1OCCE

Structure of bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (cytochrome(c)-oxygen)
molecule keywords CYTOCHROME C OXIDASE
publication title The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
pubmed rcsb
total genus 39
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1996-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1occE00
1OCCE 3AG2E 2EILE 5B1BE 2EINE 3AG4E 1OCOE 3ASOE 2EIME 5B1AE 5B3SE 1OCRE 3ABME 2EIKE 3AG3E 3X2QE 3ASNE 2Y69E 1V54E 2OCCE 3WG7E 2ZXWE 3ABLE 3AG1E 1V55E 1OCZE 2EIJE 2DYRE 5IY5E 2DYSE 3ABKE
chains in the Genus database with same CATH superfamily
1H6OA 2P9IG 3FWVA 5JJ7A 1TNUA 4LNGA 3QC1A 1PY1A 1KZPA 1Y6IA 4LNBA 1NP7A 3UUXA 1SQMA 4DI4A 5CMWA 4A1SA 3QDNA 4MS6A 4UWGA 4ZHBA 3FY4A 4HS2A 4ILIA 1MYOA 4KZ0A 1MZCA 1OUVA 4RQIA 5JJTA 5CRUA 2XGMA 4LSZE 4CDRA 4ABNA 2Y69E 2LNIA 5BXOA 1L5JA 5M72A 2CG2A 2NSZA 3HIZA 1EPUA 4WNFA 2AW6A 5AYWD 1HFAA 4NRHB 4DX1A 2CHZA 2MYOA 2IY0C 3CQCB 1ELKA 5A6CA 4I2ZA 4G26A 2GRRB 3CK9A 4UQYA 2R59A 5AENA 1TN6A 2XHEA 4GTSA 4HOSA 3QK0A 4B89A 1FT1A 4L9PA 3GYZA 4KYOB 4UI9C 4GCOA 2WM9A 3E37A 4F7AA 5FWQA 1O1SA 3PZ1A 1B89A 3JUEA 3W9GA 3JQ1A 3CR3A 4OAVB 4ANWA 5KJKA 3PREA 5ENNA 4H7YA 3U66A 3HXDA 4I1OB 2V0PA 2F0YA 5H7PA 4GMJA 3T8MA 4BFRA 3APDA 4KVOA 4PS7A 1S70B 4TRQA 3UMVA 2IO2C 5ITZF 3NAWA 4EZLA 1MQSA 2NYJA 4V3IA 3EU9A 1N0QA 4PH4B 5BPPA 2UY1A 4U96D 2I6HA 4WAFA 3OTNA 2QZAA 4GZDA 4GCNA 4X8QA 2XGOA 3MZLB 3LYAA 1D8DA 1SW6A 5B3SE 2LSUA 4K5CA 2XCBA 1KT1A 3RJVA 1K8KG 3JXJA 3KS2A 2VTBA 3HYMB 2IQCA 4BESA 4W9RA 2I2OA 3ULYA 1KZOA 4K5BA 4FLBA 1E7UA 4XX5A 3S7FA 3LY7A 2L6BA 2P9PG 3U9WA 5FT9A 4F53A 5CCMA 1HO8A 2F37A 3CVUA 5AQAA 1QZ2A 5G04J 3U64A 3PZ2A 2BTDA 3G2VA 1X5BA 2KXPC 2XPZA 2CHWA 4JHRA 3SO8A 2DCPA 4OYSA 5KNHD 3TWRA 4GZ6A 3Q4AB 2EILE 3NZUA 4RSYA 4GYWA 2NC9A 4F1PA 3FHEA 3HXBA 2HR2A 2X6FA 3ASDA 4UQXA 3LVQE 2QC9A 1PAQA 1UJJA 1TR4A 3ZHEA 3RKVA 4TXQA 4DK5A 2BF0X 4FC8A 1RW2A 4BTAA 5CRVA 2WXKA 2WQHA 3Q78A 4FLHA 5BW8C 1QQEA 4JEUA 1E8WA 2WXPA 4K03A 3P1UA 2Y4UA 2AXUA 2J9QA 1JUQA 3MX3A 2JEKA 3FUNA 4L1BA 4DX2A 4HQDA 3JQ0A 3PRZA 5AARA 3V2OA 3RAUA 4WWNA 4DLOA 4BERA 4F1SA 3ONKA 3R9MA 1Y8MA 4HOTA 3D9NA 3EHQA 4IN3B 5AQBA 3GZSA 3OXLA 1QYMA 3IXEA 4OVUA 3L22A 1S64A 2X3MA 3FUEA 4KT6B 1H2TC 2C0MA 4AIFA 3VTYA 3Q73A 5A7DB 2XS8A 2LXMA 2R02A 3MKQB 3L17A 2JLBA 4YDYA 4JVSA 3ZRHA 3UIOC 4CT4A 5CHEE 3QWVA 2PM7A 2OVFA 4G11A 1MX2A 3D9JA 1LD7A 4GAAA 5CBOA 1TNYA 2P9LG 3ZEFA 4TXPA 1HS6A 2I1JA 3Q7AA 2PQNA 3CHMA 3C3OA 3NBNB 4DJAA 3PZ4A 1TNZA 5B1BE 2WPVA 3CQGB 3NF1A 4N5CA 5G05C 5ENTD 3TL5A 2MHKA 3LCAA 3TG4A 2ETAA 2WXFA 3EHRA 3D9MA 3CLJA 4APOA 1FT2A 4ANXA 3TJPA 3RRNB 3HRAA 3LY9A 4EZJA 3FTSA 3Q79A 4YVQC 2F8XK 3T8KA 1OWPA 3ZYMA 3AU4A 3B7TA 2VJ8A 1LTXA 4L2YA 3KEZA 4GZ5A 2J07A 2KCLA 3ULEG 3ASFA 3QJZA 3LXUX 1OXJA 3SZ7A 3D9HA 4TUMA 3V79K 2LXLA 5KJLA 4BSZB 3CSTA 4HOQA 4HRLA 3NOGD 4J8FA 2V8SE 3SFYA 3QWWA 1OCCE 2IJGX 2MOWA 2XGSA 2DZNA 3MKRA 1OT8A 2KCKA 3DBSA 1IHBA 