2IOLA

Crystal structure of the c-terminal ma3 domain of pdcd4 (mouse); form 1
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
127
structure length
127
Chain Sequence
QPVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIVMVLESTGESAFKMILDLLKSLWKSSTITIDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antitumor protein
molecule keywords Programmed Cell Death 4, Pdcd4
publication title Structural basis for inhibition of translation by the tumor suppressor pdcd4.
pubmed doi rcsb
source organism Mus musculus
total genus 43
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2iolA00
3FEYA 4B89A 2IU1A 2NSZA 2ZU6B 3RK6A 2KZTA 3EIQC 2GGFA 1UG3A 1N54A 1UW4B 1PAQA 4B8CB 3JUIA 4C9BB 1H6KA 2IOSA 2FULA 4IULA 4CT4A 2IOLA 2I2OA 1H2UA 3L6AA 4B8AA 1N52A 3D3MA 2IONA 4GMLA 4JHKA 1HU3A 2KZTB 4JHJA 5ANRA 4CRWA 2HM8A 4LUNU 3FEXA 3EIJA 1H2TC 2VSOE 2VSXE 1H2VC 2RG8A 4CEMA 4GMJA
chains in the Genus database with same CATH superfamily
3LYAA 4A1GA 1O1TA 1ELRA 2XPYA 3SD5A 3FHEA 3ONLA 4CYMD 2FULA 4J8SA 3SBTB 1EPUA 2VYIA 3PE4A 4MS6A 2EINE 3SO8A 3SF4A 3FUDA 1HF8A 3LKUA 3ZN3A 4WWPA 3DSTA 3PDNA 5DIZA 3T9KA 3OXFA 3TWSA 4KT6B 1DVPA 4WAFA 5E76A 3MKQB 1N0RA 4WNDA 3C72A 2P9UG 3HYMB 5FQ4A 4U0ZA 3RO3A 4FADA 3B13A 3RRMB 3FH7A 3CK9A 2CFZA 2OVBA 1U3CA 1OWNA 1TNBA 3FUEA 2RFAA 3VLFA 1NP7A 4A63B 3ABME 3HVEA 4BT9A 1FT2A 2LXLA 4TXPA 1PC2A 3U4TA 4TUUA 1UN9A 2P9NG 5EKQD 1TNYA 4TXQA 1E8XA 2JLBA 3URZA 4N2SA 1E8ZA 3UM2A 4HOQA 4GTOA 4ZHBA 3UM3A 1V55E 5CRUA 2YQ8A 2L6BA 5FINA 2WXOA 1H2VC 4PUCA 3EHRA 2KATA 2EIJE 4B8CB 3O48A 3SY2A 1H6PA 1LD7A 2Q7FA 5AIJA 1IQUA 4CRWA 2OEWA 3FU3A 3E33A 3MJWA 1H2TC 5JA4D 3JXIA 5ANLA 4GTRA 3T5XA 2YNQA 3EHQA 4LNGA 3FUKA 2QFCA 2LAHA 3S7BA 1NFIE 5AN8A 4N5CA 2VGYA 3CVLA 5G05J 3RIBA 3V31A 5JHAA 3N71A 3Q9UC 3WXXA 5G05C 3QC1A 3VLDA 1TN8A 3UXGA 3LY8A 4I9EA 4AY6A 3UM1A 2WMOA 5KWDA 4E6HA 2J8SD 4HOUA 2IF4A 2PM7A 4A55A 1TEZA 2A4ZA 1NA0A 1RZ4A 4C9BB 3VTXA 3ZYLA 5LX8A 3BG0B 4GA0A 3EUVA 1SZAA 4GTQA 3I3NA 3P1UA 2RD0A 2Y69E 1GW6A 3PE3A 1N11A 2WXQA 4U95D 3HDXA 4I6EA 3B95A 3D3MA 4JZYA 4J8FA 1K3ZD 4EBAA 2ETCA 3JCKC 2KCKA 3Q9NC 2P2CP 3TWWA 3E30A 2Y0BG 3ZXSA 2OEVA 3FH8A 4G23A 3KEAA 4FHKA 3CVUA 4Q94A 3TAXA 4LG6A 2JEKA 3B7SA 3ML9A 2AWIA 4JD2G 4AY5A 2I1JA 3MKQA 2C0MA 2B0OE 4GCNA 3X2QE 3UT8A 2WVIA 4CZ2D 1FT1A 2CG2A 2AJAA 1MZCA 3GYZA 3NBNB 2FBNA 2CG3A 3CKCA 4PS3A 1EYHA 2XGMA 5AJDA 3DEPA 5LFAA 4GMJA 3PZ1A 5D0QD 4LCTA 4OYSA 1BPOA 2P9PG 2H6IA 3AG1E 3UQ3A 4KXKB 4NACA 3ZGQA 1NA3A 2XZDG 4JXTA 3GZ1A 4GPKA 3EU9A 4ME2A 3C98A 3LPZA 1HG2A 3FU6A 3BEEA 3Q7AA 5BV0A 4JHRA 2EIME 4I6GA 3CVYA 2I1KA 3B7TA 5FT9A 3ZYKA 2XS1A 4U96D 4FJZA 4YDEA 4J8EA 3TXMA 1H6OA 2VSNA 3OXLA 5G55A 2WMNA 3G2VA 4UWFA 2ETBA 1MYOA 5M72A 5KCMA 2WQHA 5ENRD 5LP0A 1QZ2A 4WWNA 3AS4A 1S64A 3DSVA 2GW1A 3FUJA 4HQDA 3DSWA 1N95A 1HH8A 4DI3A 3RSEG 4I43A 3D9IA 3MKRA 4U04A 1N54A 4DLOA 2GRRB 2IOSA 5EYLA 5JJ7A 5CCMA 4U8HA 4K0RA 2WPVA 3SZ7A 1HFAA 3FEYA 3NOCD 3ENEA 4QQIA 3U9WA 3SFXA 2VQ2A 1N9AA 3TJPA 1OT8A 4A3VA 3MYVA 3QNKA 4G8KA 2FO7A 3APDA 4EQFA 3L54A 4GA2A 1ZB1A 3CVVA 5AQBA 3E4BA 3K9IA 3ZPJA 2XEEA 4R7LA 3TG4A 2BUGA 4N3AA 2AW6A 4CCAA 3V79K 3TWUA 4HFGA 2YHCA 3EHNA 3ASOE 4HOTA 4U8YD 3ZRHA 2F37A 3L13A 4U0SA 3G2WA 3RU0A 5BV1A 5D0OD 2NC9A 2GRQB 3AG2E 4TUMA 5FIOA 2IO3C 2PNNA 2I2OA 3CHQA 3PEUB 3ZEFA 5EIBE 3ESLA 1D9SA 3SBSA 4GU5A 4UQXA 5HQ8A 5KJNA 3MCXA 4TRQA 3IBEA 1WG0A 3NOGD 1BLXB 3LCAA 4U07A 5J90A 4F7AA 1UW4B 1O5MA 3EU5A 1LD8A 3CSTA 1U3DA 4OVUA 3QARA 2WXIA 1WM5A 2VJ8A 3KEZA 4Z68A 4I2ZA 3CIAA 2WM9A 3E37A 4F1SA 2GRNB 1IHBA 4O1PA 3CK8A 3FULA 1QYMA 3KSQA 4BY6A 1S63A 3NQPA 2XS8A 3C3OA 1QBQA 1OWMA 1KZOA 2I9CA 2CHXA 3FTWA 4PH4B 5AARA 3CLJA 3ULYA 3IXEA 2BKGA 3J5QB 3LJ3A 3MA5A 3MX3A 4XZ4A 5HS0A 5FQ7A 1VDYA 2Y3AA 2E0IA 4B89A 2QYJA 1TNUA 3QDNA 4O6FA 3LEWA 3Q79A 3QWVA 4PDXA 1IXVA 3PZ2A 3Q78A 3S7DA 1HU3A 3QWWA 2ZISA 5KJKA 3J5PA 1TJFA 2QYUA 4U63A 2RFMA 3ZXPA 4H7YA 2EQXA 2X6IA 3DRAA 5B3SE 3DXKG 4JB8P 3JUIA 3PZ3A 1K1BA 3D9NA 1UJKA 4FA6A 1Q2ZA 1K8KG 4JHJA 4WNEA 3L22A 4MLPA 3PS6A 1DCQA 4WNFA 3HXDA 4A1SA 4U7EB 3HXCA 4ACKA 3O4ZA 2XPZA 4G24A 4DX2A 2AXUA 4BX9A 3UT7A 3FTSA 3PVLA 1HO8A 3UT4A 4HNAD 2WXKA 2FI7A 3S2AA 2XEHA 4HVBA 4L7TA 5A6CA 2EILE 2IJGX 3APFA 4XI0A 4FLBA 1UN8A 1X5BA 2KZTB 4GZ5A 3EHMA 1N4QA 1FPPA 1TNOA 4EZKA 4AJWA 1AP7A 2WXGA 3LJNA 4JA7A 4MBGA 1LF8A 5ARFA 2ZGDA 4GYWA 1JWFA 2FO1E 2LSVA 1EDUA 5FQ6A 3PNTB 3DPDA 2AVPA 2V4HC 4GMRA 3FTZA 3SGHA 4BT8A 4XIFA 3RAUA 4G2VA 4OVVA 4NQ0A 2RKKA 3AG3E 3RK6A 1NL4A 4KMOA 4N5QA 3FUMA 2Y4TA 2UWJG 5HKPA 1WY6A 3OXGA 1E7UA 4JVSA 4AXHA 2R02A 3DXMG 4KVOA 3IKOB 4BTBA 4F1PA 2F0YA 2Y1LE 3FP3A 4BERA 4EHMA 3ASNE 5C2YA 4YNDA 4PS7A 2ONDA 3CHMA 3Q49B 4GTPA 5KBAA 4GPMA 1PY1A 3QJZA 4DLQA 1MJ0A 3RRNB 5G04J 2P9SG 3Q73A 4ANWA 3R9AB 3Q5MA 2R2LA 1TN7A 3JYSA 3KS2A 5G04C 1DC2A 2PM6A 