5HS0A

Computationally designed cyclic tetramer ank1c4_7
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
160
structure length
160
Chain Sequence
MSEDGELLILAAELGIAEAVRMLIEQGADVNASDDDGRTPLHHAAENGHLAVVLLLLLKGADVNAKDSDGRTPLHHAAENGHKTVVLLLILMGADVNAKDSDGRTPLHHAAENGHKEVVKLLIRKGADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin domain protein ank1C4_7
publication title Computational design of self-assembling cyclic protein homo-oligomers.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 55
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5hs0A00
3EHQA 5CECB 5ENTD 3UXGA 1IXVA 2HE0A 2QYJA 1YCSB 3V30A 1WG0A 2F8YA 3HG0D 1QYMA 5EIDA 3TWVA 5AQBA 2P2CP 4DX5D 5AQAA 2J8SD 1OT8A 4DX1A 5KWDA 3JXIA 5AARA 2F8XK 2RFMA 3TWQA 2XEEA 3NOCD 1TR4A 1MX6A 5EILA 2JABA 5EIBE 4HLLA 4Z68A 2RFAA 5FINA 4DX2A 1D9SA 1N0RA 5CEDB 5KBAA 5AQ7A 2AJAA 3JXJA 2DVWA 2ETAA 2B0OE 2Y1LE 3AJIA 4YDWA 3Q9NC 3DEPA 4JB8P 4HQDA 3JUEA 4HRLA 3IXEA 2XZDG 3ZKJA 2XENA 2F37A 2DZNA 3F6QA 5HKPA 4HBDA 4UUCA 3V2OA 2A5EA 5ENSD 5CERB 3V31A 1YYHA 4U8YD 1K1AA 1K3ZD 2ETCA 2XZTG 4O1PA 4DRXE 3J5QB 3TWSA 3J5PA 4U8VD 2KXPC 4LNUD 3HRAA 4A63B 4QFVA 4HRMB 5ENRD 4DX7D 2PNNA 4OAVB 5ENOD 5AN8A 4DX6D 2NYJA 2DWZA 2ZGGA 5CBOA 1DCQA 4BSZB 1MX2A 3SO8A 5HRYA 4DUIA 1BD8A 5D66A 1BI7B 1MYOA 4G8KA 1BU9A 2ETBA 1WDYA 1N0QA 5EYLA 4TUMA 4BESA 3ZU7B 3UTMA 1G3NB 5AAOA 3C5RA 1K1BA 3V79K 4O1OA 5EN5D 5EYPF 3TWXA 1NFIE 3EU9A 2V5QC 1IHBA 5KNGA 4BEPA 5BXUA 2V4HC 4K5BA 2MYOA 4QQIA 4HNAD 2FO1E 4NIKA 2QC9A 5FIOA 4LG6A 3LJNA 4HI9A 4U95D 4O60A 3ZUVB 4F6RD 4U96D 3Q9UC 4CZ2D 5KNHD 3V2XA 4B93B 4OAUC 1A5EA 3EHRA 3W9FA 2L6BA 4YDYA 4GMRA 4N5QA 2XEHA 5ENPD 2Y0BG 2BKKB 1DC2A 3AAAC 3TWWA 5HS0A 3NOGD 3NBNB 3ZNGA 1BLXB 2KBXA 1S70B 2ZGDA 5ENQD 4LSZE 1BI8B 3W9GA 5BXOA 1AP7A 4ATZD 4BERA 5ITZF 3TWRA 4RLYA 1MX4A 2DZOA 4K5AB 3D9HA 4C48B 4BETA 4ZHBA 1OY3D 4G8LA 3TWTA 4HI8A 3DEOA 2VGEA 4HRNA 3UI2A 4J7WA 5CEAA 4GPMA 4HB5A 3T9KA 1SW6A 3KEAA 1AWCB 1SVXA 1UOHA 5JMND 5AQ9A 4CYMD 3T8KA 3TWUA 5CBNA 3B95A 1YMPA 4J8YA 2BKGA 1MJ0A 1N11A 4ZFHA 3B7BA 4K5CA 4F1PA 1IKND 5JA4D
chains in the Genus database with same CATH superfamily
2NC9A 3BG0B 1NL4A 4ABNA 5CMWA 4I9CA 1U2VG 3QWVA 2MHKA 3CHSA 3CHQA 2R59A 1OWNA 3O48A 5J08A 3Q78A 3ULEG 3IV0A 3FH7A 4K0RA 4CDNA 2P9LG 4X8QA 1S0PA 1PAQA 3ZKJA 2RKKA 4LNBA 3GZSA 4UUCA 3QAQA 5ENSD 3UM1A 3RU0A 3ASHA 3SBSA 3QC1A 4CRWA 2XRZA 4J8SA 4OAVB 2CHZA 1DCQA 4MLPA 4UWLA 3PS6A 3ZYMA 5JJ6A 4BTBA 2HM8A 3PNLB 2YHCA 4TRQA 3DWLG 3FTWA 3E32A 4URKA 2H6GA 4KBQA 3OAWA 5T3RA 4NQ0A 2Y4UA 2L6BA 4GTOA 1WAO1 2B6CA 2R05A 3AAAC 3QKYA 3G2TA 4Q94A 4DI3A 3L6AA 1ZBPA 5BUZA 2H6IA 5AJDA 4U07A 2XCBA 4E85A 3CSFA 5CEAA 4J7WA 2LXMA 4GPMA 4HB5A 5LCWJ 5FZSA 2Y69E 4GZ5A 2BEDA 2XHEA 4AY6A 3D9KA 4L23A 3G2UA 2QZAA 3UXGA 4GCOA 4GB9A 1WG0A 3LPZA 4JHRA 2DIWA 2IO2C 2P2CP 5AQAA 2IU1A 1JPLA 1VDYA 1OT8A 5KWDA 1HX8A 1FVHA 3CVXA 4HLLA 2P9IG 2FEZA 2Y1LE 3B7TA 3ZGQA 4XI0A 3IHYA 4HRLA 3IXEA 3ZHEA 3SI5A 2RG8A 1HZ4A 1DCEA 3L82A 4JZYA 3ZYKA 1TJFA 3CLJA 3IKOB 5AN8A 4APOA 2ZIRA 3Q79A 1Z5SC 1H6KA 4TUMA 4G1TA 4AV7A 4G2VA 2NXPA 3C5RA 3EJNA 3DBSA 3E30A 2WXNA 1O1TA 3U66A 2MYOA 4NIKA 5AENA 2BF0X 2GRRB 3HXFA 3FUMA 5CCLA 3PZDA 1V55E 5D0OD 2QY7A 2UY1A 3EDTB 3I3NA 1SZ9A 3SQVA 4LSZE 1FT1A 3UUXA 3ZXSA 3JQ1A 3CKBA 5ITZF 1LF8A 5FWQA 1OY3D 4G24A 2IJGX 2OV8A 5JMND 3ZPJA 5G05J 5FQ7A 3TWUA 3FP3A 3MJWA 4TXPA 4WNEA 3S7JA 1N95A 2X6HA 2QYJA 3VLEA 3OXGA 3D9LA 2J8SD 3FU3A 3CIAA 3ABKE 2PM6A 3D9MA 4AEZC 5FINA 2UWJG 2AJAA 5D0QD 3ZRHA 2F0YA 3JUEA 3UIOC 3U4TA 1XNFA 4BT8A 1K3ZD 2EIME 4YDOA 1IQUA 2WXMA 1K8KG 1SZAA 5JJ7A 2VGXA 4DX6D 2NYJA 4TXRA 4JPSA 4BY6A 3ISMC 4EZLA 1BD8A 3FEXA 3HVEA 4GAAA 1BU9A 4BESA 5EYLA 5AAOA 4YVQC 4ANWA 2PZIA 3B7RL 2C0MA 4GMLA 1RW2A 2A5UA 5AYWD 4XKCA 4J0UA 2MOWA 4HI9A 3HYMB 4N5CA 1A17A 4EPZA 