1N4RA

Protein geranylgeranyltransferase type-i complexed with a geranylgeranylated kkksktkcvil peptide product
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4rA00
1TNYA 1NL4A 1FPPA 1O1SA 1FT2A 3E37A 1JCSA 2BEDA 3KSLA 3DRAA 3DSXA 1D8DA 1KZPA 4YDOA 4GTPA 2R2LA 3Q75A 4EHMA 3PZ3A 3DSTA 1N4PA 1JCQA 1TNOA 1S63A 4GTOA 1O1TA 4GTRA 1TNBA 4LNBA 3HXDA 1X81A 2H6IA 4GTMA 2H6HA 1TN6A 1D8EA 1LD8A 3E32A 1MZCA 4GTTA 1SA5A 3KSQA 3PZ1A 4LNGA 3E34A 3E33A 3C72A 3E30A 1SA4A 2H6GA 1JCRA 1DCEA 1TN7A 3SFYA 3HXFA 3Q73A 1N4QA 3EUVA 3EU5A 3PZ4A 2ZISA 1TNUA 4GTSA 2H6FA 1S64A 1FT1A 4MBGA 3DSVA 1TNZA 2ZIRA 1N4RA 4YDEA 1LD7A 1O1RA 3PZ2A 3DPYA 4GTQA 1N4SA 3Q7FA 3HXEA 1N9AA 3HXCA 1N95A 1TN8A 1NI1A 3Q7AA 1N94A 3Q78A 4L9PA 1KZOA 3DSWA 4GTVA 3Q79A 2IEJA 3DSUA 3SFXA 3DSSA 1LTXA 2F0YA 1O5MA 1QBQA 3HXBA
chains in the Genus database with same CATH superfamily
3T5VA 4I6GA 3DSXA 5CHEE 3SI5A 3D9KA 5J90A 1KZPA 1PAQA 2YNQA 2LAIA 3LDZA 3Q75A 4B93B 3FEYA 3B7UX 2WXPA 3FWVA 2X6JA 3FFLA 4AJWA 4GTMA 4WNEA 4FJZA 5BW8C 4DLOA 1LD8A 3E32A 1NP7A 1HF8A 3RK6A 4LNGA 3V2XA 5HI7A 3CHQA 2FO1E 2H6GA 2F8XK 4FU3A 3HRAA 3L82A 5EN5D 3FTXA 3GZ2A 1HXIA 2QC9A 3PE4A 3UUXA 4Z68A 4TRQA 4HXIA 3R9AB 3U64A 4WWOA 4XI9A 2H6FA 3DSVA 4Q94A 1HG2A 3DBSA 2FULA 4ANUA 2CHZA 4F7AA 3CVPA 4O1OA 3O4ZA 3APCA 4LG6A 1HU3A 4WNDA 2WXHA 4RG9A 1ELKA 2DIWA 2L6BA 4G24A 4I43A 2WMNA 4O60A 3ZYQA 3HXCA 2EIJE 2VQ2A 1FVFA 1Z6TA 2A5EA 2BTDA 4MLPA 3GZ1A 4YDWA 4MRUA 4KMOA 3V79K 4FADA 1AP7A 3NZUA 4G26A 2OEVA 1H2TC 2BEDA 2GRQB 2CHXA 5B1BE 2KATA 1OWMA 3ASFA 2MRIA 3TWVA 4XEIG 3AS8A 3HYMB 3AG4E 5CRVA 1O1TA 4GB9A 3L13A 1U2VG 1TN6A 1KT1A 5FQ4A 3MX3A 4ZHBA 3ZKJA 2ILRA 2XCBA 4DI4A 3E34A 5CEDB 3ASOE 5FJYA 3FTWA 1WY6A 3SBSA 2IQCA 3QWVA 2JLBA 5KNGA 4PS3A 1MJ0A 4CDRA 5BPPA 5HS0A 4NACA 4ILHB 2YQ8A 3EHNA 4HBDA 1UJKA 4N2SA 3DPYA 4E85A 2WXOA 1K3ZD 2KCKA 4JA9A 4KVOA 4M7CA 4A1SA 2VSYA 1QNFA 4OVUA 4L9PA 3B95A 1JWGA 3HVEB 3UKUG 3DSUA 4F3VA 1WDYA 3KAEA 3AJIA 3ML8A 5C2YA 4CGVA 1NL4A 3ESKA 1OWLA 2QYUA 2PM7A 3FU0A 5FZSA 5FWQA 2A5UA 4GTPA 1K1AA 4UUCA 1HFAA 3D3MA 3JQ0A 2IO2C 2WVIA 3FUIA 2FO7A 2ZXWE 4UWHA 4JEUA 5T3RA 3CHSA 1SA4A 1HS6A 4U0ZA 3T5XA 5FTPA 3TWRA 5JHBA 3RKVA 4UQZA 4XX5A 3PZ4A 2AW6A 3L17A 3C3QA 4HVBA 2HYZA 4L2YA 3SHFA 1TNZA 2P2CP 4JD2G 4GMJA 3EU9A 3PZ2A 1OWPA 4GTQA 3CGHA 3TWTA 4CEMA 4HLLA 3LCAA 3BG0B 4A3TA 1G3NB 2PM6A 4CRWA 5ENOD 3W9GA 3UM0A 4G23A 2PL2A 4U96D 4YDYA 3U4TA 3S2AA 4G1TA 3CQGB 3QK0A 3FTVA 3U9WA 3AAAC 3B7SA 5EYLA 5J08A 4EPZA 5FZRA 3Q47B 5G2NA 1TNOA 1OCZE 2IU1A 4GTRA 1TNBA 2IFUA 3TXMA 3RRNB 1D8EA 3EIQC 1TJCA 4GTTA 2XPYA 1N0QA 5BT1A 1N11A 4ME2A 3HHMA 4GZ5A 4GMLA 3C3OA 1E8ZA 3ZIMA 2CHWA 2XGMA 2R59A 3NF1A 3ZRHA 1NZNA 5KJMA 2C2LA 2I2OA 1SZAA 1FT1A 4U7EB 4K5CA 2DVWA 4JA7A 3G2SA 2BKKB 3AG2E 1TR4A 3RJVA 3D9LA 4APFA 3ZXSA 3CEQA 2XRZA 3QDNA 4JPSA 4HOUA 3S7DA 1A5EA 3TG5A 3G2TA 3ENEA 4GTVA 2AXVA 3FTZA 2IEJA 3DSSA 1NA0A 4ILIA 1Y6IA 4N3AA 3B7BA 1TNYA 3TWSA 5AARA 4XE0A 1TYQG 3D9NA 1O1SA 2P9NG 3DWLG 3VTXA 4C48B 4FULA 1TEZA 4CCAA 4FHKA 2LXMA 1OUVA 4YDOA 3OXLA 4DX5D 4HI8A 2M63A 4AOFA 1B89A 4ILGA 2Q7FA 2IY0C 4J8YA 4CDNA 2QZAA 2XGOA 3D9IA 5KBAA 3SY2A 4CDMA 5BV1A 2VSOE 4I6JA 4OAUC 2LUHA 2YINA 5KJNA 3EHMA 2PNNA 4I17A 