1NI1A

Imidazole and cyanophenyl farnesyl transferase inhibitors
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
publication title Discovery of potent imidazole and cyanophenyl containing farnesyltransferase inhibitors with improved oral bioavailability.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 108
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ni1A00
3HXEA 3HXDA 2H6HA 3KSLA 1TNBA 4GTRA 3Q79A 2IEJA 3PZ3A 4L9PA 1LD8A 1QBQA 1N9AA 3E34A 1S63A 1FT2A 1TNZA 1O1SA 1N94A 3Q78A 1O1TA 4YDOA 3HXBA 1D8EA 4GTSA 3Q73A 2ZISA 1N4QA 1TNOA 2R2LA 2H6IA 1TNYA 3HXFA 3DSWA 4GTQA 4EHMA 3Q7FA 1MZCA 3HXCA 3PZ4A 2H6GA 1JCQA 4YDEA 3DSUA 2ZIRA 3DSTA 1TN8A 4GTOA 1N95A 4GTPA 4LNGA 1TNUA 1JCRA 4GTVA 1LD7A 1SA5A 3Q75A 3Q7AA 3PZ2A 1SA4A 2H6FA 3C72A 2BEDA 3DSXA 3E37A 3E33A 1FT1A 2F0YA 3E32A 1O1RA 1S64A 1X81A 3EUVA 3E30A 1KZOA 1DCEA 3PZ1A 3KSQA 1O5MA 1FPPA 1D8DA 1NI1A 4GTTA 3DPYA 4GTMA 1TN7A 1TN6A 1N4SA 3SFYA 1JCSA 1KZPA 4LNBA 1NL4A 3EU5A 4MBGA 1N4PA 1LTXA 1N4RA 3SFXA 3DSVA 3DSSA 3DRAA
chains in the Genus database with same CATH superfamily
4AJWA 4BX8A 2DZNA 4KT6B 3BU8A 2KCLA 2WXMA 3ASNE 3E4BA 2XS8A 2KBXA 5D2MC 4IULA 4CGVA 2OVBA 5FZRA 1EYHA 3MX3A 3FU5A 1S70B 3TL5A 1D8EA 4LERA 5JHAA 4LSZE 2IFUA 1FVFA 4JHRA 2E0IA 1TNYA 2LSVA 4GCNA 4FADA 1MZCA 3EHQA 4AM9A 5B1AE 3CVQA 1N95A 2VQ2A 1HE8A 4YNDA 3W9GA 4JC8A 5BXOA 2L6JA 2VYIA 2DZOA 3IBEA 1H6OA 1EPUA 4LRZA 3G2UA 1KT0A 4NIKA 3ASHA 3G2VA 4Q94A 1SA4A 1FT1A 3FUMA 3JUEA 5LOZA 4H7YA 1A5EA 1HFAA 3LY8A 4BX9A 4XE0A 4PS3A 2P58C 4GMRA 3SFYA 4GPMA 3LJNA 3UXGA 5AIJA 2EILE 3HXDA 4FHKA 3EHRA 4I1AA 5EKQD 2DIWA 1EF1C 3R9MA 3L17A 2ETCA 1QBQA 5CEAA 2JEKA 2XQ0A 1DNPA 2IU1A 1E8ZA 4ME2A 2WXNA 1GW6A 2R02A 2DWZA 2AXZA 1UN8A 3L22A 3V2OA 3DSWA 4I9CA 4RG9A 3J5QB 2CFUA 1U3DA 4C0MA 1TN8A 1QQEA 1U3CA 4UQZA 3CVPA 4GZ3A 3K9IA 4N2QA 4U0UA 1E8XA 4HI8A 3CGHA 5JJ7A 3CVNA 2CFZA 1ELKA 3FUEA 3SD5A 2CHZA 4E6HA 5A23A 5FINA 4JHKA 