5HI7A 3V2OA 2GRPB 3U64A 3PRZA 3ZNGA 5ENTD 2FEZA 3S7JA 4G11A 2R03A 5KJLA 2DVWA 2XCBA 2ZGGA 4JL0A 4ABNA 1JWGA 4GYYA 5D2MC 3TWQA 2MHKA 3U3WA 1XNFA 4LUNU 3FEXA 5EILA 4HORA 2MOWA 1E96B 3MEKA 3UUXA 3LVRE 4FP7A 1ZBPA 2J09A 4AV7A 3DSSA 4JHKA 3SFZA 5KNHD 3FTVA 5ANRA 1MHQA 4B0ZA 3CHPA 4BSZB 5ENOD 1HZ4A 3RRUA 4GTMA 3AJIA 3PH0C 3TGOA 2H6GA 5ENPD 3DBSA 5EN5D 2PQRA 4ILHB 1SA5A 1N4PA 4HXIA 2XENA 1YMPA 3I4RB 3ASFA 2BF0X 5E75A 5CEDB 4OAUC 2VSYA 3VTYA 4NRHB 4GTSA 4I6JA 4HLEA 2DYSE 2IEJA 3FY4A 3KSLA 3HIZA 3I5PA 4I1OB 4K03A 3FU5A 4U8VD 2X38A 4G8LA 5EDSA 4V3IA 2J49A 1SW6A 4AP2A 4L2LA 2HR2A 4GZ3A 3UI2A 3ZFWA 2WXMA 2A5EA 4CDMA 5JHBA 2LNIA 4URKA 3C3QA 4CGWA 3R9MA 3CKBA 3I4GA 5AYWD 4H7XA 3W9GA 3DEOA 4HRNA 2NSZA 4HS2A 2KZTA 4HB5A 3ONKA 1OWLA 1TNZA 4BFRA 5BXOA 3GZ2A 5CRVA 4TV3A 2LO6A 2J4DA 2KBXA 1EF1C 3PEVB 4UWHA 1KT0A 2IO2C 4KBQA 3QKYA 2KCVA 3NF1A 3BU8A 5J08A 4IULA 3Q47B 1MQSA 4UWLA 3V2XA 4UWKA 5EX3A 5BW8C 1KPSB 3UKRG 4NURA 4N3CA 5ENQD 1FVHA 4DPRA 3V30A 3FUFA 2Y4UA 3TXNA 3Q75A 2WXLA 1DNPA 4DX6D 2QZAA 4B8AA 3AS8A 4RVBA 2YINA 1FCHA 3CGHA 4HRLA 5AQ7A 3BQOA 5BUZA 3JUEA 3NAWA 2WQ6A 2F8XK 4YDOA 1XGWA 1Z6TA 2C0LA 3ML8A 4KVMA 2V5QC 2L0IA 1B89A 2V5FA 2V4LA 3CK7A 4BTAA 3LDZA 5T3RA 4M7CA 5ENNA 5BPPA 2P9IG 1OCCE 2M63A 3ULQA 1JCRA 4E85A 1L5JA 3LVQE 3APCA 3NZUA 4RLYA 5DBKA 2LXMA 5ENSD 3QAQA 3HXEA 4CT0A 3UIOC 2E2EA 4XI9A 5ITZF 3G2UA 1PAQA 1X81A 1JPLA 3L6AA 4D10C 1BU9A 2IONA 3L08A 2R17C 1DCEA 4CEMA 1BI7B 3T8MA 5T4YA 5FTPA 3MZLB 3AU4A 1UOHA 2XGOA 2WXNA 4WUYA 4ACLA 2WXRA 4HI8A 3CHRA 3ABLE 3ASHA 3QB2A 5CCLA 3EJNA 5FZRA 2X6HA 5JJ6A 4RG6A 4GTVA 4HI9A 4YVOA 2XQ0A 3LY7A 2OCCE 1E8WA 3GW4A 5EYPF 1HXIA 4F53A 4UWGA 4Y6CA 1NZNA 3ZIMA 2IU1A 3C3RA 2XHEA 3CVXA 5C1DA 3AS5A 2GROB 2H6HA 1Y6IA 2ZIRA 3UX4A 3HRAA 1SZ9A 2X6FA 1O1RA 2P9LG 3TG5A 2P9KG 4HOSA 5HRYA 3MV3B 5BT1A 5CMYA 5BXUA 4UQZA 2WB2A 2ZU6B 2MYOA 3G2SA 4DUIA 5JMND 1ZU2A 5G2NA 2VTBB 2X6KA 4J8YA 1A5EA 1INZA 4CT4A 2IOLA 3FWVA 4JEUA 2KM4A 3UKUG 3TWXA 2HO1A 2VGXB 3U66A 4I17A 1K1AA 2GGFA 4AVXA 2P58C 1KT1A 4C0MA 1N0QA 3GZSA 2L0TB 1QNFA 2LUHA 1G3NB 2WXFA 4Q69A 3EIJA 1YA0A 2CHZA 4IRUA 4AOFA 3BG1B 3IEGA 4K5BA 4O1OA 2ETAA 1SVXA 4AEZC 5CBOA 1YYHA 4JA9A 3FUNA 3ZU7B 4J6IA 3DPYA 4EZJA 3W9FA 2XGSA 3UMVA 2IY0C 3D9JA 3SI5A 4MKTA 2WXPA 3UTMA 2RG8A 3CEQA 1P5QA 3RO2A 4GCOA 1H19A 3FDHA 2J07A 4JC8A 4FULA 1W3BA 4DX7D 2MRIA 2V0PA 3CQCB 1Z5SC 2R05A 4Q96A 5FQ8A 4J7WA 1SA4A 3UIPC 1WAO1 1D8DA 3AU5A 2QY7A 2UY1B 3D9MA 3DSUA 4K5CA 2J4BA 2F8YA 3OTNA 4BESA 5LOZA 2ZXWE 2L6JA 3SNXA 2KXPC 2XRYA 1IHGA 3UINC 5CECB 3HXBA 3T8KA 3CVQA 3CR3A 2LAIA 4ANUA 4QFVA 4FHJA 1KZPA 5FZSA 1OXJA 2X6JA 1E90A 4RQIA 5CMWA 4F3VA 3ASGA 4G25A 1TN6A 4J0UA 3LXUX 1OY3D 2DBAA 4BX8A 2WQ7A 3EIQC 1OCOE 5KNGA 1LTXA 5AQ9A 2I6HA 3HHMA 4C48B 4JW1A 2DYRE 3DWLG 3B7UX 3D9LA 3CQGB 2BTDA 1TYQG 2XZTG 1BD8A 3CHOA 4DX1A 5B1BE 3G2TA 4GB9A 3ABKE 3ZYMA 1A17A 2J08A 3L82A 3ZKJA 2H6FA 4L1BA 5B1AE 1Z3XA 3PZ4A 2YHEA 1NI1A 5FZQA 4XX5A 4PS8A 4APOA 4GYOA 1N94A 3FFLA 4ILIA 4KYOB 1KLXA 2A5UA 4NIKA 1BI8B 2AXZA 3D9KA 3AG4E 4XE0A 1OWOA 3QWPA 2VGEA 3S7FA 4ATZD 2VTBA 1V54E 1IQRA 1UJJA 5A23A 3D9HA 3CVNA 3ZHEB 2XRZA 4RSYA 4RG9A 2LSUA 3ASDA 4YDWA 2OOEA 5EIDA 1FVFA 3PNLB 4FC8A 3EDTB 3E32A 2VGXA 5JJTA 4L23A 2HE0A 4GMLA 4EPZA 4AIFA 4J8DA 2B6CA 4YDYA 4FU3A 4ANXA 3CV0A 3NZSA 1MX2A 1H0AA 2BKKB 5T8IA 2EIKE 5CERB 4P29A 4A3TA 5CHEE 3TWTA 4HLLA 4UUCA 4GZCA 5EX0A 3PREA 3TWVA 5AJLA 2QC9A 4XKCA 3OAWA 4XKBA 3FU0A 2IFUA 4I1AA 4EZLA 3PZDA 3FUHA 2XPIA 1UG3A 2ILRA 4EBAG 4I1MA 3FTYA 1MX4A 4DRXE 2PZIA 2GRMA 2R5SA 3ZYQA 2WXJA 3JQ1A 1OCRE 2NXPA 5AENA 4YVQC 3PUKA 4ANVA 5CEAA 5LCWJ 2DZNA 4UI9K 4UQYA 2PL2A 3IV0A 2AXVA 2UY1A 4BETA 5CBNA 1D8EA 1SQMA 4X8QA 5LCWC 2J9QA 2WXHA 5AQAA 4WNGA 4EECA 3T5VA 2IQCA 5KJMA 1AWCB 3FH5A 3CVPA 3DSXA 2DCPA 1YCSB 4C0EA 4M3OA 3P2BA 1TJCA 2OVFA 4I9CA 2OV8A 4XEIG 3ZVVA 3L9TA 4CDNA 5FWQA 5AAOA 2CHWA 4G26A 2V8SE 2DWZA 4DI4A 1S70B 1H2UA 3QOUA 4ILGA 3HG0D 3CHSA 3JXJA 4K5AB 4W9RA 1E7VA 4GZ6A 3KAEA 4N39A 4KZCA 4DJAA 2JABA 3LS8A 3D9PA 4HRMB 1TR4A 3LY9A 4BSXA 2BEDA 4JEHA 4GAAA 4N2QA 1Y8MA 2HM8A 3D9OA 3MV2B 3HVEB 3KD7A 1Z3YA 3CVWA 3ZW3A 1MX6A 4DK5A 4U0UA 5D66A 1S0PA 1N4RA 3R7RA 4LSZE 4WWOA 4HBDA 2KCLA 3Q15A 1WDYA 4CGVA 4L9PA 1ELWA 2DIWA 1O1SA 2R59A 2VSOE 3C5RA 3SHFA 4N3BA 1QQEA 1E8YA 3E34A 2XEVA 4FLHA 4Y6WA 3ZHEA 5BNWA 5A7DB 4LNBA 4IYPA 3FTXA 1N4SA 1JUQA 2KC7A 4I2WA 4KZ0A 4L2YA 4BWRA 4AM9A 3RKVA 4JPSA 4GTTA 3VLEA 4CDRA 4GA1A 3SFYA 1OCZE 3F6QA 4G1TA 3TWRA 2GRLA 2L9BA 3HXFA 4APFA 3R7QA 2VSXE 3BUAA 3RJVA 4B94A 2XCCA 3QK0A 2HYZA 3IHYA 4F6RD 2C2LA 3FTUA 3Q4AB 1JCSA 1HE8A 3L16A 3Q7FA 4TXRA 4LEUA 3B7RL 4LRZA 1HS6A 3UM0A 1U2VG 4DX5D 3NB2A 1OUVA 3CSFA 1IKND 4GZDA 4LERA 3ZUVB 1HX8A 5FJYA 1OWPA 2DZOA 2FF4A 5H7PA 1H6KA 3B7BA 4B93B 4MRUA 3MGBA 2X3MA 2NYJA 3TL5A 5ARGA 3JQ0A 3L17A 4O60A 1HG5A 3AAAC 2CFUA 2PQNA 4BEPA 3IHVA 4IN3B 3FUIA 4ZFHA 4OAVB 3ULEG 3ESKA 1IYGA 4UI9J 5IY5E 1JCQA 4FJYA 1RW2A 4LNUD 1N52A 4ATGA 3SQVA 3PUJA 1ELKA 3ISMC 4UI9C 3WG7E 3UPVA