2P9PG 3BQOA 1TNUA 5A7DB 4IN3B 2RFAA 4JHJA 3MZLB 3V31A 2XS8A 5ARGA 2X3MA 4P29A 5LX8A 3CKCA 3L6AA 4O1PA 3IV0A 2IO3C 5CECB 4G11A 3ZVVA 2GRMA 2X6FA 2R5SA 3UX4A 5HRYA 2GRRB 1GW6A 1IHGA 1NFIE 3FUEA 2DZNA 4WNGA 4HORA 2X6KA 3CVWA 3NB2A 3B7TA 4N2QA 3QARA 2WXNA 3G2UA 3DRAA 5KJLA 4G8KA 3HDXA 3QWWA 3L08A 1E90A 2V0PA 3CVUA 4N3CA 3DSTA 4GYWA 1OY3D 3AS4A 4BETA 1P5QA 1RW2A 4BFRA 2C0MA 3R7QA 4LERA 5EX3A 5EIBE 2WMOA 1E8YA 4C0MA 3UMVA 3PUKA 4PS8A 4Q69A 4HRMB 2V4HC 3KSQA 3BEEA 4BX8A 3E33A 3NOGD 3UTMA 5D0QD 3ASDA 3ISMC 3ZHEA 4CGWA 2WPVA 2RKKA 2GRNB 1OCCE 4G25A 1AWCB 1OXJA 2J49A 2I6HA 5CCLA 3FTUA 3RSEG 3AS5A 1D9SA 2ZU6B 4KZ0A 4GCNA 5T8IA 2ZGGA 4U8HA 4BT9A 5G05J 4HB5A 2J8SD 2AXZA 3CVXA 1A17A 3PNTB 4KVMA 4JHRA 1IYGA 1U3DA 2IJGX 1PC2A 3S7BA 4AY5A 1NI1A 3QAQA 4J0UA 5KJKA 3ULEG 2XPIA 2YHEA 3C98A 3IEGA 3CVVA 3CVLA 4N39A 3P1UA 1N54A 1BD8A 2L9BA 3CSFA 3KSLA 4GA0A 5AQAA 2AXUA 4U07A 3TAXA 5JHAA 2GRLA 3QJZA 2UWJG 4KBQA 2RD0A 4EHMA 2EQXA 3PZ3A 4DX2A 1MQSA 1ZBPA 5FIOA 5BV0A 2P9SG 4UQXA 1OWOA 2VJ8A 2H6HA 3ABLE 5ANRA 4L23A 4L1BA 1MZCA 2BF0X 3FEXA 1BPOA 3UPVA 2P9IG 3AG3E 3SQVA 1KPSB 1EPUA 4NRHB 3C3RA 4OVVA 3WG7E 2I9CA 1ZU2A 5H7PA 2J08A 5CERB 4EECA 4BTAA 3JXJA 5ENNA 2F37A 5FINA 3D9HA 4DRXE 2J09A 4TUUA 3LS8A 5HKPA 2X38A 5JJ7A 3SF4A 3PEVB 3ZYKA 1H19A 1FCHA 3Q5MA 5E75A 4F1SA 1H6OA 3EHRA 4YVOA 5G55A 2MHKA 2XPZA 3NZSA 1OWNA 2WB2A 2WXIA 2VGEA 4HOQA 3HXBA 2OV8A 4G2VA 5ENSD 1FPPA 4NIKA 4BSXA 3E37A 1JCSA 3SO8A 5EIDA 2XEVA 2MYOA 3JUEA 4GZ3A 1DCQA 1H6KA 4HRLA 4K03A 4GTOA 2AWIA 4GPMA 4DLQA 3SBTB 4AIFA 4L2LA 3PRZA 2L6JA 3IHYA 1K1BA 1HX8A 2L0TB 3D9PA 2CFZA 3KEZA 3MCXA 3E30A 3TWQA 3MYVA 4BWRA 3FU6A 3ZXPA 5AQ9A 3UT8A 3LY9A 4ZFHA 5EKQD 1N0RA 3APFA 1UJJA 3EIJA 4YDEA 2XZTG 4MS6A 1U3CA 4RVBA 3R7RA 3RO2A 3MA5A 3UINC 1VDYA 1Z3YA 3Q7AA 4O6FA 1WAO1 2KM4A 4JZYA 2B6CA 4UQYA 2Y0BG 3ASNE 5BXOA 3CVYA 3J5QB 3LVRE 2XS1A 1LF8A 4I1OB 4JEHA 1WM5A 5HQ8A 4NURA 5E76A 4LCTA 4I1MA 4FA6A 3CK8A 4FC8A 1XNFA 4MKTA 2CG3A 3FUMA 3GZSA 2H6IA 3CK7A 3VLFA 3E4BA 4XZ4A 1E7UA 3PZ1A 4GAAA 3S7JA 1TJFA 4HI9A 2J07A 3FH8A 1JCRA 3FUNA 4PH4B 4PUCA 3Q73A 2GRPB 4LEUA 1KT0A 3FUKA 2R05A 2E0IA 3V30A 4XKCA 1BI8B 2CFUA 4BY6A 1N4RA 5CCMA 4HRNA 1UG3A 4L7TA 1IQUA 1O1RA 3ABKE 4A1GA 2CG2A 3SGHA 4ACKA 5EX0A 4R7LA 4M3OA 2P9KG 2QYJA 4HOTA 1QQEA 3I4RB 3PZDA 4RLYA 2WQHA 1Z5SC 1QZ2A 4UI9J 4NQ0A 2GGFA 1SW6A 4BX9A 1JUQA 4JC8A 2F0YA 5CRUA 4JVSA 2P9UG 4KZCA 4DX7D 2R02A 4RQIA 1FT2A 1NA3A 1UOHA 3LJ3A 3UIOC 4FLBA 5C1DA 3PUJA 1IHBA 2V5QC 3NBNB 1MX4A 3FDHA 4KT6B 4ANWA 2R2LA 5JMND 5FT9A 4C0EA 2OVBA 4GZ6A 1XGWA 4U0SA 3O48A 3FU5A 3ZYLA 3KEAA 4U0UA 1INZA 4J8DA 1BU9A 5AQBA 1SVXA 1X5BA 1IKND 2KBXA 4TV3A 4UWFA 2BKGA 2C0LA 4LUNU 4K5AB 2AVPA 2ETBA 3MV2B 5ENPD 3SZ7A 4ANXA 4JHKA 5CMYA 4ABNA 4Q96A 4IRUA 2X6IA 1ELRA 3ULQA 2X6HA 4J6IA 4PS7A 3U66A 3UM1A 2KZTA 2ONDA 5AYWD 4B8AA 2QFCA 3ZHEB 1L5JA 4EZJA 4XKBA 3L16A 3QOUA 1N95A 1OCOE 2FF4A 3TWUA 4AVXA 3SFXA 1LTXA 3UKRG 2XQ0A 2IOSA 5AN8A 2OEWA 4TXPA 4DPRA 2MOWA 3CV0A 5G04J 4X8QA 4A63B 2EINE 2Y4UA 1DC2A 2WQ6A 1N52A 4OAVB 4AEZC 3B13A 5KNHD 3RRUA 4FJYA 2WM9A 3ASGA 4H7XA 3FULA 1SQMA 3ZGQA 4B94A 5FQ8A 1X81A 4UWGA 4GZDA 3AG1E 4WUYA 5DBKA 3OXGA 4EQFA 4ACLA 3OXFA 3LY8A 3ZW3A 3HG0D 4UI9K 4DI3A 4QQIA 