2IOLA

Crystal structure of the c-terminal ma3 domain of pdcd4 (mouse); form 1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
127
structure length
127
Chain Sequence
QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed Cell Death 4, Pdcd4
publication title Structural basis for inhibition of translation by the tumor suppressor pdcd4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antitumor protein
total genus 43
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iolA00
2VSOE 1H2UA 4CRWA 3L6AA 3FEXA 4B8CB 1H2TC 5ANRA 2KZTB 2HM8A 3JUIA 2FULA 4GMJA 3FEYA 3D3MA 2ZU6B 2IOLA 1UG3A 2GGFA 2I2OA 3EIQC 2IOSA 1PAQA 2NSZA 2IU1A 4JHKA 4CEMA 1H6KA 2RG8A 4B8AA 4JHJA 1HU3A 1N54A 4LUNU 4C9BB 4GMLA 1UW4B 2KZTA 4CT4A 1H2VC 3EIJA 4IULA 1N52A 3RK6A 2IONA 2VSXE 4B89A
chains in the Genus database with same CATH superfamily
2CFZA 1QYMA 1W3BA 5C1DA 3CLJA 4LSZE 2HM8A 4AY5A 4F1PA 3Q7AA 2BF0X 3IV0A 4KZCA 3T5VA 5B1AE 4CDRA 4DX1A 5KJKA 5ITZF 3VLFA 3BG1B 4BSXA 2OEWA 1OWOA 4XI0A 3MX3A 3L08A 1N94A 1Z6TA 2RFAA 1HH8A 3ML8A 2EIKE 3QWVA 1AWCB 4ABNA 5BXOA 1NI1A 4E85A 4G24A 2BUGA 4A63B 3D9HA 2C0LA 5ENSD 2WXHA 2PZIA 4MS6A 3TG4A 2ZXWE 3ASDA 3AU5A 3PZ4A 2XGSA 4U07A 4RG6A 4BWRA 2WM9A 2XHEA 1TNUA 4LUNU 4ANUA 2GRMA 1N0QA 3PVLA 3FUIA 3UX4A 3HXDA 2J07A 4AEZC 2EIJE 3EUVA 4JW1A 4YDOA 1K8KG 3FUMA 4L1BA 3ZKJA 3D9PA 3HRAA 2WXIA 3OXLA 3NB2A 3ZXPA 3CHOA 3EJNA 4O1PA 4KYOB 2ZGDA 2NXPA 1QNFA 4UI9K 2A4ZA 3CVPA 3MKQB 4U95D 3T8MA 3S7DA 4U0SA 3BG0B 4GZ3A 3UXGA 3TGOA 3B7RL 3DRAA 4I1MA 4B0ZA 4ATZD 4G25A 3UPVA 4J8YA 1IQUA 2VSYA 4BETA 2YHEA 4GZCA 2QYJA 1IKND 2XEHA 5JHAA 3FU0A 5HRYA 4AY6A 2R2LA 2I9CA 4FP7A 1E7VA 5T8IA 4K5CA 1HS6A 3QB2A 5T4YA 3DEOA 2XCBA 1U2VG 4WWOA 2V8SE 3D9MA 5CRVA 5EYPF 4HLEA 5FQ7A 2Y4TA 3ZFWA 3FDHA 4BX9A 3ONKA 4GB9A 5FZQA 4U96D 2B6CA 3SFZA 3ZUVB 5EIDA 1A17A 5A7DB 4UQYA 3SGHA 4TXPA 3AG3E 3EHMA 3LY9A 5LCWC 2P9PG 2OV8A 3CVLA 4LNUD 2VSXE 1K3ZD 2ETCA 5JHBA 4BESA 1S0PA 3CVQA 3IEGA 5FQ4A 3E32A 3ZIMA 3Q4AB 2LUHA 3FTUA 3Q15A 3APFA 4ZHBA 3P2BA 3R9AB 1UW4B 4WUYA 3EIJA 2J4BA 4OVVA 4N5QA 3TJPA 2CHWA 5EN5D 1TN7A 4U04A 1OCCE 4GTVA 4WNFA 1X5BA 3KAEA 4CGVA 2XCCA 3TWSA 2KM4A 3L17A 3QDNA 3U4TA 3MJWA 3X2QE 2JABA 2CFUA 1LD8A 4ME2A 2FO1E 3ZGQA 4N3CA 2J08A 4I6JA 2KC7A 3UIOC 5AJLA 4HOTA 4FHKA 2JEKA 3VLEA 4TRQA 3PZ2A 4FC8A 3ESLA 4C0MA 1TR4A 4U0ZA 4JEUA 4AXHA 3DEPA 3SZ7A 1Q2ZA 5KWDA 3FULA 2WXPA 2GRNB 4IN3B 4D10C 4DX2A 4BERA 3O48A 1SZAA 4GMLA 1H2VC 4UI9J 4L9PA 3LY7A 3FUHA 1KT1A 4UWFA 3KEZA 4DLQA 5EYLA 3C98A 1TJFA 3RAUA 3DPDA 2AWIA 2IOLA 2AXUA 3G2SA 5BW8C 4ANVA 4GTQA 5CMYA 1EF1C 2CHZA 3PZDA 2IU1A 4A3VA 4MBGA 3ML9A 3ASNE 3GZSA 4FU3A 4IULA 3V30A 4EHMA 4GYOA 4YVOA 4LG6A 2Y1LE 2DVWA 4ILIA 3FWVA 4GMJA 4N2QA 3D9KA 1OWLA 2WB2A 1ELRA 4BFRA 4K5AB 3C3RA 2BEDA 5AN8A 3RIBA 3S7BA 4L23A 1WM5A 2VGXA 2C0MA 1VDYA 2GW1A 5CRUA 2CG3A 1Y8MA 3S7FA 5KNHD 3V2XA 3V79K 4W9RA 2LNIA 5EX3A 3VTXA 4A55A 3TAXA 2P2CP 2ZGGA 3FP3A 2IO3C 1NL4A 1N54A 2LXLA 2NC9A 4U8VD 1N52A 3QK0A 5BNWA 3C3QA 3BEEA 5FINA 3HIZA 4J8SA 2XS8A 4HOUA 3I4RB 3FEYA 1L5JA 1N4RA 1RZ4A 5J90A 3Q7FA 3B7UX 1RW2A 3UI2A 1X81A 3TWQA 1EYHA 3JXIA 3UM2A 5AARA 3EHQA 2GRLA 4BY6A 1HXIA 2M63A 5CERB 5AQAA 5CCLA 3U64A 1U3CA 3BUAA 1LD7A 2J49A 3MGBA 4FLBA 3FH8A 4DX7D 4EQFA 3KEAA 3FTYA 1B89A 1TN6A 4UWGA 1E8WA 2FO7A 1JWGA 5KJLA 3HXBA 4KVOA 4RSYA 3AS8A 3MV3B 4M3OA 5CECB 1E8XA 1O5MA 3ZYMA 1NFIE 1BI7B 5EDSA 4CT4A 1E90A 2KCVA 3FUEA 3PE3A 5DIZA 2GRQB 4JL0A 4Z68A 4GMRA 3GW4A 3LDZA 1H0AA 2IEJA 5ARGA 3B95A 3CVNA 3QOUA 2WXKA 5D2MC 3B7TA 1S63A 3Q73A 3CVWA 2L0IA 1E7UA 3ASOE 3SO8A 3CHQA 4GA1A 1BD8A 3ENEA 3HDXA 4AIFA 3RKVA 3MKRA 2IO2C 4TXQA 3B13A 1IQRA 3E33A 2YHCA 1DVPA 4EECA 4N3BA 3QNKA 4GAAA 3ABLE 2V0PA 2YNQA 1A5EA 4CYMD 3DSSA 2Q7FA 3BQOA 2WQ7A 2FULA 3HHMA 3J5PA 5G04J 1YMPA 4NQ0A 3UQ3A 4OAUC 2E0IA 4DJAA 3O4ZA 2VSOE 3FFLA 4DI4A 2XEEA 5ENQD 3W9FA 5EIBE 3CQCB 3AG4E 3TWTA 1INZA 5E76A 4Q96A 1UJKA 5BPPA 4YDYA 3CKBA 3PH0C 3ULYA 4UWHA 2OEVA 4TXRA 4CDMA 3JCKC 2R59A 5EX0A 1FVHA 2AXZA 4HXIA 1FT2A 3AS4A 4IRUA 4ATGA 4WNDA 4C0EA 2KXPC 4I6GA 1V55E 2CHXA 1MX2A 1HZ4A 1E96B 2WXNA 5J08A 3DSUA 2J4DA 4B94A 3JYSA 2VTBA 2DZOA 5HI7A 3PNLB 5LCWJ 3RO2A 2ZISA 3PZ1A 2H6GA 1EDUA 1N9AA 3GZ1A 4O60A 1MX4A 4DUIA 5AAOA 5LOZA 2X6IA 4HOQA 4DPRA 4Q69A 4HOSA 2P58C 4PUCA 1BPOA 1PC2A 5JJ6A 2H6HA 3DSTA 1MQSA 3PUJA 3HXFA 4F1SA 4WWPA 1O1TA 3CVVA 4CCAA 4LERA 3UKUG 3G2VA 1XNFA 4ILGA 3PE4A 3EHRA 1MYOA 3Q79A 1N11A 4FJYA 3J5QB 4L7TA 2WMOA 3PRZA 4XI9A 3FTSA 1IHGA 1SQMA 5JJ7A 5CBNA 2P9IG 4J8FA 1H2TC 2V5QC 1LTXA 2OCCE 2XRZA 3SI5A 4UQXA 4AM9A 4JA9A 4AV7A 4G23A 4GZ6A 4N3AA 4XKCA 2KZTA 4EZLA 2VSNA 5CEAA 2AJAA 4U0UA 4PS3A 1ELWA 1Z3YA 3ZVVA 4BEPA 2KZTB 2XGOA 3Q75A 4E6HA 2X38A 4UUCA 5KJNA 2EIME 1HX8A 5JA4D 2MYOA 1YYHA 2DIWA 4J6IA 2R05A 3S2AA 4KXKB 2PQNA 4A3TA 1MZCA 2GRRB 