1OCCE

Structure of bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE
publication title The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
pubmed rcsb
molecule tags Oxidoreductase (cytochrome(c)-oxygen)
total genus 39
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1996-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1occE00
2OCCE 3AG4E 5B1AE 3ABKE 2ZXWE 5B1BE 2DYRE 2EIJE 2EILE 1V54E 5IY5E 3AG2E 3ABME 3ASNE 3ABLE 2EIME 1OCCE 1OCRE 1V55E 2Y69E 1OCZE 3WG7E 3AG3E 3X2QE 5B3SE 2DYSE 1OCOE 2EIKE 3AG1E 3ASOE 2EINE
chains in the Genus database with same CATH superfamily
3DXMG 3ULEG 2V8SE 3ESLA 2C0LA 3CIAA 2LXMA 3LJNA 4KYOB 1H2UA 3APDA 3HIZA 4GZDA 3CEQA 3V79K 2E0IA 3Q15A 4YVQC 2KATA 1OWMA 3FUEA 3TG5A 3KEZA 2VTBB 3UUXA 3V2XA 4BESA 1LTXA 2WXKA 4K0RA 2MHKA 5JMND 2IO2C 2ETBA 4RQIA 5KJNA 3QKYA 3RRNB 3ZPJA 1DVPA 4UQXA 5LCWJ 4LNUD 4GMJA 4H7XA 5ENPD 3CLJA 5ENRD 3UI2A 3VLDA 1WG0A 2BUGA 4AIFA 4RSYA 4KZ0A 3T5XA 3CQCB 1HFAA 3DBSA 4PH4B 4BETA 4WNDA 3C5RA 3ZVVA 3IHVA 2EIJE 3CHSA 4HRLA 2H6HA 3HRAA 3L6AA 3LDZA 3MZLB 2IOSA 1OWLA 3NOCD 3AG3E 4D10C 4PS3A 3ZYLA 2FO7A 3MV3B 3D9NA 5CEAA 4LCTA 2P9KG 3GZ2A 5EIDA 3U4TA 1WDYA 1N0RA 3LS8A 1DCQA 1U2VG 1BI7B 3BG0B 1OCZE 4XIFA 2V4LA 5KWDA 3GYZA 2AW6A 3L22A 4HFGA 5D66A 2AXVA 4FJZA 3ML9A 3QNKA 3FTYA 3RIBA 1H2TC 5BNWA 1N4PA 3FULA 2QC9A 4CGWA 4IYPA 3TAXA 3NZSA 4FA6A 3AJIA 3D3MA 3FTUA 2V4HC 4EPZA 1E8WA 1S70B 3LVRE 1QQEA 2JEKA 2X6FA 4HOSA 3UQ3A 3KS2A 2OV8A 3DXKG 1E8ZA 4DLOA 3JXJA 1K8KG 3MGBA 2GRLA 4I9EA 3ZYMA 2XZTG 4GTRA 5G55A 5ENSD 2KZTA 5G04J 2P9LG 4L1BA 3ZN3A 3PRZA 3P2BA 1WAO1 3TWSA 1N9AA 4N2QA 1INZA 2IU1A 1MJ0A 1RW2A 3EDTB 1HU3A 3TWTA 1UN8A 4FU3A 2VSNA 3ULQA 4JEUA 1A17A 2WXLA 2IFUA 5CMYA 2C2LA 3E33A 5CECB 3PDNA 2WXMA 3SO8A 4BX8A 3PS6A 3UXGA 4EBAA 3RU0A 2FF4A 2WMNA 3ZXSA 2YINA 2J49A 2WQ6A 1MX4A 4C48B 1U3CA 2VGXA 1FT1A 3HYMB 4HLEA 3SFYA 3CHQA 1FPPA 4YDWA 4E6HA 2WB2A 2YHCA 4O60A 2F0YA 2OCCE 4TXPA 2NYJA 1GW6A 3FH8A 1V54E 2KCLA 5CHEE 4JEHA 1OWNA 3PE4A 2GGFA 2DVWA 4NACA 3TWWA 2R03A 4HXIA 4JB8P 4YNDA 4G2VA 3PH0C 1MZCA 3HG0D 1OUVA 3T9KA 5LOZA 4Q69A 5AJLA 4L7TA 1HG2A 4AXHA 4GTVA 2VTBA 2HE0A 3E37A 2P9SG 4C9BB 3QB2A 2KCKA 4L9PA 2BTDA 5KNHD 1ELRA 2HR2A 4HRNA 1NP7A 3ZEFA 5FZSA 5EYPF 4YVOA 1TNZA 2L6BA 1HG5A 4CEMA 2FULA 3APCA 3Q49B 3CK7A 5EYLA 2CHWA 2J4DA 2BF0X 2IY0C 5G05J 3Q73A 3FTWA 5JJ7A 2WPVA 3JUEA 4ANUA 4GTQA 3AG4E 3UTMA 3NF1A 4U0ZA 4AY5A 2WXHA 1IYGA 2UY1B 3NQPA 3N71A 4N3CA 4M3OA 1RZ4A 4BY6A 4LEUA 1MHQA 2J08A 3B13A 3CVLA 4RLYA 3ASOE 4F1SA 3NZUA 4F6RD 5E75A 2L0TB 5D0OD 3HXBA 4WWOA 1P5QA 2R05A 3B95A 3HHMA 1FVFA 3D9LA 4UWGA 3ONLA 2IO3C 4OYSA 5D0QD 3AS5A 4R7LA 3FH7A 3D9IA 2R2LA 3CHRA 2F37A 4Q94A 5EX0A 4CDNA 2DWZA 4JC8A 2UWJG 2Y0BG 3V30A 3G2SA 5CEDB 5G2NA 3I3NA 2V0PA 4HNAD 4GCOA 1E8XA 5H7PA 3AG2E 2PNNA 4B93B 3MYVA 3ZU7B 4XKCA 3X2QE 1DNPA 1W3BA 3CVXA 5FQ7A 4P29A 2WM9A 3HXFA 2QZAA 5T4YA 3CKBA 5A23A 5AN8A 2EILE 4OVUA 4IULA 1N11A 5FINA 5JHAA 