1N4RA

Protein geranylgeranyltransferase type-i complexed with a geranylgeranylated kkksktkcvil peptide product
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of mammalian protein geranylgeranyltransferase type-I
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 124
structure length 314
sequence length 314
chains with identical sequence C, E, G, I, K
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1n4rA00
3PZ3A 3DSTA 3E30A 3Q7FA 3Q79A 2R2LA 1N4SA 3EU5A 1LTXA 1DCEA 3C72A 1N94A 3DSXA 3E33A 4GTMA 2H6HA 1O1SA 1TN7A 3DSSA 2H6GA 1FT1A 1NL4A 2ZIRA 3PZ1A 4L9PA 1MZCA 1N4RA 1S63A 1N9AA 1LD7A 4GTPA 1JCSA 1SA4A 1JCQA 2H6FA 3Q73A 1NI1A 1SA5A 3E32A 3KSQA 1S64A 3DSUA 1LD8A 3HXEA 1FPPA 3HXDA 2H6IA 1TN6A 1N4QA 1N95A 1FT2A 3DSVA 1O1TA 1X81A 4YDOA 1TN8A 1TNUA 4GTQA 3HXCA 1TNOA 1TNZA 1N4PA 1QBQA 1O1RA 3EUVA 3Q75A 3PZ2A 3E34A 2BEDA 4GTTA 1JCRA 4GTSA 1O5MA 2ZISA 3Q78A 4MBGA 3KSLA 4GTRA 1D8DA 1D8EA 3DRAA 3Q7AA 4GTOA 4LNBA 2IEJA 4LNGA 3HXBA 3DPYA 3PZ4A 4YDEA 1KZPA 3E37A 3HXFA 1KZOA 4EHMA 3SFXA 1TNBA 4GTVA 2F0YA 1TNYA 3DSWA 3SFYA
chains in the Genus database with same CATH superfamily
3QKYA 3PZ3A 3ZNGA 4ABNA 2CG3A 2WM9A 2PQRA 4UWHA 3TWWA 2IO2C 2V5FA 1HO8A 3JXJA 2H6HA 2VSYA 4ME2A 5FZSA 3ASFA 2ZIRA 3RAUA 4EPZA 4J0UA 2XHEA 5CCMA 4GTPA 2ONDA 2LUHA 4FU3A 3ZW3A 3G2VA 2BF0X 2OVFA 4UUCA 3K9IA 4N3BA 2Y0BG 4O60A 3UM1A 2IOSA 4JA7A 1YCSB 3QK0A 3C98A 4F1SA 3R7QA 3CSFA 4F7AA 1PC2A 4K0RA 4K5CA 2GRRB 4F6RD 4G25A 3TXNA 1UG3A 4APFA 2XRYA 4FA6A 1QZ2A 4U63A 3LXUX 1IXVA 1H2VC 3RK6A 4J8FA 3DRAA 3PUKA 1K1BA 1ELRA 2WQ6A 3FEXA 3CGHA 2VTBB 3VLEA 4U96D 1OWMA 4F3VA 2A5UA 5G04C 1D9SA 2XGMA 5CHEE 3EHQA 3TWUA 4I2ZA 5ENSD 4RG6A 2IFUA 4ANVA 3CV0A 3SBTB 4BX8A 4OYSA 2JABA 3FTUA 3KD7A 5CRVA 1N54A 2CFZA 3PZ1A 3LYAA 5CCLA 2LSUA 4TV3A 3W9GA 1N4RA 4ILIA 5C1DA 2Y4TA 5EYLA 2DWZA 1A5EA 3L6AA 1HH8A 4RVBA 5D66A 3SGHA 1BLXB 1OWLA 3QWPA 1O1TA 2XZDG 3B7RL 4XIFA 3ZRHA 1MX4A 4XI9A 5FT9A 1TJFA 3MZLB 2BEDA 1B89A 4BY6A 5AQAA 5HQ8A 2FO1E 1OCZE 4G8LA 3MCXA 5KBAA 2P9LG 1HX8A 2E2EA 4KT6B 1OY3D 1TR4A 3Q4AB 3S7DA 1N0QA 1U3DA 3AG1E 1HG5A 3TWQA 5ARGA 4BSZB 5CECB 1Z6TA 2J4BA 3AS8A 4FJYA 3BG0B 1NP7A 3ABKE 3FH5A 2XQ0A 2WXPA 4MLPA 4RG9A 5ANRA 5FQ6A 4DX2A 4U8YD 3QAQA 3EIJA 3FUEA 3PH0C 5EDSA 2WXNA 1NA0A 3CK8A 3ML8A 1GW6A 2DVWA 2KC7A 4J8EA 5KWDA 2P58C 3LJNA 4IULA 4L23A 3ESLA 3DWLG 2EIME 1FPPA 5D2MC 4HQDA 4JVSA 3QARA 3NQPA 5B1AE 5KJKA 2XS8A 4Q96A 1Y8MA 5AJDA 4WWOA 2HR2A 4N39A 3LJ3A 4PS7A 4XE0A 2J49A 1V54E 3MKQB 3CHSA 2CFUA 3D9KA 1P5QA 3HVEA 2F8XK 1LF8A 5BXUA 3CQGB 3DEPA 1WM5A 4BETA 3HHMA 1DNPA 2L6JA 4B93B 4EQFA 3ABLE 3ISMC 4GZ5A 1TNBA 3S2AA 4EZKA 4M3OA 3TWSA 3FU5A 3RO3A 1EF1C 3PE3A 4I1MA 1HZ4A 1BPOA 3LVQE 3GZ2A 4KMOA 1FVHA 3AG3E 1IQUA 4URKA 5EIDA 4Q69A 3I5PA 3ASGA 3CHRA 3NZSA 2A5EA 2KCLA 1N9AA 2VGEA 2MRIA 3G2SA 2XCCA 2J4DA 4HRMB 4O6FA 4DX6D 3FWVA 4LRZA 5ENTD 2PM6A 4BTBA 4TXQA 3BU8A 3HXDA 3JQ0A 4Y6WA 2VSOE 4FHJA 3FUMA 2VSXE 3UT7A 3LY7A 3EHNA 3SQVA 3HXCA 2MHKA 1JWFA 3EHMA 3UQ3A 4G24A 4JZYA 1O1RA 4CZ2D 2KCVA 4C0EA 2AW6A 3FH8A 3Q47B 2B6CA 3RO2A 4JA9A 2HO1A 2VGYA 4G26A 3Q78A 4QFVA 1UW4B 4GA1A 4KVMA 1ELWA 3SFZA 2I2OA 2RG8A 4AP2A 4YDEA 4A3VA 3R9MA 1KZOA 3ASDA 1H6OA 1WAO1 5G05J 1MHQA 1IKND 4BTAA 3NZUA 3ZKJA 3DSTA 