5FQ8A 5BUZA 4PS7A 1FPPA 4I9EA 4BX8A 4DK5A 1KPSB 3LS8A 2R02A 1D9SA 2DZNA 1N95A 1LF8A 3CVUA 2R17C 2DCPA 1OY3D 3PREA 2XGMA 3SF4A 4APOA 1BLXB 4I2ZA 3V2OA 4KZ0A 4GPKA 4XE0A 4CDNA 4F3VA 4KVMA 4PDXA 5FT9A 5G2NA 3AG2E 3CSTA 3L82A 4U63A 5JJTA 5AQBA 3QWPA 4DX6D 1FCHA 1MJ0A 2HR2A 3L13A 4P29A 1KLXA 2IF4A 4TUUA 3NOCD 4GTSA 4Q94A 4LCTA 5BT1A 5DBKA 2WXFA 4M7CA 2C2LA 4AP2A 2IFUA 3OXFA 3LJNA 4MRUA 2LSVA 1WG0A 4MLPA 2PM7A 4XEIG 4HQDA 2EINE 1K1AA 2I1KA 3MV2B 2YINA 2V4LA 5M72A 3JUIA 4V3IA 2UY1A 4HNAD 5CMWA 2VYIA 1TYQG 2QYUA 3GZ2A 3ULQA 3FTZA 4J7WA 2FI7A 1UJJA 2FF4A 3ZEFA 2XS1A 4I2WA 4HB5A 2KCLA 5AIJA 4U7EB 2RD0A 2WXRA 3Q9NC 4ILHB 2WXJA 3Q47B 4GA0A 1KZOA 1YA0A 4JA7A 4I6EA 3UMVA 3CHMA 4CEMA 2RG8A 3E37A 3VLDA 1H6OA 5KNGA 3SFYA 4PS8A 2PNNA 3PNTB 3AS5A 5A6CA 4KT6B 4HS2A 2X6KA 4DLOA 1QBQA 5CEDB 2WXGA 4JHKA 3TWWA 3C72A 4JHJA 4K5BA 3CIAA 1SA4A 4HBDA 2KBXA 4K03A 2HO1A 4WWNA 2VGXB 3DSVA 3CR3A 3MEKA 2OOEA 4TV3A 3RJVA 2IY0C 3CHRA 2A5UA 5EILA 4FJZA 3UUXA 3LPZA 3T9KA 3FU6A 2AVPA 3SBTB 4G2VA 3EDTB 4EBAA 1S70B 4YDWA 4APFA 4HI8A 3ZYQA 1OUVA 1IHBA 1JCSA 3NZUA 1IYGA 3ONLA 1SW6A 2R5SA 5LX8A 4O6FA 3MA5A 3ULEG 5FTPA 4GYYA 4KBQA 3MYVA 1Z5SC 1E8YA 4JD2G 5T3RA 1N4PA 5BXUA 3IKOB 3R9MA 2FBNA 2ONDA 4WNGA 3JQ0A 4B89A 1AP7A 5BV0A 2HE0A 1JPLA 2L0TB 3UM1A 4I43A 4O1OA 3QC1A 3SNXA 2Y4UA 1SVXA 4NRHB 1PAQA 4HRMB 2RFMA 5AQ7A 3SY2A 3RRUA 3ZYKA 4CZ2D 4N2SA 5FIOA 4GZ5A 3TWUA 4G1TA 4RLYA 3G2WA 4HFGA 3TWXA 1HF8A 5FZSA 3D9LA 3R7QA 3N71A 2CG2A 1ELKA 4H7YA 1BU9A 4UI9C 2ILRA 1TNBA 2AW6A 3JQ1A 4EPZA 2PQRA 3D9IA 1QQEA 5D66A 3UM0A 5CCMA 3DXKG 4DRXE 3I4GA 3CQGB 5ENOD 1MHQA 4LNBA 1OWNA 3KSQA 3UINC 3AAAC 1N0RA 3IHVA 2HYZA 4GTPA 1JUQA 3LKUA 2QFCA 2FEZA 3SFXA 3QKYA 2VGYA 3DSWA 3FEXA 3APCA 4GPMA 1TN8A 4JVSA 4TUMA 2X6HA 3ZRHA 1OWPA 3E4BA 4GU5A 5G05C 4FULA 1IXVA 4QFVA 2MOWA 2X3MA 2XPZA 3PZ3A 3I3NA 2LSUA 4XKBA 3CSFA 2QY7A 4ANXA 2I2OA 2Y3AA 1DCEA 4LRZA 1NA0A 3QAQA 2J9QA 3URZA 3CHPA 3Q5MA 3FUFA 4JHRA 3ABKE 3QJZA 2X6FA 3PEVB 3FH7A 5E75A 2DWZA 3LCAA 3CVYA 5D0QD 4JZYA 3IBEA 4H7XA 3L6AA 2XEVA 3CGHA 4WAFA 3G2TA 3ZU7B 4GTMA 2VGEA 4XIFA 3S7JA 2R03A 1SZ9A 3B7SA 3NAWA 3CK9A 3ASFA 3DPYA 2DYRE 2BTDA 1D8EA 4ACLA 2B0OE 4AJWA 3WG7E 2GROB 4NURA 4PH4B 4BT9A 3AU4A 2V5FA 2XENA 3DBSA 3APDA 2A5EA 3MZLB 3UT4A 5ANLA 2VTBB 2WQHA 1OCZE 3ASHA 3E30A 1TEZA 3RRNB 3FY4A 4OAVB 5IY5E 2J09A 5FWQA 3CV0A 2X6JA 4AVXA 3HXEA 4NACA 5CHEE 4EZKA 2IJGX 4X8QA 2WXLA 4F53A 5FJYA 3AJIA 3IXEA 3E34A 3L22A 5C2YA 3CK8A 4OYSA 3TWRA 3U3WA 2P9KG 1U3DA 1KT0A 3Q9UC 3KD7A 2QC9A 5EKQD 2EQXA 2XPYA 3FU5A 3T8KA 4FADA 2XQ0A 4BT8A 3DSXA 3MKQA 5CBOA 5ANRA 2DYSE 3T5XA 3UT8A 5G04C 3PDNA 5AENA 4JXTA 1V54E 3CVXA 2WPVA 3BU8A 4EBAG 3EHNA 3L16A 2L6JA 1N4SA 4N39A 1DCQA 1QZ2A 3D9OA 2PL2A 4JC8A 1E8ZA 1YCSB 3ESKA 3KSLA 3FHEA 4AOFA 5ENRD 2V4HC 1GW6A 2Y69E 1UN9A 4C9BB 1SA5A 4DX5D 4GTRA 2IONA 4FHJA 3ZPJA 3EU9A 3G2UA 4HRNA 3SBSA 3SQVA 1OXJA 2LAIA 1H6KA 3Q78A 2WQ6A 4QQIA 1UN8A 2OVBA 4GYWA 3JXJA 4J8DA 4UWKA 1FVFA 3ZXSA 1OWMA 2LO6A 2VJ8A 5ENTD 2L9BA 5BV1A 5AQ9A 1S64A 3CK7A 3TXNA 2ETBA 4LEUA 4GZDA 4KMOA 2XRYA 3D9NA 1HG2A 2ZIRA 3PEUB 4Y6CA 3ZNGA 3IHYA 4DI3A 3QARA 4CRWA 2LXMA 1FT1A 3FH5A 4K0RA 1HO8A 3F6QA 2PM6A 4HVBA 1WY6A 3OAWA 4I17A 3ZN3A 2E2EA 4FLHA 3ZW3A 2LAHA 2WVIA 4GTOA 3U9WA 3L54A 2ETAA 4F7AA 4XZ4A 1ZBPA 5D0OD 2ZU6B 4U8YD 3CEQA 2KATA 5AJDA 4B8AA 3KS2A 2F8YA 4HORA 2J8SD 3RK6A 4ACKA 1H2UA 3NBNB 1PY1A 3RO3A 2DBAA 1TJCA 4IYPA 4A1GA 1D8DA 2BKGA 3TL5A 5G55A 2RKKA 3LJ3A 2F0YA 5HKPA 3ZYLA 1TNYA 5LP0A 5KBAA 1HU3A 2UY1B 3FUJA 4G26A 1P5QA 4R7LA 4L2LA 2F8XK 3LVRE 3RU0A 3UIPC 1DC2A 3GYZA 4BTBA 4HLLA 3WXXA 4I1OB 1EPUA 3CKCA 4U8HA 1JCQA 4CGWA 2XZDG 1H6PA 1N4QA 3TWVA 3D9JA 4ANWA 3UM3A 4HRLA 4YDEA 4JPSA 4L2YA 3FUNA 5AYWD 1ZB1A 4G8LA 5LFAA 2NSZA 2H6IA 1JCRA 2P9SG 5ENPD 5A23A 3MCXA 5FQ6A 1O1RA 3EU5A 2WXMA 3RSEG 2JLBA 3DWLG 4GCNA 1KZPA 4UWLA 3P1UA 4JB8P 3PUKA 5JMND 4BTAA 3NQPA 1DNPA 3EIQC 4XX5A 4G11A 3HXCA 3C5RA 3CHSA 1OT8A 5G05J 2EILE 1ZU2A 4B93B 3SD5A 3L9TA 1H19A 4OVUA 4MKTA 2MHKA 5KJMA 2GRPB 3V31A 2I6HA 1Z3XA 1TNZA 4BSZB 1XGWA 4FA6A 1WAO1 4I9CA 3ABME 4WNEA 2VQ2A 3Q49B 3U66A 3HVEA 3NOGD 3VTYA 3LXUX 4J8EA 3JUEA 1UOHA 3FUKA 1K1BA 2WMNA 3HVEB 2F37A 1UG3A 4J0UA 5H7PA 4EZJA 2WXQA 3SHFA 4GA2A 4F6RD 5B1BE 4YVQC 5HQ8A 2I1JA 2WXOA 5ENNA 2MRIA 2IQCA 3HG0D 3NF1A 2GGFA 3UTMA 1BI8B 1MX6A 2KCKA 3QWWA 3ZHEA 3R7RA 3I5PA 4CT0A 1NP7A 3RRMB 3W9GA 3FTWA 4GTTA 5HS0A 1O1SA 3ZHEB 3OTNA 4URKA 3D3MA 3B7BA 4A1SA 3OXGA 3FTXA 3FTVA 5B3SE 3TXMA 5FZRA 1NZNA 3FU3A 2P9LG 4C48B 3LYAA 2NYJA 2XPIA 3LEWA 3K9IA 1OCRE 1TNOA 3ASGA 2XZTG 4RVBA 3C3OA 4B8CB 4NIKA 3NZSA 3ISMC 1OCOE 1NA3A 3LVQE 1WDYA 1HG5A 2H6FA 2UWJG 3HYMB 5ARFA 4HI9A 1JWFA 4LNGA 4YNDA 4UQZA 3LY8A 3FUDA 4JEHA 3TG5A 2BKKB 2Y0BG 4G8KA 4RG9A 2IOSA 1HFAA 3PS6A 2L6BA 3UT7A 2P9UG 1G3NB 2YQ8A 2QZAA 2OVFA 4RQIA 3AG1E 5KCMA 2P9NG 3DXMG 4N5CA 4Y6WA 4ZFHA 4I1AA 2AXVA 3UKRG 1HE8A 4GCOA 1Y6IA
