1NI1A

Imidazole and cyanophenyl farnesyl transferase inhibitors
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Discovery of potent imidazole and cyanophenyl containing farnesyltransferase inhibitors with improved oral bioavailability.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 108
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ni1A00
3HXBA 1SA4A 1TN8A 1LD8A 1TNUA 3Q73A 2IEJA 1FPPA 2ZISA 3DRAA 3DSTA 3E32A 4LNGA 1LD7A 3KSLA 2R2LA 4GTOA 1SA5A 1MZCA 4EHMA 3HXCA 4GTSA 1S64A 2H6FA 4GTTA 3DSUA 3PZ1A 1D8DA 4GTVA 1N94A 3DSVA 1N9AA 3Q79A 1JCQA 1O1SA 1TNOA 1X81A 4MBGA 3EUVA 3HXFA 4GTQA 3SFXA 4GTPA 1FT1A 2F0YA 1NI1A 3PZ4A 1TNBA 3E30A 4GTRA 1KZPA 1TNZA 3C72A 1O5MA 1N4PA 3Q7FA 1DCEA 3Q78A 3HXEA 3HXDA 1NL4A 4YDEA 1N4SA 3E37A 1TN6A 4GTMA 1JCRA 3KSQA 1D8EA 3DSWA 3PZ2A 3DSSA 3SFYA 1KZOA 4L9PA 4YDOA 3E33A 3DSXA 3PZ3A 2H6GA 3Q7AA 3EU5A 2H6IA 1O1TA 1N4RA 2BEDA 2H6HA 1N95A 1JCSA 1S63A 1LTXA 3E34A 1O1RA 1TNYA 1QBQA 1N4QA 2ZIRA 1FT2A 3DPYA 4LNBA 3Q75A 1TN7A
chains in the Genus database with same CATH superfamily
3T5VA 1TN8A 3QB2A 4BX9A 3LCAA 4AP2A 4YVOA 2DCPA 4V3IA 3UM1A 3SNXA 3ZXPA 4ATGA 4WWPA 2JABA 2B0OE 2X3MA 3UQ3A 4WNEA 4XX5A 5D0QD 3K9IA 3CK8A 1PC2A 2XPZA 1UN9A 3ZRHA 3UIPC 3BG0B 4MBGA 3FHEA 2YINA 3JQ1A 4TXQA 3U3WA 5BUZA 4JL0A 1HXIA 5JJ6A 5AJLA 3QDNA 4GTRA 2VYIA 1KZPA 4J0UA 3DWLG 1ZBPA 3NZUA 3ABKE 1UW4B 3ABME 4PS8A 3OAWA 3APFA 3MYVA 2FULA 5C2YA 2Y69E 1S0PA 1Y8MA 4AXHA 4PS3A 2WXKA 3CVUA 3PZ3A 3L6AA 3EJNA 3CK7A 2H6HA 2BEDA 4BSXA 3ASOE 2KBXA 3LDZA 5JMND 4UWKA 2V5FA 2IF4A 2FI7A 3FU5A 3OXLA 1QBQA 2L9BA 5EN5D 3NOGD 1QZ2A 3S7FA 5M72A 2X38A 1H2UA 3LY7A 2WXHA 2J08A 2OVFA 1K8KG 1KLXA 2QFCA 1K1BA 3HXCA 4G1TA 4BETA 2CFUA 3NQPA 1S64A 4DI3A 2VJ8A 4XIFA 3DSVA 5LP0A 1OWOA 3RO3A 4M7CA 1TNOA 1X81A 1YA0A 3APCA 3IKOB 5KCMA 4BY6A 3VTXA 1NI1A 2AXZA 2PM7A 3CHMA 2R02A 5ENOD 3DXMG 4UQXA 4YDWA 3MEKA 3JYSA 5BXUA 1Z5SC 2EIJE 4U04A 4B89A 3Q7FA 3SGHA 2J49A 2HE0A 3VLDA 3RKVA 4HRNA 1TJCA 2UY1A 4L23A 4YDEA 3WXXA 3CKBA 2IONA 4DPRA 1D8EA 1JUQA 5LCWJ 4OYSA 4GYWA 4I1MA 4ANXA 3DSXA 3FH7A 5T4YA 3EIQC 4CEMA 4MRUA 4HRMB 3E34A 3GZ2A 4RQIA 5KBAA 4U8YD 4DRXE 1IKND 5KNGA 2J4BA 2CHXA 3ASNE 3X2QE 3UUXA 4NIKA 3D3MA 2KM4A 3L9TA 3LY9A 3DSTA 2IO3C 4GTOA 2JLBA 2DYSE 4HLEA 2AW6A 3QWWA 4I1AA 2BKGA 4L7TA 5G05J 1OCCE 3FFLA 3TXMA 4HNAD 2GRRB 3DXKG 3G2TA 3D9HA 3ZHEB 3JCKC 3UTMA 1HG2A 4WNGA 2RKKA 4MKTA 4DK5A 2R17C 3UKUG 2GROB 1AP7A 2UY1B 1TNZA 4TV3A 3RU0A 5EYLA 1LF8A 4N3BA 1KPSB 2VGEA 3R9AB 3Q47B 4CDRA 3UPVA 5LX8A 2QYUA 3CVVA 4KMOA 3UT4A 4GPMA 4J8YA 3ASDA 3V30A 3CSFA 3E33A 4WNDA 3CVXA 2VSYA 4LERA 3RO2A 2WXFA 3S7BA 3TWRA 1E8YA 2VSXE 3ZYKA 2J8SD 1S63A 1ZB1A 3RSEG 2V4HC 3U9WA 5BW8C 3Q9NC 1IHBA 4U8VD 4GA1A 2P9LG 3SO8A 3Q5MA 3PNTB 3I5PA 1PAQA 1YMPA 3FY4A 3ML9A 2FO1E 4N3AA 4PS7A 1H6PA 5ARFA 2GRNB 3ISMC 2I9CA 3S2AA 1A17A 5C1DA 5CEAA 3R9MA 2HYZA 3BEEA 1N94A 4FC8A 4K5CA 2OEVA 1U3CA 4AVXA 4GPKA 1JWFA 3EIJA 3UM2A 2DWZA 5EILA 4E6HA 4DX7D 2L0TB 3FWVA 3FUKA 4BEPA 4FP7A 1INZA 3CVLA 5KJLA 4JEHA 3ASGA 5CCMA 3N71A 3SBSA 5KJKA 3FUDA 3ASFA 1KT1A 2ZU6B 3G2UA 2L6JA 4CT0A 4HQDA 1QYMA 3UM3A 2IJGX 4AIFA 4TXPA 2PM6A 4KBQA 3CHSA 2OV8A 4AEZC 3HIZA 4N5CA 2F8YA 3KEZA 4EZKA 4RLYA 4OAUC 1N4QA 4APOA 3DPYA 