4WNFA 3ZPJA 3SI5A 3T5VA 5J90A 3ZXSA 4DK5A 4JHKA 3C72A 3MGBA 3ZYMA 3G2WA 4A1SA 5BUZA 1O1SA 4EECA 4ILHB 2MYOA 3ULEG 3PE4A 3SNXA 4L9PA 3ABME 3CSTA 1A17A 3ZUVB 1AWCB 3ZVVA 2ILRA 5D0QD 2DBAA 5BT1A 1UN9A 1OCRE 2I9CA 1N4QA 2V4HC 4AJWA 3VLDA 1TNUA 3UIPC 4Q94A 3URZA 2F37A 4JEUA 2BTDA 1E8YA 3MX3A 2WXGA 5JA4D 4I1AA 4UI9J 3QDNA 5FQ8A 4WNDA 4WNGA 1YA0A 2MOWA 2WXKA 3O48A 2J07A 2IY0C 3FY4A 4BERA 2ZISA 3KSLA 3ZEFA 4N5QA 2OOEA 3AG4E 4L7TA 3ZFWA 3GW4A 2EILE 4C9BB 4WWPA 1OWNA 1AP7A 2M63A 5CEDB 1NA3A 3FUFA 4U0UA 5AARA 4WWNA 3UIOC 4PH4B 3UINC 2UWJG 4EBAA 5B3SE 4GYOA 2ZGDA 1N4SA 3ZYLA 2YHEA 5A7DB 3WG7E 3FHEA 3UM2A 4N5CA 3UXGA 1NL4A 2QZAA 3VLFA 3LY8A 3FFLA 2J9QA 2PL2A 4MS6A 3BQOA 1S63A 3SD5A 4N2QA 4DJAA 3D9IA 4NQ0A 3U64A 4HFGA 1NI1A 3B7BA 2RFAA 1JUQA 4L1BA 3QWVA 2L0TB 4HRNA 1N95A 1FT2A 2AJAA 4TXRA 5BPPA 4E6HA 2J09A 4GTQA 3E4BA 4FLHA 4OVUA 4UQZA 1H2TC 3UPVA 4U0ZA 3JQ1A 5ENQD 4V3IA 2KCKA 2F8YA 2QY7A 5BNWA 2NC9A 3T8MA 2KM4A 5FQ7A 3V31A 1OCOE 4L2YA 4UQYA 2X38A 3LCAA 4GYWA 2FBNA 5CMYA 3PZ4A 2R02A 5KCMA 1NZNA 3TJPA 2V4LA 3ZHEA 3SFXA 4GCOA 1U3CA 3HRAA 1XGWA 2P9KG 4Z68A 4A3TA 3D3MA 5G05C 2P9NG 3APFA 4F53A 3NAWA 4H7XA 3UUXA 4DRXE 3FTXA 3CVLA 5FIOA 3W9FA 2Y69E 3P1UA 3DBSA 4ZHBA 5AN8A 5LP0A 5AQBA 4U7EB 1K3ZD 4UWGA 3L13A 2HM8A 4BFRA 2R17C 2Y4UA 2H6FA 3Q73A 4KZ0A 4HOTA 3S7BA 3E32A 1LD8A 1MQSA 2XENA 2HE0A 4ILGA 4I6GA 4B8CB 2YINA 5AQ9A 2VQ2A 1N11A 3Q9UC 2XEEA 4GA0A 2IJGX 1V55E 3Q5MA 4IYPA 2BKGA 5T8IA 2HYZA 3BUAA 5HRYA 2FO7A 5LX8A 3OTNA 2KZTB 3Q75A 4MRUA 4DLQA 4HS2A 4UWKA 2KXPC 5CEAA 4XX5A 3HDXA 3Q49B 3D9LA 3LY9A 5FZRA 3CKBA 3B7UX 4HVBA 3BG1B 1D8DA 4I43A 4CT0A 5JJTA 2WXHA 4I6JA 3CVNA 1EDUA 1HS6A 1HXIA 1KZPA 1MYOA 3C5RA 3HG0D 3HXFA 2XEVA 2YHCA 1H19A 2KATA 1FCHA 3EU9A 3TWXA 5KNGA 3VTXA 3D9NA 3Q15A 5G55A 2R2LA 4XEIG 4JXTA 4BEPA 3HYMB 3LDZA 1OT8A 2WXMA 4CDMA 3AS5A 3ULYA 4A55A 3EIQC 1INZA 3IBEA 2X6KA 3ASHA 3PS6A 3DSUA 3PNLB 4HLLA 4I1OB 5CMWA 3CQCB 4M7CA 1MJ0A 4AIFA 4GMLA 5HS0A 1X81A 5E75A 1Z3YA 5FQ4A 3P2BA 4ANXA 1E8XA 4AVXA 1MX2A 4KVOA 4JHJA 1SVXA 3FUKA 4O1PA 1Q2ZA 4ATZD 1KLXA 1E8WA 4A63B 5ENOD 5KJNA 3MEKA 4DI3A 1H6PA 4JPSA 4TXPA 1HG2A 2P9PG 4AM9A 1OWOA 3SO8A 4CT4A 3AU4A 5C2YA 3RKVA 3FU6A 5EIBE 3JUEA 2LAIA 4KXKB 3IHYA 4W9RA 3AS4A 2EIJE 2DYRE 1TYQG 3TWVA 2P9SG 4UWFA 2WXLA 3CVVA 1U2VG 1TEZA 4R7LA 2XS1A 2AVPA 3CEQA 3TL5A 1ELKA 2P9UG 1PAQA 3JUIA 4U07A 3SY2A 1JCSA 3F6QA 3CK7A 2JLBA 2CHXA 5ENPD 4CDNA 3U66A 3LVRE 3DSVA 4L2LA 4ACLA 4PDXA 3BEEA 4BT8A 5DBKA 4AOFA 1H2UA 1TNZA 3ZYQA 3RRNB 3SF4A 5JHAA 2I6HA 4X8QA 3G2UA 5CRUA 4GMJA 3T5XA 1OCCE 3O4ZA 1QQEA 3CVPA 2LSVA 5DIZA 1D8EA 5E76A 3Q7AA 1FVFA 4ZFHA 3QB2A 3FU0A 2IO3C 4LERA 2LAHA 3KAEA 3T8KA 1S0PA 5AJLA 4LG6A 4EHMA 3IEGA 4K5AB 4HRLA 1TNYA 1WY6A 2WXOA 5BXOA 4ANUA 2IONA 5HKPA 3EDTB 2DZNA 4HORA 5CBNA 3I3NA 3QWWA 4HB5A 1BD8A 2EIKE 2JEKA 4HXIA 3ZIMA 4JB8P 5BW8C 5EYPF 1MZCA 5ITZF 3UM3A 4XKCA 4CGVA 1SA5A 3ONLA 1S64A 2LXMA 4G2VA 3ZU7B 1NFIE 3OXLA 3NF1A 3PUJA 5LCWJ 1TN8A 2CG2A 5FINA 3V2OA 1SW6A 1TNOA 3B7TA 3LEWA 1ZU2A 1K1AA 3R7RA 4FHKA 3IV0A 4IRUA 1KT0A 4K03A 3PZ2A 3IXEA 4B8AA 3C3OA 4FLBA 3CKCA 4FC8A 3AU5A 1YYHA 2WXJA 5JHBA 2VSNA 1DC2A 4YNDA 1YMPA 2IEJA 1Y6IA 5KNHD 5JJ7A 2GRNB 4EZLA 4YVOA 4B94A 5AYWD 3FTWA 3MKQA 3FU3A 3N71A 2GRLA 4BWRA 