4BWRA 4GTTA 4I2WA 4CGVA 3FU0A 5ENTD 1JWGA 2XRZA 3D9PA 2M63A 2GRQB 4BSXA 1H6OA 1LF8A 2XEEA 3DPDA 4ZHBA 3CVWA 3BUAA 3NOGD 2IEJA 2R17C 3FEYA 1QBQA 3AAAC 3ASHA 1Z5SC 3O4ZA 2XEVA 2XQ0A 1IHGA 1DC2A 4I2ZA 4PS7A 3EJNA 1D8DA 3SY2A 1O5MA 4U0UA 4DX7D 3CHPA 3Q5MA 3FY4A 3L17A 4FHJA 4HI9A 5C2YA 3Q79A 2MYOA 4J6IA 2NSZA 5BUZA 4A63B 3SF4A 3D9HA 4GZ6A 4YDOA 2A5UA 2VGYA 5FT9A 2X6HA 2X38A 5EKQD 4ZFHA 4GA0A 4KZCA 3G2UA 4HQDA 1AWCB 1HE8A 4BT9A 2PL2A 3DSXA 2MOWA 4I1AA 4GTPA 3URZA 2NXPA 5CRUA 4TXRA 3HDXA 2Y4TA 4N3AA 3MKQB 3EHNA 4ANWA 5CCMA 3ZHEB 4ILIA 5BXUA 2LAHA 3EHRA 1NA0A 3RRUA 1WM5A 2LNIA 2NC9A 4JXTA 4B8CB 1N95A 4ACLA 2QYUA 5D2MC 4IN3B 3CVNA 3GW4A 3PUKA 3RO2A 3SD5A 3LJ3A 4WNGA 2PM6A 4O1PA 2ZU6B 4ILGA 1N4SA 4W9RA 5KCMA 3C3OA 2OVBA 4DJAA 3RO3A 2XRYA 5CERB 3BQOA 3JUIA 1E8YA 3AS8A 4I1OB 3U3WA 1G3NB 1S64A 3CVPA 3PNLB 3Q75A 4A1SA 2XS8A 4GPKA 4UI9K 3TL5A 5JA4D 5EILA 1OCOE 1S0PA 1Z3XA 1FT2A 3ZYQA 3VTXA 4UWLA 4J8EA 1H19A 4B94A 3QC1A 4GTSA 1MQSA 3S7FA 2UY1A 2YQ8A 1O1SA 4TUMA 4LNBA 4G8LA 3L08A 1MYOA 2AXUA 3I4GA 2RG8A 4WUYA 1UJKA 4HVBA 5C1DA 4DLQA 1FCHA 4EBAG 5BW8C 3Q7FA 1VDYA 1UW4B 2GRMA 2I9CA 2Y69E 4WWNA 4GB9A 4G26A 2VGEA 4CCAA 1ZBPA 1E7UA 2F8YA 1KLXA 3JCKC 4DRXE 2J9QA 3OTNA 1EDUA 4NQ0A 3UT8A 4UI9C 4TRQA 3F6QA 2C0MA 3B7TA 1NI1A 5M72A 3UINC 2HM8A 4HI8A 4FULA 2BKKB 3PEUB 2WXGA 4TXQA 4KXKB 2CHZA 5FZQA 2DBAA 2J8SD 1LD8A 3TGOA 3ASDA 3HXCA 3Q7AA 4KVMA 2CHXA 4I1MA 2GRPB 4XX5A 3UT7A 3L13A 1WY6A 4XI9A 3ESKA 4YDYA 1PAQA 4U7EB 4J8SA 4KVOA 3ZYKA 2GW1A 1HS6A 1E96B 3DWLG 4NIKA 4EQFA 1EYHA 5ANLA 5HRYA 2GRNB 1JUQA 4APFA 3DSUA 2HYZA 2RFMA 4UWKA 4G24A 3S2AA 2Y3AA 3CK8A 4ACKA 2X6JA 3AU4A 2CG3A 3EU5A 4WNFA 4N5QA 2BKGA 3C72A 4I6GA 4Y6CA 2I2OA 4APOA 1B89A 3IV0A 2XPIA 2X6KA 3KAEA 3SQVA 3EIQC 2EIKE 5ANRA 3G2VA 5EDSA 3LCAA 4UUCA 1TNYA 2CFUA 3MX3A 3RRMB 3T8MA 1YYHA 4FP7A 2WXIA 4B89A 4O1OA 5A6CA 4AOFA 1K1AA 2WXNA 5AQ7A 3DEPA 5T3RA 4J8YA 3J5QB 1HO8A 3MKQA 5LFAA 1AP7A 1S63A 1YA0A 3JQ1A 3ZHEA 3ULYA 5BV0A 2YNQA 4AY6A 4AJWA 3SBSA 4FADA 4M7CA 2PM7A 3FWVA 4HORA 3UKRG 1NA3A 1H2VC 2EINE 3EHMA 4GA2A 4QFVA 5B1AE 4ANXA 4F7AA 2WQHA 4GTOA 3Q4AB 4QQIA 1N54A 5DIZA 3FEXA 2BEDA 5FIOA 3D9JA 4G23A 3Q78A 1IKND 1SW6A 1BI8B 1L5JA 4AP2A 4G1TA 2FEZA 2GRRB 3TXNA 3PZ2A 4X8QA 1UN9A 2P9IG 5FTPA 5AQBA 3G2TA 4K03A 3FU3A 3VLFA 3APFA 1X81A 3I4RB 2ETCA 2P9PG 1QNFA 1OT8A 5FQ6A 4LG6A 4MS6A 5ENQD 4JHJA 1OXJA 4L23A 2P9UG 1UOHA 3RK6A 3CVYA 4NRHB 4FJYA 4I6EA 4CDRA 2I6HA 5FZRA 5JHBA 3KSLA 4JZYA 1TNUA 4L2LA 4AV7A 2WXQA 4TV3A 3L9TA 3LPZA 3EUVA 3EIJA 5AAOA 3D9MA 2IQCA 2H6GA 5DBKA 3OXFA 1OCCE 1A5EA 3JYSA 2ONDA 5B3SE 3RSEG 3DPYA 3CKCA 4IRUA 3FUDA 3BG1B 4U8HA 4GZCA 4U8YD 4OAUC 3TJPA 1OY3D 4N39A 3FUIA 1IQUA 5ENNA 3QDNA 2I1JA 1V55E 1JCQA 5E76A 3QAQA 4WNEA 4GYWA 5ENOD 3U9WA 3FTXA 3LYAA 4ANVA 3PZ3A 5CMWA 4B8AA 3KEAA 3DRAA 4I17A 4UQZA 3PE3A 5AQ9A 3ZIMA 1YMPA 4GYYA 3CSTA 3EHQA 3E4BA 3G2WA 3SI5A 3FUMA 4MBGA 2WXRA 2XHEA 5KJLA 2X3MA 2FBNA 1QYMA 3RAUA 4GAAA 1KPSB 3TWVA 