4F6RD 4BT9A 4B93B 2J4BA 3L08A 2BKKB 4L1BA 5C1DA 5JJTA 2IOLA 3WXXA 1BLXB 1TNOA 5FQ8A 1QQEA 2ILRA 1HE8A 4H7YA 2C2LA 2DZOA 2JEKA 3PE4A 3TWTA 3ZN3A 2KZTB 4GTPA 1NZNA 2AWIA 4UQZA 5G2NA 5CECB 4EBAG 3PDNA 2WXQA 3MKQA 4MRUA 4U0ZA 1E8WA 3NB2A 1N4PA 3QNKA 2RFMA 4HOUA 4FULA 4LCTA 2HO1A 3JUIA 4W9RA 3FTZA 4EZKA 4TV3A 2NSZA 4JHKA 5CRUA 3VLFA 2VSYA 2I2OA 5CBOA 4G25A 1GW6A 2XPYA 5D66A 1N4RA 3QB2A 2AXZA 4HS2A 3FTUA 5FZRA 3SBTB 3ZU7B 4XKBA 2VTBB 1IQRA 1DVPA 2AXVA 5KNGA 4BEPA 4K5BA 2QC9A 5FIOA 3OTNA 5BV1A 2FO7A 4ILHB 4AJWA 3OXLA 4G11A 4N5QA 1D8DA 3RIBA 4GTVA 2KM4A 2KBXA 1BI8B 1LD8A 1OWOA 3ULYA 3P1UA 3LJ3A 4I43A 1E7UA 1SW6A 1KT0A 1SVXA 1N9AA 4UI9K 1MQSA 2H6FA 1N11A 4PH4B 3L17A 2F8YA 4LEUA 4B8AA 5D2MC 3UM3A 5EKQD 3FUFA 2WXGA 2F8XK 2GRQB 2IQCA 3PNTB 3PUJA 3KSQA 4L9PA 5CEDB 4JC8A 2YHEA 4UWHA 1OCOE 2GRPB 3KSLA 3ASGA 5E75A 4HOTA 4HLEA 4I1MA 2AXUA 4WUYA 4I1OB 5BW8C 2VJ8A 2Q7FA 1O1SA 4KZ0A 2DWZA 3FWVA 2L9BA 3TL5A 1QBQA 3CQGB 3TG5A 4B8CB 2J49A 1KPSB 1K1BA 1NFIE 3RJVA 3ZW3A 1KLXA 1Z6TA 2V5QC 4GTSA 3DSSA 5BXUA 3PZ3A 4HFGA 4LG6A 2L0IA 2BTDA 4H7XA 4M3OA 1DC2A 3TXNA 2YNQA 4I6EA 2VSXE 4UI9C 4GPKA 5AJLA 1TNUA 4FADA 1MX4A 3ASNE 4DK5A 1JWFA 4EECA 4HI8A 4N3CA 5FT9A 1ZU2A 4JHJA 4JA7A 3KAEA 4B94A 1HXIA 3B7BA 3ML8A 3ASDA 3CKCA 5ENTD 2HE0A 4XIFA 4Y6CA 5EIDA 1DNPA 2IEJA 4DI4A 1INZA 4AOFA 3CGHA 4TUUA 1JWGA 1Z3XA 4LNGA 1FVFA 3DXMG 3JXJA 3MZLB 4RSYA 3KS2A 3FUKA 4O1PA 3J5PA 3LY7A 2A4ZA 4GYWA 2P58C 3TJPA 4BX8A 3LKUA 1OWMA 2I6HA 4PDXA 1WDYA 2WMOA 1E8XA 2IO3C 4L2YA 5LP0A 3L54A 3CV0A 3NZSA 3D9OA 3R7QA 4BFRA 4I6GA 4U95D 4FU3A 4U96D 2V8SE 3FH8A 3NQPA 4CGWA 5ENPD 2Y0BG 4JW1A 3L9TA 2J4DA 4J8FA 1S70B 3BG1B 3W9GA 2RD0A 4NRHB 1N52A 3G2VA 4IN3B 1TEZA 2M63A 3AS5A 1SQMA 2P9PG 4G8LA 4UWFA 2KCKA 5E76A 3UI2A 3I4GA 1N94A 3GZ1A 1UN8A 1Q2ZA 4J8YA 3MV2B 5LX8A 2FO1E 4FP7A 3V30A 2ONDA 3C3QA 3TWVA 4N2SA 4DX5D 1IHGA 1LD7A 2I1KA 4Y6WA 3TWQA 3PUKA 3ZEFA 1TR4A 5EIBE 2WQ7A 3LVRE 3IEGA 3Q9NC 4HQDA 1HU3A 3ZIMA 3PRZA 4HBDA 2BUGA 3DSUA 1O1RA 5H7PA 4LNUD 2WB2A 5KJLA 5J90A 2IY0C 3T5XA 3QWPA 5HRYA 4IYPA 4WWNA 3PH0C 3UM2A 3L13A 4CDMA 2QYUA 2R03A 3CK7A 3LYAA 2KZTA 3VLDA 4B89A 2WXPA 3EU5A 3EIJA 3OXFA 3SF4A 1JUQA 3Q47B 2HYZA 3LDZA 3EHRA 3SFZA 3LS8A 4XI9A 3FUHA 4ILIA 4F3VA 3ZNGA 2ZGDA 4LRZA 4AXHA 5BXOA 5BNWA 4APFA 2X6IA 1AWCB 4F53A 5A23A 4WAFA 4C0MA 1H6OA 4JEUA 2VSNA 2WMNA 1HF8A 3C3RA 3AG2E 4I1AA 3Q7AA 3SD5A 2E0IA 3AU4A 4G23A 3UT4A 2WPVA 1N0RA 2OEWA 3AJIA 2ETAA 3RO2A 5LCWC 4PS7A 2VTBA 3CVWA 5CMYA 3SGHA 3ONLA 1EPUA 3K9IA 4U8VD 2WXFA 4U0UA 3D9NA 4BWRA 2AW6A 4YNDA 1HO8A 5BV0A 4OVVA 3CVLA 1WM5A 1S63A 2WXJA 4I2ZA 2DYRE 3RRNB 5LFAA 4FLHA 2PQNA 3CQCB 5KNHD 4U63A 3V2XA 3N71A 1HG5A 3W9FA 3FU5A 2X6KA 2XCCA 3FDHA 3TWWA 3RRMB 4IULA 3EUVA 1AP7A 3TWRA 1HG2A 3TGOA 3P2BA 3QJZA 2DCPA 2XRYA 5AQ9A 2OVFA 5FJYA 4G26A 3FUDA 3CVUA 4OAUC 1IKND 4U8HA 3Q49B 4KMOA 1YCSB 1QYMA 3EIQC 2R5SA 4U7EB 3AU5A 4N39A 4LUNU 4DLOA 4Z68A 5KBAA 5AQ7A 1H2TC 3CVNA 2XZDG 3ZHEB 5CERB 3KD7A 4C0EA 5G05C 3V31A 1YYHA 3CHOA 4ANVA 5G04C 4GYOA 1UJKA 5ENRD 2ZGGA 2DBAA 3G2WA 5B3SE 2P9UG 1SA4A 4BTAA 1E8ZA 3C3OA 3U3WA 3DPDA 5EN5D 5DIZA 3C98A 4FHJA 3EU9A 3ASOE 1E90A 1NI1A 1JCQA 3HHMA 4ILGA 5M72A 3UX4A 2KCLA 3ZUVB 4WNGA 2KC7A 4NURA 4HVBA 2LSUA 2LSVA 2WXIA 3PZ1A 2UY1B 3RAUA 3NBNB 4I2WA 1JCRA 3UKRG 4A1GA 3D9HA 4BETA 3E4BA 4BX9A 2VGEA 2EINE 3FHEA 3AS8A 1FPPA 2I9CA 3T8KA 3UM0A 4KVOA 4MKTA 3MV3B 4K5CA 1H2VC 3IBEA 3GW4A 1IXVA 1EDUA 5CHEE 4GCNA 3MCXA 5T8IA 3URZA 2L0TB 5AQBA 4YDEA 5HI7A 3CHPA 2WXLA 3PEUB 4ME2A 3JCKC 3NOCD 1N4SA 3SHFA 3FUJA 2DVWA 1H2UA 2A5EA 1O5MA 3L22A 5EX0A 3T5VA 2IONA 4F7AA 2PNNA 5EDSA 1D8EA 3SO8A 4DUIA 2EILE 2ETBA 3TAXA 2LO6A 5FZQA 5KCMA 3QK0A 3V79K 3Q75A 3AG4E 4GZCA 3GYZA 4KVMA 4FA6A 4HXIA 5ANLA 4GTMA 3CVQA 3MA5A 3DPYA 3Q4AB 3UINC 4UWKA 3RKVA 4YDYA 1P5QA 5HS0A 5BPPA 4ATZD 2GROB 