3I3NA 1IQUA 1O1RA 5H7PA 4LG6A 4KVOA 5HS0A 3KAEA 3ESLA 1P5QA 4IRUA 3KSQA 1O5MA 3S7JA 5A6CA 1NI1A 4GTTA 3CLJA 2WXIA 1TN6A 4MRUA 3QK0A 3CSTA 4LEUA 3FUHA 1G3NB 4MBGA 2VSYA 5JMND 3SFXA 2Y3AA 4EZKA 3DRAA 3ONKA 3TGOA 4HOSA 1BPOA 3AS4A 3HXEA 3MKQA 2WXLA 1K1BA 4B0ZA 5EN5D 1H0AA 1XGWA 4DUIA 1RW2A 5EDSA 1X5BA 5FIOA 4NRHB 3CKBA 1JWGA 4GCOA 1N94A 3C98A 4J8YA 3RKVA 3FUDA 5ENOD 3VLEA 2X38A 3HXFA 2ETAA 3EJNA 3EU9A 3QWPA 3RAUA 3FDHA 5B1BE 1JCQA 1JUQA 4FA6A 2X6JA 2UWJG 4GTPA 2AVPA 2F37A 4U8VD 1BLXB 3UKRG 4K5CA 3FTYA 3VTYA 5J90A 2X6KA 3GZSA 1XNFA 2ZXWE 3NBNB 1FVHA 2B0OE 2IO3C 3D9HA 3PE4A 3NZUA 4ANXA 5BV0A 1E8WA 3DPYA 4U63A 1WY6A 4B8AA 3ZEFA 4DRXE 3QWVA 3MV2B 2HO1A 1AP7A 4CYMD 4W9RA 3C3OA 4GAAA 2HE0A 2AXUA 1H6PA 3ENEA 3JXJA 1WG0A 3CHRA 3MJWA 1MQSA 3L9TA 2QFCA 3ZFWA 2VTBB 4HOQA 2BKGA 3FU6A 1OWMA 4GTSA 1WM5A 1IYGA 4CDRA 2H6IA 1N11A 3MKQB 3Q7FA 5T3RA 3SY2A 4ANWA 1H2VC 1BI8B 4HORA 2PL2A 5AN8A 3HIZA 5C2YA 4FHJA 4G1TA 4TXRA 2J9QA 3MYVA 5KJNA 1W3BA 4HLLA 4Y6CA 3TG5A 2VJ8A 5DIZA 2V4LA 4KBQA 5LCWJ 2OOEA 5ENTD 2WXRA 5CMYA 2WQ6A 2PM6A 1OUVA 3SNXA 3EUVA 3CEQA 1IXVA 4APFA 1UG3A 4FLHA 5AARA 3CHPA 5FQ7A 2P9SG 3EU5A 4UI9C 2C0LA 1OCRE 2Q7FA 4U96D 5AJLA 3DSSA 2LNIA 4GYWA 1NFIE 1QYMA 5KJKA 1E7VA 5AQAA 4TXPA 1LD8A 4N39A 4N5CA 4CT4A 2WPVA 3L54A 2J4DA 4NACA 4APOA 2NXPA 2RFAA 3CIAA 3B7SA 4A63B 3PUKA 4YDYA 2FO1E 2V4HC 3Q5MA 1PAQA 4H7XA 3HVEB 4FJZA 5ARGA 3FUKA 2YINA 4HB5A 3UT7A 3FTSA 2IQCA 5FQ8A 5CHEE 3PZ2A 5JJ6A 3LPZA 4U0SA 1SZAA 2YHCA 1ZBPA 5G05J 3L6AA 1Y6IA 3MCXA 4BT8A 3ZYQA 3N71A 2F0YA 2FF4A 1MYOA 1VDYA 3U64A 4KMOA 3E30A 2IY0C 4OAVB 4YDWA 3FH7A 3TWWA 4G23A 1ZB1A 1TN7A 2Y4TA 2XGOA 3MV3B 2FBNA 4CCAA 3ML9A 4OVUA 3VTXA 3I4GA 1N4RA 4J7WA 5G04J 2F8YA 3FH5A 1DVPA 2XGMA 3B13A 2WXOA 1WAO1 5E75A 4O6FA 4DI3A 3QAQA 4BT9A 4GTRA 2KM4A 2I6HA 2IEJA 4ZFHA 4N5QA 3NF1A 3T9KA 3PEVB 4DI4A 1O1TA 1ZU2A 2V8SE 3ZHEA 2R2LA 5HKPA 3LYAA 3ABLE 3PZ4A 3VLFA 4M7CA 4WWPA 5KWDA 2H6GA 