5HS0A

Computationally designed cyclic tetramer ank1c4_7
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
160
structure length
160
Chain Sequence
MSEDGELLILAAELGIAEAVRMLIEQGADVNASDDDGRTPLHHAAENGHLAVVLLLLLKGADVNAKDSDGRTPLHHAAENGHKTVVLLLILMGADVNAKDSDGRTPLHHAAENGHKEVVKLLIRKGADVNTSDSDGRTPLDLAREHGNEEVVKLLEKQLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Ankyrin domain protein ank1C4_7
publication title Computational design of self-assembling cyclic protein homo-oligomers.
pubmed doi rcsb
source organism Synthetic construct
total genus 55
structure length 160
sequence length 160
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5hs0A00
2DZOA 2DVWA 2XENA 2A5EA 1K1AA 5CEAA 1MX2A 4U8VD 4C48B 2PNNA 1BU9A 5AN8A 4O1PA 3HRAA 1MX6A 4LNUD 2ETAA 5HS0A 1G3NB 2FO1E 2KBXA 5EIBE 4HNAD 3C5RA 3ZNGA 4BERA 5AQ9A 4HRMB 4ATZD 3Q9NC 4G8KA 3ZUVB 4UUCA 4DX2A 1UOHA 1OY3D 3TWWA 3TWQA 3UI2A 5AQ7A 3LJNA 3EU9A 2ETCA 4DX1A 4HI9A 2XEHA 3KEAA 1IXVA 2F8YA 4RLYA 5CBOA 3B7BA 4QFVA 1TR4A 1DC2A 2L6BA 3V2OA 5CBNA 1OT8A 1YCSB 2J8SD 3F6QA 4G8LA 5ENRD 5EYLA 4K5CA 2DWZA 3DEPA 2XZDG 3AAAC 4JB8P 3SO8A 5EN5D 1AWCB 2F37A 5ENSD 5JMND 4GPMA 5EYPF 4NIKA 4Z68A 1DCQA 2F8XK 1K1BA 2QYJA 5CEDB 2ETBA 5ENOD 1YYHA 1BLXB 1A5EA 3Q9UC 2NYJA 1MYOA 5AQAA 5ENQD 1NFIE 1WG0A 1BD8A 4F1PA 4QQIA 4O1OA 3IXEA 5KBAA 4U95D 4J7WA 2VGEA 2Y0BG 2Y1LE 4J8YA 2RFAA 1D9SA 4B93B 3D9HA 2XEEA 2P2CP 3UTMA 3V79K 2B0OE 2ZGDA 3UXGA 3J5QB 2DZNA 4F6RD 1IKND 5ENPD 2V5QC 4TUMA 2MYOA 3TWTA 4HB5A 4LSZE 2BKGA 4DUIA 4OAUC 4ZFHA 3JXJA 4HRNA 3EHQA 4ZHBA 4OAVB 5FIOA 1AP7A 1MJ0A 5BXUA 2KXPC 1BI8B 3JXIA 5ENTD 4BETA 1S70B 3ZU7B 3W9FA 4GMRA 4N5QA 1SVXA 4CYMD 5D66A 3TWXA 1MX4A 4K5BA 4BESA 1N11A 5AQBA 2JABA 5KNGA 5FINA 5EIDA 4DX6D 3EHRA 4YDYA 1WDYA 5EILA 5CERB 5KNHD 3TWUA 2AJAA 3V30A 2BKKB 5HRYA 4HQDA 4HBDA 4HRLA 3TWSA 4LG6A 3ZKJA 4U8YD 3V2XA 3T9KA 1N0RA 3HG0D 2QC9A 2XZTG 5HKPA 4U96D 5JA4D 4BEPA 3NOCD 2RFMA 3W9GA 4HI8A 2HE0A 1IHBA 4DX7D 4HLLA 3AJIA 3T8KA 1QYMA 2ZGGA 3TWVA 3V31A 4O60A 3NOGD 3NBNB 3JUEA 3J5PA 5BXOA 2V4HC 5ITZF 4YDWA 1BI7B 5CECB 1K3ZD 5KWDA 1N0QA 4DX5D 4CZ2D 3B95A 4DRXE 3TWRA 5AARA 5AAOA 1YMPA 3DEOA 4K5AB 1SW6A 4A63B 4BSZB
chains in the Genus database with same CATH superfamily
1HS6A 1GW6A 3O4ZA 4APFA 5AENA 1INZA 3FUKA 4GAAA 4IRUA 1WAO1 3ZUVB 3FULA 1H6PA 1TJFA 1V55E 3NAWA 4EQFA 4WNGA 2ONDA 3D9MA 1E90A 4RLYA 1DC2A 2J8SD 2J49A 4UWKA 4K5CA 3FUNA 1KPSB 2XZDG 5ENSD 3JQ1A 1DCEA 1N4PA 4XEIG 1YYHA 2X6JA 5AJDA 3ML8A 3CVWA 1TEZA 4U95D 4WNDA 3CR3A 3UQ3A 3VTXA 1QNFA 4TUMA 2VGXA 4GZ3A 3FEXA 4ZFHA 2P9UG 3LVRE 4WUYA 1S70B 3MX3A 4N5QA 4CYMD 3TWXA 4DI4A 3ABKE 3BUAA 4UWLA 3Q7AA 5A23A 1H6OA 3ASGA 4U96D 3HYMB 2GROB 4YDWA 4ACKA 2XPYA 4BSZB 4KMOA 4B8CB 2XENA 4U0SA 2PNNA 2IJGX 2XQ0A 1E8ZA 2KBXA 4GZ5A 3L54A 4HNAD 4U63A 3Q79A 4G24A 4ATZD 3PNTB 4KVOA 2WXGA 2ETCA 3CV0A 3L08A 3TAXA 2L0IA 4JZYA 4Q94A 2WQ7A 3LJ3A 3L22A 1YCSB 3U9WA 1UW4B 1N4RA 3AAAC 1AWCB 3E33A 3Q78A 5T4YA 3HXEA 2I1JA 5J08A 1JWFA 3IXEA 5KBAA 1HX8A 1XNFA 4J7WA 4GCNA 4HXIA 2LSUA 2B0OE 4F6RD 3S7FA 3TWTA 3HVEB 4RVBA 1AP7A 1OCZE 5BXUA 5BV0A 1HZ4A 2WQHA 4UWHA 3ENEA 4L9PA 5FWQA 2E2EA 4CDRA 1ZU2A 3C98A 3UKUG 3T8MA 3CVPA 3D9OA 3R9MA 3IV0A 4GZCA 4ANXA 5E76A 4C0EA 3CQCB 2A5UA 4O60A 2J9QA 4DLOA 5C1DA 1WM5A 1D8DA 4O1PA 4YVQC 5HQ8A 1SA5A 4LRZA 3APDA 4KBQA 4KZCA 1LTXA 4MBGA 2R02A 4QFVA 4M7CA 3CKCA 1OWOA 4L1BA 4ACLA 4JB8P 2GRLA 5AIJA 3OXFA 1A5EA 5AQAA 4J8DA 1KZOA 3SI5A 3SFXA 3CVYA 3BU8A 2VQ2A 2XEEA 5CRUA 3V79K 2H6FA 3X2QE 5CCMA 4FA6A 4E6HA 5H7PA 2PQRA 2J4DA 2WPVA 4WNFA 4WWNA 2AWIA 5AQBA 2XCCA 5BT1A 5BUZA 2QZAA 4HBDA 4I6JA 4U8YD 2R59A 2WMOA 3QB2A 4JHKA 4ILHB 4DX7D 5BW8C 2P9NG 3SHFA 3SNXA 3L13A 4J0UA 3D3MA 4GZ6A 2IQCA 1MX2A 2P9LG 5AN8A 2BEDA 5KCMA 3HDXA 4DX2A 5FQ4A 1SQMA 5FQ8A 5FT9A 2F8YA 2GGFA 3SZ7A 2VGXB 3Q49B 