5FWQA 2X3MA 4OAUC 3GZ1A 5LCWC 1S70B 4I6EA 3UT8A 2B0OE 5JJ6A 4IN3B 3KEAA 4WAFA 2Y1LE 4DI4A 3S7FA 2IU1A 1BU9A 1RW2A 3CVUA 1IHBA 1TN7A 3C3QA 3CHMA 3PEUB 3DPDA 2PZIA 3CVQA 3L22A 5T4YA 4J7WA 1PY1A 3TXMA 4LSZE 5J08A 3RIBA 4TUUA 4AEZC 4BSXA 4DX5D 2RKKA 1TJCA 3L82A 5KJLA 4YDWA 3MKRA 2BUGA 2EINE 2IOLA 3PREA 3IHVA 5EX3A 4A1GA 1IYGA 5AIJA 4OVVA 2DCPA 3EHRA 3C3RA 3FTZA 2WXRA 4DX7D 4I2WA 4GCNA 4JL0A 3TAXA 4WUYA 4I17A 4H7YA 4LNBA 1X5BA 4BESA 4PS8A 4GB9A 2OEVA 4J8YA 1BI7B 2XGOA 1XNFA 4AY5A 2YNQA 3FUJA 4GZ6A 4U8HA 3FDHA 2XPIA 5FTPA 4GTVA 5EKQD 3D9OA 3ZXPA 3U9WA 4Y6CA 1VDYA 4ANWA 3AJIA 3ESKA 3EU5A 1LTXA 4NURA 1WDYA 2RD0A 1N94A 4GZDA 2E0IA 4LEUA 2IF4A 2NXPA 4RSYA 4ATGA 4PUCA 2X6JA 4DLOA 4GZCA 2ZXWE 4HLEA 4CCAA 1L5JA 3J5PA 4XKBA 4N3AA 4FADA 2VTBA 4AV7A 2RFMA 2XGSA 3PEVB 3NOCD 3DEOA 3X2QE 2OEWA 1JWGA 4J8SA 4GAAA 2QYUA 2VGXB 2BKKB 2C2LA 4DPRA 3CVXA 4I9EA 3OAWA 4G8KA 2ETCA 1UOHA 4F1PA 5FJYA 1JCRA 3PRZA 1KPSB 1K8KG 3UT4A 5IY5E 4QQIA 2OV8A 3TWTA 5CERB 4HBDA 4BT9A 4EZJA 3FH7A 4I9CA 1DVPA 2LO6A 3GYZA 3ULQA 1OUVA 2PQNA 5HI7A 4UI9K 3TG4A 2WXIA 4U04A 1SZ9A 4APOA 2LXLA 3RRMB 1KT1A 3CVYA 3L17A 3FTVA 5BV0A 3G2TA 4YVQC 4KZCA 5EILA 3DSWA 2WVIA 5AENA 4G1TA 4KYOB 3Q79A 4NIKA 2WPVA 1N52A 4OAVB 2FF4A 3B13A 3DSXA 5AAOA 4CGWA 4LNUD 3DSSA 2H6GA 3RU0A 4GPKA 3QJZA 3J5QB 3B7SA 2FI7A 3UKRG 5LOZA 2QFCA 1IQRA 1Z5SC 3IKOB 4EBAG 4XI0A 3HXEA 1N0RA 2ETBA 5BV1A 1ZBPA 2H6IA 2WXFA 3ASNE 2AXUA 4UI9C 3KEZA 2DIWA 1EYHA 1N4PA 4RQIA 4DX1A 4AXHA 2R59A 5LFAA 4E85A 3RRUA 1E7UA 4GTTA 2GW1A 5AQ7A 4C0MA 4UQXA 5T3RA 3FTSA 4G11A 2AWIA 5EX0A 3RJVA 3D9PA 3D9MA 3DPYA 3HXBA 2AXVA 3ENEA 3GZSA 2WQHA 3D9JA 1JPLA 2C0MA 2DYSE 2GROB 3E37A 2LNIA 4B89A 2QYJA 3MYVA 2WB2A 4CRWA 2R05A 3HIZA 3CVWA 2GRPB 5KJMA 3SFYA 4ACKA 2Y3AA 3QOUA 4KBQA 3PNTB 2R5SA 2XCBA 5B1BE 4JW1A 2VJ8A 4AY6A 4JHRA 4LUNU 2GRMA 2I1KA 4U95D 3L08A 1UN8A 5ARFA 3HVEB 1FT1A 3CR3A 5ENNA 3LKUA 1E96B 4RLYA 3SZ7A 5D0OD 3TWRA 4J6IA 4FJZA 1LD7A 1SA4A 2OCCE 2X6FA 2YQ8A 4UWLA 1G3NB 3ZN3A 1HU3A 1DCQA 3V79K 3Q9NC 2UY1B 4G23A 1E90A 4N2SA 3NOGD 1OWPA 1QBQA 2XPYA 4NACA 2WMNA 2ZU6B 3ZYKA 4FULA 1IHGA 4GU5A 2KBXA 2A4ZA 4GTSA 1W3BA 4BX9A 4HOSA 2C0LA 3ZHEB 3I4RB 4JEHA 3CK9A 2GGFA 4GTRA 3D9HA 2XZTG 2FULA 2J08A 4GTOA 1WG0A 1HFAA 2EQXA 4U8VD 4GMRA 2J8SD 2DZOA 3CHPA 5ENRD 3MV3B 3VTYA 1QNFA 3MJWA 1E7VA 2CHZA 1E8ZA 5CBOA 1SZAA 4FP7A 3FP3A 3LPZA 4JC8A 2V5QC 3E30A 4HI8A 3B95A 4HOQA 3DXKG 3L54A 2XEHA 2GRQB 3E33A 4GTMA 3QNKA 1UJJA 2AXZA 1OXJA 4YDYA 5A6CA 2P2CP 3NBNB 5EN5D 4PS3A 3KSQA 4TUMA 2ETAA 3PVLA 1SQMA 1ZB1A 4K5BA 4B0ZA 5G2NA 1TN6A 1HE8A 5ANLA 2WMOA 4O1OA 3ASOE 3JCKC 4P29A 2L0IA 4CYMD 3EUVA 3CHQA 3OXFA 4NRHB 3JYSA 4CEMA 1H6KA 3FULA 2VGXA 3DXMG 2OVBA 1RZ4A 3MV2B 4MBGA 2QC9A 3APDA 4GPMA 4LNGA 3V2XA 3T9KA 5A23A 3AAAC 3LS8A 3TG5A 2ZGGA 3UMVA 3WXXA 1BI8B 4N3CA 2WXQA 4MKTA 4CDRA 5G04J 4LCTA 3TGOA 2L6BA 4WNEA 2F0YA 3R9AB 5JMND 2XRZA 2X6IA 4XZ4A 3CHOA 2UY1A 3Q7FA 4GA2A 3AG2E 3QC1A 3FEYA 2I1JA 2NYJA 2PNNA 2WQ7A 3UX4A 2X6HA 1DCEA 3PZDA 4GZ3A 3KS2A 3FUHA 3V30A 3RSEG 2Q7FA 2V8SE 3L16A 3CIAA 3CLJA 3FUNA 1Z3XA 1JCQA 3APCA 4GYYA 3I4GA 3U3WA 1HF8A 3UI2A 3L9TA 2P9IG 2CHWA 4JD2G 3OXGA 4D10C 4HOUA 3UTMA 2KZTA 3ZGQA 1QYMA 1UJKA 2V0PA 4YDOA 1H0AA 4C48B 3UKUG 1EPUA 3SHFA 3SBSA 3S7JA 3ONKA 3E34A 3UM0A 4TRQA 5H7PA 3U4TA 1MX6A 3FUDA 1O5MA 4J8DA 2FEZA 5FZQA 2IQCA 2XPZA 4DUIA 2NSZA 3ML9A 2VYIA 3FTYA 4HI9A 2PM7A 5M72A 4HNAD 3NB2A 3EJNA 3FUIA 4U0SA 2L9BA 3PDNA 3JXIA 2R03A 3MA5A
