2IOLA

Crystal structure of the c-terminal ma3 domain of pdcd4 (mouse); form 1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
127
structure length
127
Chain Sequence
QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed Cell Death 4, Pdcd4
publication title Structural basis for inhibition of translation by the tumor suppressor pdcd4.
pubmed doi rcsb
source organism Mus musculus
molecule tags Antitumor protein
total genus 43
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iolA00
5ANRA 2IONA 4CEMA 3FEYA 2IOLA 4B8AA 4LUNU 4GMLA 1H2VC 4C9BB 2IU1A 3D3MA 1N52A 2VSXE 4B89A 4GMJA 3EIJA 1UW4B 2RG8A 1N54A 4CRWA 1PAQA 4B8CB 2FULA 4JHJA 2VSOE 2GGFA 3L6AA 4JHKA 3FEXA 1HU3A 2ZU6B 3EIQC 1UG3A 1H2UA 4CT4A 3JUIA 3RK6A 2IOSA 1H6KA 2HM8A 2NSZA 1H2TC 4IULA 2KZTB 2I2OA 2KZTA
chains in the Genus database with same CATH superfamily
3HIZA 3LEWA 4U0ZA 3IV0A 4BSXA 2VSYA 2WXKA 4CDRA 3CHOA 1UW4B 2LXMA 2AXZA 5FQ6A 3RJVA 3ZGQA 1RW2A 3PEUB 2B0OE 3C3QA 2BKKB 3P1UA 2XZDG 3CVVA 3CHQA 3PUKA 4BETA 3PRZA 4A1GA 5CRUA 3KD7A 3MZLB 3QK0A 1U3CA 4PUCA 1HS6A 1Z3XA 1N54A 2V8SE 2QFCA 5D2MC 3UI2A 2CHXA 2OOEA 4UWGA 2Y4UA 4L2YA 5EIDA 1IXVA 1INZA 4OYSA 5LP0A 2WB2A 2RKKA 3LYAA 2WM9A 5BXOA 4FHKA 1AP7A 4ILHB 3TL5A 3FH5A 4DX5D 5E75A 2AWIA 3C3OA 3AS8A 5T3RA 4JEHA 1UJKA 4L1BA 3E37A 3Q9NC 3V2XA 1UOHA 3ZFWA 4XZ4A 1MJ0A 5IY5E 3HRAA 3TJPA 3BG0B 3FH7A 4JA7A 5JJ7A 4ILGA 5FIOA 1H6OA 2ZIRA 2C0MA 4F7AA 3UXGA 4Y6CA 2V5FA 2CFZA 2H6HA 4F3VA 4G25A 2L0IA 3ZPJA 2VJ8A 4HLEA 2OVBA 2WXPA 2QY7A 3FULA 3LVRE 3PDNA 2PM6A 1E8YA 1TNZA 4LNBA 1SVXA 3FH8A 3TWRA 4LNUD 4LUNU 3TGOA 3TG5A 4I17A 4JD2G 1Z6TA 1JUQA 1RZ4A 2VSNA 3AG1E 4IRUA 3D9LA 2LAIA 1IHGA 4UWLA 1D8EA 4FLHA 4XE0A 4LEUA 3DSVA 5JMND 3RK6A 4GYOA 5ENQD 3B95A 3ABKE 4A3VA 1ZB1A 2VQ2A 3HDXA 4AY5A 3LKUA 3J5PA 1IQRA 2ZGGA 4NIKA 5CMWA 5ENTD 2IY0C 4CGVA 3EU9A 3B7SA 3C3RA 3FP3A 3FDHA 3OAWA 1WDYA 5HQ8A 5DBKA 1TR4A 5FINA 5FZQA 1HG2A 1BPOA 4U7EB 2H6IA 4L7TA 2FULA 1IHBA 5KCMA 4HQDA 3QB2A 4Y6WA 2UY1A 3DSWA 3Q7FA 4BWRA 1E7VA 4YVQC 1BLXB 2PL2A 3HVEA 4ACLA 4J6IA 3QOUA 3D9KA 3CEQA 4ILIA 5EYPF 3KAEA 4B0ZA 4FU3A 4ANVA 4EECA 3ABLE 3L9TA 2GROB 2JEKA 1S70B 3UM0A 4GYWA 4D10C 4HOTA 3TWWA 5C1DA 4L2LA 2P58C 3MYVA 3FTSA 1WAO1 4BEPA 2P9IG 3CHRA 4LNGA 2YINA 5FT9A 4DX2A 4NQ0A 4OAUC 2QZAA 5DIZA 3AG3E 3RRNB 2IEJA 1H2TC 5EYLA 2KCLA 4HBDA 1N4RA 3L82A 1SZAA 1WG0A 4FULA 2XHEA 1O1SA 4FC8A 4YDOA 3UT8A 5FTPA 4G11A 3UM2A 3IKOB 3U64A 4F53A 3P2BA 4I1AA 4YVOA 3LDZA 4C9BB 1D8DA 1SA5A 3MCXA 1TNYA 3ASDA 5FQ7A 2V5QC 5T4YA 4IN3B 3GYZA 4B8CB 2J4DA 3EDTB 5G04C 5AQBA 2ETAA 3Q5MA 4ANXA 4UI9C 1S0PA 2Y0BG 2DZOA 5CERB 1DCQA 1NA3A 1PY1A 2X6IA 1OWOA 3U3WA 2F37A 4AOFA 4J8FA 2I2OA 3TXMA 1TYQG 4G23A 4I1MA 4IYPA 4JW1A 3W9FA 3CVYA 4U95D 5EDSA 4AIFA 4KZ0A 3UT4A 3FTWA 4GZCA 1KZOA 4I2ZA 5CBOA 3EIQC 1UG3A 3CHPA 4RLYA 3SBSA 3APFA 4I6JA 3Q73A 3ZW3A 4HB5A 5ANRA 4CGWA 1HXIA 4GA1A 3AAAC 2JLBA 5G2NA 3HVEB 3KEAA 3BQOA 4ANUA 4YNDA 1H2UA 2WXGA 1DNPA 2R2LA 2VGYA 1SQMA 2XGOA 4C0MA 3HYMB 5BXUA 1N4QA 4M7CA 2WXMA 3QAQA 4CZ2D 3B7TA 2BTDA 1FVHA 1W3BA 1X81A 3MJWA 5AN8A 3RSEG 2CHZA 2A4ZA 4A1SA 2XEEA 5JHBA 3X2QE 3ZN3A 1E90A 3CKCA 3JQ0A 2F0YA 5CBNA 3PREA 3KSLA 4GPMA 4BESA 4U8HA 3UIPC 3EHMA 3FFLA 5B1BE 2Y3AA 4KVOA 2MRIA 3Q49B 2P9KG 5FJYA 5G05C 4CYMD 2DCPA 4DUIA 2VYIA 4O6FA 3LY8A 4AJWA 4GB9A 4UWKA 5AYWD 2IU1A 5LCWC 2GRMA 3TG4A 4KT6B 1HH8A 2Y1LE 4V3IA 4K5CA 3I4GA 1N0RA 3ZXSA 4FLBA 3T8KA 4CDNA 3CVUA 4KXKB 2V0PA 4HOQA 3CQCB 1KPSB 3APCA 3LVQE 4U96D 4LSZE 1P5QA 4JPSA 3VTXA 3TWTA 3JUEA 1TEZA 4TUUA 3URZA 3BG1B 4XKBA 4MBGA 3QNKA 2B6CA 2XPIA 5J90A 3CGHA 2Q7FA 5CECB 2NC9A 4G1TA 4N5CA 2X6HA 1GW6A 3ZXPA 3FUFA 1JCRA 1LF8A 5AIJA 3O48A 3QARA 1U3DA 3T5XA 5E76A 4HNAD 3LY7A 2CG2A 5G04J 4BX8A 1OY3D 2BUGA 1MX6A 4URKA 4A63B 4G2VA 1QZ2A 2L9BA 4UI9J 5AJLA 4LERA 2PQRA 4GZ3A 3W9GA 1O5MA 4U04A 3Q7AA 4I2WA 3HXEA 2HM8A 4HRLA 3PNLB 3Q78A 3DWLG 3FU0A 3NZSA 2IO3C 1G3NB 3RRMB 2FBNA 5AQ7A 4KMOA 3NBNB 4U0SA 5ENRD 1IYGA 3ZHEA 2I1JA 3FUMA 2FO1E 2GRPB 2GRQB 1LD8A 3CKBA 4O60A 4PS8A 3FUNA 2VTBB 5M72A 4FA6A 3D9MA 2PNNA 3FTUA 3D9PA 4I1OB 4C0EA 1XGWA 2PM7A 4PS3A 1N52A 1S63A 5JA4D 3DXKG 1FCHA 4JEUA 5C2YA 4OVUA 3EJNA 4GTPA 1TN6A 4GTVA 1YCSB 4Q94A 2E2EA 4C48B 4JXTA 5A7DB 4XI9A 2WPVA 5T8IA 3MV3B 3ESKA 2AJAA 2GRRB 2ZU6B 4GA2A 3SI5A 3SO8A 3PUJA 5CCLA 2I1KA 2WXFA 1JWFA 1E7UA 3U4TA 1E8WA 5G05J 3CVPA 2X3MA 2WQ7A 5EN5D 2J4BA 3NQPA 1HE8A 2HO1A 3FEXA 5LCWJ 3PZ3A 2WQHA 3LJNA 3SNXA 4HLLA 2AXVA 3ML9A 2V4LA 3SY2A 4FJZA 3QWWA 2L0TB 3I4RB 4WNGA 3RRUA 4FP7A 5EX0A 2I9CA 5BNWA 1QBQA 3DSUA 2ZXWE 1KZPA 5AAOA 4RQIA 3O4ZA 3CK9A 3R7RA 3ULYA 2DIWA 2X6JA 3UKUG 4PH4B 1UN8A 4GTTA 1PC2A 4B89A 4R7LA 3SQVA 3QKYA 3L16A 3UT7A 3NOGD 1H6PA 4BT8A 2EIJE 3C5RA 1H0AA 4AY6A 3ULEG 2I6HA 3ASHA 1QNFA 3V2OA 4FHJA 3MEKA 2LO6A 4WUYA 5ENSD 4GMJA 2XPYA 