2XENA 4UWHA 4I2ZA 4K0RA 5EKQD 3B7RL 5EDSA 2AJAA 4EBAG 3J5QB 1FPPA 4LG6A 3CVYA 2R2LA 4G23A 4G8LA 5HI7A 2HR2A 4EQFA 2WPVA 4J8SA 1P5QA 2XCCA 2C0LA 2WQHA 4FA6A 3V2OA 4BFRA 4NURA 1E8ZA 3IV0A 1JPLA 4KZ0A 2DBAA 4LRZA 2F0YA 4HOQA 3FUEA 4J8DA 3LJ3A 3PEUB 4BT9A 5D0OD 1N4PA 2WXOA 3L13A 4CCAA 1YCSB 3T9KA 3HXEA 3J5PA 1NP7A 1NL4A 3E37A 1UJJA 3ABLE 3HRAA 1JCRA 2E2EA 1G3NB 4FHJA 5AN8A 5ENPD 3BG1B 1H2VC 4BTBA 2ONDA 2VTBB 3FUIA 5CHEE 4KXKB 4MLPA 2Q7FA 5LFAA 5CERB 1O1TA 4K03A 3ULQA 4JVSA 3D9NA 3L22A 2QZAA 3FTZA 2FO7A 3MKRA 3PUKA 2I1JA 4ILIA 5EIBE 3RRUA 2P9UG 4IN3B 1WY6A 3CEQA 3BUAA 3MKQB 4DJAA 2WXPA 2ZGGA 3QC1A 1IXVA 4WWOA 4DLQA 1N54A 4QQIA 2QYJA 2OCCE 4HLLA 4HS2A 4RVBA 4JB8P 4AOFA 4Y6WA 3CQCB 3HDXA 5KJNA 2J4DA 1D8DA 4J8FA 3FUHA 3D9PA 3O4ZA 5AYWD 3CVPA 5J08A 1OCOE 5ENQD 3Q79A 4HXIA 1OY3D 2MRIA 3HXFA 3AU5A 5JJTA 3CHOA 4NACA 3TAXA 5HRYA 4FJZA 5FTPA 2X6FA 5A23A 3APDA 4K5AB 2MYOA 4LEUA 3RJVA 3ZYLA 3IEGA 4EBAA 3ZYQA 3CGHA 3SFZA 1SQMA 5E76A 4GZDA 4B93B 2A5EA 3KS2A 1XGWA 1L5JA 1NA3A 3SBTB 4RSYA 1W3BA 2P9IG 1MYOA 5DIZA 1JCSA 1X5BA 2WXQA 3QK0A 3VLFA 1XNFA 5CBOA 1QQEA 4JEUA 4LNBA 5CMWA 4A3TA 2WXRA 4NRHB 3HXBA 2QC9A 2IEJA 1SZ9A 5ITZF 3T5XA 2X6KA 2KZTB 3DRAA 4LNGA 4XI9A 3WG7E 1MZCA 3MJWA 4CT4A 3S7JA 1ELKA 3FUJA 3TG4A 1A5EA 5FZQA 4B8CB 1N9AA 4PH4B 4XKCA 1HF8A 3SF4A 4LNUD 3R7RA 5CRVA 3EU9A 4GTQA 3P1UA 4F6RD 3HVEB 2RFMA 1YYHA 4WUYA 4DI4A 1OWMA 4Q69A 3ZW3A 1SW6A 4A1GA 4XEIG 3ZKJA 4EZLA 2DZNA 5ENTD 3DEOA 4UWFA 3HHMA 5KJMA 2ILRA 4RG6A 1SVXA 4A3VA 3KSQA 1OUVA 1DNPA 3ZHEA 1WDYA 3PZ2A 3MX3A 4LCTA 3UI2A 2GRMA 2DYRE 3MV3B 5BT1A 1WM5A 4GCNA 4HVBA 2XCBA 1N4RA 3ESKA 3QAQA 3LEWA 4C48B 5ANLA 2WXNA 3CHPA 3L08A 5BXOA 1U2VG 4UWGA 4HOSA 4YVQC 1N0QA 3UX4A 1JWGA 5FJYA 2L0IA 2XZDG 4ABNA 2Y0BG 3SD5A 4JZYA 4J7WA 2AXUA 4D10C 3TXNA 2XRYA 1GW6A 3QNKA 5EIDA 3DBSA 2VSOE 2X6HA 1E7UA 1IQRA 3AG2E 5FWQA 2XHEA 4GTVA 1TEZA 2ZGDA 3AS4A 2PQNA 5AQ7A 2LNIA 3B7BA 2P9NG 2RG8A 2R03A 2WXLA 1EPUA 4K5BA 3PE4A 4EPZA 2FBNA 5AENA 5CCLA 3ZYMA 5BV1A 3Q15A 1IYGA 1DVPA 1E8WA 3ONLA 4JPSA 4BSZB 4BESA 1E90A 4ANVA 3AG3E 1NZNA 3C3OA 4ANWA 3UT7A 2V5QC 5G2NA 3TL5A 1V55E 3PH0C 3HG0D 4G24A 2H6IA 4GA2A 3SHFA 5KWDA 3PVLA 1O1RA 3ZXSA 1FT2A 4WWNA 4LSZE 3PREA 1FCHA 2KXPC 4M3OA 1LD8A 1HE8A 2M63A 4JXTA 4UUCA 2VGXA 3ZIMA 3G2SA 5CBNA 4OVVA 1HH8A 1B89A 3DSUA 4B94A 3TGOA 3Q49B 3OTNA 4I1OB 3NBNB 1HX8A 3FUFA 3FULA 2I1KA 5CECB 2XS8A 2IFUA 2Y1LE 3SZ7A 4X8QA 1EF1C 1RW2A 1EDUA 3IHYA 5T8IA 1DCQA 4U0SA 3I3NA 3MGBA 5ARGA 4O1OA 2LUHA 3MV2B 2WXJA 2I2OA 2J9QA 4I43A 3FU6A 2ETBA 5EYPF 2LXMA 2PZIA 4I6JA 3UM0A 4DLOA 5AQAA 2A5UA 2XPYA 4U95D 4KZCA 1BI8B 2VSNA 3FTWA 4GZCA 2PL2A 1V54E 4XKBA 3ONKA 4YDOA 3ZVVA 3IBEA 1SZAA 1BD8A 3TWTA 4LUNU 2WB2A 4YNDA 1N95A 5D66A 3CHRA 5CEDB 2KCVA 1HU3A 2BF0X 2P9SG 5BPPA 2VGXB 2P9PG 4GA0A 4ILHB 4GB9A 3TWXA 1TN7A 2LSUA 2KCLA 5ENNA 1TNUA 3E32A 3GZSA 3PNLB 1SA5A 3D9KA 2VTBA 1H0AA 1BI7B 4F7AA 4XI0A 3EHRA 3IHVA 2RD0A 3PZ1A 3G2VA 3V31A 3FUNA 2X6JA 2EINE 4ACKA 4PDXA 1NA0A 4A1SA 4TRQA 3V2XA 4UI9K 3DEPA 1JCQA 2Y4TA 3TWWA 3OXFA 3P2BA 1Z3YA 2QY7A 4HBDA 3ML8A 2B6CA 4N2QA 3D9JA 4NQ0A 3C3RA 3MKQA 5AQBA 3FEXA 4Q96A 4AV7A 3CK9A 2XEEA 4I6GA 2ETCA 2E0IA 4CDMA 2A4ZA 2HM8A 5FQ7A 1HG5A 5ENSD 4C0EA 4UWLA 4F1SA 2WXGA 1HS6A 4PUCA 