1OCCE

Structure of bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
pubmed rcsb
molecule tags Oxidoreductase (cytochrome(c)-oxygen)
total genus 39
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1996-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1occE00
3ABLE 2Y69E 2EIME 2EIKE 5B1BE 1V54E 2OCCE 1OCCE 3ABME 3ASOE 1V55E 5B3SE 3AG1E 3AG2E 3ASNE 1OCRE 2EILE 3AG3E 3AG4E 5B1AE 1OCZE 3ABKE 3WG7E 2ZXWE 1OCOE 2DYRE 2EIJE 3X2QE 2EINE 2DYSE 5IY5E
chains in the Genus database with same CATH superfamily
4I1AA 4HXIA 4JB8P 4APFA 3FUFA 2AVPA 3Q49B 1JWFA 2CG3A 3JYSA 3FTYA 2WXPA 2MYOA 1N4SA 3ZHEB 2FEZA 5EIBE 5FZSA 3CHMA 4JHKA 4TV3A 3PH0C 4W9RA 5AYWD 4I1MA 4EZJA 4FJYA 2QY7A 3AAAC 2ZIRA 3ESKA 4LSZE 3C98A 2XCCA 4I9EA 4Q96A 1H2TC 4I6JA 2KXPC 3J5PA 5JJ7A 2KZTB 1QQEA 2P9PG 2VGEA 2KM4A 3UM0A 4JZYA 4G2VA 4I6GA 2IO3C 4AP2A 2H6GA 5FWQA 3PZ2A 3VLFA 2WXGA 2XHEA 1MJ0A 1Z5SC 5CEDB 3FTWA 5FQ6A 3G2VA 3FHEA 4XX5A 1OUVA 5FIOA 2V8SE 2HR2A 3PRZA 4H7XA 2FI7A 3HRAA 1U3CA 3AS4A 5E75A 4ILHB 1O1SA 2CG2A 3ULEG 3TWVA 4ILIA 1H6OA 1TJCA 1Z3YA 4MBGA 3PDNA 4GAAA 3APDA 3JXIA 2C0MA 3QWWA 4DJAA 3SO8A 3FU5A 4NRHB 1OCZE 3TG4A 4HRLA 3V2XA 3RSEG 2MHKA 2PQRA 4WWOA 2B0OE 3FEXA 4HS2A 4KVMA 3CGHA 3UIOC 3DXKG 2KZTA 5JHAA 1WAO1 5ARGA 4CDNA 2BKGA 2PM7A 3FULA 3MA5A 3DBSA 4OAVB 3D9KA 2WXFA 2KCVA 4CT0A 3C3OA 3ISMC 5CERB 3DSUA 4YDOA 3Q47B 4IN3B 3D9MA 5HS0A 3ZNGA 2KCLA 5AJLA 3CK7A 3BU8A 4ANWA 1ELWA 2IU1A 2WXNA 4A3TA 3ABKE 3LXUX 2XPIA 4GPMA 3PUKA 2WXJA 3CVWA 4LNGA 5T3RA 3PNTB 3Q75A 4D10C 3ASOE 4CRWA 3SI5A 4RSYA 1N0QA 3ZPJA 2VSOE 4TXRA 2IF4A 3Q5MA 3TGOA 3TWRA 2PL2A 3LVRE 4XZ4A 3JQ1A 3EU5A 3R7QA 2EIKE 5B1BE 3IKOB 4DLOA 2BEDA 4L23A 2B6CA 1DC2A 1E8ZA 3OAWA 2CHWA 2P9NG 2WXLA 3LY7A 1SZ9A 5ENSD 5FQ4A 2IFUA 3FUJA 5D0QD 5EYPF 4L2LA 4JHRA 4GMLA 3RRNB 2DWZA 3ZIMA 4MRUA 3T9KA 4HOSA 3PE3A 2Q7FA 2XRYA 3V31A 3I4RB 5G05J 1S64A 1KPSB 2KBXA 4G8LA 4WWPA 4RG6A 5M72A 5BV1A 4HRNA 4ZFHA 1SA5A 1Y8MA 5ANRA 5CMYA 1IYGA 3AG3E 3MKQB 1D8EA 5LOZA 1NP7A 4M7CA 5EX0A 3KEAA 5FINA 3CVYA 4HLEA 1N0RA 3U9WA 3L22A 3FU6A 2XGSA 2CHXA 4FHJA 2J09A 3J5QB 4TXQA 2FULA 3CVVA 4MKTA 3UKRG 1SQMA 3GZSA 3UM2A 2X6IA 2X6HA 1TN8A 2HO1A 4U95D 4OAUC 4BX9A 3Q9UC 3DEOA 4G11A 4J0UA 3B7SA 3IBEA 1HXIA 4LERA 4LEUA 3L6AA 1O5MA 4G8KA 3LS8A 4JHJA 4C0EA 1JCRA 4F53A 3L9TA 4A55A 5AARA 1KLXA 2ETBA 5G04C 1H2VC 4DI3A 2GRRB 3TAXA 2J07A 3G2SA 4GTTA 5D0OD 4AJWA 4N3CA 1S63A 2LNIA 5BXOA 3LJ3A 3L16A 4AXHA 1HX8A 4FA6A 3MKQA 4OVUA 3X2QE 5LFAA 3FTUA 3EUVA 1U3DA 2ZGGA 1INZA 3DSWA 4IULA 2IO2C 3NQPA 1MX4A 4Z68A 5A7DB 4JC8A 2OVBA 2YHEA 4B93B 4HBDA 4CT4A 1WG0A 2ETCA 2P58C 1YCSB 4M3OA 3B7TA 1L5JA 1OWPA 1ELKA 3CSTA 1OCCE 3GZ2A 1PC2A 5KCMA 5CECB 2XS8A 2FO1E 4X8QA 1H0AA 3FUNA 1EYHA 2V0PA 4ACKA 5ENRD 1HF8A 2VJ8A 1TN7A 2PQNA 4HVBA 4AY6A 3QC1A 4K5CA 4F3VA 1O1RA 3I4GA 2I2OA 1BI8B 3ASGA 1QYMA 1RW2A 4JD2G 2IOSA 4UI9K 2VSNA 3CK8A 4Q69A 1N11A 4N3AA 2QC9A 4BX8A 4UUCA 3EU9A 4IRUA 2LAHA 4DX2A 