5HS0A

Computationally designed cyclic tetramer ank1c4_7
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
160
structure length
160
Chain Sequence
b'MSEDGELLILAAELGIAEAVRMLIEQGADVNASDDDGRTPLHHAAENGHLAVVLLLLLKGADVNAKDSDGRTPLHHAAENGHKTVVLLLILMGADVNAKDSDGRTPLHHAAENGHKEVVKLLIRKGADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin domain protein ank1C4_7
publication title Computational design of self-assembling cyclic protein homo-oligomers.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 55
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5hs0A00
3V2XA 3IXEA 1NFIE 1K3ZD 3TWUA 4U95D 5FINA 4HNAD 1MX4A 4YDYA 4Z68A 2ETBA 5EYPF 4RLYA 3V2OA 5ENQD 4DRXE 4HRNA 4GMRA 4ZHBA 2A5EA 3SO8A 2HE0A 3J5QB 4DX7D 2ZGDA 2V4HC 4B93B 4K5AB 2ZGGA 5HS0A 4J8YA 4LG6A 3TWTA 1MX2A 5EYLA 2PNNA 4DX5D 3T9KA 1SW6A 5KWDA 2BKKB 3B7BA 5AAOA 2MYOA 2DVWA 4HRMB 5AQ9A 5ENTD 2L6BA 5FIOA 4ZFHA 4O1OA 5EIBE 2FO1E 1SVXA 5HKPA 5CECB 3KEAA 4G8LA 5D66A 1TR4A 1QYMA 5AARA 4HRLA 2KBXA 2NYJA 3B95A 3UI2A 4DX6D 3TWRA 4NIKA 4HQDA 2BKGA 3TWSA 4QQIA 1IKND 4G8KA 3V30A 1G3NB 3AJIA 3Q9NC 1BU9A 5CEAA 1BLXB 1WDYA 4U96D 4O1PA 4UUCA 5ENOD 1D9SA 1A5EA 2AJAA 1MX6A 1OY3D 1DCQA 2RFAA 2V5QC 4GPMA 3V31A 4CYMD 3W9GA 4F1PA 5BXOA 4C48B 3NOGD 3JXIA 1K1AA 2RFMA 3T8KA 5BXUA 5CERB 2F8YA 3AAAC 5KNHD 3DEPA 5HRYA 4HI8A 2QC9A 5CEDB 3TWVA 5AQ7A 1AP7A 4OAVB 1N11A 5ENSD 3J5PA 3DEOA 3ZNGA 2DZOA 5AN8A 3V79K 4LSZE 2Y0BG 3EU9A 1BI7B 2QYJA 3LJNA 4F6RD 2F37A 1WG0A 2XEEA 4QFVA 2ETAA 4J7WA 2VGEA 5AQAA 4BEPA 1IHBA 4BSZB 3EHRA 2ETCA 4U8VD 1MYOA 3EHQA 3W9FA 4O60A 5JA4D 5KBAA 2JABA 5JMND 4BERA 1AWCB 4DX2A 4DX1A 1DC2A 3JUEA 1YCSB 3Q9UC 4BETA 1N0RA 5ENRD 4K5BA 3NBNB 5EN5D 4JB8P 2B0OE 1N0QA 2XENA 4K5CA 5ITZF 2XEHA 2Y1LE 1MJ0A 5EIDA 3ZKJA 1BD8A 3NOCD 4A63B 2J8SD 3F6QA 4HLLA 1K1BA 5ENPD 4BESA 4HBDA 2XZDG 3ZUVB 2DZNA 5EILA 4N5QA 2XZTG 1YYHA 3ZU7B 3HG0D 4HB5A 4LNUD 4YDWA 4CZ2D 3UTMA 2P2CP 3TWWA 4HI9A 1YMPA 3HRAA 5CBOA 1IXVA 4DUIA 4U8YD 2DWZA 4TUMA 2KXPC 3TWQA 3UXGA 2F8XK 3TWXA 3C5RA 1UOHA 1BI8B 3JXJA 5KNGA 4OAUC 3D9HA 1OT8A 5CBNA 4ATZD 1S70B 5AQBA
chains in the Genus database with same CATH superfamily
3QWWA 4CDNA 4DRXE 5ENQD 5DBKA 2LAHA 2OCCE 4GTMA 2IF4A 3WXXA 3PREA 3D9NA 3CSTA 3MA5A 5FQ7A 3RRNB 4JZYA 4O1OA 3LKUA 3O48A 2FO1E 3PUKA 1S64A 3JUIA 3GZ1A 3PVLA 4NQ0A 3NOGD 4RSYA 2E2EA 3T8KA 5CMWA 2NSZA 5ANLA 4H7YA 3IHYA 4FP7A 2C2LA 4YDEA 4L7TA 3U64A 3EHQA 3FUKA 5EDSA 5JA4D 2V5FA 1TNOA 5JMND 1TEZA 4MBGA 3FWVA 3LVRE 3RU0A 1U3CA 3UX4A 5EN5D 3L16A 1QBQA 2VQ2A 2J8SD 4XKCA 4P29A 1UG3A 3FH5A 1N52A 1EDUA 4E85A 1H2VC 3V2XA 3FUJA 3ZHEA 2X6JA 5ENNA 2HYZA 4AJWA 2HO1A 5BW8C 5BUZA 4JA7A 3B13A 3QARA 4MKTA 4ABNA 3MJWA 5FIOA 2X6HA 4AY5A 4M7CA 1TNZA 1FVFA 2GRRB 4KYOB 1WDYA 4O1PA 3EUVA 1A5EA 4Q96A 4DK5A 2V5QC 4L2LA 1H19A 3PZ1A 3FEXA 4AY6A 3LY9A 4A1GA 2ZXWE 5BXUA 2IOSA 4GMJA 5HI7A 4L23A 3SZ7A 3FTVA 4DPRA 3AS8A 1H2UA 5J08A 3EU9A 3CEQA 4EECA 2F37A 5AQAA 3CVXA 5G05J 2JEKA 4O60A 3ULYA 2P9PG 1H0AA 2IY0C 3DSXA 4DX2A 1DC2A 3JUEA 1N4PA 4ILIA 4BT8A 1BD8A 2R2LA 1ZBPA 3B7RL 4N39A 3KSLA 3VLDA 3CK7A 4I1OB 1HXIA 4HBDA 2PM6A 3Q5MA 2YINA 4Y6CA 2VGYA 3FU3A 4LNUD 3UTMA 5KJMA 1TJCA 2DWZA 4GA0A 1UOHA 1BI8B 5D0QD 4A1SA 4ATZD 2J9QA 2GW1A 3GYZA 3ONLA 1NFIE 1NI1A 3TWUA 4U95D 4YDYA 3CIAA 2QYUA 4ANWA 4I6EA 4E6HA 4GMRA 4ME2A 1PAQA 4PDXA 4AVXA 2CHWA 4KMOA 1ELWA 2MYOA 4IRUA 2BTDA 5BPPA 3LY8A 1DVPA 3OXLA 1ELKA 5A6CA 2XPYA 2FEZA 5C2YA 3C72A 2VGXA 4GTSA 2BKGA 1O1TA 4B89A 4EBAG 3MV2B 4B94A 1OY3D 4KT6B 3PUJA 5C1DA 3JXIA 2OEVA 1QQEA 1SQMA 2WXHA 2GRNB 5M72A 5AQ7A 3IKOB 3AS4A 3DEOA 4GTPA 2I6HA 3UINC 3ZEFA 3FUFA 4J8DA 1X81A 2X6KA 4U0ZA 4J7WA 3FTWA 1TNYA 2XCBA 3W9FA 2ZISA 1Z5SC 2I2OA 3FHEA 3BG1B 4BTAA 3UM0A 4NACA 2LNIA 3S7BA 3PEVB 3LCAA 4I6GA 4U0UA 1FT1A 1X5BA 4K5BA 2X6FA 3PZ2A 3VTYA 2QY7A 1Q2ZA 