4K5AB 4DJAA 4C48B 2WXRA 3SFYA 2C0LA 2X38A 4XZ4A 5FTPA 1S64A 2KCVA 3EHNA 4V3IA 3RK6A 1XGWA 1UOHA 4J8DA 2VYIA 2BKGA 4WWOA 1TN8A 3IHVA 4E6HA 3HG0D 3QDNA 4PS3A 1TNBA 1ELRA 3NAWA 3FH5A 3QWWA 2ZU6B 3JXIA 1ELKA 3UMVA 5CCMA 2JABA 2Y3AA 3DRAA 2WQHA 1OCCE 4DPRA 1UG3A 2R17C 2B0OE 3I5PA 4HOQA 4ACKA 4JB8P 2KATA 2XS8A 4DRXE 3TWSA 3R9AB 4K03A 3HRAA 4HRMB 2Y4TA 4GTRA 4PS8A 1X81A 3CSTA 4WNDA 2P9NG 1OXJA 2VGYA 1X5BA 5EYPF 3TWXA 2IFUA 1NA0A 3AG3E 3D9JA 1E7VA 2H6HA 4O60A 3Q7FA 4EBAA 4BSXA 3D9IA 1TJCA 4J6IA 3FU6A 3FTVA 3HDXA 3HXCA 4AY5A 4WNFA 4GTTA 3PEVB 1H19A 3AS4A 4BERA 4WWPA 4CEMA 3PZ2A 3CR3A 2JLBA 4RLYA 3T8MA 5EX3A 3LEWA 4J8EA 1ZB1A 2LNIA 4U04A 4L7TA 3APFA 4JVSA 4JXTA 1MJ0A 3EHQA 1OCRE 2L6JA 4GYYA 4GA2A 5JHBA 2X6JA 1W3BA 2ZISA 3MX3A 1NP7A 2WXOA 3ZVVA 4DX2A 4YDWA 2V5FA 1UN9A 3DSTA 5HKPA 3X2QE 1TNYA 2VQ2A 2WQ6A 2X6FA 2IF4A 4GZ6A 3VTYA 3RO3A 4AIFA 3ZFWA 1Z3YA 5CRVA 4FHKA 4G8KA 2XGSA 1OWPA 1N54A 1N4QA 2ZXWE 4NACA 1UW4B 4RQIA 2CHXA 3NF1A 1V54E 3LJNA 5FQ6A 1ELWA 1B89A 1E96B 4JA9A 3APDA 3VTXA 4UWGA 4ATGA 5IY5E 2DYSE 4AM9A 4ZHBA 2WVIA 4GA1A 4HRNA 3UKUG 4RG6A 4GTQA 1U3CA 3BEEA 1YMPA 1OCZE 3LCAA 1E8YA 3I4RB 2PL2A 5C2YA 4F1SA 1RZ4A 4FJZA 2MRIA 3BQOA 2FF4A 3FUNA 4YVOA 1MX6A 2YQ8A 5T4YA 4KYOB 4OYSA 3MYVA 4I6JA 2XPZA 3CEQA 1FT2A 2F37A 3F6QA 3ESKA 3V2OA 1MHQA 3ABLE 4ACLA 4U8YD 3LXUX 3CVPA 2XEVA 2KXPC 3ML9A 2GRLA 1OUVA 5BT1A 3DSVA 2OVBA 1SA5A 1L5JA 2FI7A 4C9BB 3HXDA 1N0QA 3G2SA 3ASFA 3FU0A 3UTMA 1U3DA 3Q15A 3LY9A 2LAIA 1EF1C 5A6CA 3BU8A 4XEIG 3FTXA 3B13A 1Y8MA 4KT6B 4HORA 3ESLA 2EIKE 4ANUA 4HNAD 1JCSA 2GW1A 4IRUA 4CZ2D 1KT1A 1MZCA 1A5EA 3LVQE 5G04J 3HXBA 4RVBA 4A3VA 2EQXA 3ZYLA 2P9SG 3JYSA 3DEOA 3S7DA 5JHAA 3RSEG 4P29A 1KZPA 3B95A 4N2QA 3ZYQA 5KJMA 3UPVA 4N3AA 3S2AA 4DX1A 2YINA 4OVUA 3CHRA 2J09A 3JQ0A 4GA0A 3QOUA 3DXKG 3NZUA 4I17A 1OWLA 2XENA 4HOSA 3FFLA 3PVLA 1K1AA 2GRMA 3J5QB 4EZJA 4GZ3A 3HXEA 4DX7D 2CFZA 5ENOD 5ANRA 5DBKA 1MX2A 4B0ZA 2XQ0A 4FC8A 1BI7B 3SFXA 3FULA 1QNFA 3B7UX 3UIPC 3PZ4A 2CHWA 3GZ2A 2V4HC 1WY6A 4L2LA 4XX5A 3R7RA 3ZXPA 1QZ2A 3HIZA 3WG7E 2XEHA 3ONKA 4CGVA 3PE3A 3CK9A 3UQ3A 3D3MA 1PY1A 5ENQD 3Q5MA 2X3MA 4CCAA 3Q73A 4PUCA 3FUEA 2OCCE 1HS6A 3TG4A 4I9EA 4LERA 4CYMD 2OEVA 4CT4A 1BPOA 2WM9A 2XS1A 4FJYA 4ZFHA 2GRNB 3T9KA 3B7SA 4N3BA 1EYHA 4JEHA 2WXKA 3ABME 3PREA 3E34A 3MEKA 4MS6A 4M7CA 3DSXA 5KJNA 5AARA 3EHMA 1UJJA 2XEEA 2XPIA 5HQ8A 5EILA 4A3TA 2RFAA 1D9SA 3MGBA 2WXHA 3R9MA 3DEPA 2HR2A 3APCA 4UQYA 3CVVA 2ETCA 2XZTG 3U9WA 2J07A 3TXMA 4A63B 3FY4A 3L16A 4UI9J 1HFAA 3E33A 4KXKB 4BSZB 4GU5A 4Q69A 4DLQA 2LXLA 1MYOA 5AIJA 3AG1E 1G3NB 2FBNA 2J9QA 2R02A 4R7LA 2PQRA 5B1AE 3ENEA 2GGFA 3CK8A 2E2EA 2XGMA 1IHBA 3ULQA 3S7BA 2PM7A 4Q96A 2VGXB 4GMRA 2CFUA 1HH8A 3HVEB 1H6PA 2EIJE 2CG2A 5ARFA 2J08A 3FEYA 3BUAA 2QFCA 4TXQA 3SZ7A 4RG9A 5G55A 4UQXA 4AVXA 3KEAA 4EQFA 5CBNA 1TYQG 5JA4D 4FLBA 2I1JA 2FULA 2V0PA 4JL0A 2OOEA 5LOZA 4AP2A 3LY8A 2AVPA 4JD2G 4U0SA 5B1BE 2CG3A 2XGOA 3FTSA 2LUHA 3FTYA 4KZCA 3S7FA 1H0AA 1PC2A 2IOSA 2R2LA 4O6FA 1YA0A 5FQ4A 1KZOA 2DZNA 2LAHA 1TN7A 4ANXA 3MKQB 1LTXA 1Y6IA 3MKRA 3QARA 4QFVA 3DSWA 1NA3A 2P9KG 3U64A 5A7DB 5ENNA 3CVYA 3UT8A 3UT7A 4O1OA 4XE0A 4CT0A 2V4LA 4MBGA 4QQIA 4A1SA 1TN6A 3C72A 3SNXA 4CDRA 3Q9UC 3O4ZA 3FUIA 3E37A 3NOGD 4D10C 5KJKA 3KEZA 4A55A 3SY2A 1TNZA 5ARGA 2VSOE 4GMJA 3RRUA 3CHMA 1FCHA 1IYGA 3D9PA 4EHMA 4GZDA 4F1PA
chains in the Genus database with same CATH topology
