 A;  1HS6 A;  3CKC A;  1N52 A;  5G04 C;  4I9E A;  4GA0 A;  4A3V A;  3ZRH A;  5ANL A;  2V5F A;  3FU3 A;  3TJP A;  4KT6 B;  2FF4 A;  5FWQ A;  2DCP A;  2PQR A;  4GU5 A;  3SI5 A;  4FHJ A;  1HFA A;  4EEC A;  5HI7 A;  4J0U A;  3U66 A;  4UWF A;  4UI9 K;  5FQ7 A;  2VSN A;  2HR2 A;  4KZC A;  2NXP A;  2CHW A;  4QFV A;  4UQY A;  3RIB A;  4APO A;  2V4L A;  2WPV A;  1H2V C;  4OVU A;  2BF0 X;  2YQ8 A;  2AVP A;  3IBE A;  3FDH A;  3P2B A;  4KZ0 A;  4CGV A;  1E7U A;  2PM7 A;  1DNP A;  3FTX A;  3LY8 A;  2XGO A;  2WQH A;  2LNI A;  2XPY A;  4JC8 A;  4U8H A;  3RRN B;  4CDM A;  4AY5 A;  3BG0 B;  4ATG A;  4WUY A;  2VQ2 A;  4HOQ A;  4L23 A;  4FJZ A;  1E90 A;  4WNG A;  3ZPJ A;  5KCM A;  4UWK A;  3FUM A;  2L9B A;  4FU3 A;  1E96 B;  3HDX A;  4IYP A;  2VGX A;  3QWW A;  2WXM A;  4LCT A;  4G25 A;  4N3C A;  2RD0 A;  3DPD A;  3FUK A;  4IRU A;  4AVX A;  5JHA A;  2E2E A;  3ZIM A;  3D9K A;  2YHC A;  5C1D A;  4B89 A;  3RJV A;  4U63 A;  5LX8 A;  2VTB B;  4K0R A;  4ANV A;  2KC7 A;  4L2Y A;  3PRE A;  4ACL A;  4FHK A;  4JPS A;  3ASF A;  5FQ4 A;  3S2A A;  2X38 A;  5M72 A;  2AXV A;  2R59 A;  1Z3Y A;  3CST A;  3PEU B;  4NRH B;  5FZS A;  2A5U A;  1OWN A;  4UI9 J;  5J08 A;  4OVV A;  2UWJ G;  1E8Z A;  3FUJ A;  3ZHE B;  4LEU A;  5C2Y A;  4XIF A;  4CT0 A;  1HH8 A;  3RK6 A;  4YVQ C;  3IHY A;  4XI9 A;  4FC8 A;  3ZYK A;  4FJY A;  4W9R A;  1HG2 A;  5ARG A;  3TXM A;  3CHR A;  3GZS A;  1NP7 A;  2XGM A;  2C2L A;  1ELR A;  1W3B A;  5AEN A;  2X6F A;  3SGH A;  5BV0 A;  4RG6 A;  3EIQ C;  3CQC B;  3Q49 B;  3L6A A;  3UX4 A;  4DLO A;  3T5V A;  2KCK A;  3AS8 A;  4KVO A;  4BT8 A;  2LSU A;  2WXP A;  1OUV A;  1OWM A;  3O48 A;  3VTY A;  2ION A;  3QKY A;  4I43 A;  2J09 A;  1S0P A;  4NAC A;  1OWL A;  4GA2 A;  2QY7 A;  3TL5 A;  4N3A A;  2CFZ A;  4GB9 A;  4CEM A;  4BTA A;  1UJJ A;  2OVF A;  4PS8 A;  4TV3 A;  4Y6C A;  3SBS A;  2KAT A;  4G1T A;  3T5X A;  4B94 A;  3OAW A;  4H7Y A;  3ZN3 A;  2YNQ A;  5LFA A;  5JJT A;  4U04 A;  3UUX A;  5BW8 C;  3LXU X;  4AIF