1OCCE

Structure of bovine heart cytochrome c oxidase at the fully oxidized state
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
109
structure length
109
Chain Sequence
SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
pubmed rcsb
molecule tags Oxidoreductase (cytochrome(c)-oxygen)
molecule keywords CYTOCHROME C OXIDASE
total genus 39
structure length 109
sequence length 109
chains with identical sequence R
ec nomenclature
pdb deposition date 1996-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 1occE00
3AG3E 5B3SE 3AG1E 1OCOE 1V55E 1V54E 2EINE 5B1AE 2EIKE 2ZXWE 2DYRE 2EIME 3WG7E 3ABKE 2Y69E 3ASOE 3AG2E 3ABLE 2DYSE 3X2QE 1OCZE 2EILE 5IY5E 1OCCE 3AG4E 3ASNE 5B1BE 1OCRE 2OCCE 3ABME 2EIJE
chains in the Genus database with same CATH superfamily
4EBAG 3PVLA 4RQIA 5FQ4A 4JL0A 1S63A 1UN8A 5AJLA 3QKYA 4A1GA 4EPZA 3OXFA 5AAOA 3LY8A 4XIFA 2R05A 1QBQA 2MOWA 4WNFA 3WXXA 1AP7A 3IHVA 2RD0A 4JB8P 5AQ7A 3AG1E 1S64A 1N4RA 5CMWA 2BEDA 2QZAA 2L0TB 3EIQC 3AG4E 1MJ0A 4HBDA 2L0IA 3S7BA 3DSTA 1JCQA 1E7UA 1O1SA 3G2VA 3DSXA 2KCVA 4XI9A 2V0PA 3VTXA 5LCWC 5A23A 3Q79A 3AG2E 2WXNA 1Z3XA 1SA4A 3EDTB 2M63A 4J0UA 5BUZA 2GRPB 4WWNA 4DX2A 2JEKA 5CMYA 2FEZA 2RKKA 4XX5A 3FTWA 3ENEA 3E4BA 3TWRA 1N95A 4I2ZA 3AG3E 4WWPA 5LFAA 4HRMB 2IJGX 3SHFA 1FVHA 2LAIA 2GRRB 5BNWA 4QQIA 2PQNA 4E6HA 3DEOA 3ZYKA 4UWFA 4AY6A 4U8HA 4LNUD 3EHMA 3MGBA 3MV3B 4GAAA 2EINE 4U7EB 4O1OA 1Z6TA 4U0UA 3UM2A 1TNZA 4MBGA 5FJYA 2LSVA 4B8AA 2EILE 4GMRA 3ASNE 2BUGA 4IYPA 4GMLA 4URKA 1KPSB 1H0AA 4PS8A 2GW1A 5CEAA 2A5EA 2I1JA 3T5VA 5BXOA 4ACKA 4XI0A 2ZU6B 3IV0A 4BETA 2PM7A 4ME2A 5E75A 2VSOE 4B93B 4EBAA 1HE8A 5EIDA 2B6CA 3APCA 5FZRA 4I43A 2J8SD 2LUHA 1BD8A 5CBOA 3G2UA 4HOTA 2F8YA 4KYOB 4GZ3A 1JWFA 1OWNA 5T4YA 4UI9C 2XPZA 3Q9UC 2FBNA 3FULA 1FCHA 1OWOA 3KAEA 4HOUA 5CCMA 4FJYA 1MZCA 3TWXA 2VGYA 1JPLA 4OYSA 2P9NG 3OXLA 2OCCE 4I1MA 1N4PA 3ONKA 1B89A 1TEZA 1HH8A 2ETAA 4GCOA 3CIAA 2P2CP 3CEQA 3LY7A 4GYYA 1FVFA 5AQBA 5FTPA 4BSZB 1E96B 3JQ0A 3NB2A 5JJTA 1UG3A 4HRNA 5EYLA 1K1BA 3GZSA 4J8DA 3K9IA 3O4ZA 2X6KA 2L9BA 3HYMB 3Q73A 3ML8A 3PZ1A 4EZLA 3WG7E 3QC1A 4TXQA 5M72A 2CHXA 5ARGA 1X81A 3ULYA 4ANWA 1N4SA 4I9CA 2KZTA 1OT8A 4CEMA 1JCRA 2QFCA 5AENA 5AYWD 1BLXB 3CVWA 3FH5A 4EQFA 4FULA 1NI1A 5AJDA 4G24A 4L1BA 4EZKA 4G23A 3AAAC 3FDHA 4F1PA 1TJCA 2NC9A 4J8SA 4GZ6A 2EIKE 4PDXA 2C0MA 1OY3D 1K1AA 2BTDA 2X38A 3P2BA 4LNBA 4JW1A 2VTBA 4B89A 2J49A 1H6PA 3RRMB 2ZIRA 4M3OA 1HF8A 3IKOB 4G25A 4NIKA 1GW6A 2F37A 3MKQB 3ZHEA 1ZBPA 3SQVA 5EYPF 4HVBA 4RLYA 1L5JA 3QJZA 1HG2A 3E32A 1IQRA 3MYVA 2IY0C 3LDZA 3Q7FA 1A5EA 2CHWA 4JA7A 3MA5A 3MKQA 1HU3A 4N3BA 5EX3A 3FU0A 3URZA 4HI9A 5H7PA 4DX1A 3N71A 5BV1A 3RRUA 3Q4AB 2L6BA 3SO8A 4CT4A 2ZISA 3IEGA 4HOQA 3HXEA 1S70B 4MLPA 1SW6A 4W9RA 3BQOA 3DSWA 3T9KA 2ILRA 4IN3B 2XS8A 3V79K 2HYZA 3L54A 2L6JA 3PZ3A 1V54E 3BU8A 3V31A 3ZU7B 4ABNA 2P9PG 1WG0A 3DXMG 3E33A 4AM9A 1FT2A 3UX4A 1N11A 2R2LA 3U4TA 3ZGQA 2KBXA 1OCOE 1UOHA 2JABA 4FU3A 4GZ5A 