3QWVA 2EIKE 5T3RA 3MV3B 4N5QA 2XZTG 3S2AA 3ZIMA 2VSNA 1YMPA 2EIJE 4FULA 3BUAA 5CCLA 2L6JA 4DI3A 3E32A 4RLYA 2CFUA 1K8KG 4N2QA 2VYIA 3T9KA 2WXLA 2HM8A 2XGMA 5EIBE 3ASFA 1UJJA 4FJYA 5HKPA 2NYJA 4XI0A 2NC9A 1E7UA 3LVQE 1JWFA 3W9GA 1OWOA 3HXFA 3ZVVA 1N95A 2WXOA 3IBEA 3UM1A 4N5CA 1LF8A 2KCLA 4G25A 1H6PA 4PS3A 1KT0A 2KM4A 5G04J 1IHBA 3UIPC 4AXHA 3UQ3A 4RG9A 1HE8A 5FT9A 3CV0A 3ESKA 2AVPA 1SA5A 1B89A 2DZNA 1ELRA 3HXBA 2P2CP 5AYWD 3TL5A 1ZU2A 3G2TA 3FTZA 4JA9A 1TN6A 4GTQA 3ASHA 2A5EA 2WXIA 2ZU6B 2GROB 3J5QB 3ULQA 2V4HC 4HOUA 4B93B 2ZGGA 2RG8A 2WQHA 1JUQA 2OVFA 3PH0C 2WMOA 2BKKB 2IEJA 4I9EA 1HZ4A 2DVWA 5D0OD 2WXGA 2BUGA 5EX0A 1TR4A 1Z3YA 3TWSA 4FHJA 4QQIA 5B1BE 1BLXB 2KCKA 2GGFA 2VTBA 1DCQA 3PE3A 2VSXE 5LP0A 5LCWC 4AV7A 2ONDA 2V8SE 4HI8A 2YHCA 3DSVA 2L9BA 2VJ8A 1GW6A 4LERA 4UWHA 4CGWA 4F6RD 3FU5A 3QDNA 4BWRA 4LCTA 3OXGA 1KZOA 3LJ3A 3FTXA 4GTTA 4K5CA 3UT4A 2XS8A 4X8QA 4B8CB 4DJAA 1E8ZA 4U63A 3SQVA 1TJFA 3Q49B 4LRZA 4ACKA 2YQ8A 2FULA 3ASDA 4F53A 2GRMA 4JXTA 2H6FA 1S70B 3IV0A 3SY2A 5AQBA 4O6FA 2LXLA 4ZHBA 4F1SA 4K5AB 2P9SG 4CT0A 4BX9A 4GYOA 1EPUA 4WWOA 3CVNA 4HOTA 2X3MA 3E34A 4HS2A 3HIZA 1LTXA 3CVVA 1S63A 3D9IA 2KBXA 5EKQD 3CVWA 2DCPA 3HVEB 3EJNA 4XKBA 4F1PA 3MKQB 1E7VA 3AG4E 2P9LG 3MGBA 5E75A 3HDXA 3JQ0A 2EINE 3J5PA 3KD7A 4KVOA 1MQSA 3V79K 4JW1A 4JEUA 3TXMA 4N3AA 1HG5A 4QFVA 3DSWA 4OVUA 3MEKA 4EZKA 4BY6A 2LSVA 4EBAA 3DSSA 2XPZA 4GZ6A 4Q69A 5FQ6A 3MKRA 5JHAA 3ZKJA 2NXPA 2PL2A 3R7QA 3T5XA 3FFLA 2PQNA 5B3SE 3AU4A 2XQ0A 3CHSA 3NQPA 5CBOA 3Q7FA 2DIWA 3TWXA 4XI9A 1UN9A 3DSUA 5G04C 4H7XA 4HNAD 2ETBA 3CGHA 1SZ9A 2HE0A 4XX5A 1FT2A 5AJDA 1OWNA 5EYLA 2IU1A 3JCKC 3S7JA 3ULEG 4EHMA 3ASNE 2CG3A 5CCMA 3JYSA 3SNXA 4UI9J 3WG7E 5JJTA 4L9PA 3B95A 2MRIA 4G8KA 4FADA 5CEAA 2UWJG 3CVPA 1UJKA 4C48B 3ZGQA 3E37A 2GRQB 4GB9A 4CGVA 1HF8A 2HR2A 2R17C 2QC9A 3LEWA 4HVBA 3TGOA 5H7PA 3APFA 3HHMA 3UIOC 4URKA 4TXQA 5AN8A 4ACLA 3ZYKA 2XEEA 4UI9K 2ETAA 2VGEA 4BEPA 1OXJA 1N4SA 3SHFA 2WM9A 5ENRD 2Y4UA 1N54A 2L0IA 1YA0A 2XHEA 1PY1A 2LXMA 4BTBA 5EILA 2C0LA 4HOQA 3HG0D 4CZ2D 3SI5A 4TUUA 3UXGA 3G2WA 3QOUA 4NURA 5G55A 2KZTB 3AS5A 3ISMC 3L08A 3RRMB 3URZA 4LEUA 4UQXA 3QC1A 3ZRHA 2ZGDA 3I5PA 3Q79A 2X38A 3UT7A 3UUXA 2PZIA 3QB2A 2IJGX 3ZN3A 5AIJA 3FULA 3CHOA 4Q94A 3L22A 5D66A 4I2WA 4HQDA 1IKND 3SGHA 2I1JA 4UUCA 3QKYA 4N3CA 5ENOD 3AG1E 2KATA 4GPMA 5BXOA 4CYMD 3P1UA 3VLFA 4WNGA 3VTXA 2J07A 1A17A 1V55E 3CHMA 5HRYA 2CHZA 5CEDB 4GYYA 3TWVA 3GZSA 4J8EA 3GW4A 3ZYMA 4B0ZA 5KJNA 2R05A 3LJNA 3Q75A 3OTNA 3EHMA 4GU5A 3HVEA 3UKRG 3FY4A 3MKQA 3DBSA 5LOZA 1TN8A 5T4YA 2DYRE 1TYQG 1NA0A 4B8AA 1P5QA 3PNTB 3CHPA 4HLLA 3ZU7B 2P9UG 1DNPA 1JPLA 3TWWA 2M63A 4UQYA 4FU3A 5KNGA 3D9HA 2WXQA 1N4RA 2XCCA 1OT8A 4GA2A 5G2NA 2I1KA 2XRZA 1K3ZD 3ML8A 1FCHA 5JJ6A 4BSXA 3Q15A 3ENEA 3SO8A 3PZDA 3NAWA 1KPSB 1MX2A 5FQ4A 3T5VA 3SD5A 2Y69E 3CLJA 3ABKE 5CECB 3KEAA 3PEUB 2X6IA 3TWRA 4OVVA 1G3NB 3FDHA 4EPZA 4U96D 3K9IA 5CMYA 1HG2A 2ILRA 4FLBA 4G23A 2WPVA 1WM5A 4WUYA 3ABLE 1IHGA 2V0PA 4OAVB 4EZLA 1EYHA 1HX8A 4FHKA 4EQFA 1JWGA 2ETCA 3FP3A 5JJ7A 2OEWA 4G11A 1IQUA 3L13A 4AIFA 3EIJA 4A3VA 4C0MA 5DIZA 2FO7A 4AM9A 2WXMA 1WY6A 4YVQC 2P58C 1OCRE 1U3DA 5CRUA 4JL0A 4APFA 3AG2E 4K0RA 5B1AE 3ZYQA 4OYSA 2C0MA 5BV0A 4DUIA 3L9TA 2F8XK 3KSQA 4KXKB 3FU0A 1V54E 3CVUA 4L2YA 5EYPF 4FLHA 2J09A 4YVOA 3U3WA 2CFZA 4GZCA 1HO8A 3UM3A 3LYAA 2PM7A 2IOLA 5FWQA 1QZ2A 1QYMA 4DX6D 5KBAA 2KZTA 5G05C 4CDRA 3MZLB 2AJAA 2WVIA 3KS2A 3ML9A 3FUIA 3E4BA 5LFAA 3R9AB 4GZDA 2EILE 5KNHD 4TRQA 3AU5A 5FZRA 2XGOA 3PE4A 5E76A 4IULA 4ILHB 4MRUA 1MYOA 1D8DA 2R5SA 2F0YA 3MX3A 2E0IA 3RO2A 1H6KA 5A7DB 3FUHA 1OCZE 3ZXSA 4WWNA 3NBNB 2EIME 1XNFA 3I4RB 2JLBA 2WB2A 4RVBA 2BEDA 3NOCD 1MZCA 4U0SA 3NZUA 2XZDG 4PH4B 4MS6A 3CKCA 4YDOA 3RK6A 2PQRA 3EIQC 4U07A 1Y6IA 3NZSA 2AW6A 4J0UA 1H2TC 5D2MC 2WQ7A 1KT1A 