1NI1A

Imidazole and cyanophenyl farnesyl transferase inhibitors
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of potent imidazole and cyanophenyl containing farnesyltransferase inhibitors with improved oral bioavailability.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
total genus 108
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ni1A00
4YDEA 1N4QA 1TNOA 3E33A 4L9PA 2H6GA 1O1TA 3C72A 3DSVA 1LD7A 1KZOA 3SFXA 1SA5A 3EUVA 4GTOA 1NI1A 1JCRA 3PZ3A 1D8DA 3DSSA 3HXEA 1TNZA 1N95A 3HXBA 3E30A 1DCEA 4EHMA 1LTXA 4GTQA 4GTSA 3HXDA 3Q7AA 1D8EA 3Q7FA 1S63A 1JCQA 1X81A 3PZ1A 1TNUA 3Q79A 1MZCA 4GTTA 1QBQA 1N94A 4MBGA 3DSXA 1FT2A 1SA4A 1TN6A 3DSWA 3Q78A 3DSUA 2H6IA 2H6FA 3DRAA 3E37A 3KSLA 4GTPA 3Q75A 4LNBA 1TNYA 3HXFA 1LD8A 1N4PA 4GTMA 3DPYA 1TN7A 2BEDA 3EU5A 1O1RA 1FPPA 2IEJA 2R2LA 4GTVA 3DSTA 1S64A 3KSQA 4GTRA 2F0YA 2ZISA 1TNBA 1N4RA 1O1SA 1O5MA 2H6HA 2ZIRA 3SFYA 1NL4A 1N4SA 3Q73A 3PZ4A 1FT1A 1JCSA 3HXCA 1TN8A 1KZPA 1N9AA 3E34A 3PZ2A 4YDOA 3E32A 4LNGA
chains in the Genus database with same CATH superfamily
2J08A 3GZ1A 4U0ZA 1N0RA 1H2UA 1X5BA 4GZCA 4L9PA 2VJ8A 4U8VD 3NB2A 1SA5A 2J49A 1IQUA 3HXEA 2AXVA 3AG3E 5CBOA 3ZU7B 3LEWA 3T8MA 4ZHBA 1JWGA 3RU0A 3HVEA 4EECA 3FTXA 3UINC 3FTWA 3S7BA 4XI0A 2IQCA 3ZN3A 2I9CA 1OWNA 2R03A 3QJZA 4ILGA 2WXOA 2YQ8A 3IV0A 1JPLA 2H6IA 1Z3YA 4G25A 1Y6IA 4DX2A 3L16A 2WMOA 3HXFA 1OUVA 3B7SA 4HBDA 3CKCA 1A17A 4I1AA 4KMOA 4BTAA 2IU1A 1H6KA 3KSQA 2XEHA 4P29A 1H6PA 5CRUA 5D0OD 4EPZA 2H6HA 2ZIRA 5EN5D 2J09A 4BT8A 4KXKB 3PEUB 2BTDA 1SQMA 2WXRA 3FUJA 4LUNU 4G1TA 2YHCA 1PY1A 3I4RB 1HG5A 3LS8A 5EKQD 3CSTA 5G04J 4FP7A 3ULYA 1D8DA 1LF8A 2IONA 4HXIA 4I1MA 1N95A 3UTMA 3RIBA 3NZSA 2EINE 3UM0A 1INZA 1H2VC 3MV2B 3QC1A 2WVIA 4O6FA 2XPYA 4YNDA 4BX8A 1X81A 1DC2A 2R59A 2XGOA 1QBQA 2VYIA 1FT2A 1TN6A 3CSFA 4HNAD 4EBAA 1DVPA 1IYGA 2VQ2A 2ETCA 2XS1A 1IQRA 4JPSA 1KLXA 3V30A 3CVUA 3OTNA 4N5CA 4PUCA 3FTVA 4TUMA 3FEYA 3W9GA 5EDSA 2R05A 3NOCD 3UIOC 2Y1LE 2P9UG 3FUKA 3Q15A 5G04C 1NZNA 2KCLA 1S0PA 3SFYA 5G05C 3B13A 3V2OA 5AYWD 3VTXA 2AVPA 2AWIA 5FIOA 4CYMD 2C2LA 3EIJA 4ILIA 3SGHA 3E34A 5CMWA 3PNTB 2KCVA 2BKKB 3WXXA 4OVVA 4TV3A 2HO1A 3D9MA 4GCNA 2H6GA 4HOUA 5LCWC 1WY6A 3N71A 4CT4A 4LNUD 1UN8A 4Z68A 3ZW3A 4WAFA 2KZTA 5ENRD 5AARA 5KBAA 3APCA 2B0OE 1HX8A 4DRXE 3FTSA 1U3CA 4JW1A 4YVOA 3Q7FA 3LDZA 2C0LA 2IOSA 3URZA 5G05J 1NP7A 2BUGA 1HXIA 4ZFHA 4B0ZA 4DX7D 3JQ0A 1JUQA 1SVXA 3BQOA 2CHXA 3NOGD 1Z6TA 2F8YA 1LD8A 2IFUA 4U07A 3CVVA 1XNFA 5KWDA 4K5BA 5KJNA 3EHQA 2WXLA 4EZKA 3UMVA 1O5MA 1B89A 2WXPA 3TWQA 4AXHA 3TGOA 1MX2A 1FT1A 4L1BA 3CLJA 3HXCA 4BFRA 5CCLA 1EPUA 1IXVA 3UIPC 4NACA 3SQVA 2X3MA 3FY4A 5AJDA 2VGXA 4A1SA 1P5QA 5AQAA 2XPIA 4L2LA 2IJGX 3DSSA 4JB8P 3UKRG 3ZYQA 3CVLA 3CVXA 1UW4B 4GPKA 3NQPA 2LXMA 2KBXA 1LTXA 3RRMB 4UI9K 4MS6A 2AXZA 4I9CA 1ELKA 4UI9C 4PS8A 4TXQA 5DIZA 4U8HA 5FQ7A 3LY7A 4I6EA 3JXIA 4GTPA 3TWWA 2OCCE 4ACLA 4O1OA 3UT7A 2XRZA 4XZ4A 4AJWA 1E8XA 3C3OA 3QWPA 2KATA 5EYPF 4UQZA 4JHRA 4GTVA 2VSOE 4KVOA 5D66A 4FLBA 2V0PA 4B93B 3W9FA 2L6BA 2OVBA 2RG8A 3I4GA 3Q73A 2CHZA 3UM2A 4KVMA 4DLQA 4KT6B 4GMRA 4GZ5A 5FQ8A 2FEZA 4RG6A 3ABME 4YDOA 3RAUA 3CHPA 5T8IA 5AAOA 1UJKA 2BKGA 3SF4A 4WNEA 2CG3A 4J0UA 3SI5A 4ANVA 2UY1B 4C0EA 4LSZE 