chains in the Genus database with same CATH topology
3L16A 2L6JA 2CFZA 4N39A 2I1KA 1W3BA 2GRLA 4BY6A 3MV2B 1HXIA 2M63A 2YINA 5C1DA 1QZ2A 3D9OA 2V4LA 2PL2A 2HM8A 3CLJA 3JUIA 4V3IA 5M72A 2UY1A 4AY5A 4JC8A 5CCLA 5CMWA 2VYIA 1E8ZA 3ESKA 2BF0X 3U64A 1U3CA 3IV0A 4KZCA 3FHEA 4AOFA 2J49A 3T5VA 4CDRA 3MGBA 3GZ2A 4FLBA 3ULQA 1GW6A 3FH8A 3FTZA 4EQFA 5KJKA 1UN9A 4C9BB 3FTYA 2FI7A 1UJJA 1B89A 2FF4A 3ZEFA 2IONA 4I2WA 3VLFA 4UWGA 1E8WA 2FO7A 2KCLA 1JWGA 3BG1B 4BSXA 4XI0A 1OWOA 5AIJA 3MX3A 5KJLA 2RD0A 4FHJA 2WXRA 3L08A 4KVOA 4RSYA 4ILHB 3AS8A 3ZPJA 3MV3B 4M3OA 2WXJA 1Z6TA 3G2UA 3Q47B 1E8XA 1HH8A 3ML8A 4GA0A 3ZYMA 3QWVA 3SBSA 1YA0A 4ABNA 4JA7A 4I6EA 3UMVA 4E85A 3CHMA 4CEMA 2WQ6A 2LAIA 1H6KA 2RG8A 2BUGA 4G24A 2C0LA 1UN8A 2WXHA 3VLDA 4CT4A 2OVBA 5EDSA 1E90A 4GYWA 2PZIA 4J8DA 4MS6A 4UWKA 3TG4A 1FVFA 4PS8A 3ZXSA 1OWMA 2LO6A 3PNTB 3AS5A 3ASDA 5A6CA 2KCVA 3FUEA 2VJ8A 3AU5A 3PE3A 5DIZA 4JL0A 4KT6B 2L9BA 2XGSA 4HS2A 5BV1A 3CK7A 3TXNA 4U07A 4RG6A 2X6KA 4DLOA 2WXGA 4BWRA 4LEUA 2WM9A 3GW4A 4GZDA 4KMOA 4JHKA 2XRYA 3LDZA 1H0AA 2XHEA 1HG2A 3D9NA 5ARGA 4JHJA 3CVNA 3PEUB 3QOUA 4LUNU 4ANUA 2GRMA 4Y6CA 2WXKA 3PVLA 3B7TA 3CIAA 3IHYA 4DI3A 3QARA 4CRWA 3CVWA 2L0IA 4K03A 3FUIA 1E7UA 4DJAA 3CHQA 3FH5A 4K0RA 3UX4A 2HO1A 4GA1A 4WWNA 2J07A 2VGXB 1HO8A 3ENEA 2PM6A 3HDXA 4AEZC 4AIFA 4HVBA 3CR3A 3MEKA 1WY6A 2OOEA 3RKVA 3MKRA 4TV3A 4JW1A 3RJVA 3CHRA 2A5UA 3OAWA 4FJZA 3FUMA 3UUXA 4L1BA 3B13A 1IQRA 3LPZA 4I17A 3ZN3A 3D9PA 3FU6A 2AVPA 2YHCA 2WXIA 1DVPA 3OXLA 3SBTB 2E2EA 4FLHA 3ZW3A 4G2VA 3CHOA 3EDTB 4N3BA 4EECA 2LAHA 3QNKA 4GAAA 2WVIA 4EBAA 3EJNA 2V0PA 2YNQA 4KYOB 4APFA 3U9WA 3L54A 3ZYQA 4F7AA 4XZ4A 2Q7FA 2NXPA 2WQ7A 1QNFA 1ZBPA 1OUVA 2FULA 3NZUA 4UI9K 5D0OD 3ONLA 2R5SA 5LX8A 2ZU6B 1IYGA 3HHMA 3CEQA 4O6FA 2A4ZA 3MA5A 5G04J 5FTPA 3CVPA 4NQ0A 4GYYA 4KBQA 2KATA 3MYVA 1E8YA 3MKQB 3UQ3A 3T8MA 5T3RA 5AJDA 4B8AA 3KS2A 3IKOB 4HORA 3S7DA 2E0IA 2FBNA 2ONDA 4U0SA 3O4ZA 3JQ0A 4WNGA 3BG0B 4GZ3A 3RK6A 4B89A 2VSOE 3FFLA 1H2UA 4ACKA 3TGOA 4DI4A 1PY1A 3B7RL 3RO3A 5BV0A 1JPLA 2DBAA 1TJCA 4IYPA 4A1GA 2L0TB 4B0ZA 4I1MA 4G25A 4I43A 3CQCB 3TL5A 3QC1A 5G55A 3LJ3A 3SNXA 3UPVA 2Y4UA 4NRHB 3ZYLA 1PAQA 1IQUA 2VSYA 5LP0A 1INZA 5E76A 4Q96A 1UJKA 2YHEA 4GZCA 1HU3A 5BPPA 2UY1B 3FUJA 3RRUA 3ZYKA 4N2SA 4G26A 1P5QA 4R7LA 4L2LA 3CKBA 3PH0C 4GZ5A 5JHAA 3LVRE 3FU0A 4G1TA 3RU0A 4UWHA 3G2WA 4HFGA 4CDMA 3JCKC 2R59A 5EX0A 1HF8A 1FVHA 2AXZA 4AY6A 2I9CA 4FP7A 5FZSA 4HXIA 3GYZA 4BTBA 1E7VA 3D9LA 5T8IA 3R7QA 3N71A 3WXXA 3AS4A 1HS6A 2CG2A 3QB2A 5T4YA 4IRUA 4ATGA 1ELKA 4H7YA 4WNDA 4I1OB 2XCBA 4WWOA 4C0EA 4UI9C 2ILRA 2V8SE 4I6GA 2AW6A 1EPUA 3CKCA 3D9MA 2CHXA 4U8HA 3JQ1A 4EPZA 4HLEA 5FQ7A 2Y4TA 4CGWA 2PQRA 3D9IA 1QQEA 1HZ4A 1E96B 3ZFWA 5CCMA 3FDHA 4BX9A 2WXNA 3ONKA 4GB9A 5FZQA 5J08A 3I4GA 3D9JA 4ANWA 3SFZA 3CQGB 2J4DA 4B94A 4N2QA 1A17A 1MHQA 3JYSA 4JPSA 4L2YA 5A7DB 2VTBA 3FUNA 5AYWD 4UQYA 3SGHA 3EHMA 1OWNA 3LY9A 3PNLB 5HI7A 5LCWC 3RO2A 5LCWJ 5LFAA 2NSZA 2OV8A 3CVLA 5A23A 3IHVA 2HYZA 3MCXA 5FQ6A 1JUQA 1EDUA 3GZ1A 2VSXE 2QFCA 3LKUA 2WXMA 2FEZA 3QKYA 5JHBA 2JLBA 4GCNA 2VGYA 3FEXA 4UWLA 5LOZA 3APCA 3P1UA 2X6IA 1S0PA 3CVQA 4HOQA 3IEGA 3PUKA 5FQ4A 4DPRA 3ZIMA 4Q69A 4HOSA 3Q4AB 4JVSA 4BTAA 3NQPA 1DNPA 2X6HA 2P58C 3ZRHA 3FTUA 3EIQC 1OWPA 4PUCA 3E4BA 1BPOA 3Q15A 4GU5A 4XX5A 4G11A 1PC2A 3APFA 3P2BA 5JJ6A 3R9AB 3CHSA 1MQSA 3PUJA 1UW4B 4FULA 4WUYA 3EIJA 5G05J 5G05C 4F1SA 2J4BA 4QFVA 4OVVA 1ZU2A 2MOWA 2X3MA 4WWPA 3CVVA 3SD5A 4CCAA 2XPZA 4LERA 3TJPA 3G2VA 3I3NA 1H19A 2CHWA 2LSUA 4XKBA 3CSFA 4U04A 1XNFA 4OVUA 4WNFA 4ILGA 1X5BA 4MKTA 2MHKA 3KAEA 3PE4A 2QY7A 4CGVA 5KJMA 2XCCA 2I6HA 1Z3XA 4FJYA 4ANXA 2I2OA 2KM4A 1XGWA 3L17A 4L7TA 2WMOA 1WAO1 2Y3AA 3QDNA 4I9CA 3MJWA 3U4TA 4FA6A 4LRZA 1NA0A 3QAQA 2J9QA 4WNEA 2VQ2A 3Q49B 3U66A 3PRZA 4XI9A 3FTSA 3CHPA 3URZA 1IHGA 3HVEA 1SQMA 5JJ7A 2CFUA 3Q5MA 4ME2A 3FUFA 3VTYA 3ZGQA 3LXUX 4J8EA 4JHRA 4N3CA 2J08A 4I6JA 2KC7A 4J8FA 5AJLA 1H2TC 4HOTA 3FUKA 4FHKA 2WMNA 3QJZA 2JEKA 2X6FA 3PEVB 3FH7A 3HVEB 3VLEA 2XRZA 1UG3A 4J0UA 3SI5A 4UQXA 4TRQA 4FC8A 3ESLA 4AM9A 4JA9A 5E75A 4AV7A 4C0MA 4U0ZA 3LCAA 4JEUA 4G23A 4AXHA 2WXQA 4EZJA 4GZ6A 4N3AA 5D0QD 3SHFA 4XKCA 3CVYA 4JZYA 3SZ7A 2KZTA 4GA2A 4EZLA 3IBEA 4H7XA 4YVQC 2VSNA 3L6AA 5HQ8A 2XEVA 2I1JA 4U0UA 3CGHA 4PS3A 1ELWA 1Z3YA 2WXOA 3ZVVA 4WAFA 3G2TA 2KZTB 3FULA 2XGOA 5ENNA 2WXPA 2MRIA 2IQCA 3NF1A 4XIFA 3S7JA 4IN3B 2GGFA 4D10C 4E6HA 2X38A 5KJNA 2KCKA 1HX8A 3O48A 1SZAA 1SZ9A 3QWWA 3ZHEA 4GMLA 3B7SA 3R7RA 1H2VC 3I5PA 4UI9J 3LY7A 3CK9A 4CT0A 1NP7A 3RRMB 2DIWA 3FUHA 4J6IA 3ASFA 1KT1A 4UWFA 3S2AA 3KEZA 4DLQA 3FTWA 2BTDA 3ZHEB 4ACLA 3OTNA 4KXKB 3C98A 4URKA 4AJWA 1TJFA 3DPDA 2AWIA 2PQNA 3D3MA 2IOLA 2AXUA 3G2SA 4NURA 5BW8C 3OXGA 3FTXA 4A1SA 4A3TA 