1N4RA

Protein geranylgeranyltransferase type-i complexed with a geranylgeranylated kkksktkcvil peptide product
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4rA00
4MBGA 1LD8A 2H6GA 4GTVA 1DCEA 1TN7A 1N4QA 3DSSA 3EU5A 4GTSA 1TN8A 1JCSA 3DPYA 1TN6A 1O1TA 1NL4A 3DSWA 3SFYA 1N4RA 3KSQA 2IEJA 4LNBA 3Q78A 3Q79A 4YDEA 3E32A 3E30A 3Q75A 3PZ1A 4GTOA 1TNYA 4L9PA 2H6IA 2H6HA 2F0YA 4EHMA 3DSVA 2R2LA 1S64A 3PZ4A 1TNBA 1X81A 1SA5A 1TNUA 3HXCA 4GTMA 3E37A 4GTQA 3DRAA 3Q7AA 3Q7FA 2BEDA 1N94A 3C72A 3HXBA 1TNOA 3DSXA 1D8EA 4LNGA 4GTPA 1O1RA 1QBQA 3Q73A 3DSUA 4YDOA 3SFXA 1O1SA 1NI1A 1LD7A 3E34A 3HXEA 1SA4A 1LTXA 1KZOA 2ZISA 1JCQA 2ZIRA 3KSLA 1TNZA 1N95A 1FPPA 1FT1A 3E33A 1FT2A 1O5MA 1N4PA 1D8DA 2H6FA 3HXDA 3HXFA 1N4SA 3EUVA 4GTRA 3PZ3A 3DSTA 1MZCA 3PZ2A 4GTTA 1KZPA 1JCRA 1S63A 1N9AA
chains in the Genus database with same CATH superfamily
3UT4A 2QY7A 1Y8MA 2FBNA 1BD8A 3G2TA 5ENQD 3HYMB 3ZVVA 2VGYA 2KM4A 3BU8A 3B7RL 4I6GA 2EIME 4UWLA 3JYSA 5CCLA 3FUFA 4LEUA 2KBXA 3CKCA 3CR3A 3ULEG 4CDMA 4G26A 3CHMA 2AWIA 2WXOA 4F1SA 5CHEE 4XZ4A 3B13A 4J8EA 4EHMA 1D9SA 2C2LA 5BV1A 3TWVA 4I1AA 3ASHA 5KJKA 2OCCE 3AS5A 3RK6A 2GROB 2V4HC 5LFAA 4DJAA 3CIAA 5KNGA 4EBAG 1MQSA 4UQZA 1LF8A 4DRXE 1RZ4A 2IONA 5EX0A 4I1MA 4P29A 2WQ6A 2XGOA 3FTUA 1OCCE 1E8WA 5ANLA 3L54A 1MHQA 1KZOA 2PNNA 3TXNA 1JCQA 4C9BB 2IU1A 4APOA 2XEVA 4NACA 3T5VA 3IV0A 4JVSA 2PQRA 4ANUA 3UPVA 3CVLA 3IHYA 5CMYA 1S63A 3NB2A 4J7WA 2XRYA 5LCWJ 2I6HA 1TN7A 1SZ9A 5FINA 2AW6A 3RRMB 4JEUA 3FTXA 3S2AA 3SHFA 3PS6A 3QWVA 3ZHEB 3QJZA 3TWUA 5JA4D 2WXRA 4IYPA 2ILRA 3E30A 2C0MA 3MEKA 4WWPA 4EQFA 1DNPA 4I9EA 5ENRD 4JL0A 2GRRB 1L5JA 2L9BA 4N2SA 2B0OE 3C3QA 1RW2A 3NOCD 4QFVA 2HYZA 4FA6A 3OTNA 3QARA 4M7CA 2CG3A 4UWKA 2J4BA 2L0IA 3GW4A 5BNWA 1HO8A 4WUYA 2OEWA 3DSXA 5G04C 4MS6A 3SF4A 4HNAD 4YDOA 3CK8A 3MZLB 2DYRE 4XI9A 4JXTA 1U2VG 3V79K 5EILA 4URKA 3CGHA 5HKPA 3FY4A 1TJFA 3D3MA 2FO1E 2ONDA 2F8XK 1BU9A 4JW1A 3ZYQA 1NFIE 2AVPA 3ZYLA 4A63B 3SO8A 3PZ2A 3LKUA 3UINC 3ONKA 2RFMA 3D9NA 1UJKA 2J09A 1JWGA 2BKKB 3ZIMA 2J8SD 4ATZD 3FUIA 1K1AA 2WXQA 4LRZA 1DCQA 1IHBA 3LS8A 3OXLA 4XE0A 4U8HA 4I1OB 1PY1A 4A3TA 4WAFA 1U3CA 5H7PA 5KJMA 3IKOB 4RQIA 5BPPA 2H6IA 4ATGA 3CVPA 3UT7A 4J8YA 4V3IA 3FULA 4U8YD 4BERA 3ESLA 1FVFA 1P5QA 2KZTA 4GU5A 3PH0C 2LSVA 2HE0A 2X3MA 1WDYA 5AJDA 4HI9A 2WVIA 3GZ1A 2F37A 1HZ4A 4CCAA 3D9HA 4CYMD 4HOTA 4WNFA 1NI1A 3E34A 1HG5A 3FU5A 2OV8A 4KYOB 1D8DA 4F53A 1XNFA 2GRLA 3L82A 4UWFA 1K1BA 3TXMA 2XPIA 4BSZB 5J08A 1JCRA 1ELWA 3E4BA 2GW1A 3EHRA 4KMOA 1OWNA 1MX6A 3UM0A 4E6HA 2R05A 1ZBPA 3JUIA 3S7DA 4ILHB 2B6CA 2IEJA 3IXEA 2J08A 4FHJA 4G8LA 3ZEFA 4CT0A 5ARFA 4JEHA 4IN3B 2XS8A 3R9AB 3Q75A 3OXFA 2EINE 2ETBA 5LCWC 1TNYA 4LG6A 4TRQA 3MKQB 4LNUD 4EZJA 2FF4A 4CDNA 1SZAA 1N54A 4KZCA 5T8IA 2EQXA 2E2EA 4HLLA 2VJ8A 1QZ2A 4ILIA 5FQ8A 4ACKA 2F8YA 4HB5A 3CVUA 2J49A 3TWXA 2X38A 4RSYA 1E96B 5HI7A 1OY3D 4N5CA 4W9RA 3UI2A 3RU0A 3L6AA 3FUKA 3LYAA 2RG8A 2Y0BG 1H0AA 2H6FA 3V31A 4FADA 3RO2A 1TR4A 3D9MA 3TWQA 3CVYA 3FU6A 1OCOE 2R59A 2R03A 3K9IA 1ZU2A 4GTVA 4B89A 3UM3A 3IBEA 3EU5A 4OVUA 2MHKA 4KBQA 5KNHD 1ZB1A 3EHMA 2X6HA 2P2CP 4AY5A 3LJNA 2ZXWE 4AM9A 2P9PG 4ME2A 3URZA 4KT6B 3ISMC 2XPYA 3RO3A 2H6HA 4Q69A 1Y6IA 