2XEHA 1XNFA 2IOSA 4AM9A 4Y6CA 1QBQA 2J09A 4B94A 3PEUB 3ZKJA 3FU6A 2IO3C 4U07A 2DYSE 2WXQA 3UINC 4MLPA 3RO2A 3C5RA 1BPOA 3G2WA 3IHVA 1ELWA 4N5QA 3SQVA 3URZA 4AXHA 5CERB 1SZ9A 4HLLA 5FIOA 1IQRA 1E8XA 5E76A 3JXIA 2KZTA 4GYOA 4ANUA 3KSQA 4WWOA 2VSXE 4LG6A 3RRMB 1BU9A 2EIKE 4G1TA 3FUFA 3T9KA 5FQ6A 3CSFA 4JA7A 2R2LA 3ZYLA 3E33A 4GPMA 1TJFA 3HVEA 5KJNA 2XEEA 1N4QA 3VTXA 2GRLA 3SY2A 4KMOA 5BNWA 2XENA 1LF8A 3L08A 3AG3E 2WXOA 1VDYA 4NACA 1NI1A 4DX5D 3FH8A 2IF4A 3UQ3A 3TWQA 3B7UX 4JHJA 3T5XA 5D0QD 4RG9A 5ANRA 2WXMA 4GTMA 3ASNE 4XI0A 4Q94A 3R7QA 1INZA 3DSUA 4F6RD 4A55A 3AG1E 4I9CA 3FU3A 2EIJE 3FUKA 2BKGA 5HI7A 4GA2A 2FEZA 2LAHA 3F6QA 3CVQA 4ACLA 3Q75A 3UI2A 3D9KA 1WDYA 3FFLA 5LCWJ 3PZ3A 2XQ0A 2XZTG 4N3CA 5JJ6A 3EHNA 3ZFWA 4RLYA 1WM5A 3CVYA 5C2YA 1JWFA 1SVXA 4QFVA 3SBSA 4C48B 4FJZA 4BETA 4IYPA 4J8SA 3DXMG 3UX4A 3B95A 2KM4A 5JHAA 1UJKA 4FP7A 3ULQA 1O1RA 2VGXA 1HX8A 3SD5A 4UWFA 2JABA 5CEAA 3CVNA 5HRYA 3ESKA 3CHQA 2WQ7A 5CEDB 1H6KA 1HF8A 4NQ0A 3FULA 1N52A 2BEDA 3NZSA 1E8YA 4GA1A 2ZISA 1NFIE 3WXXA 2YINA 1S63A 4GB9A 4R7LA 4APFA 3GZ2A 4K5AB 3QOUA 3TWUA 3LKUA 3D3MA 4UWLA 3ESLA 1DCQA 3E4BA 1Z3YA 3LS8A 4IRUA 4A1GA 3UT7A 2GGFA 1ZB1A 3X2QE 1OWMA 3PNTB 5EKQD 3CIAA 1N0RA 2B0OE 2J49A 3HXFA 3L9TA 3FUIA 3EHMA 4LNUD 3FTXA 4NIKA 4YDOA 4K0RA 5ANLA 3TWSA 4RG6A 4YNDA 1FVFA 4BWRA 3DEPA 3ZXPA 3PEVB 3C98A 5FZRA 1UN9A 4MRUA 5G55A 3SI5A 2AXZA 2EIME 4DRXE 1S0PA 3O4ZA 3B7BA 4AY6A 5ARFA 2XZDG 3B7SA 4ILHB 1V55E 4N3BA 4G25A 4U95D 4DPRA 3AG4E 1TJCA 2X6IA 3UT8A 4DX6D 2EQXA 3FUDA 3TAXA 5DIZA 4HFGA 3CVLA 1TYQG 4C9BB 1LD8A 2CHXA 4G23A 1ZBPA 3ZIMA 5BV0A 4HORA 2P9UG 4LRZA 4KZCA 4OVVA 2DZOA 3TWXA 2E2EA 2P9NG 2L0IA 1FCHA 4XZ4A 3S2AA 5EDSA 3LEWA 3E30A 3FEYA 4I9EA 1MX4A 2VGYA 3QKYA 2AVPA 3IBEA 4FA6A 3L82A 4EHMA 3EUVA 4U8VD 3DWLG 2F8YA 1WAO1 3TXMA 4U04A 3J5PA 5EN5D 3AJIA 3QNKA 2OVBA 3SFZA 3DSTA 2B6CA 3CV0A 4GTRA 3D9LA 3LPZA 2WXRA 2FBNA 5D2MC 3FUJA 3I5PA 5AJDA 2A5EA 3IV0A 1DCEA 4HVBA 4WNDA 2L6JA 4L2LA 3SBTB 4PS8A 4LUNU 4I1AA 3S7DA 4GZ3A 1H2UA 4AOFA 4AEZC 3FTYA 1OCRE 1SA4A 3EU5A 4HOUA 2LO6A 3ZGQA 3WG7E 4N39A 3HXCA 1U2VG 4J0UA 3LVRE 3ZVVA 3ASOE 3UXGA 1DNPA 4E6HA 2X38A 5AAOA 1WG0A 4I2WA 4FHJA 1MHQA 1DC2A 2X6JA 5KJMA 3AS8A 3MYVA 2GRNB 3ASHA 3TXNA 2WVIA 5BV1A 1NA0A 5FINA 1XGWA 1A17A 2ETCA 4YDEA 2M63A 5G04C 3ZU7B 2NXPA 4XE0A 5J90A 3BQOA 4WUYA 3DXKG 2WXIA 3N71A 3FTZA 2WXJA 4AVXA 4O1PA 5ENQD 5C1DA 2H6HA 3PE3A 3PH0C 5A23A 1UOHA 3GZ1A 3MCXA 1JPLA 3KEAA 4I43A 3SNXA 2VYIA 3BU8A 3TWVA 4JB8P 4M3OA 4G8KA 3VLFA 3G2SA 1MJ0A 3HXEA 2MRIA 1TNBA 1K1BA 5B1AE 4H7XA 2GRPB 3E32A 5ENRD 3FTUA 3D9IA 4CGWA 1KT0A 2BUGA 5LOZA 2XRZA 3FP3A 2C2LA 5AIJA 4XKCA 4AP2A 1Z6TA 1FVHA 2OOEA 2RFMA 3Q9NC 2DIWA 4U7EB 1KPSB 1DVPA 3C3QA 3UKRG 4I1MA 3Q49B 3UT4A 1ELRA 3SF4A 4EPZA 4Q69A 2PNNA 5JMND 1E96B 2GW1A 4B8AA 4GTQA 2WXHA 3W9FA 2J8SD 1X81A 1E90A 4JW1A 2OEVA 5AJLA 2L0TB 3CK7A 4BX9A 3ZXSA 1A5EA 3C3RA 3L13A 5BT1A 1OWLA 4JC8A 5J08A 1N4PA 1SA5A 5FZSA 4EZKA 5EIDA 