3IHVA 3LYAA 3LXUX 5FQ4A 3B7RL 3EDTB 3S7DA 1Z5SC 3FH8A 3NBNB 1TNZA 2MHKA 2Y0BG 3CK7A 4K0RA 3RO3A 2M63A 3RO2A 4C0MA 3PUKA 4V3IA 2AJAA 3FU0A 2XZTG 4GA2A 4K03A 2LNIA 4H7XA 1FVFA 2EIKE 1N0QA 5CRVA 3TL5A 5LFAA 5JA4D 4X8QA 3TXMA 2F37A 3GZSA 5ENNA 4DJAA 5BXOA 3U9WA 2WXMA 4PS7A 2RD0A 3LKUA 3X2QE 4BSZB 3JUEA 1N11A 2IF4A 4CT0A 4G8KA 2X6FA 4ACKA 4AVXA 1V55E 3DSTA 2WPVA 2IY0C 1H2TC 4ABNA 4J7WA 5AQ9A 3PDNA 3I5PA 1MHQA 1TJFA 4GU5A 5J90A 2XS8A 5CERB 4M7CA 4TXPA 2L9BA 4MKTA 5KJMA 3CHSA 3Q9NC 4FU3A 5HRYA 2R02A 4I17A 2GRLA 4ANWA 2P9IG 3FTUA 5LP0A 1TJCA 5T3RA 4AV7A 3B7TA 4MLPA 3MGBA 2VSYA 1UG3A 4GYOA 4U0UA 3MKQA 4E6HA 5ENTD 3PNLB 2ZGGA 4N39A 3CK9A 4DPRA 5ENOD 3QNKA 2ZXWE 2DZNA 4JL0A 3FUDA 4HI9A 3APFA 3SY2A 5KJKA 3FUMA 3TWVA 3DBSA 3ML9A 5AENA 2HM8A 3PREA 4JHKA 4UWGA 1IKND 3DXKG 1E7UA 4WWPA 4NRHB 2F0YA 1E8YA 4HRMB 3CHMA 4APOA 1NL4A 3S7JA 3T9KA 2P9KG 2I1KA 3HIZA 1BLXB 4FULA 3SFZA 2GRNB 4UQXA 2A4ZA 3FFLA 3HRAA 4XI9A 3DSVA 1SZAA 3TAXA 3PZ3A 2QYUA 3U66A 3D9KA 3NAWA 2WQ7A 2WXHA 1Q2ZA 3ZIMA 2A5EA 4I6GA 1HZ4A 4BTBA 4G24A 1SA4A 2EIJE 4TUUA 3JQ1A 3B95A 2WXQA 3AJIA 1KT0A 2V5FA 3UXGA 3UPVA 3FUEA 4BY6A 4I1OB 4I43A 2L0TB 2EQXA 3D9OA 1O1RA 5FTPA 2WXJA 4F1SA 5AJLA 5ITZF 2WQ6A 4Y6WA 3B7BA 1TNBA 2VSXE 3ZXSA 4DI4A 3FU6A 1HFAA 1MYOA 3T5VA 1JCSA 3RSEG 2XGSA 3J5PA 2FULA 1NA3A 1BI7B 3PS6A 2KXPC 4YDEA 3KS2A 2DZOA 4E85A 1ELRA 3MYVA 3Q47B 4WNDA 3CHQA 5IY5E 3C72A 2XHEA 3L17A 5CEDB 5ANLA 3UT4A 4AM9A 1YA0A 5H7PA 4GA0A 4EHMA 2HYZA 2YHEA 4OVUA 2DYSE 4N2SA 3ZYKA 3R7QA 5AQBA 3U3WA 4CCAA 1MX6A 3HYMB 2B6CA 3EHNA 3TG5A 1MZCA 4GZ3A 3AS8A 4J8DA 3DSXA 2OVFA 3AG4E 3P2BA 2F8XK 3ZXPA 2XZDG 3Q78A 1ZU2A 1TYQG 3EHMA 4QFVA 3R9MA 1H6OA 5FQ6A 3IHYA 1ELWA 2A5UA 4HS2A 4A3TA 3GW4A 4JVSA 3SBTB 3QARA 5CBNA 4YDYA 5FJYA 2X6KA 5ENSD 4U8YD 2FO1E 1HE8A 5FWQA 5JHAA 3SBSA 2DVWA 3ZPJA 1UJJA 2JABA 4RVBA 1TN8A 2YNQA 3UUXA 2PNNA 1OY3D 4HLLA 3CVYA 3UM3A 1OT8A 5A7DB 3DPDA 3G2TA 4N5QA 2MOWA 2DBAA 1O1TA 4G11A 2VGXB 5LOZA 3FULA 3SFXA 3CKBA 3CEQA 1WG0A 2P58C 2RFMA 4J6IA 3D9HA 3G2VA 2OEVA 3RK6A 2PM7A 3TWTA 1DNPA 3IKOB 2V8SE 1WAO1 2CHWA 3FHEA 3ABLE 5BXUA 3OXLA 4U63A 3EU9A 3HDXA 3FUFA 2OEWA 3ML8A 3CVWA 4GMLA 2Y4TA 5M72A 1JCQA 2WXKA 5JJ7A 1OWOA 2PQNA 3QK0A 4LRZA 3QDNA 3UM1A 1OWMA 2GROB 1NFIE 4UWKA 3ESLA 2XCCA 1U3DA 4U0SA 4B8CB 1N4PA 3QWWA 3DPYA 3J5QB 5D2MC 2IO2C 3C5RA 2VTBB 2IEJA 2P2CP 5KNHD 4JHJA 4BERA 4EQFA 2Y69E 2P9PG 1N4RA 4J8YA 5C1DA 1HU3A 3ASFA 1N4SA 3ASDA 4GB9A 1K1BA 3PEVB 4RLYA 4YDWA 2CG2A 2CFZA 4JA9A 1FVHA 2UWJG 2XGMA 3KD7A 5BT1A 4YVQC 2X6JA 4WNGA 5ENPD 3FU5A 5C2YA 4IN3B 3S7FA 2KM4A 2VSNA 4ANXA 4FJZA 3OAWA 3VLEA 3ENEA 2ZGDA 5HQ8A 1IHGA 4ATZD 3CVPA 2ILRA 3E30A 2DIWA 5AQ7A 4EZLA 3ONKA 3L08A 2NC9A 4NIKA 4OYSA 3FUIA 4DX6D 4F1PA 1KT1A 2WXGA 1PAQA 3P1UA 3PZDA 3GZ2A 3MV3B 4TRQA 2FO7A 2L6JA 5JMND 1ZBPA 3CQGB 5JHBA 1GW6A 4G23A 1XGWA 3DSWA 4RSYA 5LCWJ 4F7AA 3D9NA 4APFA 3E37A 3SD5A 2LAHA 1K3ZD 1OXJA 4U04A 4JA7A 4HI8A 4LEUA 1KPSB 5ARFA 2R2LA 4WNFA 2LAIA 4FA6A 5KNGA 1D9SA 4BETA 4GZ6A 3O4ZA 4HB5A 3SZ7A 2YINA 1MQSA 4C48B 1IHBA 3ULQA 4G26A 2VTBA 3SHFA 4F3VA 1EF1C 3CR3A 3IXEA 2GRQB 4JEHA 2R17C 4Q69A 3E32A 3MCXA 4LNGA 1L5JA 3Q5MA 3LPZA 4XX5A 3ASHA 3UQ3A 3ZHEB 4D10C 3EUVA 4W9RA 3D9IA 1NI1A 4NURA 4CRWA 3BG0B 3ZUVB 4N2QA 