3EJNA 3V79K 2Y4UA 2XZTG 1HG5A 4U63A 2ILRA 1MQSA 1NL4A 3PEVB 1OT8A 4UI9C 2VYIA 3CSFA 3AS5A 1S0PA 4DLQA 1KZPA 4ME2A 3CHSA 3Q7AA 2VTBB 5CBNA 3FUIA 3I3NA 1XNFA 5B3SE 4KZ0A 3FH5A 3RRUA 1MX2A 1S70B 2IONA 4ATZD 3TG5A 1G3NB 3RO2A 1HS6A 2XQ0A 4GTRA 3UXGA 1TNBA 3LEWA 1HFAA 4JW1A 1N4PA 1UN8A 3DPYA 4YVOA 1A17A 3FUKA 1Y6IA 4G26A 5ENTD 2XENA 1FPPA 2L9BA 2CFUA 3FUEA 4N5CA 2A5UA 3VLEA 4TUUA 4URKA 3ZN3A 3ONLA 1HU3A 3RKVA 2DZNA 5KBAA 2QZAA 2GROB 2GRQB 4PH4B 1ZBPA 2F8YA 3MV2B 1HO8A 4XKCA 2KC7A 4C48B 3WG7E 5A23A 2IJGX 1ZU2A 2OV8A 1NA0A 3QB2A 2RFAA 2XCBA 5ARFA 3FY4A 2DIWA 1N4RA 4GTQA 4FLBA 2J9QA 2M63A 4TRQA 1NFIE 2AXUA 3UMVA 3E37A 4PS8A 2QYJA 4BEPA 1MZCA 1O1TA 3JUIA 3B7UX 5D2MC 4O6FA 3RAUA 2XGMA 3VLDA 2RKKA 3OXLA 1PY1A 2F37A 2I1JA 1BI7B 4FU3A 4I2ZA 3TWSA 1ZB1A 5C2YA 2EIME 5EDSA 3E4BA 4U04A 1D8DA 3MV3B 2NXPA 2J4BA 2VQ2A 2WXQA 5HI7A 2L6BA 3ZW3A 5AIJA 3CQCB 4BESA 4EECA 3ZYMA 1N94A 2I6HA 5EKQD 4U96D 3AG1E 3TJPA 2P9UG 3HVEB 5ENNA 3TWUA 4PUCA 4FJZA 2OOEA 4B8AA 3MEKA 4GTMA 3UX4A 2WXMA 2DVWA 4A63B 4O1PA 4EQFA 1UG3A 3Q78A 4GTOA 4AIFA 3RK6A 3CVXA 2BKKB 2L6JA 2F8XK 1TYQG 5E76A 1E8YA 3LY9A 4K5AB 5JMND 3ZHEA 2P9IG 3BEEA 2MOWA 4I43A 4R7LA 2BTDA 3TWQA 2WXIA 4ZHBA 4F6RD 3NAWA 2FO7A 3JQ0A 5CCLA 4GZCA 2IOLA 1FCHA 1UN9A 4APOA 2WQ6A 3FU3A 2WMOA 3FUHA 3G2WA 4GCNA 3LPZA 3URZA 4K5BA 4LRZA 3Q9NC 3DPDA 3ZXPA 1FT1A 4K03A 3EIJA 3LDZA 2VSXE 3VTYA 1LD7A 4N5QA 3HVEA 2R03A 5ITZF 1QNFA 2EINE 4EBAA 1LD8A 4BERA 3UKUG 2Y69E 4GU5A 3T5VA 5ANLA 1IKND 3SBTB 3S7JA 4QFVA 3SY2A 1HG2A 4XI0A 3ZU7B 3TWTA 4IYPA 3D9NA 4B94A 3AJIA 3S7BA 4JL0A 3HXCA 4HB5A 2IQCA 2E2EA 3L13A 2A4ZA 4UQYA 3CHRA 4U8HA 3Q4AB 2V4HC 1QBQA 3NF1A 2VSYA 1OXJA 1U2VG 3D9LA 4WNEA 1OWOA 2H6FA 3ULYA 4GZ6A 1UW4B 3IEGA 3OTNA 3TXMA 1E96B 4J8SA 3ZFWA 3PS6A 4L7TA 4CGWA 4OVVA 4GZ3A 4AM9A 3DEPA 2DYRE 4GTSA 3T8MA 5CBOA 2F0YA 4FLHA 3T5XA 4JA7A 4LNBA 2XPYA 4WNGA 4CDMA 5AQ7A 3BUAA 2JLBA 2WMNA 2H6IA 1MYOA 3PZ4A 4I9CA 3R9AB 3E30A 4E6HA 3JXJA 1E90A 4AVXA 5DBKA 5BNWA 1D9SA 4LCTA 3ASFA 4HOTA 3AG2E 3PEUB 3JUEA 3QDNA 4DPRA 2R05A 3TWXA 4J8DA 1PAQA 4AV7A 2RD0A 5FT9A 1HZ4A 3D9PA 4KVOA 4YNDA 5KNGA 4EZLA 5HKPA 2LSUA 3ZYLA 2XZDG 2J08A 3DSXA 4HI9A 2AW6A 1BU9A 3L54A 2XPZA 3ESLA 5JHBA 4RQIA 3FUDA 5BW8C 3HG0D 2XEVA 2YINA 4BTAA 4DK5A 4WAFA 1NZNA 2QFCA 1EF1C 1X81A 3DSTA 3T8KA 3QWPA 1TN6A 2X6FA 5AAOA 1FVHA 3SD5A 1K3ZD 1N54A 2WXKA 3HXBA 3IXEA 5C1DA 3SFZA 1VDYA 2GRNB 2XS1A 4B0ZA 5G05C 1JCQA 3MX3A 4BFRA 4EPZA 1K1AA 4WUYA 3ZGQA 3NZSA 1TNUA 4HI8A 4J7WA 4GB9A 3KSQA 3LJNA 2EILE 4WWNA 2L0IA 3Q7FA 3PZ3A 2E0IA 3EHMA 5LCWJ 2J8SD 4UI9J 3CR3A 2HYZA 1LF8A 2DZOA 2DYSE 2NSZA 2OVFA 3NB2A 5JA4D 1DCEA 3ZKJA 3IHYA 4U8VD 2ETAA 3ASNE 4U07A 3QWVA 2OEVA 2VGYA 3RJVA 4GMJA 4ATGA 1UJKA 3ML9A 3LKUA 4HRMB 4NURA 3LYAA 3FTZA 3EHRA 4RVBA 5BV0A 5CCMA 4UWFA 2WQ7A 2JABA 1KT1A 3UTMA 3UT8A 4E85A 1Z6TA 4TUMA 4NQ0A 2ZGDA 2P9LG 3UPVA 1JUQA 3CEQA 4GA0A 3UQ3A 3EHNA 3CVNA 4BT8A 4DX5D 4F7AA 4UQXA 3LCAA 3V2OA 3AS8A 2R59A 