4J8EA 3FTVA 4UQZA 2XZTG 3EDTB 2AWIA 2R5SA 1UOHA 3AAAC 3UKRG 1OWLA 3CLJA 3CQGB 2BUGA 2V8SE 1Q2ZA 2FEZA 2XGMA 4BT8A 4L2LA 4E85A 5FIOA 3TWSA 1MX6A 3TWVA 5T3RA 2ZIRA 5BV0A 2LAHA 5LOZA 3QJZA 4H7YA 4CRWA 5FZSA 5G55A 2FF4A 3UMVA 3ZFWA 4G26A 4OAVB 1HZ4A 4KVOA 4ZFHA 5J90A 3QWPA 4JC8A 2WMNA 2XRZA 2XPIA 1MQSA 4EHMA 3LJNA 3EHNA 4GTSA 4ATZD 5A7DB 3ENEA 1WAO1 1E7VA 1UN8A 2I6HA 3B7SA 4O1PA 3JUIA 5AJDA 1MJ0A 3T8MA 4J6IA 2AXVA 2V4LA 3JXJA 3JXIA 3ZNGA 1Z3XA 3JUEA 3U66A 5B1BE 4B0ZA 3SQVA 2KZTA 4BERA 1DCEA 3PS6A 3RRMB 3FH8A 3ASHA 1Z6TA 4G8KA 5AAOA 1N4SA 4FULA 3SY2A 4U0ZA 4DX5D 3NF1A 3AS5A 3GZ1A 3DSWA 4O6FA 3OXGA 2OOEA 3HVEA 3AG4E 3Q7AA 3LY8A 3EU5A 2DZOA 2KC7A 5G04C 1OCRE 1LTXA 1E96B 3LYAA 3LPZA 3D9OA 3D9IA 4U0UA 4IYPA 4GYOA 2C2LA 3Q73A 3PEVB 3NB2A 4FLBA 4EECA 1E8XA 3NAWA 2YQ8A 3ZU7B 1DC2A 2R59A 5FQ4A 3C98A 4Z68A 1UG3A 4N39A 4Q94A 2GRLA 5AQ9A 4IRUA 1K1AA 4F53A 3QWVA 3QOUA 4FJYA 2IU1A 3SFXA 3QKYA 3LVQE 1FT1A 3I4GA 3LS8A 3B95A 3LVRE 1U3DA 1TNBA 4ZHBA 1MX2A 4MS6A 3C72A 1O5MA 4TUUA 4FADA 4HB5A 3Q78A 3G2WA 4G25A 4FLHA 4A55A 2GW1A 3CIAA 2GRQB 4JD2G 1WG0A 3NZSA 3DSSA 2IO2C 2DIWA 5FQ8A 4L9PA 3CVQA 4GYYA 4CGWA 3EHQA 5FINA 3ZN3A 1N0RA 2IOSA 4N2SA 3TWUA 4U07A 5A6CA 3FP3A 3MZLB 2LXLA 2P9KG 4BX8A 4UI9J 3B7UX 3U64A 3UXGA 2Y3AA 2LO6A 2WVIA 4U63A 1H6KA 2DVWA 3KSLA 4GU5A 3D9MA 3CSTA 4G11A 4TUMA 2MHKA 2CG2A 4RG9A 2H6FA 4GAAA 2JEKA 4I17A 5H7PA 1VDYA 1OWNA 2YHEA 4KT6B 4TXRA 3U4TA 3FH5A 4C9BB 5JJ7A 4U7EB 4GTPA 3W9FA 1HFAA 4U96D 1FVHA 3IXEA 3FTSA 3FTYA 4DX2A 1OT8A 3AU4A 3ULEG 2BTDA 3SI5A 4HOTA 5B1AE 5B3SE 5FZRA 2KATA 3S7DA 3ZGQA 5D2MC 3TG5A 4ME2A 2LAIA 2J07A 2ZXWE 4HORA 4H7XA 3CKCA 1NFIE 4GZ5A 2EIKE 2IOLA 4ILGA 2XEHA 2WQ7A 2H6GA 3Q4AB 3W9GA 2WM9A 1UJKA 3VLEA 3L16A 3I4RB 4UI9C 4GMLA 4CZ2D 4GZ6A 3FU3A 2GRPB 4JA9A 1ZU2A 4I9EA 4KYOB 3C3QA 1SA4A 5BNWA 3TWQA 5E75A 4XZ4A 3FU0A 2VQ2A 5CRUA 2NYJA 2V0PA 4GTTA 1BU9A 2IQCA 4DX1A 1OXJA 4JHJA 1TR4A 3RK6A 3Q9UC 3KEAA 1ELRA 3L54A 4JW1A 2CFZA 3URZA 5LCWC 3F6QA 1H2TC 2CHZA 3PZ4A 3MCXA 3E30A 5FT9A 5FQ6A 2R05A 3KD7A 2EQXA 3UIOC 3ESLA 2P2CP 4HI8A 4EZJA 4G2VA 3JQ0A 3L17A 2GGFA 2OVBA 3DPDA 4N5QA 2NXPA 3LXUX 3GW4A 4XE0A 3C5RA 1TN6A 2UWJG 5HKPA 1KZOA 4GMJA 4L2YA 4BTAA 2XGSA 2F37A 4L1BA 2LSVA 5G05C 3HYMB 3ZEFA 3ULYA 3ZUVB 1HO8A 1TNYA 4F3VA 2CHWA 1RZ4A 1N11A 5CMYA 3RAUA 1IHGA 3QARA 5KNHD 2WQ6A 1QNFA 1K3ZD 1ELWA 2WXMA 3LKUA 3KAEA 4A63B 1Y6IA 4C0MA 1IQUA 4ACLA 2PNNA 1PY1A 3D9LA 3PUJA 3CVWA 5HS0A 2WMOA 3RRNB 1EYHA 3UINC 1TYQG 1MHQA 4BWRA 2L6BA 5JHAA 3EUVA 4HI9A 4URKA 5AIJA 2P58C 2XS1A 4GMRA 3PZDA 4APFA 5DBKA 4R7LA 4I9CA 4JHKA 4CDNA 4AM9A 1OWPA 4QFVA 3PRZA 1S70B 4DUIA 3CV0A 1BLXB 2IY0C 4GCOA 2ETAA 2KCKA 3R7QA 2C0MA 4F1PA 4HOUA 1OCZE 3FDHA 2MOWA 4GZ3A 3HXDA 4AY6A 1FVFA 2CG3A 4WAFA 1N52A 2EILE 3TJPA 1BPOA 3VTYA 3SFYA 2AVPA 2X6IA 2EIME 4WNFA 3FTUA 4CYMD 5IY5E 2YHCA 4UQYA 3CHQA 4FU3A 4DX6D 1D9SA 3T8KA 4HRLA 3AS8A 4HFGA 3MA5A 2WXIA 2XGOA 4IULA 2ZISA 1LD7A 1MX4A 3PDNA 4B8AA 2RFAA 3GYZA 2OEWA 3EHMA 5G04J 4U8HA 4P29A 5JA4D 4YDYA 1O1SA 2HO1A 4JA7A 2YNQA 2Y4UA 1H19A 5HQ8A 5EX3A 3PE3A 3B7TA 3BU8A 3NOCD 2J09A 4AY5A 3E4BA 1H6OA 3CR3A 2XEVA 4OVUA 3BQOA 3FUMA 2NSZA 5EX0A 3O48A 2XQ0A 2F8XK 2NC9A 5ANRA 4Y6CA 4GTMA 1KT0A 4AJWA 4W9RA 3B13A 1TJFA 3FEYA 2PQRA 3RIBA 3AG1E 3L82A 3FTXA 3UT8A 3AJIA 4JHRA 4I2WA 1AWCB 5AARA 4FHKA 4ANUA 5ENRD 4N3CA 4O60A 5JHBA 2BKKB 2VGYA 3CVNA 4KVMA 3ZPJA 3V79K 4CGVA 3Q75A 4I6EA