4J6IA 4AOFA 2FF4A 4D10C 4UWGA 3B7SA 2MOWA 2P9IG 4J8FA 4LG6A 3TWTA 4DX5D 3IHVA 5ENTD 3OAWA 1SVXA 1NL4A 3UI2A 3S7DA 3V30A 2B6CA 3D9JA 2J49A 1Z3XA 1OUVA 1N9AA 5EX3A 3CR3A 2KC7A 1HH8A 1NP7A 2OV8A 2F8YA 4XE0A 1JCSA 1PC2A 3ONKA 3BG0B 3ZPJA 2AWIA 3R7RA 2IO2C 3BQOA 3RKVA 4I6JA 1TNUA 1WG0A 2FBNA 4U8VD 3BU8A 3RSEG 4F7AA 3DPYA 1IQRA 2WXRA 2WXPA 3ASOE 1N0QA 2XEHA 2VSOE 4XEIG 2A4ZA 1D8EA 5FQ8A 3UM2A 4BESA 1S0PA 3HRAA 2AXZA 2YHEA 3CKBA 2LAIA 4JPSA 4PS8A 2P9KG 3D9LA 1OWPA 2AXVA 3ZFWA 1MX4A 3U4TA 4HRNA 3UT8A 4GZ3A 2IO3C 3NF1A 4WNFA 2J4BA 4J8SA 4XZ4A 4AP2A 3U9WA 3B7BA 5AAOA 3CVYA 5AQ9A 2R03A 3P2BA 4JHRA 1HFAA 3IEGA 4I9CA 3AJIA 3UKUG 1LD8A 1O1RA 5ANRA 3I4GA 4FJZA 3ZXPA 2EQXA 3RJVA 4L1BA 5FTPA 3CK8A 3CHQA 2GRLA 4APOA 4CCAA 4I1MA 5IY5E 1KZPA 3FUNA 4U7EB 2I9CA 3FEYA 2WXJA 2XRYA 4G2VA 4LNGA 2BF0X 2Y3AA 2UY1B 2Y0BG 1BI7B 3TAXA 1O5MA 3RRUA 2XPIA 3D9MA 3SBTB 2Q7FA 4GTOA 1DCEA 1FPPA 4TXPA 4HFGA 1HU3A 3Q4AB 1LD7A 1YCSB 2ZIRA 4UWFA 3EU5A 1N0RA 3OXFA 3FH8A 3FH7A 2XENA 4GZ5A 5FJYA 1Z6TA 2Y1LE 1MJ0A 3E30A 4PS7A 4KZ0A 2OOEA 1K1BA 5ENPD 3U66A 4XIFA 3ZUVB 2XEVA 4YDWA 1IXVA 4U8YD 5FZSA 3QNKA 3C5RA 3JXJA 1E90A 5KCMA 1NA3A 4RG6A 3HXCA 4I43A 2XGSA 4U8HA 3PZ3A 3X2QE 3QK0A 5HS0A 4FA6A 3O4ZA 3FUMA 3DXMG 4UQZA 3PS6A 3LY7A 5AARA 4HRLA 4G24A 3DXKG 5ARGA 2IONA 2RFAA 4GTVA 3V31A 4BX8A 1RZ4A 4CRWA 3HXEA 5FZQA 4DI4A 4HOSA 1AP7A 3UMVA 4GAAA 2L0TB 2QFCA 3C3OA 4TV3A 3ZNGA 1OWLA 2LSUA 2DYSE 4JEHA 2CHXA 4BSZB 4AEZC 3EHNA 1OWMA 3CHRA 3E33A 4JD2G 3D9PA 3PNLB 4BFRA 5ITZF 5LCWJ 3FUEA 4JHKA 3B7UX 5BV1A 2VTBB 1TNBA 3C3RA 3MYVA 3DPDA 4RQIA 3ZYLA 2IQCA 3G2VA 4N3BA 4HORA 5T8IA 3LPZA 3JQ1A 1U2VG 4KBQA 3TWQA 4OAUC 3DRAA 3I3NA 4C0EA 3BEEA 5A23A 3V2OA 2WQ6A 3HXDA 4IYPA 3RO3A 4DX7D 3MCXA 4ATGA 2J4DA 4KVMA 1SA4A 3QWPA 3T8MA 2A5UA 1AWCB 2WXKA 4NIKA 3CVLA 1BU9A 5KJKA 4G26A 1MX6A 4WAFA 3HYMB 3C98A 1RW2A 4WNEA 1K1AA 2RFMA 4CEMA 2DBAA 5JHBA 1IYGA 3ABME 5ENSD 4YNDA 3G2SA 2RD0A 1E96B 2RKKA 3RIBA 3FUDA 4IN3B 3SFZA 2R59A 5ARFA 2QYJA 3R9MA 3L54A 1JCRA 3EHRA 3SBSA 4G1TA 2JABA 1BPOA 1INZA 1O1SA 4GMLA 3Q9UC 3CK9A 4F3VA 4WWPA 4GTRA 3N71A 4LNBA 3QJZA 3F6QA 1E8XA 1YYHA 2UY1A 5CHEE 4HI9A 4UI9C 4JHJA 4U04A 1QNFA 4KZCA 1JCQA 4UWKA 3L17A 1NZNA 3IXEA 1MHQA 4Y6WA 5BNWA 3TG4A 3KEZA 1EF1C 2MHKA 2V4LA 4K03A 4HXIA 2PNNA 3PZ4A 3CQCB 5CRVA 2CG2A 4MLPA 3TXNA 3Q7AA 2AXUA 4ZFHA 1OCOE 3QAQA 4C9BB 4G8LA 3CQGB 4V3IA 2P9NG 3APDA 2J08A 1E8WA 3Q9NC 1WAO1 4I2ZA 4M3OA 1D9SA 5KJLA 3D3MA 4DLQA 4EZJA 1UW4B 3NB2A 3SFXA 4DLOA 3AAAC 2QZAA 1UN8A 1KLXA 4N2SA 1OCCE 3EDTB 3DWLG 4ILGA 1N11A 3D9OA 2WXNA 1N4QA 4ANUA 3PDNA 1HS6A 4LSZE 4W9RA 2H6IA 2Y4TA 4GPKA 3UPVA 4FC8A 5J90A 2WMNA 4HLEA 3ASGA 2H6GA 4BERA 2LUHA 4DX1A 2FI7A 3Q73A 3ZHEB 3VLEA 3TJPA 2OVBA 1ZB1A 4A63B 3DSTA 4GCOA 3PRZA 2GRPB 4HB5A 4NRHB 3ESLA 4BT9A 2IFUA 1SZAA 1Y8MA 4I17A 3L6AA 2WXFA 4ANXA 4PUCA 3TG5A 4A3TA 5AJLA 3FTUA 3SF4A 5FINA 4CT4A 4Z68A 3L82A 3G2UA 2YNQA 3SFYA 3CVQA 2H6HA 1FVHA 4J8YA 3ZW3A 1SW6A 4R7LA 5KWDA 4UWLA 3D9KA 3C3QA 4TXRA 4HRMB 2L6BA 3FTSA 3GZ2A 3B7TA 5AENA 3LDZA 1H6OA 1XGWA 2LO6A 1W3BA 3AG3E 2XS1A 4GYWA 3Q47B 1L5JA 3Q78A 5CERB 1N94A 2R02A 3DEPA 3FTYA 4GCNA 2DZOA 4WNDA 4CDMA 3KAEA 2KCVA 4LUNU 4ANVA 1E8YA 4JC8A 1TN7A 1VDYA 3APCA 4BETA 3FU6A 5BT1A 4JB8P 5LX8A 2B0OE 3RAUA 5EIDA 2VSYA 4JVSA 4GA1A 3CSFA 3LS8A 4I1AA 4TUMA 2KXPC 4A55A 5HQ8A 2VGXB 3LXUX 5CBNA 3S7FA
chains in the Genus database with same CATH topology