1H0AA 1AWCB 3ABLE 4F3VA 1JCQA 3RU0A 1RZ4A 5AQ9A 3JYSA 3SFXA 1HH8A 3UM3A 5EYLA 5BUZA 2FO7A 1YCSB 1P5QA 2ZGGA 2RKKA 1EYHA 1FPPA 2HE0A 3Q7FA 1KLXA 2KATA 4A3VA 2QY7A 2R5SA 2ONDA 4U8HA 5LP0A 4UI9J 4U63A 5CCLA 4UWKA 4JEHA 2FO1E 3UM1A 2PM6A 1HG5A 1OY3D 1OCOE 2YHCA 5ARGA 3ZYQA 3FEXA 1IXVA 5JHBA 2ZIRA 4UI9K 1UW4B 2WMOA 2OCCE 4BX8A 3ML8A 3ZYKA 3FDHA 4Q96A 4C0EA 3CK8A 2UY1B 1JCRA 2R05A 4FULA 3RK6A 4HBDA 1SZAA 3UKUG 2CG3A 3OXGA 4JXTA 3FH7A 1O1TA 3PDNA 2R03A 3AU5A 4AV7A 2YNQA 4FADA 2VTBB 4IULA 3HDXA 2IOLA 4CGVA 4HLEA 1N4SA 1H19A 1HE8A 5KCMA 4JZYA 5IY5E 3ABKE 3CHPA 4HI8A 2Q7FA 4JPSA 1AP7A 2UWJG 3D9OA 3DPYA 3CVWA 3ABME 3V30A 1UG3A 2HM8A 4TUUA 2Y0BG 3NB2A 3BG0B 3PUKA 2ZXWE 3CHOA 3FTVA 1OCZE 3LDZA 4MBGA 4WNGA 4TV3A 1EDUA 4GU5A 2VSNA 3PUJA 5EILA 4I6EA 5KBAA 2ETBA 3TWWA 1N54A 4GTPA 1N95A 4YDWA 3MV3B 1IQUA 1YYHA 3APCA 5EX0A 4KXKB 3ONLA 5FTPA 2IU1A 2LAIA 5AN8A 1U3CA 2XCCA 3Q9UC 1NZNA 3B7RL 3ZHEB 4B8CB 4CYMD 3DEOA 4DLQA 4N2QA 1N11A 5LX8A 2GRMA 3QWPA 3S7JA 2IONA 3ISMC 1TN8A 1BD8A 2DVWA 2RD0A 3OAWA 4EBAA 5FZQA 2V4LA 2YHEA 3CVPA 2I9CA 2WXLA 4GMLA 2XPYA 3E34A 2HO1A 4U8YD 3DRAA 3BG1B 3UM0A 2DBAA 3AS4A 3EDTB 4GYYA 4N3AA 4WNEA 5EYPF 4YVOA 4HXIA 5T4YA 4ATGA 4JL0A 2IEJA 1N9AA 4RVBA 3I4RB 4NURA 5KWDA 2OEWA 3CKBA 4J8DA 5HKPA 3QB2A 5BXUA 4J6IA 3I4GA 4GMRA 2V5QC 2EINE 3DPDA 2BKKB 1Z3XA 4O60A 3FU5A 4PUCA 3BUAA 2P2CP 2QYUA 4ZFHA 3FH5A 2WXGA 4QQIA 2WB2A 4I6JA 3U3WA 2VQ2A 5T8IA 3P2BA 2QFCA 3ZPJA 4CDMA 2AWIA 5T3RA 2H6FA 4BTBA 2A4ZA 1IKND 2CFZA 4BY6A 1JCSA 3KAEA 1HZ4A 4B93B 1V54E 3VLEA 5ENOD 5LCWC 4J8YA 4N2SA 2PQRA 2R17C 3V31A 3MA5A 4A3TA 1G3NB 2WXNA 3AS5A 2IFUA 2GRQB 4LERA 2RFAA 3C72A 2FI7A 1U3DA 1H2VC 3CVXA 2QYJA 4JA9A 5ENPD 4U0ZA 4AY5A 4EECA 5G05J 4CCAA 3PZDA 3TWTA 3CHSA 5D66A 3RSEG 4HB5A 3CHRA 4LCTA 4AJWA 1Q2ZA 2X6KA 1TN7A 4G8LA 3UTMA 4ME2A 5D0OD 2WMNA 4DI3A 5CECB 3BEEA 2I1KA 4I6GA 2XEVA 3AG2E 2KBXA 3RIBA 4B0ZA 1BI8B 3CKCA 3SGHA 1EF1C 2FULA 3L6AA 2WQ6A 4URKA 3DSXA 4O1OA 3R9AB 4G2VA 2XRYA 4ACKA 4ILGA 4TXRA 1BI7B 2DYRE 3KSLA 4J7WA 4BT9A 2AXVA 5LFAA 4CZ2D 1E8ZA 4GTVA 1PC2A 2HYZA 1OWNA 2V5FA 1UN8A 4CT0A 4DUIA 4HI9A 3UPVA 2P58C 4GPKA 2J4DA 3L54A 3FUHA 2ZU6B 4HRNA 1JWGA 1TEZA 3PVLA 3PNLB 3HG0D 2YQ8A 2XPIA 3MEKA 3ZN3A 4U0SA 4HRMB 3LJNA 1BLXB 4EBAG 4I17A 2OV8A 3FTWA 2P9KG 4OAUC 4ANVA 3CEQA 2V4HC 4CRWA 3LY8A 4C0MA 4UUCA 2VSOE 2DWZA 3D9PA 4G24A 4E85A 3RO3A 2KZTB 4DX7D 3I3NA 2Y4TA 4XEIG 4EQFA 2Y3AA 3UIPC 1D9SA 3G2UA 2H6GA 1IYGA 5JA4D 1N4RA 1D8EA 4BT8A 4O6FA 4MKTA 1IHGA 2VSYA 3MV2B 2A5UA 3OXFA 1ZU2A 4WWPA 3HVEB 3L16A 4U0UA 3S7BA 1HU3A 2LSVA 4HNAD 4UWHA 3Q15A 3JUIA 3TG5A 3QAQA 3FUMA 5FJYA 4L7TA 1WY6A 4XI9A 5FQ8A 4UQZA 4M7CA 3GW4A 3Q47B 3ZUVB 3NOCD 4Z68A 5HQ8A 3JCKC 3PS6A 4JD2G 1GW6A 3IKOB 2KCVA 4P29A 5ENSD 5FQ7A 2ZGDA 4JHKA 3QARA 2AJAA 3TGOA 5CMYA 2X6HA 3RRUA 4KBQA 4ATZD 4A63B 3MJWA 2H6IA 3EIJA 4D10C 5E75A 3U4TA 1W3BA 2LUHA 4KVMA 3SHFA 3DSVA 4LEUA 5EX3A 3ENEA 4FU3A 2P9SG 3AAAC 3MGBA 3Q5MA 2J4BA 2ILRA 1Z5SC 