chains in the Genus database with same CATH topology
5EDSA 3LYAA 3LXUX 4A1GA 3ZPJA 2DBAA 4BX8A 3TG4A 4R7LA 2WQ7A 4V3IA 3EIQC 2BUGA 4N3AA 1ELRA 2J49A 2AW6A 2XPYA 4CCAA 4AP2A 4L2LA 2HR2A 2I6HA 3SD5A 3FHEA 3ONLA 4GZ3A 2FULA 4J8SA 3HHMA 3SBTB 1EPUA 2VYIA 3PE4A 4HFGA 4JW1A 4MS6A 3ZFWA 2YHCA 3EHNA 2WXMA 3B7UX 3SF4A 3FUDA 4CDMA 1HF8A 2LNIA 3LKUA 4CGWA 4URKA 3D9LA 4HOTA 3ZRHA 3CKBA 3ZN3A 4WWPA 3CQGB 3I4GA 5AYWD 3L13A 4H7XA 4U0SA 2BTDA 3PDNA 3G2WA 3RU0A 5DIZA 2NSZA 4HS2A 5BV1A 5D0OD 3CHOA 2KZTA 2NC9A 3ONKA 1OWLA 4BFRA 3GZ2A 3OXFA 4TV3A 4KT6B 1DVPA 2LO6A 4WAFA 5E76A 2J4DA 3MKQB 1EF1C 3G2TA 4WNDA 3HYMB 5FQ4A 4U0ZA 3RO3A 4FADA 2I2OA 4GB9A 3CHQA 3PEUB 3ZEFA 3ZYMA 3ESLA 3B13A 1A17A 3RRMB 3FH7A 3PEVB 2J08A 4UWHA 3CK9A 3SBSA 2CFZA 1KT0A 2OVBA 1U3CA 1OWNA 4GU5A 4UQXA 5HQ8A 5KJNA 4KBQA 3QKYA 4L1BA 2KCVA 3FUEA 3MCXA 3NF1A 3IBEA 4TRQA 3VLFA 1Z3XA 1NP7A 3LCAA 4U07A 2YHEA 5J90A 5FZQA 4XX5A 4PS8A 4F7AA 1UW4B 3HVEA 4APOA 4GYOA 4BT9A 3FFLA 4ILIA 4KYOB 5J08A 1KLXA 2A5UA 3CSTA 1U3DA 4IULA 4OVUA 2AXZA 3Q47B 3D9KA 3QARA 1MQSA 4UWLA 4XE0A 4UWKA 5EX3A 5BW8C 1OWOA 2WXIA 1PC2A 3QWPA 3U4TA 1WM5A 2VJ8A 2VTBA 3S7FA 3KEZA 4TUUA 1UN9A 4NURA 1IQRA 1UJJA 4N3CA 5A23A 1FVHA 4DPRA 3CVNA 3ZHEB 5EKQD 2XRZA 4RSYA 4RG9A 4I2ZA 2LSUA 3ASDA 3CIAA 2WM9A 3FUFA 1E8XA 2JLBA 4F1SA 2OOEA 3URZA 1FVFA 3PNLB 2Y4UA 3TXNA 4FC8A 3EDTB 4N2SA 2VGXA 1E8ZA 3CK8A 2WXLA 4HOQA 1DNPA 3FULA 4BY6A 5JJTA 4L23A 3AS8A 4B8AA 4GMLA 4EPZA 4AIFA 4J8DA 3NQPA 2YQ8A 4RVBA 4FU3A 2YINA 4ANXA 1FCHA 3CV0A 3NZSA 3CGHA 1OWMA 2WXOA 1H2VC 5BUZA 1H0AA 5T8IA 4PUCA 2I9CA 2WQ6A 2CHXA 2KATA 3FTWA 4PH4B 1XGWA 1Z6TA 2C0LA 4P29A 4B8CB 3CLJA 3O48A 4A3TA 3ML8A 5CHEE 4KVMA 3LJ3A 3MA5A 4GZCA 5EX0A 2L0IA 1B89A 3PREA 2Q7FA 2V5FA 2V4LA 3CK7A 3MX3A 4XKCA 5AJLA 5AIJA 3OAWA 1IQUA 4XZ4A 4CRWA 4BTAA 5FQ7A 4XKBA 1VDYA 3FU0A 3FU3A 3LDZA 5T3RA 2Y3AA 3MJWA 2E0IA 1H2TC 2IFUA 5ENNA 4I1AA 5BPPA 4B89A 5ANLA 3PZDA 4EZLA 2M63A 3ULQA 4E85A 1L5JA 3FUHA 3LVQE 2XPIA 1UG3A 3T5XA 2YNQA 3QDNA 3APCA 4O6FA 3LEWA 2ILRA 3FUKA 3QWVA 3NZUA 2QFCA 4PDXA 4I1MA 4EBAG 3FTYA 2LAHA 1HU3A 3QWWA 3S7DA 5DBKA 3QAQA 3S7BA 4CT0A 5KJKA 2PZIA 4N5CA 1TJFA 4U63A 2E2EA 2GRMA 2VGYA 3CVLA 4H7YA 2EQXA 2R5SA 4XI9A 5G05J 2X6IA 3ZYQA 2WXJA 3JQ1A 3RIBA 3G2UA 5JHAA 1PAQA 3N71A 3JUIA 3D9NA 1UJKA 2NXPA 4FA6A 5AENA 4YVQC 3PUKA 1JPLA 4ANVA 5LCWJ 4UI9K 4UQYA 3WXXA 5G05C 3L6AA 4D10C 2PL2A 2IONA 3IV0A 4JHJA 3L08A 2AXVA 3QC1A 3VLDA 2R17C 2UY1A 4WNEA 3L22A 3LY8A 4MLPA 4I9EA 1SQMA 4AY6A 2WMOA 4E6HA 3PS6A 5LCWC 2J9QA 4CEMA 4HOUA 4WNFA 2WXHA 2IF4A 4WNGA 3T8MA 2PM7A 4A1SA 4A55A 4EECA 1TEZA 2A4ZA 5T4YA 1NA0A 4ACKA 3T5VA 2IQCA 5FTPA 3O4ZA 4C9BB 5KJMA 2XPZA 3MZLB 3AU4A 4G24A 3FH5A 2XGOA 2WXNA 4WUYA 2AXUA 3VTXA 4ACLA 3ZYLA 2WXRA 3CVPA 4BX9A 3CHRA 3UT7A 5LX8A 3FTSA 3PVLA 3ASHA 3BG0B 1HO8A 4GA0A 2DCPA 1SZAA 3QB2A 3UT4A 3I3NA 5CCLA 3EJNA 4C0EA 4M3OA 2WXKA 3P2BA 2FI7A 3S2AA 4HVBA 4L7TA 5A6CA 5FZRA 2X6HA 5JJ6A 1TJCA 2OVFA 3P1UA 2RD0A 4RG6A 4I9CA 2IJGX 1GW6A 2OV8A 3ZVVA 3PE3A 4CDNA 2WXQA 5FWQA 2CHWA 4G26A 3APFA 2V8SE 3HDXA 4DI4A 4XI0A 1H2UA 3QOUA 4I6EA 4FLBA 4YVOA 3D3MA 1UN8A 4ILGA 4JZYA 1X5BA 2KZTB 2XQ0A 3LY7A 4GZ5A 3CHSA 1E8WA 3EHMA 4J8FA 3GW4A 4W9RA 1E7VA 4EBAA 4GZ6A 3KAEA 3JCKC 2KCKA 1HXIA 4EZKA 4N39A 4KZCA 4AJWA 4F53A 4UWGA 4DJAA 4Y6CA 1NZNA 3ZIMA 2IU1A 2WXGA 2XHEA 3LS8A 3CVXA 3D9PA 5C1DA 3AS5A 4JA7A 3LY9A 1LF8A 5ARFA 1Y6IA 4BSXA 4JEHA 3ZXSA 3UX4A 3FH8A 4GYWA 4GAAA 1JWFA 4G23A 1SZ9A 4FHKA 3CVUA 2LSVA 1EDUA 2X6FA 4Q94A 3TAXA 5FQ6A 4N2QA 2JEKA 3B7SA 3ML9A 1Y8MA 3TG5A 3PNTB 2AWIA 3DPDA 2AVPA 4AY5A 2HM8A 4HOSA 2I1JA 3D9OA 3MV2B 3HVEB 3MKQA 3FTZA 3MV3B 3SGHA 2C0MA 3KD7A 5BT1A 4BT8A 4XIFA 1Z3YA 4G2VA 3CVWA 3ZW3A 4OVVA 4NQ0A 5CMYA 4UQZA 4DK5A 2ZU6B 3RK6A 4U0UA 2WB2A 4GCNA 1S0PA 3UT8A 3G2SA 3R7RA 2WVIA 4KMOA 3FUMA 1ZU2A 4WWOA 5G2NA 2VTBB 2Y4TA 5JHBA 2X6KA 2KCLA 2UWJG 3Q15A 1INZA 4CT4A 2IOLA 3FWVA 2CG2A 1WY6A 3OXGA 4CGVA 3GYZA 4JEUA 1E7UA 1ELWA 4JVSA 2FBNA 4AXHA 2DIWA 4KVOA 3IKOB 4BTBA 2CG3A 2KM4A 3CKCA 4PS3A 1EYHA 2HO1A 2XGMA 2R59A 3FP3A 5AJDA 2VGXB 2VSOE 3SHFA 5C2YA 4YNDA 4GMJA 4PS7A 5LFAA 3U66A 4N3BA 4I17A 2ONDA 3CHMA 3Q49B 5D0QD 1QQEA 2GGFA 1PY1A 2P58C 3QJZA 1E8YA 4AVXA 4DLQA 3RRNB 1KT1A 4LCTA 4OYSA 4C0MA 2XEVA 4FLHA 4Y6WA 1BPOA 3ZHEA 5G04J 4ANWA 3GZSA 5BNWA 3R9AB 2L0TB 3Q5MA 5A7DB 3UQ3A 4KXKB 4NACA 3ZGQA 4IYPA 3FTXA 1QNFA 1NA3A 1JUQA 2WXFA 4JXTA 3GZ1A 4Q69A 2KC7A 3JYSA 3EIJA 3KS2A 4GPKA 5G04C 4I2WA 4KZ0A 4ME2A 3C98A 2PM6A 1YA0A 3LPZA 2CHZA 5HI7A 3U64A 3PRZA 4IRUA 4L2YA 3BG1B 3IEGA 4AOFA 1HG2A 3FU6A 4AEZC 4BWRA 3BEEA 2FEZA 4AM9A 3RKVA 3S7JA 4JHRA 5BV0A 4JPSA 4I6GA 4G11A 4JA9A 5KJLA 2XCBA 3FUNA 3VLEA 4CDRA 