2F0YA 4JHRA 5ENNA 2Q7FA 4TXPA 4U63A 3BEEA 1FVHA 3VLEA 2DZNA 3CK7A 4AOFA 1HF8A 3V2XA 4N2QA 3T9KA 1JWFA 3FFLA 4B93B 1WY6A 4BSXA 2HO1A 3PREA 3SD5A 4L7TA 2KCKA 3LY8A 3D9LA 2EIKE 5G04J 2V4LA 3JQ0A 4J0UA 3ASDA 1O1SA 1LD7A 3LY9A 3BUAA 4F1PA 3QKYA 5D2MC 1NZNA 2WXNA 2AXUA 3LY7A 4F6RD 2RFAA 1OWPA 3CVXA 1PAQA 2ZU6B 3FWVA 1SW6A 4JHKA 2GRPB 2QC9A 3IEGA 3WXXA 2E0IA 4KZ0A 4HQDA 4GZ5A 3FUMA 2XPZA 1W3BA 4AV7A 3HHMA 2IO3C 4MBGA 3VTYA 2OVFA 2H6GA 4U8VD 4OAVB 5CEDB 3EIQC 2IJGX 3DSSA 5FQ6A 1IHGA 4YVOA 2P9LG 4HS2A 3B7SA 1N4RA 3Q5MA 3LCAA 5AARA 5B1AE 2IOSA 1S0PA 5G2NA 4O60A 4LNBA 4M3OA 4L1BA 4FHKA 5JHBA 2PL2A 3CVVA 1INZA 3Q15A 4FU3A 5FZRA 1KPSB 1N0RA 1HH8A 2XENA 3CHQA 3ABLE 2EIJE 2BKGA 2NYJA 3FH5A 3CVWA 2Y4UA 4X8QA 3I4RB 4JB8P 2PM6A 1SA5A 4H7XA 2NC9A 5DIZA 4C0EA 4GTQA 2WXLA 5C1DA 1PC2A 2PQNA 3F6QA 3SI5A 5CBOA 4Y6WA 1IQUA 3PUJA 3APDA 4PS7A 4BT8A 2BUGA 4FJZA 2XZDG 1H2UA 4O1OA 4GZDA 3PE3A 4NQ0A 2YQ8A 3TWRA 1V55E 3UMVA 1ELKA 2VGXB 3QDNA 4HBDA 2L0TB 3QC1A 4F7AA 3RKVA 4U0UA 4GPMA 2XCCA 3BQOA 4GPKA 3HXFA 3D9OA 3PZ3A 3AS4A 4J8FA 3B7BA 1E7UA 3OAWA 1KT1A 4NURA 2VQ2A 3ASOE 4DUIA 1OWOA 1KT0A 3ASNE 3Q4AB 4CDRA 2CG2A 5AQAA 5ITZF 4GMLA 1K3ZD 3UKRG 1MJ0A 4IRUA 1QYMA 2WXJA 3HG0D 4MLPA 3NOGD 1WM5A 4A1GA 3LEWA 3UQ3A 3Q79A 4H7YA 4CGVA 5EN5D 2WQHA 5FZQA 2WB2A 2QFCA 1BLXB 3ASGA 3CSTA 4ANVA 3PRZA 1HE8A 2J4DA 1QNFA 1UG3A 2YHCA 3AG4E 2VSOE 2I1JA 3PZ4A 3VLDA 3AG1E 1OWMA 2AJAA 2DIWA 3MV2B 3CV0A 5LP0A 1YYHA 4GA2A 3FUDA 3FTZA 1OUVA 5EDSA 3AG3E 4I6JA 2QYUA 3FU3A 4AIFA 1Q2ZA 3UTMA 4UWGA 3E33A 4BX9A 1WAO1 2WPVA 4PH4B 3TJPA 5CCMA 4OAUC 4L2LA 1NP7A 2C0LA 5ARGA 5AENA 4B8AA 3CQGB 4CT4A 3EJNA 1LD8A 2BF0X 4FLHA 1TN8A 2DZOA 4N5QA 2JLBA 3CKBA 3CK9A 5FWQA 4HORA 4RG6A 3BG1B 3PNLB 5HRYA 4GMJA 3PDNA 4I43A 4YDWA 2GRMA 4XIFA 5BW8C 3FTVA 5G55A 2VSYA 4MKTA 4DI4A 1IXVA 2XGSA 3ML9A 2WMNA 3G2SA 3LPZA 4LCTA 2VTBA 4GZ3A 1HFAA 3UXGA 3CVQA 5CRUA 3IHVA 4N3CA 2WQ7A 2LAHA 1OWLA 1KLXA 2FULA 5KWDA 1TNOA 4XI0A 4HRLA 4JPSA 3FEYA 3ESKA 4PDXA 3KEAA 3HXEA 4J8SA 3ZPJA 3PE4A 1H6OA 1N95A 2X6KA 3R7QA 4LUNU 4BY6A 1FT2A 4U7EB 5ANRA 1TEZA 4DLQA 2YINA 3APFA 2P9SG 5BXOA 2Y1LE 1JPLA 5BT1A 2KCLA 5KJLA 4YDYA 4GYOA 2IY0C 1UN9A 3Q49B 1KZPA 5BXUA 2QYJA 3TG4A 3CSFA 2BTDA 4Y6CA 5EYPF 2P58C 2P9KG 1A17A 4IULA 3APCA 3L13A 5IY5E 4DX7D 1H6KA 3AU4A 1N4QA 4TUMA 3QAQA 3RSEG 3DPYA 3VLFA 1BPOA 2GRQB 3FTYA 3QOUA 4UI9K 2KXPC 2WXKA 2YHEA 3KSQA 3C3RA 3JCKC 5JJ7A 4FC8A 2GGFA 3PEVB 2V0PA 3G2VA 4U07A 1H19A 3PZ1A 4GCNA 2AXZA 3L08A 3ZKJA 1VDYA 3U66A 4GMRA 4EZLA 4UQXA 3MX3A 3W9FA 3G2WA 2AXVA 4G1TA 3UT8A 5E76A 5CRVA 3UUXA 4DX2A 3X2QE 3ZU7B 1IKND 2LUHA 3V30A 4A1SA 4KVOA 4HOQA 2WXHA 3WG7E 2GRNB 3MGBA 3DBSA 3P1UA 5FT9A 4HVBA 2MYOA 4B8CB 4WWNA 5BV0A 4N39A 3ENEA 5KJNA 3KAEA 3ZNGA 1DVPA 4XEIG 4GZCA 2Y4TA 4AP2A 4QQIA 3CVNA 4BTBA 5D0QD 3ASFA 4EBAA 5G05C 1AWCB 2XRZA 3L17A 1IQRA 2HR2A 1TN6A 4G11A 2IO2C 1HS6A 3DSWA 5M72A 2FO7A 3FH7A 3AS8A 2CFUA 4EECA 3ABME 2DYSE 2A5EA 4JHJA 4TUUA 4GTOA 2VSXE 4LSZE 3FUEA 3DEOA 3CHRA 1FCHA 2R2LA 5JMND 2WXFA 1MX2A 1Z6TA 3E37A 4RVBA 2R17C 2ETCA 3R7RA 5HQ8A 1X5BA 3Q7FA 3HVEA 3RJVA 4OYSA 3HXBA 4O6FA 3FDHA 2UY1B 3B7UX 4LNGA 2IQCA 3Q73A 2KATA 3DSUA 1OXJA 3FEXA 1SA4A 3PNTB 3ZXSA 2RD0A 3ZUVB 1BI7B 4LERA 2X6IA 