4ANVA 4PH4B 3FTVA 4BT9A 5CMYA 1EF1C 2CHZA 3AU4A 3TXMA 3PZDA 5FZRA 1NZNA 2IU1A 2V5FA 3FU3A 5FQ8A 4A3VA 5BUZA 3DBSA 4PS7A 3APDA 3ML9A 3LYAA 3MZLB 4I9EA 3UT4A 3GZSA 4BX8A 4FU3A 4IULA 5ANLA 2WQHA 2XPIA 3ASHA 3LEWA 4DK5A 2VTBB 3K9IA 1TEZA 3ASGA 3RRNB 3FY4A 4GYOA 4YVOA 4RVBA 2J09A 5FWQA 3CV0A 4B8CB 3LS8A 4ILIA 3NZSA 3FWVA 2X6JA 4GMJA 1LF8A 3D9KA 3CVUA 2R17C 1NA3A 4AVXA 3LVQE 1OWLA 2DCPA 4NACA 2WB2A 1ELRA 1HG5A 4BFRA 3PREA 5CHEE 2XGMA 2UWJG 3RIBA 4EZKA 2IJGX 3SF4A 4APOA 3S7BA 2WXLA 3HYMB 4L23A 5FJYA 4F53A 1WM5A 5ARFA 4I2ZA 2VGXA 1JWFA 2C0MA 1VDYA 4KZ0A 2GW1A 4GPKA 2CG3A 3L22A 4YNDA 5C2YA 4XE0A 3CK8A 1Y8MA 3S7FA 4CDNA 4OYSA 3U3WA 4UQZA 4F3VA 1U3DA 1KT0A 3LY8A 3FUDA 4JEHA 4KVMA 4PDXA 3TG5A 4W9RA 3KD7A 5FT9A 5G2NA 2LNIA 4U63A 3CSTA 5EX3A 3VTXA 4RG9A 4A55A 5JJTA 3TAXA 5EKQD 3FP3A 3QWPA 2IOSA 1HFAA 2EQXA 1FCHA 3PS6A 3UT7A 2XPYA 1N54A 3FU5A 4FADA 2HR2A 2NC9A 2XQ0A 2YQ8A 1N52A 3L13A 3QK0A 4BT8A 4P29A 5BNWA 3BEEA 1KLXA 2OVFA 2IF4A 4TUUA 3HIZA 4Q94A 5KCMA 4J8SA 3MKQA 4LCTA 5BT1A 5ANRA 5DBKA 4HOUA 2WXFA 2C2LA 3T5XA 4N5CA 3I4RB 3FEYA 3UT8A 1L5JA 4AP2A 2IFUA 5G04C 3OXFA 3PDNA 5AENA 4Y6WA 4MRUA 4I1AA 2AXVA 2LSVA 4JXTA 5J90A 4MLPA 3B7UX 2PM7A 3CVXA 2WPVA 4EBAG 1HE8A 4GCOA 1Y6IA 3EHNA 1EYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSO E;  1H2U A;  4CRW A;  3L6A A;  3FEX A;  4B8C B;  1H2T C;  5ANR A;  2KZT B;  2HM8 A;  3JUI A;  2FUL A;  4GMJ A;  3FEY A;  3D3M A;  2ZU6 B;  2IOL A;  1UG3 A;  2GGF A;  2I2O A;  3EIQ C;  2IOS A;  1PAQ A;  2NSZ A;  2IU1 A;  4JHK A;  4CEM A;  1H6K A;  2RG8 A;  4B8A A;  4JHJ A;  1HU3 A;  1N54 A;  4LUN U;  4C9B B;  4GML A;  1UW4 B;  2KZT A;  4CT4 A;  1H2V C;  3EIJ A;  4IUL A;  1N52 A;  3RK6 A;  2ION A;  2VSX E;  4B89 A; 
#chains in the Genus database with same CATH topology
 2CFZ A;  1QYM A;  1W3B A;  5C1D A;  3CLJ A;  4LSZ E;  2HM8 A;  4AY5 A;  4F1P A;  3Q7A A;  2BF0 X;  3IV0 A;  4KZC A;  3T5V A;  5B1A E;  4CDR A;  4DX1 A;  5KJK A;  5ITZ F;  3VLF A;  3BG1 B;  4BSX A;  2OEW A;  1OWO A;  4XI0 A;  3MX3 A;  3L08 A;  1N94 A;  1Z6T A;  2RFA A;  1HH8 A;  3ML8 A;  2EIK E;  3QWV A;  1AWC B;  4ABN A;  5BXO A;  1NI1 A;  4E85 A;  4G24 A;  2BUG A;  4A63 B;  3D9H A;  2C0L A;  5ENS D;  2WXH A;  2PZI A;  4MS6 A;  3TG4 A;  2ZXW E;  3ASD A;  3AU5 A;  3PZ4 A;  2XGS A;  4U07 A;  4RG6 A;  4BWR A;  2WM9 A;  2XHE A;  1TNU A;  4LUN U;  4ANU A;  2GRM A;  1N0Q A;  3PVL A;  3FUI A;  3UX4 A;  3HXD A;  2J07 A;  4AEZ C;  2EIJ E;  3EUV A;  4JW1 A;  4YDO A;  1K8K G;  3FUM A;  4L1B A;  3ZKJ A;  3D9P A;  3HRA A;  2WXI A;  3OXL A;  3NB2 A;  3ZXP A;  3CHO A;  3EJN A;  4O1P A;  4KYO B;  2ZGD A;  2NXP A;  1QNF A;  4UI9 K;  2A4Z A;  3CVP A;  3MKQ B;  4U95 D;  3T8M A;  3S7D A;  4U0S A;  3BG0 B;  4GZ3 A;  3UXG A;  3TGO A;  3B7R L;  3DRA A;  4I1M A;  4B0Z A;  4ATZ D;  4G25 A;  3UPV A;  4J8Y A;  1IQU A;  2VSY A;  4BET A;  2YHE A;  4GZC A;  2QYJ A;  1IKN D;  2XEH A;  5JHA A;  3FU0 A;  5HRY A;  4AY6 A;  2R2L A;  2I9C A;  4FP7 A;  1E7V A;  5T8I A;  4K5C A;  1HS6 A;  3QB2 A;  5T4Y A;  3DEO A;  2XCB A;  1U2V G;  4WWO A;  2V8S E;  3D9M A;  5CRV A;  5EYP F;  4HLE A;  5FQ7 A;  2Y4T A;  3ZFW A;  3FDH A;  4BX9 A;  3ONK A;  4GB9 A;  5FZQ A;  4U96 D;  2B6C A;  3SFZ A;  3ZUV B;  5EID A;  1A17 A;  5A7D B;  4UQY A;  3SGH A;  4TXP A;  3AG3 E;  3EHM A;  3LY9 A;  5LCW C;  2P9P G;  2OV8 A;  3CVL A;  4LNU D;  2VSX E;  1K3Z D;  2ETC A;  5JHB A;  4BES A;  1S0P A;  3CVQ A;  3IEG A;  5FQ4 A;  3E32 A;  3ZIM A;  3Q4A B;  2LUH A;  3FTU A;  3Q15 A;  3APF A;  4ZHB A;  3P2B A;  3R9A B;  1UW4 B;  4WUY A;  3EIJ A;  2J4B A;  4OVV A;  4N5Q A;  3TJP A;  2CHW A;  5EN5 D;  1TN7 A;  4U04 A;  1OCC E;  4GTV A;  4WNF A;  1X5B A;  3KAE A;  4CGV A;  2XCC A;  3TWS A;  2KM4 A;  3L17 A;  3QDN A;  3U4T A;  3MJW A;  3X2Q E;  2JAB A;  2CFU A;  1LD8 A;  4ME2 A;  2FO1 E;  3ZGQ A;  4N3C A;  2J08 A;  4I6J A;  2KC7 A;  3UIO C;  5AJL A;  4HOT A;  4FHK A;  2JEK A;  3VLE A;  4TRQ A;  3PZ2 A;  4FC8 A;  3ESL A;  4C0M A;  1TR4 A;  4U0Z A;  4JEU A;  4AXH A;  3DEP A;  3SZ7 A;  1Q2Z A;  5KWD A;  3FUL A;  2WXP A;  2GRN B;  4IN3 B;  4D10 C;  4DX2 A;  4BER A;  3O48 A;  1SZA A;  4GML A;  1H2V C;  4UI9 J;  4L9P A;  3LY7 A;  3FUH A;  1KT1 A;  4UWF A;  3KEZ A;  4DLQ A;  5EYL A;  3C98 A;  1TJF A;  3RAU A;  3DPD A;  2AWI A;  2IOL A;  2AXU A;  3G2S A;  5BW8 C;  4ANV A;  4GTQ A;  5CMY A;  1EF1 C;  2CHZ A;  3PZD A;  2IU1 A;  4A3V A;  4MBG A;  3ML9 A;  3ASN E;  3GZS A;  4FU3 A;  4IUL A;  3V30 A;  4EHM A;  4GYO A;  4YVO A;  4LG6 A;  2Y1L E;  2DVW A;  4ILI A;  3FWV A;  4GMJ A;  4N2Q A;  3D9K A;  1OWL A;  2WB2 A;  1ELR A;  4BFR A;  4K5A B;  3C3R A;  2BED A;  5AN8 A;  3RIB A;  3S7B A;  4L23 A;  1WM5 A;  2VGX A;  2C0M A;  1VDY A;  2GW1 A;  5CRU A;  2CG3 A;  1Y8M A;  3S7F A;  