4GA1A 3DEPA 4UWHA 3CVPA 3AS4A 4WUYA 4NQ0A 3MV2B 4GPKA 2WXGA 5DIZA 4ZFHA 4U04A 2LXMA 3U3WA 4J8EA 3QAQA 4AIFA 3KSQA 3Q7AA 4G2VA 5EKQD 3FTUA 3I3NA 3CVYA 3D9IA 1O5MA 4JZYA 2XGOA 4TUMA 2XZDG 4DUIA 3UPVA 4N3CA 3IXEA 5AARA 2CFZA 4L23A 4ATGA 5HRYA 4N2QA 4UUCA 3G2TA 5HQ8A 3IBEA 1N52A 4U0ZA 3B7TA 3ULEG 3PREA 1EF1C 1OCCE 2OOEA 4CGVA 4GPMA 2GROB 4FJZA 1Y6IA 2KCKA 4U0SA 2WXOA 3TWWA 1K8KG 2BKGA 5CECB 3CK9A 2EQXA 2XGMA 4OVVA 2WM9A 3FWVA 3LXUX 1TYQG 2XENA 2WXRA 5A6CA 1IYGA 2DBAA 2MHKA 2NYJA 2R03A 4A55A 4N5CA 3NOCD 5KNHD 4E85A 1E8XA 4ILIA 3AS5A 3FFLA 1HS6A 4WNDA 1FT1A 2WB2A 2GRMA 4DLOA 1FPPA 4ZHBA 4K0RA 3QWWA 1QNFA 1V55E 3E37A 1A17A 4FC8A 4GYOA 5CHEE 1U2VG 3L9TA 4ANXA 4N39A 1XNFA 4WAFA 3HIZA 1H6KA 5EILA 3ZYQA 3FTYA 3NZSA 1QZ2A 4PH4B 4G1TA 2DIWA 1E90A 3UXGA 4F6RD 5JJ7A 5FZSA 3CKBA 3GW4A 3QNKA 3SI5A 3CLJA 4CRWA 1IQUA 5G55A 2XEVA 4ATZD 2X6JA 3EJNA 3SBSA 4C9BB 1KZPA 3RO2A 2IO3C 3HDXA 1W3BA 1N0RA 3EHNA 2YHEA 4BESA 4AY5A 3ZXPA 4DX7D 3CK8A 4U63A 2XEHA 3L82A 5AN8A 4MKTA 2R17C 3ABME 2H6GA 3CK7A 1WAO1 4HLLA 3FTSA 2XGSA 3B7RL 2F8XK 1QYMA 1BU9A 3LS8A 2VQ2A 4JHRA 1BI8B 1IHGA 3FH8A 3PRZA 3V2XA 2FF4A 3R9AB 2XPYA 3FUFA 4F3VA 5CBNA 1TNBA 1KLXA 3PS6A 4YDWA 4A1SA 3EIJA 3T5XA 1DCQA 1SZAA 2J4BA 2PL2A 1SVXA 2WXKA 4GB9A 1YYHA 3CQGB 2R02A 1TNYA 2E2EA 3Q15A 3CKCA 4I9EA 3D9HA 1HZ4A 1D8EA 2XRZA 3RSEG 3ZXSA 3MZLB 1MX2A 3FU6A 4I1OB 1DCEA 5JHAA 4J8YA 4DLQA 4GZDA 2V8SE 5EX0A 4HNAD 3VLFA 3FU3A 1HX8A 4FLHA 4O60A 4GA2A 5J90A 2Y1LE 3UM0A 4IRUA 5FT9A 5FINA 2VTBB 3FP3A 2ETBA 4IULA 4YVQC 4UQXA 2AWIA 3V30A 4GMJA 3D9OA 4HB5A 1ZU2A 3LCAA 4N3AA 1OWMA 5ENRD 5ANRA 5IY5E 4UWLA 3C3QA 2X6FA 1BPOA 3NF1A 3UKRG 1NZNA 4EZJA 3FU5A 5AQ9A 3CQCB 5CRVA 3SGHA 4J6IA 3AU5A 3BEEA 3HXDA 5AIJA 1G3NB 4NRHB 3S7JA 5ENQD 4Z68A 3MEKA 4AXHA 4TXPA 1PC2A 4J7WA 3RK6A 1AWCB 4UWKA 3FEYA 4I2WA 2WXHA 1SA5A 3QDNA 4GTPA 4GTOA 5BW8C 4Q96A 3UINC 5BXUA 3FUKA 4DRXE 4FA6A 1Q2ZA 3CHQA 2VGEA 4KT6B 1YMPA 3J5PA 3L16A 4APOA 4XKCA 3ULQA 4APFA 2DWZA 2X3MA 2ZXWE 5ARFA 2PNNA 3QK0A 3QOUA 5DBKA 3G2WA 3TWVA 3BUAA 2H6HA 2AVPA 3SFYA 3VLEA 1YA0A 4FADA 2ONDA 3RRNB 1EYHA 4I6JA 3FH7A 2NXPA 4JD2G 2P9LG 4WNGA 3MCXA 2I2OA 4BSXA 4KVMA 3CHOA 4L9PA 2V5QC 1PAQA 2J08A 3D9JA 5ENNA 3E34A 2H6FA 3L08A 1YCSB 3UKUG 2WXLA 1E8WA 4BT9A 3CSTA 5FIOA 2DCPA 2CHZA 4LNGA 4UWGA 3SBTB 1ZB1A 2WQ7A 3TAXA 4KXKB 5KJKA 2J9QA 3CVNA 3CVQA 5J08A 2Y69E 1JWGA 4PS7A 4I6GA 3X2QE 2PQRA 3LY9A 3HXFA 4B8CB 3ZHEB 4A63B 1N0QA 3UIOC 2DVWA 5ENTD 4JA9A 3QWVA 1DVPA 3ABLE 4LSZE 4G8KA 4YVOA 1ELWA 1IKND 1ELKA 3I4RB 3JUEA 2YHCA 3ML9A 1PY1A 4KMOA 4RG9A 1XGWA 4U8YD 1H2UA 4BEPA 3LJNA 2CG3A 1SQMA 4EECA 2I6HA 3HG0D 4GA0A 2VSXE 4OVUA 1JUQA 3ZNGA 4G11A 1NL4A 3FTZA 4YDYA 3S7DA 3SD5A 1HFAA 2VJ8A 3PEVB 4CCAA 4GTSA 5CRUA 1UN9A 1UJJA 3PDNA 1HO8A 2XZTG 4K5AB 3JCKC 4MRUA 4GTVA 1EPUA 2Y4UA 2IOSA 1MQSA 2XCCA 2J4DA 1Z5SC 3D3MA 2IU1A 4K5CA 4U8VD 3ISMC 3UQ3A 3CHRA 2IF4A 4BWRA 1WM5A 3G2SA 3UM3A 3CR3A 3NZUA 1JCSA 1E8YA 2GRQB 4ANUA 3GYZA 3UT4A 2OVBA 3HRAA 2ZGGA 4H7YA 