1NI1A

Imidazole and cyanophenyl farnesyl transferase inhibitors
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
312
structure length
312
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Discovery of potent imidazole and cyanophenyl containing farnesyltransferase inhibitors with improved oral bioavailability.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 108
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ni1A00
1D8DA 3DSUA 1FT2A 3E34A 3Q7AA 1TNOA 3SFYA 3Q7FA 3EUVA 1NI1A 4MBGA 1S64A 3HXBA 1DCEA 1JCSA 4GTTA 1TNZA 3Q73A 1FPPA 2H6FA 4EHMA 1O5MA 4LNGA 3DRAA 1D8EA 1MZCA 3E32A 1NL4A 2R2LA 4GTRA 1O1TA 2IEJA 1N9AA 3DSVA 1TN7A 1KZPA 1TNUA 1TN6A 1O1SA 1N94A 1O1RA 1JCQA 3KSQA 1X81A 1KZOA 3DPYA 4GTQA 3PZ4A 3PZ2A 1SA5A 3HXCA 2F0YA 3E30A 3HXFA 3EU5A 1N4RA 1TNYA 3Q79A 4YDOA 3Q75A 4GTVA 1JCRA 4GTPA 2ZIRA 4GTSA 1SA4A 4GTOA 3DSWA 4L9PA 1LTXA 2H6GA 4YDEA 3DSXA 4LNBA 3HXEA 3KSLA 2BEDA 3E37A 2ZISA 3SFXA 1LD7A 4GTMA 1LD8A 3C72A 1N4PA 3DSTA 1TN8A 3E33A 1QBQA 3HXDA 3Q78A 2H6IA 1N4QA 3PZ1A 1TNBA 3PZ3A 1FT1A 1S63A 1N4SA 2H6HA 3DSSA 1N95A
chains in the Genus database with same CATH superfamily
2GRMA 5CRUA 2IONA 2F8YA 4U07A 2DZNA 3QJZA 1Z6TA 4TXPA 4I6GA 3PREA 2J08A 4HBDA 2AXVA 2DBAA 3SO8A 1WY6A 3TWRA 4HI9A 1DC2A 2I2OA 1INZA 2VGXB 5AQ7A 3UM1A 4XKBA 2QYJA 3CEQA 3FEXA 1ZB1A 3CV0A 1V54E 4B93B 1D9SA 1JCQA 1DNPA 4U95D 1KZOA 3CVWA 3CSFA 4I1AA 3QAQA 5ANLA 5CBOA 2YINA 4E6HA 1BD8A 3IHVA 4L2YA 2QYUA 4DX5D 1IYGA 1U2VG 3SY2A 2P9PG 5AN8A 3R7QA 4XEIG 5BPPA 3JUIA 3ZW3A 4I1OB 1OWMA 3LCAA 4TUMA 2BEDA 2RG8A 2IO2C 4GTMA 5JJ7A 2L6BA 3C72A 1L5JA 2XRYA 4HOQA 3ONLA 1IQUA 4A3VA 4G26A 5AJDA 3P1UA 4FJYA 3B7BA 2KC7A 3EIQC 3PZDA 3QWWA 1S63A 1JWGA 3B7RL 1UOHA 3MEKA 3OXLA 5EYLA 1PY1A 3DPDA 3BG0B 1EDUA 4CT0A 1FVHA 4IYPA 4UQXA 3SNXA 2UY1B 5FQ6A 1QNFA 2F37A 5B3SE 2KZTB 5EYPF 4HI8A 2R05A 3TWXA 4AVXA 3UMVA 3U3WA 1K1BA 4N3CA 4GZ5A 2WXMA 5D66A 4KBQA 3FUMA 1A5EA 2V4LA 1O1TA 3NF1A 4EBAA 4XZ4A 1OY3D 1NA3A 5CERB 4NIKA 3KSQA 3ZHEA 4EZLA 3ESLA 3FUEA 3HXCA 2F0YA 3O4ZA 4ZFHA 3HXFA 4WNEA 4AOFA 4NURA 5LOZA 3D9KA 3ABLE 2WQ6A 5ARFA 4X8QA 3S7BA 4WWPA 2WM9A 3S7FA 4JW1A 4DLOA 1TEZA 5FQ8A 2LSVA 1KPSB 3EU9A 3GW4A 2ZISA 1HFAA 2WQ7A 3BUAA 3TJPA 1WDYA 1TNBA 4KXKB 3ZFWA 3PUJA 4B0ZA 4ACKA 4ACLA 4UWLA 4YDWA 3LJ3A 4JA7A 1FT2A 3TAXA 4A1SA 5FTPA 3ZPJA 3U9WA 4UI9K 3NZUA 4C9BB 3SFYA 4ANXA 3RO3A 4MBGA 2I1KA 3PH0C 3HDXA 5ENOD 4LSZE 4DX6D 3UT4A 2MOWA 4NACA 3TXMA 1OUVA 1KLXA 4J0UA 1P5QA 1HS6A 1O1SA 2LSUA 4HVBA 3AU4A 3HVEB 4HS2A 5EILA 3OAWA 1MQSA 2P2CP 2WXFA 3PZ4A 1FVFA 3PZ2A 3D9MA 4HOSA 1YYHA 3UM0A 3LVRE 4CEMA 3LY9A 2LXLA 3PE4A 3C3QA 4C0MA 3AU5A 4QFVA 3AG4E 5KCMA 4L23A 3DSWA 5HRYA 2CFUA 4K5CA 1Y6IA 2VYIA 3AG1E 3ESKA 4G8KA 4CYMD 5BT1A 5T8IA 4U04A 1HE8A 4JHJA 4F53A 1IKND 4O1OA 2KCVA 5T4YA 5JJTA 2H6IA 2PZIA 2J4DA 2DYRE 5KJLA 3CVNA 4HFGA 3FUDA 3MKRA 3B7TA 4N5CA 4YVOA 1NZNA 5B1BE 3ZEFA 3FUFA 3CR3A 3QC1A 1AWCB 4K0RA 2XGSA 2OV8A 2R59A 2KBXA 4GA0A 4Y6CA 3DEPA 3DXKG 4ABNA 3FH8A 3V31A 3HHMA 4EQFA 4JA9A 3VLFA 3RSEG 3UI2A 1N0QA 1X81A 4TV3A 1FCHA 2GRNB 1UG3A 4KZCA 4BSZB 2OEVA 3PE3A 3C5RA 4OVUA 2R5SA 4JVSA 4GTOA 3BU8A 1ZU2A 4UUCA 3HXEA 2XPYA 2AW6A 2IOLA 3NZSA 4ZHBA 3ZXSA 3ZN3A 4HLLA 2FO7A 1TN8A 4I9EA 2IU1A 1LF8A 4HXIA 