3V2XA 3IXEA 1NFIE 1K3ZD 3TWUA 4U95D 5FINA 4HNAD 1MX4A 4YDYA 4Z68A 2ETBA 5EYPF 4RLYA 3V2OA 5ENQD 4DRXE 4HRNA 4GMRA 4ZHBA 2A5EA 3SO8A 2HE0A 3J5QB 4DX7D 2ZGDA 2V4HC 4B93B 4K5AB 2ZGGA 5HS0A 4J8YA 4LG6A 3TWTA 1MX2A 5EYLA 2PNNA 4DX5D 3T9KA 1SW6A 5KWDA 2BKKB 3B7BA 5AAOA 2MYOA 2DVWA 4HRMB 5AQ9A 5ENTD 2L6BA 5FIOA 4ZFHA 4O1OA 5EIBE 2FO1E 1SVXA 5HKPA 5CECB 3KEAA 4G8LA 5D66A 1TR4A 1QYMA 5AARA 4HRLA 2KBXA 2NYJA 3B95A 3UI2A 4DX6D 3TWRA 4NIKA 4HQDA 2BKGA 3TWSA 4QQIA 1IKND 4G8KA 3V30A 1G3NB 3AJIA 3Q9NC 1BU9A 5CEAA 1BLXB 1WDYA 4U96D 4O1PA 4UUCA 5ENOD 1D9SA 1A5EA 2AJAA 1MX6A 1OY3D 1DCQA 2RFAA 2V5QC 4GPMA 3V31A 4CYMD 3W9GA 4F1PA 5BXOA 4C48B 3NOGD 3JXIA 1K1AA 2RFMA 3T8KA 5BXUA 5CERB 2F8YA 3AAAC 5KNHD 3DEPA 5HRYA 4HI8A 2QC9A 5CEDB 3TWVA 5AQ7A 1AP7A 4OAVB 1N11A 5ENSD 3J5PA 3DEOA 3ZNGA 2DZOA 5AN8A 3V79K 4LSZE 2Y0BG 3EU9A 1BI7B 2QYJA 3LJNA 4F6RD 2F37A 1WG0A 2XEEA 4QFVA 2ETAA 4J7WA 2VGEA 5AQAA 4BEPA 1IHBA 4BSZB 3EHRA 2ETCA 4U8VD 1MYOA 3EHQA 3W9FA 4O60A 5JA4D 5KBAA 2JABA 5JMND 4BERA 1AWCB 4DX2A 4DX1A 1DC2A 3JUEA 1YCSB 3Q9UC 4BETA 1N0RA 5ENRD 4K5BA 3NBNB 5EN5D 4JB8P 2B0OE 1N0QA 2XENA 4K5CA 5ITZF 2XEHA 2Y1LE 1MJ0A 5EIDA 3ZKJA 1BD8A 3NOCD 4A63B 2J8SD 3F6QA 4HLLA 1K1BA 5ENPD 4BESA 4HBDA 2XZDG 3ZUVB 2DZNA 5EILA 4N5QA 2XZTG 1YYHA 3ZU7B 3HG0D 4HB5A 4LNUD 4YDWA 4CZ2D 3UTMA 2P2CP 3TWWA 4HI9A 1YMPA 3HRAA 5CBOA 1IXVA 4DUIA 4U8YD 2DWZA 4TUMA 2KXPC 3TWQA 3UXGA 2F8XK 3TWXA 3C5RA 1UOHA 1BI8B 3JXJA 5KNGA 4OAUC 3D9HA 1OT8A 5CBNA 4ATZD 1S70B 5AQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2X A;  3IXE A;  1NFI E;  1K3Z D;  3TWU A;  4U95 D;  5FIN A;  4HNA D;  1MX4 A;  4YDY A;  4Z68 A;  2ETB A;  5EYP F;  4RLY A;  3V2O A;  5ENQ D;  4DRX E;  4HRN A;  4GMR A;  4ZHB A;  2A5E A;  3SO8 A;  2HE0 A;  3J5Q B;  4DX7 D;  2ZGD A;  2V4H C;  4B93 B;  4K5A B;  2ZGG A;  5HS0 A;  4J8Y A;  4LG6 A;  3TWT A;  1MX2 A;  5EYL A;  2PNN A;  4DX5 D;  3T9K A;  1SW6 A;  5KWD A;  2BKK B;  3B7B A;  5AAO A;  2MYO A;  2DVW A;  4HRM B;  5AQ9 A;  5ENT D;  2L6B A;  5FIO A;  4ZFH A;  4O1O A;  5EIB E;  2FO1 E;  1SVX A;  5HKP A;  5CEC B;  3KEA A;  4G8L A;  5D66 A;  1TR4 A;  1QYM A;  5AAR A;  4HRL A;  2KBX A;  2NYJ A;  3B95 A;  3UI2 A;  4DX6 D;  3TWR A;  4NIK A;  4HQD A;  2BKG A;  3TWS A;  4QQI A;  1IKN D;  4G8K A;  3V30 A;  1G3N B;  3AJI A;  3Q9N C;  1BU9 A;  5CEA A;  1BLX B;  1WDY A;  4U96 D;  4O1P A;  4UUC A;  5ENO D;  1D9S A;  1A5E A;  2AJA A;  1MX6 A;  1OY3 D;  1DCQ A;  2RFA A;  2V5Q C;  4GPM A;  3V31 A;  4CYM D;  3W9G A;  4F1P A;  5BXO A;  4C48 B;  3NOG D;  3JXI A;  1K1A A;  2RFM A;  3T8K A;  5BXU A;  5CER B;  2F8Y A;  3AAA C;  5KNH D;  3DEP A;  5HRY A;  4HI8 A;  2QC9 A;  5CED B;  3TWV A;  5AQ7 A;  1AP7 A;  4OAV B;  1N11 A;  5ENS D;  3J5P A;  3DEO A;  3ZNG A;  2DZO A;  5AN8 A;  3V79 K;  4LSZ E;  2Y0B G;  3EU9 A;  1BI7 B;  2QYJ A;  3LJN A;  4F6R D;  2F37 A;  1WG0 A;  2XEE A;  4QFV A;  2ETA A;  4J7W A;  2VGE A;  5AQA A;  4BEP A;  1IHB A;  4BSZ B;  3EHR A;  2ETC A;  4U8V D;  1MYO A;  3EHQ A;  3W9F A;  4O60 A;  5JA4 D;  5KBA A;  2JAB A;  5JMN D;  4BER A;  1AWC B;  4DX2 A;  4DX1 A;  1DC2 A;  3JUE A;  1YCS B;  3Q9U C;  4BET A;  1N0R A;  5ENR D;  4K5B A;  3NBN B;  5EN5 D;  4JB8 P;  2B0O E;  1N0Q A;  2XEN A;  4K5C A;  5ITZ F;  2XEH A;  2Y1L E;  1MJ0 A;  5EID A;  3ZKJ A;  1BD8 A;  3NOC D;  4A63 B;  2J8S D;  3F6Q A;  4HLL A;  1K1B A;  5ENP D;  4BES A;  4HBD A;  2XZD G;  3ZUV B;  2DZN A;  5EIL A;  4N5Q A;  2XZT G;  1YYH A;  3ZU7 B;  3HG0 D;  4HB5 A;  4LNU D;  4YDW A;  4CZ2 D;  3UTM A;  2P2C P;  3TWW A;  4HI9 A;  1YMP A;  3HRA A;  5CBO A;  1IXV A;  4DUI A;  4U8Y D;  2DWZ A;  4TUM A;  2KXP C;  3TWQ A;  3UXG A;  2F8X K;  3TWX A;  3C5R A;  1UOH A;  1BI8 B;  3JXJ A;  5KNG A;  4OAU C;  3D9H A;  1OT8 A;  5CBN A;  4ATZ D;  1S70 B;  5AQB A; 
#chains in the Genus database with same CATH topology