3EHQA 5CECB 5ENTD 3UXGA 1IXVA 2HE0A 2QYJA 1YCSB 3V30A 1WG0A 2F8YA 3HG0D 1QYMA 5EIDA 3TWVA 5AQBA 2P2CP 4DX5D 5AQAA 2J8SD 1OT8A 4DX1A 5KWDA 3JXIA 5AARA 2F8XK 2RFMA 3TWQA 2XEEA 3NOCD 1TR4A 1MX6A 5EILA 2JABA 5EIBE 4HLLA 4Z68A 2RFAA 5FINA 4DX2A 1D9SA 1N0RA 5CEDB 5KBAA 5AQ7A 2AJAA 3JXJA 2DVWA 2ETAA 2B0OE 2Y1LE 3AJIA 4YDWA 3Q9NC 3DEPA 4JB8P 4HQDA 3JUEA 4HRLA 3IXEA 2XZDG 3ZKJA 2XENA 2F37A 2DZNA 3F6QA 5HKPA 4HBDA 4UUCA 3V2OA 2A5EA 5ENSD 5CERB 3V31A 1YYHA 4U8YD 1K1AA 1K3ZD 2ETCA 2XZTG 4O1PA 4DRXE 3J5QB 3TWSA 3J5PA 4U8VD 2KXPC 4LNUD 3HRAA 4A63B 4QFVA 4HRMB 5ENRD 4DX7D 2PNNA 4OAVB 5ENOD 5AN8A 4DX6D 2NYJA 2DWZA 2ZGGA 5CBOA 1DCQA 4BSZB 1MX2A 3SO8A 5HRYA 4DUIA 1BD8A 5D66A 1BI7B 1MYOA 4G8KA 1BU9A 2ETBA 1WDYA 1N0QA 5EYLA 4TUMA 4BESA 3ZU7B 3UTMA 1G3NB 5AAOA 3C5RA 1K1BA 3V79K 4O1OA 5EN5D 5EYPF 3TWXA 1NFIE 3EU9A 2V5QC 1IHBA 5KNGA 4BEPA 5BXUA 2V4HC 4K5BA 2MYOA 4QQIA 4HNAD 2FO1E 4NIKA 2QC9A 5FIOA 4LG6A 3LJNA 4HI9A 4U95D 4O60A 3ZUVB 4F6RD 4U96D 3Q9UC 4CZ2D 5KNHD 3V2XA 4B93B 4OAUC 1A5EA 3EHRA 3W9FA 2L6BA 4YDYA 4GMRA 4N5QA 2XEHA 5ENPD 2Y0BG 2BKKB 1DC2A 3AAAC 3TWWA 5HS0A 3NOGD 3NBNB 3ZNGA 1BLXB 2KBXA 1S70B 2ZGDA 5ENQD 4LSZE 1BI8B 3W9GA 5BXOA 1AP7A 4ATZD 4BERA 5ITZF 3TWRA 4RLYA 1MX4A 2DZOA 4K5AB 3D9HA 4C48B 4BETA 4ZHBA 1OY3D 4G8LA 3TWTA 4HI8A 3DEOA 2VGEA 4HRNA 3UI2A 4J7WA 5CEAA 4GPMA 4HB5A 3T9KA 1SW6A 3KEAA 1AWCB 1SVXA 1UOHA 5JMND 5AQ9A 4CYMD 3T8KA 3TWUA 5CBNA 3B95A 1YMPA 4J8YA 2BKGA 1MJ0A 1N11A 4ZFHA 3B7BA 4K5CA 4F1PA 1IKND 5JA4D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EHQ A;  5CEC B;  5ENT D;  3UXG A;  1IXV A;  2HE0 A;  2QYJ A;  1YCS B;  3V30 A;  1WG0 A;  2F8Y A;  3HG0 D;  1QYM A;  5EID A;  3TWV A;  5AQB A;  2P2C P;  4DX5 D;  5AQA A;  2J8S D;  1OT8 A;  4DX1 A;  5KWD A;  3JXI A;  5AAR A;  2F8X K;  2RFM A;  3TWQ A;  2XEE A;  3NOC D;  1TR4 A;  1MX6 A;  5EIL A;  2JAB A;  5EIB E;  4HLL A;  4Z68 A;  2RFA A;  5FIN A;  4DX2 A;  1D9S A;  1N0R A;  5CED B;  5KBA A;  5AQ7 A;  2AJA A;  3JXJ A;  2DVW A;  2ETA A;  2B0O E;  2Y1L E;  3AJI A;  4YDW A;  3Q9N C;  3DEP A;  4JB8 P;  4HQD A;  3JUE A;  4HRL A;  3IXE A;  2XZD G;  3ZKJ A;  2XEN A;  2F37 A;  2DZN A;  3F6Q A;  5HKP A;  4HBD A;  4UUC A;  3V2O A;  2A5E A;  5ENS D;  5CER B;  3V31 A;  1YYH A;  4U8Y D;  1K1A A;  1K3Z D;  2ETC A;  2XZT G;  4O1P A;  4DRX E;  3J5Q B;  3TWS A;  3J5P A;  4U8V D;  2KXP C;  4LNU D;  3HRA A;  4A63 B;  4QFV A;  4HRM B;  5ENR D;  4DX7 D;  2PNN A;  4OAV B;  5ENO D;  5AN8 A;  4DX6 D;  2NYJ A;  2DWZ A;  2ZGG A;  5CBO A;  1DCQ A;  4BSZ B;  1MX2 A;  3SO8 A;  5HRY A;  4DUI A;  1BD8 A;  5D66 A;  1BI7 B;  1MYO A;  4G8K A;  1BU9 A;  2ETB A;  1WDY A;  1N0Q A;  5EYL A;  4TUM A;  4BES A;  3ZU7 B;  3UTM A;  1G3N B;  5AAO A;  3C5R A;  1K1B A;  3V79 K;  4O1O A;  5EN5 D;  5EYP F;  3TWX A;  1NFI E;  3EU9 A;  2V5Q C;  1IHB A;  5KNG A;  4BEP A;  5BXU A;  2V4H C;  4K5B A;  2MYO A;  4QQI A;  4HNA D;  2FO1 E;  4NIK A;  2QC9 A;  5FIO A;  4LG6 A;  3LJN A;  4HI9 A;  4U95 D;  4O60 A;  3ZUV B;  4F6R D;  4U96 D;  3Q9U C;  4CZ2 D;  5KNH D;  3V2X A;  4B93 B;  4OAU C;  1A5E A;  3EHR A;  3W9F A;  2L6B A;  4YDY A;  4GMR A;  4N5Q A;  2XEH A;  5ENP D;  2Y0B G;  2BKK B;  1DC2 A;  3AAA C;  3TWW A;  5HS0 A;  3NOG D;  3NBN B;  3ZNG A;  1BLX B;  2KBX A;  1S70 B;  2ZGD A;  5ENQ D;  4LSZ E;  1BI8 B;  3W9G A;  5BXO A;  1AP7 A;  4ATZ D;  4BER A;  5ITZ F;  3TWR A;  4RLY A;  1MX4 A;  2DZO A;  4K5A B;  3D9H A;  4C48 B;  4BET A;  4ZHB A;  1OY3 D;  4G8L A;  3TWT A;  4HI8 A;  3DEO A;  2VGE A;  4HRN A;  3UI2 A;  4J7W A;  5CEA A;  4GPM A;  4HB5 A;  3T9K A;  1SW6 A;  3KEA A;  1AWC B;  1SVX A;  1UOH A;  5JMN D;  5AQ9 A;  4CYM D;  3T8K A;  3TWU A;  5CBN A;  3B95 A;  1YMP A;  4J8Y A;  2BKG A;  1MJ0 A;  1N11 A;  4ZFH A;  3B7B A;  4K5C A;  4F1P A;  1IKN D;  5JA4 D; 
#chains in the Genus database with same CATH topology