chains in the Genus database with same CATH topology
3HXBA 1SA4A 1TN8A 1LD8A 1TNUA 3Q73A 2IEJA 1FPPA 2ZISA 3DRAA 3DSTA 3E32A 4LNGA 1LD7A 3KSLA 2R2LA 4GTOA 1SA5A 1MZCA 4EHMA 3HXCA 4GTSA 1S64A 2H6FA 4GTTA 3DSUA 3PZ1A 1D8DA 4GTVA 1N94A 3DSVA 1N9AA 3Q79A 1JCQA 1O1SA 1TNOA 1X81A 4MBGA 3EUVA 3HXFA 4GTQA 3SFXA 4GTPA 1FT1A 2F0YA 1NI1A 3PZ4A 1TNBA 3E30A 4GTRA 1KZPA 1TNZA 3C72A 1O5MA 1N4PA 3Q7FA 1DCEA 3Q78A 3HXEA 3HXDA 1NL4A 4YDEA 1N4SA 3E37A 1TN6A 4GTMA 1JCRA 3KSQA 1D8EA 3DSWA 3PZ2A 3DSSA 3SFYA 1KZOA 4L9PA 4YDOA 3E33A 3DSXA 3PZ3A 2H6GA 3Q7AA 3EU5A 2H6IA 1O1TA 1N4RA 2BEDA 2H6HA 1N95A 1JCSA 1S63A 1LTXA 3E34A 1O1RA 1TNYA 1QBQA 1N4QA 2ZIRA 1FT2A 3DPYA 4LNBA 3Q75A 1TN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXB A;  1SA4 A;  1TN8 A;  1LD8 A;  1TNU A;  3Q73 A;  2IEJ A;  1FPP A;  2ZIS A;  3DRA A;  3DST A;  3E32 A;  4LNG A;  1LD7 A;  3KSL A;  2R2L A;  4GTO A;  1SA5 A;  1MZC A;  4EHM A;  3HXC A;  4GTS A;  1S64 A;  2H6F A;  4GTT A;  3DSU A;  3PZ1 A;  1D8D A;  4GTV A;  1N94 A;  3DSV A;  1N9A A;  3Q79 A;  1JCQ A;  1O1S A;  1TNO A;  1X81 A;  4MBG A;  3EUV A;  3HXF A;  4GTQ A;  3SFX A;  4GTP A;  1FT1 A;  2F0Y A;  1NI1 A;  3PZ4 A;  1TNB A;  3E30 A;  4GTR A;  1KZP A;  1TNZ A;  3C72 A;  1O5M A;  1N4P A;  3Q7F A;  1DCE A;  3Q78 A;  3HXE A;  3HXD A;  1NL4 A;  4YDE A;  1N4S A;  3E37 A;  1TN6 A;  4GTM A;  1JCR A;  3KSQ A;  1D8E A;  3DSW A;  3PZ2 A;  3DSS A;  3SFY A;  1KZO A;  4L9P A;  4YDO A;  3E33 A;  3DSX A;  3PZ3 A;  2H6G A;  3Q7A A;  3EU5 A;  2H6I A;  1O1T A;  1N4R A;  2BED A;  2H6H A;  1N95 A;  1JCS A;  1S63 A;  1LTX A;  3E34 A;  1O1R A;  1TNY A;  1QBQ A;  1N4Q A;  2ZIR A;  1FT2 A;  3DPY A;  4LNB A;  3Q75 A;  1TN7 A; 
#chains in the Genus database with same CATH topology
 3T5V A;  1TN8 A;  3QB2 A;  4BX9 A;  3LCA A;  4AP2 A;  4YVO A;  2DCP A;  4V3I A;  3UM1 A;  3SNX A;  3ZXP A;  4ATG A;  4WWP A;  2JAB A;  2B0O E;  2X3M A;  3UQ3 A;  4WNE A;  4XX5 A;  5D0Q D;  3K9I A;  3CK8 A;  1PC2 A;  2XPZ A;  1UN9 A;  3ZRH A;  3UIP C;  3BG0 B;  4MBG A;  3FHE A;  2YIN A;  3JQ1 A;  4TXQ A;  3U3W A;  5BUZ A;  4JL0 A;  1HXI A;  5JJ6 A;  5AJL A;  3QDN A;  4GTR A;  2VYI A;  1KZP A;  4J0U A;  3DWL G;  1ZBP A;  3NZU A;  3ABK E;  1UW4 B;  3ABM E;  4PS8 A;  3OAW A;  3APF A;  3MYV A;  2FUL A;  5C2Y A;  2Y69 E;  1S0P A;  1Y8M A;  4AXH A;  4PS3 A;  2WXK A;  3CVU A;  3PZ3 A;  3L6A A;  3EJN A;  3CK7 A;  2H6H A;  2BED A;  4BSX A;  3ASO E;  2KBX A;  3LDZ A;  5JMN D;  4UWK A;  2V5F A;  2IF4 A;  2FI7 A;  3FU5 A;  3OXL A;  1QBQ A;  2L9B A;  5EN5 D;  3NOG D;  1QZ2 A;  3S7F A;  5M72 A;  2X38 A;  1H2U A;  3LY7 A;  2WXH A;  2J08 A;  2OVF A;  1K8K G;  1KLX A;  2QFC A;  1K1B A;  3HXC A;  4G1T A;  4BET A;  2CFU A;  3NQP A;  1S64 A;  4DI3 A;  2VJ8 A;  4XIF A;  3DSV A;  5LP0 A;  1OWO A;  3RO3 A;  4M7C A;  1TNO A;  1X81 A;  1YA0 A;  3APC A;  3IKO B;  5KCM A;  4BY6 A;  3VTX A;  1NI1 A;  2AXZ A;  2PM7 A;  3CHM A;  2R02 A;  5ENO D;  3DXM G;  4UQX A;  4YDW A;  3MEK A;  3JYS A;  5BXU A;  1Z5S C;  2EIJ E;  4U04 A;  4B89 A;  3Q7F A;  3SGH