 3QWW A;  4CDN A;  4DRX E;  5ENQ D;  5DBK A;  2LAH A;  2OCC E;  4GTM A;  2IF4 A;  3WXX A;  3PRE A;  3D9N A;  3CST A;  3MA5 A;  5FQ7 A;  3RRN B;  4JZY A;  4O1O A;  3LKU A;  3O48 A;  2FO1 E;  3PUK A;  1S64 A;  3JUI A;  3GZ1 A;  3PVL A;  4NQ0 A;  3NOG D;  4RSY A;  2E2E A;  3T8K A;  5CMW A;  2NSZ A;  5ANL A;  4H7Y A;  3IHY A;  4FP7 A;  2C2L A;  4YDE A;  4L7T A;  3U64 A;  3EHQ A;  3FUK A;  5EDS A;  5JA4 D;  2V5F A;  1TNO A;  5JMN D;  1TEZ A;  4MBG A;  3FWV A;  3LVR E;  3RU0 A;  1U3C A;  3UX4 A;  5EN5 D;  3L16 A;  1QBQ A;  2VQ2 A;  2J8S D;  4XKC A;  4P29 A;  1UG3 A;  3FH5 A;  1N52 A;  1EDU A;  4E85 A;  1H2V C;  3V2X A;  3FUJ A;  3ZHE A;  2X6J A;  5ENN A;  2HYZ A;  4AJW A;  2HO1 A;  5BW8 C;  5BUZ A;  4JA7 A;  3B13 A;  3QAR A;  4MKT A;  4ABN A;  3MJW A;  5FIO A;  2X6H A;  4AY5 A;  4M7C A;  1TNZ A;  1FVF A;  2GRR B;  4KYO B;  1WDY A;  4O1P A;  3EUV A;  1A5E A;  4Q96 A;  4DK5 A;  2V5Q C;  4L2L A;  1H19 A;  3PZ1 A;  3FEX A;  4AY6 A;  3LY9 A;  4A1G A;  2ZXW E;  5BXU A;  2IOS A;  4GMJ A;  5HI7 A;  4L23 A;  3SZ7 A;  3FTV A;  4DPR A;  3AS8 A;  1H2U A;  5J08 A;  3EU9 A;  3CEQ A;  4EEC A;  2F37 A;  5AQA A;  3CVX A;  5G05 J;  2JEK A;  4O60 A;  3ULY A;  2P9P G;  1H0A A;  2IY0 C;  3DSX A;  4DX2 A;  1DC2 A;  3JUE A;  1N4P A;  4ILI A;  4BT8 A;  1BD8 A;  2R2L A;  1ZBP A;  3B7R L;  4N39 A;  3KSL A;  3VLD A;  3CK7 A;  4I1O B;  1HXI A;  4HBD A;  2PM6 A;  3Q5M A;  2YIN A;  4Y6C A;  2VGY A;  3FU3 A;  4LNU D;  3UTM A;  5KJM A;  1TJC A;  2DWZ A;  4GA0 A;  1UOH A;  1BI8 B;  5D0Q D;  4A1S A;  4ATZ D;  2J9Q A;  2GW1 A;  3GYZ A;  3ONL A;  1NFI E;  1NI1 A;  3TWU A;  4U95 D;  4YDY A;  3CIA A;  2QYU A;  4ANW A;  4I6E A;  4E6H A;  4GMR A;  4ME2 A;  1PAQ A;  4PDX A;  4AVX A;  2CHW A;  4KMO A;  1ELW A;  2MYO A;  4IRU A;  2BTD A;  5BPP A;  3LY8 A;  1DVP A;  3OXL A;  1ELK A;  5A6C A;  2XPY A;  2FEZ A;  5C2Y A;  3C72 A;  2VGX A;  4GTS A;  2BKG A;  1O1T A;  4B89 A;  4EBA G;  3MV2 B;  4B94 A;  1OY3 D;  4KT6 B;  3PUJ A;  5C1D A;  3JXI A;  2OEV A;  1QQE A;  1SQM A;  2WXH A;  2GRN B;  5M72 A;  5AQ7 A;  3IKO B;  3AS4 A;  3DEO A;  4GTP A;  2I6H A;  3UIN C;  3ZEF A;  3FUF A;  4J8D A;  1X81 A;  2X6K A;  4U0Z A;  4J7W A;  3FTW A;  1TNY A;  2XCB A;  3W9F A;  2ZIS A;  1Z5S C;  2I2O A;  3FHE A;  3BG1 B;  4BTA A;  3UM0 A;  4NAC A;  2LNI A;  3S7B A;  3PEV B;  3LCA A;  4I6G A;  4U0U A;  1FT1 A;  1X5B A;  4K5B A;  2X6F A;  3PZ2 A;  3VTY A;  2QY7 A;  1Q2Z A;  3QWV A;  2EIK E;  5T3R A;  3MV3 B;  4N5Q A;  2XZT G;  3S2A A;  3ZIM A;  2VSN A;  1YMP A;  2EIJ E;  4FUL A;  3BUA A;  5CCL A;  2L6J A;  4DI3 A;  3E32 A;  4RLY A;  2CFU A;  1K8K G;  4N2Q A;  2VYI A;  3T9K A;  2WXL A;  2HM8 A;  2XGM A;  5EIB E;  3ASF A;  1UJJ A;  4FJY A;  5HKP A;  2NYJ A;  4XI0 A;  2NC9 A;  1E7U A;  3LVQ E;  1JWF A;  3W9G A;  1OWO A;  3HXF A;  3ZVV A;  1N95 A;  2WXO A;  3IBE A;  3UM1 A;  4N5C A;  1LF8 A;  2KCL A;  4G25 A;  1H6P A;  4PS3 A;  1KT0 A;  2KM4 A;  5G04 J;  1IHB A;  3UIP C;  4AXH A;  3UQ3 A;  4RG9 A;  1HE8 A;  5FT9 A;  3CV0 A;  3ESK A;  2AVP A;  1SA5 A;  1B89 A;  2DZN A;  1ELR A;  3HXB A;  2P2C P;  5AYW D;  3TL5 A;  1ZU2 A;  3G2T A;  3FTZ A;  4JA9 A;  1TN6 A;  4GTQ A;  3ASH A;  2A5E A;  2WXI A;  2ZU6 B;  2GRO B;  3J5Q B;  3ULQ A;  2V4H C;  4HOU A;  4B93 B;  2ZGG A;  2RG8 A;  2WQH A;  1JUQ A;  2OVF A;  3PH0 C;  2WMO A;  2BKK B;  2IEJ A;  4I9E A;  1HZ4 A;  2DVW A;  5D0O D;  2WXG A;  2BUG A;  5EX0 A;  1TR4 A;  1Z3Y A;  3TWS A;  4FHJ A;  4QQI A;  5B1B E;  1BLX B;  2KCK A;  2GGF A;  2VTB A;  1DCQ A;  3PE3 A;  2VSX E;  5LP0 A;  5LCW C;  4AV7 A;  2OND A;  2V8S E;  4HI8 A;  2YHC A;  3DSV A;  2L9B A;  2VJ8 A;  1GW6 A;  4LER A;  4UWH A;  4CGW A;  4F6R D;  3FU5 A;  3QDN A;  4BWR A;  4LCT A;  3OXG A;  1KZO A;  3LJ3 A;  3FTX A;  4GTT A;  4K5C A;  3UT4 A;  2XS8 A;  4X8Q A;  4B8C B;  4DJA A;  1E8Z A;  4U63 A;  3SQV A;  1TJF A;  3Q49 B;  4LRZ A;  4ACK A;  2YQ8 A;  2FUL A;  3ASD A;  4F53 A;  2GRM A;  4JXT A;  2H6F A;  1S70 B;  3IV0 A;  3SY2 A;  5AQB A;  4O6F A;  2LXL A;  4ZHB A;  4F1S A;  4K5A B;  2P9S G;  4CT0 A;  4BX9 A;  4GYO A;  1EPU A;  4WWO A;  3CVN