3U64A 2KXPC 4OAUC 5BT1A 4HOSA 4DI3A 3O48A 3GZ2A 3R7RA 3W9GA 3D9NA 4HFGA 2VSNA 3DPYA 4CDMA 3I4GA 5A7DB 4B0ZA 2IEJA 5E76A 2NSZA 3CHMA 3PE3A 1Z3YA 1N9AA 3EU9A 3DRAA 4J8FA 1TN6A 3LYAA 5G04J 3LVRE 5FQ6A 4O6FA 4XKBA 1MHQA 4ANVA 3NOGD 3OTNA 2QC9A 2FO1E 2DZOA 3HVEB 1IHBA 1Y8MA 5D66A 3APFA 2P9IG 1MYOA 4OAVB 4BFRA 3CHPA 5C1DA 2AXUA 4GTMA 5KWDA 5JJ6A 4P29A 5T8IA 4B94A 5G04C 3TGOA 4GTQA 5G05J 5HKPA 5D0OD 2WXFA 2UY1B 4YDOA 4U95D 5FQ7A 3DSUA 2VGXB 2IOLA 4DK5A 2OVFA 1SZ9A 3KSLA 2IONA 4JEUA 2YQ8A 5KJLA 4A3TA 3R9MA 3U66A 4KVOA 1ELRA 3JYSA 1QQEA 3ABKE 2VGXA 4BT8A 2CG2A 3FUEA 4JXTA 3ZW3A 4TXRA 5EDSA 4A3VA 3VLDA 4X8QA 2UY1A 3CV0A 5CEDB 2JLBA 2FI7A 4HORA 3D9KA 3R7QA 2XS1A 3L22A 3W9FA 4N2SA 4RVBA 3B13A 1IXVA 2Y4TA 1H2TC 2J09A 4LERA 5T3RA 4HRLA 4LCTA 4EHMA 1TNOA 5KJNA 2KC7A 2QYJA 4F53A 3C3OA 3MKRA 1OWLA 4UQYA 1TN8A 3FTXA 3CVXA 3I5PA 4RSYA 3ZIMA 5LX8A 3TWUA 2ZGDA 3AJIA 2KATA 4V3IA 4F1SA 4JHJA 2WXJA 3JUIA 5ANLA 2R5SA 1RZ4A 2V5FA 4GU5A 3TG4A 4GTTA 4Y6WA 3RJVA 4LUNU 2AXVA 4KBQA 4BERA 3IHYA 4LG6A 3DPDA 2IO2C 2B0OE 1K3ZD 3OXGA 5D0QD 4HS2A 2Y0BG 3KS2A 4N5QA 1OCRE 2GGFA 3SY2A 3LKUA 4YDEA 3LPZA 4AVXA 4KZCA 5KBAA 3UM1A 4O1PA 2HR2A 3Q49B 2WXQA 3KEAA 4DX5D 3DBSA 3QWPA 5AQAA 2VSYA 2QY7A 1LD8A 3PNTB 3DWLG 4U07A 5LP0A 1E7VA 4AJWA 2P9SG 3DSVA 4BTAA 3SZ7A 4PUCA 3OAWA 2BF0X 3UMVA 2X6HA 2XEEA 2YINA 1H6OA 4UQZA 3CVLA 1VDYA 3CVVA 3L6AA 3PE4A 5KJMA 5EN5D 3T8MA 3ZYMA 4C48B 1LTXA 3PEUB 4FLBA 3ASFA 3E30A 1WDYA 4CDNA 3PNLB 2KZTB 3FY4A 3UTMA 4BX9A 5LCWJ 3ESLA 5G2NA 1TR4A 3Q9NC 1D9SA 3ESKA 3SNXA 4D10C 3ONLA 4U96D 4FHKA 1NA3A 3FUDA 4NACA 3L17A 3TG5A 1DC2A 5D2MC 4BY6A 2LNIA 2XQ0A 3VTYA 5JHBA 4TRQA 2AW6A 2WQHA 3RIBA 2KM4A 5JMND 5C2YA 3MX3A 4HI8A 4PS3A 3PZ4A 4ILHB 3D9LA 3SFZA 4QFVA 2MYOA 4BTBA 2GRLA 4HXIA 1DNPA 2AXZA 3ZKJA 3APDA 2C0LA 2P58C 2BKKB 5HS0A 2OEWA 2WMNA 1N4QA 4H7XA 4I6EA 4XZ4A 3CVUA 5EIBE 1HG5A 1UJKA 4LRZA 3CGHA 4JHKA 1NFIE 2P9KG 3QB2A 4CDRA 4XE0A 3PH0C 2V4HC 3D9PA 3HVEA 4LEUA 4AP2A 3LJ3A 3ZYLA 1S0PA 2C2LA 5KNGA 4C0EA 1H19A 1LF8A 2QYUA 3EUVA 2F0YA 3ZVVA 5FQ8A 2PM6A 1KT1A 3NBNB 3ZRHA 3DSSA 3ZEFA 4JEHA 3NQPA 3B7SA 4DJAA 3TL5A 4Q94A 4WWOA 3Q47B 4HQDA 2EIJE 1P5QA 3PZ2A 2KCLA 3RKVA 4F7AA 4DPRA 3S2AA 3SF4A 2RFAA 3FUHA 2DYSE 2AJAA 3Q5MA 3QARA 3RU0A 1NP7A 4GYWA 2H6IA 1O1TA 2XHEA 2V4LA 5B3SE 5ENOD 3UI2A 4G8LA 4ILGA 2I1KA 3T8KA 3J5QB 2Q7FA 4RG6A 5ENPD 4BX8A 3B7UX 3UIPC 3LEWA 2HO1A 3FEXA 1E8ZA 4GZCA 1TJFA 1O1RA 4YNDA 3ASDA 2LO6A 2HM8A 4AOFA 3HHMA 4K03A 3TWTA 2MRIA 3PZDA 4C0MA 3C72A 2FO7A 3FHEA 2Y3AA 3Q75A 2X6IA 2OEVA 2WXPA 2R59A 1OCZE 1MX4A 3TJPA 3C3RA 2XRYA 4GTRA 5B1BE 2P9UG 2ETCA 5BPPA 3C98A 1OXJA 4ACLA 1MX6A 3MJWA 3P1UA 3TXMA 4AEZC 2WVIA 5CCLA 5LOZA 3ASOE 3AS8A 3GZ1A 3ZFWA 5G05C 2RG8A 4UI9K 2PZIA 1OUVA 2I9CA 4AV7A 4L2LA 5JA4D 2WMOA 2DZNA 3V2OA 4WNEA 1WY6A 1LD7A 5FWQA 4JVSA 3FTVA 2IFUA 2CFUA 4R7LA 1N54A 3U9WA 4UI9J 4Q69A 3FUIA 1INZA 1BI7B 3CSFA 5B1AE 4CZ2D 3UT7A 5FZQA 4DX6D 4GCNA 2OV8A 1KT0A 1U3CA 3SFXA 2XCBA 2A5UA 3HXBA 3FUJA 