2PL2A 1TNOA 3NQPA 4L23A 3PE4A 3J5QB 1NL4A 4XKBA 3APFA 5KNGA 1OWOA 3HHMA 1NA3A 2VGXB 4GA0A 3ASGA 1K3ZD 1YMPA 1K1AA 2VGEA 2J08A 4PS3A 3G2TA 2CFUA 3FU0A 4J8EA 3DSWA 1E7VA 2PZIA 3IEGA 3K9IA 4FJYA 4PDXA 1O5MA 4Y6WA 1H6PA 3MKQA 2XS1A 2E0IA 4GTOA 3CGHA 4CDNA 1HG2A 3EJNA 4XIFA 5G2NA 3EIQC 3ZNGA 3R7RA 4BEPA 4GZCA 5EIBE 5AQ7A 1N94A 3ML9A 5CBNA 3T5VA 2Y1LE 3B13A 4GTTA 3CVVA 3O48A 1QNFA 5FQ4A 3DSSA 1YA0A 4CEMA 2KC7A 3KD7A 1HXIA 4FHKA 3V2XA 1MX6A 2FF4A 2L9BA 3UM2A 2RG8A 3LJ3A 3ZW3A 5HS0A 3VLDA 4BSXA 2C0LA 5DBKA 2GROB 3IHYA
chains in the Genus database with same CATH topology
1OCCE 3AG2E 2EILE 5B1BE 2EINE 3AG4E 1OCOE 3ASOE 2EIME 5B1AE 5B3SE 1OCRE 3ABME 2EIKE 3AG3E 3X2QE 3ASNE 2Y69E 1V54E 2OCCE 3WG7E 2ZXWE 3ABLE 3AG1E 1V55E 1OCZE 2EIJE 2DYRE 5IY5E 2DYSE 3ABKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCC E;  3AG2 E;  2EIL E;  5B1B E;  2EIN E;  3AG4 E;  1OCO E;  3ASO E;  2EIM E;  5B1A E;  5B3S E;  1OCR E;  3ABM E;  2EIK E;  3AG3 E;  3X2Q E;  3ASN E;  2Y69 E;  1V54 E;  2OCC E;  3WG7 E;  2ZXW E;  3ABL E;  3AG1 E;  1V55 E;  1OCZ E;  2EIJ E;  2DYR E;  5IY5 E;  2DYS E;  3ABK E; 
#chains in the Genus database with same CATH topology
 1H6O A;  2P9I G;  3FWV A;  5JJ7 A;  1TNU A;  4LNG A;  3QC1 A;  1PY1 A;  1KZP A;  1Y6I A;  4LNB A;  1NP7 A;  3UUX A;  1SQM A;  4DI4 A;  5CMW A;  4A1S A;  3QDN A;  4MS6 A;  4UWG A;  4ZHB A;  3FY4 A;  4HS2 A;  4ILI A;  1MYO A;  4KZ0 A;  1MZC A;  1OUV A;  4RQI A;  5JJT A;  5CRU A;  2XGM A;  4LSZ E;  4CDR A;  4ABN A;  2Y69 E;  2LNI A;  5BXO A;  1L5J A;  5M72 A;  2CG2 A;  2NSZ A;  3HIZ A;  1EPU A;  4WNF A;  2AW6 A;  5AYW D;  1HFA A;  4NRH B;  4DX1 A;  2CHZ A;  2MYO A;  2IY0 C;  3CQC B;  1ELK A;  5A6C A;  4I2Z A;  4G26 A;  2GRR B;  3CK9 A;  4UQY A;  2R59 A;  5AEN A;  1TN6 A;  2XHE A;  4GTS A;  4HOS A;  3QK0 A;  4B89 A;  1FT1 A;  4L9P A;  3GYZ A;  4KYO B;  4UI9 C;  4GCO A;  2WM9 A;  3E37 A;  4F7A A;  5FWQ A;  1O1S A;  3PZ1 A;  1B89 A;  3JUE A;  3W9G A;  3JQ1 A;  3CR3 A;  4OAV B;  4ANW A;  5KJK A;  3PRE A;  5ENN A;  4H7Y A;  3U66 A;  3HXD A;  4I1O B;  2V0P A;  2F0Y A;  5H7P A;  4GMJ A;  3T8M A;  4BFR A;  3APD A;  4KVO A;  4PS7 A;  1S70 B;  4TRQ A;  3UMV A;  2IO2 C;  5ITZ F;  3NAW A;  4EZL A;  1MQS A;  2NYJ A;  4V3I A;  3EU9 A;  1N0Q A;  4PH4 B;  5BPP A;  2UY1 A;  4U96 D;  2I6H A;  4WAF A;  3OTN A;  2QZA A;  4GZD A;  4GCN A;  4X8Q A;  2XGO A;  3MZL B;  3LYA A;  1D8D A;  1SW6 A;  5B3S E;  2LSU A;  4K5C A;  2XCB A;  1KT1 A;  3RJV A;  1K8K G;  3JXJ A;  3KS2 A;  2VTB A;  3HYM B;  2IQC A;  4BES A;  4W9R A;  2I2O A;  3ULY A;  1KZO A;  4K5B A;  4FLB A;  1E7U A;  4XX5 A;  3S7F A;  3LY7 A;  2L6B A;  2P9P G;  3U9W A;  5FT9 A;  4F53 A;  5CCM A;  1HO8 A;  2F37 A;  3CVU A;  5AQA A;  1QZ2 A;  5G04 J;  3U64 A;  3PZ2 A;  2BTD A;  3G2V A;  1X5B A;  2KXP C;  2XPZ A;  2CHW A;  4JHR A;  3SO8 A;  2DCP A;  4OYS A;  5KNH D;  3TWR A;  4GZ6 A;  3Q4A B;  2EIL E;  3NZU A;  