A;  2J49 A;  2HE0 A;  3VLD A;  3RKV A;  4HRN A;  1TJC A;  2UY1 A;  4L23 A;  4YDE A;  3WXX A;  3CKB A;  2ION A;  4DPR A;  1D8E A;  1JUQ A;  5LCW J;  4OYS A;  4GYW A;  4I1M A;  4ANX A;  3DSX A;  3FH7 A;  5T4Y A;  3EIQ C;  4CEM A;  4MRU A;  4HRM B;  3E34 A;  3GZ2 A;  4RQI A;  5KBA A;  4U8Y D;  4DRX E;  1IKN D;  5KNG A;  2J4B A;  2CHX A;  3ASN E;  3X2Q E;  3UUX A;  4NIK A;  3D3M A;  2KM4 A;  3L9T A;  3LY9 A;  3DST A;  2IO3 C;  4GTO A;  2JLB A;  2DYS E;  4HLE A;  2AW6 A;  3QWW A;  4I1A A;  2BKG A;  4L7T A;  5G05 J;  1OCC E;  3FFL A;  3TXM A;  4HNA D;  2GRR B;  3DXK G;  3G2T A;  3D9H A;  3ZHE B;  3JCK C;  3UTM A;  1HG2 A;  4WNG A;  2RKK A;  4MKT A;  4DK5 A;  2R17 C;  3UKU G;  2GRO B;  1AP7 A;  2UY1 B;  1TNZ A;  4TV3 A;  3RU0 A;  5EYL A;  1LF8 A;  4N3B A;  1KPS B;  2VGE A;  3R9A B;  3Q47 B;  4CDR A;  3UPV A;  5LX8 A;  2QYU A;  3CVV A;  4KMO A;  3UT4 A;  4GPM A;  4J8Y A;  3ASD A;  3V30 A;  3CSF A;  3E33 A;  4WND A;  3CVX A;  2VSY A;  4LER A;  3RO2 A;  2WXF A;  3S7B A;  3TWR A;  1E8Y A;  2VSX E;  3ZYK A;  2J8S D;  1S63 A;  1ZB1 A;  3RSE G;  2V4H C;  3U9W A;  5BW8 C;  3Q9N C;  1IHB A;  4U8V D;  4GA1 A;  2P9L G;  3SO8 A;  3Q5M A;  3PNT B;  3I5P A;  1PAQ A;  1YMP A;  3FY4 A;  3ML9 A;  2FO1 E;  4N3A A;  4PS7 A;  1H6P A;  5ARF A;  2GRN B;  3ISM C;  2I9C A;  3S2A A;  1A17 A;  5C1D A;  5CEA A;  3R9M A;  2HYZ A;  3BEE A;  1N94 A;  4FC8 A;  4K5C A;  2OEV A;  1U3C A;  4AVX A;  4GPK A;  1JWF A;  3EIJ A;  3UM2 A;  2DWZ A;  5EIL A;  4E6H A;  4DX7 D;  2L0T B;  3FWV A;  3FUK A;  4BEP A;  4FP7 A;  1INZ A;  3CVL A;  5KJL A;  4JEH A;  3ASG A;  5CCM A;  3N71 A;  3SBS A;  5KJK A;  3FUD A;  3ASF A;  1KT1 A;  2ZU6 B;  3G2U A;  2L6J A;  4CT0 A;  4HQD A;  1QYM A;  3UM3 A;  2IJG X;  4AIF A;  4TXP A;  2PM6 A;  4KBQ A;  3CHS A;  2OV8 A;  4AEZ C;  3HIZ A;  4N5C A;  2F8Y A;  3KEZ A;  4EZK A;  4RLY A;  4OAU C;  1N4Q A;  4APO A;  3DPY A;  2XEN A;  4UWH A;  4I2Z A;  4K0R A;  5EKQ D;  3B7R L;  5EDS A;  2AJA A;  4EBA G;  3J5Q B;  1FPP A;  4LG6 A;  3CVY A;  2R2L A;  4G23 A;  4G8L A;  5HI7 A;  2HR2 A;  4EQF A;  2WPV A;  4J8S A;  1P5Q A;  2XCC A;  2C0L A;  2WQH A;  4FA6 A;  3V2O A;  4BFR A;  4NUR A;  1E8Z A;  3IV0 A;  1JPL A;  4KZ0 A;  2DBA A;  4LRZ A;  2F0Y A;  4HOQ A;  3FUE A;  4J8D A;  3LJ3 A;  3PEU B;  4BT9 A;  5D0O D;  1N4P A;  2WXO A;  3L13 A;  4CCA A;  1YCS B;  3T9K A;  3HXE A;  3J5P A;  1NP7 A;  1NL4 A;  3E37 A;  1UJJ A;  3ABL E;  3HRA A;  1JCR A;  2E2E A;  1G3N B;  4FHJ A;  5AN8 A;  5ENP D;  3BG1 B;  1H2V C;  4BTB A;  2OND A;  2VTB B;  3FUI A;  5CHE E;  4KXK B;  4MLP A;  2Q7F A;  5LFA A;  5CER B;  1O1T A;  4K03 A;  3ULQ A;  4JVS A;  3D9N A;  3L22 A;  2QZA A;  3FTZ A;  2FO7 A;  3MKR A;  3PUK A;  2I1J A;  4ILI A;  5EIB E;  3RRU A;  2P9U G;  4IN3 B;  1WY6 A;  3CEQ A;  3BUA A;  3MKQ B;  4DJA A;  2WXP A;  2ZGG A;  3QC1 A;  1IXV A;  4WWO A;  4DLQ A;  1N54 A;  4QQI A;  2QYJ A;  2OCC E;  4HLL A;  4HS2 A;  4RVB A;  4JB8 P;  4AOF A;  4Y6W A;  3CQC B;  3HDX A;  5KJN A;  2J4D A;  1D8D A;  4J8F A;  3FUH A;  3D9P A;  3O4Z A;  5AYW D;  3CVP A;  5J08 A;  1OCO E;  5ENQ D;  3Q79 A;  4HXI A;  1OY3 D;  2MRI A;  3HXF A;  3AU5 A;  5JJT A;  3CHO A;  4NAC A;  3TAX A;  5HRY A;  