4U8HA 4WWOA 1IHBA 3I3NA 3U66A 4GYOA 2ETCA 1UW4B 2WXNA 4LNUD 2XGOA 3X2QE 1HF8A 4CCAA 4LRZA 2BKKB 1YA0A 2PNNA 3MA5A 4FP7A 4H7XA 2VGEA 3ZUVB 2XGMA 3Q4AB 4G11A 4FADA 2MRIA 3QB2A 4DK5A 3R9AB 1U3CA 1O5MA 3UM3A 5FIOA 2RFAA 3SZ7A 3JCKC 4LERA 1HH8A 3FHEA 2IEJA 1N9AA 3DSVA 2XHEA 3CVUA 3FP3A 2OEWA 1N94A 1U3DA 4O60A 3JUEA 1Q2ZA 4ANUA 3S2AA 3CQGB 3MV2B 1TYQG 4ILHB 3V2XA 2BF0X 2NXPA 5A7DB 5CBNA 2C0MA 4NQ0A 3MKQA 4CDMA 2DCPA 1HU3A 4OAVB 4CDRA 2LXMA 4TXRA 4L9PA 1Z5SC 2X6KA 3UIPC 3QOUA 3DXMG 3P2BA 3PEUB 2QY7A 3PVLA 3IEGA 1IXVA 1DCQA 2X6FA 4J8FA 3FU0A 1WG0A 2JABA 3EJNA 4YNDA 3Q78A 2P9KG 1OWLA 2LO6A 3IKOB 1MYOA 2J9QA 4ILGA 4K5BA 2Y1LE 2DIWA 3FULA 2IY0C 2YNQA 3TWVA 1PC2A 2GW1A 5CCMA 3FUHA 4WNDA 4EPZA 4N2QA 2XZTG 3FH5A 3ZIMA 1H6OA 1E8WA 3APDA 3HXBA 5LCWC 3ASGA 1IHGA 4DI3A 4U8VD 4EHMA 2X6IA 1NL4A 2KCLA 1BPOA 5BV1A 4PS8A 3R7RA 2I6HA 4AY6A 4GB9A 1O1RA 2I9CA 2EIKE 4PDXA 4XI0A 5CRVA 1HXIA 2FI7A 2DWZA 3SGHA 5LCWJ 2GRPB 2E0IA 4N3BA 5KNHD 1OT8A 1JCRA 4FLHA 5BNWA 4JXTA 4HNAD 2VTBA 2J4BA 2VSXE 4LNBA 3Q9NC 5LP0A 5BW8C 4AJWA 3KSLA 3CVQA 3ZYMA 3UKUG 3NOGD 5G05C 5ENRD 1ELRA 3SFXA 4GCNA 4KMOA 2JLBA 1H6KA 3VTXA 3D9OA 1LD8A 3Q49B 5KJNA 4TUUA 1QBQA 4GPKA 3QNKA 3F6QA 2L9BA 3CIAA 5B1AE 4BX9A 5A23A 1PAQA 4A55A 3L6AA 4F7AA 5E76A 3Q47B 3JQ0A 3U4TA 2HE0A 3L16A 4G25A 4HOTA 3ULYA 4JEHA 5G05J 2FF4A 2RD0A 5KWDA 3B7SA 3CK7A 4RG9A 2WXKA 1NA0A 2WXJA 2WXOA 3ZKJA 3MV3B 1D8EA 3MZLB 4AIFA 4A63B 2XCCA 1GW6A 3KAEA 3CGHA 4J8DA 3ASNE 4ANWA 5CECB 2HR2A 3LY7A 1JUQA 1BLXB 3J5QB 2GRRB 1TN6A 4B8AA 3T5VA 4UQYA 3G2TA 1TJCA 4BERA 4J8SA 1IQRA 2FULA 3LVQE 2F8XK 2P58C 4JZYA 1EPUA 3FU5A 3ZHEB 1N4RA 2Y3AA 2EIME 2IO3C 4U7EB 4GAAA 2XEEA 5AARA 3QK0A 5G2NA 1SQMA 3EHRA 1H2TC 4BESA 5JHBA 3W9GA 2J49A 4O6FA 3LJNA 2KCKA 2KZTA 3CHRA 2J07A 4HOUA 1N4QA 3PZ1A 2PQRA 3PZ3A 4ANVA 3PRZA 4DLQA 3T5XA 1N52A 2OCCE 2H6HA 2ILRA 2PM7A 4G8LA 3ZGQA 3I5PA 2CG3A 3RAUA 1Z3YA 5HS0A 4L2LA 4U0UA 3E4BA 3Q7FA 3U64A 4AM9A 3FTYA 3UIOC 4HRNA 3AG2E 4UQZA 2XENA 4GPMA 4WNGA 1VDYA 1S70B 3EDTB 2L0IA 2QZAA 4J6IA 1H19A 5AQAA 3LXUX 4JB8P 3BQOA 4FLBA 4I1MA 4EECA 3FY4A 2P9UG 4RVBA 4MS6A 5G55A 4DJAA 3FUKA 1QQEA 3UUXA 5D0OD 3GZSA 2PQNA 5G04C 4MLPA 2WB2A 3HIZA 3EU5A 4PS7A 3ULQA 4YVQC 3Q79A 1TR4A 5H7PA 2VSNA 4XE0A 4I6JA 4G24A 4L7TA 3AJIA 4KZ0A 2CFZA 3DBSA 4GA2A 2Y69E 2WVIA 4HQDA 3AS4A 2EQXA 3QWPA 2CG2A 1FT1A 3RRNB 3CKBA 5G04J 4M3OA 2JEKA 3CVVA 2FBNA 3L82A 5ENTD 2V4HC 3L22A 4IULA 2YQ8A 3EHNA 4AEZC 2WXQA 3PS6A 4TXQA 3FTUA 3G2SA 3JXIA 2V5FA 4APOA 5CEDB 3L54A 2IOSA 2XEVA 4I9CA 1NI1A 5AQBA 3GZ1A 4W9RA 4GMLA 3V79K 1QZ2A 1TJFA 3Q15A 4GTTA 3ZVVA 3ASDA 4ILIA 1N54A 5EIDA 2ONDA 3DWLG 5FQ4A 5CMWA 4GYYA 4BX8A 4WAFA 2VJ8A 1HX8A 4B8CB 3RU0A 4J8YA 3UPVA 3FH7A 1TN7A 3SI5A 2Q7FA 4OYSA 4M7CA 4TRQA 4XX5A 4BT8A 3CVXA 4CGWA 1SW6A 3CVLA 3TG5A 4BEPA 5AYWD 5EIBE 2BKGA 2J09A 3KEZA 4UWFA 1EF1C 3C3RA 3IXEA 4EBAG 2OOEA 4ATZD 1E8ZA 1HZ4A 3I4GA 4AY5A 4GCOA 1XGWA 2XQ0A 2IQCA 2B6CA 5C2YA 1SZ9A 3SHFA 3FEYA 4KYOB 3QARA 3EHMA 3E33A 3ASFA 3BEEA 2CHZA 1N4SA 2WXGA 4LCTA 4RQIA 4AV7A 2WMOA 1BI8B 3CLJA 4HRMB 4GZCA 3QKYA 2A5UA 3L17A 3Q7AA 1ELKA 3LDZA 4GMJA 3ZNGA 1AP7A 3CKCA 2X6HA 3OTNA 4BTAA 1KT1A 1H0AA 1S64A 5LX8A 1JCSA 2J8SD 4UI9C 2KATA 5JJ6A 2HO1A 2Y0BG 3TWUA 2RKKA 2ETBA 4N3AA 4N5QA 