4RSY A;  4GYW A;  2NC9 A;  4F1P A;  3FHE A;  3HXB A;  2HR2 A;  2X6F A;  3ASD A;  4UQX A;  3LVQ E;  2QC9 A;  1PAQ A;  1UJJ A;  1TR4 A;  3ZHE A;  3RKV A;  4TXQ A;  4DK5 A;  2BF0 X;  4FC8 A;  1RW2 A;  4BTA A;  5CRV A;  2WXK A;  2WQH A;  3Q78 A;  4FLH A;  5BW8 C;  1QQE A;  4JEU A;  1E8W A;  2WXP A;  4K03 A;  3P1U A;  2Y4U A;  2AXU A;  2J9Q A;  1JUQ A;  3MX3 A;  2JEK A;  3FUN A;  4L1B A;  4DX2 A;  4HQD A;  3JQ0 A;  3PRZ A;  5AAR A;  3V2O A;  3RAU A;  4WWN A;  4DLO A;  4BER A;  4F1S A;  3ONK A;  3R9M A;  1Y8M A;  4HOT A;  3D9N A;  3EHQ A;  4IN3 B;  5AQB A;  3GZS A;  3OXL A;  1QYM A;  3IXE A;  4OVU A;  3L22 A;  1S64 A;  2X3M A;  3FUE A;  4KT6 B;  1H2T C;  2C0M A;  4AIF A;  3VTY A;  3Q73 A;  5A7D B;  2XS8 A;  2LXM A;  2R02 A;  3MKQ B;  3L17 A;  2JLB A;  4YDY A;  4JVS A;  3ZRH A;  3UIO C;  4CT4 A;  5CHE E;  3QWV A;  2PM7 A;  2OVF A;  4G11 A;  1MX2 A;  3D9J A;  1LD7 A;  4GAA A;  5CBO A;  1TNY A;  2P9L G;  3ZEF A;  4TXP A;  1HS6 A;  2I1J A;  3Q7A A;  2PQN A;  3CHM A;  3C3O A;  3NBN B;  4DJA A;  3PZ4 A;  1TNZ A;  5B1B E;  2WPV A;  3CQG B;  3NF1 A;  4N5C A;  5G05 C;  5ENT D;  3TL5 A;  2MHK A;  3LCA A;  3TG4 A;  2ETA A;  2WXF A;  3EHR A;  3D9M A;  3CLJ A;  4APO A;  1FT2 A;  4ANX A;  3TJP A;  3RRN B;  3HRA A;  3LY9 A;  4EZJ A;  3FTS A;  3Q79 A;  4YVQ C;  2F8X K;  3T8K A;  1OWP A;  3ZYM A;  3AU4 A;  3B7T A;  2VJ8 A;  1LTX A;  4L2Y A;  3KEZ A;  4GZ5 A;  2J07 A;  2KCL A;  3ULE G;  3ASF A;  3QJZ A;  3LXU X;  1OXJ A;  3SZ7 A;  3D9H A;  4TUM A;  3V79 K;  2LXL A;  5KJL A;  4BSZ B;  3CST A;  4HOQ A;  4HRL A;  3NOG D;  4J8F A;  2V8S E;  3SFY A;  3QWW A;  1OCC E;  2IJG X;  2MOW A;  2XGS A;  2DZN A;  3MKR A;  1OT8 A;  2KCK A;  3DBS A;  1IHB A;  2XEH A;  1XNF A;  2IOS A;  4AM9 A;  4Y6C A;  1QBQ A;  2J09 A;  4B94 A;  3PEU B;  3ZKJ A;  3FU6 A;  2IO3 C;  4U07 A;  2DYS E;  2WXQ A;  3UIN C;  4MLP A;  3RO2 A;  3C5R A;  1BPO A;  3G2W A;  3IHV A;  1ELW A;  4N5Q A;  3SQV A;  3URZ A;  4AXH A;  5CER B;  1SZ9 A;  4HLL A;  5FIO A;  1IQR A;  1E8X A;  5E76 A;  3JXI A;  2KZT A;  4GYO A;  4ANU A;  3KSQ A;  4WWO A;  2VSX E;  4LG6 A;  3RRM B;  1BU9 A;  2EIK E;  4G1T A;  3FUF A;  3T9K A;  5FQ6 A;  3CSF A;  4JA7 A;  2R2L A;  3ZYL A;  3E33 A;  4GPM A;  1TJF A;  3HVE A;  5KJN A;  2XEE A;  1N4Q A;  3VTX A;  2GRL A;  3SY2 A;  4KMO A;  5BNW A;  2XEN A;  1LF8 A;  3L08 A;  3AG3 E;  2WXO A;  1VDY A;  4NAC A;  1NI1 A;  4DX5 D;  3FH8 A;  2IF4 A;  3UQ3 A;  3TWQ A;  3B7U X;  4JHJ A;  3T5X A;  5D0Q D;  4RG9 A;  5ANR A;  2WXM A;  4GTM A;  3ASN E;  4XI0 A;  4Q94 A;  3R7Q A;  1INZ A;  3DSU A;  4F6R D;  4A55 A;  3AG1 E;  4I9C A;  3FU3 A;  2EIJ E;  3FUK A;  2BKG A;  5HI7 A;  4GA2 A;  2FEZ A;  2LAH A;  3F6Q A;  3CVQ A;  4ACL A;  3Q75 A;  3UI2 A;  3D9K A;  1WDY A;  3FFL A;  5LCW J;  3PZ3 A;  2XQ0 A;  2XZT G;  4N3C A;  5JJ6 A;  3EHN A;  3ZFW A;  4RLY A;  1WM5 A;  3CVY A;  5C2Y A;  1JWF A;  1SVX A;  4QFV A;  3SBS A;  4C48 B;  