 2NC9 A;  3BG0 B;  1NL4 A;  4ABN A;  5CMW A;  4I9C A;  1U2V G;  3QWV A;  2MHK A;  3CHS A;  3CHQ A;  2R59 A;  1OWN A;  3O48 A;  5J08 A;  3Q78 A;  3ULE G;  3IV0 A;  3FH7 A;  4K0R A;  4CDN A;  2P9L G;  4X8Q A;  1S0P A;  1PAQ A;  3ZKJ A;  2RKK A;  4LNB A;  3GZS A;  4UUC A;  3QAQ A;  5ENS D;  3UM1 A;  3RU0 A;  3ASH A;  3SBS A;  3QC1 A;  4CRW A;  2XRZ A;  4J8S A;  4OAV B;  2CHZ A;  1DCQ A;  4MLP A;  4UWL A;  3PS6 A;  3ZYM A;  5JJ6 A;  4BTB A;  2HM8 A;  3PNL B;  2YHC A;  4TRQ A;  3DWL G;  3FTW A;  3E32 A;  4URK A;  2H6G A;  4KBQ A;  3OAW A;  5T3R A;  4NQ0 A;  2Y4U A;  2L6B A;  4GTO A;  1WAO 1;  2B6C A;  2R05 A;  3AAA C;  3QKY A;  3G2T A;  4Q94 A;  4DI3 A;  3L6A A;  1ZBP A;  5BUZ A;  2H6I A;  5AJD A;  4U07 A;  2XCB A;  4E85 A;  3CSF A;  5CEA A;  4J7W A;  2LXM A;  4GPM A;  4HB5 A;  5LCW J;  5FZS A;  2Y69 E;  4GZ5 A;  2BED A;  2XHE A;  4AY6 A;  3D9K A;  4L23 A;  3G2U A;  2QZA A;  3UXG A;  4GCO A;  4GB9 A;  1WG0 A;  3LPZ A;  4JHR A;  2DIW A;  2IO2 C;  2P2C P;  5AQA A;  2IU1 A;  1JPL A;  1VDY A;  1OT8 A;  5KWD A;  1HX8 A;  1FVH A;  3CVX A;  4HLL A;  2P9I G;  2FEZ A;  2Y1L E;  3B7T A;  3ZGQ A;  4XI0 A;  3IHY A;  4HRL A;  3IXE A;  3ZHE A;  3SI5 A;  2RG8 A;  1HZ4 A;  1DCE A;  3L82 A;  4JZY A;  3ZYK A;  1TJF A;  3CLJ A;  3IKO B;  5AN8 A;  4APO A;  2ZIR A;  3Q79 A;  1Z5S C;  1H6K A;  4TUM A;  4G1T A;  4AV7 A;  4G2V A;  2NXP A;  3C5R A;  3EJN A;  3DBS A;  3E30 A;  2WXN A;  1O1T A;  3U66 A;  2MYO A;  4NIK A;  5AEN A;  2BF0 X;  2GRR B;  3HXF A;  3FUM A;  5CCL A;  3PZD A;  1V55 E;  5D0O D;  2QY7 A;  2UY1 A;  3EDT B;  3I3N A;  1SZ9 A;  3SQV A;  4LSZ E;  1FT1 A;  3UUX A;  3ZXS A;  3JQ1 A;  3CKB A;  5ITZ F;  1LF8 A;  5FWQ A;  1OY3 D;  4G24 A;  2IJG X;  2OV8 A;  5JMN D;  3ZPJ A;  5G05 J;  5FQ7 A;  3TWU A;  3FP3 A;  3MJW A;  4TXP A;  4WNE A;  3S7J A;  1N95 A;  2X6H A;  2QYJ A;  3VLE A;  3OXG A;  3D9L A;  2J8S D;  3FU3 A;  3CIA A;  3ABK E;  2PM6 A;  3D9M A;  4AEZ C;  5FIN A;  2UWJ G;  2AJA A;  5D0Q D;  3ZRH A;  2F0Y A;  3JUE A;  3UIO C;  3U4T A;  1XNF A;  4BT8 A;  1K3Z D;  2EIM E;  4YDO A;  1IQU A;  2WXM A;  1K8K G;  1SZA A;  5JJ7 A;  2VGX A;  4DX6 D;  2NYJ A;  4TXR A;  4JPS A;  4BY6 A;  3ISM C;  4EZL A;  1BD8 A;  3FEX A;  3HVE A;  4GAA A;  1BU9 A;  4BES A;  5EYL A;  5AAO A;  4YVQ C;  4ANW A;  2PZI A;  3B7R L;  2C0M A;  4GML A;  1RW2 A;  2A5U A;  5AYW D;  4XKC A;  4J0U A;  2MOW A;  4HI9 A;  3HYM B;  4N5C A;  1A17 A;  4EPZ A;  4F6R D;  4BT9 A;  4B93 B;  2J4B A;  3L08 A;  2BKK B;  4L1B A;  5C1D A;  5JJT A;  2IOL A;  3WXX A;  1BLX B;  1TNO A;  5FQ8 A;  1QQE A;  2ILR A;  1HE8 A;  4H7Y A;  2C2L A;  2DZO A;  2JEK A;  3PE4 A;  3TWT A;  3ZN3 A;  2KZT B;  4GTP A;  1NZN A;  2AWI A;  4UQZ A;  5G2N A;  5CEC B;  4EBA G;  3PDN A;  2WXQ A;  3MKQ A;  4MRU A;  4U0Z A;  1E8W A;  3NB2 A;  1N4P A;  3QNK A;  2RFM A;  4HOU A;  4FUL A;  4LCT A;  2HO1 A;  3JUI A;  4W9R A;  3FTZ A;  4EZK A;  4TV3 A;  2NSZ A;  4JHK A;  5CRU A;  3VLF A;  2VSY A;  2I2O A;  5CBO A;  4G25 A;  1GW6 A;  2XPY A;  5D66 A;  1N4R A;  3QB2 A;  2AXZ A;  4HS2 A;  3FTU A;  5FZR A;  3SBT B;  3ZU7 B;  4XKB A;  2VTB B;  1IQR A;  1DVP A;  2AXV A;  5KNG A;  4BEP A;  4K5B A;  2QC9 A;  5FIO A;  3OTN A;  5BV1 A;  2FO7 A;  4ILH B;  4AJW A;  3OXL A;  4G11 A;  4N5Q A;  1D8D A;  3RIB A;  4GTV A;  2KM4 A;  2KBX A;  1BI8 B;  1LD8 A;  1OWO A;  3ULY A;  3P1U A;  3LJ3 A;  4I43 A;  1E7U A;  1SW6 A;  1KT0 A;  1SVX A;  1N9A A;  4UI9 K;  1MQS A;  2H6F A;  1N11 A;  4PH4 B;  3L17 A;  2F8Y A;  4LEU A;  4B8A A;  5D2M C;  3UM3 A;  5EKQ D;  3FUF A;  2WXG A;  2F8X K;  2GRQ B;  2IQC A;  3PNT B;  3PUJ A;  3KSQ A;  4L9P A;  5CED B;  4JC8 A;  2YHE A;  4UWH A;  1OCO E;  2GRP B;  3KSL A;  3ASG A;  5E75 A;  4HOT A;  4HLE A;  4I1M A;  2AXU A;  4WUY A;  4I1O B;  5BW8 C;  2VJ8 A;  2Q7F A;  1O1S A;  4KZ0 A;  2DWZ A;  3FWV A;  2L9B A;  3TL5 A;  1QBQ A;  3CQG B;  3TG5 A;  4B8C B;  2J49 A;  1KPS B;  1K1B A;  1NFI E;  3RJV A;  3ZW3 A;  1KLX A;  1Z6T A;  2V5Q C;  4GTS A;  3DSS A;  5BXU A;  3PZ3 A;  4HFG A;  4LG6 A;  2L0I A;  2BTD A;  4H7X A;  4M3O A;  1DC2 A;  3TXN A;  2YNQ A;  4I6E