chains in the Genus database with same CATH topology
3PZ3A 3DSTA 3E30A 3Q7FA 3Q79A 2R2LA 1N4SA 3EU5A 1LTXA 1DCEA 3C72A 1N94A 3DSXA 3E33A 4GTMA 2H6HA 1O1SA 1TN7A 3DSSA 2H6GA 1FT1A 1NL4A 2ZIRA 3PZ1A 4L9PA 1MZCA 1N4RA 1S63A 1N9AA 1LD7A 4GTPA 1JCSA 1SA4A 1JCQA 2H6FA 3Q73A 1NI1A 1SA5A 3E32A 3KSQA 1S64A 3DSUA 1LD8A 3HXEA 1FPPA 3HXDA 2H6IA 1TN6A 1N4QA 1N95A 1FT2A 3DSVA 1O1TA 1X81A 4YDOA 1TN8A 1TNUA 4GTQA 3HXCA 1TNOA 1TNZA 1N4PA 1QBQA 1O1RA 3EUVA 3Q75A 3PZ2A 3E34A 2BEDA 4GTTA 1JCRA 4GTSA 1O5MA 2ZISA 3Q78A 4MBGA 3KSLA 4GTRA 1D8DA 1D8EA 3DRAA 3Q7AA 4GTOA 4LNBA 2IEJA 4LNGA 3HXBA 3DPYA 3PZ4A 4YDEA 1KZPA 3E37A 3HXFA 1KZOA 4EHMA 3SFXA 1TNBA 4GTVA 2F0YA 1TNYA 3DSWA 3SFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ3 A;  3DST A;  3E30 A;  3Q7F A;  3Q79 A;  2R2L A;  1N4S A;  3EU5 A;  1LTX A;  1DCE A;  3C72 A;  1N94 A;  3DSX A;  3E33 A;  4GTM A;  2H6H A;  1O1S A;  1TN7 A;  3DSS A;  2H6G A;  1FT1 A;  1NL4 A;  2ZIR A;  3PZ1 A;  4L9P A;  1MZC A;  1N4R A;  1S63 A;  1N9A A;  1LD7 A;  4GTP A;  1JCS A;  1SA4 A;  1JCQ A;  2H6F A;  3Q73 A;  1NI1 A;  1SA5 A;  3E32 A;  3KSQ A;  1S64 A;  3DSU A;  1LD8 A;  3HXE A;  1FPP A;  3HXD A;  2H6I A;  1TN6 A;  1N4Q A;  1N95 A;  1FT2 A;  3DSV A;  1O1T A;  1X81 A;  4YDO A;  1TN8 A;  1TNU A;  4GTQ A;  3HXC A;  1TNO A;  1TNZ A;  1N4P A;  1QBQ A;  1O1R A;  3EUV A;  3Q75 A;  3PZ2 A;  3E34 A;  2BED A;  4GTT A;  1JCR A;  4GTS A;  1O5M A;  2ZIS A;  3Q78 A;  4MBG A;  3KSL A;  4GTR A;  1D8D A;  1D8E A;  3DRA A;  3Q7A A;  4GTO A;  4LNB A;  2IEJ A;  4LNG A;  3HXB A;  3DPY A;  3PZ4 A;  4YDE A;  1KZP A;  3E37 A;  3HXF A;  1KZO A;  4EHM A;  3SFX A;  1TNB A;  4GTV A;  2F0Y A;  1TNY A;  3DSW A;  3SFY A; 
#chains in the Genus database with same CATH topology
 3QKY A;  3PZ3 A;  3ZNG A;  4ABN A;  2CG3 A;  2WM9 A;  2PQR A;  4UWH A;  3TWW A;  2IO2 C;  2V5F A;  1HO8 A;  3JXJ A;  2H6H A;  2VSY A;  4ME2 A;  5FZS A;  3ASF A;  2ZIR A;  3RAU A;  4EPZ A;  4J0U A;  2XHE A;  5CCM A;  4GTP A;  2OND A;  2LUH A;  4FU3 A;  3ZW3 A;  3G2V A;  2BF0 X;  2OVF A;  4UUC A;  3K9I A;  4N3B A;  2Y0B G;  4O60 A;  3UM1 A;  2IOS A;  4JA7 A;  1YCS B;  3QK0 A;  3C98 A;  4F1S A;  3R7Q A;  3CSF A;  4F7A A;  1PC2 A;  4K0R A;  4K5C A;  2GRR B;  4F6R D;  4G25 A;  3TXN A;  1UG3 A;  4APF A;  2XRY A;  4FA6 A;  1QZ2 A;  4U63 A;  3LXU X;  1IXV A;  1H2V C;  3RK6 A;  4J8F A;  3DRA A;  3PUK A;  1K1B A;  1ELR A;  2WQ6 A;  3FEX A;  3CGH A;  2VTB B;  3VLE A;  4U96 D;  1OWM A;  4F3V A;  2A5U A;  5G04 C;  1D9S A;  2XGM A;  5CHE E;  3EHQ A;  3TWU A;  4I2Z A;  5ENS D;  4RG6 A;  2IFU A;  4ANV A;  3CV0 A;  3SBT B;  4BX8 A;  4OYS A;  2JAB A;  3FTU A;  3KD7 A;  5CRV A;  1N54 A;  2CFZ A;  3PZ1 A;  3LYA A;  5CCL A;  2LSU A;  4TV3 A;  3W9G A;  1N4R A;  4ILI A;  5C1D A;  2Y4T A;  5EYL A;  2DWZ A;  1A5E A;  3L6A A;  1HH8 A;  4RVB A;  5D66 A;  3SGH A;  1BLX B;  1OWL A;  3QWP A;  1O1T A;  2XZD G;  3B7R L;  4XIF A;  3ZRH A;  1MX4 A;  4XI9 A;  5FT9 A;  1TJF A;  3MZL B;  2BED A;  1B89 A;  4BY6 A;  5AQA A;  