2IOSA 2HR2A 4JXTA 2PL2A 3U3WA 1ELKA 5EKQD 2WB2A 4IN3B 3VLFA 2XS1A 1E8YA 5EDSA 2KCVA 3RO3A 4B8AA 4JC8A 4HVBA 3QWPA 2UWJG 2KXPC 3DSSA 4U0ZA 4XI0A 3E32A 4BESA 2PQNA 3JUIA 5KNHD 3LVQE 3ZKJA 3CSFA 3ZYLA 4DJAA 5HKPA 2R17C 4BX8A 4AJWA 4GA0A 4FLBA 3FUMA 3T8KA 1OXJA 3DSWA 3KS2A 3L6AA 3QARA 4DX5D 2AXZA 3B7UX 1K1AA 3FFLA 3MKRA 5EIBE 4JVSA 1E7UA 4U07A 4UI9C 3FEYA 3SBSA 2X6KA 4D10C 2AXVA 3SFZA 1TJCA 3AG2E 3LXUX 2BTDA 5CRVA 2EIKE 4LNGA 3FTXA 5EN5D 2F37A 4B94A 5BV1A 2H6HA 3JQ0A 1S0PA 1BD8A 3CHMA 4HOSA 3LDZA 3ZXSA 4B93B 3EUVA 2DYSE 4Y6CA 3B7RL 2V5FA 3RKVA 5A7DB 2FO7A 3ZW3A 3PZ4A 1EF1C 1NA3A 2CHXA 3FTUA 3ESLA 3EJNA 3HXBA 4N3AA 3MV3B 2VSXE 3FUDA 3D9KA 5FINA 3DWLG 3TWUA 3ZRHA 2P58C 4F3VA 3ZVVA 1PC2A 3PUJA 3UMVA 3E34A 2ZGGA 3JUEA 3PDNA 3ASFA 5CECB 2XRZA 3FU5A 4CZ2D 4JD2G 3GZ1A 3URZA 4UWGA 5AARA 1SA4A 3JCKC 4H7YA 2OVBA 4RQIA 4BWRA 3D9LA 2ETAA 3PZ2A 4BY6A 3ZNGA 4AY5A 3SBTB 3ZHEA 1TNOA 4YDOA 4MKTA 2J08A 4V3IA 2VSNA 5G2NA 2L6BA 2ILRA 3DPDA 2OEWA 3G2WA 3DEPA 4BFRA 2FF4A 4C0MA 1OWMA 4R7LA 1TYQG 4GA2A 4WNEA 5B1AE 4G26A 3E37A 4N3CA 3CVVA 3DPYA 3FU6A 1H2UA 2Y0BG 2YNQA 4U0UA 2WMNA 3FUEA 3I5PA 4I2WA 1IKND 5ENPD 4TXPA 2MYOA 4TUUA 3RRNB 4Y6WA 4EBAA 2GRMA 2HYZA 3ONLA 5ENTD 3W9FA 3NQPA 5D66A 3ZYKA 1ELRA 4K5BA 3VTYA 3QDNA 5KNGA 2AW6A 3ZYQA 2WXRA 3GZ2A 2YHEA 4HQDA 5ENNA 5E75A 2AXUA 4URKA 4NQ0A 5CCLA 3EU5A 2AVPA 2KM4A 3TWVA 3V31A 3ESKA 3NBNB 1E96B 3DSXA 2VGYA 3PREA 4BTAA 3DEOA 1WY6A 3AS4A 3BG0B 3CVXA 5BPPA 3NZSA 1TNZA 2FBNA 1IYGA 2OOEA 3L9TA 4GYYA 2V0PA 3FTVA 2WXIA 1TNYA 3EU9A 4HI9A 3HXDA 3MKQA 2DYRE 4G8LA 1O1RA 3CLJA 3AG3E 2MHKA 3EIQC 4KXKB 2F8XK 2ETBA 5ENOD 1QBQA 2XCBA 1OCRE 4UI9J 2DIWA 1JWGA 1N94A 2WQ6A 4XKCA 4N2SA 2GRRB 4A55A 1HFAA 2XPZA 4DUIA 3FTZA 4XI9A 2VTBA 4OAVB 3ML9A 1N9AA 2XRYA 3FH7A 3AS8A 3PH0C 2BF0X 3S7BA 2LXMA 4A3VA 2EIJE 4IULA 4GPKA 3WG7E 4XIFA 4DX6D 5DBKA 4AY6A 2H6IA 4HOUA 3FDHA 3GZSA 2QC9A 5JA4D 3P1UA 1O1TA 3FWVA 3NOCD 3TG4A 2F0YA 1JCQA 1IHBA 1N0QA 5AJLA 2XGOA 1YMPA 4I2ZA 4XKBA 5LCWC 3PZ3A 5CEAA 4C48B 5EX0A 1BU9A 1L5JA 4B89A 2OEVA 2JLBA 3L16A 1Y6IA 4UUCA 1OCCE 3CHSA 2HM8A 3CKBA 4FJZA 3ZFWA 1FVFA 5CBNA 3ZXPA 4DPRA 2R05A 3LYAA 1FT2A 4G11A 5EYPF 1JCRA 2J09A 1UN8A 4I9EA 3Q9UC 3ZYMA 4GA1A 3UIPC 4QQIA 4HOTA 3RK6A 5BNWA 5LP0A 4L7TA 2VGEA 4UQXA 3D9JA 5D2MC 4WWOA 4Q96A 3Q7FA 3CVUA 3UT8A 3FHEA 3FUFA 3ABLE 1RW2A 5J90A 3RO2A 3R9AB 1IQUA 2KC7A 3LKUA 3NF1A 5KJMA 4JL0A 3DXMG 1SVXA 4AXHA 1JUQA 3RIBA 4G23A 2IF4A 2DCPA 3LS8A 4YNDA 4C9BB 3MA5A 3ZHEB 1QQEA 2RFMA 1FVHA 4EECA 3PEUB 4HLLA 1UN9A 4DI3A 3IEGA 1K3ZD 2EQXA 3B95A 1IHGA 2DZOA 3PNLB 2JEKA 2A5EA 3RSEG 4ANWA 1OCOE 2FO1E 1SZ9A 3C5RA 3TL5A 4KYOB 4HORA 4BTBA 2Q7FA 2LSVA 1OY3D 4ILIA 3TWQA 1B89A 2NXPA 3UKRG 4TV3A 2ZISA 1HU3A 1FPPA 2WXMA 3HHMA 3S2AA 4Z68A 1K1BA 4FHKA 5G05C 1H2TC 2Y4TA 4APOA 2H6GA 1QZ2A 2P9PG 4GTOA 4JW1A 4O6FA 3SQVA 4HS2A 2ZGDA 4OYSA 4I9CA 4XZ4A 2A4ZA 3SY2A 3LY8A 3FH5A 2WXQA 2R5SA 1E8XA 3UT4A 1U3DA 2V4LA 5T3RA 1N0RA 4CGVA 2XZTG 2VYIA 3DRAA 4HI8A 2P9KG 3Q73A 4K0RA 5ITZF 1KLXA 3ZGQA 2FULA 5AAOA 3MKQB 4K5AB 1SW6A 3CHRA 2GW1A 3UM2A 5C2YA 5KJNA 3HRAA 2IOLA 5IY5E 4XX5A 3QWWA 2X6HA 4A3TA 4BERA 1TNBA 4JHJA 3Q9NC 5T8IA 3KAEA 3SD5A 3UI2A 3LJNA 4ME2A 2HO1A 4UQYA 2OCCE 1Z3XA 3GW4A 4WAFA 5B3SE 4OVVA 4BT8A 3I4RB 4EBAG 2DWZA 2LNIA 5LCWJ 3EDTB 4HFGA 1D8EA 2VTBB 5CEDB 5FZRA 2XS8A 3AU5A 4UQZA 2GRNB 4F1PA 3RRUA 3B7TA 2UY1A 3BG1B 4XE0A 2BUGA 2CFZA 1K8KG 3FH8A 2X6FA 3UTMA 4LUNU 4OAUC 2KCKA 1DVPA 2KATA 4FULA 5G04C 2KZTA 4CT4A 2EIME 2WXHA 4J8FA 4UWFA 3NB2A 5D0OD 2NSZA 3SF4A 3Q75A 3HG0D 4F1SA 4BEPA 3AJIA 3KEZA 4FU3A 3O48A 3PZ1A 3J5PA 2IO2C 4A1SA 4U8HA 4F7AA 2IY0C 4KZ0A 3P2BA 4DRXE 5KJKA 2WXOA 4BX9A 1VDYA 2DVWA 4CRWA 4AP2A 2WXLA 2VSOE 5HS0A 2L0TB 1ZBPA 2IO3C 4AVXA 3KD7A 4IYPA 1MHQA 3TWWA 4J6IA 1HXIA 4AM9A 4DX1A 5CBOA 1H6KA 1OT8A 4KVMA 5ENRD 2P9IG 3QNKA 4N2QA 