1PC2A 3ZRHA 4DUIA 2EIME 2LSVA 2VSOE 3QWVA 4WWPA 3LVQE 5HS0A 2H6IA 2I1KA 2HO1A 3J5PA 4F1PA 3I5PA 2QY7A 3R7QA 3QARA 4GU5A 5ARFA 3CVVA 3FUHA 4YDEA 3Q47B 5EN5D 4LSZE 1Q2ZA 5AYWD 3LXUX 3D9OA 1TN8A 3UIOC 3AS4A 4EZLA 1NL4A 3D9KA 5BXOA 1K3ZD 4L2YA 5EIBE 1H6KA 1LD7A 4U63A 3DSTA 4MKTA 2WQ7A 4XI0A 1KZPA 4WAFA 2LXLA 2VSXE 1YCSB 3LKUA 2WXPA 4U04A 4HB5A 3CGHA 3R7RA 3MV2B 2DYSE 2ETAA 4HLLA 3LEWA 1H6PA 4BTBA 2DCPA 5HKPA 2L0IA 3SHFA 3NB2A 3C3QA 3IHYA 3MEKA 3CHOA 2B0OE 3ABME 2WMOA 4URKA 3TG4A 4GCNA 1O1TA 3QK0A 3UMVA 3DSSA 2AXZA 3IXEA 1NFIE 2H6FA 4BX9A 2AVPA 1OWPA 1IXVA 4CDMA 3PZDA 3SFXA 3PZ1A 4DI3A 5CCLA 1SVXA 3GZ1A 4ATZD 2IONA 5LP0A 1ELWA 2OOEA 2XGOA 3UM0A 5HQ8A 1D8EA 3UM2A 2VJ8A 2ZGDA 5HI7A 3ZXPA 4PS8A 4JL0A 2DYRE 4ATGA 1N52A 1TNBA 3ZNGA 3LY8A 2OVFA 1BD8A 4KT6B 3DEOA 4ABNA 4AVXA 4FC8A 3CSFA 1Z6TA 3C98A 2CFZA 3PEVB 1SA5A 5JJTA 4I9CA 5BT1A 1TNOA 3ZGQA 4UWHA 4N3BA 4U07A 3SFZA 4J8DA 1TR4A 1ZB1A 2ILRA 3HVEB 4GYOA 3QWWA 4FLHA 4N5CA 5BV1A 3FTVA 3U66A 1N4QA 3ASNE 4DX2A 2XEHA 4HOUA 3L54A 3IKOB 3JQ0A 4O6FA 4CT4A 2QYJA 2DZOA 4GMRA 1XNFA 5FQ8A 5ARGA 3LY7A 4RG6A 4KBQA 4GA1A 3S7BA 2X6IA 1BPOA 5A7DB 2L6JA 4PUCA 3LY9A 1KT0A 3V2OA 2R59A 5AQAA 3NBNB 5AIJA 3EU9A 3FHEA 5AARA 2L9BA 2LO6A 3UM1A 5G04C 2R02A 4J8FA 1SZ9A 2XPZA 2Y1LE 3TWXA 3R9MA 2RKKA 3QWPA 3TWQA 4UQYA 2MRIA 4EECA 1MX2A 2KCVA 3AU5A 3UM3A 2R5SA 2PZIA 3C3RA 2EQXA 5AJDA 3ZFWA 3UKUG 4DI4A 4HOTA 3JXIA 2JLBA 2ZIRA 3ZUVB 3FDHA 4UI9J 4BSZB 2XCBA 4CZ2D 4JVSA 5T8IA 3B7SA 4JW1A 1QZ2A 2AWIA 4B0ZA 1TEZA 3ABLE 3Q9NC 4U95D 3FUFA 5LX8A 3UIPC 1JCSA 1E7VA 3CV0A 3UPVA 2VYIA 3FUNA 4EHMA 3OAWA 1EF1C 1SZAA 4AEZC 2XPYA 4XZ4A 2LAIA 4G8KA 4EZKA 3IEGA 2P58C 3TWRA 2IJGX 3FP3A 4ILHB 3UX4A 2LSUA 4GZ5A 1HX8A 3MKRA 5KBAA 2F8XK 3ML8A 1TJFA 2KXPC 3ENEA 3RKVA 5JJ6A 1JPLA 4HBDA 1N4RA 2XZDG 3MA5A 3CVQA 1UJJA 2XCCA 4HOQA 5CBNA 4F53A 1JWFA 3HXEA 4KMOA 5B1BE 5BPPA 3FU5A 2QFCA 3V31A 5J08A 3ZKJA 4JPSA 1Y8MA 4HRMB 4XEIG 2IOLA 2XS1A 1Z3YA 3SBTB 2J07A 2XENA 4C0MA 5G05C 4NURA 1KZOA 2V5FA 5FWQA 4LUNU 2WXFA 4GTMA 1IHBA 3QJZA 3CK9A 4J0UA 3DSWA 5CBOA 4C0EA 1H0AA 4Y6WA 5KJMA 5J90A 4H7YA 3GZSA 4DX6D 3S7DA 1SQMA 3ISMC 4J7WA 4HS2A 3B7BA 4DPRA 1Y6IA 2Y4UA 3OXGA 1TJCA 4K5AB 4UWFA 3B7UX 4JHRA 4BEPA 2LUHA 4A3TA 2VSYA 3FU6A 4BERA 3S7JA 4PDXA 4F3VA 3SGHA 3VLEA 3B7RL 1HZ4A 3ZW3A 4GPMA 1TN6A 3DSVA 3NAWA 3CR3A 3T5VA 2ZISA 2OEWA 1PY1A 4OAVB 1EPUA 1OCRE 3KSQA 3W9GA 3ONKA 3QOUA 5FJYA 4XKBA 4A55A 3ABKE 3CVUA 3HVEA 1ELKA 2OEVA 1TN7A 3IBEA 2WXOA 2IF4A 1UG3A 2XGSA 4DK5A 2XGMA 3PNTB 2VQ2A 4BFRA 2KBXA 3Q9UC 5AENA 3FUKA 4GZ3A 2A5EA 1BU9A 4GMLA 4K5BA 5IY5E 2FO1E 3VTYA 4RG9A 4JA9A 2Q7FA 1FVHA 4G11A 4U0SA 4DX5D 2KM4A 4CT0A 2E2EA 1NZNA 1N94A 4CYMD 4JD2G 4G25A 3ASFA 3MJWA 3RJVA 1HXIA 4CRWA 5FQ4A 2A4ZA 4JHKA 1JCRA 3SNXA 4V3IA 1MX6A 4EZJA 1HF8A 3FFLA 2WVIA 5EX3A 2RD0A 3WXXA 2B6CA 4LNGA 3U64A 5ITZF 2JABA 1ZU2A 2J09A 2J4BA 2AJAA 5KNGA 3O48A 3E30A 4I6JA 3PVLA 3FTSA 4Z68A 1HH8A 3W9FA 1SA4A 4BTAA 4U96D 3K9IA 3MCXA 