A;  3MGB A;  2LAI A;  3PEV B;  3CR3 A;  3L13 A;  4GZC A;  4O6F A;  2KZT B;  4U0S A;  4I6G A;  3CVP A;  2PZI A;  4BX8 A;  4WWP A;  3ZYM A;  5BPP A;  3PS6 A;  3NF1 A;  4MRU A;  5FZR A;  2XGS A;  3CHM A;  2RG8 A;  3FTV A;  3E4B A;  4N2Q A;  3HVE A;  4EBA A;  2XPI A;  4YND A;  3MEK A;  3AS4 A;  3APD A;  3APC A;  3MA5 A;  4UQZ A;  4CGW A;  3FTW A;  2XHE A;  5JJ6 A;  3ZVV A;  3R7Q A;  3EHM A;  4XZ4 A;  4J8E A;  3C98 A;  3G2V A;  4RVB A;  4GYY A;  1HE8 A;  2GW1 A;  1PY1 A;  3FWV A;  4I6E A;  3UT4 A;  5EX3 A;  5LOZ A;  2NC9 A;  1Y6I A;  2DBA A;  3I3N A;  4JEU A;  4LER A;  3RU0 A;  4ANX A;  5HQ8 A;  2IFU A;  5T3R A;  1ELK A;  4RG9 A;  3FFL A;  3B13 A;  4F3V A;  2L6J A;  3JQ1 A;  1QNF A;  4KXK B;  4FAD A;  5CHE E;  2XCB A;  4DPR A;  3ML8 A;  2R17 C;  2VSO E;  5EX0 A;  3I4G A;  3SF4 A;  4DJA A;  4HOS A;  3SD5 A;  3U4T A;  1H6K A;  2J07 A;  3KEZ A;  3CVN A;  3IEG A;  4N3B A;  2WQ6 A;  3AU4 A;  5T4Y A;  4CT4 A;  3IKO B;  3MKQ A;  3Q4A B;  2UY1 B;  3QK0 A;  3L08 A;  5T8I A;  3QB2 A;  3Q47 B;  3TAX A;  3G2T A;  3S7F A;  4KVM A;  4TUU A;  4WAF A;  1Z6T A;  4F1S A;  4L2L A;  1PC2 A;  3B7R L;  3MV3 B;  3JYS A;  4HOU A;  4KBQ A;  3L22 A;  5CMW A;  1E8Y A;  3CVL A;  3SNX A;  4DK5 A;  2LSV A;  1KT1 A;  3L54 A;  3UQ3 A;  2Y3A A;  5ENN A;  3JUI A;  3EIJ A;  4C0M A;  4DLQ A;  4EBA G;  4UWH A;  4N5C A;  2BTD A;  4APF A;  5BV1 A;  3HIZ A;  3R9A B;  1SQM A;  4TRQ A;  2WM9 A;  3CSF A;  3ZFW A;  4WNF A;  3ENE A;  3OTN A;  3JCK C;  4I17 A;  1HU3 A;  4AJW A;  5D0Q D;  3FUL A;  3FHE A;  3QC1 A;  2PQN A;  2KCL A;  2FBN A;  4U0U A;  3TXN A;  3FY4 A;  4BFR A;  4JW1 A;  2BUG A;  3L17 A;  4CDR A;  4GZ3 A;  1L5J A;  3ONL A;  5FZQ A;  3MJW A;  3AS5 A;  2WB2 A;  3CVW A;  3TG5 A;  5AJL A;  2OND A;  2IOL A;  4Q96 A;  4J8S A;  2WXR A;  5DIZ A;  3EDT B;  4GZ6 A;  4ILG A;  4EZK A;  3LVR E;  4EZJ A;  2R5S A;  3CHS A;  3S7B A;  2MOW A;  1FVH A;  2WXL A;  3AU5 A;  5FQ6 A;  5AJD A;  4E85 A;  4RSY A;  3I4R B;  2WQ7 A;  5BNW A;  4MKT