3CVYA 2I1KA 3B7TA 4JL0A 5FT9A 4GA1A 3ZYKA 4ABNA 4J6IA 1JWGA 4FJZA 4EZJA 4GYYA 4J8EA 2XGSA 4G1TA 3TXMA 3UMVA 3D9JA 3SI5A 2MHKA 3U3WA 1XNFA 2VSNA 4LUNU 2GRLA 3FEXA 3OXLA 4MKTA 2L9BA 5G55A 2WMNA 2WXPA 4APFA 3R7QA 2VSXE 4HORA 2RG8A 3CEQA 3RJVA 4B94A 2XCCA 3G2VA 4UWFA 2MOWA 1P5QA 3QK0A 2HYZA 3RO2A 3IHYA 4GCOA 1H19A 3FDHA 2J07A 1E96B 4JC8A 4FULA 5M72A 2C2LA 3FTUA 1W3BA 3MEKA 3Q4AB 3LVRE 3UUXA 5KCMA 1HE8A 2WQHA 3L16A 4FP7A 1QZ2A 2MRIA 2V0PA 4WWNA 5LP0A 3AS4A 3CQCB 4LEUA 1ZBPA 2J09A 4AV7A 3B7RL 4JHKA 2GW1A 3FUJA 3SFZA 3FTVA 4LRZA 1HS6A 5ANRA 1MHQA 4B0ZA 3CHPA 1HZ4A 3RRUA 4Q96A 1HH8A 5FQ8A 4DI3A 1OUVA 3PH0C 3CSFA 3TGOA 4GZDA 4LERA 4I43A 1WAO1 3DBSA 3D9IA 2PQRA 3MKRA 4U04A 3AU5A 2QY7A 1HX8A 1N54A 4ILHB 5FJYA 2UY1B 1OWPA 4DLOA 2FF4A 3D9MA 1H6KA 4HXIA 2IOSA 2J4BA 4MRUA 3MGBA 3OTNA 3I4RB 5CCMA 4U8HA 5JJ7A 2X3MA 3ASFA 2BF0X 5E75A 5LOZA 3TL5A 4K0RA 2WPVA 3SZ7A 5ARGA 2L6JA 3JQ0A 3L17A 3SNXA 1HG5A 2VSYA 3VTYA 1HFAA 2XRYA 2CFUA 1IHGA 3FEYA 2PQNA 4NRHB 3ENEA 4I6JA 3U9WA 3CVQA 2VQ2A 2LAIA 3CR3A 3TJPA 3IHVA 4ANUA 4IN3B 3FUIA 3MYVA 3QNKA 4QFVA 4A3VA 3ESKA 1IYGA 4UI9J 4HLEA 2FO7A 3APDA 4FHJA 4EQFA 4FJYA 5FZSA 3FY4A 1N52A 2X6JA 1E90A 3HIZA 3I5PA 3L54A 4ATGA 5CMWA 4I1OB 3PUJA 1ELKA 4GA2A 4K03A 3FU5A 4F3VA 3CVVA 3ASGA 4UI9C 2X38A 4G25A 4J0UA 3E4BA 3K9IA 3UPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEY A;  4B89 A;  2IU1 A;  2NSZ A;  2ZU6 B;  3RK6 A;  2KZT A;  3EIQ C;  2GGF A;  1UG3 A;  1N54 A;  1UW4 B;  1PAQ A;  4B8C B;  3JUI A;  4C9B B;  1H6K A;  2IOS A;  2FUL A;  4IUL A;  4CT4 A;  2IOL A;  2I2O A;  1H2U A;  3L6A A;  4B8A A;  1N52 A;  3D3M A;  2ION A;  4GML A;  4JHK A;  1HU3 A;  2KZT B;  4JHJ A;  5ANR A;  4CRW A;  2HM8 A;  4LUN U;  3FEX A;  3EIJ A;  1H2T C;  2VSO E;  2VSX E;  1H2V C;  2RG8 A;  4CEM A;  4GMJ A; 
#chains in the Genus database with same CATH topology
 3LYA A;  4A1G A;  1O1T A;  1ELR A;  2XPY A;  3SD5 A;  3FHE A;  3ONL A;  4CYM D;  2FUL A;  4J8S A;  3SBT B;  1EPU A;  2VYI A;  3PE4 A;  4MS6 A;  2EIN E;  3SO8 A;  3SF4 A;  3FUD A;  1HF8 A;  3LKU A;  3ZN3 A;  4WWP A;  3DST A;  3PDN A;  5DIZ A;  3T9K A;  3OXF A;  3TWS A;  4KT6 B;  1DVP A;  4WAF A;  5E76 A;  3MKQ B;  1N0R A;  4WND A;  3C72 A;  2P9U G;  3HYM B;  5FQ4 A;  4U0Z A;  3RO3 A;  4FAD A;  3B13 A;  3RRM B;  3FH7 A;  3CK9 A;  2CFZ A;  2OVB A;  1U3C A;  1OWN A;  1TNB A;  3FUE A;  2RFA A;  3VLF A;  1NP7 A;  4A63 B;  3ABM E;  3HVE A;  4BT9 A;  1FT2 A;  2LXL A;  4TXP A;  1PC2 A;  3U4T A;  4TUU A;  1UN9 A;  2P9N G;  5EKQ D;  1TNY A;  4TXQ A;  1E8X A;  2JLB A;  3URZ A;  4N2S A;  1E8Z A;  3UM2 A;  4HOQ A;  4GTO A;  4ZHB A;  3UM3 A;  1V55 E;  5CRU A;  2YQ8 A;  2L6B A;  5FIN A;  2WXO A;  1H2V C;  4PUC A;  3EHR A;  2KAT A;  2EIJ E;  4B8C B;  3O48 A;  3SY2 A;  1H6P A;  1LD7 A;  2Q7F A;  5AIJ A;  1IQU A;  4CRW A;  2OEW A;  3FU3 A;  3E33 A;  3MJW A;  1H2T C;  5JA4 D;  3JXI A;  5ANL A;  4GTR A;  3T5X A;  2YNQ A;  3EHQ A;  4LNG A;  3FUK A;  2QFC A;  2LAH A;  3S7B A;  1NFI E;  5AN8 A;  4N5C A;  2VGY A;  3CVL A;  5G05 J;  3RIB A;  3V31 A;  5JHA A;  3N71 A;  3Q9U C;  3WXX A;  5G05 C;  3QC1 A;  3VLD A;  1TN8 A;  3UXG A;  3LY8 A;  4I9E A;  4AY6 A;  3UM1 A;  2WMO A;  5KWD A;  4E6H A;  2J8S D;  4HOU A;  2IF4 A;  2PM7 A;  4A55 A;  1TEZ A;  2A4Z A;  1NA0 A;  1RZ4 A;  4C9B B;  3VTX A;  3ZYL A;  5LX8 A;  3BG0 B;  4GA0 A;  3EUV A;  1SZA A;  4GTQ A;  3I3N A;  3P1U A;  2RD0 A;  2Y69 E;  1GW6 A;  3PE3 A;  1N11 A;  2WXQ A;  4U95 D;  3HDX A;  4I6E A;  3B95 A;  3D3M A;  4JZY A;  4J8F A;  1K3Z D;  4EBA A;  2ETC A;  3JCK C;  2KCK A;  3Q9N C;  2P2C P;  3TWW A;  3E30 A;  2Y0B G;  3ZXS A;  2OEV A;  3FH8 A;  4G23 A;  3KEA A;  4FHK A;  3CVU A;  4Q94 A;  3TAX A;  4LG6 A;  2JEK A;  3B7S A;  3ML9 A;  2AWI A;  4JD2 G;  4AY5 A;  2I1J A;  3MKQ A;  2C0M A;  2B0O E;  4GCN A;  3X2Q E;  3UT8 A;  2WVI A;  4CZ2 D;  1FT1 A;  2CG2 A;  2AJA A;  1MZC A;  3GYZ A;  3NBN B;  2FBN A;  2CG3 A;  3CKC A;  4PS3 A;  1EYH A;  2XGM A;  5AJD A;  3DEP A;  5LFA A;  4GMJ A;  3PZ1 A;  5D0Q D;  4LCT A;  4OYS A;  1BPO A;  2P9P G;  2H6I A;  3AG1 E;  3UQ3 A;  4KXK B;  4NAC A;  3ZGQ A;  1NA3 A;  2XZD G;  4JXT A;  3GZ1 A;  4GPK A;  3EU9 A;  4ME2 A;  3C98 A;  3LPZ A;  1HG2 A;  3FU6 A;  3BEE A;  3Q7A A;  5BV0 A;  4JHR A;  2EIM E;  4I6G A;  3CVY A;  2I1K A;  3B7T A;  5FT9 A;  3ZYK A;  2XS1 A;  4U96 D;  4FJZ A;  4YDE A;  4J8E A;  3TXM A;  1H6O A;  2VSN A;  3OXL A;  5G55 A;  2WMN A;  3G2V A;  4UWF A;  2ETB A;  1MYO A;  5M72 A;  5KCM A;  2WQH A;  5ENR D;  5LP0 A;  1QZ2 A;  4WWN A;  3AS4 A;  1S64 A;  3DSV A;  2GW1 A;  3FUJ A;  4HQD A;  3DSW A;  1N95 A;  1HH8 A;  4DI3 A;  3RSE G;  4I43 A;  3D9I A;  3MKR A;  4U04 A;  1N54 A;  4DLO A;  2GRR B;  2IOS A;  5EYL A;  5JJ7 A;  5CCM A;  4U8H A;  4K0R A;  2WPV A;  3SZ7 A;  