2EIKE 3Q75A 4XX5A 3PZ4A 4J0UA 3DSTA 3IEGA 5AQ9A 4DPRA 3UKRG 3QJZA 2FI7A 5BV1A 5HI7A 5LX8A 3WG7E 2P9PG 2WXNA 2KZTB 4RVBA 3DSXA 3ZHEB 4JHRA 3T8MA 5CCMA 3DXMG 3S7JA 3C98A 3NB2A 2FO7A 2AXUA 4JB8P 1MZCA 4N3AA 3QWPA 1S64A 3EUVA 3GZ1A 1EYHA 4B93B 4APFA 4O1PA 2VGXA 3PE4A 5ENNA 3ESLA 4HOUA 3ZIMA 4BTBA 1Y8MA 3ZYKA 3VLDA 1NP7A 1EPUA 4CRWA 2LUHA 2P2CP 2R02A 3Q4AB 2H6FA 1TJFA 2HR2A 2ONDA 2CFUA 4RG6A 3RIBA 1JWGA 3D9JA 4AXHA 3IHVA 4HI8A 2WXLA 1DCEA 4U63A 4LCTA 4HFGA 3IHYA 4YDEA 4ACKA 2EIME 4I6GA 5D66A 3FY4A 3EHQA 3ZNGA 4K0RA 3TWSA 5FQ8A 2X38A 4DX7D 3FTYA 3LY9A 4K03A 3R7QA 3HXBA 4HRMB 3PNTB 3SHFA 1VDYA 2JABA 4B94A 2IO2C 4FJYA 2MHKA 1MHQA 3HXDA 4L9PA 1TJCA 3ONLA 4TXPA 3DPDA 3UUXA 4AVXA 3JQ1A 2GGFA 2OEVA 4PDXA 4DK5A 3MA5A 2EILE 3ZEFA 3AU5A 1NZNA 3IBEA 4N3CA 5FZSA 4LRZA 3FEYA 1UN9A 2IJGX 4ABNA 3QC1A 2H6GA 2EINE 2A5UA 2OEWA 4WNDA 4DLQA 2VGEA 3S7BA 3BUAA 1OWPA 3LPZA 1H19A 1MYOA 2BEDA 3SZ7A 3JUIA 3PZ1A 2KBXA 2XGSA 5HS0A 1N4PA 3J5QB 2CHWA 2ETBA 1U2VG 1FT2A 1A17A 1K3ZD 3FTVA 4GA0A 1NI1A 3U66A 4BX9A 3PH0C 5FQ4A 2PZIA 5ENOD 3BU8A 1N94A 3T5VA 3AU4A 1N11A 3VLEA 2XENA 4MLPA 2VSXE 2XS1A 3NAWA 3MX3A 3FUEA 3SGHA 3ZKJA 1V55E 5BPPA 4G24A 4ANWA 3SBTB 4ATZD 2IONA 4K5BA 4EBAA 2UWJG 3TWVA 3FUIA 3EIJA 2J09A 3LJ3A 4XI0A 2R17C 2VTBA 3HG0D 1N95A 5AQAA 4H7YA 2VGXB 1WM5A 4BY6A 3D3MA 3EU5A 1OCOE 2WXJA 3AS4A 1Z5SC 4JHJA 4G8LA 4EZLA 3CLJA 4HS2A 4I6EA 4JZYA 2XQ0A 4ATGA 1SZ9A 3OXGA 3D9OA 3ZYQA 3PE3A 4WNEA 1OT8A 2KATA 2BF0X 3FTXA 3HXCA 2ETCA 5CMYA 5A6CA 1V54E 4TXQA 3CR3A 4G8KA 1FPPA 4O1OA 4HI9A 3PZDA 4DX1A 1A5EA 5LFAA 2XRYA 5BV0A 2IOLA 4BT9A 5EIBE 4WNFA 1SW6A 4A55A 1BI8B 3UIOC 1YMPA 3DEOA 3C72A 1LD7A 3ABME 3CVNA 3ASGA 4HVBA 2MYOA 5JJ6A 3ULQA 1ELWA 2IFUA 2J07A 2QYJA 1K8KG 3Q15A 2V4HC 2YHEA 4DRXE 3UMVA 2WXQA 2LSVA 1N9AA 4Z68A 1E96B 4AEZC 2KCVA 4BFRA 1OCCE 5CHEE 5AJDA 3Q79A 2KC7A 1IQUA 3ASNE 1AWCB 1QYMA 1Y6IA 4GU5A 3L54A 2RFAA 1EF1C 4RG9A 1H6KA 3ZU7B 1E8XA 2WMNA 3L13A 3S7DA 2Y69E 3G2WA 1Z3YA 5EKQD 3CSTA 2CG3A 5B1AE 1HU3A 2WMOA 3HXFA 5KNHD 2L6BA 2WXIA 2IQCA 3PZ2A 3FU3A 5KNGA 5ARGA 2KZTA 2XEVA 4HOSA 4GTOA 2R03A 5CRVA 2J9QA 5G55A 3E33A 3G2TA 3KS2A 2XCCA 4XKCA 1TN7A 4Q69A 4M3OA 3NF1A 3OTNA 2GW1A 3FHEA 4CDMA 3B7BA 3L08A 2KM4A 1OWMA 3DSSA 3K9IA 3UX4A 5FWQA 5H7PA 4ZFHA 1B89A 2XZTG 3NZUA 1FVFA 2NSZA 4CEMA 1BI7B 2AW6A 3DEPA 3JXJA 5EX3A 3FU5A 4EZJA 3ZYLA 2YNQA 4FADA 3GZ2A 4QQIA 3QWVA 1HFAA 2F8XK 5BT1A 4AM9A 1K1AA 3UM3A 1TNBA 4GZDA 4NACA 3OXLA 4GCOA 3CK7A 2HE0A 2RG8A 4EPZA 2DYRE 4U0UA 4APOA 1OCRE 3LXUX 4J8EA 3UPVA 1X5BA 4XIFA 4GCNA 4OAVB 1MQSA 3CQGB 5LOZA 3U9WA 3FUJA 1NA0A 2DZNA 2KCKA 1DC2A 2BKGA 4F6RD 3RO2A 5A23A 5D0QD 1KT1A 2J49A 3SFZA 3G2UA 2DVWA 3R9MA 4AV7A 3D9HA 4U07A 2R59A 3S7FA 1KLXA 3FWVA 4E6HA 2DYSE 2E0IA 1H2VC 3NOCD 3G2VA 4KVMA 3TWUA 3CVWA 3DPYA 4KBQA 4GTRA 4GYYA 4MS6A 4U8VD 3TWQA 4L23A 1EDUA 3B7UX 2LSUA 3L22A 2C0LA 2C2LA 3DRAA 2GRNB 3ZRHA 5KJNA 1HO8A 4EQFA 3JXIA 4LG6A 1KT0A 1XNFA 2Y4TA 5KJKA 5FZRA 5J08A 3UINC 3AG4E 3EHNA 2A5EA 3E30A 4IULA 3FUDA 2J8SD 2PQNA 4N2SA 3RO3A 4GMLA 3JCKC 4H7XA 3N71A 2OV8A 4GZ5A 2AVPA 2WQ6A 1JPLA 5BUZA 2NYJA 4J8DA 3V79K 4WWOA 2NXPA 5AENA 3B7RL 3FTZA 4YDWA 4NURA 1E8ZA 1ZBPA 4UUCA 3MKQA 4XEIG 1N0QA 3PEVB 2GRLA 4JA9A 5HRYA 4BTAA 4I43A 3L17A 1L5JA 4F1PA 3D9IA 3MKRA 4N39A 2WVIA 4GPKA 3PS6A 4P29A 4KYOB 3CV0A 2M63A 3B13A 1FT1A 4DI3A 4MRUA 3E34A 3TWXA 5KWDA 4AP2A 2IOSA 2YQ8A 1BU9A 3FUHA 1JCSA 4NRHB 3IXEA 1OUVA 5KBAA 3APDA 5B3SE 3S2AA 4DX6D 4F1SA 5D0OD 3Q47B 4PS7A 4BSZB 3MGBA 3I5PA 4JHKA 3ZUVB 3I3NA 4GTQA 3AG2E 3ISMC 4KZCA 1BD8A 2WXHA 5ITZF 1TN8A 2P9SG 1HF8A 4MKTA 2J08A 4E85A 3SD5A 2P9LG 4K5AB 2OCCE 3VLFA 1TNUA 2WXRA 4J8YA 1MX4A 4TXRA 3ASFA 1ELKA 4N3BA 4X8QA 4GTMA 4JL0A 4B8AA 2FF4A 4UWHA 3QDNA 4YDYA 4DJAA 1OXJA 2R5SA 2EQXA 1ZU2A 2MOWA 4DI4A 4JVSA 3ML8A 3VTYA 3AS5A 1TNOA 3D9NA 2XRZA 3T9KA 2IF4A 2L6JA 4UQXA 2R05A 1OWLA 4UWFA 1MX2A 4TV3A 4ME2A 4UQZA 2DWZA 4UQYA 3UM1A 3RU0A 1SA4A 3UQ3A 1D9SA 3R9AB 4Q96A 4WWPA 3CVQA 4CCAA 2LNIA 2XS8A 4HXIA 5AARA 3TXNA 3F6QA 2UY1B 2XCBA 3LS8A 4A3TA 2F8YA 2X6KA 2OVFA 4TRQA 1HZ4A 1JCQA 3L6AA 4J7WA 4I9EA 4U8YD 5KJLA 2QC9A 3MV2B 5JHAA 1QQEA 3UTMA 3SF4A 4J8SA 3AJIA 3V30A 2WXOA 2XGMA 5ARFA 5JJTA 2QYUA 3MKQB 1NL4A 4EZKA 4HRNA 4UI9K 4EBAG 2LXLA 1LTXA 4RSYA 1OWNA 1DVPA 4JC8A 3ZYMA 3CK8A 2FEZA 4W9RA 5ENPD 1N4SA 3DBSA 3E4BA 3JYSA 4WWNA 2RFMA 3PVLA 3HHMA 3BEEA 4GAAA 1UJJA 1PAQA 2KXPC 2P9UG 2XEHA 1YYHA 1HG5A 3G2SA 3ZVVA 4CT4A 4ZHBA 4BERA 3RKVA 3E32A 4EHMA 2P9NG 1OCZE 2DBAA 2ILRA 2ZISA 3ONKA 2YHCA 4GTSA 1O1TA 3ASOE 3EHRA 4GMRA 5EILA 3CHMA 3GZSA 1NFIE 3CIAA 5CEDB 2VSOE 3RAUA 3WXXA 4TUMA 5HKPA 4I9CA 5BW8C 3TAXA 3FUKA 1IKND 1HX8A 4QFVA 3CVXA 3KSQA 5ANLA 3KEZA 4HORA 1Q2ZA 2LAHA 4WAFA 4G26A 3SFXA 1K1BA 4OVVA 1YA0A 1ELRA 3FU6A 3LCAA 3SFYA 4GZ6A 3OXFA 1O1RA 3V31A 2RD0A 2ZGDA 2XPZA 4N2QA 4DLOA 5KJMA 3CHSA 4CT0A 2HYZA 2X6FA 5CEAA 3GW4A 4N5QA 3ENEA 3CSFA 3Q9UC 3CVLA 1WY6A