5CRVA 3BEEA 4JA7A 1IQRA 2PQNA 2FI7A 4DX1A 3UT4A 4A1GA 1O1RA 4TUUA 3FH5A 4FLBA 1OWOA 3AG1E 1BLXB 4ME2A 1X5BA 3HXDA 4LRZA 2V5QC 2PQRA 2P2CP 2CG2A 3CQGB 2KZTB 3PREA 1U3DA 2ZGGA 3TWUA 4E85A 4I43A 1D9SA 3R9AB 3TXMA 2WXJA 4MRUA 1KT1A 3P1UA 4BT8A 1XGWA 3PUJA 3ASGA 3FTZA 4U8VD 2DIWA 4XE0A 3FUJA 2DZNA 1TYQG 4LERA 3E32A 3WG7E 4AM9A 4Q96A 1E90A 1DCEA 2P9NG 4K5CA 4A3VA 4FHKA 2ZXWE 3PZ4A 2VGXB 3BU8A 3L16A 1N0QA 3OXLA 5KJKA 2GROB 3T8KA 4RVBA 4N2SA 3KD7A 3CHMA 2RFAA 5LCWC 2KC7A 3E34A 4MLPA 1K1BA 3SZ7A 3L82A 2YHEA 4OVVA
chains in the Genus database with same CATH topology
2OCCE 3AG4E 5B1AE 3ABKE 2ZXWE 5B1BE 2DYRE 2EIJE 2EILE 1V54E 5IY5E 3AG2E 3ABME 3ASNE 3ABLE 2EIME 1OCCE 1OCRE 1V55E 2Y69E 1OCZE 3WG7E 3AG3E 3X2QE 5B3SE 2DYSE 1OCOE 2EIKE 3AG1E 3ASOE 2EINE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCC E;  3AG4 E;  5B1A E;  3ABK E;  2ZXW E;  5B1B E;  2DYR E;  2EIJ E;  2EIL E;  1V54 E;  5IY5 E;  3AG2 E;  3ABM E;  3ASN E;  3ABL E;  2EIM E;  1OCC E;  1OCR E;  1V55 E;  2Y69 E;  1OCZ E;  3WG7 E;  3AG3 E;  3X2Q E;  5B3S E;  2DYS E;  1OCO E;  2EIK E;  3AG1 E;  3ASO E;  2EIN E; 
#chains in the Genus database with same CATH topology
 3DXM G;  3ULE G;  2V8S E;  3ESL A;  2C0L A;  3CIA A;  2LXM A;  3LJN A;  4KYO B;  1H2U A;  3APD A;  3HIZ A;  4GZD A;  3CEQ A;  3V79 K;  2E0I A;  3Q15 A;  4YVQ C;  2KAT A;  1OWM A;  3FUE A;  3TG5 A;  3KEZ A;  2VTB B;  3UUX A;  3V2X A;  4BES A;  1LTX A;  2WXK A;  4K0R A;  2MHK A;  5JMN D;  2IO2 C;  2ETB A;  4RQI A;  5KJN A;  3QKY A;  3RRN B;  3ZPJ A;  1DVP A;  4UQX A;  5LCW J;  4LNU D;  4GMJ A;  4H7X A;  5ENP D;  3CLJ A;  5ENR D;  3UI2 A;  3VLD A;  1WG0 A;  2BUG A;  4AIF A;  4RSY A;  4KZ0 A;  3T5X A;  3CQC B;  1HFA A;  3DBS A;  4PH4 B;  4BET A;  4WND A;  3C5R A;  3ZVV A;  3IHV A;  2EIJ E;  3CHS A;  4HRL A;  2H6H A;  3HRA A;  3L6A A;  3LDZ A;  3MZL B;  2IOS A;  1OWL A;  3NOC D;  3AG3 E;  4D10 C;  4PS3 A;  3ZYL A;  2FO7 A;  3MV3 B;  3D9N A;  5CEA A;  4LCT A;  2P9K G;  3GZ2 A;  5EID A;  3U4T A;  1WDY A;  1N0R A;  3LS8 A;  1DCQ A;  1U2V G;  1BI7 B;  3BG0 B;  1OCZ E;  4XIF A;  2V4L A;  5KWD A;  3GYZ A;  2AW6 A;  3L22 A;  4HFG A;  5D66 A;  2AXV A;  4FJZ A;  3ML9 A;  3QNK A;  3FTY A;  3RIB A;  1H2T C;  5BNW A;  1N4P A;  3FUL A;  2QC9 A;  4CGW A;  4IYP A;  3TAX A;  3NZS A;  4FA6 A;  3AJI A;  3D3M A;  3FTU A;  2V4H C;  4EPZ A;  1E8W A;  1S70 B;  3LVR E;  1QQE A;  2JEK A;  2X6F A;  4HOS A;  3UQ3 A;  3KS2 A;  2OV8 A;  3DXK G;  1E8Z A;  4DLO A;  3JXJ A;  1K8K G;  3MGB A;  2GRL A;  4I9E A;  3ZYM A;  2XZT G;  4GTR A;  5G55 A;  5ENS D;  2KZT A;  5G04 J;  2P9L G;  4L1B A;  3ZN3 A;  3PRZ A;  3P2B A;  1WAO 1;  3TWS A;  1N9A A;  4N2Q A;  1INZ A;  2IU1 A;  1MJ0 A;  1RW2 A;  3EDT B;  1HU3 A;  3TWT A;  1UN8 A;  4FU3 A;  2VSN A;  3ULQ A;  4JEU A;  1A17 A;  2WXL A;  2IFU A;  5CMY A;  2C2L A;  3E33 A;  5CEC B;  3PDN A;  2WXM A;  3SO8 A;  4BX8 A;  3PS6 A;  3UXG A;  4EBA