4RSYA 4GMJA 1DCQA 3JYSA 3TXMA 1NFIE 1TN6A 5LFAA 3ASHA 2PM7A 1N52A 1N4QA 2IU1A 3RU0A 4J8YA 3Q15A 4JPSA 5KJLA 4GTSA 3DBSA 1H0AA 2XGSA 3NZUA 1HO8A 2Y4UA 3GYZA 1EPUA 4ZHBA 1MJ0A 4NRHB 4MLPA 4B0ZA 5G05J 1JCSA 2IONA 2R2LA 4CGWA 3FTWA 1HG2A 5JJ6A 5CERB 3KSQA 4YDEA 3ULQA 1XGWA 3RAUA 3T5XA 1HE8A 3TG5A 3RRMB 3EHMA 3Q4AB 1KZPA 2V4HC 3ASNE 4JEHA 2DBAA 3PE3A 1BI7B 1JPLA 1O1SA 1U2VG 3TGOA 1YA0A 5FZQA 4GTMA 5ARFA 2C2LA 2CFUA 1HH8A 4U8VD 2M63A 3N71A 4P29A 2P9SG 3ONKA 3MEKA 3TXNA 4HOQA 3PE4A 4HRMB 3CVLA 4N3BA 4CEMA 2OVFA 3PVLA 4J8SA 4J8EA 2WM9A 4GCOA 2KCLA 1PAQA 1TNUA 2C0LA 3LY7A 3OAWA 3ABME 5ANRA 3UPVA 1U3CA 4O1OA 1MZCA 4PUCA 3C3RA 1RZ4A 3UM3A 4L2YA 4DLQA 4FP7A 3CSTA 3D9HA 3EHNA 3J5QB 2YQ8A 3FTSA 3HIZA 2CHWA 1OWPA 4U7EB 4HB5A 3CK9A 5CMWA 3QAQA 2J4BA 4GMLA 3MCXA 4LERA 3B7SA 3C3OA 2CHZA 2CG3A 4MS6A 4YDYA 4CT0A 2WXKA 3K9IA 4GYWA 5M72A 4LG6A 3B13A 3UM1A 4EZJA 1LD7A 2XPIA 4FJYA 1NA0A 1E7VA 1DNPA 5G04J 4PDXA 2NC9A 2V8SE 4GTQA 4LEUA 2WXFA 3QJZA 2MOWA 2VJ8A 4LNBA 1N4SA 3QOUA 4M3OA 1ELWA 3PEVB 4FADA 1G3NB 2X38A 4KT6B 3CK8A 4UI9K 3CQGB 1TN7A 5FQ6A 4G8KA 2CG2A 2UY1B 3TJPA 1X81A 4I6GA 4HLEA 3I3NA 1IXVA 4G1TA 3CHPA 1TR4A 3APCA 3V2OA 4H7XA 3F6QA 2E0IA 3E4BA 1H19A 4NIKA 2I6HA 2KZTB 3I4GA 2J07A 2L9BA 2YHCA 5JJTA 4I6EA 4BSXA 3U66A 1IQRA 1W3BA 4EPZA 3AG4E 3Q47B 3G2TA 2RFAA 1D9SA 3IHYA 4MRUA 3L82A 3CHOA 1NP7A 3ASDA 3JXJA 3QK0A 4PS8A 3MZLB 4DK5A 1UG3A 1EYHA 4AIFA 1Z5SC 2L6JA 3FUIA 3OXLA 3UT7A 4GTPA 5LOZA 3ISMC 3EHRA 2XEVA 3UM0A 1UJKA 3HXCA 3TWSA 4HRLA 3DSTA 2LXLA 2XHEA 2I2OA 3G2UA 3T9KA 1Y8MA 1OWLA 3W9GA 4PS3A 3AU4A 4EHMA 4GTRA 5DIZA 5BXOA 3CGHA 5KWDA 4JEUA 3TWRA 3DXKG 4I43A 1UJJA 1P5QA 4EZLA 4CDNA 4LNUD 1MX6A 1A17A 3ULEG 2EILE 1Z3YA 3ZN3A 3HXFA 5AQ7A 3CIAA 3U4TA 3MJWA 2XEHA 3KEAA 5FQ7A 4CDMA 5JMND 3C3QA 3BEEA 1BLXB 2NYJA 1MYOA 4I1AA 2QY7A 3KSLA 2YINA 1S64A 4N5CA 4ANVA 3AG1E 4ABNA 4N39A 2WVIA 4GYOA 3QWVA 4FLHA 3EHQA 2EINE 1HF8A 5FIOA 2I9CA 3RJVA 3D9PA 1NI1A 1EDUA 4PS7A 4BETA 3ZU7B 2RG8A 4E85A 4GMRA 2GRQB 3CEQA 1SZAA 3OTNA 3CK7A 2RD0A 3QC1A 2HE0A 4GB9A 1QYMA 3NOGD 3IHVA 5HI7A 3IKOB 3CVQA 3R7QA 3LCAA 4AEZC 4BT9A 3DSVA 3UIOC 4JA7A 2OV8A 3UUXA 4RG6A 4K03A 3VLEA 3LEWA 4G25A 5G55A 3MV2B 2ZU6B 3PS6A 1UOHA 3OXGA 3AS5A 5JJ7A 3LY9A 2ZIRA 5EX3A 3B7BA 5ARGA 3FUHA 4JHRA 3ASOE 5JHBA 1N54A 3VLDA 2LAHA 5ENQD 1WG0A 2WXPA 4JA9A 5D0QD 4I1OB 3CVNA 1ZB1A 3G2VA 2B6CA 3FY4A 4ATGA 2QFCA 2WXNA 2Y69E 3CHQA 3UXGA 4CCAA 2DZNA 3PUKA 2BKGA 3SGHA 2MRIA 1OUVA 2FEZA 1LD8A 4Q69A 4W9RA 3FTYA 1BI8B 3JXIA 2ZXWE 3LPZA 4L2LA 4TXRA 3UX4A 1S63A 1Z6TA 2RKKA 2Y3AA 4AOFA 4PH4B 1KT1A 5EIDA 1NZNA 5EILA 4TXQA 3R7RA 3PZDA 3APFA 1O5MA 2X3MA 3V2XA 2XGMA 3UINC 1FT1A 5ANLA 4ILGA 5JHAA 3HVEA 4WWPA 4EZKA 3MYVA 3BQOA 2R03A 3Q5MA 1LF8A 2C0MA 3D9NA 5LX8A 2I1KA 4FC8A 5AQ9A 2X6IA 3QKYA 1HG5A 3PRZA 3E30A 4I17A 4RG9A 1TN8A 1OWNA 1PY1A 3FU0A 5FTPA 3C72A 1H2VC 3DSUA 1Q2ZA 2LO6A 5EYLA 3IBEA 3ZPJA 4GTTA 3SO8A 3U64A 4GPMA 2QYUA 1N95A 2QYJA 3D9IA 4GZDA 3FUJA 5FZSA 1E8WA 3G2SA 3L17A 3S7DA 5FJYA 3SFYA 4A1GA 4FHJA 2Y1LE 4LCTA 4TRQA 2WXJA 3ZIMA 5B1BE 3MGBA 5CMYA 2P2CP 1BPOA 3WXXA 4GU5A 2V5QC 4ANUA 1FCHA 4LSZE 2FI7A 3ULYA 4HRNA 2GRPB 1KT0A 5AYWD 4U04A 3T5VA 3ZEFA 4YVOA 3S7JA 2PZIA 4NACA 1MX4A 1N11A 4OVUA 2JABA 2PM6A 1WDYA 2AJAA 2IEJA 3V30A 2BKKB 1X5BA 5HRYA 2LUHA 5A6CA 4G2VA 4F53A 4GTVA 1MQSA 3FP3A 3EIJA 4I1MA 4L23A 2IFUA 2LAIA 4NURA 3FU3A 4X8QA 1V54E 5CHEE 1NL4A 4AV7A 2VSYA 4A63B
chains in the Genus database with same CATH topology