2DVWA 4RG9A 3SQVA 3UX4A 4CGWA 1HG2A 3CHOA 3EUVA 1H2VC 4GTRA 2JEKA 4U96D 3DSTA 4XKBA 2Y69E 3SBSA 4U95D 5EX3A 1EPUA 1N9AA 3FH8A 4GA0A 2ZGGA 3TG5A 1JCSA 2RKKA 3G2UA 3RIBA 1NL4A 2IF4A 2KCVA 4UUCA 3QWPA 4Q96A 5AQBA 5FIOA 3RAUA 4F3VA 2L6BA 3QB2A 3GZSA 5D66A 3C98A 1OCZE 2OVBA 1S70B 2V8SE 3FUJA 2MOWA 4ANXA 4Z68A 3C5RA 3SBTB 3GYZA 4TV3A 5CERB 4KXKB 1N94A 3ZW3A 5D0OD 3O48A 1QBQA 2J9QA 2X6FA 5J90A 4J6IA 4BTAA 2HM8A 3T5XA 2VGXA 4YNDA 3ZYKA 3JXJA 5AN8A 3CHPA 1FPPA 1FT1A 3DXKG 2PM7A 2YNQA 4WWOA 2DBAA 4ANWA 2NSZA 4YVQC 4NIKA 3NQPA 3DPDA 3SGHA 4JZYA 5B1BE 4TXQA 4JA9A 2LO6A 3TGOA 4A3VA 3S7JA 1O1TA 3FTWA 3TAXA 3PUKA 4U0SA 5FQ7A 3JQ1A 3Q78A 3UKUG 2WXIA 2R5SA 4BX8A 3E32A 4C48B 3ML8A 4AEZC 2P9NG 3JXIA 4HFGA 4MRUA 5AAOA 5ENTD 3PEUB 3ZHEA 5A6CA 5CECB 1TNBA 1HX8A 5EKQD 1TNUA 3C3OA 3TL5A 2P9UG 5HS0A 3U9WA 1E8XA 5E75A 3Q7AA 4ZHBA 3EIJA 2I1KA 2BEDA 4ACLA 1H6PA 1TJCA 3DXMG 3N71A 4GYWA 3AG2E 3TWTA 3ULQA 4I9CA 3GZ2A 3SFXA 1TNZA 4ILGA 4UWHA 1DC2A 4I2WA 3SNXA 2XZTG 3EU9A 1EDUA 4Q94A 4A55A 4BETA 2XHEA 2XCBA 3D9IA 5JHAA 1HXIA 3B95A 1MZCA 2LAIA 3CLJA 3AJIA 2R02A 4GAAA 4JA7A 2DWZA 2WXGA 4PS3A 4BFRA 1IYGA 1E8YA 5G05J 3R9MA 3D9PA 4I17A 3EHNA 2IOLA 2VYIA 2VGEA 1V54E 5ENSD 2XEEA 4K5CA 3LVQE 3FTSA 1SVXA 4GB9A 4TXRA 3LDZA 4C0MA 4GA1A 4L2YA 3MKRA 2XGMA 1NA0A 3KD7A 1SQMA 4G8KA 3RRUA 1Z3YA 5BUZA 2UWJG 4K03A 3Q47B 2V5QC 2WM9A 4J8DA 4AXHA 1H2TC 2QZAA 2WMOA 5EIDA 1OT8A 3NZUA 3HXCA 3AU5A 3I4GA 5ENPD 3MJWA 4GYYA 3D9KA 1UJJA 4HI8A 2CHZA 1UW4B 3JUEA 1YA0A 2XQ0A 4R7LA 2A5UA 1TYQG 5FJYA 3SFZA 5LOZA 3ZFWA 4K0RA 4HRNA 1E8ZA 3HDXA 2ZIRA 3KSLA 3UIPC 2FI7A 1N4PA 5AIJA 1N4SA 3NF1A 4B94A 4GTTA 3FHEA 4G23A 4L23A 3ONLA 2MRIA 2P9IG 4AVXA 3W9GA 2VSNA 1DCEA 5EYLA 2LXMA 4PS8A 4I6EA 4UI9J 1G3NB 1MX4A 3L16A 3ZXPA 1YCSB 2VTBB 1N11A 5FZSA 2EILE 4I2ZA 3Q9NC 3QWWA 4L9PA 3RRNB 1B89A 4B0ZA 1WG0A 4PUCA 2PZIA 4FP7A 2KZTB 3NAWA 1X81A 4CZ2D 4GZ6A 3KS2A 3DRAA 1U3DA 5EIBE 4G24A 2FEZA 5B3SE 4AY6A 3MKQA 1JUQA 1GW6A 3CQCB 2Y3AA 5KCMA 1O1RA 5C2YA 4UQYA 1QQEA 4WNDA 2DCPA 3BG0B 4DX6D 4U04A 1O5MA 4BWRA 5DBKA 1NA3A 4DX5D 3CHSA 3LXUX 3HXDA 4HLEA 2OEVA 4DK5A 4N3BA 1K8KG 5A23A 3U4TA 3NZSA 4WNEA 4EPZA 4HOSA 3MV3B 4DPRA 3S7BA 4DLOA 3SFYA 4AJWA 4EZKA 2CHXA 4D10C 2L6JA 3LVRE 5CBNA 5KBAA 4YDEA 4ABNA 1YMPA 3ZYMA 5FTPA 3CEQA 4HXIA 2XS1A 4CEMA 2M63A 1UN8A 1XGWA 3SY2A 1Z3XA 2NXPA 3J5PA 4KVMA 2I9CA 5JJ6A 3DSVA 3V2OA 5A7DB 3U3WA 3HIZA 1Z5SC 4NRHB 3EHQA 3ZN3A 2KC7A 4GTMA 4K5BA 3B7TA 3DEPA 3FU0A 3MYVA 3PZDA 3SZ7A 2OOEA 3ZRHA 5JJTA 4JD2G 3FUHA 2UY1A 3TWSA 1BI8B 2X6JA 4DI3A 2ZGDA 1OCRE 3QNKA 2LSUA 4ZFHA 3TWWA 1LTXA 5CMWA 2ZISA 3L9TA 3S7FA 3ZGQA 2J07A 3FP3A 3DWLG 4FLBA 5AJLA 4G2VA 2A4ZA 3UIOC 2XEHA 5LX8A 5AYWD 2CHWA 4BESA 1E90A 1EYHA 5AQ7A 4BT9A 1N52A 3LJ3A 3T8KA 4FJYA 2CFZA 4CRWA 3ULYA 5ENOD 4XX5A 3UM2A 4O1PA 4E85A 4GTSA 3Q9UC 4XKCA 4WNGA 3FUNA 4OVVA 3PVLA 4HRMB 3P2BA 4K5AB 4APFA 3AAAC 3EDTB 5AQ9A 3O4ZA 2WXMA 5T4YA 2I2OA 4N3AA 1E7VA 3HVEB 3QK0A 4HOUA 3ABKE 4G25A 4UI9C 2LNIA 3NBNB 1AP7A 1S64A 4GCOA 2WXPA 3J5QB 4RLYA 3MA5A 3KEZA 2IFUA 3U64A 1N0QA 3I5PA 3OXGA 4DX1A 3C72A 3MCXA 5FQ4A 3L22A 4FULA 1EF1C 1D8EA 4GTPA 3D9JA 3HRAA 4BEPA 4U0ZA 2V5FA 5T3RA 5CEAA 2LXLA 3UM1A 1UOHA 2ETAA 3I3NA 1ELRA 2JABA 1MYOA 1HU3A 1A5EA 3T8MA 3VTXA 4JC8A