A;  3RU0 A;  2FF4 A;  2WMN A;  3ZXS A;  2YIN A;  2J49 A;  2WQ6 A;  1MX4 A;  4C48 B;  1U3C A;  2VGX A;  1FT1 A;  3HYM B;  4HLE A;  3SFY A;  3CHQ A;  1FPP A;  4YDW A;  4E6H A;  2WB2 A;  2YHC A;  4O60 A;  2F0Y A;  2OCC E;  4TXP A;  2NYJ A;  1GW6 A;  3FH8 A;  1V54 E;  2KCL A;  5CHE E;  4JEH A;  1OWN A;  3PE4 A;  2GGF A;  2DVW A;  4NAC A;  3TWW A;  2R03 A;  4HXI A;  4JB8 P;  4YND A;  4G2V A;  3PH0 C;  1MZC A;  3HG0 D;  1OUV A;  3T9K A;  5LOZ A;  4Q69 A;  5AJL A;  4L7T A;  1HG2 A;  4AXH A;  4GTV A;  2VTB A;  2HE0 A;  3E37 A;  2P9S G;  4C9B B;  3QB2 A;  2KCK A;  4L9P A;  2BTD A;  5KNH D;  1ELR A;  2HR2 A;  4HRN A;  1NP7 A;  3ZEF A;  5FZS A;  5EYP F;  4YVO A;  1TNZ A;  2L6B A;  1HG5 A;  4CEM A;  2FUL A;  3APC A;  3Q49 B;  3CK7 A;  5EYL A;  2CHW A;  2J4D A;  2BF0 X;  2IY0 C;  5G05 J;  3Q73 A;  3FTW A;  5JJ7 A;  2WPV A;  3JUE A;  4ANU A;  4GTQ A;  3AG4 E;  3UTM A;  3NF1 A;  4U0Z A;  4AY5 A;  2WXH A;  1IYG A;  2UY1 B;  3NQP A;  3N71 A;  4N3C A;  4M3O A;  1RZ4 A;  4BY6 A;  4LEU A;  1MHQ A;  2J08 A;  3B13 A;  3CVL A;  4RLY A;  3ASO E;  4F1S A;  3NZU A;  4F6R D;  5E75 A;  2L0T B;  5D0O D;  3HXB A;  4WWO A;  1P5Q A;  2R05 A;  3B95 A;  3HHM A;  1FVF A;  3D9L A;  4UWG A;  3ONL A;  2IO3 C;  4OYS A;  5D0Q D;  3AS5 A;  4R7L A;  3FH7 A;  3D9I A;  2R2L A;  3CHR A;  2F37 A;  4Q94 A;  5EX0 A;  4CDN A;  2DWZ A;  4JC8 A;  2UWJ G;  2Y0B G;  3V30 A;  3G2S A;  5CED B;  5G2N A;  3I3N A;  2V0P A;  4HNA D;  4GCO A;  1E8X A;  5H7P A;  3AG2 E;  2PNN A;  4B93 B;  3MYV A;  3ZU7 B;  4XKC A;  3X2Q E;  1DNP A;  1W3B A;  3CVX A;  5FQ7 A;  4P29 A;  2WM9 A;  3HXF A;  2QZA A;  5T4Y A;  3CKB A;  5A23 A;  5AN8 A;  2EIL E;  4OVU A;  4IUL A;  1N11 A;  5FIN A;  5JHA A;  4BWR A;  4GTT A;  4I2W A;  4CGV A;  3FU0 A;  5ENT D;  1JWG A;  2XRZ A;  3D9P A;  2M63 A;  2GRQ B;  4BSX A;  1H6O A;  1LF8 A;  2XEE A;  3DPD A;  4ZHB A;  3CVW A;  3BUA A;  3NOG D;  2IEJ A;  2R17 C;  3FEY A;  1QBQ A;  3AAA C;  3ASH A;  1Z5S C;  3O4Z A;  2XEV A;  2XQ0 A;  1IHG A;  1DC2 A;  4I2Z A;  4PS7 A;  3EJN A;  1D8D A;  3SY2 A;  1O5M A;  4U0U A;  4DX7 D;  3CHP A;  3Q5M A;  3FY4 A;  3L17 A;  4FHJ A;  4HI9 A;  5C2Y A;  3Q79 A;  2MYO A;  4J6I A;  2NSZ A;  5BUZ A;  4A63 B;  3SF4 A;  3D9H A;  4GZ6 A;  4YDO A;  2A5U A;  2VGY A;  5FT9 A;  2X6H A;  2X38 A;  5EKQ D;  4ZFH A;  4GA0 A;  4KZC A;  3G2U A;  4HQD A;  1AWC B;  1HE8 A;  4BT9 A;  2PL2 A;  3DSX A;  2MOW A;  4I1A A;  4GTP A;  3URZ A;  2NXP A;  5CRU A;  4TXR A;  3HDX A;  2Y4T A;  4N3A A;  3MKQ B;  3EHN A;  4ANW A;  5CCM A;  3ZHE B;  4ILI A;  5BXU A;  2LAH A;  3EHR A;  1NA0 A;  3RRU A;  1WM5 A;  2LNI A;  2NC9 A;  4JXT A;  4B8C B;  1N95 A;  4ACL A;  2QYU A;  5D2M C;  4IN3 B;  3CVN A;  3GW4 A;  3PUK A;  3RO2 A;  3SD5 A;  3LJ3 A;  4WNG A;  2PM6 A;  4O1P A;  2ZU6 B;  4ILG A;  1N4S A;  4W9R A;  5KCM A;  3C3O A;  2OVB A;  4DJA A;  3RO3 A;  2XRY A;  5CER B;  3BQO A;  3JUI A;  1E8Y A;  3AS8 A;  4I1O