2P9NG 5FZSA 4D10C 1QYMA 3FTZA 1E96B 3UINC 3FDHA 3LPZA 3JXJA 2KXPC 4L1BA 1MHQA 3RIBA 5BXOA 3MYVA 3ZYKA 1TNYA 3S7DA 4CZ2D 4UI9J 4WWNA 2ZIRA 4GTSA 3TL5A 3GZ2A 5E75A 1JPLA 3AG3E 3ENEA 5FWQA 3R9MA 4U0SA 5FINA 4EZKA 2AJAA 3FU3A 4A1GA 3CHSA 3FTXA 2PM6A 3K9IA 3SF4A 3UQ3A 1B89A 5FQ7A 1MX2A 1OCRE 3FTWA 1RZ4A 2GGFA 1UJJA 4I17A 5J90A 3HXDA 3T8MA 3TG4A 4JEUA 2FO1E 4JL0A 2WXLA 3MCXA 4Q69A 1D8DA 2ZXWE 3ZU7B 1YCSB 3ASOE 4HORA 2LAHA 2GRLA 3W9FA 3CHMA 4XIFA 2MHKA 2KM4A 3SBTB 4Z68A 5AIJA 2QFCA 3V30A 5ARGA 3IBEA 3QDNA 5CMYA 4PS3A 1EYHA 1S0PA 2IFUA 5HQ8A 4H7YA 2FEZA 3NOCD 4GTQA 4I2WA 2ZU6B 4HB5A 4FULA 3E30A 3GYZA 4MRUA 3ML8A 4PH4B 4OVVA 4BWRA 4F1SA 3UKRG 2NYJA 3CHPA 5ENNA 3CHQA 3NBNB 1LTXA 2X3MA 3DSXA 3FUNA 1H2UA 3J5PA 1E8YA 5ENPD 4Y6WA 3D9PA 2VTBB 4JC8A 5FT9A 3DSTA 4GMRA 4IRUA 3NB2A 1OWPA 3KEAA 4FU3A 2IF4A 2V8SE 2HYZA 3DSUA 5BUZA 3E34A 3D3MA 2XCBA 1N11A 4DX1A 1TNOA 4JHKA 3ZXPA 4B94A 3CVPA 2VGXA 3FUIA 3VTYA 5EKQD 2ETAA 3SFZA 4CGVA 4R7LA 2YHCA 2ZGGA 4CDNA 5C1DA 1UN9A 4F3VA 5AENA 2A5EA 2R17C 4GTRA 4DX7D 5D2MC 2ZGDA 2LNIA 3KS2A 4I43A 3FWVA 1MX6A 1K1AA 2BTDA 4UWHA 2NC9A 5BV0A 3ISMC 4HLEA 4KT6B 5CHEE 4GZ3A 4RLYA 3JQ1A 5CEAA 3UTMA 1HG5A 5JA4D 5M72A 1BU9A 4JD2G 3B13A 3Q75A 1SA4A 2XEHA 5EX0A 3RRUA 1NFIE 3G2UA 2BUGA 3RRMB 3CSTA 3D9NA 3CK8A 3HG0D 4BSXA 5FZQA 4Q96A 1K3ZD 3O48A 3AS8A 4QQIA 4FA6A 2DZOA 4OAUC 3IHYA 4LG6A 5J08A 4G23A 5ITZF 1X5BA 5AQ9A 5DIZA 3TWQA 2UY1A 3CHOA 3URZA 1W3BA 3FTVA 5D0QD 3EUVA 3VLDA 2UWJG 3LS8A 3L08A 1OCCE 1OWNA 4UWGA 3UX4A 5IY5E 1MZCA 3C98A 4B89A 2LAIA 1OCOE 3FTSA 3BG1B 3I4RB 1ZBPA 5EX3A 2A4ZA 3ABME 4KVOA 4BY6A 2M63A 4LUNU 4E85A 3QWVA 3D9HA 3TWTA 1N0RA 2XZDG 3LKUA 3EIJA 4DPRA 3FU6A 3KD7A 4NRHB 3UT7A 3HYMB 1E7UA 4BT9A 3UM2A 4YDYA 3TWSA 5JHAA 2L6JA 3CVYA 2RFMA 3S7JA 2P9IG 4Q94A 3L9TA 1N4PA 3WXXA 4APFA 1UN8A 2XS8A 1OCZE 1V55E 1N95A 4GZDA 4FHJA 1JWFA 2L0TB 3ONKA 1SZAA 3FFLA 3SQVA 2PL2A 2WXHA 2VGYA 1OWOA 1DCEA 3N71A 1TNZA 2H6FA 4DRXE 3D9LA 4LNGA 5FZRA 4DI4A 3ZYLA 4ATGA 3DEOA 3PUKA 4JHRA 2EILE 2HM8A 5HKPA 3HVEA 3B7UX 3RO2A 4XI9A 4I2ZA 2R02A 1KZPA 1TNUA 4F6RD 4WNFA 5JMND 2WXPA 3DPYA 1H6PA 4J8EA 2AXUA 1BI7B 2C0LA 4GYWA 4G2VA 1OXJA 1G3NB 2H6GA 5CCLA 4O1PA 3TGOA 3HRAA 1E8XA 3UXGA 2VQ2A 3AAAC 3SBSA 5BXUA 3AS5A 3PNTB 3D9IA 3B95A 4UWKA 3SD5A 3WG7E 4CRWA 3G2WA 3NAWA 1K8KG 2XPZA 2EIJE 4EZJA 5LFAA 2B0OE 4WUYA 5T3RA 3MX3A 3LY8A 3OXGA 2AWIA 4C0EA 4AP2A 5AJLA 4HRLA 3Q9UC 4N39A 1MJ0A 4JPSA 5A6CA 4N2SA 2OVFA 4XKCA 2E2EA 1FPPA 3PDNA 2AVPA 3DRAA 3RJVA 4FC8A 4LEUA 2CHWA 2XRZA 5ENQD 5FJYA 2DVWA 4BTBA 2YHEA 4ME2A 3TWWA 5ENSD 4AXHA 3RK6A 4U63A 3G2VA 3NQPA 4RSYA 4P29A 5AAOA 4GZ6A 3ABKE 3RKVA 1SA5A 2WXIA 1SVXA 2WXRA 2GRQB 3LEWA 3OXFA 2V0PA 5KBAA 4I6EA 2EINE 4GTVA 4GTPA 3ULEG 1H2VC 1DVPA 2I1JA 1NP7A 2NSZA 3T8KA 3IV0A 1YMPA 5KNGA 2WPVA 3APCA 3Q5MA 1WAO1 4GU5A 2DYSE 4U96D 2P9LG 3ZYQA 2LUHA 2MYOA 3MJWA 3MKQB 4PUCA 4C48B 3ZRHA 2Y4UA 3TXNA 3C3OA 3JYSA 3LYAA 1E90A 4FJZA 1E7VA 1Y8MA 1RW2A 2IJGX 1MX4A 4FHKA 5ANRA 3FUJA 5EDSA 3PEVB 4U0ZA 3Q73A 4K5AB 3T9KA 2R03A 3VLEA 2XPIA 4J7WA 3MGBA 3E32A 2R2LA 3CQCB 2X6JA 4CT4A 3D9JA 4KVMA 1HO8A 4V3IA 4G1TA 2AXZA 4MKTA 2Y4TA 4BETA 4U8YD 1Z3XA 3EHQA 5EN5D 4GA1A 4DUIA 4DX2A 1A17A 2WQHA 3UT8A 4BFRA 2VSOE 3ML9A 1ELWA 5KJKA 4IN3B 4A3TA 4YDOA 2GROB 4F1PA 1KT0A 2C2LA 1WM5A 5DBKA 3ASHA 4YDEA 4RG6A 2OVBA 3L13A 3CK9A 3E37A 2XS1A 1LD7A 5KJMA 2V5QC 1HG2A 3PNLB 4K03A 2P9SG 2X38A 2CHXA 1UJKA 1XNFA 5HI7A 4URKA 3APFA 2WMNA 3V2OA 2QC9A 2VSYA 3DSSA