3D9JA 3HXBA 4FADA 1E8WA 3QAQA 2EIME 2KZTB 1DCEA 3O48A 3V79K 4GYYA 2J4DA 4J8SA 3FWVA 4GPMA 4CZ2D 3NZUA 1PC2A 3SNXA 5FINA 4I2WA 1HH8A 2QFCA 4FLHA 1E96B 1YMPA 4A63B 3WG7E 1UN9A 2RFAA 3SO8A 4IYPA 4UWFA 4H7YA 4HFGA 2I1JA 4J8EA 4F6RD 2X6HA 3FTZA 3RKVA 4N3BA 4BWRA 2L0IA 3CHOA 5B1AE 3MJWA 2NSZA 4AOFA 5EILA 4U96D 3JUIA 3AS4A 3LY9A 3DWLG 3LVQE 3RRNB 4FHKA 4I2ZA 2V4LA 3ONLA 4HOTA 3HHMA 3L6AA 2GRPB 3CQCB 3TJPA 1N9AA 2J8SD 1RW2A 3VLDA 3PZ2A 4PDXA 4JXTA 3B7UX 3MZLB 3KEAA 3CK8A 4JC8A 1H19A 1A5EA 2KC7A 3D9PA 3VLFA 2JLBA 3TWSA 4G2VA 4GTOA 5ANRA 5ENQD 5KCMA 3NF1A 1SZ9A 1UOHA 2CFUA 3D3MA 3KEZA 5BW8C 4WWNA 1AWCB 2WQHA 1K8KG 3HXDA 2ONDA 1S63A 2X6IA 3E4BA 2XCBA 3Q79A 4GTTA 3BUAA 4FC8A 5EX3A 3G2WA 3C3QA 3L54A 3DRAA 3AG1E 1K1AA 1HF8A 3FDHA 4HRNA 3Q75A 3UKUG 4U95D 4XKCA 4G8LA 4PH4B 1N54A 4BESA 3U64A 3EU5A 2BF0X 4GYWA 4RQIA 5BPPA 2AW6A 3ZGQA 1OWPA 2LO6A 3TWUA 4DX5D 1O1SA 4M3OA 4KZ0A 4A55A 3PZ4A 3TG4A 5J08A 2WXFA 3L82A 1QYMA 2VGYA 1EDUA 3QWVA 4LCTA 1E90A 2RKKA 3AG2E 3ZKJA 2LSVA 5AN8A 4UI9J 4ILHB 2QC9A 4HRLA 2P9NG 3EJNA 4U7EB 4UUCA 3TXNA 3HG0D 4B94A 4AEZC 4AY6A 3MKRA 1MJ0A 5BV0A 4GAAA 3ABKE 4CGWA 1JWFA 1N52A 3GYZA 1OWLA 3QKYA 3EHRA 2FBNA 2GGFA 1YYHA 3ASGA 3DXMG 4GTSA 3LCAA 3Q7AA 1D8EA 1OCZE 2KCKA 3V31A 3K9IA 5EIDA 5T4YA 3S2AA 2WXNA 2XRYA 4CGVA 3D9LA 3PUJA 2HE0A 4DLOA 3KSLA 1VDYA 3UX4A 1RZ4A 3V2XA 3FTYA 4N3AA 3FH5A 5CEAA 3BU8A 3APDA 4AY5A 4FHJA 4OAVB 1E8ZA 2ZISA 3G2SA 5JJTA 4DI3A 5BV1A 2HR2A 3TWRA 3JXJA 3PE3A 4B89A 1EYHA 4UWLA 3LY8A 2QY7A 4HQDA 1S70B 4GMJA 3PH0C 4Y6CA 5HS0A 3PE4A 5B1BE 3ISMC 4IULA 2LSUA 2ZU6B 3PRZA 3RRUA 3LJ3A 2EILE 4DX1A 4GZDA 5BUZA 3TWXA 5JJ6A 4HLEA 4AIFA 3CIAA 3R7RA 2GRRB 4PS3A 2V4HC 2OV8A 4JEUA 1Y8MA 2PL2A 2LUHA 2DWZA 5G55A 2XQ0A 4WUYA 1SW6A 4XKBA 3MKQB 1OCCE 1V54E 2GW1A 1TNUA 3QOUA 4CDNA 2MYOA 1N94A 3Q49B 4L7TA 1QNFA 4TXRA 4L2YA 2H6FA 4MRUA 3G2UA 3C3RA 3MX3A 4XEIG 3ASOE 4QQIA 3BEEA 3OXGA 4JZYA 3FP3A 2QYJA 1OCOE 4A1GA 4ANUA 4F53A 4EBAG 4Q94A 5CCMA 4BT9A 3CVQA 2AXUA 2WXIA 4IRUA 3OXFA 5B3SE 1BU9A 4J8FA 4ME2A 2XPZA 5KJLA 2GRMA 2P9LG 3ASNE 3FU3A 5D0QD 4KYOB 3ZYLA 5CECB 4EZJA 1KZPA 1OCRE 4L23A 2FF4A 3ZVVA 3RJVA 5CMYA 3DEOA 3I3NA 1N4QA 3Q9UC 1TNOA 1ZB1A 4R7LA 3E33A 5G2NA 4NQ0A 3ZYMA 3T8KA 3VTYA 3L13A 3L22A 1KZOA 4N3CA 3FH7A 5EIBE 2WB2A 3LJNA 5LX8A 1JCRA 2P9SG 4URKA 3JCKC 1HG2A 1BI8B 4C9BB 2C0MA 4K5CA 3BG1B 3FEXA 1AP7A 2IO3C 4WWOA 3LVRE 4DK5A 3ZRHA 4LG6A 2FI7A 4RG9A 4DUIA 4BSXA 3UT8A 1G3NB 4HORA 1U2VG 3DSUA 3HVEB 2E2EA 4LERA 4CDMA 4HOSA 4B8AA 2I6HA 3AU4A 3CVNA 5E75A 2PM6A 4HOQA 4UQYA 5FZQA 1HO8A 2Y4UA 5FT9A 4BEPA 1DCQA 4KZCA 3PVLA 4ATGA 1TN7A 2BEDA 1Z3XA 4KBQA 1FPPA 2J07A 4HVBA 3L9TA 3CV0A 5EX0A 3KAEA 2XEVA 4O1PA 3FUNA 2PQRA 3AAAC 1YCSB 2WMNA 1WDYA 1W3BA 4GCOA 4K5AB 4AP2A 4CEMA 2PZIA 3ZHEA 2E0IA 2NXPA 3MEKA 2NYJA 2WM9A 5E76A 2Q7FA 2XEEA 3ZEFA 1HS6A 4UWHA 3JYSA 2MRIA 2I2OA 3ZFWA 2Y3AA 4O60A 1TEZA 1NA0A 2LXLA 4FJYA 2R5SA 1LD7A 2OOEA 2UY1A 3IEGA 3UI2A 1TR4A 3C98A 3ULEG 1BD8A 3AU5A 5HKPA 4GTQA 4XIFA 4CDRA 5AIJA 4JD2G 4GA1A 1WM5A 3PZ1A 2X38A 3MA5A 2JEKA 4MBGA 1QQEA 5EYLA 4A3VA 4I9EA 2V5QC 1FCHA 5FZSA 4Q96A 1H0AA 1MX4A 4LNBA 1TNYA 2XENA 1E7VA 3R9AB 3IBEA 4GTMA 2ETBA 3FUHA 3DEPA 3U4TA 2J9QA 5A23A 3CGHA 2VGEA 5HI7A 3ESKA 5A6CA 1S64A 2ETAA 5BNWA 4GTRA 3Q4AB 2QZAA 3T5XA 3ZNGA 2IOLA 3F6QA 2J4BA 4BX9A 3QB2A 5CHEE 5ARGA 4XE0A 3EIQC 1QZ2A 5DBKA 3CHRA 2DCPA 2DYRE 4I6JA 1BPOA 3AS5A 5FZRA 4OAUC