A;  4HOT A;  2X3M A;  3E34 A;  4HS2 A;  3HIZ A;  1LTX A;  3CVV A;  1S63 A;  3D9I A;  2KBX A;  5EKQ D;  3CVW A;  2DCP A;  3HVE B;  3EJN A;  4XKB A;  4F1P A;  3MKQ B;  1E7V A;  3AG4 E;  2P9L G;  3MGB A;  5E75 A;  3HDX A;  3JQ0 A;  2EIN E;  3J5P A;  3KD7 A;  4KVO A;  1MQS A;  3V79 K;  4JW1 A;  4JEU A;  3TXM A;  4N3A A;  1HG5 A;  4QFV A;  3DSW A;  4OVU A;  3MEK A;  4EZK A;  4BY6 A;  2LSV A;  4EBA A;  3DSS A;  2XPZ A;  4GZ6 A;  4Q69 A;  5FQ6 A;  3MKR A;  5JHA A;  3ZKJ A;  2NXP A;  2PL2 A;  3R7Q A;  3T5X A;  3FFL A;  2PQN A;  5B3S E;  3AU4 A;  2XQ0 A;  3CHS A;  3NQP A;  5CBO A;  3Q7F A;  2DIW A;  3TWX A;  4XI9 A;  1UN9 A;  3DSU A;  5G04 C;  4H7X A;  4HNA D;  2ETB A;  3CGH A;  1SZ9 A;  2HE0 A;  4XX5 A;  1FT2 A;  5AJD A;  1OWN A;  5EYL A;  2IU1 A;  3JCK C;  3S7J A;  3ULE G;  4EHM A;  3ASN E;  2CG3 A;  5CCM A;  3JYS A;  3SNX A;  4UI9 J;  3WG7 E;  5JJT A;  4L9P A;  3B95 A;  2MRI A;  4G8K A;  4FAD A;  5CEA A;  2UWJ G;  3CVP A;  1UJK A;  4C48 B;  3ZGQ A;  3E37 A;  2GRQ B;  4GB9 A;  4CGV A;  1HF8 A;  2HR2 A;  2R17 C;  2QC9 A;  3LEW A;  4HVB A;  3TGO A;  5H7P A;  3APF A;  3HHM A;  3UIO C;  4URK A;  4TXQ A;  5AN8 A;  4ACL A;  3ZYK A;  2XEE A;  4UI9 K;  2ETA A;  2VGE A;  4BEP A;  1OXJ A;  1N4S A;  3SHF A;  2WM9 A;  5ENR D;  2Y4U A;  1N54 A;  2L0I A;  1YA0 A;  2XHE A;  1PY1 A;  2LXM A;  4BTB A;  5EIL A;  2C0L A;  4HOQ A;  3HG0 D;  4CZ2 D;  3SI5 A;  4TUU A;  3UXG A;  3G2W A;  3QOU A;  4NUR A;  5G55 A;  2KZT B;  3AS5 A;  3ISM C;  3L08 A;  3RRM B;  3URZ A;  4LEU A;  4UQX A;  3QC1 A;  3ZRH A;  2ZGD A;  3I5P A;  3Q79 A;  2X38 A;  3UT7 A;  3UUX A;  2PZI A;  3QB2 A;  2IJG X;  3ZN3 A;  5AIJ A;  3FUL A;  3CHO A;  4Q94 A;  3L22 A;  5D66 A;  4I2W A;  4HQD A;  1IKN D;  3SGH A;  2I1J A;  4UUC A;  3QKY A;  4N3C A;  5ENO D;  3AG1 E;  2KAT A;  4GPM A;  5BXO A;  4CYM D;  3P1U A;  3VLF A;  4WNG A;  3VTX A;  2J07 A;  1A17 A;  1V55 E;  3CHM A;  5HRY A;  2CHZ A;  5CED B;  4GYY A;  3TWV A;  3GZS A;  4J8E A;  3GW4 A;  3ZYM A;  4B0Z A;  5KJN A;  2R05 A;  3LJN A;  3Q75 A;  3OTN A;  3EHM A;  4GU5 A;  3HVE A;  3UKR G;  3FY4 A;  3MKQ A;  3DBS A;  5LOZ A;  1TN8 A;  5T4Y A;  2DYR E;  1TYQ G;  1NA0 A;  4B8A A;  1P5Q A;  3PNT B;  3CHP A;  4HLL A;  3ZU7 B;  2P9U G;  1DNP A;  1JPL A;  3TWW A;  2M63 A;  4UQY A;  4FU3 A;  5KNG A;  3D9H A;  2WXQ A;  1N4R A;  2XCC A;  1OT8 A;  4GA2 A;  5G2N A;  2I1K A;  2XRZ A;  1K3Z D;  3ML8 A;  1FCH A;  5JJ6 A;  4BSX A;  3Q15 A;  3ENE A;  3SO8 A;  3PZD A;  3NAW A;  1KPS B;  1MX2 A;  5FQ4 A;  3T5V A;  3SD5 A;  2Y69 E;  3CLJ A;  3ABK E;  5CEC B;  3KEA A;  3PEU B;  2X6I A;  3TWR A;  4OVV A;  1G3N B;  3FDH A;  4EPZ A;  4U96 D;  3K9I A;  5CMY A;  1HG2 A;  2ILR A;  4FLB A;  4G23 A;  2WPV A;  1WM5 A;  4WUY A;  3ABL E;  1IHG A;  2V0P A;  4OAV B;  4EZL A;  1EYH A;  1HX8 A;  4FHK A;  4EQF A;  1JWG A;  2ETC A;  3FP3 A;  5JJ7 A;  2OEW A;  4G11 A;  1IQU A;  3L13 A;  4AIF A;  3EIJ A;  4A3V A;  4C0M A;  5DIZ A;  2FO7 A;  4AM9 A;  2WXM A;  1WY6 A;  4YVQ C;  2P58 C;  1OCR E;  1U3D A;  5CRU A;  4JL0 A;  4APF A;  3AG2 E;  4K0R A;  5B1A E;  3ZYQ A;  4OYS A;  2C0M A;  5BV0 A;  4DUI A;  3L9T A;  2F8X K;  3KSQ A;  4KXK B;  3FU0 A;  1V54 E;  3CVU A;  4L2Y A;  5EYP F;  4FLH A;  2J09 A;  4YVO A;  3U3W A;  2CFZ A;  4GZC A;  1HO8 A;  3UM3 A;  3LYA A;  2PM7 A;  2IOL A;  5FWQ A;  1QZ2 A;  1QYM A;  4DX6 D;  5KBA A;  2KZT A;  5G05 C;  4CDR A;  3MZL B;  2AJA A;  2WVI A;  3KS2 A;  3ML9 A;  3FUI A;  3E4B A;  5LFA A;  3R9A B;  4GZD A;  2EIL E;  5KNH D;  4TRQ A;  3AU5 A;  5FZR A;  2XGO A;  3PE4 A;  5E76 A;  4IUL A;  4ILH B;  4MRU A;  1MYO A;  1D8D A;  2R5S A;  2F0Y A;  3MX3 A;  2E0I A;  3RO2 A;  1H6K A;  5A7D B;  3FUH A;  1OCZ E;  3ZXS A;  4WWN A;  3NBN B;  2EIM E;  1XNF A;  3I4R B;  2JLB A;  2WB2 