chains in the Genus database with same CATH topology
3HIZA 3LEWA 5LOZA 4C0MA 4U0ZA 3U9WA 3HYMB 3FUJA 1NA0A 3IV0A 4BSXA 2WXLA 2VSYA 2WXKA 4U63A 4CDRA 4LCTA 4HFGA 3IHYA 3CHOA 4ACKA 1UW4B 2WXMA 2AXZA 2KCKA 5FQ6A 4I6GA 3QAQA 3RJVA 3FY4A 3B7TA 2BTDA 3ZGQA 3RO2A 1FVHA 4K0RA 1W3BA 5FQ8A 2X38A 5A23A 5D0QD 3FTYA 3LY9A 3MJWA 4K03A 2CHZA 2A4ZA 4A1SA 3R7QA 1KT1A 5JHBA 3PEUB 2J49A 3PNTB 3SFZA 3G2UA 3SHFA 4AV7A 3P1UA 4U07A 3CVVA 3ZN3A 1VDYA 1E90A 3CHQA 3PUKA 4B94A 3PRZA 3CKCA 2R59A 3JQ0A 3S7FA 1KLXA 3FWVA 4E6HA 4A1GA 2E0IA 4FJYA 1H2VC 3KD7A 2MHKA 3MZLB 1MHQA 3G2VA 1U3CA 3PREA 3QK0A 4KVMA 4PUCA 1HS6A 3CVWA 1TJCA 1N54A 1Z3XA 2V8SE 3DPDA 3ONLA 4KBQA 3UUXA 2QFCA 4AVXA 4U8HA 2CHXA 3EHMA 3FFLA 4GYYA 3JQ1A 4MS6A 2GGFA 2OOEA 2Y3AA 2Y4UA 4KVOA 4UWGA 2MRIA 3Q49B 4L2YA 4PDXA 4DK5A 5FJYA 4L23A 1EDUA 3B7UX 2LSUA 3MA5A 5G05C 2DCPA 3L22A 3ZEFA 4OYSA 5LP0A 2WB2A 2C0LA 3AU5A 1INZA 1NZNA 2C2LA 2VYIA 3IBEA 4O6FA 3LYAA 2WM9A 4N3CA 4LRZA 3FEYA 3LY8A 5FZSA 1UN9A 3ZRHA 5KJNA 4FHKA 4ILHB 4GB9A 1HO8A 3TL5A 4AJWA 4UWKA 5AYWD 2IU1A 3FH5A 2IJGX 4ABNA 5LCWC 2GRMA 5E75A 3TG4A 3QC1A 4EQFA 4KT6B 2AWIA 1HH8A 1KT0A 1XNFA 2A5UA 4WNDA 4DLQA 3S7BA 4V3IA 1OWPA 2Y4TA 3AS8A 5KJKA 5T3RA 3I4GA 4JEHA 5FZRA 3LPZA 3ZXSA 5J08A 1H19A 1UJKA 4L1BA 3SZ7A 3JUIA 4FLBA 2XGSA 4CDNA 3EHNA 4XZ4A 3ZFWA 3CVUA 4IULA 4KXKB 3FUDA 2V0PA 4HOQA 2PQNA 3TJPA 4N2SA 3RO3A 3BG0B 3CQCB 2CHWA 3APCA 3FH7A 3LVQE 4GMLA 4JA7A 5JJ7A 3JCKC 4ILGA 1A17A 4H7XA 3N71A 2OV8A 3FTVA 2AVPA 1P5QA 4GZ5A 4GA0A 2C0MA 1JPLA 4JPSA 4J8DA 5BUZA 4F7AA 3U66A 3VTXA 4BX9A 2WQ6A 3PH0C 5FQ4A 4Y6CA 4WWOA 2NXPA 5AENA 3B7RL 1TEZA 2V5FA 2CFZA 4TUUA 3FTZA 3URZA 3BG1B 4XKBA 4F3VA 3QNKA 2PZIA 2XPIA 5J90A 4G25A 3CGHA 2Q7FA 4NURA 1E8ZA 1ZBPA 2L0IA 3T5VA 3ZPJA 2VJ8A 3AU4A 2OVBA 2WXPA 4HLEA 2NC9A 3VLEA 4MLPA 4G1TA 2VSXE 4N5CA 3MKQA 2X6HA 1GW6A 2QY7A 3FULA 3LVRE 3PEVB 3FUFA 3PDNA 2PM6A 2GRLA 1LF8A 4JA9A 3MX3A 1E8YA 5AIJA 3O48A 3FUEA 3SGHA 3QARA 1U3DA 3T5XA 5E76A 4BTAA 3LY7A 3FH8A 5BPPA 2CG2A 4G24A 4ANWA 4I43A 5G04J 3SBTB 2IONA 3L17A 1L5JA 2BUGA 4BX8A 4EBAA 2UWJG 4LUNU 3D9IA 3MKRA 4URKA 3TG5A 3TGOA 4I17A 1Z6TA 3FUIA 1JUQA 2VSNA 4N39A 2WVIA 4G2VA 4GPKA 1QZ2A 3EIJA 2L9BA 2J09A 3LJ3A 3PS6A 4P29A 4IRUA 4XI0A 3D9LA 2LAIA 4UI9J 1IHGA 5AJLA 4UWLA 4KYOB 2R17C 3CV0A 2M63A 3B13A 2PQRA 4LERA 4GZ3A 4FLHA 4U04A 4XE0A 2VTBA 4DI3A 4LEUA 4MRUA 4H7YA 3CVLA 4AP2A 3RK6A 4I2WA 2IOSA 2YQ8A 4GYOA 2HM8A 2VGXB 1WM5A 3FUHA 3PNLB 4BY6A 4A3VA 4NRHB 2VQ2A 1OUVA 3HDXA 4AY5A 3FU0A 3LKUA 3NZSA 3APDA 3D3MA 1IQRA 3S2AA 5CMWA 4F1SA 5D0OD 3RRMB 3Q47B 4PS7A 2WXJA 3AS4A 2FBNA 3MGBA 4JHJA 3I5PA 4JHKA 4CGVA 4KMOA 3I3NA 4EZLA 4U0SA 3CLJA 3B7SA 4HS2A 4KZCA 4I6EA 2WXHA 4JZYA 2XQ0A 4ATGA 3FP3A 1IYGA 1SZ9A 3ZHEA 1HF8A 3FDHA 3OXGA 2I1JA 3OAWA 4MKTA 3D9OA 3FUMA 3ZYQA 3PE3A 4WNEA 5HQ8A 5DBKA 2KATA 5FZQA 2J08A 3CKBA 4E85A 1HG2A 1BPOA 2BF0X 3FTXA 3SD5A 4PS8A 4L7TA 2FULA 3FUNA 2VTBB 5KCMA 5CMYA 3VLFA 5A6CA 4FA6A 5M72A 2WXRA 3D9MA 3CR3A 3QB2A 4Y6WA 3FTUA 3D9PA 3ASFA 4I1OB 4C0EA 2UY1A 1ELKA 3PZDA 4N3BA 1XGWA 5LFAA 2PM7A 2XRYA 5BV0A 2IOLA 4JL0A 4BT9A 4B8AA 2FF4A 4WNFA 4UWHA 3QDNA 4A55A 4BWRA 4DJAA 4PS3A 1E7VA 2R5SA 1N52A 1ZU2A 2EQXA 2MOWA 4YVQC 4DI4A 4JVSA 3ML8A 1FCHA 3VTYA 3AS5A 4JEUA 2PL2A 3HVEA 5C2YA 4ACLA 4OVUA 3D9NA 2XRZA 3EJNA 3CVNA 2IF4A 4J6IA 3IHVA 3QOUA 3ASGA 2L6JA 3D9KA 4HVBA 4UQXA 3CEQA 4ILIA 5JJ6A 4Q94A 2E2EA 3ULQA 1OWLA 1ELWA 4UWFA 2IFUA 2J07A 3KAEA 4TV3A 3Q15A 4B0ZA 4JXTA 5A7DB 4XI9A 4FU3A 4ME2A 2WPVA 4UQZA 2YHEA 5T8IA 3UMVA 3MV3B 2WXQA 2LSVA 3ESKA 4UQYA 4ANVA 3RU0A 4EECA 3UQ3A 3R9AB 4Q96A 4WWPA 3CVQA 1E96B 4CCAA 2JEKA 2LNIA 2ZU6B 4GYWA 4D10C 4HOTA 4GA2A 4HXIA 4AEZC 5C1DA 2KCVA 4BFRA 4L2LA 3SI5A 3TXNA 2UY1B 2P58C 2XCBA 3MYVA 3PUJA 5CHEE 3FTSA 1WAO1 5CCLA 2I1KA 3LS8A 5AJDA 2WXFA 1JWFA 2KC7A 1IQUA 1E7UA 3U4TA 4A3TA 2X6KA 1E8WA 2OVFA 4TRQA 5G05J 3CHRA 2YINA 3CVPA 2X3MA 5FT9A 2WQ7A 1HZ4A 1Y6IA 2J4BA 4NQ0A 4GU5A 3NQPA 1HE8A 3L6AA 2HO1A 3FEXA 5DIZA 5LCWJ 3L54A 4I9EA 2WQHA 1EF1C 5KJLA 4RG9A 3MV2B 1H6KA 3RRNB 3SNXA 5JHAA 1E8XA 1H2TC 1QQEA 2WMNA 2AXVA 3L13A 3S7DA 3SF4A 4J8SA 3ML9A 2KCLA 2V4LA 2WXOA 2XGMA 4GCNA 3G2WA 4FJZA 5ARFA 5JJTA 1Z3YA 1SZAA 5EKQD 3MKQB 3QWWA 2L0TB 3I4RB 4FULA 4EZKA 3CSTA 4UI9K 4WNGA 2XHEA 3RRUA 4EBAG 2CG3A 4RSYA 4FP7A 1HU3A 2WMOA 1OWNA 5EX0A 2I9CA 1DVPA 5BNWA 4FC8A 4JC8A 3UT8A 3ZYMA 2WXIA 5FTPA 4G11A 3IKOB 2IQCA 3FU3A 3CK8A 5ARGA 2FEZA 3O4ZA 2KZTA 3CK9A 3U64A 4W9RA 4F53A 3R7RA 2XEVA 3P2BA 4I1AA 2DIWA 2X6JA 3DBSA 3E4BA 3LDZA 1UN8A 3JYSA 4PH4B 4WWNA 4YVOA 4C9BB 3PVLA 3HHMA 3BEEA 1PC2A 3MCXA 4B89A 3ASDA 4R7LA 2J9QA 4GAAA 5FQ7A 1UJJA 5G55A 5T4YA 3QKYA 1PAQA 4IN3B 3GYZA 4B8CB 3L16A 2J4DA 3G2TA 3UT7A 3EDTB 5G04C 4BT8A 3KS2A 1H0AA 2XCCA 1HG5A 3G2SA 