2GRLA 1GW6A 4GMRA 2IY0C 3P1UA 3UT7A 5LX8A 3FTSA 3UINC 1HH8A 1Z3XA 4P29A 4BETA 3FUMA 3SFYA 5EILA 1BD8A 3NBNB 2A5EA 3ENEA 4XE0A 2R02A 3S7FA 4N39A 5AENA 5A6CA 3CV0A 4J8FA 1FT2A 2V5QC 3FEYA 3O4ZA 4I2WA 4U0ZA 2ONDA 1IHGA 4C9BB 1TJFA 3BG0B 4AEZC 1V54E 3ZRHA 3ABME 1KT0A 3FH7A 3VTXA 3C3QA 3P2BA 2FF4A 1NA3A 2BUGA 3FDHA 3Q15A 1Q2ZA 3CVPA 2WB2A 3DSVA 4N2SA 3KAEA 4GYWA 3FU0A 4LNUD 3G2TA 3CKCA 3L17A 2AXZA 2QYUA 5HRYA 5EX3A 2LXLA 4CZ2D 1SW6A 4B89A 4JA9A 2DCPA 1K1BA 2NYJA 3ZEFA 4ANVA 5FZRA 3D9OA 2J4DA 3E34A 1OWLA 4HOQA 2I9CA 3B7BA 3CHPA 3U4TA 3EHQA 3SF4A 1MHQA 2VTBA 1H6PA 2LXMA 4GTVA 4MLPA 4KZCA 1E8XA 3FFLA 4GZDA 1BLXB 4GYYA 5ENOD 4YDWA 3SBSA 2WVIA 2OCCE 3QOUA 4LUNU 3UT4A 3FP3A 4U0SA 4DUIA 4J6IA 3K9IA 2KATA 1AWCB 2BF0X 2J49A 3CHQA 4JXTA 1IQUA 3PE4A 2WXRA 2AWIA 5CRUA 3CK9A 4KYOB 5FTPA 1EDUA 4DRXE 4Y6CA 4NACA 3KSLA 2XGOA 3PNLB 4BSZB 3W9GA 3S7DA 5G2NA 3FWVA 2X3MA 4EBAG 4EZKA 2Y1LE 4ANUA 2EQXA 2YHCA 3BQOA 3S2AA 3CVQA 4A3VA 3R9MA 3U64A 2WPVA 4YDYA 2VGXB 1IHBA 1UJJA 4FP7A 3E33A 4Y6WA 3ZYQA 3BG1B 3KD7A 4EHMA 5KWDA 4UWHA 1E7UA 1IXVA 3HXEA 4WNFA 4UWLA 2I1KA 3CLJA 1K8KG 4KT6B 3SQVA 5KJNA 2XEEA 5FQ7A 4FADA 4DX7D 4N2QA 2R2LA 2PZIA 3ZUVB 2ZXWE 4CCAA 2GRPB 3MGBA 4G25A 4U0UA 3MZLB 3MYVA 4FULA 4CYMD 5IY5E 1FVFA 4JEUA 1H6KA 3FTVA 3HXDA 5B1AE 3B7RL 4PS3A 2WQHA 1OCOE 1B89A 2LUHA 3GW4A 4U8YD 4U7EB 4UWKA 3OXFA 4UWGA 4F1SA 4O60A 2V5FA 1YYHA 5CEAA 3NOGD 1A5EA 1E8WA 5FQ8A 2IEJA 2VGXA 1MX6A 3AG4E 4HQDA 4ACLA 4L9PA 3PREA 4ILGA 3NZUA 3G2UA 3F6QA 4FC8A 3JCKC 3UM3A 1TEZA 2YQ8A 3V30A 4AOFA 3MKRA 4XEIG 4KXKB 4FHKA 3PZ1A 2P9SG 5FZQA 3KEZA 3HXFA 1AP7A 4G23A 5JJ6A 2GGFA 1SA4A 4ANXA 3DXMG 1X5BA 3IV0A 5HQ8A 3PUJA 5ENPD 3QAQA 4V3IA 3TXNA 3C3RA 4HORA 1KZOA 4H7YA 2C0LA 5AQAA 5DIZA 2UY1B 5FJYA 4J8EA 3MCXA 1JCSA 3C72A 2WXHA 2XRZA 3FH8A 1HE8A 2AJAA 2AXVA 1TNOA 3ZYKA 3RU0A 3DRAA 4I6EA 4O1OA 3HIZA 4BT9A 1JPLA 5G04J 4B8CB 3UUXA 3HYMB 5G55A 4HNAD 2ZU6B 1W3BA 1XGWA 3UI2A 2MRIA 5LP0A 3MJWA 4GCOA 3AU5A 3ASDA 4DX1A 4TXPA 3EIQC 2HE0A 1DCQA 3PZDA 5H7PA 1OCRE 4A1SA 3QARA 5AQBA 4LG6A 4F1PA 4BTBA 2FBNA 4GA2A 3LVQE 5D66A 3EDTB 5KJMA 2Y0BG 3Q73A 1SZAA 2JEKA 2R5SA 2X6KA 3N71A 3SGHA 2UY1A 3O48A 5KNHD 3D9HA 3OXGA 4RG9A 5AN8A 2P9KG 1N52A 3Q79A 5J08A 3B95A 3I5PA 1WY6A 4BWRA 3D9IA 4ABNA 3DWLG 4Q94A 3AU4A 5EYLA 4AY5A 1ELRA 3FTXA 4GYOA 1TNZA 5EN5D 3PVLA 2WXOA 3SFXA 1IQRA 4A1GA 2GRMA 4I17A 4GA1A 2C2LA 3RIBA 3R7RA 4CGVA 4CEMA 5CMWA 4QQIA 3CVLA 2UWJG 2YNQA 1EPUA 4PS7A 5AQ9A 4G24A 5BPPA 1QZ2A 1N4QA 3TL5A 3B13A 3CHOA 3CVUA 3DSSA 1NI1A 2X6JA 3SZ7A 2DBAA 4HLLA 5J90A 5BT1A 5CHEE 3L08A 5KJLA 2L0TB 4XI9A 1E7VA 2HM8A 3SHFA 2RG8A 5BUZA 1UOHA 2NC9A 5T8IA 4GPKA 4BY6A 3ZXSA 1DNPA 4L1BA 1TR4A 5CRVA 4CDRA 3CKBA 2ZISA 5BXUA 3UIPC 4G1TA 2LSVA 2Y3AA 1OWNA 3D9JA 4J8YA 4NIKA 4PDXA 4OYSA 1WDYA 4GZ5A 5KJKA 2CFZA 1TNYA 1YA0A 5AJDA 3RO3A 3QK0A 4KMOA 3C5RA 4HFGA 3W9FA 3ASHA 4UQZA 4DI4A 1SVXA 3GZ1A 4KBQA 1YMPA 2RFMA 4XIFA 3U66A 3U3WA 3RRMB 2KCKA 4YVQC 