4FJZ A;  5FTP A;  2X6F A;  5A23 A;  3APD A;  4K5A B;  2MYO A;  4LEU A;  3RJV A;  3ZYL A;  3IEG A;  4EBA A;  3ZYQ A;  3CGH A;  3SFZ A;  1SQM A;  5E76 A;  4GZD A;  4B93 B;  2A5E A;  3KS2 A;  1XGW A;  1L5J A;  1NA3 A;  3SBT B;  4RSY A;  1W3B A;  2P9I G;  1MYO A;  5DIZ A;  1JCS A;  1X5B A;  2WXQ A;  3QK0 A;  3VLF A;  1XNF A;  5CBO A;  1QQE A;  4JEU A;  4LNB A;  5CMW A;  4A3T A;  2WXR A;  4NRH B;  3HXB A;  2QC9 A;  2IEJ A;  1SZ9 A;  5ITZ F;  3T5X A;  2X6K A;  2KZT B;  3DRA A;  4LNG A;  4XI9 A;  3WG7 E;  1MZC A;  3MJW A;  4CT4 A;  3S7J A;  1ELK A;  3FUJ A;  3TG4 A;  1A5E A;  5FZQ A;  4B8C B;  1N9A A;  4PH4 B;  4XKC A;  1HF8 A;  3SF4 A;  4LNU D;  3R7R A;  5CRV A;  3EU9 A;  4GTQ A;  3P1U A;  4F6R D;  3HVE B;  2RFM A;  1YYH A;  4WUY A;  4DI4 A;  1OWM A;  4Q69 A;  3ZW3 A;  1SW6 A;  4A1G A;  4XEI G;  3ZKJ A;  4EZL A;  2DZN A;  5ENT D;  3DEO A;  4UWF A;  3HHM A;  5KJM A;  2ILR A;  4RG6 A;  1SVX A;  4A3V A;  3KSQ A;  1OUV A;  1DNP A;  3ZHE A;  1WDY A;  3PZ2 A;  3MX3 A;  4LCT A;  3UI2 A;  2GRM A;  2DYR E;  3MV3 B;  5BT1 A;  1WM5 A;  4GCN A;  4HVB A;  2XCB A;  1N4R A;  3ESK A;  3QAQ A;  3LEW A;  4C48 B;  5ANL A;  2WXN A;  3CHP A;  3L08 A;  5BXO A;  1U2V G;  4UWG A;  4HOS A;  4YVQ C;  1N0Q A;  3UX4 A;  1JWG A;  5FJY A;  2L0I A;  2XZD G;  4ABN A;  2Y0B G;  3SD5 A;  4JZY A;  4J7W A;  2AXU A;  4D10 C;  3TXN A;  2XRY A;  1GW6 A;  3QNK A;  5EID A;  3DBS A;  2VSO E;  2X6H A;  1E7U A;  1IQR A;  3AG2 E;  5FWQ A;  2XHE A;  4GTV A;  1TEZ A;  2ZGD A;  3AS4 A;  2PQN A;  5AQ7 A;  2LNI A;  3B7B A;  2P9N G;  2RG8 A;  2R03 A;  2WXL A;  1EPU A;  4K5B A;  3PE4 A;  4EPZ A;  2FBN A;  5AEN A;  5CCL A;  3ZYM A;  5BV1 A;  3Q15 A;  1IYG A;  1DVP A;  1E8W A;  3ONL A;  4JPS A;  4BSZ B;  4BES A;  1E90 A;  4ANV A;  3AG3 E;  1NZN A;  3C3O A;  4ANW A;  3UT7 A;  2V5Q C;  5G2N A;  3TL5 A;  1V55 E;  3PH0 C;  3HG0 D;  4G24 A;  2H6I A;  4GA2 A;  3SHF A;  5KWD A;  3PVL A;  1O1R A;  3ZXS A;  1FT2 A;  4WWN A;  4LSZ E;  3PRE A;  1FCH A;  2KXP C;  4M3O A;  1LD8 A;  1HE8 A;  2M63 A;  4JXT A;  4UUC A;  2VGX A;  3ZIM A;  3G2S A;  5CBN A;  4OVV A;  1HH8 A;  1B89 A;  3DSU A;  4B94 A;  3TGO A;  3Q49 B;  3OTN A;  4I1O B;  3NBN B;  1HX8 A;  3FUF A;  3FUL A;  2I1K A;  5CEC B;  2XS8 A;  2IFU A;  2Y1L E;  3SZ7 A;  4X8Q A;  1EF1 C;  1RW2 A;  1EDU A;  3IHY A;  5T8I A;  1DCQ A;  4U0S A;  3I3N A;  3MGB A;  5ARG A;  4O1O A;  2LUH A;  3MV2 B;  2WXJ A;  2I2O A;  2J9Q A;  4I43 A;  3FU6 A;  2ETB A;  5EYP F;  2LXM A;  2PZI A;  4I6J A;  3UM0 A;  4DLO A;  5AQA A;  2A5U A;  2XPY A;  4U95 D;  4KZC A;  1BI8 B;  2VSN A;  3FTW A;  4GZC A;  2PL2 A;  1V54 E;  4XKB A;  3ONK A;  4YDO A;  3ZVV A;  3IBE A;  1SZA A;  1BD8 A;  3TWT A;  4LUN U;  2WB2 A;  4YND A;  1N95 A;  5D66 A;  3CHR A;  5CED B;  2KCV A;  1HU3 A;  2BF0 X;  2P9S G;  5BPP A;  2VGX B;  2P9P G;  4GA0 A;  4ILH B;  4GB9 A;  3TWX A;  1TN7 A;  2LSU A;  2KCL A;  5ENN A;  1TNU A;  3E32 A;  3GZS A;  3PNL B;  1SA5 A;  3D9K A;  2VTB A;  1H0A A;  1BI7 B;  4F7A A;  4XI0 A;  3EHR A;  3IHV A;  2RD0 A;  3PZ1 A;  3G2V A;  3V31 A;  3FUN A;  2X6J A;  2EIN E;  4ACK A;  4PDX A;  1NA0 A;  4A1S A;  4TRQ A;  3V2X A;  4UI9 K;  3DEP A;  1JCQ A;  2Y4T A;  3TWW A;  3OXF