4AY6A 3ZVVA 4CT4A 2I6HA 3ASHA 4XKCA 1QNFA 3RKVA 4FHJA 4Q69A 3MEKA 3Q5MA 2DBAA 4ANXA 2ILRA 3ONKA 2LO6A 2YHCA 3NF1A 4M3OA 3OTNA 4WUYA 4UI9C 2GW1A 1S0PA 3FHEA 4GMJA 4CDMA 2XPYA 3CHMA 3GZSA 3L08A 3CIAA 2KM4A 1OWMA 4XX5A 2VSOE 4J0UA 1NA3A 3IEGA 3K9IA 3UX4A 5FWQA 4DPRA 1PY1A 3WXXA 3QJZA 1B89A 2FI7A 4I9CA 2X6IA 1OWOA 5BV1A 3NZUA 5BW8C 1FVFA 3TAXA 3U3WA 5HI7A 5LX8A 3FUKA 2NSZA 4AOFA 2WXNA 2KZTB 4J8FA 2I2OA 4RVBA 4CEMA 3TXMA 4I1MA 2AW6A 4G23A 3ZHEB 4JHRA 4IYPA 3T8MA 1HX8A 4JW1A 4QFVA 5EX3A 5CCMA 5ANLA 3FU5A 3CVXA 4EZJA 3ZYLA 4HOSA 3CVYA 2YNQA 3S7JA 3C98A 3KEZA 4HORA 2FO7A 2AXUA 2LAHA 4WAFA 5EDSA 4AIFA 4FADA 4KZ0A 3GZ2A 4G26A 3UT4A 4N3AA 3FTWA 3QWVA 3QWPA 4GZCA 3GZ1A 4I2ZA 1EYHA 3EIQC 1UG3A 3CHPA 1HFAA 4OVVA 4APFA 1YA0A 3SBSA 5BT1A 3APFA 4I6JA 1ELRA 2VGXA 3FU6A 3PE4A 4AM9A 5ENNA 3LCAA 3ESLA 3ZW3A 5ANRA 4GZ6A 4CGWA 3OXFA 4HOUA 3ZIMA 2RD0A 1HXIA 4GA1A 2XPZA 4GZDA 4NACA 4N2QA 3OXLA 2JLBA 4DLOA 5KJMA 3CHSA 4GCOA 4BTBA 1Y8MA 3ZYKA 3CK7A 2RG8A 3VLDA 1NP7A 1EPUA 2HYZA 2X6FA 4CRWA 4CT0A 5G2NA 4EPZA 4U0UA 4APOA 3GW4A 3HVEB 3LXUX 3Q4AB 4ANUA 1TJFA 2HR2A 2ONDA 4YNDA 2CFUA 1H2UA 3ENEA 4RG6A 4J8EA 3UPVA 1X5BA 2WXGA 3CSFA 3RIBA 1DNPA 1JWGA 3D9JA 4XIFA 4AXHA 2VGYA 1SQMA 1MQSA 2XGOA 1WY6A 3CQGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ANR A;  2ION A;  4CEM A;  3FEY A;  2IOL A;  4B8A A;  4LUN U;  4GML A;  1H2V C;  4C9B B;  2IU1 A;  3D3M A;  1N52 A;  2VSX E;  4B89 A;  4GMJ A;  3EIJ A;  1UW4 B;  2RG8 A;  1N54 A;  4CRW A;  1PAQ A;  4B8C B;  2FUL A;  4JHJ A;  2VSO E;  2GGF A;  3L6A A;  4JHK A;  3FEX A;  1HU3 A;  2ZU6 B;  3EIQ C;  1UG3 A;  1H2U A;  4CT4 A;  3JUI A;  3RK6 A;  2IOS A;  1H6K A;  2HM8 A;  2NSZ A;  1H2T C;  4IUL A;  2KZT B;  2I2O A;  2KZT A; 
#chains in the Genus database with same CATH topology
 3HIZ A;  3LEW A;  4U0Z A;  3IV0 A;  4BSX A;  2VSY A;  2WXK A;  4CDR A;  3CHO A;  1UW4 B;  2LXM A;  2AXZ A;  5FQ6 A;  3RJV A;  3ZGQ A;  1RW2 A;  3PEU B;  2B0O E;  3C3Q A;  2BKK B;  3P1U A;  2XZD G;  3CVV A;  3CHQ A;  3PUK A;  4BET A;  3PRZ A;  4A1G A;  5CRU A;  3KD7 A;  3MZL B;  3QK0 A;  1U3C A;  4PUC A;  1HS6 A;  1Z3X A;  1N54 A;  2V8S E;  2QFC A;  5D2M C;  3UI2 A;  2CHX A;  2OOE A;  4UWG A;  2Y4U A;  4L2Y A;  5EID A;  1IXV A;  1INZ A;  4OYS A;  5LP0 A;  2WB2 A;  2RKK A;  3LYA A;  2WM9 A;  5BXO A;  4FHK A;  1AP7 A;  4ILH B;  3TL5 A;  3FH5 A;  4DX5 D;  5E75 A;  2AWI A;  3C3O A;  3AS8 A;  5T3R A;  4JEH A;  1UJK A;  4L1B A;  3E37 A;  3Q9N C;  3V2X A;  1UOH A;  3ZFW A;  4XZ4 A;  1MJ0 A;  5IY5 E;  3HRA A;  3TJP A;  3BG0 B;  3FH7 A;  4JA7 A;  5JJ7 A;  4ILG A;  5FIO A;  1H6O A;  2ZIR A;  2C0M A;  4F7A A;  3UXG A;  4Y6C A;  2V5F A;  2CFZ A;  2H6H A;  4F3V A;  4G25 A;  2L0I A;  3ZPJ A;  2VJ8 A;  4HLE A;  2OVB A;  2WXP A;  2QY7 A;  3FUL A;  3LVR E;  3PDN A;  2PM6 A;  1E8Y A;  1TNZ A;  4LNB A;  1SVX A;  3FH8 A;  3TWR A;  4LNU D;  4LUN U;  3TGO A;  3TG5 A;  4I17 A;  4JD2 G;  1Z6T A;  1JUQ A;  1RZ4 A;  2VSN A;  3AG1 E;  4IRU A;  3D9L A;  2LAI A;  1IHG A;  4UWL A;  1D8E A;  4FLH A;  4XE0 A;  4LEU A;  3DSV A;  5JMN D;  3RK6 A;  4GYO A;  5ENQ D;  3B95 A;  3ABK E;  4A3V A;  1ZB1 A;  2VQ2 A;  3HDX A;  4AY5 A;  3LKU A;  3J5P A;  1IQR A;  2ZGG A;  4NIK A;  5CMW A;  5ENT D;  2IY0 C;  4CGV A;  3EU9 A;  3B7S A;  3C3R A;  3FP3 A;  3FDH A;  3OAW A;  1WDY A;  5HQ8 A;  5DBK A;  1TR4 A;  5FIN A;  5FZQ A;  1HG2 A;  1BPO A;  4U7E B;  2H6I A;  4L7T A;  2FUL A;  1IHB A;  5KCM A;  4HQD A;  3QB2 A;  4Y6W A;  2UY1 A;  3DSW A;  3Q7F A;  4BWR A;  1E7V A;  4YVQ C;  1BLX B;  2PL2 A;  3HVE A;  4ACL A;  4J6I A;  3QOU A;  3D9K A;  3CEQ A;  4ILI A;  5EYP F;  3KAE A;  4B0Z A;  4FU3 A;  4ANV A;  4EEC A;  3ABL E;  3L9T A;  2GRO B;  2JEK A;  1S70 B;  3UM0 A;  4GYW A;  4D10 C;  4HOT A;  3TWW A;  5C1D A;  4L2L A;  2P58 C;  3MYV A;  3FTS A;  1WAO 1;  4BEP A;  2P9I G;  3CHR A;  4LNG A;  2YIN A;  5FT9 A;  4DX2 A;  4NQ0 A;  4OAU C;  2QZA A;  5DIZ A;  3AG3 E;  3RRN B;  2IEJ A;  1H2T C;  5EYL A;  2KCL A;  4HBD A;  1N4R A;  3L82 A;  1SZA A;  1WG0 A;  4FUL A;  2XHE A;  1O1S A;  4FC8 A;  4YDO A;  3UT8 A;  5FTP A;  4G11 A;  3UM2 A;  3IKO B;  3U64 A;  4F53 A;  3P2B A;  4I1A A;  4YVO A;  3LDZ A;  4C9B B;  1D8D A;  1SA5 A;  3MCX A;  1TNY A;  3ASD A;  5FQ7 A;  2V5Q C;  5T4Y A;  4IN3 B;  3GYZ A;  4B8C B;  2J4D A;  3EDT B;  5G04 C;  5AQB A;  2ETA A;  3Q5M A;  4ANX A;  4UI9 C;  1S0P A;  2Y0B G;  2DZO A;  5CER B;  1DCQ A;  1NA3 A;  1PY1 A;  2X6I A;  1OWO A;  3U3W A;  2F37 A;  4AOF A;  4J8F A;  2I2O A;  3TXM A;  1TYQ G;  4G23 A;  4I1M A;  4IYP A;  4JW1 A;  3W9F A;  3CVY A;  4U95 D;  5EDS A;  4AIF A;  4KZ0 A;  3UT4 A;  3FTW A;  4GZC A;  1KZO A;  4I2Z A;  5CBO A;  3EIQ C;  1UG3 A;  3CHP A;  4RLY A;  3SBS A;  3APF A;  4I6J A;  3Q73 A;  3ZW3 A;  4HB5 