3UM1A 2PNNA 5ENQD 3ABLE 4N3BA 3ML8A 3D3MA 3HHMA 5EIDA 2PM6A 5LCWC 4BSXA 4XKBA 3HDXA 2OEWA 3APFA 1H2UA 4GTPA 1WM5A 4HOUA 2Y4TA 3E32A 3WXXA 1RZ4A 3ZVVA 2V4LA 2X38A 3GYZA 4JPSA 2EIJE 3APCA 4WNDA 1H19A 5T4YA 4K0RA 3CIAA 1DVPA 1LTXA 3QJZA 5JJTA 4YDEA 1JWGA 1P5QA 3ONKA 1N9AA 1OY3D 2LO6A 4JEHA 3L82A 4C0MA 3NOCD 3KS2A 1OWMA 4DX6D 2H6HA 3IHVA 1BPOA 2P2CP 4I1OB 3ULQA 1V55E 4RLYA 3SNXA 2CHZA 3QKYA 3QNKA 2WM9A 3TWWA 4L2YA 3LY8A 2LAIA 1N95A 2XEHA 4JVSA 2GW1A 3CQGB 2R17C 4MS6A
chains in the Genus database with same CATH topology
3ABLE 2Y69E 2EIME 2EIKE 5B1BE 1V54E 2OCCE 1OCCE 3ABME 3ASOE 1V55E 5B3SE 3AG1E 3AG2E 3ASNE 1OCRE 2EILE 3AG3E 3AG4E 5B1AE 1OCZE 3ABKE 3WG7E 2ZXWE 1OCOE 2DYRE 2EIJE 3X2QE 2EINE 2DYSE 5IY5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABL E;  2Y69 E;  2EIM E;  2EIK E;  5B1B E;  1V54 E;  2OCC E;  1OCC E;  3ABM E;  3ASO E;  1V55 E;  5B3S E;  3AG1 E;  3AG2 E;  3ASN E;  1OCR E;  2EIL E;  3AG3 E;  3AG4 E;  5B1A E;  1OCZ E;  3ABK E;  3WG7 E;  2ZXW E;  1OCO E;  2DYR E;  2EIJ E;  3X2Q E;  2EIN E;  2DYS E;  5IY5 E; 
#chains in the Genus database with same CATH topology
 4I1A A;  4HXI A;  4JB8 P;  4APF A;  3FUF A;  2AVP A;  3Q49 B;  1JWF A;  2CG3 A;  3JYS A;  3FTY A;  2WXP A;  2MYO A;  1N4S A;  3ZHE B;  2FEZ A;  5EIB E;  5FZS A;  3CHM A;  4JHK A;  4TV3 A;  3PH0 C;  4W9R A;  5AYW D;  4I1M A;  4EZJ A;  4FJY A;  2QY7 A;  3AAA C;  2ZIR A;  3ESK A;  4LSZ E;  3C98 A;  2XCC A;  4I9E A;  4Q96 A;  1H2T C;  4I6J A;  2KXP C;  3J5P A;  5JJ7 A;  2KZT B;  1QQE A;  2P9P G;  2VGE A;  2KM4 A;  3UM0 A;  4JZY A;  4G2V A;  4I6G A;  2IO3 C;  4AP2 A;  2H6G A;  5FWQ A;  3PZ2 A;  3VLF A;  2WXG A;  2XHE A;  1MJ0 A;  1Z5S C;  5CED B;  3FTW A;  5FQ6 A;  3G2V A;  3FHE A;  4XX5 A;  1OUV A;  5FIO A;  2V8S E;  2HR2 A;  3PRZ A;  4H7X A;  2FI7 A;  3HRA A;  1U3C A;  3AS4 A;  5E75 A;  4ILH B;  1O1S A;  2CG2 A;  3ULE G;  3TWV A;  4ILI A;  1H6O A;  1TJC A;  1Z3Y A;  4MBG A;  3PDN A;  4GAA A;  3APD A;  3JXI A;  2C0M A;  3QWW A;  4DJA A;  3SO8 A;  3FU5 A;  4NRH B;  1OCZ E;  3TG4 A;  4HRL A;  3V2X A;  3RSE G;  2MHK A;  2PQR A;  4WWO A;  2B0O E;  3FEX A;  4HS2 A;  4KVM A;  3CGH A;  3UIO C;  3DXK G;  2KZT A;  5JHA A;  1WAO 1;  5ARG A;  4CDN A;  2BKG A;  2PM7 A;  3FUL A;  3MA5 A;  3DBS A;  4OAV B;  3D9K A;  2WXF A;  2KCV A;  4CT0 A;  3C3O A;  3ISM C;  5CER B;  3DSU A;  4YDO A;  3Q47 B;  4IN3 B;  3D9M A;  5HS0 A;  3ZNG A;  2KCL A;  5AJL A;  3CK7 A;  3BU8 A;  4ANW A;  1ELW A;  2IU1 A;  2WXN A;  4A3T A;  3ABK E;  3LXU X;  2XPI A;  4GPM A;  3PUK A;  2WXJ A;  3CVW A;  4LNG A;  5T3R A;  3PNT B;  3Q75 A;  4D10 C;  3ASO E;  4CRW A;  3SI5 A;  4RSY A;  1N0Q A;  3ZPJ A;  2VSO E;  4TXR A;  2IF4 A;  3Q5M A;  3TGO A;  3TWR A;  2PL2 A;  3LVR E;  4XZ4 A;  3JQ1 A;  3EU5 A;  3R7Q A;  2EIK E;  5B1B E;  3IKO B;  4DLO A;  2BED A;  4L23 A;  2B6C A;  1DC2 A;  1E8Z A;  3OAW A;  2CHW A;  2P9N G;  2WXL A;  3LY7 A;  