4KXKB 3VTYA 5CBOA 5JA4D 2VTBB 2KCVA 2OVFA 1ZB1A 5DIZA 5KCMA 2XGSA 3IXEA 2HR2A 3LJNA 5ARFA 2IOLA 3ONKA 3N71A 4GTSA 3W9FA 3TWXA 3ESLA 4DX6D 3ABME 4BSZB 4FLHA 1V54E 1IXVA 5ITZF 2KC7A 2E2EA 3UM2A 2VSNA 5D0OD 4GCOA 5LP0A 4EZLA 4TUMA 4GA2A 5B3SE 3Q78A 1KZOA 3DPDA 4XI0A 3LY7A 5EYPF 3Q79A 1Z3XA 4HQDA 1E8WA 4EBAG 5EILA 2WXRA 2IONA 3ASHA 2F8YA 1DVPA 3I4GA 3S7FA 5FZQA 3FH5A 3CHPA 3RIBA 5LFAA 2PZIA 4U8YD 3D9JA 4E6HA 4ATZD 2R17C 4DUIA 5G05C 1HG5A 2XEEA 3PNLB 4IULA 3DEOA 4I2WA 2VTBA 1OCRE 3V2OA 4J8SA 2VGYA 3PS6A 2RG8A 1Y8MA 3CR3A 3CVNA 4KYOB 3UI2A 2QY7A 2LNIA 2YHCA 2HM8A 2WXGA 5IY5E 4LSZE 5AJLA 2ZISA 2DWZA 2GW1A 2UY1A 2Y1LE 4U63A 4AY6A 2B0OE 1HO8A 2GROB 3HXEA 4YVQC 3FTSA 4J8EA 4ANVA 3F6QA 3CQCB 4B8CB 3FP3A 2V5FA 3NOCD 1K8KG 3TJPA 4H7YA 2WQ7A 3EJNA 2WXMA 2XEHA 3OTNA 4AM9A 1EF1C 2NXPA 5FQ6A 5KWDA 1MYOA 3LVQE 1N4PA 1YYHA 2KCLA 2VSXE 4W9RA 1HZ4A 2JABA 2DCPA 4F1PA 4V3IA 3SFZA 3LXUX 5CEAA 3CK9A 3T8MA 4BESA 1QYMA 2XENA 3TL5A 2WXJA 2HE0A 4U8VD 3JCKC 5BNWA 4JW1A 3EU5A 2EIKE 5CBNA 4U95D 3APDA 3ONLA 1SZ9A 3MV3B 4Y6WA 1FVHA 4RSYA 2ZGDA 3CHRA 1S70B 3U3WA 5EDSA 3VLDA 4I6EA 3JQ1A 3TGOA 4LNUD 4B0ZA 3MJWA 3ZFWA 4HS2A 3L22A 3BG1B 3G2WA 1N9AA 1BLXB 1IQRA 1MX6A 2LXLA 2OOEA 3Q49B 1JWFA 3QNKA 4EBAA 4N3BA 3G2VA 3ZUVB 3Q9UC 2IF4A 1O5MA 2XRYA 4I9CA 4HOSA 5JJ6A 4HLEA 3EDTB 2VYIA 3L54A 2VGXB 3CVQA 3FUJA 4CT4A 1D8DA 1E96B 3VLEA 3QB2A 2WXFA 1H2UA 1HH8A 3FTYA 4URKA 1YMPA 3CLJA 1JCQA 4APOA 2OCCE 3Q9NC 3T9KA 4FP7A 4N5CA 3Q15A 4LNBA 3P2BA 4AV7A 3QKYA 4GU5A 3CHOA 3KD7A 3T8KA 4G8LA 4ATGA 4DK5A 3I5PA 3UIPC 4I1AA 2P9LG 1DCEA 3HIZA 3B7RL 4B89A 1TN7A 3SD5A 2XCCA 3HXFA 1N4QA 5M72A 4JB8P 3K9IA 1H6PA 1JPLA 4F53A 3HVEA 2LAHA 3RRMB 2NYJA 3DEPA 4HNAD 3CHMA 3GYZA 2NC9A 3TXNA 3OAWA 3D9MA 4BEPA 4GPKA 3L9TA 2JEKA 1E7VA 1OT8A 4WAFA 2DBAA 2BUGA 4K0RA 4BERA 3ZNGA 2I1KA 4RG6A 1Q2ZA 3BUAA 3RO3A 3JYSA 2EILE 3TG4A 5AAOA 3ZU7B 2PQNA 1H0AA 4WNFA 3ZN3A 4QFVA 2VGXA 2DYSE 3EHQA 4BT8A 4HFGA 1HE8A 1KLXA 1YCSB 3R9MA 1RZ4A 3DXKG 4PDXA 3AU4A 4UWLA 4YNDA 5FQ7A 4GA1A 2J4DA 3UT7A 2KZTB 3I3NA 3QWPA 1W3BA 3MGBA 3MKQB 4Y6CA 1MX2A 3JUIA 2V8SE 4GZCA 3HXDA 3MEKA 2PQRA 2J9QA 3ML9A 3RAUA 3ZPJA 2FI7A 4CZ2D 1DNPA 5A23A 4I2ZA 4EZKA 5B1AE 4UI9C 4FHJA 3URZA 3ZYMA 4F6RD 1ELWA 3LYAA 3EUVA 3FHEA 3CKBA 2J4BA 4GYYA 3C5RA 5ENQD 3RU0A 2ETAA 3PDNA 3FU3A 5JJTA 1WG0A 2A4ZA 3GW4A 1LD7A 5LOZA 3FUFA 3FUHA 3PH0C 2WXQA 2ETCA 1N4SA 3X2QE 3FH7A 2V4LA 2XZDG 4CT0A 3CSTA 3ZEFA 4AP2A 1V55E 4A55A 5ENRD 3JXIA 1S0PA 1H2VC 1N94A 5AQ7A 2WXKA 3DSWA 2Y4TA 3FUDA 4CYMD 3IKOB 4K5BA 4GMRA 3PEUB 3BU8A 3D9OA 2XHEA 1E8XA 1QBQA 4DJAA 4JL0A 5AJDA 3IHVA 4D10C 2RFMA 4A3VA 3PREA 4I9EA 3NQPA 3Q4AB 4AXHA 3MKQA 4DX1A 3AU5A 3J5PA 4U04A 1S63A 3IBEA 4BTBA 4JXTA 2LSVA 3NAWA 3DXMG 4J8FA 4IYPA 2Y3AA 2L0IA 1UW4B 3SNXA 3LPZA 4OYSA 5BXUA 1SA5A 2NSZA 2KXPC 3C72A 5AENA 4J7WA 2EIME 1EDUA 5T4YA 3SFYA 5BUZA 5A6CA 2AJAA 2FEZA 2FBNA 2WXLA 5ENTD 3UXGA 4TXRA 4LRZA 5G04C 5D66A 4WWPA 4GYOA 5ANLA 1S64A 5LCWJ 4MBGA 4WWNA 2ZIRA 2HO1A 3QC1A 2LSUA 1YA0A 2DZOA 3CIAA 2LO6A 3UT4A 2P58C 4UWKA 3ULYA 4C9BB 1EYHA 5AIJA 3UM3A 2I1JA 4N5QA 2R03A 1PY1A 3Q7FA 3FY4A 3WXXA 5LCWC 3TWWA 5D2MC 3LEWA 3KS2A 5CMWA 3LKUA 1TN8A 4TXQA 1UN8A 3UQ3A 2DYRE 3MKRA 1BI7B 4XIFA 3PE3A 2Y69E 1MHQA 3PVLA 1UN9A 2UY1B