A;  3P2B A;  1Z3Y A;  2QY7 A;  4HBD A;  3ML8 A;  2B6C A;  4N2Q A;  3D9J A;  4NQ0 A;  3C3R A;  3MKQ A;  5AQB A;  3FEX A;  4Q96 A;  4AV7 A;  3CK9 A;  2XEE A;  4I6G A;  2ETC A;  2E0I A;  4CDM A;  2A4Z A;  2HM8 A;  5FQ7 A;  1HG5 A;  5ENS D;  4C0E A;  4UWL A;  4F1S A;  2WXG A;  1HS6 A;  4PUC A;  4J8E A;  3FTV A;  4UQZ A;  2XZT G;  3EDT B;  2AWI A;  2R5S A;  1UOH A;  3AAA C;  3UKR G;  1OWL A;  3CLJ A;  3CQG B;  2BUG A;  2V8S E;  1Q2Z A;  2FEZ A;  2XGM A;  4BT8 A;  4L2L A;  4E85 A;  5FIO A;  3TWS A;  1MX6 A;  3TWV A;  5T3R A;  2ZIR A;  5BV0 A;  2LAH A;  5LOZ A;  3QJZ A;  4H7Y A;  4CRW A;  5FZS A;  5G55 A;  2FF4 A;  3UMV A;  3ZFW A;  4G26 A;  4OAV B;  1HZ4 A;  4KVO A;  4ZFH A;  5J90 A;  3QWP A;  4JC8 A;  2WMN A;  2XRZ A;  2XPI A;  1MQS A;  4EHM A;  3LJN A;  3EHN A;  4GTS A;  4ATZ D;  5A7D B;  3ENE A;  1WAO 1;  1E7V A;  1UN8 A;  2I6H A;  3B7S A;  4O1P A;  3JUI A;  5AJD A;  1MJ0 A;  3T8M A;  4J6I A;  2AXV A;  2V4L A;  3JXJ A;  3JXI A;  3ZNG A;  1Z3X A;  3JUE A;  3U66 A;  5B1B E;  4B0Z A;  3SQV A;  2KZT A;  4BER A;  1DCE A;  3PS6 A;  3RRM B;  3FH8 A;  3ASH A;  1Z6T A;  4G8K A;  5AAO A;  1N4S A;  4FUL A;  3SY2 A;  4U0Z A;  4DX5 D;  3NF1 A;  3AS5 A;  3GZ1 A;  3DSW A;  4O6F A;  3OXG A;  2OOE A;  3HVE A;  3AG4 E;  3Q7A A;  3LY8 A;  3EU5 A;  2DZO A;  2KC7 A;  5G04 C;  1OCR E;  1LTX A;  1E96 B;  3LYA A;  3LPZ A;  3D9O A;  3D9I A;  4U0U A;  4IYP A;  4GYO A;  2C2L A;  3Q73 A;  3PEV B;  3NB2 A;  4FLB A;  4EEC A;  1E8X A;  3NAW A;  2YQ8 A;  3ZU7 B;  1DC2 A;  2R59 A;  5FQ4 A;  3C98 A;  4Z68 A;  1UG3 A;  4N39 A;  4Q94 A;  2GRL A;  5AQ9 A;  4IRU A;  1K1A A;  4F53 A;  3QWV A;  3QOU A;  4FJY A;  2IU1 A;  3SFX A;  3QKY A;  3LVQ E;  1FT1 A;  3I4G A;  3LS8 A;  3B95 A;  3LVR E;  1U3D A;  1TNB A;  4ZHB A;  1MX2 A;  4MS6 A;  3C72 A;  1O5M A;  4TUU A;  4FAD A;  4HB5 A;  3Q78 A;  3G2W A;  4G25 A;  4FLH A;  4A55 A;  2GW1 A;  3CIA A;  2GRQ B;  4JD2 G;  1WG0 A;  3NZS A;  3DSS A;  2IO2 C;  2DIW A;  5FQ8 A;  4L9P A;  3CVQ A;  4GYY A;  4CGW A;  3EHQ A;  5FIN A;  3ZN3 A;  1N0R A;  2IOS A;  4N2S A;  3TWU A;  4U07 A;  5A6C A;  3FP3 A;  3MZL B;  2LXL A;  2P9K G;  4BX8 A;  4UI9 J;  3B7U X;  3U64 A;  3UXG A;  2Y3A A;  2LO6 A;  2WVI A;  4U63 A;  1H6K A;  2DVW A;  3KSL A;  4GU5 A;  3D9M A;  3CST A;  4G11 A;  4TUM A;  2MHK A;  2CG2 A;  4RG9 A;  2H6F A;  4GAA A;  2JEK A;  4I17 A;  5H7P A;  1VDY A;  1OWN A;  2YHE A;  4KT6 B;  4TXR A;  3U4T A;  3FH5 A;  4C9B B;  5JJ7 A;  4U7E B;  4GTP A;  3W9F A;  1HFA A;  4U96 D;  1FVH A;  3IXE A;  3FTS A;  3FTY A;  4DX2 A;  1OT8 A;  3AU4 A;  3ULE G;  2BTD A;  3SI5 A;  4HOT A;  5B1A E;  5B3S E;  5FZR A;  2KAT A;  3S7D A;  3ZGQ A;  5D2M C;  3TG5 A;  4ME2 A;  2LAI A;  2J07 A;  2ZXW E;  4HOR A;  4H7X A;  3CKC A;  1NFI E;  4GZ5 A;  2EIK E;  2IOL A;  4ILG A;  2XEH A;  2WQ7 A;  2H6G A;  3Q4A B;  3W9G A;  2WM9 A;  1UJK A;  3VLE A;  3L16 A;  3I4R B;  4UI9 C;  4GML A;  4CZ2 D;  4GZ6 A;  3FU3 A;  2GRP B;  4JA9 A;  1ZU2 A;  4I9E A;  4KYO B;  3C3Q A;  1SA4 A;  5BNW A;  3TWQ A;  5E75 A;  4XZ4 A;  3FU0 A;  2VQ2 A;  5CRU A;  2NYJ A;  2V0P A;  4GTT A;  1BU9 A;  2IQC A;  4DX1 A;  1OXJ A;  4JHJ A;  1TR4 A;  3RK6 A;  3Q9U C;  3KEA A;  1ELR A;  3L54 A;  