4KZ0A 2WXIA 2RFMA 1N94A 5BV0A 3EHQA 2VYIA 5ENSD 1RW2A 3B95A 3JXIA 1TNUA 4L7TA 1HXIA 4XEIG 2DYRE 4TUUA 4CYMD 4G26A 2WPVA 2YNQA 4M7CA 2LXLA 3NAWA 3L13A 3RO3A 2IQCA 1TN7A 4K5BA 3ASGA 3UUXA 3TXNA 2EIME 1D8DA 1NA0A 4TV3A 2A4ZA 4DI4A 3B7BA 3BG1B 2WXMA 3TWQA 4FP7A 4Y6CA 3ZPJA 2WQ6A 2HE0A 1H2VC 3FUNA 4CGWA 3CHSA 4I1AA 4MS6A 4JC8A 3JXJA 5HI7A 3ZN3A 3Q78A 4JPSA 3KEZA 3FUMA 1OWPA 4NURA 3C5RA 2FULA 5ITZF 1UW4B 4FHJA 2UWJG 3RAUA 3JQ1A 3ZUVB 3D9MA 3LVQE 1U3DA 3HXCA 2LAHA 1KZOA 3DXKG 3S7FA 4CT0A 3PUJA 4HLEA 3UT8A 1X5BA 3PUKA 3TWSA 2E0IA 1EDUA 2J07A 3ASHA 2GRNB 3AU4A 5KCMA 3BG0B 4I17A 3EU5A 3KD7A 3F6QA 2LSUA 3EHRA 4L2YA 5CERB 2XPIA
chains in the Genus database with same CATH topology
3AG3E 5B3SE 3AG1E 1OCOE 1V55E 1V54E 2EINE 5B1AE 2EIKE 2ZXWE 2DYRE 2EIME 3WG7E 3ABKE 2Y69E 3ASOE 3AG2E 3ABLE 2DYSE 3X2QE 1OCZE 2EILE 5IY5E 1OCCE 3AG4E 3ASNE 5B1BE 1OCRE 2OCCE 3ABME 2EIJE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG3 E;  5B3S E;  3AG1 E;  1OCO E;  1V55 E;  1V54 E;  2EIN E;  5B1A E;  2EIK E;  2ZXW E;  2DYR E;  2EIM E;  3WG7 E;  3ABK E;  2Y69 E;  3ASO E;  3AG2 E;  3ABL E;  2DYS E;  3X2Q E;  1OCZ E;  2EIL E;  5IY5 E;  1OCC E;  3AG4 E;  3ASN E;  5B1B E;  1OCR E;  2OCC E;  3ABM E;  2EIJ E; 
#chains in the Genus database with same CATH topology
 4EBA G;  3PVL A;  4RQI A;  5FQ4 A;  4JL0 A;  1S63 A;  1UN8 A;  5AJL A;  3QKY A;  4A1G A;  4EPZ A;  3OXF A;  5AAO A;  3LY8 A;  4XIF A;  2R05 A;  1QBQ A;  2MOW A;  4WNF A;  3WXX A;  1AP7 A;  3IHV A;  2RD0 A;  4JB8 P;  5AQ7 A;  3AG1 E;  1S64 A;  1N4R A;  5CMW A;  2BED A;  2QZA A;  2L0T B;  3EIQ C;  3AG4 E;  1MJ0 A;  4HBD A;  2L0I A;  3S7B A;  3DST A;  1JCQ A;  1E7U A;  1O1S A;  3G2V A;  3DSX A;  2KCV A;  4XI9 A;  2V0P A;  3VTX A;  5LCW C;  5A23 A;  3Q79 A;  3AG2 E;  2WXN A;  1Z3X A;  1SA4 A;  3EDT B;  2M63 A;  4J0U A;  5BUZ A;  2GRP B;  4WWN A;  4DX2 A;  2JEK A;  5CMY A;  2FEZ A;  2RKK A;  4XX5 A;  3FTW A;  3ENE A;  3E4B A;  3TWR A;  1N95 A;  4I2Z A;  3AG3 E;  4WWP A;  5LFA A;  4HRM B;  2IJG X;  3SHF A;  1FVH A;  2LAI A;  2GRR B;  5BNW A;  4QQI A;  2PQN A;  4E6H A;  3DEO A;  3ZYK A;  4UWF A;  4AY6 A;  4U8H A;  4LNU D;  3EHM A;  3MGB A;  3MV3 B;  4GAA A;  2EIN E;  4U7E B;  4O1O A;  1Z6T A;  4U0U A;  3UM2 A;  1TNZ A;  4MBG A;  5FJY A;  2LSV A;  4B8A A;  2EIL E;  4GMR A;  3ASN E;  2BUG A;  4IYP A;  4GML A;  4URK A;  1KPS B;  1H0A A;  4PS8 A;  2GW1 A;  5CEA A;  2A5E A;  2I1J A;  3T5V A;  5BXO A;  4ACK A;  4XI0 A;  2ZU6 B;  3IV0 A;  4BET A;  2PM7 A;  4ME2 A;  5E75 A;  2VSO E;  4B93 B;  4EBA A;  1HE8 A;  5EID A;  2B6C A;  3APC A;  5FZR A;  4I43 A;  2J8S D;  2LUH A;  1BD8 A;  5CBO A;  3G2U A;  4HOT A;  2F8Y A;  4KYO B;  4GZ3 A;  1JWF A;  1OWN A;  5T4Y A;  4UI9 C;  2XPZ A;  3Q9U C;  2FBN A;  3FUL A;  1FCH A;  1OWO A;  3KAE A;  4HOU A;  5CCM A;  4FJY A;  1MZC A;  3TWX A;  2VGY A;  1JPL A;  4OYS A;  2P9N G;  3OXL A;  2OCC E;  4I1M A;  1N4P A;  3ONK A;  1B89 A;  1TEZ A;  1HH8 A;  2ETA A;  4GCO A;  3CIA A;  2P2C P;  3CEQ A;  3LY7 A;  4GYY A;  1FVF A;  5AQB A;  5FTP A;  4BSZ B;  1E96 B;  3JQ0 A;  3NB2 A;  5JJT A;  1UG3 A;  4HRN A;  5EYL A;  1K1B A;  3GZS A;  4J8D A;  3K9I A;  3O4Z A;  2X6K A;  2L9B A;  3HYM B;  3Q73 A;  3ML8 A;  3PZ1 A;  4EZL A;  3WG7 E;  3QC1 A;  4TXQ A;  5M72 A;  2CHX A;  5ARG A;  1X81 A;  3ULY A;  4ANW A;  1N4S A;  4I9C A;  2KZT A;  1OT8 A;  4CEM A;  1JCR A;  2QFC A;  5AEN A;  5AYW D;  1BLX B;  3CVW A;  3FH5 A;  4EQF A;  4FUL A;  1NI1 A;  5AJD A;  4G24 A;  4L1B A;  4EZK A;  4G23 A;  3AAA C;  3FDH A;  4F1P A;  1TJC A;  2NC9 A;  4J8S A;  4GZ6 A;  2EIK E;  4PDX A;  2C0M A;  1OY3 D;  1K1A A;  2BTD A;  2X38 A;  3P2B A;  4LNB A;  4JW1 A;  2VTB A;  4B89 A;  2J49 A;  1H6P A;  3RRM B;  2ZIR A;  4M3O A;  1HF8 A;  3IKO B;  4G25 A;  4NIK A;  1GW6 A;  2F37 A;  3MKQ B;  3ZHE A;  1ZBP A;  3SQV A;  5EYP F;  4HVB A;  4RLY A;  1L5J A;  3QJZ A;  1HG2 A;  3E32 A;  1IQR A;  3MYV A;  2IY0 C;  3LDZ A;  3Q7F A;  1A5E A;  2CHW A;  4JA7 A;  3MA5 A;  3MKQ A;  1HU3 A;  4N3B A;  5EX3 A;  3FU0 A;  3URZ A;  4HI9 A;  5H7P A;  4DX1 A;  3N71 A;  5BV1 A;  3RRU A;  3Q4A B;  2L6B A;  3SO8 A;  4CT4 A;  2ZIS A;  3IEG A;  4HOQ A;  3HXE A;  1S70 B;  4MLP A;  1SW6 A;  4W9R A;  3BQO A;  3DSW A;  3T9K A;  2ILR A;  4IN3 B;  2XS8 A;  3V79 K;  2HYZ A;  3L54 A;  2L6J A;  3PZ3 A;  1V54 E;  3BU8 A;  3V31 A;  3ZU7 B;  4ABN A;  2P9P G;  1WG0 A;  3DXM G;  3E33 A;  4AM9 A;  1FT2 A;  3UX4 A;  1N11 A;  2R2L A;  3U4T A;  3ZGQ A;  2KBX A;  1OCO E;  1UOH A;  2JAB A;  4FU3 A;  4GZ5 A;  4GA1 A;  3DEP A;  4UWH A;  3CVP A;  3AS4 A;  4WUY A;  4NQ0 A;  3MV2 B;  4GPK A;  2WXG A;  5DIZ A;  4ZFH A;  4U04 A;  2LXM A;  3U3W A;  4J8E A;  3QAQ A;  4AIF A;  3KSQ A;  3Q7A A;  4G2V A;  5EKQ D;  3FTU A;  3I3N A;  3CVY A;  3D9I A;  1O5M A;  4JZY A;  2XGO A;  4TUM A;  2XZD G;  4DUI A;  3UPV A;  4N3C A;  3IXE A;  5AAR A;  2CFZ A;  4L23 A;  4ATG A;  5HRY A;  4N2Q A;  4UUC A;  3G2T A;  5HQ8 A;  3IBE A;  1N52 A;  4U0Z A;  3B7T A;  3ULE G;  3PRE A;  1EF1 C;  1OCC E;  2OOE A;  4CGV A;  4GPM A;  2GRO B;  4FJZ A;  1Y6I A;  2KCK A;  4U0S A;  2WXO A;  3TWW A;  1K8K G;  2BKG A;  5CEC B;  3CK9 A;  2EQX A;  2XGM A;  4OVV A;  2WM9 A;  3FWV A;  3LXU X;  1TYQ G;  2XEN A;  2WXR A;  5A6C A;  1IYG A;  2DBA A;  2MHK A;  2NYJ A;  2R03 A;  4A55 A;  4N5C A;  3NOC D;  5KNH D;  4E85 A;  1E8X A;  4ILI A;  3AS5 A;  3FFL A;  1HS6 A;  4WND A;  1FT1 A;  2WB2 A;  2GRM A;  4DLO A;  1FPP A;  4ZHB A;  4K0R A;  3QWW A;  1QNF A;  1V55 E;  3E37 A;  1A17 A;  4FC8 A;  4GYO A;  5CHE E;  1U2V G;  3L9T A;  4ANX A;  4N39 A;  1XNF A;  4WAF A;  3HIZ A;  1H6K A;  5EIL A;  3ZYQ A;  3FTY A;  3NZS A;  1QZ2 A;  4PH4 B;  4G1T A;  2DIW A;  1E90 A;  3UXG A;  4F6R D;  5JJ7 A;  5FZS A;  3CKB A;  3GW4 A;  3QNK A;  3SI5 A;  3CLJ A;  4CRW A;  1IQU A;  5G55 A;  2XEV A;  4ATZ D;  2X6J A;  3EJN A;  3SBS A;  4C9B B;  1KZP A;  3RO2 A;  2IO3 C;  3HDX A;  1W3B A;  