chains in the Genus database with same CATH topology
1D8DA 3DSUA 1FT2A 3E34A 3Q7AA 1TNOA 3SFYA 3Q7FA 3EUVA 1NI1A 4MBGA 1S64A 3HXBA 1DCEA 1JCSA 4GTTA 1TNZA 3Q73A 1FPPA 2H6FA 4EHMA 1O5MA 4LNGA 3DRAA 1D8EA 1MZCA 3E32A 1NL4A 2R2LA 4GTRA 1O1TA 2IEJA 1N9AA 3DSVA 1TN7A 1KZPA 1TNUA 1TN6A 1O1SA 1N94A 1O1RA 1JCQA 3KSQA 1X81A 1KZOA 3DPYA 4GTQA 3PZ4A 3PZ2A 1SA5A 3HXCA 2F0YA 3E30A 3HXFA 3EU5A 1N4RA 1TNYA 3Q79A 4YDOA 3Q75A 4GTVA 1JCRA 4GTPA 2ZIRA 4GTSA 1SA4A 4GTOA 3DSWA 4L9PA 1LTXA 2H6GA 4YDEA 3DSXA 4LNBA 3HXEA 3KSLA 2BEDA 3E37A 2ZISA 3SFXA 1LD7A 4GTMA 1LD8A 3C72A 1N4PA 3DSTA 1TN8A 3E33A 1QBQA 3HXDA 3Q78A 2H6IA 1N4QA 3PZ1A 1TNBA 3PZ3A 1FT1A 1S63A 1N4SA 2H6HA 3DSSA 1N95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8D A;  3DSU A;  1FT2 A;  3E34 A;  3Q7A A;  1TNO A;  3SFY A;  3Q7F A;  3EUV A;  1NI1 A;  4MBG A;  1S64 A;  3HXB A;  1DCE A;  1JCS A;  4GTT A;  1TNZ A;  3Q73 A;  1FPP A;  2H6F A;  4EHM A;  1O5M A;  4LNG A;  3DRA A;  1D8E A;  1MZC A;  3E32 A;  1NL4 A;  2R2L A;  4GTR A;  1O1T A;  2IEJ A;  1N9A A;  3DSV A;  1TN7 A;  1KZP A;  1TNU A;  1TN6 A;  1O1S A;  1N94 A;  1O1R A;  1JCQ A;  3KSQ A;  1X81 A;  1KZO A;  3DPY A;  4GTQ A;  3PZ4 A;  3PZ2 A;  1SA5 A;  3HXC A;  2F0Y A;  3E30 A;  3HXF A;  3EU5 A;  1N4R A;  1TNY A;  3Q79 A;  4YDO A;  3Q75 A;  4GTV A;  1JCR A;  4GTP A;  2ZIR A;  4GTS A;  1SA4 A;  4GTO A;  3DSW A;  4L9P A;  1LTX A;  2H6G A;  4YDE A;  3DSX A;  4LNB A;  3HXE A;  3KSL A;  2BED A;  3E37 A;  2ZIS A;  3SFX A;  1LD7 A;  4GTM A;  1LD8 A;  3C72 A;  1N4P A;  3DST A;  1TN8 A;  3E33 A;  1QBQ A;  3HXD A;  3Q78 A;  2H6I A;  1N4Q A;  3PZ1 A;  1TNB A;  3PZ3 A;  1FT1 A;  1S63 A;  1N4S A;  2H6H A;  3DSS A;  1N95 A; 
#chains in the Genus database with same CATH topology
 2GRM A;  5CRU A;  2ION A;  2F8Y A;  4U07 A;  2DZN A;  3QJZ A;  1Z6T A;  4TXP A;  4I6G A;  3PRE A;  2J08 A;  4HBD A;  2AXV A;  2DBA A;  3SO8 A;  1WY6 A;  3TWR A;  4HI9 A;  1DC2 A;  2I2O A;  1INZ A;  2VGX B;  5AQ7 A;  3UM1 A;  4XKB A;  2QYJ A;  3CEQ A;  3FEX A;  1ZB1 A;  3CV0 A;  1V54 E;  4B93 B;  1D9S A;  1JCQ A;  1DNP A;  4U95 D;  1KZO A;  3CVW A;  3CSF A;  4I1A A;  3QAQ A;  5ANL A;  5CBO A;  2YIN A;  4E6H A;  1BD8 A;  3IHV A;  4L2Y A;  2QYU A;  4DX5 D;  1IYG A;  1U2V G;  3SY2 A;  2P9P G;  5AN8 A;  3R7Q A;  4XEI G;  5BPP A;  3JUI A;  3ZW3 A;  4I1O B;  1OWM A;  3LCA A;  4TUM A;  2BED A;  2RG8 A;  2IO2 C;  4GTM A;  5JJ7 A;  2L6B A;  3C72 A;  1L5J A;  2XRY A;  4HOQ A;  3ONL A;  1IQU A;  4A3V A;  4G26 A;  5AJD A;  3P1U A;  4FJY A;  3B7B A;  2KC7 A;  3EIQ C;  3PZD A;  3QWW A;  1S63 A;  1JWG A;  3B7R L;  1UOH A;  3MEK A;  3OXL A;  5EYL A;  1PY1 A;  3DPD A;  3BG0 B;  1EDU A;  4CT0 A;  1FVH A;  4IYP A;  4UQX A;  3SNX A;  2UY1 B;  5FQ6 A;  1QNF A;  2F37 A;  5B3S E;  2KZT B;  5EYP F;  4HI8 A;  2R05 A;  3TWX A;  4AVX A;  3UMV A;  3U3W A;  1K1B A;  4N3C A;  4GZ5 A;  2WXM A;  5D66 A;  4KBQ A;  3FUM A;  1A5E A;  2V4L A;  1O1T A;  3NF1 A;  4EBA A;  4XZ4 A;  1OY3 D;  1NA3 A;  5CER B;  4NIK A;  3KSQ A;  3ZHE A;  4EZL A;  3ESL A;  3FUE A;  3HXC A;  2F0Y A;  3O4Z A;  4ZFH A;  3HXF A;  4WNE A;  4AOF A;  4NUR A;  5LOZ A;  3D9K A;  3ABL E;  2WQ6 A;  5ARF A;  4X8Q A;  3S7B A;  4WWP A;  2WM9 A;  3S7F A;  4JW1 A;  4DLO A;  1TEZ A;  5FQ8 A;  2LSV A;  1KPS B;  3EU9 A;  3GW4 A;  2ZIS A;  1HFA A;  2WQ7 A;  3BUA A;  3TJP A;  1WDY A;  1TNB A;  4KXK B;  3ZFW A;  3PUJ A;  4B0Z A;  4ACK A;  4ACL A;  4UWL A;  4YDW A;  3LJ3 A;  4JA7 A;  1FT2 A;  3TAX A;  4A1S A;  5FTP A;  3ZPJ A;  3U9W A;  4UI9 K;  3NZU A;  4C9B B;  3SFY A;  4ANX A;  3RO3 A;  4MBG A;  2I1K A;  3PH0 C;  3HDX A;  5ENO D;  4LSZ E;  4DX6 D;  3UT4 A;  2MOW A;  4NAC A;  3TXM A;  1OUV A;  1KLX A;  4J0U A;  1P5Q A;  1HS6 A;  1O1S A;  2LSU A;  4HVB A;  3AU4 A;  3HVE B;  4HS2 A;  5EIL A;  3OAW A;  1MQS A;  2P2C P;  2WXF A;  3PZ4 A;  1FVF A;  3PZ2 A;  3D9M A;  4HOS A;  1YYH A;  3UM0 A;  3LVR E;  4CEM A;  3LY9 A;  2LXL A;  3PE4 A;  3C3Q A;  4C0M A;  3AU5 A;  4QFV A;  3AG4 E;  5KCM A;  4L23 A;  3DSW A;  5HRY A;  2CFU A;  4K5C A;  1Y6I A;  2VYI A;  3AG1 E;  3ESK A;  4G8K A;  4CYM D;  5BT1 A;  5T8I A;  4U04 A;  1HE8 A;  4JHJ A;  4F53 A;  1IKN D;  4O1O A;  2KCV A;  5T4Y A;  5JJT A;  2H6I A;  2PZI A;  2J4D A;  2DYR E;  5KJL A;  3CVN A;  4HFG A;  3FUD A;  3MKR A;  3B7T A;  4N5C A;  4YVO A;  1NZN A;  5B1B E;  3ZEF A;  3FUF A;  3CR3 A;  3QC1 A;  1AWC B;  4K0R A;  2XGS A;  2OV8 A;  2R59 A;  2KBX A;  4GA0 A;  4Y6C A;  3DEP A;  3DXK G;  4ABN A;  3FH8 A;  3V31 A;  3HHM A;  4EQF A;  4JA9 A;  3VLF A;  3RSE G;  3UI2 A;  1N0Q A;  1X81 A;  4TV3 A;  1FCH A;  2GRN B;  1UG3 A;  4KZC A;  4BSZ B;  2OEV A;  3PE3 A;  3C5R A;  4OVU A;  2R5S A;  4JVS A;  4GTO A;  3BU8 A;  1ZU2 A;  4UUC A;  3HXE A;  2XPY A;  2AW6 A;  2IOL A;  3NZS A;  4ZHB A;  3ZXS A;  3ZN3 A;  4HLL A;  2FO7 A;  1TN8 A;  4I9E A;  2IU1 A;  1LF8 A;  4HXI A;  4U8H A;  4WWO A;  1IHB A;  3I3N A;  3U66 A;  4GYO A;  2ETC A;  1UW4 B;  2WXN A;  4LNU D;  2XGO A;  3X2Q E;  1HF8 A;  4CCA A;  4LRZ A;  2BKK B;  1YA0 A;  2PNN A;  3MA5 A;  4FP7 A;  4H7X A;  2VGE A;  3ZUV B;  2XGM A;  3Q4A B;  4G11 A;  4FAD A;  2MRI A;  3QB2 A;  4DK5 A;  3R9A B;  1U3C A;  1O5M A;  3UM3 A;  5FIO A;  2RFA A;  3SZ7 A;  3JCK C;  4LER A;  1HH8 A;  3FHE A;  2IEJ A;  1N9A A;  3DSV A;  2XHE A;  3CVU A;  3FP3 A;  2OEW A;  1N94 A;  1U3D A;  4O60 A;  3JUE A;  1Q2Z A;  4ANU A;  3S2A A;  3CQG B;  3MV2 B;  1TYQ G;  4ILH B;  3V2X A;  2BF0 X;  2NXP A;  5A7D B;  5CBN A;  2C0M A;  4NQ0 A;  3MKQ A;  4CDM A;  2DCP A;  1HU3 A;  4OAV B;  4CDR A;  2LXM A;  4TXR A;  4L9P A;  1Z5S C;  2X6K A;  3UIP C;  3QOU A;  3DXM G;  3P2B A;  3PEU B;  2QY7 A;  3PVL A;  3IEG A;  1IXV A;  1DCQ A;  2X6F A;  4J8F A;  3FU0 A;  1WG0 A;  2JAB A;  3EJN A;  4YND A;  3Q78 A;  2P9K G;  1OWL A;  2LO6 A;  3IKO B;  1MYO A;  2J9Q A;  4ILG A;  4K5B A;  2Y1L E;  2DIW A;  3FUL A;  2IY0 C;  2YNQ A;  3TWV A;  1PC2 A;  2GW1 A;  5CCM A;  3FUH A;  4WND A;  4EPZ A;  4N2Q A;  2XZT G;  3FH5 A;  3ZIM A;  1H6O A;  1E8W A;  3APD A;  3HXB A;  5LCW C;  3ASG A;  1IHG A;  4DI3 A;  4U8V D;  4EHM A;  2X6I A;  1NL4 A;  2KCL A;  1BPO A;  5BV1 A;  4PS8 A;  3R7R A;  2I6H A;  4AY6 A;  4GB9 A;  1O1R A;  2I9C A;  2EIK E;  4PDX A;  4XI0 A;  5CRV A;  1HXI A;  