2DZOA 2DVWA 2XENA 2A5EA 1K1AA 5CEAA 1MX2A 4U8VD 4C48B 2PNNA 1BU9A 5AN8A 4O1PA 3HRAA 1MX6A 4LNUD 2ETAA 5HS0A 1G3NB 2FO1E 2KBXA 5EIBE 4HNAD 3C5RA 3ZNGA 4BERA 5AQ9A 4HRMB 4ATZD 3Q9NC 4G8KA 3ZUVB 4UUCA 4DX2A 1UOHA 1OY3D 3TWWA 3TWQA 3UI2A 5AQ7A 3LJNA 3EU9A 2ETCA 4DX1A 4HI9A 2XEHA 3KEAA 1IXVA 2F8YA 4RLYA 5CBOA 3B7BA 4QFVA 1TR4A 1DC2A 2L6BA 3V2OA 5CBNA 1OT8A 1YCSB 2J8SD 3F6QA 4G8LA 5ENRD 5EYLA 4K5CA 2DWZA 3DEPA 2XZDG 3AAAC 4JB8P 3SO8A 5EN5D 1AWCB 2F37A 5ENSD 5JMND 4GPMA 5EYPF 4NIKA 4Z68A 1DCQA 2F8XK 1K1BA 2QYJA 5CEDB 2ETBA 5ENOD 1YYHA 1BLXB 1A5EA 3Q9UC 2NYJA 1MYOA 5AQAA 5ENQD 1NFIE 1WG0A 1BD8A 4F1PA 4QQIA 4O1OA 3IXEA 5KBAA 4U95D 4J7WA 2VGEA 2Y0BG 2Y1LE 4J8YA 2RFAA 1D9SA 4B93B 3D9HA 2XEEA 2P2CP 3UTMA 3V79K 2B0OE 2ZGDA 3UXGA 3J5QB 2DZNA 4F6RD 1IKND 5ENPD 2V5QC 4TUMA 2MYOA 3TWTA 4HB5A 4LSZE 2BKGA 4DUIA 4OAUC 4ZFHA 3JXJA 4HRNA 3EHQA 4ZHBA 4OAVB 5FIOA 1AP7A 1MJ0A 5BXUA 2KXPC 1BI8B 3JXIA 5ENTD 4BETA 1S70B 3ZU7B 3W9FA 4GMRA 4N5QA 1SVXA 4CYMD 5D66A 3TWXA 1MX4A 4K5BA 4BESA 1N11A 5AQBA 2JABA 5KNGA 5FINA 5EIDA 4DX6D 3EHRA 4YDYA 1WDYA 5EILA 5CERB 5KNHD 3TWUA 2AJAA 3V30A 2BKKB 5HRYA 4HQDA 4HBDA 4HRLA 3TWSA 4LG6A 3ZKJA 4U8YD 3V2XA 3T9KA 1N0RA 3HG0D 2QC9A 2XZTG 5HKPA 4U96D 5JA4D 4BEPA 3NOCD 2RFMA 3W9GA 4HI8A 2HE0A 1IHBA 4DX7D 4HLLA 3AJIA 3T8KA 1QYMA 2ZGGA 3TWVA 3V31A 4O60A 3NOGD 3NBNB 3JUEA 3J5PA 5BXOA 2V4HC 5ITZF 4YDWA 1BI7B 5CECB 1K3ZD 5KWDA 1N0QA 4DX5D 4CZ2D 3B95A 4DRXE 3TWRA 5AARA 5AAOA 1YMPA 3DEOA 4K5AB 1SW6A 4A63B 4BSZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZO A;  2DVW A;  2XEN A;  2A5E A;  1K1A A;  5CEA A;  1MX2 A;  4U8V D;  4C48 B;  2PNN A;  1BU9 A;  5AN8 A;  4O1P A;  3HRA A;  1MX6 A;  4LNU D;  2ETA A;  5HS0 A;  1G3N B;  2FO1 E;  2KBX A;  5EIB E;  4HNA D;  3C5R A;  3ZNG A;  4BER A;  5AQ9 A;  4HRM B;  4ATZ D;  3Q9N C;  4G8K A;  3ZUV B;  4UUC A;  4DX2 A;  1UOH A;  1OY3 D;  3TWW A;  3TWQ A;  3UI2 A;  5AQ7 A;  3LJN A;  3EU9 A;  2ETC A;  4DX1 A;  4HI9 A;  2XEH A;  3KEA A;  1IXV A;  2F8Y A;  4RLY A;  5CBO A;  3B7B A;  4QFV A;  1TR4 A;  1DC2 A;  2L6B A;  3V2O A;  5CBN A;  1OT8 A;  1YCS B;  2J8S D;  3F6Q A;  4G8L A;  5ENR D;  5EYL A;  4K5C A;  2DWZ A;  3DEP A;  2XZD G;  3AAA C;  4JB8 P;  3SO8 A;  5EN5 D;  1AWC B;  2F37 A;  5ENS D;  5JMN D;  4GPM A;  5EYP F;  4NIK A;  4Z68 A;  1DCQ A;  2F8X K;  1K1B A;  2QYJ A;  5CED B;  2ETB A;  5ENO D;  1YYH A;  1BLX B;  1A5E A;  3Q9U C;  2NYJ A;  1MYO A;  5AQA A;  5ENQ D;  1NFI E;  1WG0 A;  1BD8 A;  4F1P A;  4QQI A;  4O1O A;  3IXE A;  5KBA A;  4U95 D;  4J7W A;  2VGE A;  2Y0B G;  2Y1L E;  4J8Y A;  2RFA A;  1D9S A;  4B93 B;  3D9H A;  2XEE A;  2P2C P;  3UTM A;  3V79 K;  2B0O E;  2ZGD A;  3UXG A;  3J5Q B;  2DZN A;  4F6R D;  1IKN D;  5ENP D;  2V5Q C;  4TUM A;  2MYO A;  3TWT A;  4HB5 A;  4LSZ E;  2BKG A;  4DUI A;  4OAU C;  4ZFH A;  3JXJ A;  4HRN A;  3EHQ A;  4ZHB A;  4OAV B;  5FIO A;  1AP7 A;  1MJ0 A;  5BXU A;  2KXP C;  1BI8 B;  3JXI A;  5ENT D;  4BET A;  1S70 B;  3ZU7 B;  3W9F A;  4GMR A;  4N5Q A;  1SVX A;  4CYM D;  5D66 A;  3TWX A;  1MX4 A;  4K5B A;  4BES A;  1N11 A;  5AQB A;  2JAB A;  5KNG A;  5FIN A;  5EID A;  4DX6 D;  3EHR A;  4YDY A;  1WDY A;  5EIL A;  5CER B;  5KNH D;  3TWU A;  2AJA A;  3V30 A;  2BKK B;  5HRY A;  4HQD A;  4HBD A;  4HRL A;  3TWS A;  4LG6 A;  3ZKJ A;  4U8Y D;  3V2X A;  3T9K A;  1N0R A;  3HG0 D;  2QC9 A;  2XZT G;  5HKP A;  4U96 D;  5JA4 D;  4BEP A;  3NOC D;  2RFM A;  3W9G A;  4HI8 A;  2HE0 A;  1IHB A;  4DX7 D;  4HLL A;  3AJI A;  3T8K A;  1QYM A;  2ZGG A;  3TWV A;  3V31 A;  4O60 A;  3NOG D;  3NBN B;  3JUE A;  3J5P A;  5BXO A;  2V4H C;  5ITZ F;  4YDW A;  1BI7 B;  5CEC B;  1K3Z D;  5KWD A;  1N0Q A;  4DX5 D;  4CZ2 D;  3B95 A;  4DRX E;  3TWR A;  5AAR A;  5AAO A;  1YMP A;  3DEO A;  4K5A B;  1SW6 A;  4A63 B;  4BSZ B; 
#chains in the Genus database with same CATH topology
 1HS6 A;  1GW6 A;  3O4Z A;  4APF A;  5AEN A;  1INZ A;  3FUK A;  4GAA A;  4IRU A;  1WAO 1;  3ZUV B;  3FUL A;  1H6P A;  1TJF A;  1V55 E;  3NAW A;  4EQF A;  4WNG A;  2OND A;  3D9M A;  1E90 A;  4RLY A;  1DC2 A;  2J8S D;  2J49 A;  4UWK A;  4K5C A;  3FUN A;  1KPS B;  2XZD G;  5ENS D;  3JQ1 A;  1DCE A;  1N4P A;  4XEI G;  1YYH A;  2X6J A;  5AJD A;  3ML8 A;  3CVW A;  1TEZ A;  4U95 D;  4WND A;  3CR3 A;  3UQ3 A;  3VTX A;  1QNF A;  4TUM A;  2VGX A;  4GZ3 A;  3FEX A;  4ZFH A;  2P9U G;  3LVR E;  4WUY A;  1S70 B;  3MX3 A;  4N5Q A;  4CYM D;  3TWX A;  4DI4 A;  3ABK E;  3BUA A;  4UWL A;  3Q7A A;  5A23 A;  1H6O A;  3ASG A;  4U96 D;  3HYM B;  2GRO B;  4YDW A;  4ACK A;  2XPY A;  4BSZ B;  4KMO A;  4B8C B;  2XEN A;  4U0S A;  2PNN A;  2IJG X;  2XQ0 A;  1E8Z A;  2KBX A;  4GZ5 A;  3L54 A;  4HNA D;  4U63 A;  3Q79 A;  4G24 A;  4ATZ D;  3PNT B;  4KVO A;  2WXG A;  2ETC A;  3CV0 A;  3L08 A;  3TAX A;  2L0I A;  4JZY A;  4Q94 A;  2WQ7 A;  3LJ3 A;  3L22 A;  1YCS B;  3U9W A;  1UW4 B;  1N4R A;  3AAA C;  1AWC B;  3E33 A;  3Q78 A;  5T4Y A;  3HXE A;  2I1J A;  5J08 A;  1JWF A;  3IXE A;  5KBA A;  1HX8 A;  1XNF A;  4J7W A;  4GCN A;  4HXI A;  2LSU A;  2B0O E;  4F6R D;  3S7F A;  3TWT A;  3HVE B;  4RVB A;  1AP7 A;  1OCZ E;  5BXU A;  5BV0 A;  1HZ4 A;  2WQH A;  4UWH A;  3ENE A;  4L9P A;  5FWQ A;  2E2E A;  4CDR A;  1ZU2 A;  3C98 A;  3UKU G;  3T8M A;  3CVP A;  3D9O A;  3R9M A;  3IV0 A;  4GZC A;  4ANX A;  5E76 A;  4C0E A;  3CQC B;  2A5U A;  4O60 A;  2J9Q A;  4DLO A;  5C1D A;  1WM5 A;  1D8D A;  4O1P A;  4YVQ C;  5HQ8 A;  1SA5 A;  4LRZ A;  3APD A;  4KBQ A;  4KZC A;  1LTX A;  4MBG A;  2R02 A;  4QFV A;  4M7C A;  3CKC A;  1OWO A;  4L1B A;  4ACL A;  4JB8 P;  2GRL A;  5AIJ A;  3OXF A;  1A5E A;  5AQA A;  4J8D A;  1KZO A;  3SI5 A;  3SFX A;  3CVY A;  3BU8 A;  2VQ2 A;  2XEE A;  5CRU A;  3V79 K;  2H6F A;  3X2Q E;  5CCM A;  4FA6 A;  4E6H A;  5H7P A;  2PQR A;  2J4D A;  2WPV A;  4WNF A;  4WWN A;  2AWI A;  5AQB A;  2XCC A;  5BT1 A;  5BUZ A;  2QZA A;  4HBD A;  4I6J A;  4U8Y D;  2R59 A;  2WMO A;  3QB2 A;  4JHK A;  4ILH B;  4DX7 D;  5BW8 C;  2P9N G;  3SHF A;  3SNX A;  3L13 A;  4J0U A;  3D3M A;  4GZ6 A;  2IQC A;  1MX2 A;  2P9L G;  5AN8 A;  2BED A;  5KCM A;  3HDX A;  4DX2 A;  5FQ4 A;  1SQM A;  5FQ8 A;  5FT9 A;  2F8Y A;  2GGF A;  3SZ7 A;  2VGX B;  3Q49 B;  2IOS A;  2HR2 A;  4JXT A;  2PL2 A;  3U3W A;  1ELK A;  5EKQ D;  2WB2 A;  4IN3 B;  3VLF A;  2XS1 A;  1E8Y A;  5EDS A;  2KCV A;  3RO3 A;  4B8A A;  4JC8 A;  4HVB A;  3QWP A;  2UWJ G;  2KXP C;  3DSS A;  4U0Z A;  4XI0 A;  3E32 A;  4BES A;  2PQN A;  3JUI A;  5KNH D;  3LVQ E;  3ZKJ A;  3CSF A;  3ZYL A;  4DJA A;  5HKP A;  2R17 C;  4BX8 A;  4AJW A;  4GA0 A;  4FLB A;  3FUM A;  3T8K A;  1OXJ A;  3DSW A;  3KS2 A;  3L6A A;  3QAR A;  4DX5 D;  2AXZ A;  3B7U X;  1K1A A;  3FFL A;  3MKR A;  5EIB E;  4JVS A;  1E7U A;  4U07 A;  4UI9 C;  3FEY A;  3SBS A;  2X6K A;  4D10 C;  2AXV A;  3SFZ A;  1TJC A;  3AG2 E;  3LXU X;  2BTD A;  5CRV A;  2EIK E;  4LNG A;  3FTX A;  5EN5 D;  2F37 A;  4B94 A;  5BV1 A;  2H6H A;  3JQ0 A;  1S0P A;  1BD8 A;  3CHM A;  4HOS A;  3LDZ A;  3ZXS A;  4B93 B;  3EUV A;  2DYS E;  4Y6C A;  3B7R L;  2V5F A;  3RKV A;  5A7D B;  2FO7 A;  3ZW3 A;  3PZ4 A;  1EF1 C;  1NA3 A;  2CHX A;  3FTU A;  3ESL A;  3EJN A;  3HXB A;  4N3A A;  3MV3 B;  2VSX E;  3FUD A;  3D9K A;  5FIN A;  3DWL G;  3TWU A;  3ZRH A;  2P58 C;  4F3V A;  3ZVV A;  1PC2 A;  3PUJ A;  3UMV A;  3E34 A;  2ZGG A;  3JUE A;  3PDN A;  3ASF A;  5CEC B;  2XRZ A;  3FU5 A;  4CZ2 D;  4JD2 G;  3GZ1 A;  3URZ A;  4UWG A;  5AAR A;  1SA4 A;  3JCK C;  4H7Y A;  2OVB A;  4RQI A;  4BWR A;  3D9L A;  2ETA A;  3PZ2 A;  4BY6 A;  3ZNG A;  4AY5 A;  3SBT B;  3ZHE A;  1TNO A;  4YDO A;  4MKT A;  2J08 A;  4V3I A;  2VSN A;  5G2N A;  2L6B A;  2ILR A;  3DPD A;  2OEW A;  3G2W A;  3DEP A;  4BFR A;  2FF4 A;  4C0M A;  1OWM A;  4R7L A;  1TYQ G;  4GA2 A;  4WNE A;  5B1A E;  4G26 A;  3E37 A;  4N3C A;  3CVV A;  3DPY A;  3FU6 A;  1H2U A;  2Y0B G;  2YNQ A;  4U0U A;  2WMN A;  3FUE A;  3I5P A;  4I2W A;  1IKN D;  5ENP D;  4TXP A;  2MYO A;  4TUU A;  