3LVQE 3QOUA 3U4TA 2ETBA 3AU4A 2XS1A 3R7RA 5AJDA 3D9PA 2FULA 1YMPA 3OAWA 3APCA 3Q7AA 3RRNB 2Y4UA 3CVUA 1BU9A 3EDTB 2ONDA 5AAOA 3FEYA 3G2TA 4MS6A 4WWOA 3LXUX 4U8YD 4WNGA 4JL0A 2R5SA 2XZDG 2WXPA 3LJ3A 2QC9A 5CCMA 4A3VA 1IKND 3DXMG 4KVMA 4A3TA 4AY5A 5KNHD 4CDNA 4U8HA 2VGYA 4GA1A 2PQNA 4JEHA 1U2VG 3L13A 3P2BA 4JB8P 5IY5E 3UT4A 1TR4A 4GZDA 4WWNA 3GZ2A 4HS2A 1LTXA 4M3OA 4JHJA 2KXPC 3GW4A 1UW4B 5B3SE 4F1PA 3WG7E 1TNBA 3KS2A 2X3MA 3TWRA 4B8CB 2MRIA 3UIOC 5M72A 3O4ZA 3PVLA 3JQ0A 5ENPD 4I9EA 3ZUVB 4A55A 1K3ZD 5HRYA 1UJKA 3LS8A 4C0EA 2DYRE 2IONA 3HYMB 2WB2A 3Q73A 5AQ9A 4YVQC 1N4QA 2DYSE 2E2EA 5FQ6A 3ZYLA 2P9UG 1E7UA 3PH0C 4J8SA 4U7EB 2DVWA 2X6IA 5FZQA 4I2ZA 5BUZA 4JEUA 2P9LG 2WMOA 4ILIA 5KBAA 2J8SD 3SF4A 3Q75A 4HLEA 3ZHEB 4G25A 5A7DB 3JXIA 3UM3A 3D3MA 3PEUB 4JA9A 3OXFA 3DWLG 3BG0B 2CHXA 4EPZA 4HOTA 4UI9K 3PUJA 4WAFA 5KJMA 1OY3D 3UINC 4BETA 3QB2A 4ZHBA 4BTAA 2VGEA 4OYSA 3UM1A 4HNAD 3FUNA 3ASOE 2ZU6B 5G2NA 3LVRE 1OCOE 3MGBA 3CVWA 5HI7A 3ZIMA 4G11A 1OCCE 2WMNA 4CRWA 4TRQA 4O60A 3APFA 1YA0A 5BW8C 3VLDA 4L2YA 2AW6A 3FY4A 2Y0BG 1NZNA 5JHBA 3E34A 5BV1A 1EDUA 2KCKA 4GYYA 3U9WA 1TJCA 2VTBA 2A5UA 5CBOA 3ULEG 1OWPA 3D9IA 4AVXA 5FTPA 1OCZE 3BEEA 5J08A 4KXKB 4XKCA 5DBKA 3MEKA 2GGFA 4DPRA 1NA3A 2RKKA 1HH8A 4GTOA 4RLYA 2HYZA 3FU0A 3RRUA 3C3RA 1Z5SC 5CMWA 2KZTB 3LCAA 4HFGA 2CG2A 4BEPA 3OXLA 2XEEA 2QY7A 2LXMA 3F6QA 3ASGA 4NQ0A 4JVSA 2VGXB 3ML8A 2XPIA 4ATGA 4GZ6A 1K8KG 5EIDA 4GYOA 3ESKA 3PNLB 3ULQA 2FI7A 5C1DA 3CHSA 1D9SA 2L9BA 1H2UA 4DJAA 4LNBA 2WVIA 3S7DA 4GMLA 3U66A 2GRRB 1JPLA 4LCTA 3D9MA 4C48B 2GRNB 5ANRA 4UQYA 5G05C 2MHKA 3FHEA 4EQFA 2JLBA 3Q79A 2YQ8A 4UWHA 4BY6A 3FTVA 1N9AA 1LF8A 1FT2A 4K5AB 5D66A 1O1SA 4U04A 4KZ0A 4HXIA 2GRMA 4G8LA 2XEVA 3ONLA 3URZA 5ENNA 4F3VA 2C2LA 5ENSD 3QJZA 3CHOA 3CHMA 3HHMA 4K5BA 2LAHA 3TAXA 4FU3A 4PS8A 2GROB 3HVEA 2ZIRA 5G04C 2DBAA 1MX6A 4B94A 2GRQB 1LD7A 2NC9A 5HQ8A 4FJYA 5D0QD 4AEZC 1N54A 2LXLA 3V79K 3JCKC 3SHFA 