chains in the Genus database with same CATH topology
4YDEA 1N4QA 1TNOA 3E33A 4L9PA 2H6GA 1O1TA 3C72A 3DSVA 1LD7A 1KZOA 3SFXA 1SA5A 3EUVA 4GTOA 1NI1A 1JCRA 3PZ3A 1D8DA 3DSSA 3HXEA 1TNZA 1N95A 3HXBA 3E30A 1DCEA 4EHMA 1LTXA 4GTQA 4GTSA 3HXDA 3Q7AA 1D8EA 3Q7FA 1S63A 1JCQA 1X81A 3PZ1A 1TNUA 3Q79A 1MZCA 4GTTA 1QBQA 1N94A 4MBGA 3DSXA 1FT2A 1SA4A 1TN6A 3DSWA 3Q78A 3DSUA 2H6IA 2H6FA 3DRAA 3E37A 3KSLA 4GTPA 3Q75A 4LNBA 1TNYA 3HXFA 1LD8A 1N4PA 4GTMA 3DPYA 1TN7A 2BEDA 3EU5A 1O1RA 1FPPA 2IEJA 2R2LA 4GTVA 3DSTA 1S64A 3KSQA 4GTRA 2F0YA 2ZISA 1TNBA 1N4RA 1O1SA 1O5MA 2H6HA 2ZIRA 3SFYA 1NL4A 1N4SA 3Q73A 3PZ4A 1FT1A 1JCSA 3HXCA 1TN8A 1KZPA 1N9AA 3E34A 3PZ2A 4YDOA 3E32A 4LNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDE A;  1N4Q A;  1TNO A;  3E33 A;  4L9P A;  2H6G A;  1O1T A;  3C72 A;  3DSV A;  1LD7 A;  1KZO A;  3SFX A;  1SA5 A;  3EUV A;  4GTO A;  1NI1 A;  1JCR A;  3PZ3 A;  1D8D A;  3DSS A;  3HXE A;  1TNZ A;  1N95 A;  3HXB A;  3E30 A;  1DCE A;  4EHM A;  1LTX A;  4GTQ A;  4GTS A;  3HXD A;  3Q7A A;  1D8E A;  3Q7F A;  1S63 A;  1JCQ A;  1X81 A;  3PZ1 A;  1TNU A;  3Q79 A;  1MZC A;  4GTT A;  1QBQ A;  1N94 A;  4MBG A;  3DSX A;  1FT2 A;  1SA4 A;  1TN6 A;  3DSW A;  3Q78 A;  3DSU A;  2H6I A;  2H6F A;  3DRA A;  3E37 A;  3KSL A;  4GTP A;  3Q75 A;  4LNB A;  1TNY A;  3HXF A;  1LD8 A;  1N4P A;  4GTM A;  3DPY A;  1TN7 A;  2BED A;  3EU5 A;  1O1R A;  1FPP A;  2IEJ A;  2R2L A;  4GTV A;  3DST A;  1S64 A;  3KSQ A;  4GTR A;  2F0Y A;  2ZIS A;  1TNB A;  1N4R A;  1O1S A;  1O5M A;  2H6H A;  2ZIR A;  3SFY A;  1NL4 A;  1N4S A;  3Q73 A;  3PZ4 A;  1FT1 A;  1JCS A;  3HXC A;  1TN8 A;  1KZP A;  1N9A A;  3E34 A;  3PZ2 A;  4YDO A;  3E32 A;  4LNG A; 
#chains in the Genus database with same CATH topology
 2J08 A;  3GZ1 A;  4U0Z A;  1N0R A;  1H2U A;  1X5B A;  4GZC A;  4L9P A;  2VJ8 A;  4U8V D;  3NB2 A;  1SA5 A;  2J49 A;  1IQU A;  3HXE A;  2AXV A;  3AG3 E;  5CBO A;  3ZU7 B;  3LEW A;  3T8M A;  4ZHB A;  1JWG A;  3RU0 A;  3HVE A;  4EEC A;  3FTX A;  3UIN C;  3FTW A;  3S7B A;  4XI0 A;  2IQC A;  3ZN3 A;  2I9C A;  1OWN A;  2R03 A;  3QJZ A;  4ILG A;  2WXO A;  2YQ8 A;  3IV0 A;  1JPL A;  2H6I A;  1Z3Y A;  4G25 A;  1Y6I A;  4DX2 A;  3L16 A;  2WMO A;  3HXF A;  1OUV A;  3B7S A;  4HBD A;  3CKC A;  1A17 A;  4I1A A;  4KMO A;  4BTA A;  2IU1 A;  1H6K A;  3KSQ A;  2XEH A;  4P29 A;  1H6P A;  5CRU A;  5D0O D;  4EPZ A;  2H6H A;  2ZIR A;  5EN5 D;  2J09 A;  4BT8 A;  4KXK B;  3PEU B;  2BTD A;  1SQM A;  2WXR A;  3FUJ A;  4LUN U;  4G1T A;  2YHC A;  1PY1 A;  3I4R B;  1HG5 A;  3LS8 A;  5EKQ D;  3CST A;  5G04 J;  4FP7 A;  3ULY A;  1D8D A;  1LF8 A;  2ION A;  4HXI A;  4I1M A;  1N95 A;  3UTM A;  3RIB A;  3NZS A;  2EIN E;  3UM0 A;  1INZ A;  1H2V C;  3MV2 B;  3QC1 A;  2WVI A;  4O6F A;  2XPY A;  4YND A;  4BX8 A;  1X81 A;  1DC2 A;  2R59 A;  2XGO A;  1QBQ A;  2VYI A;  1FT2 A;  1TN6 A;  3CSF A;  4HNA D;  4EBA A;  1DVP A;  1IYG A;  2VQ2 A;  2ETC A;  2XS1 A;  1IQR A;  4JPS A;  1KLX A;  3V30 A;  3CVU A;  3OTN A;  4N5C A;  4PUC A;  3FTV A;  4TUM A;  3FEY A;  3W9G