5KNH D;  3V2X A;  3V79 K;  4W9R A;  2LNI A;  5EX3 A;  3VTX A;  4A55 A;  3TAX A;  2P2C P;  2ZGG A;  3FP3 A;  2IO3 C;  1NL4 A;  1N54 A;  2LXL A;  2NC9 A;  4U8V D;  1N52 A;  3QK0 A;  5BNW A;  3C3Q A;  3BEE A;  5FIN A;  3HIZ A;  4J8S A;  2XS8 A;  4HOU A;  3I4R B;  3FEY A;  1L5J A;  1N4R A;  1RZ4 A;  5J90 A;  3Q7F A;  3B7U X;  1RW2 A;  3UI2 A;  1X81 A;  3TWQ A;  1EYH A;  3JXI A;  3UM2 A;  5AAR A;  3EHQ A;  2GRL A;  4BY6 A;  1HXI A;  2M63 A;  5CER B;  5AQA A;  5CCL A;  3U64 A;  1U3C A;  3BUA A;  1LD7 A;  2J49 A;  3MGB A;  4FLB A;  3FH8 A;  4DX7 D;  4EQF A;  3KEA A;  3FTY A;  1B89 A;  1TN6 A;  4UWG A;  1E8W A;  2FO7 A;  1JWG A;  5KJL A;  3HXB A;  4KVO A;  4RSY A;  3AS8 A;  3MV3 B;  4M3O A;  5CEC B;  1E8X A;  1O5M A;  3ZYM A;  1NFI E;  1BI7 B;  5EDS A;  4CT4 A;  1E90 A;  2KCV A;  3FUE A;  3PE3 A;  5DIZ A;  2GRQ B;  4JL0 A;  4Z68 A;  4GMR A;  3GW4 A;  3LDZ A;  1H0A A;  2IEJ A;  5ARG A;  3B95 A;  3CVN A;  3QOU A;  2WXK A;  5D2M C;  3B7T A;  1S63 A;  3Q73 A;  3CVW A;  2L0I A;  1E7U A;  3ASO E;  3SO8 A;  3CHQ A;  4GA1 A;  1BD8 A;  3ENE A;  3HDX A;  4AIF A;  3RKV A;  3MKR A;  2IO2 C;  4TXQ A;  3B13 A;  1IQR A;  3E33 A;  2YHC A;  1DVP A;  4EEC A;  4N3B A;  3QNK A;  4GAA A;  3ABL E;  2V0P A;  2YNQ A;  1A5E A;  4CYM D;  3DSS A;  2Q7F A;  3BQO A;  2WQ7 A;  2FUL A;  3HHM A;  3J5P A;  5G04 J;  1YMP A;  4NQ0 A;  3UQ3 A;  4OAU C;  2E0I A;  4DJA A;  3O4Z A;  2VSO E;  3FFL A;  4DI4 A;  2XEE A;  5ENQ D;  3W9F A;  5EIB E;  3CQC B;  3AG4 E;  3TWT A;  1INZ A;  5E76 A;  4Q96 A;  1UJK A;  5BPP A;  4YDY A;  3CKB A;  3PH0 C;  3ULY A;  4UWH A;  2OEV A;  4TXR A;  4CDM A;  3JCK C;  2R59 A;  5EX0 A;  1FVH A;  2AXZ A;  4HXI A;  1FT2 A;  3AS4 A;  4IRU A;  4ATG A;  4WND A;  4C0E A;  2KXP C;  4I6G A;  1V55 E;  2CHX A;  1MX2 A;  1HZ4 A;  1E96 B;  2WXN A;  5J08 A;  3DSU A;  2J4D A;  4B94 A;  3JYS A;  2VTB A;  2DZO A;  5HI7 A;  3PNL B;  5LCW J;  3RO2 A;  2ZIS A;  3PZ1 A;  2H6G A;  1EDU A;  1N9A A;  3GZ1 A;  4O60 A;  1MX4 A;  4DUI A;  5AAO A;  5LOZ A;  2X6I A;  4HOQ A;  4DPR A;  4Q69 A;  4HOS A;  2P58 C;  4PUC A;  1BPO A;  1PC2 A;  5JJ6 A;  2H6H A;  3DST A;  1MQS A;  3PUJ A;  3HXF A;  4F1S A;  4WWP A;  1O1T A;  3CVV A;  4CCA A;  4LER A;  3UKU G;  3G2V A;  1XNF A;  4ILG A;  3PE4 A;  3EHR A;  1MYO A;  3Q79 A;  1N11 A;  4FJY A;  3J5Q B;  4L7T A;  2WMO A;  3PRZ A;  4XI9 A;  3FTS A;  1IHG A;  1SQM A;  5JJ7 A;  5CBN A;  2P9I G;  4J8F A;  1H2T C;  2V5Q C;  1LTX A;  2OCC E;  2XRZ A;  3SI5 A;  4UQX A;  4AM9 A;  4JA9 A;  4AV7 A;  4G23 A;  4GZ6 A;  4N3A A;  4XKC A;  2KZT A;  4EZL A;  2VSN A;  5CEA A;  2AJA A;  4U0U A;  4PS3 A;  1ELW A;  1Z3Y A;  3ZVV A;  4BEP A;  2KZT B;  2XGO A;  3Q75 A;  4E6H A;  2X38 A;  4UUC A;  5KJN A;  2EIM E;  1HX8 A;  5JA4 D;  2MYO A;  1YYH A;  2DIW A;  4J6I A;  2R05 A;  3S2A A;  4KXK B;  2PQN A;  4A3T A;  1MZC A;  2GRR B;  5FQ8 A;  5BUZ A;  4PS7 A;  1FPP A;  4I9E A;  4BX8 A;  4DK5 A;  1KPS B;  3LS8 A;  2R02 A;  1D9S A;  2DZN A;  1N95 A;  1LF8 A;  3CVU A;  2R17 C;  2DCP A;  1OY3 D;  3PRE A;  2XGM A;  3SF4 A;  4APO A;  1BLX B;  4I2Z A;  3V2O A;  4KZ0 A;  4GPK A;  4XE0 A;  4CDN A;  4F3V A;  4KVM A;  4PDX A;  5FT9 A;  5G2N A;  3AG2 E;  3CST A;  3L82 A;  4U63 A;  5JJT A;  5AQB A;  3QWP A;  4DX6 D;  1FCH A;  1MJ0 A;  2HR2 A;  3L13 A;  4P29 A;  1KLX A;  2IF4 A;  4TUU A;  3NOC D;  4GTS A;  4Q94 A;  4LCT A;  5BT1 A;  5DBK A;  2WXF A;  4M7C A;  2C2L A;  4AP2 A;  2IFU A;  3OXF A;  3LJN A;  4MRU A;  2LSV A;  1WG0 A;  4MLP A;  2PM7 A;  4XEI G;  4HQD A;  2EIN E;  1K1A A;  2I1K A;  3MV2 B;  2YIN A;  2V4L A;  5M72 A;  3JUI A;  4V3I A;  2UY1 A;  4HNA D;  5CMW A;  2VYI A;  1TYQ G;  2QYU A;  3GZ2 A;  3ULQ A;  3FTZ A;  4J7W A;  2FI7 A;  1UJJ A;  2FF4 A;  3ZEF A;  2XS1 A;  4I2W A;  4HB5 A;  2KCL A;  5AIJ A;  4U7E B;  2RD0 A;  2WXR A;  3Q9N C;  4ILH B;  2WXJ A;  3Q47 B;  4GA0 A;  1KZO A;  1YA0 A;  4JA7 A;  4I6E A;  3UMV A;  3CHM A;  4CEM A;  2RG8 A;  3E37 A;  3VLD A;  1H6O A;  5KNG A;  3SFY A;  4PS8 A;  2PNN A;  3PNT B;  3AS5 A;  5A6C A;  4KT6 B;  4HS2 A;  2X6K A;  4DLO A;  1QBQ A;  5CED B;  2WXG A;  4JHK A;  3TWW A;  3C72 A;  4JHJ A;  4K5B A;  3CIA A;  1SA4 A;  4HBD A;  2KBX A;  4K03 A;  2HO1 A;  4WWN A;  2VGX B;  3DSV A;  3CR3 A;  3MEK A;  2OOE A;  4TV3 A;  3RJV A;  2IY0 C;  3CHR A;  2A5U A;  5EIL A;  4FJZ A;  3UUX A;  3LPZ A;  3T9K A;  3FU6 A;  2AVP A;  3SBT B;  4G2V A;  3EDT B;  4EBA A;  1S70 B;  4YDW A;  4APF A;  4HI8 A;  3ZYQ A;  1OUV A;  1IHB A;  1JCS A;  3NZU A;  1IYG A;  3ONL A;  1SW6 A;  2R5S A;  5LX8 A;  4O6F A;  3MA5 A;  3ULE G;  5FTP A;  4GYY A;  4KBQ A;  3MYV A;  1Z5S C;  1E8Y A;  4JD2 G;  5T3R A;  1N4P A;  5BXU A;  3IKO B;  3R9M A;  2FBN A;  2OND A;  4WNG A;  3JQ0 A;  4B89 A;  1AP7 A;  5BV0 A;  2HE0 