A;  5ANR A;  4CGW A;  1HXI A;  4GA1 A;  3AAA C;  2JLB A;  5G2N A;  3HVE B;  3KEA A;  3BQO A;  4ANU A;  4YND A;  1H2U A;  2WXG A;  1DNP A;  2R2L A;  2VGY A;  1SQM A;  2XGO A;  4C0M A;  3HYM B;  5BXU A;  1N4Q A;  4M7C A;  2WXM A;  3QAQ A;  4CZ2 D;  3B7T A;  2BTD A;  1FVH A;  1W3B A;  1X81 A;  3MJW A;  5AN8 A;  3RSE G;  2CHZ A;  2A4Z A;  4A1S A;  2XEE A;  5JHB A;  3X2Q E;  3ZN3 A;  1E90 A;  3CKC A;  3JQ0 A;  2F0Y A;  5CBN A;  3PRE A;  3KSL A;  4GPM A;  4BES A;  4U8H A;  3UIP C;  3EHM A;  3FFL A;  5B1B E;  2Y3A A;  4KVO A;  2MRI A;  3Q49 B;  2P9K G;  5FJY A;  5G05 C;  4CYM D;  2DCP A;  4DUI A;  2VYI A;  4O6F A;  3LY8 A;  4AJW A;  4GB9 A;  4UWK A;  5AYW D;  2IU1 A;  5LCW C;  2GRM A;  3TG4 A;  4KT6 B;  1HH8 A;  2Y1L E;  4V3I A;  4K5C A;  3I4G A;  1N0R A;  3ZXS A;  4FLB A;  3T8K A;  4CDN A;  3CVU A;  4KXK B;  2V0P A;  4HOQ A;  3CQC B;  1KPS B;  3APC A;  3LVQ E;  4U96 D;  4LSZ E;  1P5Q A;  4JPS A;  3VTX A;  3TWT A;  3JUE A;  1TEZ A;  4TUU A;  3URZ A;  3BG1 B;  4XKB A;  4MBG A;  3QNK A;  2B6C A;  2XPI A;  5J90 A;  3CGH A;  2Q7F A;  5CEC B;  2NC9 A;  4G1T A;  4N5C A;  2X6H A;  1GW6 A;  3ZXP A;  3FUF A;  1JCR A;  1LF8 A;  5AIJ A;  3O48 A;  3QAR A;  1U3D A;  3T5X A;  5E76 A;  4HNA D;  3LY7 A;  2CG2 A;  5G04 J;  4BX8 A;  1OY3 D;  2BUG A;  1MX6 A;  4URK A;  4A63 B;  4G2V A;  1QZ2 A;  2L9B A;  4UI9 J;  5AJL A;  4LER A;  2PQR A;  4GZ3 A;  3W9G A;  1O5M A;  4U04 A;  3Q7A A;  4I2W A;  3HXE A;  2HM8 A;  4HRL A;  3PNL B;  3Q78 A;  3DWL G;  3FU0 A;  3NZS A;  2IO3 C;  1G3N B;  3RRM B;  2FBN A;  5AQ7 A;  4KMO A;  3NBN B;  4U0S A;  5ENR D;  1IYG A;  3ZHE A;  2I1J A;  3FUM A;  2FO1 E;  2GRP B;  2GRQ B;  1LD8 A;  3CKB A;  4O60 A;  4PS8 A;  3FUN A;  2VTB B;  5M72 A;  4FA6 A;  3D9M A;  2PNN A;  3FTU A;  3D9P A;  4I1O B;  4C0E A;  1XGW A;  2PM7 A;  4PS3 A;  1N52 A;  1S63 A;  5JA4 D;  3DXK G;  1FCH A;  4JEU A;  5C2Y A;  4OVU A;  3EJN A;  4GTP A;  1TN6 A;  4GTV A;  1YCS B;  4Q94 A;  2E2E A;  4C48 B;  4JXT A;  5A7D B;  4XI9 A;  2WPV A;  5T8I A;  3MV3 B;  3ESK A;  2AJA A;  2GRR B;  2ZU6 B;  4GA2 A;  3SI5 A;  3SO8 A;  3PUJ A;  5CCL A;  2I1K A;  2WXF A;  1JWF A;  1E7U A;  3U4T A;  1E8W A;  5G05 J;  3CVP A;  2X3M A;  2WQ7 A;  5EN5 D;  2J4B A;  3NQP A;  1HE8 A;  2HO1 A;  3FEX A;  5LCW J;  3PZ3 A;  2WQH A;  3LJN A;  3SNX A;  4HLL A;  2AXV A;  3ML9 A;  2V4L A;  3SY2 A;  4FJZ A;  3QWW A;  2L0T B;  3I4R B;  4WNG A;  3RRU A;  4FP7 A;  5EX0 A;  2I9C A;  5BNW A;  1QBQ A;  3DSU A;  2ZXW E;  1KZP A;  5AAO A;  4RQI A;  3O4Z A;  3CK9 A;  3R7R A;  3ULY A;  2DIW A;  2X6J A;  3UKU G;  4PH4 B;  1UN8 A;  4GTT A;  1PC2 A;  4B89 A;  4R7L A;  3SQV A;  3QKY A;  3L16 A;  3UT7 A;  3NOG D;  1H6P A;  4BT8 A;  2EIJ E;  3C5R A;  1H0A A;  4AY6 A;  3ULE G;  2I6H A;  3ASH A;  1QNF A;  3V2O A;  4FHJ A;  3MEK A;  2LO6 A;  4WUY A;  5ENS D;  4GMJ A;  2XPY A;  2EIK E;  3Q75 A;  4XX5 A;  3PZ4 A;  4J0U A;  3DST A;  3IEG A;  5AQ9 A;  4DPR A;  3UKR G;  3QJZ A;  2FI7 A;  5BV1 A;  5HI7 A;  5LX8 A;  3WG7 E;  2P9P G;  2WXN A;  2KZT B;  4RVB A;  3DSX A;  3ZHE B;  4JHR A;  3T8M A;  5CCM A;  3DXM G;  3S7J A;  3C98 A;  3NB2 A;  2FO7 A;  2AXU A;  4JB8 P;  1MZC A;  4N3A A;  3QWP A;  1S64 A;  3EUV A;  3GZ1 A;  1EYH A;  4B93 B;  4APF A;  4O1P A;  2VGX A;  3PE4 A;  5ENN A;  3ESL A;  4HOU A;  3ZIM A;  4BTB A;  1Y8M A;  3ZYK A;  3VLD A;  1NP7 A;  1EPU A;  4CRW A;  2LUH A;  2P2C P;  2R02 A;  3Q4A B;  2H6F A;  1TJF A;  2HR2 A;  2OND A;  2CFU A;  4RG6 A;  3RIB A;  1JWG A;  3D9J A;  4AXH A;  3IHV A;  4HI8 A;  2WXL A;  1DCE A;  4U63 A;  4LCT A;  4HFG A;  3IHY A;  4YDE A;  4ACK A;  2EIM E;  4I6G A;  5D66 A;  3FY4 A;  3EHQ A;  3ZNG A;  4K0R A;  3TWS A;  5FQ8 A;  2X38 A;  4DX7 D;  3FTY A;  3LY9 A;  4K03 A;  3R7Q A;  3HXB A;  4HRM B;  3PNT B;  3SHF A;  1VDY A;  2JAB A;  4B94 A;  2IO2 C;  4FJY A;  2MHK A;  1MHQ A;  3HXD A;  4L9P A;  1TJC A;  3ONL A;  4TXP A;  3DPD A;  3UUX A;  4AVX A;  3JQ1 A;  2GGF A;  2OEV A;  4PDX A;  4DK5 A;  3MA5 A;  2EIL E;  3ZEF A;  3AU5 A;  1NZN A;  3IBE A;  4N3C A;  5FZS A;  4LRZ A;  3FEY A;  1UN9 A;  2IJG X;  4ABN A;  3QC1 A;  2H6G A;  2EIN E;  2A5U A;  2OEW A;  4WND A;  4DLQ A;  2VGE A;  3S7B A;  3BUA A;  1OWP A;  3LPZ A;  1H19 A;  1MYO A;  2BED A;  3SZ7 A;  3JUI A;  3PZ1 A;  2KBX A;  2XGS A;  5HS0 A;  1N4P A;  3J5Q B;  2CHW A;  2ETB A;  1U2V G;  1FT2 A;  1A17 A;  1K3Z D;  3FTV A;  4GA0 A;  1NI1 A;  3U66 A;  4BX9 A;  3PH0 C;  5FQ4 A;  2PZI A;  5ENO D;  3BU8 A;  1N94 A;  3T5V A;  3AU4 A;  1N11 A;  3VLE A;  2XEN A;  4MLP A;  2VSX E;  2XS1 A;  3NAW A;  3MX3 A;  3FUE A;  3SGH A;  3ZKJ A;  1V55 E;  5BPP A;  4G24 A;  4ANW A;  3SBT B;  4ATZ D;  2ION A;  4K5B A;  4EBA A;  2UWJ G;  3TWV A;  3FUI A;  3EIJ A;  2J09 A;  3LJ3 A;  4XI0 A;  2R17 C;  