A;  3I5P A;  1FCH A;  2I2O A;  5AIJ A;  4KMO A;  3G2W A;  4GMJ A;  4AY6 A;  5LCW J;  4J6I A;  2XEV A;  3PUK A;  2HO1 A;  4PS3 A;  3NZU A;  4FA6 A;  2GRL A;  3ZXS A;  4HS2 A;  2AXU A;  4GYO A;  4A3T A;  4N2S A;  3B7T A;  3FH7 A;  1EF1 C;  2XCC A;  4AOF A;  4PS7 A;  2FEZ A;  3L16 A;  3B7S A;  4GA1 A;  4PDX A;  1SZA A;  5ARF A;  5JHB A;  4ILI A;  2CG2 A;  4L1B A;  4N39 A;  1VDY A;  4UQX A;  4XX5 A;  3ASG A;  1IQU A;  3VLE A;  3CHP A;  3D9L A;  3PE3 A;  4A55 A;  3KD7 A;  4JZY A;  3FU0 A;  1GW6 A;  3D9M A;  3RO2 A;  2MRI A;  3NZS A;  4MLP A;  1JWF A;  2CG3 A;  3BG1 B;  4Y6W A;  2IF4 A;  3CVX A;  4GML A;  4I2Z A;  4H7X A;  1UN8 A;  4UWL A;  4XKB A;  4WWN A;  3UMV A;  4XE0 A;  3D9J A;  2WXJ A;  3ML9 A;  4C9B B;  3VTX A;  4AV7 A;  4AM9 A;  4L7T A;  4B0Z A;  2FO7 A;  3MCX A;  1OWO A;  4CCA A;  2I9C A;  5LCW C;  3ULQ A;  1HF8 A;  1N54 A;  3LCA A;  4Q69 A;  2HM8 A;  3CGH A;  2X3M A;  2JEK A;  3CV0 A;  4K03 A;  1INZ A;  4F53 A;  4OYS A;  2V8S E;  2Y4U A;  1YA0 A;  4G11 A;  3CQG B;  2LAH A;  4BY6 A;  2KM4 A;  3LS8 A;  4AP2 A;  3KAE A;  3U64 A;  5LP0 A;  3CK8 A;  3IHV A;  3LPZ A;  3NQP A;  1TJC A;  3FUH A;  3MZL B;  5FJY A;  5D0O D;  5FT9 A;  2VJ8 A;  3R7R A;  2OV8 A;  3FUN A;  3FUE A;  5KJK A;  3CK7 A;  4GCN A;  1X5B A;  2P58 C;  3HHM A;  2I1K A;  3MV2 B;  1OWP A;  4GPK A;  3GW4 A;  1HO8 A;  2YIN A;  4GAA A;  3U9W A;  4AXH A;  5DBK A;  1Y8M A;  3LEW A;  1E8X A;  1A17 A;  3QAR A;  1MHQ A;  1IHG A;  2HYZ A;  3CHQ A;  3CKB A;  3K9I A;  4FLH A;  4G26 A;  4JHJ A;  2YHE A;  5BUZ A;  4G2V A;  3RO3 A;  3UT8 A;  2OVB A;  1XGW A;  3QJZ A;  4JEH A;  3WXX A;  2WMO A;  5A7D B;  1XNF A;  2L0I A;  1EPU A;  3CIA A;  2WXI A;  4GYW A;  1NA3 A;  4GCO A;  2WXH A;  3FTZ A;  4JA9 A;  3PNT B;  1QQE A;  2ZU6 B;  2A4Z A;  2OOE A;  1UW4 B;  3MYV A;  4G24 A;  1WM5 A;  2E0I A;  4G23 A;  3UT7 A;  5G05 J;  3VLF A;  4B8A A;  2ILR A;  2VTB A;  1U3D A;  3ZEF A;  2FI7 A;  3S7J A;  1B89 A;  1IYG A;  3CEQ A;  4WWO A;  2XPZ A;  3QWP