A;  2VSX E;  4UI9 C;  4GPK A;  5AJL A;  1TNU A;  4FAD A;  1MX4 A;  3ASN E;  4DK5 A;  1JWF A;  4EEC A;  4HI8 A;  4N3C A;  5FT9 A;  1ZU2 A;  4JHJ A;  4JA7 A;  3KAE A;  4B94 A;  1HXI A;  3B7B A;  3ML8 A;  3ASD A;  3CKC A;  5ENT D;  2HE0 A;  4XIF A;  4Y6C A;  5EID A;  1DNP A;  2IEJ A;  4DI4 A;  1INZ A;  4AOF A;  3CGH A;  4TUU A;  1JWG A;  1Z3X A;  4LNG A;  1FVF A;  3DXM G;  3JXJ A;  3MZL B;  4RSY A;  3KS2 A;  3FUK A;  4O1P A;  3J5P A;  3LY7 A;  2A4Z A;  4GYW A;  2P58 C;  3TJP A;  4BX8 A;  3LKU A;  1OWM A;  2I6H A;  4PDX A;  1WDY A;  2WMO A;  1E8X A;  2IO3 C;  4L2Y A;  5LP0 A;  3L54 A;  3CV0 A;  3NZS A;  3D9O A;  3R7Q A;  4BFR A;  4I6G A;  4U95 D;  4FU3 A;  4U96 D;  2V8S E;  3FH8 A;  3NQP A;  4CGW A;  5ENP D;  2Y0B G;  4JW1 A;  3L9T A;  2J4D A;  4J8F A;  1S70 B;  3BG1 B;  3W9G A;  2RD0 A;  4NRH B;  1N52 A;  3G2V A;  4IN3 B;  1TEZ A;  2M63 A;  3AS5 A;  1SQM A;  2P9P G;  4G8L A;  4UWF A;  2KCK A;  5E76 A;  3UI2 A;  3I4G A;  1N94 A;  3GZ1 A;  1UN8 A;  1Q2Z A;  4J8Y A;  3MV2 B;  5LX8 A;  2FO1 E;  4FP7 A;  3V30 A;  2OND A;  3C3Q A;  3TWV A;  4N2S A;  4DX5 D;  1IHG A;  1LD7 A;  2I1K A;  4Y6W A;  3TWQ A;  3PUK A;  3ZEF A;  1TR4 A;  5EIB E;  2WQ7 A;  3LVR E;  3IEG A;  3Q9N C;  4HQD A;  1HU3 A;  3ZIM A;  3PRZ A;  4HBD A;  2BUG A;  3DSU A;  1O1R A;  5H7P A;  4LNU D;  2WB2 A;  5KJL A;  5J90 A;  2IY0 C;  3T5X A;  3QWP A;  5HRY A;  4IYP A;  4WWN A;  3PH0 C;  3UM2 A;  3L13 A;  4CDM A;  2QYU A;  2R03 A;  3CK7 A;  3LYA A;  2KZT A;  3VLD A;  4B89 A;  2WXP A;  3EU5 A;  3EIJ A;  3OXF A;  3SF4 A;  1JUQ A;  3Q47 B;  2HYZ A;  3LDZ A;  3EHR A;  3SFZ A;  3LS8 A;  4XI9 A;  3FUH A;  4ILI A;  4F3V A;  3ZNG A;  2ZGD A;  4LRZ A;  4AXH A;  5BXO A;  5BNW A;  4APF A;  2X6I A;  1AWC B;  4F53 A;  5A23 A;  4WAF A;  4C0M A;  1H6O A;  4JEU A;  2VSN A;  2WMN A;  1HF8 A;  3C3R A;  3AG2 E;  4I1A A;  3Q7A A;  3SD5 A;  2E0I A;  3AU4 A;  4G23 A;  3UT4 A;  2WPV A;  1N0R A;  2OEW A;  3AJI A;  2ETA A;  3RO2 A;  5LCW C;  4PS7 A;  2VTB A;  3CVW A;  5CMY A;  3SGH A;  3ONL A;  1EPU A;  3K9I A;  4U8V D;  2WXF A;  4U0U A;  3D9N A;  4BWR A;  2AW6 A;  4YND A;  1HO8 A;  5BV0 A;  4OVV A;  3CVL A;  1WM5 A;  1S63 A;  2WXJ A;  4I2Z A;  2DYR E;  3RRN B;  5LFA A;  4FLH A;  2PQN A;  3CQC B;  5KNH D;  4U63 A;  3V2X A;  3N71 A;  1HG5 A;  3W9F A;  3FU5 A;  2X6K A;  2XCC A;  3FDH A;  3TWW A;  3RRM B;  4IUL A;  3EUV A;  1AP7 A;  3TWR A;  1HG2 A;  3TGO A;  3P2B A;  3QJZ A;  2DCP A;  2XRY A;  5AQ9 A;  2OVF A;  5FJY A;  4G26 A;  3FUD A;  3CVU A;  4OAU C;  1IKN D;  4U8H A;  3Q49 B;  4KMO A;  1YCS B;  1QYM A;  3EIQ C;  2R5S A;  4U7E B;  3AU5 A;  4N39 A;  4LUN U;  4DLO A;  4Z68 A;  5KBA A;  5AQ7 A;  1H2T C;  3CVN A;  2XZD G;  3ZHE B;  5CER B;  3KD7 A;  4C0E A;  5G05 C;  3V31 A;  1YYH A;  3CHO A;  4ANV A;  5G04 C;  4GYO A;  1UJK A;  5ENR D;  2ZGG A;  2DBA A;  3G2W A;  5B3S E;  2P9U G;  1SA4 A;  4BTA A;  1E8Z A;  3C3O A;  3U3W A;  3DPD A;  5EN5 D;  5DIZ A;  3C98 A;  4FHJ A;  3EU9 A;  3ASO E;  1E90 A;  1NI1 A;  1JCQ A;  3HHM A;  4ILG A;  5M72 A;  3UX4 A;  2KCL A;  3ZUV B;  4WNG A;  2KC7 A;  4NUR A;  4HVB A;  2LSU A;  2LSV A;  2WXI A;  3PZ1 A;  2UY1 B;  3RAU A;  3NBN B;  4I2W A;  1JCR A;  3UKR G;  4A1G A;  3D9H A;  4BET A;  3E4B A;  4BX9 A;  2VGE A;  2EIN E;  3FHE A;  3AS8 A;  1FPP A;  2I9C A;  3T8K A;  3UM0 A;  4KVO A;  4MKT A;  3MV3 B;  4K5C A;  1H2V C;  3IBE A;  3GW4 A;  1IXV A;  1EDU A;  5CHE E;  4GCN A;  3MCX A;  5T8I A;  3URZ A;  2L0T B;  5AQB A;  4YDE A;  5HI7 A;  3CHP A;  2WXL A;  3PEU B;  4ME2 A;  3JCK C;  3NOC D;  1N4S A;  3SHF A;  3FUJ A;  2DVW A;  1H2U A;  2A5E A;  1O5M A;  3L22 A;  5EX0 A;  3T5V A;  2ION A;  4F7A A;  2PNN A;  5EDS A;  1D8E A;  3SO8 A;  4DUI A;  2EIL E;  2ETB A;  3TAX A;  2LO6 A;  5FZQ A;  5KCM