A;  5EDS A;  2R05 A;  3NOC D;  3UIO C;  2Y1L E;  2P9U G;  3FUK A;  3Q15 A;  5G04 C;  1NZN A;  2KCL A;  1S0P A;  3SFY A;  5G05 C;  3B13 A;  3V2O A;  5AYW D;  3VTX A;  2AVP A;  2AWI A;  5FIO A;  4CYM D;  2C2L A;  3EIJ A;  4ILI A;  3SGH A;  3E34 A;  5CMW A;  3PNT B;  2KCV A;  2BKK B;  3WXX A;  4OVV A;  4TV3 A;  2HO1 A;  3D9M A;  4GCN A;  2H6G A;  4HOU A;  5LCW C;  1WY6 A;  3N71 A;  4CT4 A;  4LNU D;  1UN8 A;  4Z68 A;  3ZW3 A;  4WAF A;  2KZT A;  5ENR D;  5AAR A;  5KBA A;  3APC A;  2B0O E;  1HX8 A;  4DRX E;  3FTS A;  1U3C A;  4JW1 A;  4YVO A;  3Q7F A;  3LDZ A;  2C0L A;  2IOS A;  3URZ A;  5G05 J;  1NP7 A;  2BUG A;  1HXI A;  4ZFH A;  4B0Z A;  4DX7 D;  3JQ0 A;  1JUQ A;  1SVX A;  3BQO A;  2CHX A;  3NOG D;  1Z6T A;  2F8Y A;  1LD8 A;  2IFU A;  4U07 A;  3CVV A;  1XNF A;  5KWD A;  4K5B A;  5KJN A;  3EHQ A;  2WXL A;  4EZK A;  3UMV A;  1O5M A;  1B89 A;  2WXP A;  3TWQ A;  4AXH A;  3TGO A;  1MX2 A;  1FT1 A;  4L1B A;  3CLJ A;  3HXC A;  4BFR A;  5CCL A;  1EPU A;  1IXV A;  3UIP C;  4NAC A;  3SQV A;  2X3M A;  3FY4 A;  5AJD A;  2VGX A;  4A1S A;  1P5Q A;  5AQA A;  2XPI A;  4L2L A;  2IJG X;  3DSS A;  4JB8 P;  3UKR G;  3ZYQ A;  3CVL A;  3CVX A;  1UW4 B;  4GPK A;  3NQP A;  2LXM A;  2KBX A;  1LTX A;  3RRM B;  4UI9 K;  4MS6 A;  2AXZ A;  4I9C A;  1ELK A;  4UI9 C;  4PS8 A;  4TXQ A;  5DIZ A;  4U8H A;  5FQ7 A;  3LY7 A;  4I6E A;  3JXI A;  4GTP A;  3TWW A;  2OCC E;  4ACL A;  4O1O A;  3UT7 A;  2XRZ A;  4XZ4 A;  4AJW A;  1E8X A;  3C3O A;  3QWP A;  2KAT A;  5EYP F;  4UQZ A;  4JHR A;  4GTV A;  2VSO E;  4KVO A;  5D66 A;  4FLB A;  2V0P A;  4B93 B;  3W9F A;  2L6B A;  2OVB A;  2RG8 A;  3I4G A;  3Q73 A;  2CHZ A;  3UM2 A;  4KVM A;  4DLQ A;  4KT6 B;  4GMR A;  4GZ5 A;  5FQ8 A;  2FEZ A;  4RG6 A;  3ABM E;  4YDO A;  3RAU A;  3CHP A;  5T8I A;  5AAO A;  1UJK A;  2BKG A;  3SF4 A;  4WNE A;  2CG3 A;  4J0U A;  3SI5 A;  4ANV A;  2UY1 B;  4C0E A;  4LSZ E;  3IHV A;  3LYA A;  3LXU X;  5FQ4 A;  3B7R L;  3EDT B;  3S7D A;  1Z5S C;  3FH8 A;  3NBN B;  1TNZ A;  2MHK A;  2Y0B G;  3CK7 A;  4K0R A;  3RO3 A;  2M63 A;  3RO2 A;  4C0M A;  3PUK A;  4V3I A;  2AJA A;  3FU0 A;  2XZT G;  4GA2 A;  4K03 A;  2LNI A;  4H7X A;  1FVF A;  2EIK E;  1N0Q A;  5CRV A;  3TL5 A;  5LFA A;  5JA4 D;  4X8Q A;  3TXM A;  2F37 A;  3GZS A;  5ENN A;  4DJA A;  5BXO A;  3U9W A;  2WXM A;  4PS7 A;  2RD0 A;  3LKU A;  3X2Q E;  4BSZ B;  3JUE A;  1N11 A;  2IF4 A;  4CT0 A;  4G8K A;  2X6F A;  4ACK A;  4AVX A;  1V55 E;  3DST A;  2WPV A;  2IY0 C;  1H2T C;  4ABN A;  4J7W A;  5AQ9 A;  3PDN A;  3I5P A;  1MHQ A;  1TJF A;  4GU5 A;  5J90 A;  2XS8 A;  5CER B;  4M7C A;  4TXP A;  2L9B A;  4MKT A;  5KJM A;  3CHS A;  3Q9N C;  4FU3 A;  5HRY A;  2R02 A;  4I17 A;  2GRL A;  4ANW A;  2P9I G;  3FTU A;  5LP0 A;  1TJC A;  5T3R A;  4AV7 A;  3B7T A;  4MLP A;  3MGB A;  2VSY A;  1UG3 A;  4GYO A;  4U0U A;  3MKQ A;  4E6H A;  5ENT D;  3PNL B;  2ZGG A;  4N39 A;  3CK9 A;  4DPR A;  5ENO D;  3QNK A;  2ZXW E;  2DZN A;  4JL0 A;  3FUD A;  4HI9 A;  3APF A;  3SY2 A;  5KJK A;  3FUM A;  3TWV A;  3DBS A;  3ML9 A;  5AEN A;  2HM8 A;  3PRE A;  4JHK A;  4UWG A;  1IKN D;  3DXK G;  1E7U A;  4WWP A;  4NRH B;  2F0Y A;  1E8Y A;  4HRM B;  3CHM A;  4APO A;  1NL4 A;  3S7J A;  