2VTB A;  3HG0 D;  1N95 A;  5AQA A;  4H7Y A;  2VGX B;  1WM5 A;  4BY6 A;  3D3M A;  3EU5 A;  1OCO E;  2WXJ A;  3AS4 A;  1Z5S C;  4JHJ A;  4G8L A;  4EZL A;  3CLJ A;  4HS2 A;  4I6E A;  4JZY A;  2XQ0 A;  4ATG A;  1SZ9 A;  3OXG A;  3D9O A;  3ZYQ A;  3PE3 A;  4WNE A;  1OT8 A;  2KAT A;  2BF0 X;  3FTX A;  3HXC A;  2ETC A;  5CMY A;  5A6C A;  1V54 E;  4TXQ A;  3CR3 A;  4G8K A;  1FPP A;  4O1O A;  4HI9 A;  3PZD A;  4DX1 A;  1A5E A;  5LFA A;  2XRY A;  5BV0 A;  2IOL A;  4BT9 A;  5EIB E;  4WNF A;  1SW6 A;  4A55 A;  1BI8 B;  3UIO C;  1YMP A;  3DEO A;  3C72 A;  1LD7 A;  3ABM E;  3CVN A;  3ASG A;  4HVB A;  2MYO A;  5JJ6 A;  3ULQ A;  1ELW A;  2IFU A;  2J07 A;  2QYJ A;  1K8K G;  3Q15 A;  2V4H C;  2YHE A;  4DRX E;  3UMV A;  2WXQ A;  2LSV A;  1N9A A;  4Z68 A;  1E96 B;  4AEZ C;  2KCV A;  4BFR A;  1OCC E;  5CHE E;  5AJD A;  3Q79 A;  2KC7 A;  1IQU A;  3ASN E;  1AWC B;  1QYM A;  1Y6I A;  4GU5 A;  3L54 A;  2RFA A;  1EF1 C;  4RG9 A;  1H6K A;  3ZU7 B;  1E8X A;  2WMN A;  3L13 A;  3S7D A;  2Y69 E;  3G2W A;  1Z3Y A;  5EKQ D;  3CST A;  2CG3 A;  5B1A E;  1HU3 A;  2WMO A;  3HXF A;  5KNH D;  2L6B A;  2WXI A;  2IQC A;  3PZ2 A;  3FU3 A;  5KNG A;  5ARG A;  2KZT A;  2XEV A;  4HOS A;  4GTO A;  2R03 A;  5CRV A;  2J9Q A;  5G55 A;  3E33 A;  3G2T A;  3KS2 A;  2XCC A;  4XKC A;  1TN7 A;  4Q69 A;  4M3O A;  3NF1 A;  3OTN A;  2GW1 A;  3FHE A;  4CDM A;  3B7B A;  3L08 A;  2KM4 A;  1OWM A;  3DSS A;  3K9I A;  3UX4 A;  5FWQ A;  5H7P A;  4ZFH A;  1B89 A;  2XZT G;  3NZU A;  1FVF A;  2NSZ A;  4CEM A;  1BI7 B;  2AW6 A;  3DEP A;  3JXJ A;  5EX3 A;  3FU5 A;  4EZJ A;  3ZYL A;  2YNQ A;  4FAD A;  3GZ2 A;  4QQI A;  3QWV A;  1HFA A;  2F8X K;  5BT1 A;  4AM9 A;  1K1A A;  3UM3 A;  1TNB A;  4GZD A;  4NAC A;  3OXL A;  4GCO A;  3CK7 A;  2HE0 A;  2RG8 A;  4EPZ A;  2DYR E;  4U0U A;  4APO A;  1OCR E;  3LXU X;  4J8E A;  3UPV A;  1X5B A;  4XIF A;  4GCN A;  4OAV B;  1MQS A;  3CQG B;  5LOZ A;  3U9W A;  3FUJ A;  1NA0 A;  2DZN A;  2KCK A;  1DC2 A;  2BKG A;  4F6R D;  3RO2 A;  5A23 A;  5D0Q D;  1KT1 A;  2J49 A;  3SFZ A;  3G2U A;  2DVW A;  3R9M A;  4AV7 A;  3D9H A;  4U07 A;  2R59 A;  3S7F A;  1KLX A;  3FWV A;  4E6H A;  2DYS E;  2E0I A;  1H2V C;  3NOC D;  3G2V A;  4KVM A;  3TWU A;  3CVW A;  3DPY A;  4KBQ A;  4GTR A;  4GYY A;  4MS6 A;  4U8V D;  3TWQ A;  4L23 A;  1EDU A;  3B7U X;  2LSU A;  3L22 A;  2C0L A;  2C2L A;  3DRA A;  2GRN B;  3ZRH A;  5KJN A;  1HO8 A;  4EQF A;  3JXI A;  4LG6 A;  1KT0 A;  1XNF A;  2Y4T A;  5KJK A;  5FZR A;  5J08 A;  3UIN C;  3AG4 E;  3EHN A;  2A5E A;  3E30 A;  4IUL A;  3FUD A;  2J8S D;  2PQN A;  4N2S A;  3RO3 A;  4GML A;  3JCK C;  4H7X A;  3N71 A;  2OV8 A;  4GZ5 A;  2AVP A;  2WQ6 A;  1JPL A;  5BUZ A;  2NYJ A;  4J8D A;  3V79 K;  4WWO A;  2NXP A;  5AEN A;  3B7R L;  3FTZ A;  4YDW A;  4NUR A;  1E8Z A;  1ZBP A;  4UUC A;  3MKQ A;  4XEI G;  1N0Q A;  3PEV B;  2GRL A;  4JA9 A;  5HRY A;  4BTA A;  4I43 A;  3L17 A;  1L5J A;  4F1P A;  3D9I A;  3MKR A;  4N39 A;  2WVI A;  4GPK A;  3PS6 A;  4P29 A;  4KYO B;  3CV0 A;  2M63 A;  3B13 A;  1FT1 A;  4DI3 A;  4MRU A;  3E34 A;  3TWX A;  5KWD A;  4AP2 A;  2IOS A;  2YQ8 A;  1BU9 A;  3FUH A;  1JCS A;  4NRH B;  3IXE A;  1OUV A;  5KBA A;  3APD A;  5B3S E;  3S2A A;  4DX6 D;  4F1S A;  5D0O D;  3Q47 B;  4PS7 A;  4BSZ B;  3MGB A;  3I5P A;  4JHK A;  3ZUV B;  3I3N A;  4GTQ A;  3AG2 E;  3ISM C;  4KZC A;  1BD8 A;  2WXH A;  5ITZ F;  1TN8 A;  2P9S G;  1HF8 A;  4MKT A;  2J08 A;  4E85 A;  3SD5 A;  2P9L G;  4K5A B;  2OCC E;  3VLF A;  1TNU A;  2WXR A;  4J8Y A;  1MX4 A;  4TXR A;  3ASF A;  1ELK A;  4N3B A;  4X8Q A;  4GTM A;  4JL0 A;  4B8A A;  2FF4 A;  4UWH A;  3QDN A;  4YDY A;  4DJA A;  1OXJ A;  2R5S A;  2EQX A;  1ZU2 A;  2MOW A;  4DI4 A;  4JVS A;  3ML8 A;  3VTY A;  3AS5 A;  1TNO A;  3D9N A;  2XRZ A;  3T9K A;  2IF4 A;  2L6J A;  4UQX A;  2R05 A;  1OWL A;  4UWF A;  1MX2 A;  4TV3 A;  4ME2 A;  4UQZ A;  2DWZ A;  4UQY A;  3UM1 A;  3RU0 A;  1SA4 A;  3UQ3 A;  1D9S A;  3R9A B;  4Q96 A;  4WWP A;  3CVQ A;  4CCA A;  2LNI A;  2XS8 A;  4HXI A;  5AAR A;  3TXN A;  3F6Q A;  2UY1 B;  2XCB A;  3LS8 A;  4A3T A;  2F8Y A;  2X6K A;  2OVF A;  4TRQ A;  1HZ4 A;  1JCQ A;  3L6A A;  4J7W A;  4I9E A;  4U8Y D;  5KJL A;  2QC9 A;  3MV2 B;  5JHA A;  1QQE A;  3UTM A;  3SF4 A;  4J8S A;  3AJI A;  3V30 A;  2WXO A;  2XGM A;  5ARF A;  5JJT A;  2QYU A;  3MKQ B;  1NL4 A;  4EZK A;  4HRN A;  4UI9 K;  4EBA G;  2LXL A;  1LTX A;  4RSY A;  1OWN A;  1DVP A;  4JC8 A;  3ZYM A;  3CK8 A;  2FEZ A;  4W9R A;  5ENP D;  1N4S A;  3DBS A;  3E4B A;  3JYS A;  4WWN A;  2RFM A;  3PVL A;  3HHM A;  3BEE A;  4GAA A;  1UJJ A;  1PAQ A;  2KXP C;  2P9U G;  2XEH A;  1YYH A;  1HG5 A;  3G2S A;  3ZVV A;  4CT4 A;  4ZHB A;  4BER A;  3RKV A;  3E32 A;  4EHM A;  2P9N G;  1OCZ E;  2DBA A;  2ILR A;  2ZIS A;  3ONK A;  2YHC A;  4GTS A;  1O1T A;  3ASO E;  3EHR A;  4GMR A;  5EIL A;  3CHM A;  3GZS A;  1NFI E;  3CIA A;  5CED B;  2VSO E;  3RAU A;  3WXX A;  4TUM A;  5HKP A;  4I9C A;  5BW8 C;  3TAX A;  3FUK A;  1IKN D;  1HX8 A;  4QFV A;  3CVX A;  3KSQ A;  5ANL A;  3KEZ A;  4HOR A;  1Q2Z A;  2LAH A;  4WAF A;  4G26 A;  3SFX A;  1K1B A;  4OVV A;  1YA0 A;  1ELR A;  3FU6 A;  3LCA A;  3SFY A;  4GZ6 A;  3OXF A;  1O1R A;  3V31 A;  2RD0 A;  2ZGD A;  2XPZ A;  4N2Q A;  4DLO A;  5KJM A;  3CHS A;  4CT0 A;  2HYZ A;  2X6F A;  5CEA A;  3GW4 A;  4N5Q A;  3ENE A;  3CSF A;  3Q9U C;  3CVL A;  1WY6 A; 