2FI7 A;  2DWZ A;  3SGH A;  5LCW J;  2GRP B;  2E0I A;  4N3B A;  5KNH D;  1OT8 A;  1JCR A;  4FLH A;  5BNW A;  4JXT A;  4HNA D;  2VTB A;  2J4B A;  2VSX E;  4LNB A;  3Q9N C;  5LP0 A;  5BW8 C;  4AJW A;  3KSL A;  3CVQ A;  3ZYM A;  3UKU G;  3NOG D;  5G05 C;  5ENR D;  1ELR A;  3SFX A;  4GCN A;  4KMO A;  2JLB A;  1H6K A;  3VTX A;  3D9O A;  1LD8 A;  3Q49 B;  5KJN A;  4TUU A;  1QBQ A;  4GPK A;  3QNK A;  3F6Q A;  2L9B A;  3CIA A;  5B1A E;  4BX9 A;  5A23 A;  1PAQ A;  4A55 A;  3L6A A;  4F7A A;  5E76 A;  3Q47 B;  3JQ0 A;  3U4T A;  2HE0 A;  3L16 A;  4G25 A;  4HOT A;  3ULY A;  4JEH A;  5G05 J;  2FF4 A;  2RD0 A;  5KWD A;  3B7S A;  3CK7 A;  4RG9 A;  2WXK A;  1NA0 A;  2WXJ A;  2WXO A;  3ZKJ A;  3MV3 B;  1D8E A;  3MZL B;  4AIF A;  4A63 B;  2XCC A;  1GW6 A;  3KAE A;  3CGH A;  4J8D A;  3ASN E;  4ANW A;  5CEC B;  2HR2 A;  3LY7 A;  1JUQ A;  1BLX B;  3J5Q B;  2GRR B;  1TN6 A;  4B8A A;  3T5V A;  4UQY A;  3G2T A;  1TJC A;  4BER A;  4J8S A;  1IQR A;  2FUL A;  3LVQ E;  2F8X K;  2P58 C;  4JZY A;  1EPU A;  3FU5 A;  3ZHE B;  1N4R A;  2Y3A A;  2EIM E;  2IO3 C;  4U7E B;  4GAA A;  2XEE A;  5AAR A;  3QK0 A;  5G2N A;  1SQM A;  3EHR A;  1H2T C;  4BES A;  5JHB A;  3W9G A;  2J49 A;  4O6F A;  3LJN A;  2KCK A;  2KZT A;  3CHR A;  2J07 A;  4HOU A;  1N4Q A;  3PZ1 A;  2PQR A;  3PZ3 A;  4ANV A;  3PRZ A;  4DLQ A;  3T5X A;  1N52 A;  2OCC E;  2H6H A;  2ILR A;  2PM7 A;  4G8L A;  3ZGQ A;  3I5P A;  2CG3 A;  3RAU A;  1Z3Y A;  5HS0 A;  4L2L A;  4U0U A;  3E4B A;  3Q7F A;  3U64 A;  4AM9 A;  3FTY A;  3UIO C;  4HRN A;  3AG2 E;  4UQZ A;  2XEN A;  4GPM A;  4WNG A;  1VDY A;  1S70 B;  3EDT B;  2L0I A;  2QZA A;  4J6I A;  1H19 A;  5AQA A;  3LXU X;  4JB8 P;  3BQO A;  4FLB A;  4I1M A;  4EEC A;  3FY4 A;  2P9U G;  4RVB A;  4MS6 A;  5G55 A;  4DJA A;  3FUK A;  1QQE A;  3UUX A;  5D0O D;  3GZS A;  2PQN A;  5G04 C;  4MLP A;  2WB2 A;  3HIZ A;  3EU5 A;  4PS7 A;  3ULQ A;  4YVQ C;  3Q79 A;  1TR4 A;  5H7P A;  2VSN A;  4XE0 A;  4I6J A;  4G24 A;  4L7T A;  3AJI A;  4KZ0 A;  2CFZ A;  3DBS A;  4GA2 A;  2Y69 E;  2WVI A;  4HQD A;  3AS4 A;  2EQX A;  3QWP A;  2CG2 A;  1FT1 A;  3RRN B;  3CKB A;  5G04 J;  4M3O A;  2JEK A;  3CVV A;  2FBN A;  3L82 A;  5ENT D;  2V4H C;  3L22 A;  4IUL A;  2YQ8 A;  3EHN A;  4AEZ C;  2WXQ A;  3PS6 A;  4TXQ A;  3FTU A;  3G2S A;  3JXI A;  2V5F A;  4APO A;  5CED B;  3L54 A;  2IOS A;  2XEV A;  4I9C A;  1NI1 A;  5AQB A;  3GZ1 A;  4W9R A;  4GML A;  3V79 K;  1QZ2 A;  1TJF A;  3Q15 A;  4GTT A;  3ZVV A;  3ASD A;  4ILI A;  1N54 A;  5EID A;  2OND A;  3DWL G;  5FQ4 A;  5CMW A;  4GYY A;  4BX8 A;  4WAF A;  2VJ8 A;  1HX8 A;  4B8C B;  3RU0 A;  4J8Y A;  3UPV A;  3FH7 A;  1TN7 A;  3SI5 A;  2Q7F A;  4OYS A;  4M7C A;  4TRQ A;  4XX5 A;  4BT8 A;  3CVX A;  4CGW A;  1SW6 A;  3CVL A;  3TG5 A;  4BEP A;  5AYW D;  5EIB E;  2BKG A;  2J09 A;  3KEZ A;  4UWF A;  1EF1 C;  3C3R A;  3IXE A;  4EBA G;  2OOE A;  4ATZ D;  1E8Z A;  1HZ4 A;  3I4G A;  4AY5 A;  4GCO A;  1XGW A;  2XQ0 A;  2IQC A;  2B6C A;  5C2Y A;  1SZ9 A;  3SHF A;  3FEY A;  4KYO B;  3QAR A;  3EHM A;  3E33 A;  3ASF A;  3BEE A;  2CHZ A;  1N4S A;  2WXG A;  4LCT A;  4RQI A;  4AV7 A;  2WMO A;  1BI8 B;  3CLJ A;  4HRM B;  4GZC A;  3QKY A;  2A5U A;  3L17 A;  3Q7A A;  1ELK