1HFA A;  3FEY A;  3NOC D;  3ENE A;  4QQI A;  3U9W A;  3SFX A;  2VQ2 A;  1N9A A;  3TJP A;  1OT8 A;  4A3V A;  3MYV A;  3QNK A;  4G8K A;  2FO7 A;  3APD A;  4EQF A;  3L54 A;  4GA2 A;  1ZB1 A;  3CVV A;  5AQB A;  3E4B A;  3K9I A;  3ZPJ A;  2XEE A;  4R7L A;  3TG4 A;  2BUG A;  4N3A A;  2AW6 A;  4CCA A;  3V79 K;  3TWU A;  4HFG A;  2YHC A;  3EHN A;  3ASO E;  4HOT A;  4U8Y D;  3ZRH A;  2F37 A;  3L13 A;  4U0S A;  3G2W A;  3RU0 A;  5BV1 A;  5D0O D;  2NC9 A;  2GRQ B;  3AG2 E;  4TUM A;  5FIO A;  2IO3 C;  2PNN A;  2I2O A;  3CHQ A;  3PEU B;  3ZEF A;  5EIB E;  3ESL A;  1D9S A;  3SBS A;  4GU5 A;  4UQX A;  5HQ8 A;  5KJN A;  3MCX A;  4TRQ A;  3IBE A;  1WG0 A;  3NOG D;  1BLX B;  3LCA A;  4U07 A;  5J90 A;  4F7A A;  1UW4 B;  1O5M A;  3EU5 A;  1LD8 A;  3CST A;  1U3D A;  4OVU A;  3QAR A;  2WXI A;  1WM5 A;  2VJ8 A;  3KEZ A;  4Z68 A;  4I2Z A;  3CIA A;  2WM9 A;  3E37 A;  4F1S A;  2GRN B;  1IHB A;  4O1P A;  3CK8 A;  3FUL A;  1QYM A;  3KSQ A;  4BY6 A;  1S63 A;  3NQP A;  2XS8 A;  3C3O A;  1QBQ A;  1OWM A;  1KZO A;  2I9C A;  2CHX A;  3FTW A;  4PH4 B;  5AAR A;  3CLJ A;  3ULY A;  3IXE A;  2BKG A;  3J5Q B;  3LJ3 A;  3MA5 A;  3MX3 A;  4XZ4 A;  5HS0 A;  5FQ7 A;  1VDY A;  2Y3A A;  2E0I A;  4B89 A;  2QYJ A;  1TNU A;  3QDN A;  4O6F A;  3LEW A;  3Q79 A;  3QWV A;  4PDX A;  1IXV A;  3PZ2 A;  3Q78 A;  3S7D A;  1HU3 A;  3QWW A;  2ZIS A;  5KJK A;  3J5P A;  1TJF A;  2QYU A;  4U63 A;  2RFM A;  3ZXP A;  4H7Y A;  2EQX A;  2X6I A;  3DRA A;  5B3S E;  3DXK G;  4JB8 P;  3JUI A;  3PZ3 A;  1K1B A;  3D9N A;  1UJK A;  4FA6 A;  1Q2Z A;  1K8K G;  4JHJ A;  4WNE A;  3L22 A;  4MLP A;  3PS6 A;  1DCQ A;  4WNF A;  3HXD A;  4A1S A;  4U7E B;  3HXC A;  4ACK A;  3O4Z A;  2XPZ A;  4G24 A;  4DX2 A;  2AXU A;  4BX9 A;  3UT7 A;  3FTS A;  3PVL A;  1HO8 A;  3UT4 A;  4HNA D;  2WXK A;  2FI7 A;  3S2A A;  2XEH A;  4HVB A;  4L7T A;  5A6C A;  2EIL E;  2IJG X;  3APF A;  4XI0 A;  4FLB A;  1UN8 A;  1X5B A;  2KZT B;  4GZ5 A;  3EHM A;  1N4Q A;  1FPP A;  1TNO A;  4EZK A;  4AJW A;  1AP7 A;  2WXG A;  3LJN A;  4JA7 A;  4MBG A;  1LF8 A;  5ARF A;  2ZGD A;  4GYW A;  1JWF A;  2FO1 E;  2LSV A;  1EDU A;  5FQ6 A;  3PNT B;  3DPD A;  2AVP A;  2V4H C;  4GMR A;  3FTZ A;  3SGH A;  4BT8 A;  4XIF A;  3RAU A;  4G2V A;  4OVV A;  4NQ0 A;  2RKK A;  3AG3 E;  3RK6 A;  1NL4 A;  4KMO A;  4N5Q A;  3FUM A;  2Y4T A;  2UWJ G;  5HKP A;  1WY6 A;  3OXG A;  1E7U A;  4JVS A;  4AXH A;  2R02 A;  3DXM G;  4KVO A;  3IKO B;  4BTB A;  4F1P A;  2F0Y A;  2Y1L E;  3FP3 A;  4BER A;  4EHM A;  3ASN E;  5C2Y A;  4YND A;  4PS7 A;  2OND A;  3CHM A;  3Q49 B;  4GTP A;  5KBA A;  4GPM A;  1PY1 A;  3QJZ A;  4DLQ A;  1MJ0 A;  3RRN B;  5G04 J;  2P9S G;  3Q73 A;  4ANW A;  3R9A B;  3Q5M A;  2R2L A;  1TN7 A;  3JYS A;  3KS2 A;  5G04 C;  1DC2 A;  2PM6 A;  5HI7 A;  3V2O A;  2GRP B;  3U64 A;  3PRZ A;  3ZNG A;  5ENT D;  2FEZ A;  3S7J A;  4G11 A;  2R03 A;  5KJL A;  2DVW A;  2XCB A;  2ZGG A;  4JL0 A;  4ABN A;  1JWG A;  4GYY A;  5D2M C;  3TWQ A;  2MHK A;  3U3W A;  1XNF A;  4LUN U;  3FEX A;  5EIL A;  4HOR A;  2MOW A;  1E96 B;  3MEK A;  3UUX A;  3LVR E;  4FP7 A;  1ZBP A;  2J09 A;  4AV7 A;  3DSS A;  4JHK A;  3SFZ A;  5KNH D;  3FTV A;  5ANR A;  1MHQ A;  4B0Z A;  3CHP A;  4BSZ B;  5ENO D;  1HZ4 A;  3RRU A;  4GTM A;  3AJI A;  3PH0 C;  3TGO A;  2H6G A;  5ENP D;  3DBS A;  5EN5 D;  2PQR A;  4ILH B;  1SA5 A;  1N4P A;  4HXI A;  2XEN A;  1YMP A;  3I4R B;  3ASF A;  2BF0 X;  5E75 A;  5CED B;  4OAU C;  2VSY A;  3VTY A;  4NRH B;  4GTS A;  4I6J A;  4HLE A;  2DYS E;  2IEJ A;  3FY4 A;  3KSL A;  3HIZ A;  3I5P A;  4I1O B;  4K03 A;  3FU5 A;  4U8V D;  2X38 A;  4G8L A;  5EDS A;  4V3I A;  2J49 A;  1SW6 A;  4AP2 A;  4L2L A;  2HR2 A;  4GZ3 A;  3UI2 A;  3ZFW A;  2WXM A;  2A5E A;  4CDM A;  5JHB A;  2LNI A;  4URK A;  3C3Q A;  4CGW A;  3R9M A;  3CKB A;  3I4G A;  5AYW D;  4H7X A;  3W9G A;  3DEO A;  4HRN A;  2NSZ A;  4HS2 A;  2KZT A;  4HB5 A;  3ONK A;  1OWL A;  1TNZ A;  4BFR A;  5BXO A;  3GZ2 A;  5CRV A;  4TV3 A;  2LO6 A;  2J4D A;  2KBX A;  1EF1 C;  3PEV B;  4UWH A;  1KT0 A;  2IO2 C;  4KBQ A;  3QKY A;  2KCV A;  3NF1 A;  3BU8 A;  5J08 A;  4IUL A;  3Q47 B;  1MQS A;  4UWL A;  3V2X A;  4UWK A;  5EX3 A;  5BW8 C;  1KPS B;  3UKR G;  4NUR A;  4N3C A;  5ENQ D;  1FVH A;  4DPR A;  3V30 A;  3FUF A;  2Y4U A;  3TXN A;  3Q75 A;  2WXL A;  1DNP A;  4DX6 D;  2QZA A;  4B8A A;  3AS8 A;  4RVB A;  2YIN A;  1FCH A;  3CGH A;  4HRL A;  5AQ7 A;  3BQO A;  5BUZ A;  3JUE A;  3NAW A;  2WQ6 A;  2F8X K;  4YDO A;  1XGW A;  1Z6T A;  2C0L A;  3ML8 A;  4KVM A;  2V5Q C;  2L0I A;  1B89 A;  2V5F A;  2V4L A;  3CK7 A;  4BTA A;  3LDZ A;  5T3R A;  4M7C A;  5ENN A;  5BPP A;  2P9I G;  1OCC E;  2M63 A;  3ULQ A;  1JCR A;  4E85 A;  1L5J A;  3LVQ E;  3APC A;  3NZU A;  4RLY A;  5DBK A;  2LXM A;  5ENS D;  3QAQ A;  