4FJZ A;  4BET A;  4IYP A;  4J8S A;  3DXM G;  3UX4 A;  3B95 A;  2KM4 A;  5JHA A;  1UJK A;  4FP7 A;  3ULQ A;  1O1R A;  2VGX A;  1HX8 A;  3SD5 A;  4UWF A;  2JAB A;  5CEA A;  3CVN A;  5HRY A;  3ESK A;  3CHQ A;  2WQ7 A;  5CED B;  1H6K A;  1HF8 A;  4NQ0 A;  3FUL A;  1N52 A;  2BED A;  3NZS A;  1E8Y A;  4GA1 A;  2ZIS A;  1NFI E;  3WXX A;  2YIN A;  1S63 A;  4GB9 A;  4R7L A;  4APF A;  3GZ2 A;  4K5A B;  3QOU A;  3TWU A;  3LKU A;  3D3M A;  4UWL A;  3ESL A;  1DCQ A;  3E4B A;  1Z3Y A;  3LS8 A;  4IRU A;  4A1G A;  3UT7 A;  2GGF A;  1ZB1 A;  3X2Q E;  1OWM A;  3PNT B;  5EKQ D;  3CIA A;  1N0R A;  2B0O E;  2J49 A;  3HXF A;  3L9T A;  3FUI A;  3EHM A;  4LNU D;  3FTX A;  4NIK A;  4YDO A;  4K0R A;  5ANL A;  3TWS A;  4RG6 A;  4YND A;  1FVF A;  4BWR A;  3DEP A;  3ZXP A;  3PEV B;  3C98 A;  5FZR A;  1UN9 A;  4MRU A;  5G55 A;  3SI5 A;  2AXZ A;  2EIM E;  4DRX E;  1S0P A;  3O4Z A;  3B7B A;  4AY6 A;  5ARF A;  2XZD G;  3B7S A;  4ILH B;  1V55 E;  4N3B A;  4G25 A;  4U95 D;  4DPR A;  3AG4 E;  1TJC A;  2X6I A;  3UT8 A;  4DX6 D;  2EQX A;  3FUD A;  3TAX A;  5DIZ A;  4HFG A;  3CVL A;  1TYQ G;  4C9B B;  1LD8 A;  2CHX A;  4G23 A;  1ZBP A;  3ZIM A;  5BV0 A;  4HOR A;  2P9U G;  4LRZ A;  4KZC A;  4OVV A;  2DZO A;  3TWX A;  2E2E A;  2P9N G;  2L0I A;  1FCH A;  4XZ4 A;  3S2A A;  5EDS A;  3LEW A;  3E30 A;  3FEY A;  4I9E A;  1MX4 A;  2VGY A;  3QKY A;  2AVP A;  3IBE A;  4FA6 A;  3L82 A;  4EHM A;  3EUV A;  4U8V D;  3DWL G;  2F8Y A;  1WAO 1;  3TXM A;  4U04 A;  3J5P A;  5EN5 D;  3AJI A;  3QNK A;  2OVB A;  3SFZ A;  3DST A;  2B6C A;  3CV0 A;  4GTR A;  3D9L A;  3LPZ A;  2WXR A;  2FBN A;  5D2M C;  3FUJ A;  3I5P A;  5AJD A;  2A5E A;  3IV0 A;  1DCE A;  4HVB A;  4WND A;  2L6J A;  4L2L A;  3SBT B;  4PS8 A;  4LUN U;  4I1A A;  3S7D A;  4GZ3 A;  1H2U A;  4AOF A;  4AEZ C;  3FTY A;  1OCR E;  1SA4 A;  3EU5 A;  4HOU A;  2LO6 A;  3ZGQ A;  3WG7 E;  4N39 A;  3HXC A;  1U2V G;  4J0U A;  3LVR E;  3ZVV A;  3ASO E;  3UXG A;  1DNP A;  4E6H A;  2X38 A;  5AAO A;  1WG0 A;  4I2W A;  4FHJ A;  1MHQ A;  1DC2 A;  2X6J A;  5KJM A;  3AS8 A;  3MYV A;  2GRN B;  3ASH A;  3TXN A;  2WVI A;  5BV1 A;  1NA0 A;  5FIN A;  1XGW A;  1A17 A;  2ETC A;  4YDE A;  2M63 A;  5G04 C;  3ZU7 B;  2NXP A;  4XE0 A;  5J90 A;  3BQO A;  4WUY A;  3DXK G;  2WXI A;  3N71 A;  3FTZ A;  2WXJ A;  4AVX A;  4O1P A;  5ENQ D;  5C1D A;  2H6H A;  3PE3 A;  3PH0 C;  5A23 A;  1UOH A;  3GZ1 A;  3MCX A;  1JPL A;  3KEA A;  4I43 A;  3SNX A;  2VYI A;  3BU8 A;  3TWV A;  4JB8 P;  4M3O A;  4G8K A;  3VLF A;  3G2S A;  1MJ0 A;  3HXE A;  2MRI A;  1TNB A;  1K1B A;  5B1A E;  4H7X A;  2GRP B;  3E32 A;  5ENR D;  3FTU A;  3D9I A;  4CGW A;  1KT0 A;  2BUG A;  5LOZ A;  2XRZ A;  3FP3 A;  2C2L A;  5AIJ A;  4XKC A;  4AP2 A;  1Z6T A;  1FVH A;  2OOE A;  2RFM A;  3Q9N C;  2DIW A;  4U7E B;  1KPS B;  1DVP A;  3C3Q A;  3UKR G;  4I1M A;  3Q49 B;  3UT4 A;  1ELR A;  3SF4 A;  4EPZ A;  4Q69 A;  2PNN A;  5JMN D;  1E96 B;  