3T9K A;  2P9K G;  2I1K A;  3HIZ A;  1BLX B;  4FUL A;  3SFZ A;  2GRN B;  4UQX A;  2A4Z A;  3FFL A;  3HRA A;  4XI9 A;  3DSV A;  1SZA A;  3TAX A;  3PZ3 A;  2QYU A;  3U66 A;  3D9K A;  3NAW A;  2WQ7 A;  2WXH A;  1Q2Z A;  3ZIM A;  2A5E A;  4I6G A;  1HZ4 A;  4BTB A;  4G24 A;  1SA4 A;  2EIJ E;  4TUU A;  3JQ1 A;  3B95 A;  2WXQ A;  3AJI A;  1KT0 A;  2V5F A;  3UXG A;  3UPV A;  3FUE A;  4BY6 A;  4I1O B;  4I43 A;  2L0T B;  2EQX A;  3D9O A;  1O1R A;  5FTP A;  2WXJ A;  4F1S A;  5AJL A;  5ITZ F;  2WQ6 A;  4Y6W A;  3B7B A;  1TNB A;  2VSX E;  3ZXS A;  4DI4 A;  3FU6 A;  1HFA A;  1MYO A;  3T5V A;  1JCS A;  3RSE G;  2XGS A;  3J5P A;  2FUL A;  1NA3 A;  1BI7 B;  3PS6 A;  2KXP C;  4YDE A;  3KS2 A;  2DZO A;  4E85 A;  1ELR A;  3MYV A;  3Q47 B;  4WND A;  3CHQ A;  5IY5 E;  3C72 A;  2XHE A;  3L17 A;  5CED B;  5ANL A;  3UT4 A;  4AM9 A;  1YA0 A;  5H7P A;  4GA0 A;  4EHM A;  2HYZ A;  2YHE A;  4OVU A;  2DYS E;  4N2S A;  3ZYK A;  3R7Q A;  5AQB A;  3U3W A;  4CCA A;  1MX6 A;  3HYM B;  2B6C A;  3EHN A;  3TG5 A;  1MZC A;  4GZ3 A;  3AS8 A;  4J8D A;  3DSX A;  2OVF A;  3AG4 E;  3P2B A;  2F8X K;  3ZXP A;  2XZD G;  3Q78 A;  1ZU2 A;  1TYQ G;  3EHM A;  4QFV A;  3R9M A;  1H6O A;  5FQ6 A;  3IHY A;  1ELW A;  2A5U A;  4HS2 A;  4A3T A;  3GW4 A;  4JVS A;  3SBT B;  3QAR A;  5CBN A;  4YDY A;  5FJY A;  2X6K A;  5ENS D;  4U8Y D;  2FO1 E;  1HE8 A;  5FWQ A;  5JHA A;  3SBS A;  2DVW A;  3ZPJ A;  1UJJ A;  2JAB A;  4RVB A;  1TN8 A;  2YNQ A;  3UUX A;  2PNN A;  1OY3 D;  4HLL A;  3CVY A;  3UM3 A;  1OT8 A;  5A7D B;  3DPD A;  3G2T A;  4N5Q A;  2MOW A;  2DBA A;  1O1T A;  4G11 A;  2VGX B;  5LOZ A;  3FUL A;  3SFX A;  3CKB A;  3CEQ A;  1WG0 A;  2P58 C;  2RFM A;  4J6I A;  3D9H A;  3G2V A;  2OEV A;  3RK6 A;  2PM7 A;  3TWT A;  1DNP A;  3IKO B;  2V8S E;  1WAO 1;  2CHW A;  3FHE A;  3ABL E;  5BXU A;  3OXL A;  4U63 A;  3EU9 A;  3HDX A;  3FUF A;  2OEW A;  3ML8 A;  3CVW A;  4GML A;  2Y4T A;  5M72 A;  1JCQ A;  2WXK A;  5JJ7 A;  1OWO A;  2PQN A;  3QK0 A;  4LRZ A;  3QDN A;  3UM1 A;  1OWM A;  2GRO B;  1NFI E;  4UWK A;  3ESL A;  2XCC A;  1U3D A;  4U0S A;  4B8C B;  1N4P A;  3QWW A;  3DPY A;  3J5Q B;  5D2M C;  2IO2 C;  3C5R A;  2VTB B;  2IEJ A;  2P2C P;  5KNH D;  4JHJ A;  4BER A;  4EQF A;  2Y69 E;  2P9P G;  1N4R A;  4J8Y A;  5C1D A;  1HU3 A;  3ASF A;  1N4S A;  3ASD A;  4GB9 A;  1K1B A;  3PEV B;  4RLY A;  4YDW A;  2CG2 A;  2CFZ A;  4JA9 A;  1FVH A;  2UWJ G;  2XGM A;  3KD7 A;  5BT1 A;  4YVQ C;  2X6J A;  4WNG A;  5ENP D;  3FU5 A;  5C2Y A;  4IN3 B;  3S7F A;  2KM4 A;  2VSN A;  4ANX A;  4FJZ A;  3OAW A;  3VLE A;  3ENE A;  2ZGD A;  5HQ8 A;  1IHG A;  4ATZ D;  3CVP A;  2ILR A;  3E30 A;  2DIW A;  5AQ7 A;  4EZL A;  3ONK A;  3L08 A;  2NC9 A;  4NIK A;  4OYS A;  3FUI A;  4DX6 D;  4F1P A;  1KT1 A;  2WXG A;  1PAQ A;  3P1U A;  3PZD A;  3GZ2 A;  3MV3 B;  4TRQ A;  2FO7 A;  2L6J A;  5JMN D;  1ZBP A;  3CQG B;  5JHB A;  1GW6 A;  4G23 A;  1XGW A;  3DSW A;  4RSY A;  5LCW J;  4F7A A;  3D9N A;  4APF A;  3E37 A;  3SD5 A;  2LAH A;  1K3Z D;  1OXJ A;  4U04 A;  4JA7 A;  4HI8 A;  4LEU A;  1KPS B;  5ARF A;  2R2L A;  4WNF A;  2LAI A;  4FA6 A;  5KNG A;  1D9S A;  4BET A;  4GZ6 A;  3O4Z A;  4HB5 A;  3SZ7 A;  2YIN A;  1MQS A;  4C48 B;  1IHB