B;  3U3W A;  1G3N B;  1S64 A;  3CVP A;  3PNL B;  3Q75 A;  4A1S A;  2XS8 A;  4GPK A;  4UI9 K;  3TL5 A;  5JA4 D;  5EIL A;  1OCO E;  1S0P A;  1Z3X A;  1FT2 A;  3ZYQ A;  3VTX A;  4UWL A;  4J8E A;  1H19 A;  4B94 A;  3QC1 A;  4GTS A;  1MQS A;  3S7F A;  2UY1 A;  2YQ8 A;  1O1S A;  4TUM A;  4LNB A;  4G8L A;  3L08 A;  1MYO A;  2AXU A;  3I4G A;  2RG8 A;  4WUY A;  1UJK A;  4HVB A;  5C1D A;  4DLQ A;  1FCH A;  4EBA G;  5BW8 C;  3Q7F A;  1VDY A;  1UW4 B;  2GRM A;  2I9C A;  2Y69 E;  4WWN A;  4GB9 A;  4G26 A;  2VGE A;  4CCA A;  1ZBP A;  1E7U A;  2F8Y A;  1KLX A;  3JCK C;  4DRX E;  2J9Q A;  3OTN A;  1EDU A;  4NQ0 A;  3UT8 A;  4UI9 C;  4TRQ A;  3F6Q A;  2C0M A;  3B7T A;  1NI1 A;  5M72 A;  3UIN C;  2HM8 A;  4HI8 A;  4FUL A;  2BKK B;  3PEU B;  2WXG A;  4TXQ A;  4KXK B;  2CHZ A;  5FZQ A;  2DBA A;  2J8S D;  1LD8 A;  3TGO A;  3ASD A;  3HXC A;  3Q7A A;  4KVM A;  2CHX A;  4I1M A;  2GRP B;  4XX5 A;  3UT7 A;  3L13 A;  1WY6 A;  4XI9 A;  3ESK A;  4YDY A;  1PAQ A;  4U7E B;  4J8S A;  4KVO A;  3ZYK A;  2GW1 A;  1HS6 A;  1E96 B;  3DWL G;  4NIK A;  4EQF A;  1EYH A;  5ANL A;  5HRY A;  2GRN B;  1JUQ A;  4APF A;  3DSU A;  2HYZ A;  2RFM A;  4UWK A;  4G24 A;  3S2A A;  2Y3A A;  3CK8 A;  4ACK A;  2X6J A;  3AU4 A;  2CG3 A;  3EU5 A;  4WNF A;  4N5Q A;  2BKG A;  3C72 A;  4I6G A;  4Y6C A;  2I2O A;  4APO A;  1B89 A;  3IV0 A;  2XPI A;  2X6K A;  3KAE A;  3SQV A;  3EIQ C;  2EIK E;  5ANR A;  3G2V A;  5EDS A;  3LCA A;  4UUC A;  1TNY A;  2CFU A;  3MX3 A;  3RRM B;  3T8M A;  1YYH A;  4FP7 A;  2WXI A;  4B89 A;  4O1O A;  5A6C A;  4AOF A;  1K1A A;  2WXN A;  5AQ7 A;  3DEP A;  5T3R A;  4J8Y A;  3J5Q B;  1HO8 A;  3MKQ A;  5LFA A;  1AP7 A;  1S63 A;  1YA0 A;  3JQ1 A;  3ZHE A;  3ULY A;  5BV0 A;  2YNQ A;  4AY6 A;  4AJW A;  3SBS A;  4FAD A;  4M7C A;  2PM7 A;  3FWV A;  4HOR A;  3UKR G;  1NA3 A;  1H2V C;  2EIN E;  3EHM A;  4GA2 A;  4QFV A;  5B1A E;  4ANX A;  4F7A A;  2WQH A;  4GTO A;  3Q4A B;  4QQI A;  1N54 A;  5DIZ A;  3FEX A;  2BED A;  5FIO A;  3D9J A;  4G23 A;  3Q78 A;  1IKN D;  1SW6 A;  1BI8 B;  1L5J A;  4AP2 A;  4G1T A;  2FEZ A;  2GRR B;  3TXN A;  3PZ2 A;  4X8Q A;  1UN9 A;  2P9I G;  5FTP A;  5AQB A;  3G2T A;  4K03 A;  3FU3 A;  3VLF A;  3APF A;  1X81 A;  3I4R B;  2ETC A;  2P9P G;  1QNF A;  1OT8 A;  5FQ6 A;  4LG6 A;  4MS6 A;  5ENQ D;  4JHJ A;  1OXJ A;  4L23 A;  2P9U G;  1UOH A;  3RK6 A;  3CVY A;  4NRH B;  4FJY A;  4I6E A;  4CDR A;  2I6H A;  5FZR A;  5JHB A;  3KSL A;  4JZY A;  1TNU A;  4L2L A;  4AV7 A;  2WXQ A;  4TV3 A;  3L9T A;  3LPZ A;  3EUV A;  3EIJ A;  5AAO A;  3D9M A;  2IQC A;  2H6G A;  5DBK A;  3OXF A;  1OCC E;  1A5E A;  3JYS A;  2OND A;  5B3S E;  3RSE G;  3DPY A;  3CKC A;  4IRU A;  3FUD A;  3BG1 B;  4U8H A;  4GZC A;  4U8Y D;  4OAU C;  3TJP A;  1OY3 D;  4N39 A;  3FUI A;  1IQU A;  5ENN A;  3QDN A;  2I1J A;  1V55 E;  1JCQ A;  5E76 A;  3QAQ A;  4WNE A;  4GYW A;  5ENO D;  3U9W A;  3FTX A;  3LYA A;  4ANV A;  3PZ3 A;  