chains in the Genus database with same CATH topology
4MBGA 1LD8A 2H6GA 4GTVA 1DCEA 1TN7A 1N4QA 3DSSA 3EU5A 4GTSA 1TN8A 1JCSA 3DPYA 1TN6A 1O1TA 1NL4A 3DSWA 3SFYA 1N4RA 3KSQA 2IEJA 4LNBA 3Q78A 3Q79A 4YDEA 3E32A 3E30A 3Q75A 3PZ1A 4GTOA 1TNYA 4L9PA 2H6IA 2H6HA 2F0YA 4EHMA 3DSVA 2R2LA 1S64A 3PZ4A 1TNBA 1X81A 1SA5A 1TNUA 3HXCA 4GTMA 3E37A 4GTQA 3DRAA 3Q7AA 3Q7FA 2BEDA 1N94A 3C72A 3HXBA 1TNOA 3DSXA 1D8EA 4LNGA 4GTPA 1O1RA 1QBQA 3Q73A 3DSUA 4YDOA 3SFXA 1O1SA 1NI1A 1LD7A 3E34A 3HXEA 1SA4A 1LTXA 1KZOA 2ZISA 1JCQA 2ZIRA 3KSLA 1TNZA 1N95A 1FPPA 1FT1A 3E33A 1FT2A 1O5MA 1N4PA 1D8DA 2H6FA 3HXDA 3HXFA 1N4SA 3EUVA 4GTRA 3PZ3A 3DSTA 1MZCA 3PZ2A 4GTTA 1KZPA 1JCRA 1S63A 1N9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MBG A;  1LD8 A;  2H6G A;  4GTV A;  1DCE A;  1TN7 A;  1N4Q A;  3DSS A;  3EU5 A;  4GTS A;  1TN8 A;  1JCS A;  3DPY A;  1TN6 A;  1O1T A;  1NL4 A;  3DSW A;  3SFY A;  1N4R A;  3KSQ A;  2IEJ A;  4LNB A;  3Q78 A;  3Q79 A;  4YDE A;  3E32 A;  3E30 A;  3Q75 A;  3PZ1 A;  4GTO A;  1TNY A;  4L9P A;  2H6I A;  2H6H A;  2F0Y A;  4EHM A;  3DSV A;  2R2L A;  1S64 A;  3PZ4 A;  1TNB A;  1X81 A;  1SA5 A;  1TNU A;  3HXC A;  4GTM A;  3E37 A;  4GTQ A;  3DRA A;  3Q7A A;  3Q7F A;  2BED A;  1N94 A;  3C72 A;  3HXB A;  1TNO A;  3DSX A;  1D8E A;  4LNG A;  4GTP A;  1O1R A;  1QBQ A;  3Q73 A;  3DSU A;  4YDO A;  3SFX A;  1O1S A;  1NI1 A;  1LD7 A;  3E34 A;  3HXE A;  1SA4 A;  1LTX A;  1KZO A;  2ZIS A;  1JCQ A;  2ZIR A;  3KSL A;  1TNZ A;  1N95 A;  1FPP A;  1FT1 A;  3E33 A;  1FT2 A;  1O5M A;  1N4P A;  1D8D A;  2H6F A;  3HXD A;  3HXF A;  1N4S A;  3EUV A;  4GTR A;  3PZ3 A;  3DST A;  1MZC A;  3PZ2 A;  4GTT A;  1KZP A;  1JCR A;  1S63 A;  1N9A A; 
#chains in the Genus database with same CATH topology
 3UT4 A;  2QY7 A;  1Y8M A;  2FBN A;  1BD8 A;  3G2T A;  5ENQ D;  3HYM B;  3ZVV A;  2VGY A;  2KM4 A;  3BU8 A;  3B7R L;  4I6G A;  2EIM E;  4UWL A;  3JYS A;  5CCL A;  3FUF A;  4LEU A;  2KBX A;  3CKC A;  3CR3 A;  3ULE G;  4CDM A;  4G26 A;  3CHM A;  2AWI A;  2WXO A;  4F1S A;  5CHE E;  4XZ4 A;  3B13 A;  4J8E A;  4EHM A;  1D9S A;  2C2L A;  5BV1 A;  3TWV A;  4I1A A;  3ASH A;  5KJK A;  2OCC E;  3AS5 A;  3RK6 A;  2GRO B;  2V4H C;  5LFA A;  4DJA A;  3CIA A;  5KNG A;  4EBA G;  1MQS A;  4UQZ A;  1LF8 A;  4DRX E;  1RZ4 A;  2ION A;  5EX0 A;  4I1M A;  4P29 A;  2WQ6 A;  2XGO A;  3FTU A;  1OCC E;  1E8W A;  5ANL A;  3L54 A;  1MHQ A;  1KZO A;  2PNN A;  3TXN A;  1JCQ A;  4C9B B;  2IU1 A;  4APO A;  2XEV A;  4NAC A;  3T5V A;  3IV0 A;  4JVS A;  2PQR A;  4ANU A;  3UPV A;  3CVL A;  3IHY A;  5CMY A;  1S63 A;  3NB2 A;  4J7W A;  2XRY A;  5LCW J;  2I6H A;  1TN7 A;  1SZ9 A;  5FIN A;  2AW6 A;  3RRM B;  4JEU A;  3FTX A;  3S2A A;  3SHF A;  3PS6 A;  3QWV A;  3ZHE B;  3QJZ A;  3TWU A;  5JA4 D;  2WXR A;  4IYP A;  2ILR A;  3E30 A;  2C0M A;  3MEK A;  4WWP A;  4EQF A;  1DNP A;  4I9E A;  5ENR D;  4JL0 A;  2GRR B;  1L5J A;  2L9B A;  4N2S A;  2B0O E;  3C3Q A;  1RW2 A;  3NOC D;  4QFV A;  2HYZ A;  4FA6 A;  3OTN A;  3QAR A;  4M7C A;  2CG3 A;  4UWK A;  2J4B A;  2L0I A;  3GW4 A;  5BNW A;  1HO8 A;  4WUY A;  2OEW A;  3DSX A;  5G04 C;  4MS6 A;  3SF4 A;  4HNA D;  