1SZ9 A;  5ENS D;  5FQ4 A;  2IFU A;  3FUJ A;  5D0Q D;  5EYP F;  4L2L A;  4JHR A;  4GML A;  3RRN B;  2DWZ A;  3ZIM A;  4MRU A;  3T9K A;  4HOS A;  3PE3 A;  2Q7F A;  2XRY A;  3V31 A;  3I4R B;  5G05 J;  1S64 A;  1KPS B;  2KBX A;  4G8L A;  4WWP A;  4RG6 A;  5M72 A;  5BV1 A;  4HRN A;  4ZFH A;  1SA5 A;  1Y8M A;  5ANR A;  5CMY A;  1IYG A;  3AG3 E;  3MKQ B;  1D8E A;  5LOZ A;  1NP7 A;  4M7C A;  5EX0 A;  3KEA A;  5FIN A;  3CVY A;  4HLE A;  1N0R A;  3U9W A;  3L22 A;  3FU6 A;  2XGS A;  2CHX A;  4FHJ A;  2J09 A;  3J5Q B;  4TXQ A;  2FUL A;  3CVV A;  4MKT A;  3UKR G;  1SQM A;  3GZS A;  3UM2 A;  2X6I A;  2X6H A;  1TN8 A;  2HO1 A;  4U95 D;  4OAU C;  4BX9 A;  3Q9U C;  3DEO A;  4G11 A;  4J0U A;  3B7S A;  3IBE A;  1HXI A;  4LER A;  4LEU A;  3L6A A;  1O5M A;  4G8K A;  3LS8 A;  4JHJ A;  4C0E A;  1JCR A;  4F53 A;  3L9T A;  4A55 A;  5AAR A;  1KLX A;  2ETB A;  5G04 C;  1H2V C;  4DI3 A;  2GRR B;  3TAX A;  2J07 A;  3G2S A;  4GTT A;  5D0O D;  4AJW A;  4N3C A;  1S63 A;  2LNI A;  5BXO A;  3LJ3 A;  3L16 A;  4AXH A;  1HX8 A;  4FA6 A;  3MKQ A;  4OVU A;  3X2Q E;  5LFA A;  3FTU A;  3EUV A;  1U3D A;  2ZGG A;  1INZ A;  3DSW A;  4IUL A;  2IO2 C;  3NQP A;  1MX4 A;  4Z68 A;  5A7D B;  4JC8 A;  2OVB A;  2YHE A;  4B93 B;  4HBD A;  4CT4 A;  1WG0 A;  2ETC A;  2P58 C;  1YCS B;  4M3O A;  3B7T A;  1L5J A;  1OWP A;  1ELK A;  3CST A;  1OCC E;  3GZ2 A;  1PC2 A;  5KCM A;  5CEC B;  2XS8 A;  2FO1 E;  4X8Q A;  1H0A A;  3FUN A;  1EYH A;  2V0P A;  4ACK A;  5ENR D;  1HF8 A;  2VJ8 A;  1TN7 A;  2PQN A;  4HVB A;  4AY6 A;  3QC1 A;  4K5C A;  4F3V A;  1O1R A;  3I4G A;  2I2O A;  1BI8 B;  3ASG A;  1QYM A;  1RW2 A;  4JD2 G;  2IOS A;  4UI9 K;  2VSN A;  3CK8 A;  4Q69 A;  1N11 A;  4N3A A;  2QC9 A;  4BX8 A;  4UUC A;  3EU9 A;  4IRU A;  2LAH A;  4DX2 A;  3EJN A;  3V79 K;  2Y4U A;  2XZT G;  1HG5 A;  4U63 A;  2ILR A;  1MQS A;  1NL4 A;  3PEV B;  1OT8 A;  4UI9 C;  2VYI A;  3CSF A;  3AS5 A;  1S0P A;  4DLQ A;  1KZP A;  4ME2 A;  3CHS A;  3Q7A A;  2VTB B;  5CBN A;  3FUI A;  3I3N A;  1XNF A;  5B3S E;  4KZ0 A;  3FH5 A;  3RRU A;  1MX2 A;  1S70 B;  2ION A;  4ATZ D;  3TG5 A;  1G3N B;  3RO2 A;  1HS6 A;  2XQ0 A;  4GTR A;  3UXG A;  1TNB A;  3LEW A;  1HFA A;  4JW1 A;  1N4P A;  1UN8 A;  3DPY A;  4YVO A;  1A17 A;  3FUK A;  1Y6I A;  4G26 A;  5ENT D;  2XEN A;  1FPP A;  2L9B A;  2CFU A;  3FUE A;  4N5C A;  2A5U A;  3VLE A;  4TUU A;  4URK A;  3ZN3 A;  3ONL A;  1HU3 A;  3RKV A;  2DZN A;  5KBA A;  2QZA A;  2GRO B;  2GRQ B;  4PH4 B;  1ZBP A;  2F8Y A;  3MV2 B;  1HO8 A;  4XKC A;  2KC7 A;  4C48 B;  3WG7 E;  5A23 A;  2IJG X;  1ZU2 A;  2OV8 A;  1NA0 A;  3QB2 A;  2RFA A;  2XCB A;  5ARF A;  3FY4 A;  2DIW A;  1N4R A;  4GTQ A;  4FLB A;  2J9Q A;  2M63 A;  4TRQ A;  1NFI E;  2AXU A;  3UMV A;  3E37 A;  4PS8 A;  2QYJ A;  4BEP A;  1MZC A;  1O1T A;  3JUI A;  3B7U X;  5D2M C;  4O6F A;  3RAU A;  2XGM A;  3VLD A;  2RKK A;  3OXL A;  1PY1 A;  2F37 A;  2I1J A;  1BI7 