A;  3QK0 A;  3V79 K;  3Q75 A;  3AG4 E;  4GZC A;  3GYZ A;  4KVM A;  4FA6 A;  4HXI A;  5ANL A;  4GTM A;  3CVQ A;  3MA5 A;  3DPY A;  3Q4A B;  3UIN C;  4UWK A;  3RKV A;  4YDY A;  1P5Q A;  5HS0 A;  5BPP A;  4ATZ D;  2GRO B;  4K5A B;  4DJA A;  4C48 B;  2WXR A;  3SFY A;  2C0L A;  2X38 A;  4XZ4 A;  5FTP A;  1S64 A;  2KCV A;  3EHN A;  4V3I A;  3RK6 A;  1XGW A;  1UOH A;  4J8D A;  2VYI A;  2BKG A;  4WWO A;  1TN8 A;  3IHV A;  4E6H A;  3HG0 D;  3QDN A;  4PS3 A;  1TNB A;  1ELR A;  3NAW A;  3FH5 A;  3QWW A;  2ZU6 B;  3JXI A;  1ELK A;  3UMV A;  5CCM A;  2JAB A;  2Y3A A;  3DRA A;  2WQH A;  1OCC E;  4DPR A;  1UG3 A;  2R17 C;  2B0O E;  3I5P A;  4HOQ A;  4ACK A;  4JB8 P;  2KAT A;  2XS8 A;  4DRX E;  3TWS A;  3R9A B;  4K03 A;  3HRA A;  4HRM B;  2Y4T A;  4GTR A;  4PS8 A;  1X81 A;  3CST A;  4WND A;  2P9N G;  1OXJ A;  2VGY A;  1X5B A;  5EYP F;  3TWX A;  2IFU A;  1NA0 A;  3AG3 E;  3D9J A;  1E7V A;  2H6H A;  4O60 A;  3Q7F A;  4EBA A;  4BSX A;  3D9I A;  1TJC A;  4J6I A;  3FU6 A;  3FTV A;  3HDX A;  3HXC A;  4AY5 A;  4WNF A;  4GTT A;  3PEV B;  1H19 A;  3AS4 A;  4BER A;  4WWP A;  4CEM A;  3PZ2 A;  3CR3 A;  2JLB A;  4RLY A;  3T8M A;  5EX3 A;  3LEW A;  4J8E A;  1ZB1 A;  2LNI A;  4U04 A;  4L7T A;  3APF A;  4JVS A;  4JXT A;  1MJ0 A;  3EHQ A;  1OCR E;  2L6J A;  4GYY A;  4GA2 A;  5JHB A;  2X6J A;  1W3B A;  2ZIS A;  3MX3 A;  1NP7 A;  2WXO A;  3ZVV A;  4DX2 A;  4YDW A;  2V5F A;  1UN9 A;  3DST A;  5HKP A;  3X2Q E;  1TNY A;  2VQ2 A;  2WQ6 A;  2X6F A;  2IF4 A;  4GZ6 A;  3VTY A;  3RO3 A;  4AIF A;  3ZFW A;  1Z3Y A;  5CRV A;  4FHK A;  4G8K A;  2XGS A;  1OWP A;  1N54 A;  1N4Q A;  2ZXW E;  4NAC A;  1UW4 B;  4RQI A;  2CHX A;  3NF1 A;  1V54 E;  3LJN A;  5FQ6 A;  1ELW A;  1B89 A;  1E96 B;  4JA9 A;  3APD A;  3VTX A;  4UWG A;  4ATG A;  5IY5 E;  2DYS E;  4AM9 A;  4ZHB A;  2WVI A;  4GA1 A;  4HRN A;  3UKU G;  4RG6 A;  4GTQ A;  1U3C A;  3BEE A;  1YMP A;  1OCZ E;  3LCA A;  1E8Y A;  3I4R B;  2PL2 A;  5C2Y A;  4F1S A;  1RZ4 A;  4FJZ A;  2MRI A;  3BQO A;  2FF4 A;  3FUN A;  4YVO A;  1MX6 A;  2YQ8 A;  5T4Y A;  4KYO B;  4OYS A;  3MYV A;  4I6J A;  2XPZ A;  3CEQ A;  1FT2 A;  2F37 A;  3F6Q A;  3ESK A;  3V2O A;  1MHQ A;  3ABL E;  4ACL A;  4U8Y D;  3LXU X;  3CVP A;  2XEV A;  2KXP C;  3ML9 A;  2GRL A;  1OUV A;  5BT1 A;  3DSV A;  2OVB A;  1SA5 A;  1L5J A;  2FI7 A;  4C9B B;  3HXD A;  1N0Q A;  3G2S A;  3ASF A;  3FU0 A;  3UTM A;  1U3D A;  3Q15 A;  3LY9 A;  2LAI A;  1EF1 C;  5A6C A;  3BU8 A;  4XEI G;  3FTX A;  3B13 A;  1Y8M A;  4KT6 B;  4HOR A;  3ESL A;  2EIK E;  4ANU A;  4HNA D;  1JCS A;  2GW1 A;  4IRU A;  4CZ2 D;  1KT1 A;  1MZC A;  1A5E A;  3LVQ E;  5G04 J;  3HXB A;  4RVB A;  4A3V A;  2EQX A;  3ZYL A;  2P9S G;  3JYS A;  3DEO A;  3S7D A;  5JHA A;  3RSE G;  4P29 A;  1KZP A;  3B95 A;  4N2Q A;  3ZYQ A;  5KJM A;  3UPV A;  4N3A A;  3S2A A;  4DX1 A;  2YIN A;  4OVU A;  3CHR A;  2J09 A;  3JQ0 A;  4GA0 A;  3QOU A;  3DXK G;  3NZU A;  4I17 A;  1OWL A;  2XEN A;  4HOS A;  3FFL A;  3PVL A;  1K1A A;  2GRM A;  3J5Q B;  4EZJ A;  4GZ3 A;  3HXE A;  4DX7 D;  2CFZ A;  5ENO D;  5ANR A;  5DBK A;  1MX2 A;  4B0Z A;  2XQ0 A;  4FC8 A;  1BI7 B;  3SFX A;  3FUL A;  1QNF A;  3B7U X;  3UIP C;  3PZ4 A;  2CHW A;  3GZ2 A;  2V4H C;  1WY6 A;  4L2L A;  4XX5 A;  3R7R A;  3ZXP A;  1QZ2 A;  3HIZ A;  3WG7 E;  2XEH A;  3ONK A;  4CGV A;  3PE3 A;  3CK9 A;  3UQ3 A;  3D3M A;  1PY1 A;  5ENQ D;  3Q5M A;  2X3M A;  4CCA A;  3Q73 A;  4PUC A;  3FUE A;  2OCC E;  1HS6 A;  3TG4 A;  4I9E A;  4LER A;  4CYM D;  2OEV A;  4CT4 A;  1BPO A;  2WM9 A;  2XS1 A;  4FJY A;  4ZFH A;  2GRN B;  3T9K A;  3B7S A;  4N3B A;  1EYH A;  4JEH A;  2WXK A;  3ABM E;  3PRE A;  3E34 A;  3MEK A;  4MS6 A;  4M7C A;  3DSX A;  5KJN A;  5AAR A;  3EHM A;  1UJJ A;  2XEE A;  2XPI A;  5HQ8 A;  5EIL A;  4A3T A;  