4YDO A;  3CK8 A;  3MZL B;  2DYR E;  4XI9 A;  4JXT A;  1U2V G;  3V79 K;  5EIL A;  4URK A;  3CGH A;  5HKP A;  3FY4 A;  1TJF A;  3D3M A;  2FO1 E;  2OND A;  2F8X K;  1BU9 A;  4JW1 A;  3ZYQ A;  1NFI E;  2AVP A;  3ZYL A;  4A63 B;  3SO8 A;  3PZ2 A;  3LKU A;  3UIN C;  3ONK A;  2RFM A;  3D9N A;  1UJK A;  2J09 A;  1JWG A;  2BKK B;  3ZIM A;  2J8S D;  4ATZ D;  3FUI A;  1K1A A;  2WXQ A;  4LRZ A;  1DCQ A;  1IHB A;  3LS8 A;  3OXL A;  4XE0 A;  4U8H A;  4I1O B;  1PY1 A;  4A3T A;  4WAF A;  1U3C A;  5H7P A;  5KJM A;  3IKO B;  4RQI A;  5BPP A;  2H6I A;  4ATG A;  3CVP A;  3UT7 A;  4J8Y A;  4V3I A;  3FUL A;  4U8Y D;  4BER A;  3ESL A;  1FVF A;  1P5Q A;  2KZT A;  4GU5 A;  3PH0 C;  2LSV A;  2HE0 A;  2X3M A;  1WDY A;  5AJD A;  4HI9 A;  2WVI A;  3GZ1 A;  2F37 A;  1HZ4 A;  4CCA A;  3D9H A;  4CYM D;  4HOT A;  4WNF A;  1NI1 A;  3E34 A;  1HG5 A;  3FU5 A;  2OV8 A;  4KYO B;  1D8D A;  4F53 A;  1XNF A;  2GRL A;  3L82 A;  4UWF A;  1K1B A;  3TXM A;  2XPI A;  4BSZ B;  5J08 A;  1JCR A;  1ELW A;  3E4B A;  2GW1 A;  3EHR A;  4KMO A;  1OWN A;  1MX6 A;  3UM0 A;  4E6H A;  2R05 A;  1ZBP A;  3JUI A;  3S7D A;  4ILH B;  2B6C A;  2IEJ A;  3IXE A;  2J08 A;  4FHJ A;  4G8L A;  3ZEF A;  4CT0 A;  5ARF A;  4JEH A;  4IN3 B;  2XS8 A;  3R9A B;  3Q75 A;  3OXF A;  2EIN E;  2ETB A;  5LCW C;  1TNY A;  4LG6 A;  4TRQ A;  3MKQ B;  4LNU D;  4EZJ A;  2FF4 A;  4CDN A;  1SZA A;  1N54 A;  4KZC A;  5T8I A;  2EQX A;  2E2E A;  4HLL A;  2VJ8 A;  1QZ2 A;  4ILI A;  5FQ8 A;  4ACK A;  2F8Y A;  4HB5 A;  3CVU A;  2J49 A;  3TWX A;  2X38 A;  4RSY A;  1E96 B;  5HI7 A;  1OY3 D;  4N5C A;  4W9R A;  3UI2 A;  3RU0 A;  3L6A A;  3FUK A;  3LYA A;  2RG8 A;  2Y0B G;  1H0A A;  2H6F A;  3V31 A;  4FAD A;  3RO2 A;  1TR4 A;  3D9M A;  3TWQ A;  3CVY A;  3FU6 A;  1OCO E;  2R59 A;  2R03 A;  3K9I A;  1ZU2 A;  4GTV A;  4B89 A;  3UM3 A;  3IBE A;  3EU5 A;  4OVU A;  2MHK A;  4KBQ A;  5KNH D;  1ZB1 A;  3EHM A;  2X6H A;  2P2C P;  4AY5 A;  3LJN A;  2ZXW E;  4AM9 A;  2P9P G;  4ME2 A;  3URZ A;  4KT6 B;  3ISM C;  2XPY A;  3RO3 A;  2H6H A;  4Q69 A;  1Y6I A;  2F0Y A;  4JHR A;  5ENN A;  2Q7F A;  4TXP A;  4U63 A;  3BEE A;  1FVH A;  3VLE A;  2DZN A;  3CK7 A;  4AOF A;  1HF8 A;  3V2X A;  4N2Q A;  3T9K A;  1JWF A;  3FFL A;  4B93 B;  1WY6 A;  4BSX A;  2HO1 A;  3PRE A;  3SD5 A;  4L7T A;  2KCK A;  3LY8 A;  3D9L A;  2EIK E;  5G04 J;  2V4L A;  3JQ0 A;  4J0U A;  3ASD A;  1O1S A;  1LD7 A;  3LY9 A;  3BUA A;  4F1P A;  3QKY A;  5D2M C;  1NZN A;  2WXN A;  2AXU A;  3LY7 A;  4F6R D;  2RFA A;  1OWP A;  3CVX A;  1PAQ A;  2ZU6 B;  3FWV A;  1SW6 A;  4JHK A;  2GRP B;  2QC9 A;  3IEG A;  3WXX A;  2E0I A;  4KZ0 A;  4HQD A;  4GZ5 A;  3FUM A;  2XPZ A;  1W3B A;  4AV7 A;  3HHM A;  2IO3 C;  4MBG A;  3VTY A;  2OVF A;  2H6G A;  4U8V D;  4OAV B;  5CED B;  3EIQ C;  2IJG X;  3DSS A;  5FQ6 A;  1IHG A;  4YVO A;  2P9L G;  4HS2 A;  3B7S A;  1N4R A;  3Q5M A;  3LCA A;  5AAR A;  5B1A E;  2IOS A;  1S0P A;  5G2N A;  4O60 A;  4LNB A;  4M3O A;  4L1B A;  4FHK A;  5JHB A;  2PL2 A;  3CVV A;  1INZ A;  3Q15 A;  4FU3 A;  5FZR A;  1KPS B;  1N0R A;  1HH8 A;  2XEN A;  3CHQ A;  3ABL E;  2EIJ E;  2BKG A;  2NYJ A;  3FH5 A;  3CVW A;  2Y4U A;  4X8Q A;  3I4R B;  4JB8 P;  