A;  4IUL A;  1JUQ A;  4JHK A;  5EDS A;  3PDN A;  4HOR A;  3QNK A;  4CRW A;  5A6C A;  3D9P A;  4EQF A;  2AW6 A;  1H2T C;  4LUN U;  4B8C B;  3UPV A;  5A23 A;  5KJL A;  1JPL A;  4FLB A;  2C0M A;  2CHX A;  4ACK A;  4J8F A;  3ZHE A;  4BSX A;  3PRZ A;  3LDZ A;  3T8M A;  2I6H A;  3CVQ A;  4LRZ A;  1MQS A;  2IOS A;  4GZD A;  2XQ0 A;  1H2U A;  4E6H A;  4AEZ C;  2X6H A;  3FEX A;  3HVE B;  3JQ0 A;  2GRM A;  4A1G A;  5E75 A;  3B7U X;  4C0E A;  1U3C A;  2IU1 A;  3PH0 C;  2WXF A;  3URZ A;  3ASH A;  3LKU A;  1KLX A;  3LY7 A;  4BT9 A;  4V3I A;  3RKV A;  4I1O B;  3MX3 A;  3FUF A;  3N71 A;  4JXT A;  2CHZ A;  3PE4 A;  2LO6 A;  3ZYQ A;  2WXG A;  1HG5 A;  2L0T B;  5JJ7 A;  5G05 C;  1UN9 A;  4U07 A;  5FQ8 A;  4EPZ A;  2AWI A;  3G2S A;  3S7D A;  2WMN A;  3MKR A;  3CLJ A;  3LYA A;  2X6K A;  3Q15 A;  2J4D A;  3LJ3 A;  3QAQ A;  3PVL A;  1TEZ A;  2KZT A;  5ANR A;  4NUR A;  4ANU A;  2VGY A;  3LY9 A;  4HOT A;  4JA7 A;  4HXI A;  2X6J A;  1WY6 A;  3CK9 A;  4ILH B;  3QOU A;  2QFC A;  1NA0 A;  3FH5 A;  3GYZ A;  4J8D A;  5AYW D;  1LF8 A;  4UWG A;  3MKQ B;  3PUJ A;  1E7V A;  2I1J A;  1WAO 1;  4I1A A;  4FP7 A;  3CHO A;  5KJN A;  4IN3 B;  1PAQ A;  3SZ7 A;  3SHF A;  4F7A A;  4URK A;  5J90 A;  2JLB A;  3CVY A;  4PUC A;  3D9O A;  4JHR A;  2Y4T A;  4KYO B;  3ZYL A;  3O4Z A;  3FTY A;  1P5Q A;  4BTB A;  1HX8 A;  5KJM A;  4WNE A;  3TG4 A;  5BT1 A;  2XRZ A;  5EKQ D;  2KCV A;  2VYI A;  1NZN A;  4R7L A;  4I6J A;  1ZU2 A;  1JWG A;  3FTS A;  3ONK A;  1Z3X A;  3QWV A;  2EQX A;  3ASD A;  1EYH A;  2CFU A;  3FEY A;  2J49 A;  5CMY A;  3EJN A;  4M3O A;  4BX9 A;  1DVP A;  2GGF A;  3G2U A;  4D10 C;  4WND A;  2J9Q A;  2VGX B;  3QDN A;  4GZ5 A;  3D9N A;  1TJF A;  5E76 A;  3LVQ E;  3FP3 A;  4ABN A;  3CVV A;  2WXO A;  4Q94 A;  3HYM B;  2V0P A;  4P29 A;  5G2N A;  4YVO A;  5G55 A;  3RRM B;  5CCM A;  4I2W A;  4NQ0 A;  1SZ9 A;  3GZ1 A;  3PNL B;  2DIW A;  3FTU A;  2UY1 A;  3ESL A;  4DI3 A;  2J4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...