3HXE A;  4CT0 A;  3UIO C;  2E2E A;  4XI9 A;  5ITZ F;  3G2U A;  1PAQ A;  1X81 A;  1JPL A;  3L6A A;  4D10 C;  1BU9 A;  2ION A;  3L08 A;  2R17 C;  1DCE A;  4CEM A;  1BI7 B;  3T8M A;  5T4Y A;  5FTP A;  3MZL B;  3AU4 A;  1UOH A;  2XGO A;  2WXN A;  4WUY A;  4ACL A;  2WXR A;  4HI8 A;  3CHR A;  3ABL E;  3ASH A;  3QB2 A;  5CCL A;  3EJN A;  5FZR A;  2X6H A;  5JJ6 A;  4RG6 A;  4GTV A;  4HI9 A;  4YVO A;  2XQ0 A;  3LY7 A;  2OCC E;  1E8W A;  3GW4 A;  5EYP F;  1HXI A;  4F53 A;  4UWG A;  4Y6C A;  1NZN A;  3ZIM A;  2IU1 A;  3C3R A;  2XHE A;  3CVX A;  5C1D A;  3AS5 A;  2GRO B;  2H6H A;  1Y6I A;  2ZIR A;  3UX4 A;  3HRA A;  1SZ9 A;  2X6F A;  1O1R A;  2P9L G;  3TG5 A;  2P9K G;  4HOS A;  5HRY A;  3MV3 B;  5BT1 A;  5CMY A;  5BXU A;  4UQZ A;  2WB2 A;  2ZU6 B;  2MYO A;  3G2S A;  4DUI A;  5JMN D;  1ZU2 A;  5G2N A;  2VTB B;  2X6K A;  4J8Y A;  1A5E A;  1INZ A;  4CT4 A;  2IOL A;  3FWV A;  4JEU A;  2KM4 A;  3UKU G;  3TWX A;  2HO1 A;  2VGX B;  3U66 A;  4I17 A;  1K1A A;  2GGF A;  4AVX A;  2P58 C;  1KT1 A;  4C0M A;  1N0Q A;  3GZS A;  2L0T B;  1QNF A;  2LUH A;  1G3N B;  2WXF A;  4Q69 A;  3EIJ A;  1YA0 A;  2CHZ A;  4IRU A;  4AOF A;  3BG1 B;  3IEG A;  4K5B A;  4O1O A;  2ETA A;  1SVX A;  4AEZ C;  5CBO A;  1YYH A;  4JA9 A;  3FUN A;  3ZU7 B;  4J6I A;  3DPY A;  4EZJ A;  3W9F A;  2XGS A;  3UMV A;  2IY0 C;  3D9J A;  3SI5 A;  4MKT A;  2WXP A;  3UTM A;  2RG8 A;  3CEQ A;  1P5Q A;  3RO2 A;  4GCO A;  1H19 A;  3FDH A;  2J07 A;  4JC8 A;  4FUL A;  1W3B A;  4DX7 D;  2MRI A;  2V0P A;  3CQC B;  1Z5S C;  2R05 A;  4Q96 A;  5FQ8 A;  4J7W A;  1SA4 A;  3UIP C;  1WAO 1;  1D8D A;  3AU5 A;  2QY7 A;  2UY1 B;  3D9M A;  3DSU A;  4K5C A;  2J4B A;  2F8Y A;  3OTN A;  4BES A;  5LOZ A;  2ZXW E;  2L6J A;  3SNX A;  2KXP C;  2XRY A;  1IHG A;  3UIN C;  5CEC B;  3HXB A;  3T8K A;  3CVQ A;  3CR3 A;  2LAI A;  4ANU A;  4QFV A;  4FHJ A;  1KZP A;  5FZS A;  1OXJ A;  2X6J A;  1E90 A;  4RQI A;  5CMW A;  4F3V A;  3ASG A;  4G25 A;  1TN6 A;  4J0U A;  3LXU X;  1OY3 D;  2DBA A;  4BX8 A;  2WQ7 A;  3EIQ C;  1OCO E;  5KNG A;  1LTX A;  5AQ9 A;  2I6H A;  3HHM A;  4C48 B;  4JW1 A;  2DYR E;  3DWL G;  3B7U X;  3D9L A;  3CQG B;  2BTD A;  1TYQ G;  2XZT G;  1BD8 A;  3CHO A;  4DX1 A;  5B1B E;  3G2T A;  4GB9 A;  3ABK E;  3ZYM A;  1A17 A;  2J08 A;  3L82 A;  3ZKJ A;  2H6F A;  4L1B A;  5B1A E;  1Z3X A;  3PZ4 A;  2YHE A;  1NI1 A;  5FZQ A;  4XX5 A;  4PS8 A;  4APO A;  4GYO A;  1N94 A;  3FFL A;  4ILI A;  4KYO B;  1KLX A;  2A5U A;  4NIK A;  1BI8 B;  2AXZ A;  3D9K A;  3AG4 E;  4XE0 A;  1OWO A;  3QWP A;  2VGE A;  3S7F A;  4ATZ D;  2VTB A;  1V54 E;  1IQR A;  1UJJ A;  5A23 A;  3D9H A;  3CVN A;  3ZHE B;  2XRZ A;  4RSY A;  4RG9 A;  2LSU A;  3ASD A;  4YDW A;  2OOE A;  5EID A;  1FVF A;  3PNL B;  4FC8 A;  3EDT B;  3E32 A;  2VGX A;  5JJT A;  4L23 A;  2HE0 A;  4GML A;  4EPZ A;  4AIF A;  4J8D A;  2B6C A;  4YDY A;  4FU3 A;  4ANX A;  3CV0 A;  3NZS A;  1MX2 A;  1H0A A;  2BKK B;  5T8I A;  2EIK E;  5CER B;  4P29 A;  4A3T A;  5CHE E;  3TWT A;  4HLL A;  4UUC A;  4GZC A;  5EX0 A;  3PRE A;  3TWV A;  5AJL A;  2QC9 A;  4XKC A;  3OAW A;  4XKB A;  3FU0 A;  2IFU A;  4I1A A;  4EZL A;  3PZD A;  3FUH A;  2XPI A;  1UG3 A;  2ILR A;  4EBA G;  4I1M A;  3FTY A;  1MX4 A;  4DRX E;  2PZI A;  2GRM A;  2R5S A;  3ZYQ A;  2WXJ A;  3JQ1 A;  1OCR E;  2NXP A;  5AEN A;  4YVQ C;  3PUK A;  4ANV A;  5CEA A;  5LCW J;  2DZN A;  4UI9 K;  4UQY A;  2PL2 A;  3IV0 A;  2AXV A;  2UY1 A;  4BET A;  5CBN A;  1D8E A;  1SQM A;  4X8Q A;  5LCW C;  2J9Q A;  2WXH A;  5AQA A;  4WNG A;  4EEC A;  3T5V A;  2IQC A;  5KJM A;  1AWC B;  3FH5 A;  3CVP A;  3DSX A;  2DCP A;  1YCS B;  4C0E A;  4M3O A;  3P2B A;  1TJC A;  2OVF A;  4I9C A;  2OV8 A;  4XEI G;  3ZVV A;  3L9T A;  4CDN A;  5FWQ A;  5AAO A;  2CHW A;  4G26 A;  2V8S E;  2DWZ A;  4DI4 A;  1S70 B;  1H2U A;  3QOU A;  4ILG A;  3HG0 D;  3CHS A;  3JXJ A;  4K5A B;  4W9R A;  1E7V A;  4GZ6 A;  3KAE A;  4N39 A;  4KZC A;  4DJA A;  2JAB A;  3LS8 A;  3D9P A;  4HRM B;  1TR4 A;  3LY9 A;  4BSX A;  2BED A;  4JEH A;  4GAA A;  4N2Q A;  1Y8M A;  2HM8 A;  3D9O A;  3MV2 B;  3HVE B;  3KD7 A;  1Z3Y A;  3CVW A;  3ZW3 A;  1MX6 A;  4DK5 A;  4U0U A;  5D66 A;  1S0P A;  1N4R A;  3R7R A;  4LSZ E;  4WWO A;  4HBD A;  2KCL A;  3Q15 A;  1WDY A;  4CGV A;  4L9P A;  1ELW A;  2DIW A;  1O1S A;  2R59 A;  2VSO E;  3C5R A;  3SHF A;  4N3B A;  1QQE A;  1E8Y A;  3E34 A;  2XEV A;  4FLH A;  4Y6W A;  3ZHE A;  5BNW A;  5A7D B;  4LNB A;  4IYP A;  3FTX A;  1N4S A;  1JUQ A;  2KC7 A;  4I2W A;  4KZ0 A;  4L2Y A;  4BWR A;  4AM9 A;  3RKV A;  4JPS A;  4GTT A;  3VLE A;  4CDR A;  4GA1 A;  3SFY A;  1OCZ E;  3F6Q A;  4G1T A;  3TWR A;  2GRL A;  2L9B A;  3HXF A;  4APF A;  3R7Q A;  2VSX E;  3BUA A;  3RJV A;  4B94 A;  2XCC A;  3QK0 A;  2HYZ A;  3IHY A;  4F6R D;  2C2L A;  3FTU A;  3Q4A B;  1JCS A;  1HE8 A;  3L16 A;  3Q7F A;  4TXR A;  4LEU A;  3B7R L;  4LRZ A;  1HS6 A;  3UM0 A;  1U2V G;  4DX5 D;  3NB2 A;  1OUV A;  3CSF A;  1IKN D;  4GZD A;  4LER A;  3ZUV B;  1HX8 A;  5FJY A;  1OWP A;  2DZO A;  2FF4 A;  5H7P A;  1H6K A;  3B7B A;  4B93 B;  4MRU A;  3MGB A;  2X3M A;  2NYJ A;  3TL5 A;  5ARG A;  3JQ0 A;  3L17 A;  4O60 A;  1HG5 A;  3AAA C;  2CFU A;  2PQN A;  4BEP A;  3IHV A;  4IN3 B;  3FUI A;  4ZFH A;  4OAV B;  3ULE G;  3ESK A;  1IYG A;  4UI9 J;  5IY5 E;  1JCQ A;  4FJY A;  1RW2 A;  4LNU D;  1N52 A;  4ATG A;  3SQV A;  3PUJ A;  1ELK A;  3ISM C;  4UI9 C;  3WG7 E;  3UPV A; 