A;  4RVB A;  2BED A;  3NOC D;  1MZC A;  4U0S A;  3NZU A;  2XZD G;  4PH4 B;  4MS6 A;  3CKC A;  4YDO A;  3RK6 A;  2PQR A;  3EIQ C;  4U07 A;  1Y6I A;  3NZS A;  2AW6 A;  4J0U A;  1H2T C;  5D2M C;  2WQ7 A;  1KT1 A;  4J6I A;  4AOF A;  2FF4 A;  4D10 C;  4UWG A;  3B7S A;  2MOW A;  2P9I G;  4J8F A;  4LG6 A;  3TWT A;  4DX5 D;  3IHV A;  5ENT D;  3OAW A;  1SVX A;  1NL4 A;  3UI2 A;  3S7D A;  3V30 A;  2B6C A;  3D9J A;  2J49 A;  1Z3X A;  1OUV A;  1N9A A;  5EX3 A;  3CR3 A;  2KC7 A;  1HH8 A;  1NP7 A;  2OV8 A;  2F8Y A;  4XE0 A;  1JCS A;  1PC2 A;  3ONK A;  3BG0 B;  3ZPJ A;  2AWI A;  3R7R A;  2IO2 C;  3BQO A;  3RKV A;  4I6J A;  1TNU A;  1WG0 A;  2FBN A;  4U8V D;  3BU8 A;  3RSE G;  4F7A A;  3DPY A;  1IQR A;  2WXR A;  2WXP A;  3ASO E;  1N0Q A;  2XEH A;  2VSO E;  4XEI G;  2A4Z A;  1D8E A;  5FQ8 A;  3UM2 A;  4BES A;  1S0P A;  3HRA A;  2AXZ A;  2YHE A;  3CKB A;  2LAI A;  4JPS A;  4PS8 A;  2P9K G;  3D9L A;  1OWP A;  2AXV A;  3ZFW A;  1MX4 A;  3U4T A;  4HRN A;  3UT8 A;  4GZ3 A;  2IO3 C;  3NF1 A;  4WNF A;  2J4B A;  4J8S A;  4XZ4 A;  4AP2 A;  3U9W A;  3B7B A;  5AAO A;  3CVY A;  5AQ9 A;  2R03 A;  3P2B A;  4JHR A;  1HFA A;  3IEG A;  4I9C A;  3AJI A;  3UKU G;  1LD8 A;  1O1R A;  5ANR A;  3I4G A;  4FJZ A;  3ZXP A;  2EQX A;  3RJV A;  4L1B A;  5FTP A;  3CK8 A;  3CHQ A;  2GRL A;  4APO A;  4CCA A;  4I1M A;  5IY5 E;  1KZP A;  3FUN A;  4U7E B;  2I9C A;  3FEY A;  2WXJ A;  2XRY A;  4G2V A;  4LNG A;  2BF0 X;  2Y3A A;  2UY1 B;  2Y0B G;  1BI7 B;  3TAX A;  1O5M A;  3RRU A;  2XPI A;  3D9M A;  3SBT B;  2Q7F A;  4GTO A;  1DCE A;  1FPP A;  4TXP A;  4HFG A;  1HU3 A;  3Q4A B;  1LD7 A;  1YCS B;  2ZIR A;  4UWF A;  3EU5 A;  1N0R A;  3OXF A;  3FH8 A;  3FH7 A;  2XEN A;  4GZ5 A;  5FJY A;  1Z6T A;  2Y1L E;  1MJ0 A;  3E30 A;  4PS7 A;  4KZ0 A;  2OOE A;  1K1B A;  5ENP D;  3U66 A;  4XIF A;  3ZUV B;  2XEV A;  4YDW A;  1IXV A;  4U8Y D;  5FZS A;  3QNK A;  3C5R A;  3JXJ A;  1E90 A;  5KCM A;  1NA3 A;  4RG6 A;  3HXC A;  4I43 A;  2XGS A;  4U8H A;  3PZ3 A;  3X2Q E;  3QK0 A;  5HS0 A;  4FA6 A;  3O4Z A;  3FUM A;  3DXM G;  4UQZ A;  3PS6 A;  3LY7 A;  5AAR A;  4HRL A;  4G24 A;  3DXK G;  5ARG A;  2ION A;  2RFA A;  4GTV A;  3V31 A;  4BX8 A;  1RZ4 A;  4CRW A;  3HXE A;  5FZQ A;  4DI4 A;  4HOS A;  1AP7 A;  3UMV A;  4GAA A;  2L0T B;  2QFC A;  3C3O A;  4TV3 A;  3ZNG A;  1OWL A;  2LSU A;  2DYS E;  4JEH A;  2CHX A;  4BSZ B;  4AEZ C;  3EHN A;  1OWM A;  3CHR A;  3E33 A;  4JD2 G;  3D9P A;  3PNL B;  4BFR A;  5ITZ F;  5LCW J;  3FUE A;  4JHK A;  3B7U X;  5BV1 A;  2VTB B;  1TNB A;  3C3R A;  3MYV A;  3DPD A;  4RQI A;  3ZYL A;  2IQC A;  3G2V A;  4N3B A;  4HOR A;  5T8I A;  3LPZ A;  3JQ1 A;  1U2V G;  4KBQ A;  3TWQ A;  4OAU C;  3DRA A;  3I3N A;  4C0E A;  3BEE A;  5A23 A;  3V2O A;  2WQ6 A;  3HXD A;  4IYP A;  3RO3 A;  4DX7 D;  3MCX A;  4ATG A;  2J4D A;  4KVM A;  1SA4 A;  3QWP A;  3T8M A;  2A5U A;  1AWC B;  2WXK A;  4NIK A;  3CVL A;  1BU9 A;  5KJK A;  4G26 A;  1MX6 A;  4WAF A;  3HYM B;  3C98 A;  1RW2 A;  4WNE A;  1K1A A;  2RFM A;  4CEM A;  2DBA A;  5JHB A;  1IYG A;  3ABM E;  5ENS D;  4YND A;  3G2S A;  2RD0 A;  1E96 B;  2RKK A;  3RIB A;  3FUD A;  4IN3 B;  3SFZ A;  2R59 A;  5ARF A;  2QYJ A;  3R9M A;  3L54 A;  1JCR A;  3EHR A;  3SBS A;  4G1T A;  2JAB A;  1BPO A;  1INZ A;  1O1S A;  4GML A;  3Q9U C;  3CK9 A;  4F3V A;  4WWP A;  4GTR A;  3N71 A;  4LNB A;  3QJZ A;  3F6Q A;  1E8X A;  1YYH A;  2UY1 A;  5CHE E;  4HI9 A;  4UI9 C;  4JHJ A;  4U04 A;  1QNF A;  4KZC A;  1JCQ A;  4UWK A;  3L17 A;  1NZN A;  3IXE A;  1MHQ A;  4Y6W A;  5BNW A;  3TG4 A;  3KEZ A;  1EF1 C;  2MHK A;  2V4L A;  4K03 A;  4HXI A;  2PNN A;  3PZ4 A;  3CQC B;  5CRV A;  2CG2 A;  4MLP A;  3TXN A;  3Q7A A;  2AXU A;  4ZFH A;  1OCO E;  3QAQ A;  4C9B B;  4G8L A;  3CQG B;  4V3I A;  2P9N G;  3APD