#chains in the Genus database with same CATH homology
 3HIZ A;  3LEW A;  5LOZ A;  4C0M A;  4U0Z A;  3U9W A;  3HYM B;  3FUJ A;  1NA0 A;  3IV0 A;  4BSX A;  2WXL A;  2VSY A;  2WXK A;  4U63 A;  4CDR A;  4LCT A;  4HFG A;  3IHY A;  3CHO A;  4ACK A;  1UW4 B;  2WXM A;  2AXZ A;  2KCK A;  5FQ6 A;  4I6G A;  3QAQ A;  3RJV A;  3FY4 A;  3B7T A;  2BTD A;  3ZGQ A;  3RO2 A;  1FVH A;  4K0R A;  1W3B A;  5FQ8 A;  2X38 A;  5A23 A;  5D0Q D;  3FTY A;  3LY9 A;  3MJW A;  4K03 A;  2CHZ A;  2A4Z A;  4A1S A;  3R7Q A;  1KT1 A;  5JHB A;  3PEU B;  2J49 A;  3PNT B;  3SFZ A;  3G2U A;  3SHF A;  4AV7 A;  3P1U A;  4U07 A;  3CVV A;  3ZN3 A;  1VDY A;  1E90 A;  3CHQ A;  3PUK A;  4B94 A;  3PRZ A;  3CKC A;  2R59 A;  3JQ0 A;  3S7F A;  1KLX A;  3FWV A;  4E6H A;  4A1G A;  2E0I A;  4FJY A;  1H2V C;  3KD7 A;  2MHK A;  3MZL B;  1MHQ A;  3G2V A;  1U3C A;  3PRE A;  3QK0 A;  4KVM A;  4PUC A;  1HS6 A;  3CVW A;  1TJC A;  1N54 A;  1Z3X A;  2V8S E;  3DPD A;  3ONL A;  4KBQ A;  3UUX A;  2QFC A;  4AVX A;  4U8H A;  2CHX A;  3EHM A;  3FFL A;  4GYY A;  3JQ1 A;  4MS6 A;  2GGF A;  2OOE A;  2Y3A A;  2Y4U A;  4KVO A;  4UWG A;  2MRI A;  3Q49 B;  4L2Y A;  4PDX A;  4DK5 A;  5FJY A;  4L23 A;  1EDU A;  3B7U X;  2LSU A;  3MA5 A;  5G05 C;  2DCP A;  3L22 A;  3ZEF A;  4OYS A;  5LP0 A;  2WB2 A;  2C0L A;  3AU5 A;  1INZ A;  1NZN A;  2C2L A;  2VYI A;  3IBE A;  4O6F A;  3LYA A;  2WM9 A;  4N3C A;  4LRZ A;  3FEY A;  3LY8 A;  5FZS A;  1UN9 A;  3ZRH A;  5KJN A;  4FHK A;  4ILH B;  4GB9 A;  1HO8 A;  3TL5 A;  4AJW A;  4UWK A;  5AYW D;  2IU1 A;  3FH5 A;  2IJG X;  4ABN A;  5LCW C;  2GRM A;  5E75 A;  3TG4 A;  3QC1 A;  4EQF A;  4KT6 B;  2AWI A;  1HH8 A;  1KT0 A;  1XNF A;  2A5U A;  4WND A;  4DLQ A;  3S7B A;  4V3I A;  1OWP A;  2Y4T A;  3AS8 A;  5KJK A;  5T3R A;  3I4G A;  4JEH A;  5FZR A;  3LPZ A;  3ZXS A;  5J08 A;  1H19 A;  1UJK A;  4L1B A;  3SZ7 A;  3JUI A;  4FLB A;  2XGS A;  4CDN A;  3EHN A;  4XZ4 A;  3ZFW A;  3CVU A;  4IUL A;  4KXK B;  3FUD A;  2V0P A;  4HOQ A;  2PQN A;  3TJP A;  4N2S A;  3RO3 A;  3BG0 B;  3CQC B;  2CHW A;  3APC A;  3FH7 A;  3LVQ E;  4GML A;  4JA7 A;  5JJ7 A;  3JCK C;  4ILG A;  1A17 A;  4H7X A;  3N71 A;  2OV8 A;  3FTV A;  2AVP A;  1P5Q A;  4GZ5 A;  4GA0 A;  2C0M A;  1JPL A;  4JPS A;  4J8D A;  5BUZ A;  4F7A A;  3U66 A;  3VTX A;  4BX9 A;  2WQ6 A;  3PH0 C;  5FQ4 A;  4Y6C A;  4WWO A;  2NXP A;  5AEN A;  3B7R L;  1TEZ A;  2V5F A;  2CFZ A;  4TUU A;  3FTZ A;  3URZ A;  3BG1 B;  4XKB A;  4F3V A;  3QNK A;  2PZI A;  2XPI A;  5J90 A;  4G25 A;  3CGH A;  2Q7F A;  4NUR A;  1E8Z A;  1ZBP A;  2L0I A;  3T5V A;  3ZPJ A;  2VJ8 A;  3AU4 A;  2OVB A;  2WXP A;  4HLE A;  2NC9 A;  3VLE A;  4MLP A;  4G1T A;  2VSX E;  4N5C A;  3MKQ A;  2X6H A;  1GW6 A;  2QY7 A;  3FUL A;  3LVR E;  3PEV B;  3FUF A;  3PDN A;  2PM6 A;  2GRL A;  1LF8 A;  4JA9 A;  3MX3 A;  1E8Y A;  5AIJ A;  3O48 A;  3FUE A;  3SGH A;  3QAR A;  1U3D A;  3T5X A;  5E76 A;  4BTA A;  3LY7 A;  3FH8 A;  5BPP A;  2CG2 A;  4G24 A;  4ANW A;  4I43 A;  5G04 J;  3SBT B;  2ION A;  3L17 A;  1L5J A;  2BUG A;  4BX8 A;  4EBA A;  2UWJ G;  4LUN U;  3D9I A;  3MKR A;  4URK A;  3TG5 A;  3TGO A;  4I17 A;  1Z6T A;  3FUI A;  1JUQ A;  2VSN A;  4N39 A;  2WVI A;  4G2V A;  4GPK A;  1QZ2 A;  3EIJ A;  2L9B A;  2J09 A;  3LJ3 A;  3PS6 A;  4P29 A;  4IRU A;  4XI0 A;  3D9L A;  2LAI A;  4UI9 J;  1IHG A;  5AJL A;  4UWL A;  4KYO B;  2R17 C;  3CV0 A;  2M63 A;  3B13 A;  2PQR A;  4LER A;  4GZ3 A;  4FLH A;  4U04 A;  4XE0 A;  2VTB A;  4DI3 A;  4LEU A;  4MRU A;  4H7Y A;  3CVL A;  4AP2 A;  3RK6 A;  4I2W A;  2IOS A;  2YQ8 A;  4GYO A;  2HM8 A;  2VGX B;  1WM5 A;  3FUH A;  3PNL B;  4BY6 A;  4A3V A;  4NRH B;  2VQ2 A;  1OUV A;  3HDX A;  4AY5 A;  3FU0 A;  3LKU A;  3NZS A;  3APD A;  3D3M A;  1IQR A;  3S2A A;  5CMW A;  4F1S A;  5D0O D;  3RRM B;  3Q47 B;  4PS7 A;  2WXJ A;  3AS4 A;  2FBN A;  3MGB A;  4JHJ A;  3I5P A;  4JHK A;  4CGV A;  4KMO A;  3I3N A;  4EZL A;  4U0S A;  3CLJ A;  3B7S A;  4HS2 A;  4KZC A;  4I6E A;  2WXH A;  4JZY A;  2XQ0 A;  4ATG A;  3FP3 A;  1IYG A;  1SZ9 A;  3ZHE A;  1HF8 A;  3FDH A;  3OXG A;  2I1J A;  3OAW A;  4MKT A;  3D9O A;  3FUM A;  3ZYQ A;  3PE3 A;  4WNE A;  5HQ8 A;  