4JW1 A;  2CFZ A;  3URZ A;  5LCW C;  3F6Q A;  1H2T C;  2CHZ A;  3PZ4 A;  3MCX A;  3E30 A;  5FT9 A;  5FQ6 A;  2R05 A;  3KD7 A;  2EQX A;  3UIO C;  3ESL A;  2P2C P;  4HI8 A;  4EZJ A;  4G2V A;  3JQ0 A;  3L17 A;  2GGF A;  2OVB A;  3DPD A;  4N5Q A;  2NXP A;  3LXU X;  3GW4 A;  4XE0 A;  3C5R A;  1TN6 A;  2UWJ G;  5HKP A;  1KZO A;  4GMJ A;  4L2Y A;  4BTA A;  2XGS A;  2F37 A;  4L1B A;  2LSV A;  5G05 C;  3HYM B;  3ZEF A;  3ULY A;  3ZUV B;  1HO8 A;  1TNY A;  4F3V A;  2CHW A;  1RZ4 A;  1N11 A;  5CMY A;  3RAU A;  1IHG A;  3QAR A;  5KNH D;  2WQ6 A;  1QNF A;  1K3Z D;  1ELW A;  2WXM A;  3LKU A;  3KAE A;  4A63 B;  1Y6I A;  4C0M A;  1IQU A;  4ACL A;  2PNN A;  1PY1 A;  3D9L A;  3PUJ A;  3CVW A;  5HS0 A;  2WMO A;  3RRN B;  1EYH A;  3UIN C;  1TYQ G;  1MHQ A;  4BWR A;  2L6B A;  5JHA A;  3EUV A;  4HI9 A;  4URK A;  5AIJ A;  2P58 C;  2XS1 A;  4GMR A;  3PZD A;  4APF A;  5DBK A;  4R7L A;  4I9C A;  4JHK A;  4CDN A;  4AM9 A;  1OWP A;  4QFV A;  3PRZ A;  1S70 B;  4DUI A;  3CV0 A;  1BLX B;  2IY0 C;  4GCO A;  2ETA A;  2KCK A;  3R7Q A;  2C0M A;  4F1P A;  4HOU A;  1OCZ E;  3FDH A;  2MOW A;  4GZ3 A;  3HXD A;  4AY6 A;  1FVF A;  2CG3 A;  4WAF A;  1N52 A;  2EIL E;  3TJP A;  1BPO A;  3VTY A;  3SFY A;  2AVP A;  2X6I A;  2EIM E;  4WNF A;  3FTU A;  4CYM D;  5IY5 E;  2YHC A;  4UQY A;  3CHQ A;  4FU3 A;  4DX6 D;  1D9S A;  3T8K A;  4HRL A;  3AS8 A;  4HFG A;  3MA5 A;  2WXI A;  2XGO A;  4IUL A;  2ZIS A;  1LD7 A;  1MX4 A;  3PDN A;  4B8A A;  2RFA A;  3GYZ A;  2OEW A;  3EHM A;  5G04 J;  4U8H A;  4P29 A;  5JA4 D;  4YDY A;  1O1S A;  2HO1 A;  4JA7 A;  2YNQ A;  2Y4U A;  1H19 A;  5HQ8 A;  5EX3 A;  3PE3 A;  3B7T A;  3BU8 A;  3NOC D;  2J09 A;  4AY5 A;  3E4B A;  1H6O A;  3CR3 A;  2XEV A;  4OVU A;  3BQO A;  3FUM A;  2NSZ A;  5EX0 A;  3O48 A;  2XQ0 A;  2F8X K;  2NC9 A;  5ANR A;  4Y6C A;  4GTM A;  1KT0 A;  4AJW A;  4W9R A;  3B13 A;  1TJF A;  3FEY A;  2PQR A;  3RIB A;  3AG1 E;  3L82 A;  3FTX A;  3UT8 A;  3AJI A;  4JHR A;  4I2W A;  1AWC B;  5AAR A;  4FHK A;  4ANU A;  5ENR D;  4N3C A;  4O60 A;  5JHB A;  2BKK B;  2VGY A;  3CVN A;  4KVM A;  3ZPJ A;  3V79 K;  4CGV A;  3Q75 A;  4I6E A; 
#chains in the Genus database with same CATH homology
 3HXB A;  1SA4 A;  1TN8 A;  1LD8 A;  1TNU A;  3Q73 A;  2IEJ A;  1FPP A;  2ZIS A;  3DRA A;  3DST A;  3E32 A;  4LNG A;  1LD7 A;  3KSL A;  2R2L A;  4GTO A;  1SA5 A;  1MZC A;  4EHM A;  3HXC A;  4GTS A;  1S64 A;  2H6F A;  4GTT A;  3DSU A;  3PZ1 A;  1D8D A;  4GTV A;  1N94 A;  3DSV A;  1N9A A;  3Q79 A;  1JCQ A;  1O1S A;  1TNO A;  1X81 A;  4MBG A;  3EUV A;  3HXF A;  4GTQ A;  3SFX A;  4GTP A;  1FT1 A;  2F0Y A;  1NI1 A;  3PZ4 A;  1TNB A;  3E30 A;  4GTR A;  1KZP A;  1TNZ A;  3C72 A;  1O5M A;  1N4P A;  3Q7F A;  1DCE A;  3Q78 A;  3HXE A;  3HXD A;  1NL4 A;  4YDE A;  1N4S A;  3E37 A;  1TN6 A;  4GTM A;  1JCR A;  3KSQ A;  1D8E A;  3DSW A;  3PZ2 A;  3DSS A;  3SFY A;  1KZO A;  4L9P A;  4YDO A;  3E33 A;  3DSX A;  3PZ3 A;  2H6G A;  3Q7A A;  3EU5 A;  2H6I A;  1O1T A;  1N4R A;  2BED A;  2H6H A;  1N95 A;  1JCS A;  1S63 A;  1LTX A;  3E34 A;  1O1R A;  1TNY A;  1QBQ A;  1N4Q A;  2ZIR A;  1FT2 A;  3DPY A;  4LNB A;  3Q75 A;  1TN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...