1N0R A;  3EHN A;  2YHE A;  4BES A;  4AY5 A;  3ZXP A;  4DX7 D;  3CK8 A;  4U63 A;  2XEH A;  3L82 A;  5AN8 A;  4MKT A;  2R17 C;  3ABM E;  2H6G A;  3CK7 A;  1WAO 1;  4HLL A;  3FTS A;  2XGS A;  3B7R L;  2F8X K;  1QYM A;  1BU9 A;  3LS8 A;  2VQ2 A;  4JHR A;  1BI8 B;  1IHG A;  3FH8 A;  3PRZ A;  3V2X A;  2FF4 A;  3R9A B;  2XPY A;  3FUF A;  4F3V A;  5CBN A;  1TNB A;  1KLX A;  3PS6 A;  4YDW A;  4A1S A;  3EIJ A;  3T5X A;  1DCQ A;  1SZA A;  2J4B A;  2PL2 A;  1SVX A;  2WXK A;  4GB9 A;  1YYH A;  3CQG B;  2R02 A;  1TNY A;  2E2E A;  3Q15 A;  3CKC A;  4I9E A;  3D9H A;  1HZ4 A;  1D8E A;  2XRZ A;  3RSE G;  3ZXS A;  3MZL B;  1MX2 A;  3FU6 A;  4I1O B;  1DCE A;  5JHA A;  4J8Y A;  4DLQ A;  4GZD A;  2V8S E;  5EX0 A;  4HNA D;  3VLF A;  3FU3 A;  1HX8 A;  4FLH A;  4O60 A;  4GA2 A;  5J90 A;  2Y1L E;  3UM0 A;  4IRU A;  5FT9 A;  5FIN A;  2VTB B;  3FP3 A;  2ETB A;  4IUL A;  4YVQ C;  4UQX A;  2AWI A;  3V30 A;  4GMJ A;  3D9O A;  4HB5 A;  1ZU2 A;  3LCA A;  4N3A A;  1OWM A;  5ENR D;  5ANR A;  5IY5 E;  4UWL A;  3C3Q A;  2X6F A;  1BPO A;  3NF1 A;  3UKR G;  1NZN A;  4EZJ A;  3FU5 A;  5AQ9 A;  3CQC B;  5CRV A;  3SGH A;  4J6I A;  3AU5 A;  3BEE A;  3HXD A;  5AIJ A;  1G3N B;  4NRH B;  3S7J A;  5ENQ D;  4Z68 A;  3MEK A;  4AXH A;  4TXP A;  1PC2 A;  4J7W A;  3RK6 A;  1AWC B;  4UWK A;  3FEY A;  4I2W A;  2WXH A;  1SA5 A;  3QDN A;  4GTP A;  4GTO A;  5BW8 C;  4Q96 A;  3UIN C;  5BXU A;  3FUK A;  4DRX E;  4FA6 A;  1Q2Z A;  3CHQ A;  2VGE A;  4KT6 B;  1YMP A;  3J5P A;  3L16 A;  4APO A;  4XKC A;  3ULQ A;  4APF A;  2DWZ A;  2X3M A;  2ZXW E;  5ARF A;  2PNN A;  3QK0 A;  3QOU A;  5DBK A;  3G2W A;  3TWV A;  3BUA A;  2H6H A;  2AVP A;  3SFY A;  3VLE A;  1YA0 A;  4FAD A;  2OND A;  3RRN B;  1EYH A;  4I6J A;  3FH7 A;  2NXP A;  4JD2 G;  2P9L G;  4WNG A;  3MCX A;  2I2O A;  4BSX A;  4KVM A;  3CHO A;  4L9P A;  2V5Q C;  1PAQ A;  2J08 A;  3D9J A;  5ENN A;  3E34 A;  2H6F A;  3L08 A;  1YCS B;  3UKU G;  2WXL A;  1E8W A;  4BT9 A;  3CST A;  5FIO A;  2DCP A;  2CHZ A;  4LNG A;  4UWG A;  3SBT B;  1ZB1 A;  2WQ7 A;  3TAX A;  4KXK B;  5KJK A;  2J9Q A;  3CVN A;  3CVQ A;  5J08 A;  2Y69 E;  1JWG A;  4PS7 A;  4I6G A;  3X2Q E;  2PQR A;  3LY9 A;  3HXF A;  4B8C B;  3ZHE B;  4A63 B;  1N0Q A;  3UIO C;  2DVW A;  5ENT D;  4JA9 A;  3QWV A;  1DVP A;  3ABL E;  4LSZ E;  4G8K A;  4YVO A;  1ELW A;  1IKN D;  1ELK A;  3I4R B;  3JUE A;  2YHC A;  3ML9 A;  1PY1 A;  4KMO A;  4RG9 A;  1XGW A;  4U8Y D;  1H2U A;  4BEP A;  3LJN A;  2CG3 A;  1SQM A;  4EEC A;  2I6H A;  3HG0 D;  4GA0 A;  2VSX E;  4OVU A;  1JUQ A;  3ZNG A;  4G11 A;  1NL4 A;  3FTZ A;  4YDY A;  3S7D A;  3SD5 A;  1HFA A;  2VJ8 A;  3PEV B;  4CCA A;  4GTS A;  5CRU A;  1UN9 A;  1UJJ A;  3PDN A;  1HO8 A;  2XZT G;  4K5A B;  3JCK C;  4MRU A;  4GTV A;  1EPU A;  2Y4U A;  2IOS A;  1MQS A;  2XCC A;  2J4D A;  1Z5S C;  3D3M A;  2IU1 A;  4K5C A;  4U8V D;  3ISM C;  3UQ3 A;  3CHR A;  2IF4 A;  4BWR A;  1WM5 A;  3G2S A;  3UM3 A;  3CR3 A;  