2PM6 A;  1SA5 A;  4H7X A;  2NC9 A;  5DIZ A;  4C0E A;  4GTQ A;  2WXL A;  5C1D A;  1PC2 A;  2PQN A;  3F6Q A;  3SI5 A;  5CBO A;  4Y6W A;  1IQU A;  3PUJ A;  3APD A;  4PS7 A;  4BT8 A;  2BUG A;  4FJZ A;  2XZD G;  1H2U A;  4O1O A;  4GZD A;  3PE3 A;  4NQ0 A;  2YQ8 A;  3TWR A;  1V55 E;  3UMV A;  1ELK A;  2VGX B;  3QDN A;  4HBD A;  2L0T B;  3QC1 A;  4F7A A;  3RKV A;  4U0U A;  4GPM A;  2XCC A;  3BQO A;  4GPK A;  3HXF A;  3D9O A;  3PZ3 A;  3AS4 A;  4J8F A;  3B7B A;  1E7U A;  3OAW A;  1KT1 A;  4NUR A;  2VQ2 A;  3ASO E;  4DUI A;  1OWO A;  1KT0 A;  3ASN E;  3Q4A B;  4CDR A;  2CG2 A;  5AQA A;  5ITZ F;  4GML A;  1K3Z D;  3UKR G;  1MJ0 A;  4IRU A;  1QYM A;  2WXJ A;  3HG0 D;  4MLP A;  3NOG D;  1WM5 A;  4A1G A;  3LEW A;  3UQ3 A;  3Q79 A;  4H7Y A;  4CGV A;  5EN5 D;  2WQH A;  5FZQ A;  2WB2 A;  2QFC A;  1BLX B;  3ASG A;  3CST A;  4ANV A;  3PRZ A;  1HE8 A;  2J4D A;  1QNF A;  1UG3 A;  2YHC A;  3AG4 E;  2VSO E;  2I1J A;  3PZ4 A;  3VLD A;  3AG1 E;  1OWM A;  2AJA A;  2DIW A;  3MV2 B;  3CV0 A;  5LP0 A;  1YYH A;  4GA2 A;  3FUD A;  3FTZ A;  1OUV A;  5EDS A;  3AG3 E;  4I6J A;  2QYU A;  3FU3 A;  4AIF A;  1Q2Z A;  3UTM A;  4UWG A;  3E33 A;  4BX9 A;  1WAO 1;  2WPV A;  4PH4 B;  3TJP A;  5CCM A;  4OAU C;  4L2L A;  1NP7 A;  2C0L A;  5ARG A;  5AEN A;  4B8A A;  3CQG B;  4CT4 A;  3EJN A;  1LD8 A;  2BF0 X;  4FLH A;  1TN8 A;  2DZO A;  4N5Q A;  2JLB A;  3CKB A;  3CK9 A;  5FWQ A;  4HOR A;  4RG6 A;  3BG1 B;  3PNL B;  5HRY A;  4GMJ A;  3PDN A;  4I43 A;  4YDW A;  2GRM A;  4XIF A;  5BW8 C;  3FTV A;  5G55 A;  2VSY A;  4MKT A;  4DI4 A;  1IXV A;  2XGS A;  3ML9 A;  2WMN A;  3G2S A;  3LPZ A;  4LCT A;  2VTB A;  4GZ3 A;  1HFA A;  3UXG A;  3CVQ A;  5CRU A;  3IHV A;  4N3C A;  2WQ7 A;  2LAH A;  1OWL A;  1KLX A;  2FUL A;  5KWD A;  1TNO A;  4XI0 A;  4HRL A;  4JPS A;  3FEY A;  3ESK A;  4PDX A;  3KEA A;  3HXE A;  4J8S A;  3ZPJ A;  3PE4 A;  1H6O A;  1N95 A;  2X6K A;  3R7Q A;  4LUN U;  4BY6 A;  1FT2 A;  4U7E B;  5ANR A;  1TEZ A;  4DLQ A;  2YIN A;  3APF A;  2P9S G;  5BXO A;  2Y1L E;  1JPL A;  5BT1 A;  2KCL A;  5KJL A;  4YDY A;  4GYO A;  2IY0 C;  1UN9 A;  3Q49 B;  1KZP A;  5BXU A;  2QYJ A;  3TG4 A;  3CSF A;  2BTD A;  4Y6C A;  5EYP F;  2P58 C;  2P9K G;  1A17 A;  4IUL A;  3APC A;  3L13 A;  5IY5 E;  4DX7 D;  1H6K A;  3AU4 A;  1N4Q A;  4TUM A;  3QAQ A;  3RSE G;  3DPY A;  3VLF A;  1BPO A;  2GRQ B;  3FTY A;  3QOU A;  4UI9 K;  2KXP C;  2WXK A;  2YHE A;  3KSQ A;  3C3R A;  3JCK C;  5JJ7 A;  4FC8 A;  2GGF A;  3PEV B;  2V0P A;  3G2V A;  4U07 A;  1H19 A;  3PZ1 A;  4GCN A;  2AXZ A;  3L08 A;  3ZKJ A;  1VDY A;  3U66 A;  4GMR A;  4EZL A;  4UQX A;  3MX3 A;  3W9F A;  3G2W A;  2AXV A;  4G1T A;  3UT8 A;  5E76 A;  5CRV A;  3UUX A;  4DX2 A;  3X2Q E;  3ZU7 B;  1IKN D;  2LUH A;  3V30 A;  4A1S A;  4KVO A;  4HOQ A;  2WXH A;  3WG7 E;  2GRN B;  3MGB A;  3DBS A;  3P1U A;  5FT9 A;  4HVB A;  2MYO A;  4B8C B;  4WWN A;  5BV0 A;  4N39 A;  3ENE A;  5KJN A;  3KAE A;  3ZNG A;  1DVP A;  4XEI G;  4GZC A;  2Y4T A;  4AP2 A;  4QQI A;  3CVN A;  4BTB A;  5D0Q D;  3ASF A;  4EBA A;  5G05 C;  1AWC B;  2XRZ A;  3L17 A;  1IQR A;  2HR2 A;  1TN6 A;  4G11 A;  2IO2 C;  1HS6 A;  3DSW A;  5M72 A;  2FO7 A;  3FH7 A;  