A;  1JPL A;  2L0T B;  3UM1 A;  4I43 A;  4O1O A;  3QC1 A;  3SNX A;  2Y4U A;  1SVX A;  4NRH B;  1PAQ A;  4HRM B;  2RFM A;  5AQ7 A;  3SY2 A;  3RRU A;  3ZYK A;  4CZ2 D;  4N2S A;  5FIO A;  4GZ5 A;  3TWU A;  4G1T A;  4RLY A;  3G2W A;  4HFG A;  3TWX A;  1HF8 A;  5FZS A;  3D9L A;  3R7Q A;  3N71 A;  2CG2 A;  1ELK A;  4H7Y A;  1BU9 A;  4UI9 C;  2ILR A;  1TNB A;  2AW6 A;  3JQ1 A;  4EPZ A;  2PQR A;  3D9I A;  1QQE A;  5D66 A;  3UM0 A;  5CCM A;  3DXK G;  4DRX E;  3I4G A;  3CQG B;  5ENO D;  1MHQ A;  4LNB A;  1OWN A;  3KSQ A;  3UIN C;  3AAA C;  1N0R A;  3IHV A;  2HYZ A;  4GTP A;  1JUQ A;  3LKU A;  2QFC A;  2FEZ A;  3SFX A;  3QKY A;  2VGY A;  3DSW A;  3FEX A;  3APC A;  4GPM A;  1TN8 A;  4JVS A;  4TUM A;  2X6H A;  3ZRH A;  1OWP A;  3E4B A;  4GU5 A;  5G05 C;  4FUL A;  1IXV A;  4QFV A;  2MOW A;  2X3M A;  2XPZ A;  3PZ3 A;  3I3N A;  2LSU A;  4XKB A;  3CSF A;  2QY7 A;  4ANX A;  2I2O A;  2Y3A A;  1DCE A;  4LRZ A;  1NA0 A;  3QAQ A;  2J9Q A;  3URZ A;  3CHP A;  3Q5M A;  3FUF A;  4JHR A;  3ABK E;  3QJZ A;  2X6F A;  3PEV B;  3FH7 A;  5E75 A;  2DWZ A;  3LCA A;  3CVY A;  5D0Q D;  4JZY A;  3IBE A;  4H7X A;  3L6A A;  2XEV A;  3CGH A;  4WAF A;  3G2T A;  3ZU7 B;  4GTM A;  2VGE A;  4XIF A;  3S7J A;  2R03 A;  1SZ9 A;  3B7S A;  3NAW A;  3CK9 A;  3ASF A;  3DPY A;  2DYR E;  2BTD A;  1D8E A;  4ACL A;  2B0O E;  4AJW A;  3WG7 E;  2GRO B;  4NUR A;  4PH4 B;  4BT9 A;  3AU4 A;  2V5F A;  2XEN A;  3DBS A;  3APD A;  2A5E A;  3MZL B;  3UT4 A;  5ANL A;  2VTB B;  2WQH A;  1OCZ E;  3ASH A;  3E30 A;  1TEZ A;  3RRN B;  3FY4 A;  4OAV B;  5IY5 E;  2J09 A;  5FWQ A;  3CV0 A;  2X6J A;  4AVX A;  3HXE A;  4NAC A;  5CHE E;  4EZK A;  2IJG X;  4X8Q A;  2WXL A;  4F53 A;  5FJY A;  3AJI A;  3IXE A;  3E34 A;  3L22 A;  5C2Y A;  3CK8 A;  4OYS A;  3TWR A;  3U3W A;  2P9K G;  1U3D A;  1KT0 A;  3Q9U C;  3KD7 A;  2QC9 A;  5EKQ D;  2EQX A;  2XPY A;  3FU5 A;  3T8K A;  4FAD A;  2XQ0 A;  4BT8 A;  3DSX A;  3MKQ A;  5CBO A;  5ANR A;  2DYS E;  3T5X A;  3UT8 A;  5G04 C;  3PDN A;  5AEN A;  4JXT A;  1V54 E;  3CVX A;  2WPV A;  3BU8 A;  4EBA G;  3EHN A;  3L16 A;  2L6J A;  1N4S A;  4N39 A;  1DCQ A;  1QZ2 A;  3D9O A;  2PL2 A;  4JC8 A;  1E8Z A;  1YCS B;  3ESK A;  3KSL A;  3FHE A;  4AOF A;  5ENR D;  2V4H C;  1GW6 A;  2Y69 E;  1UN9 A;  4C9B B;  1SA5 A;  4DX5 D;  4GTR A;  2ION A;  4FHJ A;  3ZPJ A;  3EU9 A;  3G2U A;  4HRN A;  3SBS A;  3SQV A;  1OXJ A;  2LAI A;  1H6K A;  3Q78 A;  2WQ6 A;  4QQI A;  1UN8 A;  2OVB A;  4GYW A;  3JXJ A;  4J8D A;  4UWK A;  1FVF A;  3ZXS A;  1OWM A;  2LO6 A;  2VJ8 A;  5ENT D;  2L9B A;  5BV1 A;  5AQ9 A;  1S64 A;  3CK7 A;  3TXN A;  2ETB A;  4LEU A;  4GZD A;  4KMO A;  2XRY A;  3D9N A;  1HG2 A;  2ZIR A;  3PEU B;  4Y6C A;  3ZNG A;  3IHY A;  4DI3 A;  3QAR A;  4CRW A;  2LXM A;  1FT1 A;  3FH5 A;  4K0R A;  1HO8 A;  3F6Q A;  2PM6 A;  4HVB A;  1WY6 A;  3OAW A;  4I17 A;  3ZN3 A;  2E2E A;  4FLH A;  3ZW3 A;  2LAH A;  2WVI A;  4GTO A;  3U9W A;  3L54 A;  2ETA A;  4F7A A;  4XZ4 A;  1ZBP A;  5D0O D;  2ZU6 B;  4U8Y D;  3CEQ A;  2KAT A;  5AJD A;  4B8A A;  3KS2 A;  2F8Y A;  4HOR A;  2J8S D;  3RK6 A;  4ACK A;  1H2U A;  3NBN B;  1PY1 A;  3RO3 A;  2DBA A;  1TJC A;  4IYP A;  4A1G A;  1D8D A;  2BKG A;  3TL5 A;  5G55 A;  2RKK A;  3LJ3 A;  2F0Y A;  5HKP A;  3ZYL A;  1TNY A;  5LP0 A;  5KBA A;  1HU3 A;  2UY1 B;  3FUJ A;  4G26 A;  1P5Q A;  4R7L A;  4L2L A;  2F8X K;  3LVR E;  3RU0 A;  3UIP C;  1DC2 A;  3GYZ A;  4BTB A;  4HLL A;  3WXX A;  4I1O B;  1EPU A;  3CKC A;  4U8H A;  1JCQ A;  4CGW A;  2XZD G;  1H6P A;  1N4Q A;  3TWV A;  3D9J A;  4ANW A;  3UM3 A;  4HRL A;  4YDE A;  4JPS A;  4L2Y A;  3FUN A;  5AYW D;  1ZB1 A;  4G8L A;  5LFA A;  2NSZ A;  2H6I A;  1JCR A;  2P9S G;  5ENP D;  5A23 A;  3MCX A;  5FQ6 A;  1O1R A;  3EU5 A;  2WXM A;  3RSE G;  2JLB A;  3DWL G;  4GCN A;  1KZP A;  4UWL A;  3P1U A;  4JB8 P;  3PUK A;  5JMN D;  4BTA A;  3NQP A;  1DNP A;  3EIQ C;  4XX5 A;  4G11 A;  3HXC A;  3C5R A;  3CHS A;  1OT8 A;  5G05 J;  2EIL E;  1ZU2 A;  4B93 B;  3SD5 A;  3L9T A;  1H19 A;  4OVU A;  4MKT A;  2MHK A;  5KJM A;  2GRP B;  3V31 A;  2I6H A;  1Z3X A;  1TNZ A;  4BSZ B;  1XGW A;  4FA6 A;  1WAO 1;  4I9C A;  3ABM E;  4WNE A;  2VQ2 A;  3Q49 B;  3U66 A;  3HVE A;  3NOG D;  3VTY A;  3LXU X;  4J8E A;  3JUE A;  1UOH A;  3FUK A;  1K1B A;  2WMN A;  3HVE B;  2F37 A;  1UG3 A;  4J0U A;  5H7P A;  4EZJ A;  2WXQ A;  3SHF A;  4GA2 A;  4F6R D;  5B1B E;  4YVQ C;  5HQ8 A;  2I1J A;  2WXO A;  5ENN A;  2MRI A;  2IQC A;  3HG0 D;  3NF1 A;  2GGF A;  3UTM A;  1BI8 B;  1MX6 A;  2KCK A;  3QWW A;  3ZHE A;  3R7R A;  3I5P A;  4CT0 A;  1NP7 A;  3RRM B;  3W9G A;  3FTW A;  4GTT A;  5HS0 A;  1O1S A;  3ZHE B;  3OTN A;  4URK A;  3D3M A;  3B7B A;  4A1S A;  3OXG A;  3FTX A;  3FTV A;  5B3S E;  3TXM A;  5FZR A;  1NZN A;  3FU3 A;  2P9L G;  4C48 B;  3LYA A;  2NYJ A;  2XPI A;  3LEW A;  3K9I A;  1OCR E;  1TNO A;  3ASG A;  2XZT G;  4RVB A;  3C3O A;  4B8C B;  4NIK A;  3NZS A;  3ISM C;  1OCO E;  1NA3 A;  3LVQ E;  1WDY A;  1HG5 A;  2H6F A;  2UWJ G;  3HYM B;  5ARF A;  4HI9 A;  1JWF A;  4LNG A;  4YND A;  4UQZ A;  3LY8 A;  3FUD A;  4JEH A;  3TG5 A;  2BKK B;  2Y0B G;  4G8K A;  4RG9 A;  2IOS A;  1HFA A;  3PS6 A;  2L6B A;  3UT7 A;  2P9U G;  1G3N B;  2YQ8 A;  2QZA A;  2OVF A;  4RQI A;  3AG1 E;  5KCM A;  2P9N G;  3DXM G;  4N5C A;  4Y6W A;  4ZFH A;  4I1A A;  2AXV A;  3UKR G;  1HE8 A;  4GCO A;  1Y6I A; 