5DBK A;  2KAT A;  5FZQ A;  2J08 A;  3CKB A;  4E85 A;  1HG2 A;  1BPO A;  2BF0 X;  3FTX A;  3SD5 A;  4PS8 A;  4L7T A;  2FUL A;  3FUN A;  2VTB B;  5KCM A;  5CMY A;  3VLF A;  5A6C A;  4FA6 A;  5M72 A;  2WXR A;  3D9M A;  3CR3 A;  3QB2 A;  4Y6W A;  3FTU A;  3D9P A;  3ASF A;  4I1O B;  4C0E A;  2UY1 A;  1ELK A;  3PZD A;  4N3B A;  1XGW A;  5LFA A;  2PM7 A;  2XRY A;  5BV0 A;  2IOL A;  4JL0 A;  4BT9 A;  4B8A A;  2FF4 A;  4WNF A;  4UWH A;  3QDN A;  4A55 A;  4BWR A;  4DJA A;  4PS3 A;  1E7V A;  2R5S A;  1N52 A;  1ZU2 A;  2EQX A;  2MOW A;  4YVQ C;  4DI4 A;  4JVS A;  3ML8 A;  1FCH A;  3VTY A;  3AS5 A;  4JEU A;  2PL2 A;  3HVE A;  5C2Y A;  4ACL A;  4OVU A;  3D9N A;  2XRZ A;  3EJN A;  3CVN A;  2IF4 A;  4J6I A;  3IHV A;  3QOU A;  3ASG A;  2L6J A;  3D9K A;  4HVB A;  4UQX A;  3CEQ A;  4ILI A;  5JJ6 A;  4Q94 A;  2E2E A;  3ULQ A;  1OWL A;  1ELW A;  4UWF A;  2IFU A;  2J07 A;  3KAE A;  4TV3 A;  3Q15 A;  4B0Z A;  4JXT A;  5A7D B;  4XI9 A;  4FU3 A;  4ME2 A;  2WPV A;  4UQZ A;  2YHE A;  5T8I A;  3UMV A;  3MV3 B;  2WXQ A;  2LSV A;  3ESK A;  4UQY A;  4ANV A;  3RU0 A;  4EEC A;  3UQ3 A;  3R9A B;  4Q96 A;  4WWP A;  3CVQ A;  1E96 B;  4CCA A;  2JEK A;  2LNI A;  2ZU6 B;  4GYW A;  4D10 C;  4HOT A;  4GA2 A;  4HXI A;  4AEZ C;  5C1D A;  2KCV A;  4BFR A;  4L2L A;  3SI5 A;  3TXN A;  2UY1 B;  2P58 C;  2XCB A;  3MYV A;  3PUJ A;  5CHE E;  3FTS A;  1WAO 1;  5CCL A;  2I1K A;  3LS8 A;  5AJD A;  2WXF A;  1JWF A;  2KC7 A;  1IQU A;  1E7U A;  3U4T A;  4A3T A;  2X6K A;  1E8W A;  2OVF A;  4TRQ A;  5G05 J;  3CHR A;  2YIN A;  3CVP A;  2X3M A;  5FT9 A;  2WQ7 A;  1HZ4 A;  1Y6I A;  2J4B A;  4NQ0 A;  4GU5 A;  3NQP A;  1HE8 A;  3L6A A;  2HO1 A;  3FEX A;  5DIZ A;  5LCW J;  3L54 A;  4I9E A;  2WQH A;  1EF1 C;  5KJL A;  4RG9 A;  3MV2 B;  1H6K A;  3RRN B;  3SNX A;  5JHA A;  1E8X A;  1H2T C;  1QQE A;  2WMN A;  2AXV A;  3L13 A;  3S7D A;  3SF4 A;  4J8S A;  3ML9 A;  2KCL A;  2V4L A;  2WXO A;  2XGM A;  4GCN A;  3G2W A;  4FJZ A;  5ARF A;  5JJT A;  1Z3Y A;  1SZA A;  5EKQ D;  3MKQ B;  3QWW A;  2L0T B;  3I4R B;  4FUL A;  4EZK A;  3CST A;  4UI9 K;  4WNG A;  2XHE A;  3RRU A;  4EBA G;  2CG3 A;  4RSY A;  4FP7 A;  1HU3 A;  2WMO A;  1OWN A;  5EX0 A;  2I9C A;  1DVP A;  5BNW A;  4FC8 A;  4JC8 A;  3UT8 A;  3ZYM A;  2WXI A;  5FTP A;  4G11 A;  3IKO B;  2IQC A;  3FU3 A;  3CK8 A;  5ARG A;  2FEZ A;  3O4Z A;  2KZT A;  3CK9 A;  3U64 A;  4W9R A;  4F53 A;  3R7R A;  2XEV A;  3P2B A;  4I1A A;  2DIW A;  2X6J A;  3DBS A;  3E4B A;  3LDZ A;  1UN8 A;  3JYS A;  4PH4 B;  4WWN A;  4YVO A;  4C9B B;  3PVL A;  3HHM A;  3BEE A;  1PC2 A;  3MCX A;  4B89 A;  3ASD A;  4R7L A;  2J9Q A;  4GAA A;  5FQ7 A;  1UJJ A;  5G55 A;  5T4Y A;  3QKY A;  1PAQ A;  4IN3 B;  3GYZ A;  4B8C B;  3L16 A;  2J4D A;  3G2T A;  3UT7 A;  3EDT B;  5G04 C;  4BT8 A;  3KS2 A;  1H0A A;  2XCC A;  1HG5 A;  3G2S A;  4AY6 A;  3ZVV A;  4CT4 A;  2I6H A;  3ASH A;  4XKC A;  1QNF A;  3RKV A;  4FHJ A;  4Q69 A;  3MEK A;  3Q5M A;  2DBA A;  4ANX A;  2ILR A;  3ONK A;  2LO6 A;  2YHC A;  3NF1 A;  4M3O A;  3OTN A;  4WUY A;  4UI9 C;  2GW1 A;  1S0P A;  3FHE A;  4GMJ A;  4CDM A;  2XPY A;  3CHM A;  3GZS A;  3L08 A;  3CIA A;  2KM4 A;  1OWM A;  4XX5 A;  2VSO E;  4J0U A;  1NA3 A;  3IEG A;  3K9I A;  3UX4 A;  5FWQ A;  4DPR A;  1PY1 A;  3WXX A;  3QJZ A;  1B89 A;  2FI7 A;  4I9C A;  2X6I A;  1OWO A;  5BV1 A;  3NZU A;  5BW8 C;  1FVF A;  3TAX A;  3U3W A;  5HI7 A;  5LX8 A;  3FUK A;  2NSZ A;  4AOF A;  2WXN A;  2KZT B;  4J8F A;  2I2O A;  4RVB A;  4CEM A;  3TXM A;  4I1M A;  2AW6 A;  4G23 A;  3ZHE B;  4JHR A;  4IYP A;  3T8M A;  1HX8 A;  4JW1 A;  4QFV A;  5EX3 A;  5CCM A;  5ANL A;  3FU5 A;  3CVX A;  4EZJ A;  3ZYL A;  4HOS A;  3CVY A;  2YNQ A;  3S7J A;  3C98 A;  3KEZ A;  4HOR A;  2FO7 A;  2AXU A;  2LAH A;  4WAF A;  5EDS A;  4AIF A;  4FAD A;  4KZ0 A;  3GZ2 A;  4G26 A;  3UT4 A;  4N3A A;  3FTW A;  3QWV A;  3QWP A;  4GZC A;  3GZ1 A;  4I2Z A;  1EYH A;  3EIQ C;  1UG3 A;  3CHP A;  1HFA A;  4OVV A;  4APF A;  1YA0 A;  3SBS A;  5BT1 A;  3APF A;  4I6J A;  1ELR A;  2VGX A;  3FU6 A;  3PE4 A;  4AM9 A;  5ENN A;  3LCA A;  3ESL A;  3ZW3 A;  5ANR A;  4GZ6 A;  4CGW A;  3OXF A;  4HOU A;  3ZIM A;  2RD0 A;  1HXI A;  4GA1 A;  2XPZ A;  4GZD A;  4NAC A;  4N2Q A;  3OXL A;  2JLB A;  4DLO A;  5KJM A;  3CHS A;  4GCO A;  4BTB A;  1Y8M A;  3ZYK A;  3CK7 A;  2RG8 A;  3VLD A;  1NP7 A;  1EPU A;  2HYZ A;  2X6F A;  4CRW A;  4CT0 A;  5G2N A;  4EPZ A;  4U0U A;  4APO A;  3GW4 A;  3HVE B;  3LXU X;  3Q4A B;  4ANU A;  1TJF A;  2HR2 A;  2OND A;  4YND A;  2CFU A;  1H2U A;  3ENE A;  4RG6 A;  4J8E A;  3UPV A;  1X5B A;  2WXG A;  3CSF A;  3RIB A;  1DNP A;  1JWG A;  3D9J A;  4XIF A;  4AXH A;  2VGY A;  1SQM A;  1MQS A;  2XGO A;  1WY6 A;  3CQG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...