#chains in the Genus database with same CATH homology
 5EDS A;  3LYA A;  3LXU X;  4A1G A;  3ZPJ A;  2DBA A;  4BX8 A;  3TG4 A;  4R7L A;  2WQ7 A;  4V3I A;  3EIQ C;  2BUG A;  4N3A A;  1ELR A;  2J49 A;  2AW6 A;  2XPY A;  4CCA A;  4AP2 A;  4L2L A;  2HR2 A;  2I6H A;  3SD5 A;  3FHE A;  3ONL A;  4GZ3 A;  2FUL A;  4J8S A;  3HHM A;  3SBT B;  1EPU A;  2VYI A;  3PE4 A;  4HFG A;  4JW1 A;  4MS6 A;  3ZFW A;  2YHC A;  3EHN A;  2WXM A;  3B7U X;  3SF4 A;  3FUD A;  4CDM A;  1HF8 A;  2LNI A;  3LKU A;  4CGW A;  4URK A;  3D9L A;  4HOT A;  3ZRH A;  3CKB A;  3ZN3 A;  4WWP A;  3CQG B;  3I4G A;  5AYW D;  3L13 A;  4H7X A;  4U0S A;  2BTD A;  3PDN A;  3G2W A;  3RU0 A;  5DIZ A;  2NSZ A;  4HS2 A;  5BV1 A;  5D0O D;  3CHO A;  2KZT A;  2NC9 A;  3ONK A;  1OWL A;  4BFR A;  3GZ2 A;  3OXF A;  4TV3 A;  4KT6 B;  1DVP A;  2LO6 A;  4WAF A;  5E76 A;  2J4D A;  3MKQ B;  1EF1 C;  3G2T A;  4WND A;  3HYM B;  5FQ4 A;  4U0Z A;  3RO3 A;  4FAD A;  2I2O A;  4GB9 A;  3CHQ A;  3PEU B;  3ZEF A;  3ZYM A;  3ESL A;  3B13 A;  1A17 A;  3RRM B;  3FH7 A;  3PEV B;  2J08 A;  4UWH A;  3CK9 A;  3SBS A;  2CFZ A;  1KT0 A;  2OVB A;  1U3C A;  1OWN A;  4GU5 A;  4UQX A;  5HQ8 A;  5KJN A;  4KBQ A;  3QKY A;  4L1B A;  2KCV A;  3FUE A;  3MCX A;  3NF1 A;  3IBE A;  4TRQ A;  3VLF A;  1Z3X A;  1NP7 A;  3LCA A;  4U07 A;  2YHE A;  5J90 A;  5FZQ A;  4XX5 A;  4PS8 A;  4F7A A;  1UW4 B;  3HVE A;  4APO A;  4GYO A;  4BT9 A;  3FFL A;  4ILI A;  4KYO B;  5J08 A;  1KLX A;  2A5U A;  3CST A;  1U3D A;  4IUL A;  4OVU A;  2AXZ A;  3Q47 B;  3D9K A;  3QAR A;  1MQS A;  4UWL A;  4XE0 A;  4UWK A;  5EX3 A;  5BW8 C;  1OWO A;  2WXI A;  1PC2 A;  3QWP A;  3U4T A;  1WM5 A;  2VJ8 A;  2VTB A;  3S7F A;  3KEZ A;  4TUU A;  1UN9 A;  4NUR A;  1IQR A;  1UJJ A;  4N3C A;  5A23 A;  1FVH A;  4DPR A;  3CVN A;  3ZHE B;  5EKQ D;  2XRZ A;  4RSY A;  4RG9 A;  4I2Z A;  2LSU A;  3ASD A;  3CIA A;  2WM9 A;  3FUF A;  1E8X A;  2JLB A;  4F1S A;  2OOE A;  3URZ A;  1FVF A;  3PNL B;  2Y4U A;  3TXN A;  4FC8 A;  3EDT B;  4N2S A;  2VGX A;  1E8Z A;  3CK8 A;  2WXL A;  4HOQ A;  1DNP A;  3FUL A;  4BY6 A;  5JJT A;  4L23 A;  3AS8 A;  4B8A A;  4GML A;  4EPZ A;  4AIF A;  4J8D A;  3NQP A;  2YQ8 A;  4RVB A;  4FU3 A;  2YIN A;  4ANX A;  1FCH A;  3CV0 A;  3NZS A;  3CGH A;  1OWM A;  2WXO A;  1H2V C;  5BUZ A;  1H0A A;  5T8I A;  4PUC A;  2I9C A;  2WQ6 A;  2CHX A;  2KAT A;  3FTW A;  4PH4 B;  1XGW A;  1Z6T A;  2C0L A;  4P29 A;  4B8C B;  3CLJ A;  3O48 A;  4A3T A;  3ML8 A;  5CHE E;  4KVM A;  3LJ3 A;  3MA5 A;  4GZC A;  5EX0 A;  2L0I A;  1B89 A;  3PRE A;  2Q7F A;  2V5F A;  2V4L A;  3CK7 A;  3MX3 A;  4XKC A;  5AJL A;  5AIJ A;  3OAW A;  1IQU A;  4XZ4 A;  4CRW A;  4BTA A;  5FQ7 A;  4XKB A;  1VDY A;  3FU0 A;  3FU3 A;  3LDZ A;  5T3R A;  2Y3A A;  3MJW A;  2E0I A;  1H2T C;  2IFU A;  5ENN A;  4I1A A;  5BPP A;  4B89 A;  5ANL A;  3PZD A;  4EZL A;  2M63 A;  3ULQ A;  4E85 A;  1L5J A;  3FUH A;  3LVQ E;  2XPI A;  1UG3 A;  3T5X A;  2YNQ A;  3QDN A;  3APC A;  4O6F A;  3LEW A;  2ILR A;  3FUK A;  3QWV A;  3NZU A;  2QFC A;  4PDX A;  4I1M A;  4EBA G;  3FTY A;  2LAH A;  1HU3 A;  3QWW A;  3S7D A;  5DBK A;  3QAQ A;  3S7B A;  4CT0 A;  5KJK A;  2PZI A;  4N5C A;  1TJF A;  4U63 A;  2E2E A;  2GRM A;  2VGY A;  3CVL A;  4H7Y A;  2EQX A;  2R5S A;  4XI9 A;  5G05 J;  2X6I A;  3ZYQ A;  2WXJ A;  3JQ1 A;  3RIB A;  3G2U A;  5JHA A;  1PAQ A;  3N71 A;  3JUI A;  3D9N A;  1UJK A;  2NXP A;  4FA6 A;  5AEN A;  4YVQ C;  3PUK A;  1JPL A;  4ANV A;  5LCW J;  4UI9 K;  4UQY A;  3WXX A;  5G05 C;  3L6A A;  4D10 C;  2PL2 A;  2ION A;  3IV0 A;  4JHJ A;  3L08 A;  2AXV A;  3QC1 A;  3VLD A;  2R17 C;  2UY1 A;  4WNE A;  3L22 A;  3LY8 A;  4MLP A;  4I9E A;  1SQM A;  4AY6 A;  2WMO A;  4E6H A;  3PS6 A;  5LCW C;  2J9Q A;  4CEM A;  4HOU A;  4WNF A;  2WXH A;  2IF4 A;  4WNG A;  3T8M A;  2PM7 A;  4A1S A;  4A55 A;  4EEC A;  1TEZ A;  2A4Z A;  5T4Y A;  1NA0 A;  4ACK A;  3T5V A;  2IQC A;  5FTP A;  3O4Z A;  4C9B B;  5KJM A;  2XPZ A;  3MZL B;  3AU4 A;  4G24 A;  3FH5 A;  2XGO A;  2WXN A;  4WUY A;  2AXU A;  3VTX A;  4ACL A;  3ZYL A;  2WXR A;  3CVP A;  4BX9 A;  3CHR A;  3UT7 A;  5LX8 A;  3FTS A;  3PVL A;  3ASH A;  3BG0 