3RRN B;  4Y6W A;  4EBA A;  2GRM A;  2HYZ A;  3ONL A;  5ENT D;  3W9F A;  3NQP A;  5D66 A;  3ZYK A;  1ELR A;  4K5B A;  3VTY A;  3QDN A;  5KNG A;  2AW6 A;  3ZYQ A;  2WXR A;  3GZ2 A;  2YHE A;  4HQD A;  5ENN A;  5E75 A;  2AXU A;  4URK A;  4NQ0 A;  5CCL A;  3EU5 A;  2AVP A;  2KM4 A;  3TWV A;  3V31 A;  3ESK A;  3NBN B;  1E96 B;  3DSX A;  2VGY A;  3PRE A;  4BTA A;  3DEO A;  1WY6 A;  3AS4 A;  3BG0 B;  3CVX A;  5BPP A;  3NZS A;  1TNZ A;  2FBN A;  1IYG A;  2OOE A;  3L9T A;  4GYY A;  2V0P A;  3FTV A;  2WXI A;  1TNY A;  3EU9 A;  4HI9 A;  3HXD A;  3MKQ A;  2DYR E;  4G8L A;  1O1R A;  3CLJ A;  3AG3 E;  2MHK A;  3EIQ C;  4KXK B;  2F8X K;  2ETB A;  5ENO D;  1QBQ A;  2XCB A;  1OCR E;  4UI9 J;  2DIW A;  1JWG A;  1N94 A;  2WQ6 A;  4XKC A;  4N2S A;  2GRR B;  4A55 A;  1HFA A;  2XPZ A;  4DUI A;  3FTZ A;  4XI9 A;  2VTB A;  4OAV B;  3ML9 A;  1N9A A;  2XRY A;  3FH7 A;  3AS8 A;  3PH0 C;  2BF0 X;  3S7B A;  2LXM A;  4A3V A;  2EIJ E;  4IUL A;  4GPK A;  3WG7 E;  4XIF A;  4DX6 D;  5DBK A;  4AY6 A;  2H6I A;  4HOU A;  3FDH A;  3GZS A;  2QC9 A;  5JA4 D;  3P1U A;  1O1T A;  3FWV A;  3NOC D;  3TG4 A;  2F0Y A;  1JCQ A;  1IHB A;  1N0Q A;  5AJL A;  2XGO A;  1YMP A;  4I2Z A;  4XKB A;  5LCW C;  3PZ3 A;  5CEA A;  4C48 B;  5EX0 A;  1BU9 A;  1L5J A;  4B89 A;  2OEV A;  2JLB A;  3L16 A;  1Y6I A;  4UUC A;  1OCC E;  3CHS A;  2HM8 A;  3CKB A;  4FJZ A;  3ZFW A;  1FVF A;  5CBN A;  3ZXP A;  4DPR A;  2R05 A;  3LYA A;  1FT2 A;  4G11 A;  5EYP F;  1JCR A;  2J09 A;  1UN8 A;  4I9E A;  3Q9U C;  3ZYM A;  4GA1 A;  3UIP C;  4QQI A;  4HOT A;  3RK6 A;  5BNW A;  5LP0 A;  4L7T A;  2VGE A;  4UQX A;  3D9J A;  5D2M C;  4WWO A;  4Q96 A;  3Q7F A;  3CVU A;  3UT8 A;  3FHE A;  3FUF A;  3ABL E;  1RW2 A;  5J90 A;  3RO2 A;  3R9A B;  1IQU A;  2KC7 A;  3LKU A;  3NF1 A;  5KJM A;  4JL0 A;  3DXM G;  1SVX A;  4AXH A;  1JUQ A;  3RIB A;  4G23 A;  2IF4 A;  2DCP A;  3LS8 A;  4YND A;  4C9B B;  3MA5 A;  3ZHE B;  1QQE A;  2RFM A;  1FVH A;  4EEC A;  3PEU B;  4HLL A;  1UN9 A;  4DI3 A;  3IEG A;  1K3Z D;  2EQX A;  3B95 A;  1IHG A;  2DZO A;  3PNL B;  2JEK A;  2A5E A;  3RSE G;  4ANW A;  1OCO E;  2FO1 E;  1SZ9 A;  3C5R A;  3TL5 A;  4KYO B;  4HOR A;  4BTB A;  2Q7F A;  2LSV A;  1OY3 D;  4ILI A;  3TWQ A;  1B89 A;  2NXP A;  3UKR G;  4TV3 A;  2ZIS A;  1HU3 A;  1FPP A;  2WXM A;  3HHM A;  3S2A A;  4Z68 A;  1K1B A;  4FHK A;  5G05 C;  1H2T C;  2Y4T A;  4APO A;  2H6G A;  1QZ2 A;  2P9P G;  4GTO A;  4JW1 A;  4O6F A;  3SQV A;  4HS2 A;  2ZGD A;  4OYS A;  4I9C A;  4XZ4 A;  2A4Z A;  3SY2 A;  3LY8 A;  3FH5 A;  2WXQ A;  2R5S A;  1E8X A;  3UT4 A;  1U3D A;  2V4L A;  5T3R A;  1N0R A;  4CGV A;  2XZT G;  2VYI A;  3DRA A;  4HI8 A;  2P9K G;  3Q73 A;  4K0R A;  5ITZ F;  1KLX A;  3ZGQ A;  2FUL A;  5AAO A;  3MKQ B;  4K5A B;  1SW6 A;  3CHR A;  2GW1 A;  3UM2 A;  5C2Y A;  5KJN A;  3HRA A;  2IOL A;  5IY5 E;  4XX5 A;  3QWW A;  2X6H A;  4A3T A;  4BER A;  1TNB A;  4JHJ A;  3Q9N C;  5T8I A;  3KAE A;  3SD5 A;  3UI2 A;  3LJN A;  4ME2 A;  2HO1 A;  4UQY A;  2OCC E;  1Z3X A;  3GW4 A;  4WAF A;  5B3S E;  4OVV A;  4BT8 A;  3I4R B;  4EBA G;  2DWZ A;  2LNI A;  5LCW J;  3EDT B;  4HFG A;  1D8E A;  2VTB B;  5CED B;  5FZR A;  2XS8 A;  3AU5 A;  4UQZ A;  2GRN B;  4F1P A;  3RRU A;  3B7T A;  2UY1 A;  3BG1 B;  4XE0 A;  2BUG A;  2CFZ A;  1K8K G;  3FH8 A;  2X6F A;  3UTM A;  4LUN U;  4OAU C;  2KCK A;  1DVP A;  2KAT A;  4FUL A;  5G04 C;  2KZT A;  4CT4 A;  2EIM E;  2WXH A;  4J8F A;  4UWF A;  3NB2 A;  5D0O D;  2NSZ A;  3SF4 A;  3Q75 A;  3HG0 D;  4F1S A;  4BEP A;  3AJI A;  3KEZ A;  4FU3 A;  3O48 A;  3PZ1 A;  3J5P A;  2IO2 C;  4A1S A;  4U8H A;  4F7A A;  2IY0 C;  4KZ0 A;  3P2B A;  4DRX E;  5KJK A;  2WXO A;  4BX9 A;  1VDY A;  2DVW A;  4CRW A;  4AP2 A;  2WXL A;  2VSO E;  5HS0 A;  2L0T B;  1ZBP A;  2IO3 C;  4AVX A;  