#chains in the Genus database with same CATH homology
 3L16 A;  2L6J A;  2CFZ A;  4N39 A;  2I1K A;  1W3B A;  2GRL A;  4BY6 A;  3MV2 B;  1HXI A;  2M63 A;  2YIN A;  5C1D A;  1QZ2 A;  3D9O A;  2V4L A;  2PL2 A;  2HM8 A;  3CLJ A;  3JUI A;  4V3I A;  5M72 A;  2UY1 A;  4AY5 A;  4JC8 A;  5CCL A;  5CMW A;  2VYI A;  1E8Z A;  3ESK A;  2BF0 X;  3U64 A;  1U3C A;  3IV0 A;  4KZC A;  3FHE A;  4AOF A;  2J49 A;  3T5V A;  4CDR A;  3MGB A;  3GZ2 A;  4FLB A;  3ULQ A;  1GW6 A;  3FH8 A;  3FTZ A;  4EQF A;  5KJK A;  1UN9 A;  4C9B B;  3FTY A;  2FI7 A;  1UJJ A;  1B89 A;  2FF4 A;  3ZEF A;  2ION A;  4I2W A;  3VLF A;  4UWG A;  1E8W A;  2FO7 A;  2KCL A;  1JWG A;  3BG1 B;  4BSX A;  4XI0 A;  1OWO A;  5AIJ A;  3MX3 A;  5KJL A;  2RD0 A;  4FHJ A;  2WXR A;  3L08 A;  4KVO A;  4RSY A;  4ILH B;  3AS8 A;  3ZPJ A;  3MV3 B;  4M3O A;  2WXJ A;  1Z6T A;  3G2U A;  3Q47 B;  1E8X A;  1HH8 A;  3ML8 A;  4GA0 A;  3ZYM A;  3QWV A;  3SBS A;  1YA0 A;  4ABN A;  4JA7 A;  4I6E A;  3UMV A;  4E85 A;  3CHM A;  4CEM A;  2WQ6 A;  2LAI A;  1H6K A;  2RG8 A;  2BUG A;  4G24 A;  2C0L A;  1UN8 A;  2WXH A;  3VLD A;  4CT4 A;  2OVB A;  5EDS A;  1E90 A;  4GYW A;  2PZI A;  4J8D A;  4MS6 A;  4UWK A;  3TG4 A;  1FVF A;  4PS8 A;  3ZXS A;  1OWM A;  2LO6 A;  3PNT B;  3AS5 A;  3ASD A;  5A6C A;  2KCV A;  3FUE A;  2VJ8 A;  3AU5 A;  3PE3 A;  5DIZ A;  4JL0 A;  4KT6 B;  2L9B A;  2XGS A;  4HS2 A;  5BV1 A;  3CK7 A;  3TXN A;  4U07 A;  4RG6 A;  2X6K A;  4DLO A;  2WXG A;  4BWR A;  4LEU A;  2WM9 A;  3GW4 A;  4GZD A;  4KMO A;  4JHK A;  2XRY A;  3LDZ A;  1H0A A;  2XHE A;  1HG2 A;  3D9N A;  5ARG A;  4JHJ A;  3CVN A;  3PEU B;  3QOU A;  4LUN U;  4ANU A;  2GRM A;  4Y6C A;  2WXK A;  3PVL A;  3B7T A;  3CIA A;  3IHY A;  4DI3 A;  3QAR A;  4CRW A;  3CVW A;  2L0I A;  4K03 A;  3FUI A;  1E7U A;  4DJA A;  3CHQ A;  3FH5 A;  4K0R A;  3UX4 A;  2HO1 A;  4GA1 A;  4WWN A;  2J07 A;  2VGX B;  1HO8 A;  3ENE A;  2PM6 A;  3HDX A;  4AEZ C;  4AIF A;  4HVB A;  3CR3 A;  3MEK A;  1WY6 A;  2OOE A;  3RKV A;  3MKR A;  4TV3 A;  4JW1 A;  3RJV A;  3CHR A;  2A5U A;  3OAW A;  4FJZ A;  3FUM A;  3UUX A;  4L1B A;  3B13 A;  1IQR A;  3LPZ A;  4I17 A;  3ZN3 A;  3D9P A;  3FU6 A;  2AVP A;  2YHC A;  2WXI A;  1DVP A;  3OXL A;  3SBT B;  2E2E A;  4FLH A;  3ZW3 A;  4G2V A;  3CHO A;  3EDT B;  4N3B A;  4EEC A;  2LAH A;  3QNK A;  4GAA A;  2WVI A;  4EBA A;  3EJN A;  2V0P A;  2YNQ A;  4KYO B;  4APF A;  3U9W A;  3L54 A;  3ZYQ A;  4F7A A;  4XZ4 A;  2Q7F A;  2NXP A;  2WQ7 A;  1QNF A;  1ZBP A;  1OUV A;  2FUL A;  3NZU A;  4UI9 K;  5D0O D;  3ONL A;  2R5S A;  5LX8 A;  2ZU6 B;  1IYG A;  3HHM A;  3CEQ A;  4O6F A;  2A4Z A;  3MA5 A;  5G04 J;  5FTP A;  3CVP A;  4NQ0 A;  4GYY A;  4KBQ A;  2KAT A;  3MYV A;  1E8Y A;  3MKQ B;  3UQ3 A;  3T8M A;  5T3R A;  5AJD A;  4B8A A;  3KS2 A;  3IKO B;  4HOR A;  3S7D A;  2E0I A;  2FBN A;  2OND A;  4U0S A;  3O4Z A;  3JQ0 A;  4WNG A;  3BG0 B;  4GZ3 A;  3RK6 A;  4B89 A;  2VSO E;  3FFL A;  1H2U A;  4ACK A;  3TGO A;  4DI4 A;  1PY1 A;  3B7R L;  3RO3 A;  5BV0 A;  1JPL A;  2DBA A;  1TJC A;  4IYP A;  4A1G A;  2L0T B;  4B0Z A;  4I1M A;  4G25 A;  4I43 A;  3CQC B;  3TL5 A;  3QC1 A;  5G55 A;  3LJ3 A;  3SNX A;  3UPV A;  2Y4U A;  4NRH B;  3ZYL A;  1PAQ A;  1IQU A;  2VSY A;  5LP0 A;  1INZ A;  5E76 A;  4Q96 A;  1UJK A;  2YHE A;  4GZC A;  1HU3 A;  5BPP A;  2UY1 B;  3FUJ A;  3RRU A;  3ZYK A;  4N2S A;  4G26 A;  1P5Q A;  4R7L A;  4L2L A;  3CKB A;  3PH0 C;  4GZ5 A;  5JHA A;  3LVR E;  3FU0 A;  4G1T A;  3RU0 A;  4UWH A;  3G2W A;  4HFG A;  4CDM A;  3JCK C;  2R59 A;  5EX0 A;  1HF8 A;  1FVH A;  2AXZ A;  4AY6 A;  2I9C A;  4FP7 A;  5FZS A;  4HXI A;  3GYZ A;  4BTB A;  1E7V A;  3D9L A;  5T8I A;  3R7Q A;  3N71 A;  3WXX A;  3AS4 A;  1HS6 A;  2CG2 A;  3QB2 A;  5T4Y A;  4IRU A;  4ATG A;  1ELK A;  4H7Y A;  4WND A;  4I1O B;  2XCB A;  4WWO A;  4C0E A;  4UI9 C;  2ILR A;  2V8S E;  4I6G A;  2AW6 A;  1EPU A;  3CKC A;  3D9M A;  2CHX A;  4U8H A;  3JQ1 A;  4EPZ A;  4HLE A;  5FQ7 A;  2Y4T A;  4CGW A;  2PQR A;  3D9I A;  1QQE A;  1HZ4 A;  1E96 B;  3ZFW A;  5CCM A;  3FDH A;  4BX9 A;  2WXN A;  3ONK A;  4GB9 A;  5FZQ A;  5J08 A;  3I4G A;  3D9J A;  4ANW A;  3SFZ A;  3CQG B;  