B;  1HO8 A;  4GA0 A;  2DCP A;  1SZA A;  3QB2 A;  3UT4 A;  3I3N A;  5CCL A;  3EJN A;  4C0E A;  4M3O A;  2WXK A;  3P2B A;  2FI7 A;  3S2A A;  4HVB A;  4L7T A;  5A6C A;  5FZR A;  2X6H A;  5JJ6 A;  1TJC A;  2OVF A;  3P1U A;  2RD0 A;  4RG6 A;  4I9C A;  2IJG X;  1GW6 A;  2OV8 A;  3ZVV A;  3PE3 A;  4CDN A;  2WXQ A;  5FWQ A;  2CHW A;  4G26 A;  3APF A;  2V8S E;  3HDX A;  4DI4 A;  4XI0 A;  1H2U A;  3QOU A;  4I6E A;  4FLB A;  4YVO A;  3D3M A;  1UN8 A;  4ILG A;  4JZY A;  1X5B A;  2KZT B;  2XQ0 A;  3LY7 A;  4GZ5 A;  3CHS A;  1E8W A;  3EHM A;  4J8F A;  3GW4 A;  4W9R A;  1E7V A;  4EBA A;  4GZ6 A;  3KAE A;  3JCK C;  2KCK A;  1HXI A;  4EZK A;  4N39 A;  4KZC A;  4AJW A;  4F53 A;  4UWG A;  4DJA A;  4Y6C A;  1NZN A;  3ZIM A;  2IU1 A;  2WXG A;  2XHE A;  3LS8 A;  3CVX A;  3D9P A;  5C1D A;  3AS5 A;  4JA7 A;  3LY9 A;  1LF8 A;  5ARF A;  1Y6I A;  4BSX A;  4JEH A;  3ZXS A;  3UX4 A;  3FH8 A;  4GYW A;  4GAA A;  1JWF A;  4G23 A;  1SZ9 A;  4FHK A;  3CVU A;  2LSV A;  1EDU A;  2X6F A;  4Q94 A;  3TAX A;  5FQ6 A;  4N2Q A;  2JEK A;  3B7S A;  3ML9 A;  1Y8M A;  3TG5 A;  3PNT B;  2AWI A;  3DPD A;  2AVP A;  4AY5 A;  2HM8 A;  4HOS A;  2I1J A;  3D9O A;  3MV2 B;  3HVE B;  3MKQ A;  3FTZ A;  3MV3 B;  3SGH A;  2C0M A;  3KD7 A;  5BT1 A;  4BT8 A;  4XIF A;  1Z3Y A;  4G2V A;  3CVW A;  3ZW3 A;  4OVV A;  4NQ0 A;  5CMY A;  4UQZ A;  4DK5 A;  2ZU6 B;  3RK6 A;  4U0U A;  2WB2 A;  4GCN A;  1S0P A;  3UT8 A;  3G2S A;  3R7R A;  2WVI A;  4KMO A;  3FUM A;  1ZU2 A;  4WWO A;  5G2N A;  2VTB B;  2Y4T A;  5JHB A;  2X6K A;  2KCL A;  2UWJ G;  3Q15 A;  1INZ A;  4CT4 A;  2IOL A;  3FWV A;  2CG2 A;  1WY6 A;  3OXG A;  4CGV A;  3GYZ A;  4JEU A;  1E7U A;  1ELW A;  4JVS A;  2FBN A;  4AXH A;  2DIW A;  4KVO A;  3IKO B;  4BTB A;  2CG3 A;  2KM4 A;  3CKC A;  4PS3 A;  1EYH A;  2HO1 A;  2XGM A;  2R59 A;  3FP3 A;  5AJD A;  2VGX B;  2VSO E;  3SHF A;  5C2Y A;  4YND A;  4GMJ A;  4PS7 A;  5LFA A;  3U66 A;  4N3B A;  4I17 A;  2OND A;  3CHM A;  3Q49 B;  5D0Q D;  1QQE A;  2GGF A;  1PY1 A;  2P58 C;  3QJZ A;  1E8Y A;  4AVX A;  4DLQ A;  3RRN B;  1KT1 A;  4LCT A;  4OYS A;  4C0M A;  2XEV A;  4FLH A;  4Y6W A;  1BPO A;  3ZHE A;  5G04 J;  4ANW A;  3GZS A;  5BNW A;  3R9A B;  2L0T B;  3Q5M A;  5A7D B;  3UQ3 A;  4KXK B;  4NAC A;  3ZGQ A;  4IYP A;  3FTX A;  1QNF A;  1NA3 A;  1JUQ A;  2WXF A;  4JXT A;  3GZ1 A;  4Q69 A;  2KC7 A;  3JYS A;  3EIJ A;  3KS2 A;  4GPK A;  5G04 C;  4I2W A;  4KZ0 A;  4ME2 A;  3C98 A;  2PM6 A;  1YA0 A;  3LPZ A;  2CHZ A;  5HI7 A;  3U64 A;  3PRZ A;  4IRU A;  4L2Y A;  3BG1 B;  3IEG A;  4AOF A;  1HG2 A;  3FU6 A;  4AEZ C;  4BWR A;  3BEE A;  2FEZ A;  4AM9 A;  3RKV A;  3S7J A;  4JHR A;  5BV0 A;  4JPS A;  4I6G A;  4G11 A;  4JA9 A;  5KJL A;  2XCB A;  3FUN A;  3VLE A;  4CDR A;  3CVY A;  2I1K A;  3B7T A;  4JL0 A;  5FT9 A;  4GA1 A;  3ZYK A;  4ABN A;  4J6I A;  1JWG A;  4FJZ A;  4EZJ A;  4GYY A;  4J8E A;  2XGS A;  4G1T A;  3TXM A;  3UMV A;  3D9J A;  3SI5 A;  2MHK A;  3U3W A;  1XNF A;  2VSN A;  4LUN U;  2GRL A;  3FEX A;  3OXL A;  4MKT A;  2L9B A;  5G55 A;  2WMN A;  2WXP A;  4APF A;  3R7Q A;  2VSX E;  4HOR A;  2RG8 A;  3CEQ A;  3RJV A;  4B94 A;  2XCC A;  3G2V A;  4UWF A;  2MOW A;  1P5Q A;  3QK0 A;  2HYZ A;  3RO2 A;  3IHY A;  4GCO A;  1H19 A;  3FDH A;  2J07 A;  1E96 B;  4JC8 A;  4FUL A;  5M72 A;  2C2L A;  3FTU A;  1W3B A;  3MEK A;  3Q4A B;  3LVR E;  3UUX A;  5KCM A;  1HE8 A;  2WQH A;  3L16 A;  4FP7 A;  1QZ2 A;  2MRI A;  2V0P A;  4WWN A;  5LP0 A;  3AS4 A;  3CQC B;  4LEU A;  1ZBP A;  2J09 A;  4AV7 A;  3B7R L;  4JHK A;  2GW1 A;  3FUJ A;  3SFZ A;  3FTV A;  4LRZ A;  1HS6 A;  5ANR A;  1MHQ A;  4B0Z A;  3CHP A;  1HZ4 A;  3RRU A;  4Q96 A;  1HH8 A;  5FQ8 A;  4DI3 A;  1OUV A;  3PH0 C;  3CSF A;  3TGO A;  4GZD A;  4LER A;  4I43 A;  1WAO 1;  3DBS A;  3D9I A;  2PQR A;  3MKR A;  4U04 A;  3AU5 A;  2QY7 A;  1HX8 A;  1N54 A;  4ILH B;  5FJY A;  2UY1 B;  1OWP A;  4DLO A;  2FF4 A;  3D9M A;  1H6K A;  4HXI A;  2IOS A;  2J4B A;  4MRU A;  3MGB A;  3OTN A;  3I4R B;  5CCM A;  4U8H A;  5JJ7 A;  2X3M A;  3ASF A;  2BF0 X;  5E75 A;  5LOZ A;  3TL5 A;  4K0R A;  2WPV A;  3SZ7 A;  5ARG A;  2L6J A;  3JQ0 A;  3L17 A;  3SNX A;  1HG5 A;  2VSY A;  3VTY A;  1HFA A;  2XRY A;  2CFU A;  1IHG A;  3FEY A;  2PQN A;  4NRH B;  3ENE A;  4I6J A;  3U9W A;  3CVQ A;  2VQ2 A;  2LAI A;  3CR3 A;  3TJP A;  3IHV A;  4ANU A;  4IN3 B;  3FUI A;  3MYV A;  3QNK A;  4QFV A;  4A3V A;  3ESK A;  1IYG A;  4UI9 J;  4HLE A;  2FO7 A;  3APD A;  4FHJ A;  4EQF A;  4FJY A;  5FZS A;  3FY4 A;  1N52 A;  2X6J A;  1E90 A;  3HIZ A;  3I5P A;  3L54 A;  4ATG A;  5CMW A;  4I1O B;  3PUJ A;  1ELK A;  4GA2 A;  4K03 A;  3FU5 A;  4F3V A;  3CVV A;  3ASG A;  4UI9 C;  2X38 A;  4G25 A;  4J0U A;  3E4B A;  3K9I A;  3UPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...