2GW1 A;  4B8A A;  4GTQ A;  2WXH A;  3W9F A;  2J8S D;  1X81 A;  1E90 A;  4JW1 A;  2OEV A;  5AJL A;  2L0T B;  3CK7 A;  4BX9 A;  3ZXS A;  1A5E A;  3C3R A;  3L13 A;  5BT1 A;  1OWL A;  4JC8 A;  5J08 A;  1N4P A;  1SA5 A;  5FZS A;  4EZK A;  5EID A;  1H0A A;  1AWC B;  3ABL E;  4F3V A;  1JCQ A;  3RU0 A;  1RZ4 A;  5AQ9 A;  3JYS A;  3SFX A;  1HH8 A;  3UM3 A;  5EYL A;  5BUZ A;  2FO7 A;  1YCS B;  1P5Q A;  2ZGG A;  2RKK A;  1EYH A;  1FPP A;  2HE0 A;  3Q7F A;  1KLX A;  2KAT A;  4A3V A;  2QY7 A;  2R5S A;  2OND A;  4U8H A;  5LP0 A;  4UI9 J;  4U63 A;  5CCL A;  4UWK A;  4JEH A;  2FO1 E;  3UM1 A;  2PM6 A;  1HG5 A;  1OY3 D;  1OCO E;  2YHC A;  5ARG A;  3ZYQ A;  3FEX A;  1IXV A;  5JHB A;  2ZIR A;  4UI9 K;  1UW4 B;  2WMO A;  2OCC E;  4BX8 A;  3ML8 A;  3ZYK A;  3FDH A;  4Q96 A;  4C0E A;  3CK8 A;  2UY1 B;  1JCR A;  2R05 A;  4FUL A;  3RK6 A;  4HBD A;  1SZA A;  3UKU G;  2CG3 A;  3OXG A;  4JXT A;  3FH7 A;  1O1T A;  3PDN A;  2R03 A;  3AU5 A;  4AV7 A;  2YNQ A;  4FAD A;  2VTB B;  4IUL A;  3HDX A;  2IOL A;  4CGV A;  4HLE A;  1N4S A;  1H19 A;  1HE8 A;  5KCM A;  4JZY A;  5IY5 E;  3ABK E;  3CHP A;  4HI8 A;  2Q7F A;  4JPS A;  1AP7 A;  2UWJ G;  3D9O A;  3DPY A;  3CVW A;  3ABM E;  3V30 A;  1UG3 A;  2HM8 A;  4TUU A;  2Y0B G;  3NB2 A;  3BG0 B;  3PUK A;  2ZXW E;  3CHO A;  3FTV A;  1OCZ E;  3LDZ A;  4MBG A;  4WNG A;  4TV3 A;  1EDU A;  4GU5 A;  2VSN A;  3PUJ A;  5EIL A;  4I6E A;  5KBA A;  2ETB A;  3TWW A;  1N54 A;  4GTP A;  1N95 A;  4YDW A;  3MV3 B;  1IQU A;  1YYH A;  3APC A;  5EX0 A;  4KXK B;  3ONL A;  5FTP A;  2IU1 A;  2LAI A;  5AN8 A;  1U3C A;  2XCC A;  3Q9U C;  1NZN A;  3B7R L;  3ZHE B;  4B8C B;  4CYM D;  3DEO A;  4DLQ A;  4N2Q A;  1N11 A;  5LX8 A;  2GRM A;  3QWP A;  3S7J A;  2ION A;  3ISM C;  1TN8 A;  1BD8 A;  2DVW A;  2RD0 A;  3OAW A;  4EBA A;  5FZQ A;  2V4L A;  2YHE A;  3CVP A;  2I9C A;  2WXL A;  4GML A;  2XPY A;  3E34 A;  2HO1 A;  4U8Y D;  3DRA A;  3BG1 B;  3UM0 A;  2DBA A;  3AS4 A;  3EDT B;  4GYY A;  4N3A A;  4WNE A;  5EYP F;  4YVO A;  4HXI A;  5T4Y A;  4ATG A;  4JL0 A;  2IEJ A;  1N9A A;  4RVB A;  3I4R B;  4NUR A;  5KWD A;  2OEW A;  3CKB A;  4J8D A;  5HKP A;  3QB2 A;  5BXU A;  4J6I A;  3I4G A;  4GMR A;  2V5Q C;  2EIN E;  3DPD A;  2BKK B;  1Z3X A;  4O60 A;  3FU5 A;  4PUC A;  3BUA A;  2P2C P;  2QYU A;  4ZFH A;  3FH5 A;  2WXG A;  4QQI A;  2WB2 A;  4I6J A;  3U3W A;  2VQ2 A;  5T8I A;  3P2B A;  2QFC A;  3ZPJ A;  4CDM A;  2AWI A;  5T3R A;  2H6F A;  4BTB A;  2A4Z A;  1IKN D;  2CFZ A;  4BY6 A;  1JCS A;  3KAE A;  1HZ4 A;  4B93 B;  1V54 E;  3VLE A;  5ENO D;  5LCW C;  4J8Y A;  4N2S A;  2PQR A;  2R17 C;  3V31 A;  3MA5 A;  4A3T A;  1G3N B;  2WXN A;  3AS5 A;  2IFU A;  2GRQ B;  4LER A;  2RFA A;  3C72 A;  2FI7 A;  1U3D A;  1H2V C;  3CVX A;  2QYJ A;  4JA9 A;  5ENP D;  4U0Z A;  4AY5 A;  4EEC A;  5G05 J;  4CCA A;  3PZD A;  3TWT A;  3CHS A;  5D66 A;  3RSE G;  4HB5 A;  3CHR A;  4LCT A;  4AJW A;  1Q2Z A;  2X6K A;  