chains in the Genus database with same CATH topology
1TNYA 1NL4A 1FPPA 1O1SA 1FT2A 3E37A 1JCSA 2BEDA 3KSLA 3DRAA 3DSXA 1D8DA 1KZPA 4YDOA 4GTPA 2R2LA 3Q75A 4EHMA 3PZ3A 3DSTA 1N4PA 1JCQA 1TNOA 1S63A 4GTOA 1O1TA 4GTRA 1TNBA 4LNBA 3HXDA 1X81A 2H6IA 4GTMA 2H6HA 1TN6A 1D8EA 1LD8A 3E32A 1MZCA 4GTTA 1SA5A 3KSQA 3PZ1A 4LNGA 3E34A 3E33A 3C72A 3E30A 1SA4A 2H6GA 1JCRA 1DCEA 1TN7A 3SFYA 3HXFA 3Q73A 1N4QA 3EUVA 3EU5A 3PZ4A 2ZISA 1TNUA 4GTSA 2H6FA 1S64A 1FT1A 4MBGA 3DSVA 1TNZA 2ZIRA 1N4RA 4YDEA 1LD7A 1O1RA 3PZ2A 3DPYA 4GTQA 1N4SA 3Q7FA 3HXEA 1N9AA 3HXCA 1N95A 1TN8A 1NI1A 3Q7AA 1N94A 3Q78A 4L9PA 1KZOA 3DSWA 4GTVA 3Q79A 2IEJA 3DSUA 3SFXA 3DSSA 1LTXA 2F0YA 1O5MA 1QBQA 3HXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNY A;  1NL4 A;  1FPP A;  1O1S A;  1FT2 A;  3E37 A;  1JCS A;  2BED A;  3KSL A;  3DRA A;  3DSX A;  1D8D A;  1KZP A;  4YDO A;  4GTP A;  2R2L A;  3Q75 A;  4EHM A;  3PZ3 A;  3DST A;  1N4P A;  1JCQ A;  1TNO A;  1S63 A;  4GTO A;  1O1T A;  4GTR A;  1TNB A;  4LNB A;  3HXD A;  1X81 A;  2H6I A;  4GTM A;  2H6H A;  1TN6 A;  1D8E A;  1LD8 A;  3E32 A;  1MZC A;  4GTT A;  1SA5 A;  3KSQ A;  3PZ1 A;  4LNG A;  3E34 A;  3E33 A;  3C72 A;  3E30 A;  1SA4 A;  2H6G A;  1JCR A;  1DCE A;  1TN7 A;  3SFY A;  3HXF A;  3Q73 A;  1N4Q A;  3EUV A;  3EU5 A;  3PZ4 A;  2ZIS A;  1TNU A;  4GTS A;  2H6F A;  1S64 A;  1FT1 A;  4MBG A;  3DSV A;  1TNZ A;  2ZIR A;  1N4R A;  4YDE A;  1LD7 A;  1O1R A;  3PZ2 A;  3DPY A;  4GTQ A;  1N4S A;  3Q7F A;  3HXE A;  1N9A A;  3HXC A;  1N95 A;  1TN8 A;  1NI1 A;  3Q7A A;  1N94 A;  3Q78 A;  4L9P A;  1KZO A;  3DSW A;  4GTV A;  3Q79 A;  2IEJ A;  3DSU A;  3SFX A;  3DSS A;  1LTX A;  2F0Y A;  1O5M A;  1QBQ A;  3HXB A; 
#chains in the Genus database with same CATH topology
 3T5V A;  4I6G A;  3DSX A;  5CHE E;  3SI5 A;  3D9K A;  5J90 A;  1KZP A;  1PAQ A;  2YNQ A;  2LAI A;  3LDZ A;  3Q75 A;  4B93 B;  3FEY A;  3B7U X;  2WXP A;  3FWV A;  2X6J A;  3FFL A;  4AJW A;  4GTM A;  4WNE A;  4FJZ A;  5BW8 C;  4DLO A;  1LD8 A;  3E32 A;  1NP7 A;  1HF8 A;  3RK6 A;  4LNG A;  3V2X A;  5HI7 A;  3CHQ A;  2FO1 E;  2H6G A;  2F8X K;  4FU3 A;  3HRA A;  3L82 A;  5EN5 D;  3FTX A;  3GZ2 A;  1HXI A;  2QC9 A;  3PE4 A;  3UUX A;  4Z68 A;  4TRQ A;  4HXI A;  3R9A B;  3U64 A;  4WWO A;  4XI9 A;  2H6F A;  3DSV A;  4Q94 A;  1HG2 A;  3DBS A;  2FUL A;  4ANU A;  2CHZ A;  4F7A A;  3CVP A;  4O1O A;  3O4Z A;  3APC A;  4LG6 A;  1HU3 A;  4WND A;  2WXH A;  4RG9 A;  1ELK A;  2DIW A;  2L6B A;  4G24 A;  4I43 A;  2WMN A;  4O60 A;  3ZYQ A;  3HXC A;  2EIJ E;  2VQ2 A;  1FVF A;  1Z6T A;  2A5E A;  2BTD A;  4MLP A;  3GZ1 A;  4YDW A;  4MRU A;  4KMO A;  3V79 K;  4FAD A;  1AP7 A;  3NZU A;  4G26 A;  2OEV A;  1H2T C;  2BED A;  2GRQ B;  2CHX A;  5B1B E;  2KAT A;  1OWM A;  3ASF A;  2MRI A;  3TWV A;  4XEI G;  3AS8 A;  3HYM B;  3AG4 E;  5CRV A;  1O1T A;  4GB9 A;  3L13 A;  1U2V G;  1TN6 A;  1KT1 A;  5FQ4 A;  3MX3 A;  4ZHB A;  3ZKJ A;  2ILR A;  2XCB A;  4DI4 A;  3E34 A;  5CED B;  3ASO E;  5FJY A;  3FTW A;  1WY6 A;  3SBS A;  2IQC A;  3QWV A;  2JLB A;  5KNG A;  4PS3 A;  1MJ0 A;  4CDR A;  5BPP A;  5HS0 A;  4NAC A;  4ILH B;  2YQ8 A;  3EHN A;  4HBD A;  