5CMW A;  4B8A A;  3KEA A;  3DRA A;  4I17 A;  4UQZ A;  3PE3 A;  5AQ9 A;  3ZIM A;  1YMP A;  4GYY A;  3CST A;  3EHQ A;  3E4B A;  3G2W A;  3SI5 A;  3FUM A;  4MBG A;  2WXR A;  2XHE A;  5KJL A;  2X3M A;  2FBN A;  1QYM A;  3RAU A;  4GAA A;  1KPS B;  3TWV A;  1PC2 A;  3ZRH A;  4DUI A;  2EIM E;  2LSV A;  2VSO E;  3QWV A;  4WWP A;  3LVQ E;  5HS0 A;  2H6I A;  2I1K A;  2HO1 A;  3J5P A;  4F1P A;  3I5P A;  2QY7 A;  3R7Q A;  3QAR A;  4GU5 A;  5ARF A;  3CVV A;  3FUH A;  4YDE A;  3Q47 B;  5EN5 D;  4LSZ E;  1Q2Z A;  5AYW D;  3LXU X;  3D9O A;  1TN8 A;  3UIO C;  3AS4 A;  4EZL A;  1NL4 A;  3D9K A;  5BXO A;  1K3Z D;  4L2Y A;  5EIB E;  1H6K A;  1LD7 A;  4U63 A;  3DST A;  4MKT A;  2WQ7 A;  4XI0 A;  1KZP A;  4WAF A;  2LXL A;  2VSX E;  1YCS B;  3LKU A;  2WXP A;  4U04 A;  4HB5 A;  3CGH A;  3R7R A;  3MV2 B;  2DYS E;  2ETA A;  4HLL A;  3LEW A;  1H6P A;  4BTB A;  2DCP A;  5HKP A;  2L0I A;  3SHF A;  3NB2 A;  3C3Q A;  3IHY A;  3MEK A;  3CHO A;  2B0O E;  3ABM E;  2WMO A;  4URK A;  3TG4 A;  4GCN A;  1O1T A;  3QK0 A;  3UMV A;  3DSS A;  2AXZ A;  3IXE A;  1NFI E;  2H6F A;  4BX9 A;  2AVP A;  1OWP A;  1IXV A;  4CDM A;  3PZD A;  3SFX A;  3PZ1 A;  4DI3 A;  5CCL A;  1SVX A;  3GZ1 A;  4ATZ D;  2ION A;  5LP0 A;  1ELW A;  2OOE A;  2XGO A;  3UM0 A;  5HQ8 A;  1D8E A;  3UM2 A;  2VJ8 A;  2ZGD A;  5HI7 A;  3ZXP A;  4PS8 A;  4JL0 A;  2DYR E;  4ATG A;  1N52 A;  1TNB A;  3ZNG A;  3LY8 A;  2OVF A;  1BD8 A;  4KT6 B;  3DEO A;  4ABN A;  4AVX A;  4FC8 A;  3CSF A;  1Z6T A;  3C98 A;  2CFZ A;  3PEV B;  1SA5 A;  5JJT A;  4I9C A;  5BT1 A;  1TNO A;  3ZGQ A;  4UWH A;  4N3B A;  4U07 A;  3SFZ A;  4J8D A;  1TR4 A;  1ZB1 A;  2ILR A;  3HVE B;  4GYO A;  3QWW A;  4FLH A;  4N5C A;  5BV1 A;  3FTV A;  3U66 A;  1N4Q A;  3ASN E;  4DX2 A;  2XEH A;  4HOU A;  3L54 A;  3IKO B;  3JQ0 A;  4O6F A;  4CT4 A;  2QYJ A;  2DZO A;  4GMR A;  1XNF A;  5FQ8 A;  5ARG A;  3LY7 A;  4RG6 A;  4KBQ A;  4GA1 A;  3S7B A;  2X6I A;  1BPO A;  5A7D B;  2L6J A;  4PUC A;  3LY9 A;  1KT0 A;  3V2O A;  2R59 A;  5AQA A;  3NBN B;  5AIJ A;  3EU9 A;  3FHE A;  5AAR A;  2L9B A;  2LO6 A;  3UM1 A;  5G04 C;  2R02 A;  4J8F A;  1SZ9 A;  2XPZ A;  2Y1L E;  3TWX A;  3R9M A;  2RKK A;  3QWP A;  3TWQ A;  4UQY A;  2MRI A;  4EEC A;  1MX2 A;  2KCV A;  3AU5 A;  3UM3 A;  2R5S A;  2PZI A;  3C3R A;  2EQX A;  5AJD A;  3ZFW A;  3UKU G;  4DI4 A;  4HOT A;  3JXI A;  2JLB A;  2ZIR A;  3ZUV B;  3FDH A;  4UI9 J;  4BSZ B;  2XCB A;  4CZ2 D;  4JVS A;  5T8I A;  3B7S A;  4JW1 A;  1QZ2 A;  2AWI A;  4B0Z A;  1TEZ A;  3ABL E;  3Q9N C;  4U95 D;  3FUF A;  5LX8 A;  3UIP C;  1JCS A;  1E7V A;  3CV0 A;  3UPV A;  2VYI A;  3FUN A;  4EHM A;  3OAW A;  1EF1 C;  1SZA A;  4AEZ C;  2XPY A;  4XZ4 A;  2LAI A;  4G8K A;  4EZK A;  3IEG A;  2P58 C;  3TWR A;  2IJG X;  3FP3 A;  4ILH B;  3UX4 A;  2LSU A;  4GZ5 A;  1HX8 A;  3MKR A;  5KBA A;  2F8X K;  3ML8 A;  1TJF A;  2KXP C;  3ENE A;  3RKV A;  5JJ6 A;  1JPL A;  4HBD A;  1N4R A;  