3KD7 A;  4IYP A;  1MHQ A;  3TWW A;  4J6I A;  1HXI A;  4AM9 A;  4DX1 A;  5CBO A;  1H6K A;  1OT8 A;  4KVM A;  5ENR D;  2P9I G;  3QNK A;  4N2Q A;  4RSY A;  4GMJ A;  1DCQ A;  3JYS A;  3TXM A;  1NFI E;  1TN6 A;  5LFA A;  3ASH A;  2PM7 A;  1N52 A;  1N4Q A;  2IU1 A;  3RU0 A;  4J8Y A;  3Q15 A;  4JPS A;  5KJL A;  4GTS A;  3DBS A;  1H0A A;  2XGS A;  3NZU A;  1HO8 A;  2Y4U A;  3GYZ A;  1EPU A;  4ZHB A;  1MJ0 A;  4NRH B;  4MLP A;  4B0Z A;  5G05 J;  1JCS A;  2ION A;  2R2L A;  4CGW A;  3FTW A;  1HG2 A;  5JJ6 A;  5CER B;  3KSQ A;  4YDE A;  3ULQ A;  1XGW A;  3RAU A;  3T5X A;  1HE8 A;  3TG5 A;  3RRM B;  3EHM A;  3Q4A B;  1KZP A;  2V4H C;  3ASN E;  4JEH A;  2DBA A;  3PE3 A;  1BI7 B;  1JPL A;  1O1S A;  1U2V G;  3TGO A;  1YA0 A;  5FZQ A;  4GTM A;  5ARF A;  2C2L A;  2CFU A;  1HH8 A;  4U8V D;  2M63 A;  3N71 A;  4P29 A;  2P9S G;  3ONK A;  3MEK A;  3TXN A;  4HOQ A;  3PE4 A;  4HRM B;  3CVL A;  4N3B A;  4CEM A;  2OVF A;  3PVL A;  4J8S A;  4J8E A;  2WM9 A;  4GCO A;  2KCL A;  1PAQ A;  1TNU A;  2C0L A;  3LY7 A;  3OAW A;  3ABM E;  5ANR A;  3UPV A;  1U3C A;  4O1O A;  1MZC A;  4PUC A;  3C3R A;  1RZ4 A;  3UM3 A;  4L2Y A;  4DLQ A;  4FP7 A;  3CST A;  3D9H A;  3EHN A;  3J5Q B;  2YQ8 A;  3FTS A;  3HIZ A;  2CHW A;  1OWP A;  4U7E B;  4HB5 A;  3CK9 A;  5CMW A;  3QAQ A;  2J4B A;  4GML A;  3MCX A;  4LER A;  3B7S A;  3C3O A;  2CHZ A;  2CG3 A;  4MS6 A;  4YDY A;  4CT0 A;  2WXK A;  3K9I A;  4GYW A;  5M72 A;  4LG6 A;  3B13 A;  3UM1 A;  4EZJ A;  1LD7 A;  2XPI A;  4FJY A;  1NA0 A;  1E7V A;  1DNP A;  5G04 J;  4PDX A;  2NC9 A;  2V8S E;  4GTQ A;  4LEU A;  2WXF A;  3QJZ A;  2MOW A;  2VJ8 A;  4LNB A;  1N4S A;  3QOU A;  4M3O A;  1ELW A;  3PEV B;  4FAD A;  1G3N B;  2X38 A;  4KT6 B;  3CK8 A;  4UI9 K;  3CQG B;  1TN7 A;  5FQ6 A;  4G8K A;  2CG2 A;  2UY1 B;  3TJP A;  1X81 A;  4I6G A;  4HLE A;  3I3N A;  1IXV A;  4G1T A;  3CHP A;  1TR4 A;  3APC A;  3V2O A;  4H7X A;  3F6Q A;  2E0I A;  3E4B A;  1H19 A;  4NIK A;  2I6H A;  2KZT B;  3I4G A;  2J07 A;  2L9B A;  2YHC A;  5JJT A;  4I6E A;  4BSX A;  3U66 A;  1IQR A;  1W3B A;  4EPZ A;  3AG4 E;  3Q47 B;  3G2T A;  2RFA A;  1D9S A;  3IHY A;  4MRU A;  3L82 A;  3CHO A;  1NP7 A;  3ASD A;  3JXJ A;  3QK0 A;  4PS8 A;  3MZL B;  4DK5 A;  1UG3 A;  1EYH A;  4AIF A;  1Z5S C;  2L6J A;  3FUI A;  3OXL A;  3UT7 A;  4GTP A;  5LOZ A;  3ISM C;  3EHR A;  2XEV A;  3UM0 A;  1UJK A;  3HXC A;  3TWS A;  4HRL A;  3DST A;  2LXL A;  2XHE A;  2I2O A;  3G2U A;  3T9K A;  1Y8M A;  1OWL A;  3W9G A;  4PS3 A;  3AU4 A;  4EHM A;  4GTR A;  5DIZ A;  5BXO A;  3CGH A;  5KWD A;  4JEU A;  3TWR A;  3DXK G;  4I43 A;  1UJJ A;  1P5Q A;  4EZL A;  4CDN A;  4LNU D;  1MX6 A;  1A17 A;  3ULE G;  2EIL E;  1Z3Y A;  3ZN3 A;  3HXF A;  5AQ7 A;  3CIA A;  3U4T A;  3MJW A;  2XEH A;  3KEA A;  5FQ7 A;  4CDM A;  5JMN D;  3C3Q A;  3BEE A;  1BLX B;  2NYJ A;  1MYO A;  4I1A A;  2QY7 A;  3KSL A;  2YIN A;  1S64 A;  4N5C A;  4ANV A;  3AG1 E;  4ABN A;  4N39 A;  2WVI A;  4GYO A;  3QWV A;  4FLH A;  3EHQ A;  2EIN E;  1HF8 A;  5FIO A;  2I9C A;  3RJV A;  3D9P A;  1NI1 A;  1EDU A;  4PS7 A;  4BET A;  3ZU7 B;  2RG8 A;  4E85 A;  4GMR A;  2GRQ B;  3CEQ A;  1SZA A;  3OTN A;  3CK7 A;  2RD0 A;  3QC1 A;  2HE0 A;  4GB9 A;  1QYM A;  3NOG D;  3IHV A;  5HI7 A;  3IKO B;  3CVQ A;  3R7Q A;  3LCA A;  4AEZ C;  4BT9 A;  3DSV A;  3UIO C;  4JA7 A;  2OV8 A;  3UUX A;  4RG6 A;  4K03 A;  3VLE A;  3LEW A;  4G25 A;  5G55 A;  3MV2 B;  2ZU6 B;  3PS6 A;  1UOH A;  3OXG A;  3AS5 A;  5JJ7 A;  3LY9 A;  2ZIR A;  5EX3 A;  3B7B A;  5ARG A;  3FUH A;  4JHR A;  3ASO E;  5JHB A;  1N54 A;  3VLD A;  2LAH A;  5ENQ D;  1WG0 A;  2WXP A;  4JA9 A;  5D0Q D;  4I1O B;  3CVN A;  1ZB1 A;  3G2V A;  2B6C A;  3FY4 A;  4ATG A;  2QFC A;  2WXN A;  2Y69 E;  3CHQ A;  3UXG A;  4CCA A;  2DZN A;  3PUK A;  2BKG A;  3SGH