2RFA A;  1D9S A;  3MGB A;  2WXH A;  3R9M A;  3DEP A;  2HR2 A;  3APC A;  4UQY A;  3CVV A;  2ETC A;  2XZT G;  3U9W A;  2J07 A;  3TXM A;  4A63 B;  3FY4 A;  3L16 A;  4UI9 J;  1HFA A;  3E33 A;  4KXK B;  4BSZ B;  4GU5 A;  4Q69 A;  4DLQ A;  2LXL A;  1MYO A;  5AIJ A;  3AG1 E;  1G3N B;  2FBN A;  2J9Q A;  2R02 A;  4R7L A;  2PQR A;  5B1A E;  3ENE A;  2GGF A;  3CK8 A;  2E2E A;  2XGM A;  1IHB A;  3ULQ A;  3S7B A;  2PM7 A;  4Q96 A;  2VGX B;  4GMR A;  2CFU A;  1HH8 A;  3HVE B;  1H6P A;  2EIJ E;  2CG2 A;  5ARF A;  2J08 A;  3FEY A;  3BUA A;  2QFC A;  4TXQ A;  3SZ7 A;  4RG9 A;  5G55 A;  4UQX A;  4AVX A;  3KEA A;  4EQF A;  5CBN A;  1TYQ G;  5JA4 D;  4FLB A;  2I1J A;  2FUL A;  2V0P A;  4JL0 A;  2OOE A;  5LOZ A;  4AP2 A;  3LY8 A;  2AVP A;  4JD2 G;  4U0S A;  5B1B E;  2CG3 A;  2XGO A;  3FTS A;  2LUH A;  3FTY A;  4KZC A;  3S7F A;  1H0A A;  1PC2 A;  2IOS A;  2R2L A;  4O6F A;  1YA0 A;  5FQ4 A;  1KZO A;  2DZN A;  2LAH A;  1TN7 A;  4ANX A;  3MKQ B;  1LTX A;  1Y6I A;  3MKR A;  3QAR A;  4QFV A;  3DSW A;  1NA3 A;  2P9K G;  3U64 A;  5A7D B;  5ENN A;  3CVY A;  3UT8 A;  3UT7 A;  4O1O A;  4XE0 A;  4CT0 A;  2V4L A;  4MBG A;  4QQI A;  4A1S A;  1TN6 A;  3C72 A;  3SNX A;  4CDR A;  3Q9U C;  3O4Z A;  3FUI A;  3E37 A;  3NOG D;  4D10 C;  5KJK A;  3KEZ A;  4A55 A;  3SY2 A;  1TNZ A;  5ARG A;  2VSO E;  4GMJ A;  3RRU A;  3CHM A;  1FCH A;  1IYG A;  3D9P A;  4EHM A;  4GZD A;  4F1P A; 
#chains in the Genus database with same CATH homology
 3EHQ A;  5CEC B;  5ENT D;  3UXG A;  1IXV A;  2HE0 A;  2QYJ A;  1YCS B;  3V30 A;  1WG0 A;  2F8Y A;  3HG0 D;  1QYM A;  5EID A;  3TWV A;  5AQB A;  2P2C P;  4DX5 D;  5AQA A;  2J8S D;  1OT8 A;  4DX1 A;  5KWD A;  3JXI A;  5AAR A;  2F8X K;  2RFM A;  3TWQ A;  2XEE A;  3NOC D;  1TR4 A;  1MX6 A;  5EIL A;  2JAB A;  5EIB E;  4HLL A;  4Z68 A;  2RFA A;  5FIN A;  4DX2 A;  1D9S A;  1N0R A;  5CED B;  5KBA A;  5AQ7 A;  2AJA A;  3JXJ A;  2DVW A;  2ETA A;  2B0O E;  2Y1L E;  3AJI A;  4YDW A;  3Q9N C;  3DEP A;  4JB8 P;  4HQD A;  3JUE A;  4HRL A;  3IXE A;  2XZD G;  3ZKJ A;  2XEN A;  2F37 A;  2DZN A;  3F6Q A;  5HKP A;  4HBD A;  4UUC A;  3V2O A;  2A5E A;  5ENS D;  5CER B;  3V31 A;  1YYH A;  4U8Y D;  1K1A A;  1K3Z D;  2ETC A;  2XZT G;  4O1P A;  4DRX E;  3J5Q B;  3TWS A;  3J5P A;  4U8V D;  2KXP C;  4LNU D;  3HRA A;  4A63 B;  4QFV A;  4HRM B;  5ENR D;  4DX7 D;  2PNN A;  4OAV B;  5ENO D;  5AN8 A;  4DX6 D;  2NYJ A;  2DWZ A;  2ZGG A;  5CBO A;  1DCQ A;  4BSZ B;  1MX2 A;  3SO8 A;  5HRY A;  4DUI A;  1BD8 A;  5D66 A;  1BI7 B;  1MYO A;  4G8K A;  1BU9 A;  2ETB A;  1WDY A;  1N0Q A;  5EYL A;  4TUM A;  4BES A;  3ZU7 B;  3UTM A;  1G3N B;  5AAO A;  3C5R A;  1K1B A;  3V79 K;  4O1O A;  5EN5 D;  5EYP F;  3TWX A;  1NFI E;  3EU9 A;  2V5Q C;  1IHB A;  5KNG A;  4BEP A;  5BXU A;  2V4H C;  4K5B A;  2MYO A;  4QQI A;  4HNA D;  2FO1 E;  4NIK A;  2QC9 A;  5FIO A;  4LG6 A;  3LJN A;  4HI9 A;  4U95 D;  4O60 A;  3ZUV B;  4F6R D;  4U96 D;  3Q9U C;  4CZ2 D;  5KNH D;  3V2X A;  4B93 B;  4OAU C;  1A5E A;  3EHR A;  3W9F A;  2L6B A;  4YDY A;  4GMR A;  4N5Q A;  2XEH A;  5ENP D;  2Y0B G;  2BKK B;  1DC2 A;  3AAA C;  3TWW A;  5HS0 A;  3NOG D;  3NBN B;  3ZNG A;  1BLX B;  2KBX A;  1S70 B;  2ZGD A;  5ENQ D;  4LSZ E;  1BI8 B;  3W9G A;  5BXO A;  1AP7 A;  4ATZ D;  4BER A;  5ITZ F;  3TWR A;  4RLY A;  1MX4 A;  2DZO A;  4K5A B;  3D9H A;  4C48 B;  4BET A;  4ZHB A;  1OY3 D;  4G8L A;  3TWT A;  4HI8 A;  3DEO A;  2VGE A;  4HRN A;  3UI2 A;  4J7W A;  5CEA A;  4GPM A;  4HB5 A;  3T9K A;  1SW6 A;  3KEA A;  1AWC B;  1SVX A;  1UOH A;  5JMN D;  5AQ9 A;  4CYM D;  3T8K A;  3TWU A;  5CBN A;  3B95 A;  1YMP A;  4J8Y A;  2BKG A;  1MJ0 A;  1N11 A;  4ZFH A;  3B7B A;  4K5C A;  4F1P A;  1IKN D;  5JA4 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...