A;  3ULQ A;  4G26 A;  2VTB A;  3SHF A;  4F3V A;  1EF1 C;  3CR3 A;  3IXE A;  2GRQ B;  4JEH A;  2R17 C;  4Q69 A;  3E32 A;  3MCX A;  4LNG A;  1L5J A;  3Q5M A;  3LPZ A;  4XX5 A;  3ASH A;  3UQ3 A;  3ZHE B;  4D10 C;  3EUV A;  4W9R A;  3D9I A;  1NI1 A;  4NUR A;  4CRW A;  3BG0 B;  3ZUV B;  4N2Q A;  3D9J A;  3HXB A;  4FAD A;  1E8W A;  3QAQ A;  2EIM E;  2KZT B;  1DCE A;  3O48 A;  3V79 K;  4GYY A;  2J4D A;  4J8S A;  3FWV A;  4GPM A;  4CZ2 D;  3NZU A;  1PC2 A;  3SNX A;  5FIN A;  4I2W A;  1HH8 A;  2QFC A;  4FLH A;  1E96 B;  1YMP A;  4A63 B;  3WG7 E;  1UN9 A;  2RFA A;  3SO8 A;  4IYP A;  4UWF A;  4H7Y A;  4HFG A;  2I1J A;  4J8E A;  4F6R D;  2X6H A;  3FTZ A;  3RKV A;  4N3B A;  4BWR A;  2L0I A;  3CHO A;  5B1A E;  3MJW A;  2NSZ A;  4AOF A;  5EIL A;  4U96 D;  3JUI A;  3AS4 A;  3LY9 A;  3DWL G;  3LVQ E;  3RRN B;  4FHK A;  4I2Z A;  2V4L A;  3ONL A;  4HOT A;  3HHM A;  3L6A A;  2GRP B;  3CQC B;  3TJP A;  1N9A A;  2J8S D;  1RW2 A;  3VLD A;  3PZ2 A;  4PDX A;  4JXT A;  3B7U X;  3MZL B;  3KEA A;  3CK8 A;  4JC8 A;  1H19 A;  1A5E A;  2KC7 A;  3D9P A;  3VLF A;  2JLB A;  3TWS A;  4G2V A;  4GTO A;  5ANR A;  5ENQ D;  5KCM A;  3NF1 A;  1SZ9 A;  1UOH A;  2CFU A;  3D3M A;  3KEZ A;  5BW8 C;  4WWN A;  1AWC B;  2WQH A;  1K8K G;  3HXD A;  2OND A;  1S63 A;  2X6I A;  3E4B A;  2XCB A;  3Q79 A;  4GTT A;  3BUA A;  4FC8 A;  5EX3 A;  3G2W A;  3C3Q A;  3L54 A;  3DRA A;  3AG1 E;  1K1A A;  1HF8 A;  3FDH A;  4HRN A;  3Q75 A;  3UKU G;  4U95 D;  4XKC A;  4G8L A;  4PH4 B;  1N54 A;  4BES A;  3U64 A;  3EU5 A;  2BF0 X;  4GYW A;  4RQI A;  5BPP A;  2AW6 A;  3ZGQ A;  1OWP A;  2LO6 A;  3TWU A;  4DX5 D;  1O1S A;  4M3O A;  4KZ0 A;  4A55 A;  3PZ4 A;  3TG4 A;  5J08 A;  2WXF A;  3L82 A;  1QYM A;  2VGY A;  1EDU A;  3QWV A;  4LCT A;  1E90 A;  2RKK A;  3AG2 E;  3ZKJ A;  2LSV A;  5AN8 A;  4UI9 J;  4ILH B;  2QC9 A;  4HRL A;  2P9N G;  3EJN A;  4U7E B;  4UUC A;  3TXN A;  3HG0 D;  4B94 A;  4AEZ C;  4AY6 A;  3MKR A;  1MJ0 A;  5BV0 A;  4GAA A;  3ABK E;  4CGW A;  1JWF A;  1N52 A;  3GYZ A;  1OWL A;  3QKY A;  3EHR A;  2FBN A;  2GGF A;  1YYH A;  3ASG A;  3DXM G;  4GTS A;  3LCA A;  3Q7A A;  1D8E A;  1OCZ E;  2KCK A;  3V31 A;  3K9I A;  5EID A;  5T4Y A;  3S2A A;  2WXN A;  2XRY A;  4CGV A;  3D9L A;  3PUJ A;  2HE0 A;  4DLO A;  3KSL A;  1VDY A;  3UX4 A;  1RZ4 A;  3V2X A;  3FTY A;  4N3A A;  3FH5 A;  5CEA A;  3BU8 A;  3APD A;  4AY5 A;  4FHJ A;  4OAV B;  1E8Z A;  2ZIS A;  3G2S A;  5JJT A;  4DI3 A;  5BV1 A;  2HR2 A;  3TWR A;  3JXJ A;  3PE3 A;  4B89 A;  1EYH A;  4UWL A;  3LY8 A;  2QY7 A;  4HQD A;  1S70 B;  4GMJ A;  3PH0 C;  4Y6C A;  5HS0 A;  3PE4 A;  5B1B E;  3ISM C;  4IUL A;  2LSU A;  2ZU6 B;  3PRZ A;  3RRU A;  3LJ3 A;  2EIL E;  4DX1 A;  4GZD A;  5BUZ A;  3TWX A;  5JJ6 A;  4HLE A;  4AIF A;  3CIA A;  3R7R A;  2GRR B;  4PS3 A;  2V4H C;  2OV8 A;  4JEU A;  1Y8M A;  2PL2 A;  2LUH A;  2DWZ A;  5G55 A;  2XQ0 A;  4WUY A;  1SW6 A;  4XKB A;  3MKQ B;  1OCC E;  1V54 E;  2GW1 A;  1TNU A;  3QOU A;  4CDN A;  2MYO A;  1N94 A;  3Q49 B;  4L7T A;  1QNF A;  4TXR A;  4L2Y A;  2H6F A;  4MRU A;  3G2U A;  3C3R A;  3MX3 A;  4XEI G;  3ASO E;  4QQI A;  3BEE A;  3OXG A;  4JZY A;  3FP3 A;  2QYJ A;  1OCO E;  4A1G A;  4ANU A;  4F53 A;  