5HQ8 A;  2FO1 E;  1OCZ E;  4G8L A;  3MCX A;  5KBA A;  2P9L G;  1HX8 A;  2E2E A;  4KT6 B;  1OY3 D;  1TR4 A;  3Q4A B;  3S7D A;  1N0Q A;  1U3D A;  3AG1 E;  1HG5 A;  3TWQ A;  5ARG A;  4BSZ B;  5CEC B;  1Z6T A;  2J4B A;  3AS8 A;  4FJY A;  3BG0 B;  1NP7 A;  3ABK E;  3FH5 A;  2XQ0 A;  2WXP A;  4MLP A;  4RG9 A;  5ANR A;  5FQ6 A;  4DX2 A;  4U8Y D;  3QAQ A;  3EIJ A;  3FUE A;  3PH0 C;  5EDS A;  2WXN A;  1NA0 A;  3CK8 A;  3ML8 A;  1GW6 A;  2DVW A;  2KC7 A;  4J8E A;  5KWD A;  2P58 C;  3LJN A;  4IUL A;  4L23 A;  3ESL A;  3DWL G;  2EIM E;  1FPP A;  5D2M C;  4HQD A;  4JVS A;  3QAR A;  3NQP A;  5B1A E;  5KJK A;  2XS8 A;  4Q96 A;  1Y8M A;  5AJD A;  4WWO A;  2HR2 A;  4N39 A;  3LJ3 A;  4PS7 A;  4XE0 A;  2J49 A;  1V54 E;  3MKQ B;  3CHS A;  2CFU A;  3D9K A;  1P5Q A;  3HVE A;  2F8X K;  1LF8 A;  5BXU A;  3CQG B;  3DEP A;  1WM5 A;  4BET A;  3HHM A;  1DNP A;  2L6J A;  4B93 B;  4EQF A;  3ABL E;  3ISM C;  4GZ5 A;  1TNB A;  3S2A A;  4EZK A;  4M3O A;  3TWS A;  3FU5 A;  3RO3 A;  1EF1 C;  3PE3 A;  4I1M A;  1HZ4 A;  1BPO A;  3LVQ E;  3GZ2 A;  4KMO A;  1FVH A;  3AG3 E;  1IQU A;  4URK A;  5EID A;  4Q69 A;  3I5P A;  3ASG A;  3CHR A;  3NZS A;  2A5E A;  2KCL A;  1N9A A;  2VGE A;  2MRI A;  3G2S A;  2XCC A;  2J4D A;  4HRM B;  4O6F A;  4DX6 D;  3FWV A;  4LRZ A;  5ENT D;  2PM6 A;  4BTB A;  4TXQ A;  3BU8 A;  3HXD A;  3JQ0 A;  4Y6W A;  2VSO E;  4FHJ A;  3FUM A;  2VSX E;  3UT7 A;  3LY7 A;  3EHN A;  3SQV A;  3HXC A;  2MHK A;  1JWF A;  3EHM A;  3UQ3 A;  4G24 A;  4JZY A;  1O1R A;  4CZ2 D;  2KCV A;  4C0E A;  2AW6 A;  3FH8 A;  3Q47 B;  2B6C A;  3RO2 A;  4JA9 A;  2HO1 A;  2VGY A;  4G26 A;  3Q78 A;  4QFV A;  1UW4 B;  4GA1 A;  4KVM A;  1ELW A;  3SFZ A;  2I2O A;  2RG8 A;  4AP2 A;  4YDE A;  4A3V A;  3R9M A;  1KZO A;  3ASD A;  1H6O A;  1WAO 1;  5G05 J;  1MHQ A;  1IKN D;  4BTA A;  3NZU A;  3ZKJ A;  3DST A;  4WNF A;  3ZPJ A;  3SI5 A;  3T5V A;  5J90 A;  3ZXS A;  4DK5 A;  4JHK A;  3C72 A;  3MGB A;  3ZYM A;  3G2W A;  4A1S A;  5BUZ A;  1O1S A;  4EEC A;  4ILH B;  2MYO A;  3ULE G;  3PE4 A;  3SNX A;  4L9P A;  3ABM E;  3CST A;  1A17 A;  3ZUV B;  1AWC B;  3ZVV A;  2ILR A;  5D0Q D;  2DBA A;  5BT1 A;  1UN9 A;  1OCR E;  2I9C A;  1N4Q A;  2V4H C;  4AJW A;  3VLD A;  1TNU A;  3UIP C;  4Q94 A;  3URZ A;  2F37 A;  4JEU A;  2BTD A;  1E8Y A;  3MX3 A;  2WXG A;  5JA4 D;  4I1A A;  4UI9 J;  3QDN A;  5FQ8 A;  4WND A;  4WNG A;  1YA0 A;  2MOW A;  2WXK A;  3O48 A;  2J07 A;  2IY0 C;  3FY4 A;  4BER A;  2ZIS A;  3KSL A;  3ZEF A;  4N5Q A;  2OOE A;  3AG4 E;  4L7T A;  3ZFW A;  3GW4 A;  2EIL E;  4C9B B;  4WWP A;  1OWN A;  1AP7 A;  2M63 A;  5CED B;  1NA3 A;  3FUF A;  4U0U A;  5AAR A;  4WWN A;  3UIO C;  4PH4 B;  3UIN C;  2UWJ G;  4EBA A;  5B3S E;  4GYO A;  2ZGD A;  1N4S A;  3ZYL A;  2YHE A;  5A7D B;  3WG7 E;  3FHE A;  3UM2 A;  4N5C A;  3UXG A;  1NL4 A;  2QZA A;  3VLF A;  3LY8 A;  3FFL A;  2J9Q A;  2PL2 A;  4MS6 A;  3BQO A;  1S63 A;  3SD5 A;  4N2Q A;  4DJA A;  3D9I A;  4NQ0 A;  3U64 A;  4HFG A;  1NI1 A;  3B7B A;  2RFA A;  1JUQ A;  4L1B A;  3QWV A;  2L0T B;  4HRN A;  1N95 A;  1FT2 A;  2AJA A;  4TXR A;  5BPP A;  4E6H A;  2J09 A;  4GTQ A;  3E4B A;  4FLH A;  4OVU A;  4UQZ A;  1H2T C;  3UPV A;  4U0Z A;  3JQ1 A;  5ENQ D;  4V3I