1UJK A;  4N2S A;  3DPY A;  4E85 A;  2WXO A;  1K3Z D;  2KCK A;  4JA9 A;  4KVO A;  4M7C A;  4A1S A;  2VSY A;  1QNF A;  4OVU A;  4L9P A;  3B95 A;  1JWG A;  3HVE B;  3UKU G;  3DSU A;  4F3V A;  1WDY A;  3KAE A;  3AJI A;  3ML8 A;  5C2Y A;  4CGV A;  1NL4 A;  3ESK A;  1OWL A;  2QYU A;  2PM7 A;  3FU0 A;  5FZS A;  5FWQ A;  2A5U A;  4GTP A;  1K1A A;  4UUC A;  1HFA A;  3D3M A;  3JQ0 A;  2IO2 C;  2WVI A;  3FUI A;  2FO7 A;  2ZXW E;  4UWH A;  4JEU A;  5T3R A;  3CHS A;  1SA4 A;  1HS6 A;  4U0Z A;  3T5X A;  5FTP A;  3TWR A;  5JHB A;  3RKV A;  4UQZ A;  4XX5 A;  3PZ4 A;  2AW6 A;  3L17 A;  3C3Q A;  4HVB A;  2HYZ A;  4L2Y A;  3SHF A;  1TNZ A;  2P2C P;  4JD2 G;  4GMJ A;  3EU9 A;  3PZ2 A;  1OWP A;  4GTQ A;  3CGH A;  3TWT A;  4CEM A;  4HLL A;  3LCA A;  3BG0 B;  4A3T A;  1G3N B;  2PM6 A;  4CRW A;  5ENO D;  3W9G A;  3UM0 A;  4G23 A;  2PL2 A;  4U96 D;  4YDY A;  3U4T A;  3S2A A;  4G1T A;  3CQG B;  3QK0 A;  3FTV A;  3U9W A;  3AAA C;  3B7S A;  5EYL A;  5J08 A;  4EPZ A;  5FZR A;  3Q47 B;  5G2N A;  1TNO A;  1OCZ E;  2IU1 A;  4GTR A;  1TNB A;  2IFU A;  3TXM A;  3RRN B;  1D8E A;  3EIQ C;  1TJC A;  4GTT A;  2XPY A;  1N0Q A;  5BT1 A;  1N11 A;  4ME2 A;  3HHM A;  4GZ5 A;  4GML A;  3C3O A;  1E8Z A;  3ZIM A;  2CHW A;  2XGM A;  2R59 A;  3NF1 A;  3ZRH A;  1NZN A;  5KJM A;  2C2L A;  2I2O A;  1SZA A;  1FT1 A;  4U7E B;  4K5C A;  2DVW A;  4JA7 A;  3G2S A;  2BKK B;  3AG2 E;  1TR4 A;  3RJV A;  3D9L A;  4APF A;  3ZXS A;  3CEQ A;  2XRZ A;  3QDN A;  4JPS A;  4HOU A;  3S7D A;  1A5E A;  3TG5 A;  3G2T A;  3ENE A;  4GTV A;  2AXV A;  3FTZ A;  2IEJ A;  3DSS A;  1NA0 A;  4ILI A;  1Y6I A;  4N3A A;  3B7B A;  1TNY A;  3TWS A;  5AAR A;  4XE0 A;  1TYQ G;  3D9N A;  1O1S A;  2P9N G;  3DWL G;  3VTX A;  4C48 B;  4FUL A;  1TEZ A;  4CCA A;  4FHK A;  2LXM A;  1OUV A;  4YDO A;  3OXL A;  4DX5 D;  4HI8 A;  2M63 A;  4AOF A;  1B89 A;  4ILG A;  2Q7F A;  2IY0 C;  4J8Y A;  4CDN A;  2QZA A;  2XGO A;  3D9I A;  5KBA A;  3SY2 A;  4CDM A;  5BV1 A;  2VSO E;  4I6J A;  4OAU C;  2LUH A;  2YIN A;  5KJN A;  3EHM A;  2PNN A;  4I17 A;  2P9P G;  3BQO A;  1TNU A;  5A7D B;  4IN3 B;  2RFA A;  4JHJ A;  3MZL B;  3V31 A;  2XS8 A;  5ARG A;  2X3M A;  4P29 A;  5LX8 A;  3CKC A;  3L6A A;  4O1P A;  3IV0 A;  2IO3 C;  5CEC B;  4G11 A;  3ZVV A;  2GRM A;  2X6F A;  2R5S A;  3UX4 A;  5HRY A;  2GRR B;  1GW6 A;  1IHG A;  1NFI E;  3FUE A;  2DZN A;  4WNG A;  4HOR A;  2X6K A;  3CVW A;  3NB2 A;  3B7T A;  4N2Q A;  3QAR A;  2WXN A;  3G2U A;  3DRA A;  5KJL A;  4G8K A;  3HDX A;  3QWW A;  3L08 A;  1E90 A;  2V0P A;  3CVU A;  4N3C A;  3DST A;  4GYW A;  1OY3 D;  3AS4 A;  4BET A;  1P5Q A;  1RW2 A;  4BFR A;  2C0M A;  3R7Q A;  4LER A;  5EX3 A;  5EIB E;  2WMO A;  1E8Y A;  4C0M A;  3UMV A;  3PUK A;  4PS8 A;  4Q69 A;  4HRM B;  2V4H C;  3KSQ A;  3BEE A;  4BX8 A;  3E33 A;  3NOG D;  3UTM A;  5D0Q D;  3ASD A;  3ISM C;  3ZHE A;  4CGW A;  2WPV A;  2RKK A;  2GRN B;  1OCC E;  4G25 A;  1AWC B;  1OXJ A;  2J49 A;  2I6H A;  5CCL A;  3FTU A;  3RSE G;  3AS5 A;  1D9S A;  2ZU6 B;  4KZ0 A;  4GCN A;  5T8I A;  2ZGG A;  4U8H A;  4BT9 A;  5G05 J;  4HB5 A;  2J8S D;  2AXZ A;  3CVX A;  1A17 A;  3PNT B;  4KVM A;  4JHR A;  1IYG A;  1U3D A;  2IJG X;  