B;  4FU3 A;  4I2Z A;  3TWS A;  1ZB1 A;  5C2Y A;  2EIM E;  5EDS A;  3E4B A;  4U04 A;  1D8D A;  3MV3 B;  2NXP A;  2J4B A;  2VQ2 A;  2WXQ A;  5HI7 A;  2L6B A;  3ZW3 A;  5AIJ A;  3CQC B;  4BES A;  4EEC A;  3ZYM A;  1N94 A;  2I6H A;  5EKQ D;  4U96 D;  3AG1 E;  3TJP A;  2P9U G;  3HVE B;  5ENN A;  3TWU A;  4PUC A;  4FJZ A;  2OOE A;  4B8A A;  3MEK A;  4GTM A;  3UX4 A;  2WXM A;  2DVW A;  4A63 B;  4O1P A;  4EQF A;  1UG3 A;  3Q78 A;  4GTO A;  4AIF A;  3RK6 A;  3CVX A;  2BKK B;  2L6J A;  2F8X K;  1TYQ G;  5E76 A;  1E8Y A;  3LY9 A;  4K5A B;  5JMN D;  3ZHE A;  2P9I G;  3BEE A;  2MOW A;  4I43 A;  4R7L A;  2BTD A;  3TWQ A;  2WXI A;  4ZHB A;  4F6R D;  3NAW A;  2FO7 A;  3JQ0 A;  5CCL A;  4GZC A;  2IOL A;  1FCH A;  1UN9 A;  4APO A;  2WQ6 A;  3FU3 A;  2WMO A;  3FUH A;  3G2W A;  4GCN A;  3LPZ A;  3URZ A;  4K5B A;  4LRZ A;  3Q9N C;  3DPD A;  3ZXP A;  1FT1 A;  4K03 A;  3EIJ A;  3LDZ A;  2VSX E;  3VTY A;  1LD7 A;  4N5Q A;  3HVE A;  2R03 A;  5ITZ F;  1QNF A;  2EIN E;  4EBA A;  1LD8 A;  4BER A;  3UKU G;  2Y69 E;  4GU5 A;  3T5V A;  5ANL A;  1IKN D;  3SBT B;  3S7J A;  4QFV A;  3SY2 A;  1HG2 A;  4XI0 A;  3ZU7 B;  3TWT A;  4IYP A;  3D9N A;  4B94 A;  3AJI A;  3S7B A;  4JL0 A;  3HXC A;  4HB5 A;  2IQC A;  2E2E A;  3L13 A;  2A4Z A;  4UQY A;  3CHR A;  4U8H A;  3Q4A B;  2V4H C;  1QBQ A;  3NF1 A;  2VSY A;  1OXJ A;  1U2V G;  3D9L A;  4WNE A;  1OWO A;  2H6F A;  3ULY A;  4GZ6 A;  1UW4 B;  3IEG A;  3OTN A;  3TXM A;  1E96 B;  4J8S A;  3ZFW A;  3PS6 A;  4L7T A;  4CGW A;  4OVV A;  4GZ3 A;  4AM9 A;  3DEP A;  2DYR E;  4GTS A;  3T8M A;  5CBO A;  2F0Y A;  4FLH A;  3T5X A;  4JA7 A;  4LNB A;  2XPY A;  4WNG A;  4CDM A;  5AQ7 A;  3BUA A;  2JLB A;  2WMN A;  2H6I A;  1MYO A;  3PZ4 A;  4I9C A;  3R9A B;  3E30 A;  4E6H A;  3JXJ A;  1E90 A;  4AVX A;  5DBK A;  5BNW A;  1D9S A;  4LCT A;  3ASF A;  4HOT A;  3AG2 E;  3PEU B;  3JUE A;  3QDN A;  4DPR A;  2R05 A;  3TWX A;  4J8D A;  1PAQ A;  4AV7 A;  2RD0 A;  5FT9 A;  1HZ4 A;  3D9P A;  4KVO A;  4YND A;  5KNG A;  4EZL A;  5HKP A;  2LSU A;  3ZYL A;  2XZD G;  2J08 A;  3DSX A;  4HI9 A;  2AW6 A;  1BU9 A;  3L54 A;  2XPZ A;  3ESL A;  5JHB A;  4RQI A;  3FUD A;  5BW8 C;  3HG0 D;  2XEV A;  2YIN A;  4BTA A;  4DK5 A;  4WAF A;  1NZN A;  2QFC A;  1EF1 C;  1X81 A;  3DST A;  3T8K A;  3QWP A;  1TN6 A;  2X6F A;  5AAO A;  1FVH A;  3SD5 A;  1K3Z D;  1N54 A;  2WXK A;  3HXB A;  3IXE A;  5C1D A;  3SFZ A;  1VDY A;  2GRN B;  2XS1 A;  4B0Z A;  5G05 C;  1JCQ A;  3MX3 A;  4BFR A;  4EPZ A;  1K1A A;  4WUY A;  3ZGQ A;  3NZS A;  1TNU A;  4HI8 A;  4J7W A;  4GB9 A;  3KSQ A;  3LJN A;  2EIL E;  4WWN A;  2L0I A;  3Q7F A;  3PZ3 A;  2E0I A;  3EHM A;  5LCW J;  2J8S D;  4UI9 J;  3CR3 A;  2HYZ A;  1LF8 A;  2DZO A;  2DYS E;  2NSZ A;  2OVF A;  3NB2 A;  5JA4 D;  1DCE A;  3ZKJ A;  3IHY A;  4U8V D;  2ETA A;  3ASN E;  4U07 A;  3QWV A;  2OEV A;  2VGY A;  3RJV A;  4GMJ A;  4ATG A;  1UJK A;  3ML9 A;  3LKU A;  4HRM