3AS8 A;  2CFU A;  4EEC A;  3ABM E;  2DYS E;  2A5E A;  4JHJ A;  4TUU A;  4GTO A;  2VSX E;  4LSZ E;  3FUE A;  3DEO A;  3CHR A;  1FCH A;  2R2L A;  5JMN D;  2WXF A;  1MX2 A;  1Z6T A;  3E37 A;  4RVB A;  2R17 C;  2ETC A;  3R7R A;  5HQ8 A;  1X5B A;  3Q7F A;  3HVE A;  3RJV A;  4OYS A;  3HXB A;  4O6F A;  3FDH A;  2UY1 B;  3B7U X;  4LNG A;  2IQC A;  3Q73 A;  2KAT A;  3DSU A;  1OXJ A;  3FEX A;  1SA4 A;  3PNT B;  3ZXS A;  2RD0 A;  3ZUV B;  1BI7 B;  4LER A;  2X6I A;  2DVW A;  4RG9 A;  3SQV A;  3UX4 A;  4CGW A;  1HG2 A;  3CHO A;  3EUV A;  1H2V C;  4GTR A;  2JEK A;  4U96 D;  3DST A;  4XKB A;  2Y69 E;  3SBS A;  4U95 D;  5EX3 A;  1EPU A;  1N9A A;  3FH8 A;  4GA0 A;  2ZGG A;  3TG5 A;  1JCS A;  2RKK A;  3G2U A;  3RIB A;  1NL4 A;  2IF4 A;  2KCV A;  4UUC A;  3QWP A;  4Q96 A;  5AQB A;  5FIO A;  3RAU A;  4F3V A;  2L6B A;  3QB2 A;  3GZS A;  5D66 A;  3C98 A;  1OCZ E;  2OVB A;  1S70 B;  2V8S E;  3FUJ A;  2MOW A;  4ANX A;  4Z68 A;  3C5R A;  3SBT B;  3GYZ A;  4TV3 A;  5CER B;  4KXK B;  1N94 A;  3ZW3 A;  5D0O D;  3O48 A;  1QBQ A;  2J9Q A;  2X6F A;  5J90 A;  4J6I A;  4BTA A;  2HM8 A;  3T5X A;  2VGX A;  4YND A;  3ZYK A;  3JXJ A;  5AN8 A;  3CHP A;  1FPP A;  1FT1 A;  3DXK G;  2PM7 A;  2YNQ A;  4WWO A;  2DBA A;  4ANW A;  2NSZ A;  4YVQ C;  4NIK A;  3NQP A;  3DPD A;  3SGH A;  4JZY A;  5B1B E;  4TXQ A;  4JA9 A;  2LO6 A;  3TGO A;  4A3V A;  3S7J A;  1O1T A;  3FTW A;  3TAX A;  3PUK A;  4U0S A;  5FQ7 A;  3JQ1 A;  3Q78 A;  3UKU G;  2WXI A;  2R5S A;  4BX8 A;  3E32 A;  4C48 B;  3ML8 A;  4AEZ C;  2P9N G;  3JXI A;  4HFG A;  4MRU A;  5AAO A;  5ENT D;  3PEU B;  3ZHE A;  5A6C A;  5CEC B;  1TNB A;  1HX8 A;  5EKQ D;  1TNU A;  3C3O A;  3TL5 A;  2P9U G;  5HS0 A;  3U9W A;  1E8X A;  5E75 A;  3Q7A A;  4ZHB A;  3EIJ A;  2I1K A;  2BED A;  4ACL A;  1H6P A;  1TJC A;  3DXM G;  3N71 A;  4GYW A;  3AG2 E;  3TWT A;  3ULQ A;  4I9C A;  3GZ2 A;  3SFX A;  1TNZ A;  4ILG A;  4UWH A;  1DC2 A;  4I2W A;  3SNX A;  2XZT G;  3EU9 A;  1EDU A;  4Q94 A;  4A55 A;  4BET A;  2XHE A;  2XCB A;  3D9I A;  5JHA A;  1HXI A;  3B95 A;  1MZC A;  2LAI A;  3CLJ A;  3AJI A;  2R02 A;  4GAA A;  4JA7 A;  2DWZ A;  2WXG A;  4PS3 A;  4BFR A;  1IYG A;  1E8Y A;  5G05 J;  3R9M A;  3D9P A;  4I17 A;  3EHN A;  2IOL A;  2VYI A;  2VGE A;  1V54 E;  5ENS D;  2XEE A;  4K5C A;  3LVQ E;  3FTS A;  1SVX A;  4GB9 A;  4TXR A;  3LDZ A;  4C0M A;  4GA1 A;  4L2Y A;  3MKR A;  2XGM A;  1NA0 A;  3KD7 A;  1SQM A;  4G8K A;  3RRU A;  1Z3Y A;  5BUZ A;  2UWJ G;  4K03 A;  3Q47 B;  2V5Q C;  2WM9 A;  4J8D A;  4AXH A;  1H2T C;  2QZA A;  2WMO A;  5EID A;  1OT8 A;  3NZU A;  3HXC A;  3AU5 A;  3I4G A;  5ENP D;  3MJW A;  4GYY A;  3D9K A;  1UJJ A;  4HI8 A;  2CHZ A;  1UW4 B;  3JUE A;  1YA0 A;  2XQ0 A;  4R7L A;  2A5U A;  1TYQ G;  5FJY A;  3SFZ A;  5LOZ A;  3ZFW A;  4K0R A;  4HRN A;  1E8Z A;  3HDX A;  2ZIR A;  3KSL A;  3UIP C;  2FI7 A;  1N4P A;  5AIJ A;  1N4S A;  3NF1 A;  4B94 A;  4GTT A;  3FHE A;  4G23 A;  4L23 A;  3ONL A;  2MRI A;  2P9I G;  4AVX A;  3W9G A;  2VSN A;  1DCE A;  5EYL A;  2LXM A;  4PS8 A;  4I6E A;  4UI9 J;  1G3N B;  1MX4 A;  3L16 A;  3ZXP A;  1YCS B;  2VTB B;  1N11 A;  5FZS A;  2EIL E;  4I2Z A;  3Q9N C;  3QWW A;  4L9P A;  