1PC2 A;  3S7B A;  4AY5 A;  1NI1 A;  3QAQ A;  4J0U A;  5KJK A;  3ULE G;  2XPI A;  2YHE A;  3C98 A;  3IEG A;  3CVV A;  3CVL A;  4N39 A;  3P1U A;  1N54 A;  1BD8 A;  2L9B A;  3CSF A;  3KSL A;  4GA0 A;  5AQA A;  2AXU A;  4U07 A;  3TAX A;  5JHA A;  2GRL A;  3QJZ A;  2UWJ G;  4KBQ A;  2RD0 A;  4EHM A;  2EQX A;  3PZ3 A;  4DX2 A;  1MQS A;  1ZBP A;  5FIO A;  5BV0 A;  2P9S G;  4UQX A;  1OWO A;  2VJ8 A;  2H6H A;  3ABL E;  5ANR A;  4L23 A;  4L1B A;  1MZC A;  2BF0 X;  3FEX A;  1BPO A;  3UPV A;  2P9I G;  3AG3 E;  3SQV A;  1KPS B;  1EPU A;  4NRH B;  3C3R A;  4OVV A;  3WG7 E;  2I9C A;  1ZU2 A;  5H7P A;  2J08 A;  5CER B;  4EEC A;  4BTA A;  3JXJ A;  5ENN A;  2F37 A;  5FIN A;  3D9H A;  4DRX E;  2J09 A;  4TUU A;  3LS8 A;  5HKP A;  2X38 A;  5JJ7 A;  3SF4 A;  3PEV B;  3ZYK A;  1H19 A;  1FCH A;  3Q5M A;  5E75 A;  4F1S A;  1H6O A;  3EHR A;  4YVO A;  5G55 A;  2MHK A;  2XPZ A;  3NZS A;  1OWN A;  2WB2 A;  2WXI A;  2VGE A;  4HOQ A;  3HXB A;  2OV8 A;  4G2V A;  5ENS D;  1FPP A;  4NIK A;  4BSX A;  3E37 A;  1JCS A;  3SO8 A;  5EID A;  2XEV A;  2MYO A;  3JUE A;  4GZ3 A;  1DCQ A;  1H6K A;  4HRL A;  4K03 A;  4GTO A;  2AWI A;  4GPM A;  4DLQ A;  3SBT B;  4AIF A;  4L2L A;  3PRZ A;  2L6J A;  3IHY A;  1K1B A;  1HX8 A;  2L0T B;  3D9P A;  2CFZ A;  3KEZ A;  3MCX A;  3E30 A;  3TWQ A;  3MYV A;  4BWR A;  3FU6 A;  3ZXP A;  5AQ9 A;  3UT8 A;  3LY9 A;  4ZFH A;  5EKQ D;  1N0R A;  3APF A;  1UJJ A;  3EIJ A;  4YDE A;  2XZT G;  4MS6 A;  1U3C A;  4RVB A;  3R7R A;  3RO2 A;  3MA5 A;  3UIN C;  1VDY A;  1Z3Y A;  3Q7A A;  4O6F A;  1WAO 1;  2KM4 A;  4JZY A;  2B6C A;  4UQY A;  2Y0B G;  3ASN E;  5BXO A;  3CVY A;  3J5Q B;  3LVR E;  2XS1 A;  1LF8 A;  4I1O B;  4JEH A;  1WM5 A;  5HQ8 A;  4NUR A;  5E76 A;  4LCT A;  4I1M A;  4FA6 A;  3CK8 A;  4FC8 A;  1XNF A;  4MKT A;  2CG3 A;  3FUM A;  3GZS A;  2H6I A;  3CK7 A;  3VLF A;  3E4B A;  4XZ4 A;  1E7U A;  3PZ1 A;  4GAA A;  3S7J A;  1TJF A;  4HI9 A;  2J07 A;  3FH8 A;  1JCR A;  3FUN A;  4PH4 B;  4PUC A;  3Q73 A;  2GRP B;  4LEU A;  1KT0 A;  3FUK A;  2R05 A;  2E0I A;  3V30 A;  4XKC A;  1BI8 B;  2CFU A;  4BY6 A;  1N4R A;  5CCM A;  4HRN A;  1UG3 A;  4L7T A;  1IQU A;  1O1R A;  3ABK E;  4A1G A;  2CG2 A;  3SGH A;  4ACK A;  5EX0 A;  4R7L A;  4M3O A;  2P9K G;  2QYJ A;  4HOT A;  1QQE A;  3I4R B;  3PZD A;  4RLY A;  2WQH A;  1Z5S C;  1QZ2 A;  4UI9 J;  4NQ0 A;  2GGF A;  1SW6 A;  4BX9 A;  1JUQ A;  4JC8 A;  2F0Y A;  5CRU A;  4JVS A;  2P9U G;  4KZC A;  4DX7 D;  2R02 A;  4RQI A;  1FT2 A;  1NA3 A;  1UOH A;  3LJ3 A;  3UIO C;  4FLB A;  5C1D A;  3PUJ A;  1IHB A;  2V5Q C;  3NBN B;  1MX4 A;  3FDH A;  4KT6 B;  4ANW A;  2R2L A;  5JMN D;  5FT9 A;  4C0E A;  2OVB A;  4GZ6 A;  1XGW A;  4U0S A;  3O48 A;  3FU5 A;  3ZYL A;  3KEA A;  4U0U A;  1INZ A;  4J8D A;  1BU9 A;  5AQB A;  1SVX A;  1X5B A;  1IKN D;  2KBX A;  4TV3 A;  4UWF A;  2BKG A;  2C0L A;  4LUN U;  4K5A B;  2AVP A;  2ETB A;  3MV2 B;  5ENP D;  3SZ7 A;  4ANX A;  4JHK A;  5CMY A;  4ABN A;  4Q96 A;  4IRU A;  2X6I A;  1ELR A;  3ULQ A;  2X6H A;  4J6I A;  4PS7 A;  3U66 A;  3UM1 A;  2KZT A;  2OND A;  5AYW D;  4B8A A;  2QFC A;  3ZHE B;  1L5J A;  4EZJ A;  4XKB A;  3L16 A;  3QOU A;  1N95 A;  1OCO E;  2FF4 A;  