B;  4NUR A;  3LYA A;  3FTZ A;  3EHR A;  4RVB A;  5BV0 A;  5CCM A;  4UWF A;  2WQ7 A;  2JAB A;  1KT1 A;  3UTM A;  3UT8 A;  4E85 A;  1Z6T A;  4TUM A;  4NQ0 A;  2ZGD A;  2P9L G;  3UPV A;  1JUQ A;  3CEQ A;  4GA0 A;  3UQ3 A;  3EHN A;  3CVN A;  4BT8 A;  4DX5 D;  4F7A A;  4UQX A;  3LCA A;  3V2O A;  3AS8 A;  2R59 A;  2GRL A;  1GW6 A;  4GMR A;  2IY0 C;  3P1U A;  3UT7 A;  5LX8 A;  3FTS A;  3UIN C;  1HH8 A;  1Z3X A;  4P29 A;  4BET A;  3FUM A;  3SFY A;  5EIL A;  1BD8 A;  3NBN B;  2A5E A;  3ENE A;  4XE0 A;  2R02 A;  3S7F A;  4N39 A;  5AEN A;  5A6C A;  3CV0 A;  4J8F A;  1FT2 A;  2V5Q C;  3FEY A;  3O4Z A;  4I2W A;  4U0Z A;  2OND A;  1IHG A;  4C9B B;  1TJF A;  3BG0 B;  4AEZ C;  1V54 E;  3ZRH A;  3ABM E;  1KT0 A;  3FH7 A;  3VTX A;  3C3Q A;  3P2B A;  2FF4 A;  1NA3 A;  2BUG A;  3FDH A;  3Q15 A;  1Q2Z A;  3CVP A;  2WB2 A;  3DSV A;  4N2S A;  3KAE A;  4GYW A;  3FU0 A;  4LNU D;  3G2T A;  3CKC A;  3L17 A;  2AXZ A;  2QYU A;  5HRY A;  5EX3 A;  2LXL A;  4CZ2 D;  1SW6 A;  4B89 A;  4JA9 A;  2DCP A;  1K1B A;  2NYJ A;  3ZEF A;  4ANV A;  5FZR A;  3D9O A;  2J4D A;  3E34 A;  1OWL A;  4HOQ A;  2I9C A;  3B7B A;  3CHP A;  3U4T A;  3EHQ A;  3SF4 A;  1MHQ A;  2VTB A;  1H6P A;  2LXM A;  4GTV A;  4MLP A;  4KZC A;  1E8X A;  3FFL A;  4GZD A;  1BLX B;  4GYY A;  5ENO D;  4YDW A;  3SBS A;  2WVI A;  2OCC E;  3QOU A;  4LUN U;  3UT4 A;  3FP3 A;  4U0S A;  4DUI A;  4J6I A;  3K9I A;  2KAT A;  1AWC B;  2BF0 X;  2J49 A;  3CHQ A;  4JXT A;  1IQU A;  3PE4 A;  2WXR A;  2AWI A;  5CRU A;  3CK9 A;  4KYO B;  5FTP A;  1EDU A;  4DRX E;  4Y6C A;  4NAC A;  3KSL A;  2XGO A;  3PNL B;  4BSZ B;  3W9G A;  3S7D A;  5G2N A;  3FWV A;  2X3M A;  4EBA G;  4EZK A;  2Y1L E;  4ANU A;  2EQX A;  2YHC A;  3BQO A;  3S2A A;  3CVQ A;  4A3V A;  3R9M A;  3U64 A;  2WPV A;  4YDY A;  2VGX B;  1IHB A;  1UJJ A;  4FP7 A;  3E33 A;  4Y6W A;  3ZYQ A;  3BG1 B;  3KD7 A;  4EHM A;  5KWD A;  4UWH A;  1E7U A;  1IXV A;  3HXE A;  4WNF A;  4UWL A;  2I1K A;  3CLJ A;  1K8K G;  4KT6 B;  3SQV A;  5KJN A;  2XEE A;  5FQ7 A;  4FAD A;  4DX7 D;  4N2Q A;  2R2L A;  2PZI A;  3ZUV B;  2ZXW E;  4CCA A;  2GRP B;  3MGB A;  4G25 A;  4U0U A;  3MZL B;  3MYV A;  4FUL A;  4CYM D;  5IY5 E;  1FVF A;  4JEU A;  1H6K A;  3FTV A;  3HXD A;  5B1A E;  3B7R L;  4PS3 A;  2WQH A;  1OCO E;  1B89 A;  2LUH A;  3GW4 A;  4U8Y D;  4U7E B;  4UWK A;  3OXF A;  4UWG A;  4F1S A;  4O60 A;  2V5F A;  1YYH A;  5CEA A;  3NOG D;  1A5E A;  1E8W A;  5FQ8 A;  2IEJ A;  2VGX A;  1MX6 A;  3AG4 E;  4HQD A;  4ACL A;  4L9P A;  3PRE A;  4ILG A;  3NZU A;  3G2U A;  3F6Q A;  4FC8 A;  3JCK C;  3UM3 A;  1TEZ A;  2YQ8 A;  3V30 A;  4AOF A;  3MKR A;  4XEI G;  4KXK B;  4FHK A;  3PZ1 A;  2P9S G;  5FZQ A;  3KEZ A;  3HXF A;  1AP7 A;  4G23 A;  5JJ6 A;  2GGF A;  1SA4 A;  4ANX A;  3DXM G;  1X5B A;  3IV0 A;  5HQ8 A;  3PUJ A;  5ENP D;  3QAQ A;  4V3I A;  3TXN A;  3C3R A;  4HOR A;  1KZO A;  4H7Y A;  2C0L A;  5AQA A;  5DIZ A;  