2J4D A;  4B94 A;  4N2Q A;  1A17 A;  1MHQ A;  3JYS A;  4JPS A;  4L2Y A;  5A7D B;  2VTB A;  3FUN A;  5AYW D;  4UQY A;  3SGH A;  3EHM A;  1OWN A;  3LY9 A;  3PNL B;  5HI7 A;  5LCW C;  3RO2 A;  5LCW J;  5LFA A;  2NSZ A;  2OV8 A;  3CVL A;  5A23 A;  3IHV A;  2HYZ A;  3MCX A;  5FQ6 A;  1JUQ A;  1EDU A;  3GZ1 A;  2VSX E;  2QFC A;  3LKU A;  2WXM A;  2FEZ A;  3QKY A;  5JHB A;  2JLB A;  4GCN A;  2VGY A;  3FEX A;  4UWL A;  5LOZ A;  3APC A;  3P1U A;  2X6I A;  1S0P A;  3CVQ A;  4HOQ A;  3IEG A;  3PUK A;  5FQ4 A;  4DPR A;  3ZIM A;  4Q69 A;  4HOS A;  3Q4A B;  4JVS A;  4BTA A;  3NQP A;  1DNP A;  2X6H A;  2P58 C;  3ZRH A;  3FTU A;  3EIQ C;  1OWP A;  4PUC A;  3E4B A;  1BPO A;  3Q15 A;  4GU5 A;  4XX5 A;  4G11 A;  1PC2 A;  3APF A;  3P2B A;  5JJ6 A;  3R9A B;  3CHS A;  1MQS A;  3PUJ A;  1UW4 B;  4FUL A;  4WUY A;  3EIJ A;  5G05 J;  5G05 C;  4F1S A;  2J4B A;  4QFV A;  4OVV A;  1ZU2 A;  2MOW A;  2X3M A;  4WWP A;  3CVV A;  3SD5 A;  4CCA A;  2XPZ A;  4LER A;  3TJP A;  3G2V A;  3I3N A;  1H19 A;  2CHW A;  2LSU A;  4XKB A;  3CSF A;  4U04 A;  1XNF A;  4OVU A;  4WNF A;  4ILG A;  1X5B A;  4MKT A;  2MHK A;  3KAE A;  3PE4 A;  2QY7 A;  4CGV A;  5KJM A;  2XCC A;  2I6H A;  1Z3X A;  4FJY A;  4ANX A;  2I2O A;  2KM4 A;  1XGW A;  3L17 A;  4L7T A;  2WMO A;  1WAO 1;  2Y3A A;  3QDN A;  4I9C A;  3MJW A;  3U4T A;  4FA6 A;  4LRZ A;  1NA0 A;  3QAQ A;  2J9Q A;  4WNE A;  2VQ2 A;  3Q49 B;  3U66 A;  3PRZ A;  4XI9 A;  3FTS A;  3CHP A;  3URZ A;  1IHG A;  3HVE A;  1SQM A;  5JJ7 A;  2CFU A;  3Q5M A;  4ME2 A;  3FUF A;  3VTY A;  3ZGQ A;  3LXU X;  4J8E A;  4JHR A;  4N3C A;  2J08 A;  4I6J A;  2KC7 A;  4J8F A;  5AJL A;  1H2T C;  4HOT A;  3FUK A;  4FHK A;  2WMN A;  3QJZ A;  2JEK A;  2X6F A;  3PEV B;  3FH7 A;  3HVE B;  3VLE A;  2XRZ A;  1UG3 A;  4J0U A;  3SI5 A;  4UQX A;  4TRQ A;  4FC8 A;  3ESL A;  4AM9 A;  4JA9 A;  5E75 A;  4AV7 A;  4C0M A;  4U0Z A;  3LCA A;  4JEU A;  4G23 A;  4AXH A;  2WXQ A;  4EZJ A;  4GZ6 A;  4N3A A;  5D0Q D;  3SHF A;  4XKC A;  3CVY A;  4JZY A;  3SZ7 A;  2KZT A;  4GA2 A;  4EZL A;  3IBE A;  4H7X A;  4YVQ C;  2VSN A;  3L6A A;  5HQ8 A;  2XEV A;  2I1J A;  4U0U A;  3CGH A;  4PS3 A;  1ELW A;  1Z3Y A;  2WXO A;  3ZVV A;  4WAF A;  3G2T A;  2KZT B;  3FUL A;  2XGO A;  5ENN A;  2WXP A;  2MRI A;  2IQC A;  3NF1 A;  4XIF A;  3S7J A;  4IN3 B;  2GGF A;  4D10 C;  4E6H A;  2X38 A;  5KJN A;  2KCK A;  1HX8 A;  3O48 A;  1SZA A;  1SZ9 A;  3QWW A;  3ZHE A;  4GML A;  3B7S A;  3R7R A;  1H2V C;  3I5P A;  4UI9 J;  3LY7 A;  3CK9 A;  4CT0 A;  1NP7 A;  3RRM B;  2DIW A;  3FUH A;  4J6I A;  3ASF A;  1KT1 A;  4UWF A;  3S2A A;  3KEZ A;  4DLQ A;  3FTW A;  2BTD A;  3ZHE B;  4ACL A;  3OTN A;  4KXK B;  3C98 A;  4URK A;  4AJW A;  1TJF A;  3DPD A;  2AWI A;  2PQN A;  3D3M A;  2IOL A;  2AXU A;  3G2S A;  4NUR A;  5BW8 C;  3OXG A;  3FTX A;  4A1S A;  4A3T A;  4ANV A;  4PH4 B;  3FTV A;  4BT9 A;  5CMY A;  1EF1 C;  2CHZ A;  3AU4 A;  3TXM A;  3PZD A;  5FZR A;  1NZN A;  2IU1 A;  2V5F A;  3FU3 A;  5FQ8 A;  4A3V A;  5BUZ A;  3DBS A;  4PS7 A;  3APD A;  3ML9 A;  3LYA A;  3MZL B;  4I9E A;  3UT4 A;  3GZS A;  4BX8 A;  4FU3 A;  4IUL A;  5ANL A;  2WQH A;  2XPI A;  3ASH A;  3LEW A;  4DK5 A;  2VTB B;  3K9I A;  1TEZ A;  3ASG A;  3RRN B;  3FY4 A;  4GYO A;  4YVO A;  4RVB A;  2J09 A;  5FWQ A;  3CV0 A;  4B8C B;  3LS8 A;  4ILI A;  3NZS A;  3FWV A;  2X6J A;  4GMJ A;  1LF8 A;  3D9K A;  3CVU A;  2R17 C;  1NA3 A;  4AVX A;  3LVQ E;  1OWL A;  2DCP A;  4NAC A;  2WB2 A;  1ELR A;  1HG5 A;  4BFR A;  3PRE A;  5CHE E;  2XGM A;  2UWJ G;  3RIB A;  4EZK A;  2IJG X;  3SF4 A;  4APO A;  3S7B A;  2WXL A;  3HYM B;  4L23 A;  5FJY A;  4F53 A;  1WM5 A;  5ARF A;  4I2Z A;  2VGX A;  1JWF A;  2C0M A;  1VDY A;  4KZ0 A;  2GW1 A;  4GPK A;  2CG3 A;  3L22 A;  4YND A;  5C2Y A;  4XE0 A;  3CK8 A;  1Y8M A;  3S7F A;  4CDN A;  4OYS A;  3U3W A;  4UQZ A;  4F3V A;  1U3D A;  1KT0 A;  3LY8 A;  3FUD A;  4JEH A;  4KVM A;  4PDX A;  3TG5 A;  4W9R A;  3KD7 A;  5FT9 A;  5G2N A;  2LNI A;  4U63 A;  3CST A;  5EX3 A;  3VTX A;  4RG9 A;  4A55 A;  5JJT A;  3TAX A;  5EKQ D;  3FP3 A;  3QWP A;  2IOS A;  1HFA A;  2EQX A;  1FCH A;  3PS6 A;  3UT7 A;  2XPY A;  1N54 A;  3FU5 A;  4FAD A;  2HR2 A;  2NC9 A;  2XQ0 A;  2YQ8 A;  1N52 A;  3L13 A;  3QK0 A;  4BT8 A;  4P29 A;  5BNW A;  3BEE A;  1KLX A;  2OVF A;  2IF4 A;  4TUU A;  3HIZ A;  4Q94 A;  5KCM A;  4J8S A;  3MKQ A;  4LCT A;  5BT1 A;  5ANR A;  5DBK A;  4HOU A;  2WXF A;  2C2L A;  3T5X A;  4N5C A;  3I4R B;  3FEY A;  3UT8 A;  1L5J A;  4AP2 A;  2IFU A;  5G04 C;  3OXF A;  3PDN A;  5AEN A;  4Y6W A;  4MRU A;  4I1A A;  2AXV A;  2LSV A;  4JXT A;  5J90 A;  4MLP A;  3B7U X;  2PM7 A;  3CVX A;  2WPV A;  4EBA G;  1HE8 A;  4GCO A;  1Y6I A;  3EHN A;  1EYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...