A;  2MRI A;  1OUV A;  2FEZ A;  1LD8 A;  4Q69 A;  4W9R A;  3FTY A;  1BI8 B;  3JXI A;  2ZXW E;  3LPZ A;  4L2L A;  4TXR A;  3UX4 A;  1S63 A;  1Z6T A;  2RKK A;  2Y3A A;  4AOF A;  4PH4 B;  1KT1 A;  5EID A;  1NZN A;  5EIL A;  4TXQ A;  3R7R A;  3PZD A;  3APF A;  1O5M A;  2X3M A;  3V2X A;  2XGM A;  3UIN C;  1FT1 A;  5ANL A;  4ILG A;  5JHA A;  3HVE A;  4WWP A;  4EZK A;  3MYV A;  3BQO A;  2R03 A;  3Q5M A;  1LF8 A;  2C0M A;  3D9N A;  5LX8 A;  2I1K A;  4FC8 A;  5AQ9 A;  2X6I A;  3QKY A;  1HG5 A;  3PRZ A;  3E30 A;  4I17 A;  4RG9 A;  1TN8 A;  1OWN A;  1PY1 A;  3FU0 A;  5FTP A;  3C72 A;  1H2V C;  3DSU A;  1Q2Z A;  2LO6 A;  5EYL A;  3IBE A;  3ZPJ A;  4GTT A;  3SO8 A;  3U64 A;  4GPM A;  2QYU A;  1N95 A;  2QYJ A;  3D9I A;  4GZD A;  3FUJ A;  5FZS A;  1E8W A;  3G2S A;  3L17 A;  3S7D A;  5FJY A;  3SFY A;  4A1G A;  4FHJ A;  2Y1L E;  4LCT A;  4TRQ A;  2WXJ A;  3ZIM A;  5B1B E;  3MGB A;  5CMY A;  2P2C P;  1BPO A;  3WXX A;  4GU5 A;  2V5Q C;  4ANU A;  1FCH A;  4LSZ E;  2FI7 A;  3ULY A;  4HRN A;  2GRP B;  1KT0 A;  5AYW D;  4U04 A;  3T5V A;  3ZEF A;  4YVO A;  3S7J A;  2PZI A;  4NAC A;  1MX4 A;  1N11 A;  4OVU A;  2JAB A;  2PM6 A;  1WDY A;  2AJA A;  2IEJ A;  3V30 A;  2BKK B;  1X5B A;  5HRY A;  2LUH A;  5A6C A;  4G2V A;  4F53 A;  4GTV A;  1MQS A;  3FP3 A;  3EIJ A;  4I1M A;  4L23 A;  2IFU A;  2LAI A;  4NUR A;  3FU3 A;  4X8Q A;  1V54 E;  5CHE E;  1NL4 A;  4AV7 A;  2VSY A;  4A63 B; 
#chains in the Genus database with same CATH homology
 2DZO A;  2DVW A;  2XEN A;  2A5E A;  1K1A A;  5CEA A;  1MX2 A;  4U8V D;  4C48 B;  2PNN A;  1BU9 A;  5AN8 A;  4O1P A;  3HRA A;  1MX6 A;  4LNU D;  2ETA A;  5HS0 A;  1G3N B;  2FO1 E;  2KBX A;  5EIB E;  4HNA D;  3C5R A;  3ZNG A;  4BER A;  5AQ9 A;  4HRM B;  4ATZ D;  3Q9N C;  4G8K A;  3ZUV B;  4UUC A;  4DX2 A;  1UOH A;  1OY3 D;  3TWW A;  3TWQ A;  3UI2 A;  5AQ7 A;  3LJN A;  3EU9 A;  2ETC A;  4DX1 A;  4HI9 A;  2XEH A;  3KEA A;  1IXV A;  2F8Y A;  4RLY A;  5CBO A;  3B7B A;  4QFV A;  1TR4 A;  1DC2 A;  2L6B A;  3V2O A;  5CBN A;  1OT8 A;  1YCS B;  2J8S D;  3F6Q A;  4G8L A;  5ENR D;  5EYL A;  4K5C A;  2DWZ A;  3DEP A;  2XZD G;  3AAA C;  4JB8 P;  3SO8 A;  5EN5 D;  1AWC B;  2F37 A;  5ENS D;  5JMN D;  4GPM A;  5EYP F;  4NIK A;  4Z68 A;  1DCQ A;  2F8X K;  1K1B A;  2QYJ A;  5CED B;  2ETB A;  5ENO D;  1YYH A;  1BLX B;  1A5E A;  3Q9U C;  2NYJ A;  1MYO A;  5AQA A;  5ENQ D;  1NFI E;  1WG0 A;  1BD8 A;  4F1P A;  4QQI A;  4O1O A;  3IXE A;  5KBA A;  4U95 D;  4J7W A;  2VGE A;  2Y0B G;  2Y1L E;  4J8Y A;  2RFA A;  1D9S A;  4B93 B;  3D9H A;  2XEE A;  2P2C P;  3UTM A;  3V79 K;  2B0O E;  2ZGD A;  3UXG A;  3J5Q B;  2DZN A;  4F6R D;  1IKN D;  5ENP D;  2V5Q C;  4TUM A;  2MYO A;  3TWT A;  4HB5 A;  4LSZ E;  2BKG A;  4DUI A;  4OAU C;  4ZFH A;  3JXJ A;  4HRN A;  3EHQ A;  4ZHB A;  4OAV B;  5FIO A;  1AP7 A;  1MJ0 A;  5BXU A;  2KXP C;  1BI8 B;  3JXI A;  5ENT D;  4BET A;  1S70 B;  3ZU7 B;  3W9F A;  4GMR A;  4N5Q A;  1SVX A;  4CYM D;  5D66 A;  3TWX A;  1MX4 A;  4K5B A;  4BES A;  1N11 A;  5AQB A;  2JAB A;  5KNG A;  5FIN A;  5EID A;  4DX6 D;  3EHR A;  4YDY A;  1WDY A;  5EIL A;  5CER B;  5KNH D;  3TWU A;  2AJA A;  3V30 A;  2BKK B;  5HRY A;  4HQD A;  4HBD A;  4HRL A;  3TWS A;  4LG6 A;  3ZKJ A;  4U8Y D;  3V2X A;  3T9K A;  1N0R A;  3HG0 D;  2QC9 A;  2XZT G;  5HKP A;  4U96 D;  5JA4 D;  4BEP A;  3NOC D;  2RFM A;  3W9G A;  4HI8 A;  2HE0 A;  1IHB A;  4DX7 D;  4HLL A;  3AJI A;  3T8K A;  1QYM A;  2ZGG A;  3TWV A;  3V31 A;  4O60 A;  3NOG D;  3NBN B;  3JUE A;  3J5P A;  5BXO A;  2V4H C;  5ITZ F;  4YDW A;  1BI7 B;  5CEC B;  1K3Z D;  5KWD A;  1N0Q A;  4DX5 D;  4CZ2 D;  3B95 A;  4DRX E;  3TWR A;  5AAR A;  5AAO A;  1YMP A;  3DEO A;  4K5A B;  1SW6 A;  4A63 B;  4BSZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...