2UY1 B;  5FJY A;  4J8E A;  3MCX A;  1JCS A;  3C72 A;  2WXH A;  2XRZ A;  3FH8 A;  1HE8 A;  2AJA A;  2AXV A;  1TNO A;  3ZYK A;  3RU0 A;  3DRA A;  4I6E A;  4O1O A;  3HIZ A;  4BT9 A;  1JPL A;  5G04 J;  4B8C B;  3UUX A;  3HYM B;  5G55 A;  4HNA D;  2ZU6 B;  1W3B A;  1XGW A;  3UI2 A;  2MRI A;  5LP0 A;  3MJW A;  4GCO A;  3AU5 A;  3ASD A;  4DX1 A;  4TXP A;  3EIQ C;  2HE0 A;  1DCQ A;  3PZD A;  5H7P A;  1OCR E;  4A1S A;  3QAR A;  5AQB A;  4LG6 A;  4F1P A;  4BTB A;  2FBN A;  4GA2 A;  3LVQ E;  5D66 A;  3EDT B;  5KJM A;  2Y0B G;  3Q73 A;  1SZA A;  2JEK A;  2R5S A;  2X6K A;  3N71 A;  3SGH A;  2UY1 A;  3O48 A;  5KNH D;  3D9H A;  3OXG A;  4RG9 A;  5AN8 A;  2P9K G;  1N52 A;  3Q79 A;  5J08 A;  3B95 A;  3I5P A;  1WY6 A;  4BWR A;  3D9I A;  4ABN A;  3DWL G;  4Q94 A;  3AU4 A;  5EYL A;  4AY5 A;  1ELR A;  3FTX A;  4GYO A;  1TNZ A;  5EN5 D;  3PVL A;  2WXO A;  3SFX A;  1IQR A;  4A1G A;  2GRM A;  4I17 A;  4GA1 A;  2C2L A;  3RIB A;  3R7R A;  4CGV A;  4CEM A;  5CMW A;  4QQI A;  3CVL A;  2UWJ G;  2YNQ A;  1EPU A;  4PS7 A;  5AQ9 A;  4G24 A;  5BPP A;  1QZ2 A;  1N4Q A;  3TL5 A;  3B13 A;  3CHO A;  3CVU A;  3DSS A;  1NI1 A;  2X6J A;  3SZ7 A;  2DBA A;  4HLL A;  5J90 A;  5BT1 A;  5CHE E;  3L08 A;  5KJL A;  2L0T B;  4XI9 A;  1E7V A;  2HM8 A;  3SHF A;  2RG8 A;  5BUZ A;  1UOH A;  2NC9 A;  5T8I A;  4GPK A;  4BY6 A;  3ZXS A;  1DNP A;  4L1B A;  1TR4 A;  5CRV A;  4CDR A;  3CKB A;  2ZIS A;  5BXU A;  3UIP C;  4G1T A;  2LSV A;  2Y3A A;  1OWN A;  3D9J A;  4J8Y A;  4NIK A;  4PDX A;  4OYS A;  1WDY A;  4GZ5 A;  5KJK A;  2CFZ A;  1TNY A;  1YA0 A;  5AJD A;  3RO3 A;  3QK0 A;  4KMO A;  3C5R A;  4HFG A;  3W9F A;  3ASH A;  4UQZ A;  4DI4 A;  1SVX A;  3GZ1 A;  4KBQ A;  1YMP A;  2RFM A;  4XIF A;  3U66 A;  3U3W A;  3RRM B;  2KCK A;  4YVQ C;  3UM1 A;  2PNN A;  5ENQ D;  3ABL E;  4N3B A;  3ML8 A;  3D3M A;  3HHM A;  5EID A;  2PM6 A;  5LCW C;  4BSX A;  4XKB A;  3HDX A;  2OEW A;  3APF A;  1H2U A;  4GTP A;  1WM5 A;  4HOU A;  2Y4T A;  3E32 A;  3WXX A;  1RZ4 A;  3ZVV A;  2V4L A;  2X38 A;  3GYZ A;  4JPS A;  2EIJ E;  3APC A;  4WND A;  1H19 A;  5T4Y A;  4K0R A;  3CIA A;  1DVP A;  1LTX A;  3QJZ A;  5JJT A;  4YDE A;  1JWG A;  1P5Q A;  3ONK A;  1N9A A;  1OY3 D;  2LO6 A;  4JEH A;  3L82 A;  4C0M A;  3NOC D;  3KS2 A;  1OWM A;  4DX6 D;  2H6H A;  3IHV A;  1BPO A;  2P2C P;  4I1O B;  3ULQ A;  1V55 E;  4RLY A;  3SNX A;  2CHZ A;  3QKY A;  3QNK A;  2WM9 A;  3TWW A;  4L2Y A;  3LY8 A;  2LAI A;  1N95 A;  2XEH A;  4JVS A;  2GW1 A;  3CQG B;  2R17 C;  4MS6 A; 
#chains in the Genus database with same CATH homology
 3ABL E;  2Y69 E;  2EIM E;  2EIK E;  5B1B E;  1V54 E;  2OCC E;  1OCC E;  3ABM E;  3ASO E;  1V55 E;  5B3S E;  3AG1 E;  3AG2 E;  3ASN E;  1OCR E;  2EIL E;  3AG3 E;  3AG4 E;  5B1A E;  1OCZ E;  3ABK E;  3WG7 E;  2ZXW E;  1OCO E;  2DYR E;  2EIJ E;  3X2Q E;  2EIN E;  2DYS E;  5IY5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...