A;  2KCK A;  2F8Y A;  2QY7 A;  5BNW A;  2NC9 A;  3T8M A;  2KM4 A;  5FQ7 A;  3V31 A;  1OCO E;  4L2Y A;  4UQY A;  2X38 A;  3LCA A;  4GYW A;  2FBN A;  5CMY A;  3PZ4 A;  2R02 A;  5KCM A;  1NZN A;  3TJP A;  2V4L A;  3ZHE A;  3SFX A;  4GCO A;  1U3C A;  3HRA A;  1XGW A;  2P9K G;  4Z68 A;  4A3T A;  3D3M A;  5G05 C;  2P9N G;  3APF A;  4F53 A;  3NAW A;  4H7X A;  3UUX A;  4DRX E;  3FTX A;  3CVL A;  5FIO A;  3W9F A;  2Y69 E;  3P1U A;  3DBS A;  4ZHB A;  5AN8 A;  5LP0 A;  5AQB A;  4U7E B;  1K3Z D;  4UWG A;  3L13 A;  2HM8 A;  4BFR A;  2R17 C;  2Y4U A;  2H6F A;  3Q73 A;  4KZ0 A;  4HOT A;  3S7B A;  3E32 A;  1LD8 A;  1MQS A;  2XEN A;  2HE0 A;  4ILG A;  4I6G A;  4B8C B;  2YIN A;  5AQ9 A;  2VQ2 A;  1N11 A;  3Q9U C;  2XEE A;  4GA0 A;  2IJG X;  1V55 E;  3Q5M A;  4IYP A;  2BKG A;  5T8I A;  2HYZ A;  3BUA A;  5HRY A;  2FO7 A;  5LX8 A;  3OTN A;  2KZT B;  3Q75 A;  4MRU A;  4DLQ A;  4HS2 A;  4UWK A;  2KXP C;  5CEA A;  4XX5 A;  3HDX A;  3Q49 B;  3D9L A;  3LY9 A;  5FZR A;  3CKB A;  3B7U X;  4HVB A;  3BG1 B;  1D8D A;  4I43 A;  4CT0 A;  5JJT A;  2WXH A;  4I6J A;  3CVN A;  1EDU A;  1HS6 A;  1HXI A;  1KZP A;  1MYO A;  3C5R A;  3HG0 D;  3HXF A;  2XEV A;  2YHC A;  1H19 A;  2KAT A;  1FCH A;  3EU9 A;  3TWX A;  5KNG A;  3VTX A;  3D9N A;  3Q15 A;  5G55 A;  2R2L A;  4XEI G;  4JXT A;  4BEP A;  3HYM B;  3LDZ A;  1OT8 A;  2WXM A;  4CDM A;  3AS5 A;  3ULY A;  4A55 A;  3EIQ C;  1INZ A;  3IBE A;  2X6K A;  3ASH A;  3PS6 A;  3DSU A;  3PNL B;  4HLL A;  4I1O B;  5CMW A;  3CQC B;  4M7C A;  1MJ0 A;  4AIF A;  4GML A;  5HS0 A;  1X81 A;  5E75 A;  1Z3Y A;  5FQ4 A;  3P2B A;  4ANX A;  1E8X A;  4AVX A;  1MX2 A;  4KVO A;  4JHJ A;  1SVX A;  3FUK A;  4O1P A;  1Q2Z A;  4ATZ D;  1KLX A;  1E8W A;  4A63 B;  5ENO D;  5KJN A;  3MEK A;  4DI3 A;  1H6P A;  4JPS A;  4TXP A;  1HG2 A;  2P9P G;  4AM9 A;  1OWO A;  3SO8 A;  4CT4 A;  3AU4 A;  5C2Y A;  3RKV A;  3FU6 A;  5EIB E;  3JUE A;  2LAI A;  4KXK B;  3IHY A;  4W9R A;  3AS4 A;  2EIJ E;  2DYR E;  1TYQ G;  3TWV A;  2P9S G;  4UWF A;  2WXL A;  3CVV A;  1U2V G;  1TEZ A;  4R7L A;  2XS1 A;  2AVP A;  3CEQ A;  3TL5 A;  1ELK A;  2P9U G;  1PAQ A;  3JUI A;  4U07 A;  3SY2 A;  1JCS A;  3F6Q A;  3CK7 A;  2JLB A;  2CHX A;  5ENP D;  4CDN A;  3U66 A;  3LVR E;  3DSV A;  4L2L A;  4ACL A;  4PDX A;  3BEE A;  4BT8 A;  5DBK A;  4AOF A;  1H2U A;  1TNZ A;  3ZYQ A;  3RRN B;  3SF4 A;  5JHA A;  2I6H A;  4X8Q A;  3G2U A;  5CRU A;  4GMJ A;  3T5X A;  1OCC E;  3O4Z A;  1QQE A;  3CVP A;  2LSV A;  5DIZ A;  1D8E A;  5E76 A;  3Q7A A;  1FVF A;  4ZFH A;  3QB2 A;  3FU0 A;  2IO3 C;  4LER A;  2LAH A;  3KAE A;  3T8K A;  1S0P A;  5AJL A;  4LG6 A;  4EHM A;  3IEG A;  4K5A B;  4HRL A;  1TNY A;  1WY6 A;  2WXO A;  5BXO A;  4ANU A;  2ION A;  5HKP A;  3EDT B;  2DZN A;  4HOR A;  5CBN A;  3I3N A;  3QWW A;  4HB5 A;  1BD8 A;  2EIK E;  2JEK A;  4HXI A;  3ZIM A;  4JB8 P;  5BW8 C;  5EYP F;  1MZC A;  5ITZ F;  3UM3 A;  4XKC A;  4CGV A;  1SA5 A;  3ONL A;  1S64 A;  2LXM A;  4G2V A;  3ZU7 B;  1NFI E;  3OXL A;  3NF1 A;  3PUJ A;  5LCW J;  1TN8 A;  2CG2 A;  5FIN A;  3V2O A;  1SW6 A;  1TNO A;  3B7T A;  3LEW A;  1ZU2 A;  1K1A A;  3R7R A;  4FHK A;  3IV0 A;  4IRU A;  1KT0 A;  4K03 A;  3PZ2 A;  3IXE A;  4B8A A;  3C3O A;  