4EBA G;  4Q94 A;  5CCM A;  4BT9 A;  3CVQ A;  2AXU A;  2WXI A;  4IRU A;  3OXF A;  5B3S E;  1BU9 A;  4J8F A;  4ME2 A;  2XPZ A;  5KJL A;  2GRM A;  2P9L G;  3ASN E;  3FU3 A;  5D0Q D;  4KYO B;  3ZYL A;  5CEC B;  4EZJ A;  1KZP A;  1OCR E;  4L23 A;  2FF4 A;  3ZVV A;  3RJV A;  5CMY A;  3DEO A;  3I3N A;  1N4Q A;  3Q9U C;  1TNO A;  1ZB1 A;  4R7L A;  3E33 A;  5G2N A;  4NQ0 A;  3ZYM A;  3T8K A;  3VTY A;  3L13 A;  3L22 A;  1KZO A;  4N3C A;  3FH7 A;  5EIB E;  2WB2 A;  3LJN A;  5LX8 A;  1JCR A;  2P9S G;  4URK A;  3JCK C;  1HG2 A;  1BI8 B;  4C9B B;  2C0M A;  4K5C A;  3BG1 B;  3FEX A;  1AP7 A;  2IO3 C;  4WWO A;  3LVR E;  4DK5 A;  3ZRH A;  4LG6 A;  2FI7 A;  4RG9 A;  4DUI A;  4BSX A;  3UT8 A;  1G3N B;  4HOR A;  1U2V G;  3DSU A;  3HVE B;  2E2E A;  4LER A;  4CDM A;  4HOS A;  4B8A A;  2I6H A;  3AU4 A;  3CVN A;  5E75 A;  2PM6 A;  4HOQ A;  4UQY A;  5FZQ A;  1HO8 A;  2Y4U A;  5FT9 A;  4BEP A;  1DCQ A;  4KZC A;  3PVL A;  4ATG A;  1TN7 A;  2BED A;  1Z3X A;  4KBQ A;  1FPP A;  2J07 A;  4HVB A;  3L9T A;  3CV0 A;  5EX0 A;  3KAE A;  2XEV A;  4O1P A;  3FUN A;  2PQR A;  3AAA C;  1YCS B;  2WMN A;  1WDY A;  1W3B A;  4GCO A;  4K5A B;  4AP2 A;  4CEM A;  2PZI A;  3ZHE A;  2E0I A;  2NXP A;  3MEK A;  2NYJ A;  2WM9 A;  5E76 A;  2Q7F A;  2XEE A;  3ZEF A;  1HS6 A;  4UWH A;  3JYS A;  2MRI A;  2I2O A;  3ZFW A;  2Y3A A;  4O60 A;  1TEZ A;  1NA0 A;  2LXL A;  4FJY A;  2R5S A;  1LD7 A;  2OOE A;  2UY1 A;  3IEG A;  3UI2 A;  1TR4 A;  3C98 A;  3ULE G;  1BD8 A;  3AU5 A;  5HKP A;  4GTQ A;  4XIF A;  4CDR A;  5AIJ A;  4JD2 G;  4GA1 A;  1WM5 A;  3PZ1 A;  2X38 A;  3MA5 A;  2JEK A;  4MBG A;  1QQE A;  5EYL A;  4A3V A;  4I9E A;  2V5Q C;  1FCH A;  5FZS A;  4Q96 A;  1H0A A;  1MX4 A;  4LNB A;  1TNY A;  2XEN A;  1E7V A;  3R9A B;  3IBE A;  4GTM A;  2ETB A;  3FUH A;  3DEP A;  3U4T A;  2J9Q A;  5A23 A;  3CGH A;  2VGE A;  5HI7 A;  3ESK A;  5A6C A;  1S64 A;  2ETA A;  5BNW A;  4GTR A;  3Q4A B;  2QZA A;  3T5X A;  3ZNG A;  2IOL A;  3F6Q A;  2J4B A;  4BX9 A;  3QB2 A;  5CHE E;  5ARG A;  4XE0 A;  3EIQ C;  1QZ2 A;  5DBK A;  3CHR A;  2DCP A;  2DYR E;  4I6J A;  1BPO A;  3AS5 A;  5FZR A;  4OAU C; 
#chains in the Genus database with same CATH homology
 4YDE A;  1N4Q A;  1TNO A;  3E33 A;  4L9P A;  2H6G A;  1O1T A;  3C72 A;  3DSV A;  1LD7 A;  1KZO A;  3SFX A;  1SA5 A;  3EUV A;  4GTO A;  1NI1 A;  1JCR A;  3PZ3 A;  1D8D A;  3DSS A;  3HXE A;  1TNZ A;  1N95 A;  3HXB A;  3E30 A;  1DCE A;  4EHM A;  1LTX A;  4GTQ A;  4GTS A;  3HXD A;  3Q7A A;  1D8E A;  3Q7F A;  1S63 A;  1JCQ A;  1X81 A;  3PZ1 A;  1TNU A;  3Q79 A;  1MZC A;  4GTT A;  1QBQ A;  1N94 A;  4MBG A;  3DSX A;  1FT2 A;  1SA4 A;  1TN6 A;  3DSW A;  3Q78 A;  3DSU A;  2H6I A;  2H6F A;  3DRA A;  3E37 A;  3KSL A;  4GTP A;  3Q75 A;  4LNB A;  1TNY A;  3HXF A;  1LD8 A;  1N4P A;  4GTM A;  3DPY A;  1TN7 A;  2BED A;  3EU5 A;  1O1R A;  1FPP A;  2IEJ A;  2R2L A;  4GTV A;  3DST A;  1S64 A;  3KSQ A;  4GTR A;  2F0Y A;  2ZIS A;  1TNB A;  1N4R A;  1O1S A;  1O5M A;  2H6H A;  2ZIR A;  3SFY A;  1NL4 A;  1N4S A;  3Q73 A;  3PZ4 A;  1FT1 A;  1JCS A;  3HXC A;  1TN8 A;  1KZP A;  1N9A A;  3E34 A;  3PZ2 A;  4YDO A;  3E32 A;  4LNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...