3RRN B;  1B89 A;  4B0Z A;  1WG0 A;  4PUC A;  2PZI A;  4FP7 A;  2KZT B;  3NAW A;  1X81 A;  4CZ2 D;  4GZ6 A;  3KS2 A;  3DRA A;  1U3D A;  5EIB E;  4G24 A;  2FEZ A;  5B3S E;  4AY6 A;  3MKQ A;  1JUQ A;  1GW6 A;  3CQC B;  2Y3A A;  5KCM A;  1O1R A;  5C2Y A;  4UQY A;  1QQE A;  4WND A;  2DCP A;  3BG0 B;  4DX6 D;  4U04 A;  1O5M A;  4BWR A;  5DBK A;  1NA3 A;  4DX5 D;  3CHS A;  3LXU X;  3HXD A;  4HLE A;  2OEV A;  4DK5 A;  4N3B A;  1K8K G;  5A23 A;  3U4T A;  3NZS A;  4WNE A;  4EPZ A;  4HOS A;  3MV3 B;  4DPR A;  3S7B A;  4DLO A;  3SFY A;  4AJW A;  4EZK A;  2CHX A;  4D10 C;  2L6J A;  3LVR E;  5CBN A;  5KBA A;  4YDE A;  4ABN A;  1YMP A;  3ZYM A;  5FTP A;  3CEQ A;  4HXI A;  2XS1 A;  4CEM A;  2M63 A;  1UN8 A;  1XGW A;  3SY2 A;  1Z3X A;  2NXP A;  3J5P A;  4KVM A;  2I9C A;  5JJ6 A;  3DSV A;  3V2O A;  5A7D B;  3U3W A;  3HIZ A;  1Z5S C;  4NRH B;  3EHQ A;  3ZN3 A;  2KC7 A;  4GTM A;  4K5B A;  3B7T A;  3DEP A;  3FU0 A;  3MYV A;  3PZD A;  3SZ7 A;  2OOE A;  3ZRH A;  5JJT A;  4JD2 G;  3FUH A;  2UY1 A;  3TWS A;  1BI8 B;  2X6J A;  4DI3 A;  2ZGD A;  1OCR E;  3QNK A;  2LSU A;  4ZFH A;  3TWW A;  1LTX A;  5CMW A;  2ZIS A;  3L9T A;  3S7F A;  3ZGQ A;  2J07 A;  3FP3 A;  3DWL G;  4FLB A;  5AJL A;  4G2V A;  2A4Z A;  3UIO C;  2XEH A;  5LX8 A;  5AYW D;  2CHW A;  4BES A;  1E90 A;  1EYH A;  5AQ7 A;  4BT9 A;  1N52 A;  3LJ3 A;  3T8K A;  4FJY A;  2CFZ A;  4CRW A;  3ULY A;  5ENO D;  4XX5 A;  3UM2 A;  4O1P A;  4E85 A;  4GTS A;  3Q9U C;  4XKC A;  4WNG A;  3FUN A;  4OVV A;  3PVL A;  4HRM B;  3P2B A;  4K5A B;  4APF A;  3AAA C;  3EDT B;  5AQ9 A;  3O4Z A;  2WXM A;  5T4Y A;  2I2O A;  4N3A A;  1E7V A;  3HVE B;  3QK0 A;  4HOU A;  3ABK E;  4G25 A;  4UI9 C;  2LNI A;  3NBN B;  1AP7 A;  1S64 A;  4GCO A;  2WXP A;  3J5Q B;  4RLY A;  3MA5 A;  3KEZ A;  2IFU A;  3U64 A;  1N0Q A;  3I5P A;  3OXG A;  4DX1 A;  3C72 A;  3MCX A;  5FQ4 A;  3L22 A;  4FUL A;  1EF1 C;  1D8E A;  4GTP A;  3D9J A;  3HRA A;  4BEP A;  4U0Z A;  2V5F A;  5T3R A;  5CEA A;  2LXL A;  3UM1 A;  1UOH A;  2ETA A;  3I3N A;  1ELR A;  2JAB A;  1MYO A;  1HU3 A;  1A5E A;  3T8M A;  3VTX A;  4JC8 A; 
#chains in the Genus database with same CATH homology
 4MBG A;  1LD8 A;  2H6G A;  4GTV A;  1DCE A;  1TN7 A;  1N4Q A;  3DSS A;  3EU5 A;  4GTS A;  1TN8 A;  1JCS A;  3DPY A;  1TN6 A;  1O1T A;  1NL4 A;  3DSW A;  3SFY A;  1N4R A;  3KSQ A;  2IEJ A;  4LNB A;  3Q78 A;  3Q79 A;  4YDE A;  3E32 A;  3E30 A;  3Q75 A;  3PZ1 A;  4GTO A;  1TNY A;  4L9P A;  2H6I A;  2H6H A;  2F0Y A;  4EHM A;  3DSV A;  2R2L A;  1S64 A;  3PZ4 A;  1TNB A;  1X81 A;  1SA5 A;  1TNU A;  3HXC A;  4GTM A;  3E37 A;  4GTQ A;  3DRA A;  3Q7A A;  3Q7F A;  2BED A;  1N94 A;  3C72 A;  3HXB A;  1TNO A;  3DSX A;  1D8E A;  4LNG A;  4GTP A;  1O1R A;  1QBQ A;  3Q73 A;  3DSU A;  4YDO A;  3SFX A;  1O1S A;  1NI1 A;  1LD7 A;  3E34 A;  3HXE A;  1SA4 A;  1LTX A;  1KZO A;  2ZIS A;  1JCQ A;  2ZIR A;  3KSL A;  1TNZ A;  1N95 A;  1FPP A;  1FT1 A;  3E33 A;  1FT2 A;  1O5M A;  1N4P A;  1D8D A;  2H6F A;  3HXD A;  3HXF A;  1N4S A;  3EUV A;  4GTR A;  3PZ3 A;  3DST A;  1MZC A;  3PZ2 A;  4GTT A;  1KZP A;  1JCR A;  1S63 A;  1N9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...