3TWU A;  4AVX A;  3SFX A;  1LTX A;  3UKR G;  2XQ0 A;  2IOS A;  5AN8 A;  2OEW A;  4TXP A;  4DPR A;  2MOW A;  3CV0 A;  5G04 J;  4X8Q A;  4A63 B;  2EIN E;  2Y4U A;  1DC2 A;  2WQ6 A;  1N52 A;  4OAV B;  4AEZ C;  3B13 A;  5KNH D;  3RRU A;  4FJY A;  2WM9 A;  3ASG A;  4H7X A;  3FUL A;  1SQM A;  3ZGQ A;  4B94 A;  5FQ8 A;  1X81 A;  4UWG A;  4GZD A;  3AG1 E;  4WUY A;  5DBK A;  3OXG A;  4EQF A;  4ACL A;  3OXF A;  3LY8 A;  3ZW3 A;  3HG0 D;  4UI9 K;  4DI3 A;  4QQI A;  4KXK B;  3VTY A;  5CBO A;  5JA4 D;  2VTB B;  2KCV A;  2OVF A;  1ZB1 A;  5DIZ A;  5KCM A;  2XGS A;  3IXE A;  2HR2 A;  3LJN A;  5ARF A;  2IOL A;  3ONK A;  3N71 A;  4GTS A;  3W9F A;  3TWX A;  3ESL A;  4DX6 D;  3ABM E;  4BSZ B;  4FLH A;  1V54 E;  1IXV A;  5ITZ F;  2KC7 A;  2E2E A;  3UM2 A;  2VSN A;  5D0O D;  4GCO A;  5LP0 A;  4EZL A;  4TUM A;  4GA2 A;  5B3S E;  3Q78 A;  1KZO A;  3DPD A;  4XI0 A;  3LY7 A;  5EYP F;  3Q79 A;  1Z3X A;  4HQD A;  1E8W A;  4EBA G;  5EIL A;  2WXR A;  2ION A;  3ASH A;  2F8Y A;  1DVP A;  3I4G A;  3S7F A;  5FZQ A;  3FH5 A;  3CHP A;  3RIB A;  5LFA A;  2PZI A;  4U8Y D;  3D9J A;  4E6H A;  4ATZ D;  2R17 C;  4DUI A;  5G05 C;  1HG5 A;  2XEE A;  3PNL B;  4IUL A;  3DEO A;  4I2W A;  2VTB A;  1OCR E;  3V2O A;  4J8S A;  2VGY A;  3PS6 A;  2RG8 A;  1Y8M A;  3CR3 A;  3CVN A;  4KYO B;  3UI2 A;  2QY7 A;  2LNI A;  2YHC A;  2HM8 A;  2WXG A;  5IY5 E;  4LSZ E;  5AJL A;  2ZIS A;  2DWZ A;  2GW1 A;  2UY1 A;  2Y1L E;  4U63 A;  4AY6 A;  2B0O E;  1HO8 A;  2GRO B;  3HXE A;  4YVQ C;  3FTS A;  4J8E A;  4ANV A;  3F6Q A;  3CQC B;  4B8C B;  3FP3 A;  2V5F A;  3NOC D;  1K8K G;  3TJP A;  4H7Y A;  2WQ7 A;  3EJN A;  2WXM A;  2XEH A;  3OTN A;  4AM9 A;  1EF1 C;  2NXP A;  5FQ6 A;  5KWD A;  1MYO A;  3LVQ E;  1N4P A;  1YYH A;  2KCL A;  2VSX E;  4W9R A;  1HZ4 A;  2JAB A;  2DCP A;  4F1P A;  4V3I A;  3SFZ A;  3LXU X;  5CEA A;  3CK9 A;  3T8M A;  4BES A;  1QYM A;  2XEN A;  3TL5 A;  2WXJ A;  2HE0 A;  4U8V D;  3JCK C;  5BNW A;  4JW1 A;  3EU5 A;  2EIK E;  5CBN A;  4U95 D;  3APD A;  3ONL A;  1SZ9 A;  3MV3 B;  4Y6W A;  1FVH A;  4RSY A;  2ZGD A;  3CHR A;  1S70 B;  3U3W A;  5EDS A;  3VLD A;  4I6E A;  3JQ1 A;  3TGO A;  4LNU D;  4B0Z A;  3MJW A;  3ZFW A;  4HS2 A;  3L22 A;  3BG1 B;  3G2W A;  1N9A A;  1BLX B;  1IQR A;  1MX6 A;  2LXL A;  2OOE A;  3Q49 B;  1JWF A;  3QNK A;  4EBA A;  4N3B A;  3G2V A;  3ZUV B;  3Q9U C;  2IF4 A;  1O5M A;  2XRY A;  4I9C A;  4HOS A;  5JJ6 A;  4HLE A;  3EDT B;  2VYI A;  3L54 A;  2VGX B;  3CVQ A;  3FUJ A;  4CT4 A;  1D8D A;  1E96 B;  3VLE A;  3QB2 A;  2WXF A;  1H2U A;  1HH8 A;  3FTY A;  4URK A;  1YMP A;  3CLJ A;  1JCQ A;  4APO A;  2OCC E;  3Q9N C;  3T9K A;  4FP7 A;  4N5C A;  3Q15 A;  4LNB A;  3P2B A;  4AV7 A;  3QKY A;  4GU5 A;  3CHO A;  3KD7 A;  3T8K A;  4G8L A;  4ATG A;  4DK5 A;  3I5P A;  3UIP C;  4I1A A;  2P9L G;  1DCE A;  3HIZ A;  3B7R L;  4B89 A;  1TN7 A;  3SD5 A;  2XCC A;  3HXF A;  1N4Q A;  5M72 A;  4JB8 P;  3K9I A;  1H6P A;  1JPL A;  4F53 A;  3HVE A;  2LAH A;  3RRM B;  2NYJ A;  3DEP A;  4HNA D;  3CHM A;  3GYZ A;  2NC9 A;  3TXN A;  3OAW A;  3D9M A;  4BEP A;  4GPK A;  3L9T A;  2JEK A;  1E7V A;  1OT8 A;  4WAF A;  2DBA A;  2BUG A;  4K0R A;  4BER A;  3ZNG A;  