3NZU A;  1JCS A;  1E8Y A;  2GRQ B;  4ANU A;  3GYZ A;  3UT4 A;  2OVB A;  3HRA A;  2ZGG A;  4H7Y A;  3U64 A;  2KXP C;  4OAU C;  5BT1 A;  4HOS A;  4DI3 A;  3O48 A;  3GZ2 A;  3R7R A;  3W9G A;  3D9N A;  4HFG A;  2VSN A;  3DPY A;  4CDM A;  3I4G A;  5A7D B;  4B0Z A;  2IEJ A;  5E76 A;  2NSZ A;  3CHM A;  3PE3 A;  1Z3Y A;  1N9A A;  3EU9 A;  3DRA A;  4J8F A;  1TN6 A;  3LYA A;  5G04 J;  3LVR E;  5FQ6 A;  4O6F A;  4XKB A;  1MHQ A;  4ANV A;  3NOG D;  3OTN A;  2QC9 A;  2FO1 E;  2DZO A;  3HVE B;  1IHB A;  1Y8M A;  5D66 A;  3APF A;  2P9I G;  1MYO A;  4OAV B;  4BFR A;  3CHP A;  5C1D A;  2AXU A;  4GTM A;  5KWD A;  5JJ6 A;  4P29 A;  5T8I A;  4B94 A;  5G04 C;  3TGO A;  4GTQ A;  5G05 J;  5HKP A;  5D0O D;  2WXF A;  2UY1 B;  4YDO A;  4U95 D;  5FQ7 A;  3DSU A;  2VGX B;  2IOL A;  4DK5 A;  2OVF A;  1SZ9 A;  3KSL A;  2ION A;  4JEU A;  2YQ8 A;  5KJL A;  4A3T A;  3R9M A;  3U66 A;  4KVO A;  1ELR A;  3JYS A;  1QQE A;  3ABK E;  2VGX A;  4BT8 A;  2CG2 A;  3FUE A;  4JXT A;  3ZW3 A;  4TXR A;  5EDS A;  4A3V A;  3VLD A;  4X8Q A;  2UY1 A;  3CV0 A;  5CED B;  2JLB A;  2FI7 A;  4HOR A;  3D9K A;  3R7Q A;  2XS1 A;  3L22 A;  3W9F A;  4N2S A;  4RVB A;  3B13 A;  1IXV A;  2Y4T A;  1H2T C;  2J09 A;  4LER A;  5T3R A;  4HRL A;  4LCT A;  4EHM A;  1TNO A;  5KJN A;  2KC7 A;  2QYJ A;  4F53 A;  3C3O A;  3MKR A;  1OWL A;  4UQY A;  1TN8 A;  3FTX A;  3CVX A;  3I5P A;  4RSY A;  3ZIM A;  5LX8 A;  3TWU A;  2ZGD A;  3AJI A;  2KAT A;  4V3I A;  4F1S A;  4JHJ A;  2WXJ A;  3JUI A;  5ANL A;  2R5S A;  1RZ4 A;  2V5F A;  4GU5 A;  3TG4 A;  4GTT A;  4Y6W A;  3RJV A;  4LUN U;  2AXV A;  4KBQ A;  4BER A;  3IHY A;  4LG6 A;  3DPD A;  2IO2 C;  2B0O E;  1K3Z D;  3OXG A;  5D0Q D;  4HS2 A;  2Y0B G;  3KS2 A;  4N5Q A;  1OCR E;  2GGF A;  3SY2 A;  3LKU A;  4YDE A;  3LPZ A;  4AVX A;  4KZC A;  5KBA A;  3UM1 A;  4O1P A;  2HR2 A;  3Q49 B;  2WXQ A;  3KEA A;  4DX5 D;  3DBS A;  3QWP A;  5AQA A;  2VSY A;  2QY7 A;  1LD8 A;  3PNT B;  3DWL G;  4U07 A;  5LP0 A;  1E7V A;  4AJW A;  2P9S G;  3DSV A;  4BTA A;  3SZ7 A;  4PUC A;  3OAW A;  2BF0 X;  3UMV A;  2X6H A;  2XEE A;  2YIN A;  1H6O A;  4UQZ A;  3CVL A;  1VDY A;  3CVV A;  3L6A A;  3PE4 A;  5KJM A;  5EN5 D;  3T8M A;  3ZYM A;  4C48 B;  1LTX A;  3PEU B;  4FLB A;  3ASF A;  3E30 A;  1WDY A;  4CDN A;  3PNL B;  2KZT B;  3FY4 A;  3UTM A;  4BX9 A;  5LCW J;  3ESL A;  5G2N A;  1TR4 A;  3Q9N C;  1D9S A;  3ESK A;  3SNX A;  4D10 C;  3ONL A;  4U96 D;  4FHK A;  1NA3 A;  3FUD A;  4NAC A;  3L17 A;  3TG5 A;  1DC2 A;  5D2M C;  4BY6 A;  2LNI A;  2XQ0 A;  3VTY A;  5JHB A;  4TRQ A;  2AW6 A;  2WQH A;  3RIB A;  2KM4 A;  5JMN D;  5C2Y A;  3MX3 A;  4HI8 A;  4PS3 A;  3PZ4 A;  4ILH B;  3D9L A;  3SFZ A;  4QFV A;  2MYO A;  4BTB A;  2GRL A;  4HXI A;  1DNP A;  2AXZ A;  3ZKJ A;  3APD A;  2C0L A;  2P58 C;  2BKK B;  5HS0 A;  2OEW A;  2WMN A;  1N4Q A;  4H7X A;  4I6E A;  4XZ4 A;  3CVU A;  5EIB E;  1HG5 A;  1UJK A;  4LRZ A;  3CGH A;  4JHK A;  1NFI E;  2P9K G;  3QB2 