2XZD G;  3MA5 A;  3CVQ A;  1UJJ A;  2XCC A;  4HOQ A;  5CBN A;  4F53 A;  1JWF A;  3HXE A;  4KMO A;  5B1B E;  5BPP A;  3FU5 A;  2QFC A;  3V31 A;  5J08 A;  3ZKJ A;  4JPS A;  1Y8M A;  4HRM B;  4XEI G;  2IOL A;  2XS1 A;  1Z3Y A;  3SBT B;  2J07 A;  2XEN A;  4C0M A;  5G05 C;  4NUR A;  1KZO A;  2V5F A;  5FWQ A;  4LUN U;  2WXF A;  4GTM A;  1IHB A;  3QJZ A;  3CK9 A;  4J0U A;  3DSW A;  5CBO A;  4C0E A;  1H0A A;  4Y6W A;  5KJM A;  5J90 A;  4H7Y A;  3GZS A;  4DX6 D;  3S7D A;  1SQM A;  3ISM C;  4J7W A;  4HS2 A;  3B7B A;  4DPR A;  1Y6I A;  2Y4U A;  3OXG A;  1TJC A;  4K5A B;  4UWF A;  3B7U X;  4JHR A;  4BEP A;  2LUH A;  4A3T A;  2VSY A;  3FU6 A;  4BER A;  3S7J A;  4PDX A;  4F3V A;  3SGH A;  3VLE A;  3B7R L;  1HZ4 A;  3ZW3 A;  4GPM A;  1TN6 A;  3DSV A;  3NAW A;  3CR3 A;  3T5V A;  2ZIS A;  2OEW A;  1PY1 A;  4OAV B;  1EPU A;  1OCR E;  3KSQ A;  3W9G A;  3ONK A;  3QOU A;  5FJY A;  4XKB A;  4A55 A;  3ABK E;  3CVU A;  3HVE A;  1ELK A;  2OEV A;  1TN7 A;  3IBE A;  2WXO A;  2IF4 A;  1UG3 A;  2XGS A;  4DK5 A;  2XGM A;  3PNT B;  2VQ2 A;  4BFR A;  2KBX A;  3Q9U C;  5AEN A;  3FUK A;  4GZ3 A;  2A5E A;  1BU9 A;  4GML A;  4K5B A;  5IY5 E;  2FO1 E;  3VTY A;  4RG9 A;  4JA9 A;  2Q7F A;  1FVH A;  4G11 A;  4U0S A;  4DX5 D;  2KM4 A;  4CT0 A;  2E2E A;  1NZN A;  1N94 A;  4CYM D;  4JD2 G;  4G25 A;  3ASF A;  3MJW A;  3RJV A;  1HXI A;  4CRW A;  5FQ4 A;  2A4Z A;  4JHK A;  1JCR A;  3SNX A;  4V3I A;  1MX6 A;  4EZJ A;  1HF8 A;  3FFL A;  2WVI A;  5EX3 A;  2RD0 A;  3WXX A;  2B6C A;  4LNG A;  3U64 A;  5ITZ F;  2JAB A;  1ZU2 A;  2J09 A;  2J4B A;  2AJA A;  5KNG A;  3O48 A;  3E30 A;  4I6J A;  3PVL A;  3FTS A;  4Z68 A;  1HH8 A;  3W9F A;  1SA4 A;  4BTA A;  4U96 D;  3K9I A;  3MCX A;  5CRV A;  3BEE A;  4JA7 A;  1IQR A;  2PQN A;  2FI7 A;  4DX1 A;  3UT4 A;  4A1G A;  1O1R A;  4TUU A;  3FH5 A;  4FLB A;  1OWO A;  3AG1 E;  1BLX B;  4ME2 A;  1X5B A;  3HXD A;  4LRZ A;  2V5Q C;  2PQR A;  2P2C P;  2CG2 A;  3CQG B;  2KZT B;  3PRE A;  1U3D A;  2ZGG A;  3TWU A;  4E85 A;  4I43 A;  1D9S A;  3R9A B;  3TXM A;  2WXJ A;  4MRU A;  1KT1 A;  3P1U A;  4BT8 A;  1XGW A;  3PUJ A;  3ASG A;  3FTZ A;  4U8V D;  2DIW A;  4XE0 A;  3FUJ A;  2DZN A;  1TYQ G;  4LER A;  3E32 A;  3WG7 E;  4AM9 A;  4Q96 A;  1E90 A;  1DCE A;  2P9N G;  4K5C A;  4A3V A;  4FHK A;  2ZXW E;  3PZ4 A;  2VGX B;  3BU8 A;  3L16 A;  1N0Q A;  3OXL A;  5KJK A;  2GRO B;  3T8K A;  4RVB A;  4N2S A;  3KD7 A;  3CHM A;  2RFA A;  5LCW C;  2KC7 A;  3E34 A;  4MLP A;  1K1B A;  3SZ7 A;  3L82 A;  2YHE A;  4OVV A; 
#chains in the Genus database with same CATH homology
 2OCC E;  3AG4 E;  5B1A E;  3ABK E;  2ZXW E;  5B1B E;  2DYR E;  2EIJ E;  2EIL E;  1V54 E;  5IY5 E;  3AG2 E;  3ABM E;  3ASN E;  3ABL E;  2EIM E;  1OCC E;  1OCR E;  1V55 E;  2Y69 E;  1OCZ E;  3WG7 E;  3AG3 E;  3X2Q E;  5B3S E;  2DYS E;  1OCO E;  2EIK E;  3AG1 E;  3ASO E;  2EIN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...