A;  3LDZ A;  4GMJ A;  3ZNG A;  1AP7 A;  3CKC A;  2X6H A;  3OTN A;  4BTA A;  1KT1 A;  1H0A A;  1S64 A;  5LX8 A;  1JCS A;  2J8S D;  4UI9 C;  2KAT A;  5JJ6 A;  2HO1 A;  2Y0B G;  3TWU A;  2RKK A;  2ETB A;  4N3A A;  4N5Q A;  2P9N G;  5FZS A;  4D10 C;  1QYM A;  3FTZ A;  1E96 B;  3UIN C;  3FDH A;  3LPZ A;  3JXJ A;  2KXP C;  4L1B A;  1MHQ A;  3RIB A;  5BXO A;  3MYV A;  3ZYK A;  1TNY A;  3S7D A;  4CZ2 D;  4UI9 J;  4WWN A;  2ZIR A;  4GTS A;  3TL5 A;  3GZ2 A;  5E75 A;  1JPL A;  3AG3 E;  3ENE A;  5FWQ A;  3R9M A;  4U0S A;  5FIN A;  4EZK A;  2AJA A;  3FU3 A;  4A1G A;  3CHS A;  3FTX A;  2PM6 A;  3K9I A;  3SF4 A;  3UQ3 A;  1B89 A;  5FQ7 A;  1MX2 A;  1OCR E;  3FTW A;  1RZ4 A;  2GGF A;  1UJJ A;  4I17 A;  5J90 A;  3HXD A;  3T8M A;  3TG4 A;  4JEU A;  2FO1 E;  4JL0 A;  2WXL A;  3MCX A;  4Q69 A;  1D8D A;  2ZXW E;  3ZU7 B;  1YCS B;  3ASO E;  4HOR A;  2LAH A;  2GRL A;  3W9F A;  3CHM A;  4XIF A;  2MHK A;  2KM4 A;  3SBT B;  4Z68 A;  5AIJ A;  2QFC A;  3V30 A;  5ARG A;  3IBE A;  3QDN A;  5CMY A;  4PS3 A;  1EYH A;  1S0P A;  2IFU A;  5HQ8 A;  4H7Y A;  2FEZ A;  3NOC D;  4GTQ A;  4I2W A;  2ZU6 B;  4HB5 A;  4FUL A;  3E30 A;  3GYZ A;  4MRU A;  3ML8 A;  4PH4 B;  4OVV A;  4BWR A;  4F1S A;  3UKR G;  2NYJ A;  3CHP A;  5ENN A;  3CHQ A;  3NBN B;  1LTX A;  2X3M A;  3DSX A;  3FUN A;  1H2U A;  3J5P A;  1E8Y A;  5ENP D;  4Y6W A;  3D9P A;  2VTB B;  4JC8 A;  5FT9 A;  3DST A;  4GMR A;  4IRU A;  3NB2 A;  1OWP A;  3KEA A;  4FU3 A;  2IF4 A;  2V8S E;  2HYZ A;  3DSU A;  5BUZ A;  3E34 A;  3D3M A;  2XCB A;  1N11 A;  4DX1 A;  1TNO A;  4JHK A;  3ZXP A;  4B94 A;  3CVP A;  2VGX A;  3FUI A;  3VTY A;  5EKQ D;  2ETA A;  3SFZ A;  4CGV A;  4R7L A;  2YHC A;  2ZGG A;  4CDN A;  5C1D A;  1UN9 A;  4F3V A;  5AEN A;  2A5E A;  2R17 C;  4GTR A;  4DX7 D;  5D2M C;  2ZGD A;  2LNI A;  3KS2 A;  4I43 A;  3FWV A;  1MX6 A;  1K1A A;  2BTD A;  4UWH A;  2NC9 A;  5BV0 A;  3ISM C;  4HLE A;  4KT6 B;  5CHE E;  4GZ3 A;  4RLY A;  3JQ1 A;  5CEA A;  3UTM A;  1HG5 A;  5JA4 D;  5M72 A;  1BU9 A;  4JD2 G;  3B13 A;  3Q75 A;  1SA4 A;  2XEH A;  5EX0 A;  3RRU A;  1NFI E;  3G2U A;  2BUG A;  3RRM B;  3CST A;  3D9N A;  3CK8 A;  3HG0 D;  4BSX A;  5FZQ A;  4Q96 A;  1K3Z D;  3O48 A;  3AS8 A;  4QQI A;  4FA6 A;  2DZO A;  4OAU C;  3IHY A;  4LG6 A;  5J08 A;  4G23 A;  5ITZ F;  1X5B A;  5AQ9 A;  5DIZ A;  3TWQ A;  2UY1 A;  3CHO A;  3URZ A;  1W3B A;  3FTV A;  5D0Q D;  3EUV A;  3VLD A;  2UWJ G;  3LS8 A;  3L08 A;  1OCC E;  1OWN A;  4UWG A;  3UX4 A;  5IY5 E;  1MZC A;  3C98 A;  4B89 A;  2LAI A;  1OCO E;  3FTS A;  3BG1 B;  3I4R B;  1ZBP A;  5EX3 A;  2A4Z A;  3ABM E;  4KVO A;  4BY6 A;  2M63 A;  4LUN U;  4E85 A;  3QWV A;  3D9H A;  3TWT A;  1N0R A;  2XZD G;  3LKU A;  3EIJ A;  4DPR A;  3FU6 A;  3KD7 A;  4NRH B;  3UT7 A;  3HYM B;  1E7U A;  4BT9 A;  3UM2 A;  4YDY A;  3TWS A;  5JHA A;  2L6J A;  3CVY A;  2RFM A;  3S7J A;  2P9I G;  4Q94 A;  3L9T A;  1N4P A;  3WXX A;  4APF A;  1UN8 A;  2XS8 A;  1OCZ E;  1V55 E;  1N95 A;  4GZD A;  4FHJ A;  1JWF A;  2L0T B;  3ONK A;  1SZA A;  3FFL A;  3SQV A;  2PL2 A;  2WXH A;  2VGY A;  1OWO A;  1DCE A;  3N71 A;  1TNZ A;  2H6F A;  4DRX E;  3D9L A;  4LNG A;  5FZR A;  4DI4 A;  3ZYL A;  4ATG A;  3DEO A;  3PUK A;  4JHR A;  