A;  2J08 A;  1E8W A;  3Q9N C;  1WAO 1;  4I2Z A;  4M3O A;  1D9S A;  5KJL A;  3D3M A;  4DLQ A;  4EZJ A;  1UW4 B;  3NB2 A;  3SFX A;  4DLO A;  3AAA C;  2QZA A;  1UN8 A;  1KLX A;  4N2S A;  1OCC E;  3EDT B;  3DWL G;  4ILG A;  1N11 A;  3D9O A;  2WXN A;  1N4Q A;  4ANU A;  3PDN A;  1HS6 A;  4LSZ E;  4W9R A;  2H6I A;  2Y4T A;  4GPK A;  3UPV A;  4FC8 A;  5J90 A;  2WMN A;  4HLE A;  3ASG A;  2H6G A;  4BER A;  2LUH A;  4DX1 A;  2FI7 A;  3Q73 A;  3ZHE B;  3VLE A;  3TJP A;  2OVB A;  1ZB1 A;  4A63 B;  3DST A;  4GCO A;  3PRZ A;  2GRP B;  4HB5 A;  4NRH B;  3ESL A;  4BT9 A;  2IFU A;  1SZA A;  1Y8M A;  4I17 A;  3L6A A;  2WXF A;  4ANX A;  4PUC A;  3TG5 A;  4A3T A;  5AJL A;  3FTU A;  3SF4 A;  5FIN A;  4CT4 A;  4Z68 A;  3L82 A;  3G2U A;  2YNQ A;  3SFY A;  3CVQ A;  2H6H A;  1FVH A;  4J8Y A;  3ZW3 A;  1SW6 A;  4R7L A;  5KWD A;  4UWL A;  3D9K A;  3C3Q A;  4TXR A;  4HRM B;  2L6B A;  3FTS A;  3GZ2 A;  3B7T A;  5AEN A;  3LDZ A;  1H6O A;  1XGW A;  2LO6 A;  1W3B A;  3AG3 E;  2XS1 A;  4GYW A;  3Q47 B;  1L5J A;  3Q78 A;  5CER B;  1N94 A;  2R02 A;  3DEP A;  3FTY A;  4GCN A;  2DZO A;  4WND A;  4CDM A;  3KAE A;  2KCV A;  4LUN U;  4ANV A;  1E8Y A;  4JC8 A;  1TN7 A;  1VDY A;  3APC A;  4BET A;  3FU6 A;  5BT1 A;  4JB8 P;  5LX8 A;  2B0O E;  3RAU A;  5EID A;  2VSY A;  4JVS A;  4GA1 A;  3CSF A;  3LS8 A;  4I1A A;  4TUM A;  2KXP C;  4A55 A;  5HQ8 A;  2VGX B;  3LXU X;  5CBN A;  3S7F A; 
#chains in the Genus database with same CATH homology
 3V2X A;  3IXE A;  1NFI E;  1K3Z D;  3TWU A;  4U95 D;  5FIN A;  4HNA D;  1MX4 A;  4YDY A;  4Z68 A;  2ETB A;  5EYP F;  4RLY A;  3V2O A;  5ENQ D;  4DRX E;  4HRN A;  4GMR A;  4ZHB A;  2A5E A;  3SO8 A;  2HE0 A;  3J5Q B;  4DX7 D;  2ZGD A;  2V4H C;  4B93 B;  4K5A B;  2ZGG A;  5HS0 A;  4J8Y A;  4LG6 A;  3TWT A;  1MX2 A;  5EYL A;  2PNN A;  4DX5 D;  3T9K A;  1SW6 A;  5KWD A;  2BKK B;  3B7B A;  5AAO A;  2MYO A;  2DVW A;  4HRM B;  5AQ9 A;  5ENT D;  2L6B A;  5FIO A;  4ZFH A;  4O1O A;  5EIB E;  2FO1 E;  1SVX A;  5HKP A;  5CEC B;  3KEA A;  4G8L A;  5D66 A;  1TR4 A;  1QYM A;  5AAR A;  4HRL A;  2KBX A;  2NYJ A;  3B95 A;  3UI2 A;  4DX6 D;  3TWR A;  4NIK A;  4HQD A;  2BKG A;  3TWS A;  4QQI A;  1IKN D;  4G8K A;  3V30 A;  1G3N B;  3AJI A;  3Q9N C;  1BU9 A;  5CEA A;  1BLX B;  1WDY A;  4U96 D;  4O1P A;  4UUC A;  5ENO D;  1D9S A;  1A5E A;  2AJA A;  1MX6 A;  1OY3 D;  1DCQ A;  2RFA A;  2V5Q C;  4GPM A;  3V31 A;  4CYM D;  3W9G A;  4F1P A;  5BXO A;  4C48 B;  3NOG D;  3JXI A;  1K1A A;  2RFM A;  3T8K A;  5BXU A;  5CER B;  2F8Y A;  3AAA C;  5KNH D;  3DEP A;  5HRY A;  4HI8 A;  2QC9 A;  5CED B;  3TWV A;  5AQ7 A;  1AP7 A;  4OAV B;  1N11 A;  5ENS D;  3J5P A;  3DEO A;  3ZNG A;  2DZO A;  5AN8 A;  3V79 K;  4LSZ E;  2Y0B G;  3EU9 A;  1BI7 B;  2QYJ A;  3LJN A;  4F6R D;  2F37 A;  1WG0 A;  2XEE A;  4QFV A;  2ETA A;  4J7W A;  2VGE A;  5AQA A;  4BEP A;  1IHB A;  4BSZ B;  3EHR A;  2ETC A;  4U8V D;  1MYO A;  3EHQ A;  3W9F A;  4O60 A;  5JA4 D;  5KBA A;  2JAB A;  5JMN D;  4BER A;  1AWC B;  4DX2 A;  4DX1 A;  1DC2 A;  3JUE A;  1YCS B;  3Q9U C;  4BET A;  1N0R A;  5ENR D;  4K5B A;  3NBN B;  5EN5 D;  4JB8 P;  2B0O E;  1N0Q A;  2XEN A;  4K5C A;  5ITZ F;  2XEH A;  2Y1L E;  1MJ0 A;  5EID A;  3ZKJ A;  1BD8 A;  3NOC D;  4A63 B;  2J8S D;  3F6Q A;  4HLL A;  1K1B A;  5ENP D;  4BES A;  4HBD A;  2XZD G;  3ZUV B;  2DZN A;  5EIL A;  4N5Q A;  2XZT G;  1YYH A;  3ZU7 B;  3HG0 D;  4HB5 A;  4LNU D;  4YDW A;  4CZ2 D;  3UTM A;  2P2C P;  3TWW A;  4HI9 A;  1YMP A;  3HRA A;  5CBO A;  1IXV A;  4DUI A;  4U8Y D;  2DWZ A;  4TUM A;  2KXP C;  3TWQ A;  3UXG A;  2F8X K;  3TWX A;  3C5R A;  1UOH A;  1BI8 B;  3JXJ A;  5KNG A;  4OAU C;  3D9H A;  1OT8 A;  5CBN A;  4ATZ D;  1S70 B;  5AQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...