4FLB A;  3CKC A;  4FC8 A;  3AU5 A;  1YYH A;  2WXJ A;  5JHB A;  2VSN A;  1DC2 A;  4YND A;  1YMP A;  2IEJ A;  1Y6I A;  5KNH D;  5JJ7 A;  2GRN B;  4EZL A;  4YVO A;  4B94 A;  5AYW D;  3FTW A;  3MKQ A;  3FU3 A;  3N71 A;  2GRL A;  4BWR A;  5FWQ A;  2X3M A;  4OAU C;  3GZ1 A;  5LCW C;  1S70 B;  4I6E A;  3UT8 A;  2B0O E;  5JJ6 A;  4IN3 B;  3KEA A;  4WAF A;  2Y1L E;  4DI4 A;  3S7F A;  2IU1 A;  1BU9 A;  1RW2 A;  3CVU A;  1IHB A;  1TN7 A;  3C3Q A;  3CHM A;  3PEU B;  3DPD A;  2PZI A;  3CVQ A;  3L22 A;  5T4Y A;  4J7W A;  1PY1 A;  3TXM A;  4LSZ E;  5J08 A;  3RIB A;  4TUU A;  4AEZ C;  4BSX A;  4DX5 D;  2RKK A;  1TJC A;  3L82 A;  5KJL A;  4YDW A;  3MKR A;  2BUG A;  2EIN E;  2IOL A;  3PRE A;  3IHV A;  5EX3 A;  4A1G A;  1IYG A;  5AIJ A;  4OVV A;  2DCP A;  3EHR A;  3C3R A;  3FTZ A;  2WXR A;  4DX7 D;  4I2W A;  4GCN A;  4JL0 A;  3TAX A;  4WUY A;  4I17 A;  4H7Y A;  4LNB A;  1X5B A;  4BES A;  4PS8 A;  4GB9 A;  2OEV A;  4J8Y A;  1BI7 B;  2XGO A;  1XNF A;  4AY5 A;  2YNQ A;  3FUJ A;  4GZ6 A;  4U8H A;  3FDH A;  2XPI A;  5FTP A;  4GTV A;  5EKQ D;  3D9O A;  3ZXP A;  3U9W A;  4Y6C A;  1VDY A;  4ANW A;  3AJI A;  3ESK A;  3EU5 A;  1LTX A;  4NUR A;  1WDY A;  2RD0 A;  1N94 A;  4GZD A;  2E0I A;  4LEU A;  2IF4 A;  2NXP A;  4RSY A;  4ATG A;  4PUC A;  2X6J A;  4DLO A;  4GZC A;  2ZXW E;  4HLE A;  4CCA A;  1L5J A;  3J5P A;  4XKB A;  4N3A A;  4FAD A;  2VTB A;  4AV7 A;  2RFM A;  2XGS A;  3PEV B;  3NOC D;  3DEO A;  3X2Q E;  2OEW A;  1JWG A;  4J8S A;  4GAA A;  2QYU A;  2VGX B;  2BKK B;  2C2L A;  4DPR A;  3CVX A;  4I9E A;  3OAW A;  4G8K A;  2ETC A;  1UOH A;  4F1P A;  5FJY A;  1JCR A;  3PRZ A;  1KPS B;  1K8K G;  3UT4 A;  5IY5 E;  4QQI A;  2OV8 A;  3TWT A;  5CER B;  4HBD A;  4BT9 A;  4EZJ A;  3FH7 A;  4I9C A;  1DVP A;  2LO6 A;  3GYZ A;  3ULQ A;  1OUV A;  2PQN A;  5HI7 A;  4UI9 K;  3TG4 A;  2WXI A;  4U04 A;  1SZ9 A;  4APO A;  2LXL A;  3RRM B;  1KT1 A;  3CVY A;  3L17 A;  3FTV A;  5BV0 A;  3G2T A;  4YVQ C;  4KZC A;  5EIL A;  3DSW A;  2WVI A;  5AEN A;  4G1T A;  4KYO B;  3Q79 A;  4NIK A;  2WPV A;  1N52 A;  4OAV B;  2FF4 A;  3B13 A;  3DSX A;  5AAO A;  4CGW A;  4LNU D;  3DSS A;  2H6G A;  3RU0 A;  4GPK A;  3QJZ A;  3J5Q B;  3B7S A;  2FI7 A;  3UKR G;  5LOZ A;  2QFC A;  1IQR A;  1Z5S C;  3IKO B;  4EBA G;  4XI0 A;  3HXE A;  1N0R A;  2ETB A;  5BV1 A;  1ZBP A;  2H6I A;  2WXF A;  3ASN E;  2AXU A;  4UI9 C;  3KEZ A;  2DIW A;  1EYH A;  1N4P A;  4RQI A;  4DX1 A;  4AXH A;  2R59 A;  5LFA A;  4E85 A;  3RRU A;  1E7U A;  4GTT A;  2GW1 A;  5AQ7 A;  4C0M A;  4UQX A;  5T3R A;  3FTS A;  4G11 A;  2AWI A;  5EX0 A;  3RJV A;  3D9P A;  3D9M A;  3DPY A;  3HXB A;  2AXV A;  3ENE A;  3GZS A;  2WQH A;  3D9J A;  1JPL A;  2C0M A;  2DYS E;  2GRO B;  3E37 A;  2LNI A;  4B89 A;  2QYJ A;  3MYV A;  2WB2 A;  4CRW A;  2R05 A;  3HIZ A;  3CVW A;  2GRP B;  5KJM A;  3SFY A;  4ACK A;  2Y3A A;  3QOU A;  4KBQ A;  3PNT B;  2R5S A;  2XCB A;  5B1B E;  4JW1 A;  2VJ8 A;  4AY6 A;  4JHR A;  4LUN U;  2GRM A;  2I1K A;  4U95 D;  3L08 A;  1UN8 A;  5ARF A;  3HVE B;  1FT1 A;  3CR3 A;  5ENN A;  3LKU A;  1E96 B;  4RLY A;  3SZ7 A;  5D0O D;  3TWR A;  4J6I A;  4FJZ A;  1LD7 A;  1SA4 A;  2OCC E;  2X6F A;  2YQ8 A;  4UWL A;  1G3N B;  3ZN3 A;  1HU3 