A;  4CDR A;  4XE0 A;  3PH0 C;  2V4H C;  3D9P A;  3HVE A;  4LEU A;  4AP2 A;  3LJ3 A;  3ZYL A;  1S0P A;  2C2L A;  5KNG A;  4C0E A;  1H19 A;  1LF8 A;  2QYU A;  3EUV A;  2F0Y A;  3ZVV A;  5FQ8 A;  2PM6 A;  1KT1 A;  3NBN B;  3ZRH A;  3DSS A;  3ZEF A;  4JEH A;  3NQP A;  3B7S A;  4DJA A;  3TL5 A;  4Q94 A;  4WWO A;  3Q47 B;  4HQD A;  2EIJ E;  1P5Q A;  3PZ2 A;  2KCL A;  3RKV A;  4F7A A;  4DPR A;  3S2A A;  3SF4 A;  2RFA A;  3FUH A;  2DYS E;  2AJA A;  3Q5M A;  3QAR A;  3RU0 A;  1NP7 A;  4GYW A;  2H6I A;  1O1T A;  2XHE A;  2V4L A;  5B3S E;  5ENO D;  3UI2 A;  4G8L A;  4ILG A;  2I1K A;  3T8K A;  3J5Q B;  2Q7F A;  4RG6 A;  5ENP D;  4BX8 A;  3B7U X;  3UIP C;  3LEW A;  2HO1 A;  3FEX A;  1E8Z A;  4GZC A;  1TJF A;  1O1R A;  4YND A;  3ASD A;  2LO6 A;  2HM8 A;  4AOF A;  3HHM A;  4K03 A;  3TWT A;  2MRI A;  3PZD A;  4C0M A;  3C72 A;  2FO7 A;  3FHE A;  2Y3A A;  3Q75 A;  2X6I A;  2OEV A;  2WXP A;  2R59 A;  1OCZ E;  1MX4 A;  3TJP A;  3C3R A;  2XRY A;  4GTR A;  5B1B E;  2P9U G;  2ETC A;  5BPP A;  3C98 A;  1OXJ A;  4ACL A;  1MX6 A;  3MJW A;  3P1U A;  3TXM A;  4AEZ C;  2WVI A;  5CCL A;  5LOZ A;  3ASO E;  3AS8 A;  3GZ1 A;  3ZFW A;  5G05 C;  2RG8 A;  4UI9 K;  2PZI A;  1OUV A;  2I9C A;  4AV7 A;  4L2L A;  5JA4 D;  2WMO A;  2DZN A;  3V2O A;  4WNE A;  1WY6 A;  1LD7 A;  5FWQ A;  4JVS A;  3FTV A;  2IFU A;  2CFU A;  4R7L A;  1N54 A;  3U9W A;  4UI9 J;  4Q69 A;  3FUI A;  1INZ A;  1BI7 B;  3CSF A;  5B1A E;  4CZ2 D;  3UT7 A;  5FZQ A;  4DX6 D;  4GCN A;  2OV8 A;  1KT0 A;  1U3C A;  3SFX A;  2XCB A;  2A5U A;  3HXB A;  3FUJ A;  4KZ0 A;  2WXI A;  2RFM A;  1N94 A;  5BV0 A;  3EHQ A;  2VYI A;  5ENS D;  1RW2 A;  3B95 A;  3JXI A;  1TNU A;  4L7T A;  1HXI A;  4XEI G;  2DYR E;  4TUU A;  4CYM D;  4G26 A;  2WPV A;  2YNQ A;  4M7C A;  2LXL A;  3NAW A;  3L13 A;  3RO3 A;  2IQC A;  1TN7 A;  4K5B A;  3ASG A;  3UUX A;  3TXN A;  2EIM E;  1D8D A;  1NA0 A;  4TV3 A;  2A4Z A;  4DI4 A;  3B7B A;  3BG1 B;  2WXM A;  3TWQ A;  4FP7 A;  4Y6C A;  3ZPJ A;  2WQ6 A;  2HE0 A;  1H2V C;  3FUN A;  4CGW A;  3CHS A;  4I1A A;  4MS6 A;  4JC8 A;  3JXJ A;  5HI7 A;  3ZN3 A;  3Q78 A;  4JPS A;  3KEZ A;  3FUM A;  1OWP A;  4NUR A;  3C5R A;  2FUL A;  5ITZ F;  1UW4 B;  4FHJ A;  2UWJ G;  3RAU A;  3JQ1 A;  3ZUV B;  3D9M A;  3LVQ E;  1U3D A;  3HXC A;  2LAH A;  1KZO A;  3DXK G;  3S7F A;  4CT0 A;  3PUJ A;  4HLE A;  3UT8 A;  1X5B A;  3PUK A;  3TWS A;  2E0I A;  1EDU A;  2J07 A;  3ASH A;  2GRN B;  3AU4 A;  5KCM A;  3BG0 B;  4I17 A;  3EU5 A;  3KD7 A;  3F6Q A;  2LSU A;  3EHR A;  4L2Y A;  5CER B;  2XPI A; 
#chains in the Genus database with same CATH homology
 3AG3 E;  5B3S E;  3AG1 E;  1OCO E;  1V55 E;  1V54 E;  2EIN E;  5B1A E;  2EIK E;  2ZXW E;  2DYR E;  2EIM E;  3WG7 E;  3ABK E;  2Y69 E;  3ASO E;  3AG2 E;  3ABL E;  2DYS E;  3X2Q E;  1OCZ E;  2EIL E;  5IY5 E;  1OCC E;  3AG4 E;  3ASN E;  5B1B E;  1OCR E;  2OCC E;  3ABM E;  2EIJ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...