2I1K A;  4RG6 A;  1Q2Z A;  3BUA A;  3RO3 A;  3JYS A;  2EIL E;  3TG4 A;  5AAO A;  3ZU7 B;  2PQN A;  1H0A A;  4WNF A;  3ZN3 A;  4QFV A;  2VGX A;  2DYS E;  3EHQ A;  4BT8 A;  4HFG A;  1HE8 A;  1KLX A;  1YCS B;  3R9M A;  1RZ4 A;  3DXK G;  4PDX A;  3AU4 A;  4UWL A;  4YND A;  5FQ7 A;  4GA1 A;  2J4D A;  3UT7 A;  2KZT B;  3I3N A;  3QWP A;  1W3B A;  3MGB A;  3MKQ B;  4Y6C A;  1MX2 A;  3JUI A;  2V8S E;  4GZC A;  3HXD A;  3MEK A;  2PQR A;  2J9Q A;  3ML9 A;  3RAU A;  3ZPJ A;  2FI7 A;  4CZ2 D;  1DNP A;  5A23 A;  4I2Z A;  4EZK A;  5B1A E;  4UI9 C;  4FHJ A;  3URZ A;  3ZYM A;  4F6R D;  1ELW A;  3LYA A;  3EUV A;  3FHE A;  3CKB A;  2J4B A;  4GYY A;  3C5R A;  5ENQ D;  3RU0 A;  2ETA A;  3PDN A;  3FU3 A;  5JJT A;  1WG0 A;  2A4Z A;  3GW4 A;  1LD7 A;  5LOZ A;  3FUF A;  3FUH A;  3PH0 C;  2WXQ A;  2ETC A;  1N4S A;  3X2Q E;  3FH7 A;  2V4L A;  2XZD G;  4CT0 A;  3CST A;  3ZEF A;  4AP2 A;  1V55 E;  4A55 A;  5ENR D;  3JXI A;  1S0P A;  1H2V C;  1N94 A;  5AQ7 A;  2WXK A;  3DSW A;  2Y4T A;  3FUD A;  4CYM D;  3IKO B;  4K5B A;  4GMR A;  3PEU B;  3BU8 A;  3D9O A;  2XHE A;  1E8X A;  1QBQ A;  4DJA A;  4JL0 A;  5AJD A;  3IHV A;  4D10 C;  2RFM A;  4A3V A;  3PRE A;  4I9E A;  3NQP A;  3Q4A B;  4AXH A;  3MKQ A;  4DX1 A;  3AU5 A;  3J5P A;  4U04 A;  1S63 A;  3IBE A;  4BTB A;  4JXT A;  2LSV A;  3NAW A;  3DXM G;  4J8F A;  4IYP A;  2Y3A A;  2L0I A;  1UW4 B;  3SNX A;  3LPZ A;  4OYS A;  5BXU A;  1SA5 A;  2NSZ A;  2KXP C;  3C72 A;  5AEN A;  4J7W A;  2EIM E;  1EDU A;  5T4Y A;  3SFY A;  5BUZ A;  5A6C A;  2AJA A;  2FEZ A;  2FBN A;  2WXL A;  5ENT D;  3UXG A;  4TXR A;  4LRZ A;  5G04 C;  5D66 A;  4WWP A;  4GYO A;  5ANL A;  1S64 A;  5LCW J;  4MBG A;  4WWN A;  2ZIR A;  2HO1 A;  3QC1 A;  2LSU A;  1YA0 A;  2DZO A;  3CIA A;  2LO6 A;  3UT4 A;  2P58 C;  4UWK A;  3ULY A;  4C9B B;  1EYH A;  5AIJ A;  3UM3 A;  2I1J A;  4N5Q A;  2R03 A;  1PY1 A;  3Q7F A;  3FY4 A;  3WXX A;  5LCW C;  3TWW A;  5D2M C;  3LEW A;  3KS2 A;  5CMW A;  3LKU A;  1TN8 A;  4TXQ A;  1UN8 A;  3UQ3 A;  2DYR E;  3MKR A;  1BI7 B;  4XIF A;  3PE3 A;  2Y69 E;  1MHQ A;  3PVL A;  1UN9 A;  2UY1 B; 
#chains in the Genus database with same CATH homology
 1TNY A;  1NL4 A;  1FPP A;  1O1S A;  1FT2 A;  3E37 A;  1JCS A;  2BED A;  3KSL A;  3DRA A;  3DSX A;  1D8D A;  1KZP A;  4YDO A;  4GTP A;  2R2L A;  3Q75 A;  4EHM A;  3PZ3 A;  3DST A;  1N4P A;  1JCQ A;  1TNO A;  1S63 A;  4GTO A;  1O1T A;  4GTR A;  1TNB A;  4LNB A;  3HXD A;  1X81 A;  2H6I A;  4GTM A;  2H6H A;  1TN6 A;  1D8E A;  1LD8 A;  3E32 A;  1MZC A;  4GTT A;  1SA5 A;  3KSQ A;  3PZ1 A;  4LNG A;  3E34 A;  3E33 A;  3C72 A;  3E30 A;  1SA4 A;  2H6G A;  1JCR A;  1DCE A;  1TN7 A;  3SFY A;  3HXF A;  3Q73 A;  1N4Q A;  3EUV A;  3EU5 A;  3PZ4 A;  2ZIS A;  1TNU A;  4GTS A;  2H6F A;  1S64 A;  1FT1 A;  4MBG A;  3DSV A;  1TNZ A;  2ZIR A;  1N4R A;  4YDE A;  1LD7 A;  1O1R A;  3PZ2 A;  3DPY A;  4GTQ A;  1N4S A;  3Q7F A;  3HXE A;  1N9A A;  3HXC A;  1N95 A;  1TN8 A;  1NI1 A;  3Q7A A;  1N94 A;  3Q78 A;  4L9P A;  1KZO A;  3DSW A;  4GTV A;  3Q79 A;  2IEJ A;  3DSU A;  3SFX A;  3DSS A;  1LTX A;  2F0Y A;  1O5M A;  1QBQ A;  3HXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...