A;  1DCQ A;  3V79 K;  3Q9N C;  2UY1 B;  4G23 A;  1E90 A;  4N2S A;  3NOG D;  1OWP A;  1QBQ A;  2XPY A;  4NAC A;  2WMN A;  2ZU6 B;  3ZYK A;  4FUL A;  1IHG A;  4GU5 A;  2KBX A;  2A4Z A;  4GTS A;  1W3B A;  4BX9 A;  4HOS A;  2C0L A;  3ZHE B;  3I4R B;  4JEH A;  3CK9 A;  2GGF A;  4GTR A;  3D9H A;  2XZT G;  2FUL A;  2J08 A;  4GTO A;  1WG0 A;  1HFA A;  2EQX A;  4U8V D;  4GMR A;  2J8S D;  2DZO A;  3CHP A;  5ENR D;  3MV3 B;  3VTY A;  1QNF A;  3MJW A;  1E7V A;  2CHZ A;  1E8Z A;  5CBO A;  1SZA A;  4FP7 A;  3FP3 A;  3LPZ A;  4JC8 A;  2V5Q C;  3E30 A;  4HI8 A;  3B95 A;  4HOQ A;  3DXK G;  3L54 A;  2XEH A;  2GRQ B;  3E33 A;  4GTM A;  3QNK A;  1UJJ A;  2AXZ A;  1OXJ A;  4YDY A;  5A6C A;  2P2C P;  3NBN B;  5EN5 D;  4PS3 A;  3KSQ A;  4TUM A;  2ETA A;  3PVL A;  1SQM A;  1ZB1 A;  4K5B A;  4B0Z A;  5G2N A;  1TN6 A;  1HE8 A;  5ANL A;  2WMO A;  4O1O A;  3ASO E;  3JCK C;  4P29 A;  2L0I A;  4CYM D;  3EUV A;  3CHQ A;  3OXF A;  4NRH B;  3JYS A;  4CEM A;  1H6K A;  3FUL A;  2VGX A;  3DXM G;  2OVB A;  1RZ4 A;  3MV2 B;  4MBG A;  2QC9 A;  3APD A;  4GPM A;  4LNG A;  3V2X A;  3T9K A;  5A23 A;  3AAA C;  3LS8 A;  3TG5 A;  2ZGG A;  3UMV A;  3WXX A;  1BI8 B;  4N3C A;  2WXQ A;  4MKT A;  4CDR A;  5G04 J;  4LCT A;  3TGO A;  2L6B A;  4WNE A;  2F0Y A;  3R9A B;  5JMN D;  2XRZ A;  2X6I A;  4XZ4 A;  3CHO A;  2UY1 A;  3Q7F A;  4GA2 A;  3AG2 E;  3QC1 A;  3FEY A;  2I1J A;  2NYJ A;  2PNN A;  2WQ7 A;  3UX4 A;  2X6H A;  1DCE A;  3PZD A;  4GZ3 A;  3KS2 A;  3FUH A;  3V30 A;  3RSE G;  2Q7F A;  2V8S E;  3L16 A;  3CIA A;  3CLJ A;  3FUN A;  1Z3X A;  1JCQ A;  3APC A;  4GYY A;  3I4G A;  3U3W A;  1HF8 A;  3UI2 A;  3L9T A;  2P9I G;  2CHW A;  4JD2 G;  3OXG A;  4D10 C;  4HOU A;  3UTM A;  2KZT A;  3ZGQ A;  1QYM A;  1UJK A;  2V0P A;  4YDO A;  1H0A A;  4C48 B;  3UKU G;  1EPU A;  3SHF A;  3SBS A;  3S7J A;  3ONK A;  3E34 A;  3UM0 A;  4TRQ A;  5H7P A;  3U4T A;  1MX6 A;  3FUD A;  1O5M A;  4J8D A;  2FEZ A;  5FZQ A;  2IQC A;  2XPZ A;  4DUI A;  2NSZ A;  3ML9 A;  2VYI A;  3FTY A;  4HI9 A;  2PM7 A;  5M72 A;  4HNA D;  3NB2 A;  3EJN A;  3FUI A;  4U0S A;  2L9B A;  3PDN A;  3JXI A;  2R03 A;  3MA5 A; 
#chains in the Genus database with same CATH homology
 3PZ3 A;  3DST A;  3E30 A;  3Q7F A;  3Q79 A;  2R2L A;  1N4S A;  3EU5 A;  1LTX A;  1DCE A;  3C72 A;  1N94 A;  3DSX A;  3E33 A;  4GTM A;  2H6H A;  1O1S A;  1TN7 A;  3DSS A;  2H6G A;  1FT1 A;  1NL4 A;  2ZIR A;  3PZ1 A;  4L9P A;  1MZC A;  1N4R A;  1S63 A;  1N9A A;  1LD7 A;  4GTP A;  1JCS A;  1SA4 A;  1JCQ A;  2H6F A;  3Q73 A;  1NI1 A;  1SA5 A;  3E32 A;  3KSQ A;  1S64 A;  3DSU A;  1LD8 A;  3HXE A;  1FPP A;  3HXD A;  2H6I A;  1TN6 A;  1N4Q A;  1N95 A;  1FT2 A;  3DSV A;  1O1T A;  1X81 A;  4YDO A;  1TN8 A;  1TNU A;  4GTQ A;  3HXC A;  1TNO A;  1TNZ A;  1N4P A;  1QBQ A;  1O1R A;  3EUV A;  3Q75 A;  3PZ2 A;  3E34 A;  2BED A;  4GTT A;  1JCR A;  4GTS A;  1O5M A;  2ZIS A;  3Q78 A;  4MBG A;  3KSL A;  4GTR A;  1D8D A;  1D8E A;  3DRA A;  3Q7A A;  4GTO A;  4LNB A;  2IEJ A;  4LNG A;  3HXB A;  3DPY A;  3PZ4 A;  4YDE A;  1KZP A;  3E37 A;  3HXF A;  1KZO A;  4EHM A;  3SFX A;  1TNB A;  4GTV A;  2F0Y A;  1TNY A;  3DSW A;  3SFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...