2EIL E;  2HM8 A;  5HKP A;  3HVE A;  3B7U X;  3RO2 A;  4XI9 A;  4I2Z A;  2R02 A;  1KZP A;  1TNU A;  4F6R D;  4WNF A;  5JMN D;  2WXP A;  3DPY A;  1H6P A;  4J8E A;  2AXU A;  1BI7 B;  2C0L A;  4GYW A;  4G2V A;  1OXJ A;  1G3N B;  2H6G A;  5CCL A;  4O1P A;  3TGO A;  3HRA A;  1E8X A;  3UXG A;  2VQ2 A;  3AAA C;  3SBS A;  5BXU A;  3AS5 A;  3PNT B;  3D9I A;  3B95 A;  4UWK A;  3SD5 A;  3WG7 E;  4CRW A;  3G2W A;  3NAW A;  1K8K G;  2XPZ A;  2EIJ E;  4EZJ A;  5LFA A;  2B0O E;  4WUY A;  5T3R A;  3MX3 A;  3LY8 A;  3OXG A;  2AWI A;  4C0E A;  4AP2 A;  5AJL A;  4HRL A;  3Q9U C;  4N39 A;  1MJ0 A;  4JPS A;  5A6C A;  4N2S A;  2OVF A;  4XKC A;  2E2E A;  1FPP A;  3PDN A;  2AVP A;  3DRA A;  3RJV A;  4FC8 A;  4LEU A;  2CHW A;  2XRZ A;  5ENQ D;  5FJY A;  2DVW A;  4BTB A;  2YHE A;  4ME2 A;  3TWW A;  5ENS D;  4AXH A;  3RK6 A;  4U63 A;  3G2V A;  3NQP A;  4RSY A;  4P29 A;  5AAO A;  4GZ6 A;  3ABK E;  3RKV A;  1SA5 A;  2WXI A;  1SVX A;  2WXR A;  2GRQ B;  3LEW A;  3OXF A;  2V0P A;  5KBA A;  4I6E A;  2EIN E;  4GTV A;  4GTP A;  3ULE G;  1H2V C;  1DVP A;  2I1J A;  1NP7 A;  2NSZ A;  3T8K A;  3IV0 A;  1YMP A;  5KNG A;  2WPV A;  3APC A;  3Q5M A;  1WAO 1;  4GU5 A;  2DYS E;  4U96 D;  2P9L G;  3ZYQ A;  2LUH A;  2MYO A;  3MJW A;  3MKQ B;  4PUC A;  4C48 B;  3ZRH A;  2Y4U A;  3TXN A;  3C3O A;  3JYS A;  3LYA A;  1E90 A;  4FJZ A;  1E7V A;  1Y8M A;  1RW2 A;  2IJG X;  1MX4 A;  4FHK A;  5ANR A;  3FUJ A;  5EDS A;  3PEV B;  4U0Z A;  3Q73 A;  4K5A B;  3T9K A;  2R03 A;  3VLE A;  2XPI A;  4J7W A;  3MGB A;  3E32 A;  2R2L A;  3CQC B;  2X6J A;  4CT4 A;  3D9J A;  4KVM A;  1HO8 A;  4V3I A;  4G1T A;  2AXZ A;  4MKT A;  2Y4T A;  4BET A;  4U8Y D;  1Z3X A;  3EHQ A;  5EN5 D;  4GA1 A;  4DUI A;  4DX2 A;  1A17 A;  2WQH A;  3UT8 A;  4BFR A;  2VSO E;  3ML9 A;  1ELW A;  5KJK A;  4IN3 B;  4A3T A;  4YDO A;  2GRO B;  4F1P A;  1KT0 A;  2C2L A;  1WM5 A;  5DBK A;  3ASH A;  4YDE A;  4RG6 A;  2OVB A;  3L13 A;  3CK9 A;  3E37 A;  2XS1 A;  1LD7 A;  5KJM A;  2V5Q C;  1HG2 A;  3PNL B;  4K03 A;  2P9S G;  2X38 A;  2CHX A;  1UJK A;  1XNF A;  5HI7 A;  4URK A;  3APF A;  2WMN A;  3V2O A;  2QC9 A;  2VSY A;  3DSS A; 
#chains in the Genus database with same CATH homology
 1D8D A;  3DSU A;  1FT2 A;  3E34 A;  3Q7A A;  1TNO A;  3SFY A;  3Q7F A;  3EUV A;  1NI1 A;  4MBG A;  1S64 A;  3HXB A;  1DCE A;  1JCS A;  4GTT A;  1TNZ A;  3Q73 A;  1FPP A;  2H6F A;  4EHM A;  1O5M A;  4LNG A;  3DRA A;  1D8E A;  1MZC A;  3E32 A;  1NL4 A;  2R2L A;  4GTR A;  1O1T A;  2IEJ A;  1N9A A;  3DSV A;  1TN7 A;  1KZP A;  1TNU A;  1TN6 A;  1O1S A;  1N94 A;  1O1R A;  1JCQ A;  3KSQ A;  1X81 A;  1KZO A;  3DPY A;  4GTQ A;  3PZ4 A;  3PZ2 A;  1SA5 A;  3HXC A;  2F0Y A;  3E30 A;  3HXF A;  3EU5 A;  1N4R A;  1TNY A;  3Q79 A;  4YDO A;  3Q75 A;  4GTV A;  1JCR A;  4GTP A;  2ZIR A;  4GTS A;  1SA4 A;  4GTO A;  3DSW A;  4L9P A;  1LTX A;  2H6G A;  4YDE A;  3DSX A;  4LNB A;  3HXE A;  3KSL A;  2BED A;  3E37 A;  2ZIS A;  3SFX A;  1LD7 A;  4GTM A;  1LD8 A;  3C72 A;  1N4P A;  3DST A;  1TN8 A;  3E33 A;  1QBQ A;  3HXD A;  3Q78 A;  2H6I A;  1N4Q A;  3PZ1 A;  1TNB A;  3PZ3 A;  1FT1 A;  1S63 A;  1N4S A;  2H6H A;  3DSS A;  1N95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...