1TN7 A;  4G8L A;  3UTM A;  4ME2 A;  5D0O D;  2WMN A;  4DI3 A;  5CEC B;  3BEE A;  2I1K A;  4I6G A;  2XEV A;  3AG2 E;  2KBX A;  3RIB A;  4B0Z A;  1BI8 B;  3CKC A;  3SGH A;  1EF1 C;  2FUL A;  3L6A A;  2WQ6 A;  4URK A;  3DSX A;  4O1O A;  3R9A B;  4G2V A;  2XRY A;  4ACK A;  4ILG A;  4TXR A;  1BI7 B;  2DYR E;  3KSL A;  4J7W A;  4BT9 A;  2AXV A;  5LFA A;  4CZ2 D;  1E8Z A;  4GTV A;  1PC2 A;  2HYZ A;  1OWN A;  2V5F A;  1UN8 A;  4CT0 A;  4DUI A;  4HI9 A;  3UPV A;  2P58 C;  4GPK A;  2J4D A;  3L54 A;  3FUH A;  2ZU6 B;  4HRN A;  1JWG A;  1TEZ A;  3PVL A;  3PNL B;  3HG0 D;  2YQ8 A;  2XPI A;  3MEK A;  3ZN3 A;  4U0S A;  4HRM B;  3LJN A;  1BLX B;  4EBA G;  4I17 A;  2OV8 A;  3FTW A;  2P9K G;  4OAU C;  4ANV A;  3CEQ A;  2V4H C;  4CRW A;  3LY8 A;  4C0M A;  4UUC A;  2VSO E;  2DWZ A;  3D9P A;  4G24 A;  4E85 A;  3RO3 A;  2KZT B;  4DX7 D;  3I3N A;  2Y4T A;  4XEI G;  4EQF A;  2Y3A A;  3UIP C;  1D9S A;  3G2U A;  2H6G A;  1IYG A;  5JA4 D;  1N4R A;  1D8E A;  4BT8 A;  4O6F A;  4MKT A;  1IHG A;  2VSY A;  3MV2 B;  2A5U A;  3OXF A;  1ZU2 A;  4WWP A;  3HVE B;  3L16 A;  4U0U A;  3S7B A;  1HU3 A;  2LSV A;  4HNA D;  4UWH A;  3Q15 A;  3JUI A;  3TG5 A;  3QAQ A;  3FUM A;  5FJY A;  4L7T A;  1WY6 A;  4XI9 A;  5FQ8 A;  4UQZ A;  4M7C A;  3GW4 A;  3Q47 B;  3ZUV B;  3NOC D;  4Z68 A;  5HQ8 A;  3JCK C;  3PS6 A;  4JD2 G;  1GW6 A;  3IKO B;  2KCV A;  4P29 A;  5ENS D;  5FQ7 A;  2ZGD A;  4JHK A;  3QAR A;  2AJA A;  3TGO A;  5CMY A;  2X6H A;  3RRU A;  4KBQ A;  4ATZ D;  4A63 B;  3MJW A;  2H6I A;  3EIJ A;  4D10 C;  5E75 A;  3U4T A;  1W3B A;  2LUH A;  4KVM A;  3SHF A;  3DSV A;  4LEU A;  5EX3 A;  3ENE A;  4FU3 A;  2P9S G;  3AAA C;  3MGB A;  3Q5M A;  2J4B A;  2ILR A;  1Z5S C;  2PL2 A;  1TNO A;  3NQP A;  4L23 A;  3PE4 A;  3J5Q B;  1NL4 A;  4XKB A;  3APF A;  5KNG A;  1OWO A;  3HHM A;  1NA3 A;  2VGX B;  4GA0 A;  3ASG A;  1K3Z D;  1YMP A;  1K1A A;  2VGE A;  2J08 A;  4PS3 A;  3G2T A;  2CFU A;  3FU0 A;  4J8E A;  3DSW A;  1E7V A;  2PZI A;  3IEG A;  3K9I A;  4FJY A;  4PDX A;  1O5M A;  4Y6W A;  1H6P A;  3MKQ A;  2XS1 A;  2E0I A;  4GTO A;  3CGH A;  4CDN A;  1HG2 A;  3EJN A;  4XIF A;  5G2N A;  3EIQ C;  3ZNG A;  3R7R A;  4BEP A;  4GZC A;  5EIB E;  5AQ7 A;  1N94 A;  3ML9 A;  5CBN A;  3T5V A;  2Y1L E;  3B13 A;  4GTT A;  3CVV A;  3O48 A;  1QNF A;  5FQ4 A;  3DSS A;  1YA0 A;  4CEM A;  2KC7 A;  3KD7 A;  1HXI A;  4FHK A;  3V2X A;  1MX6 A;  2FF4 A;  2L9B A;  3UM2 A;  2RG8 A;  3LJ3 A;  3ZW3 A;  5HS0 A;  3VLD A;  4BSX A;  2C0L A;  5DBK A;  2GRO B;  3IHY A; 
#chains in the Genus database with same CATH homology
 1OCC E;  3AG2 E;  2EIL E;  5B1B E;  2EIN E;  3AG4 E;  1OCO E;  3ASO E;  2EIM E;  5B1A E;  5B3S E;  1OCR E;  3ABM E;  2EIK E;  3AG3 E;  3X2Q E;  3ASN E;  2Y69 E;  1V54 E;  2OCC E;  3WG7 E;  2ZXW E;  3ABL E;  3AG1 E;  1V55 E;  1OCZ E;  2EIJ E;  2DYR E;  5IY5 E;  2DYS E;  3ABK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...