3X2QE 3P1UA 2LSUA 3QDNA 4IYPA 3D9KA 1SZ9A 4JD2G 4HQDA 3FTWA 1ELWA 2NSZA 4HRNA 3QWWA 4F53A 3DBSA 3UUXA 2RD0A 3PZ1A 3IXEA 3Q4AB 2CG3A 4GTMA 3NOCD 5FZSA 4UUCA 2OVFA 1E8YA 3AAAC 1NL4A 4PH4B 2WQHA 2EIKE 3NB2A 3B7RL 4I43A 2J4BA 4QFVA 4BSZB 3OXGA 4O1PA 5BNWA 4BTBA 4RG6A 1SW6A 3Q49B 2B6CA 3L08A 3TWQA 1S63A 4K03A 2OEWA 3S7FA 1OWNA 1INZA 2UY1B 3EIJA 5EX3A 3CHQA 2QYUA 2XRZA 1Z3XA 5FJYA 3UKUG 3RJVA 3J5PA 1OT8A 1HS6A 4ILGA 3Q15A 4FULA 3DSUA 5CERB 2A5EA 2V5QC 3T8KA 4AOFA 2BUGA 2IJGX 4U07A 3CQCB 3QARA 1BD8A 3PZDA 2KCVA 1UJJA 2J07A 2P9NG 2XGSA 3AJIA 3DSXA 5KNGA 1V54E 1Z3YA 1IQRA 2LO6A 2I1KA 1S64A 3V30A 3FEXA 5EYLA 4EECA 3AS8A 5LFAA 2OV8A 3CVYA 3JQ1A 4P29A 3ZVVA 3G2WA 4F6RD 4N3CA 5ANLA 4TUUA 4MLPA 1MJ0A 3ZPJA 3RK6A 3S7BA 4IN3B 3DSVA 3IHYA 4Y6WA 5CBNA 3FTZA 5JJTA 3SFZA 3CVLA 3KSLA 3G2SA 1HO8A 4HRLA 1B89A 4UWKA 4L9PA 4I6EA 5CEDB 4ANUA 3TJPA 3LY7A 4Q69A 5D0OD 3R9AB 4F1SA 4HI9A 4LUNU 3UTMA 2XRYA 4GPKA 2F8XK 1IHBA 3PREA 3ZGQA 4UWFA 1KLXA 4R7LA 1FCHA 4PUCA 4OAUC 1K1AA 4L2LA 3TWXA 4GU5A 3EIQC 3Q9UC 2PM7A 1TYQG 1QZ2A 4DX7D 3GYZA 2EINE 3ZXSA 4RSYA 3I5PA 2HM8A 2IOSA 4DX1A 2EIME 4EZLA 4KYOB 2VSNA 2IO2C 4FP7A 3JYSA 5CRVA 3W9FA 3SGHA 3UT8A 1UOHA 4G26A 3EHMA 2XPZA 4L1BA 3ZU7B 3ZW3A 5KCMA 3CVVA 2JABA 1E90A 3RSEG 4FLBA 2P9PG 1HG5A 4J8EA 3AG3E 3Q9NC 4AV7A 3MA5A 5BPPA 1N4PA 4D10C 2M63A 3UIPC 5E76A 4DX6D 3C3QA 2X6HA 4PDXA 4EBAG 2FO7A 2YHEA 3TXMA 1JWFA 1HX8A 4JW1A 3DXKG 4U0ZA 1H19A 5ARFA 2OEVA 3Q78A 4UI9J 1KT1A 1TJFA 2R03A 3D9OA 3IEGA 3LY9A 4DX2A 4DLOA 1HZ4A 4JZYA 4I2WA 4LNUD 2P2CP 3HDXA 1JCRA 4X8QA 4F7AA 3PS6A 2KZTA 3Q47B 3NQPA 3AG2E 4I17A 3DEPA 4HOUA 1Y8MA 3KD7A 3SI5A 3FTXA 3MZLB 1E96B 4GMJA 4L7TA 2BEDA 4WUYA 5T8IA 2Y1LE 2VGXA 3E33A 3GZ1A 4ABNA 3HG0D 4HRMB 4AY6A 3PRZA 4JA7A 3OTNA 3R7QA 4UWGA 4K0RA 1KPSB 3UM0A 4JPSA 2MOWA 4N2SA 1NP7A 5BXUA 3KEZA 4N3AA 4B89A 3FUFA 2I2OA 1OWOA 4XIFA 2VSXE 5AENA 2OCCE 1H2TC 1NA0A 3TG4A 4ACLA 3EHNA 3O48A 3ZXPA 3CR3A 4I1OB 3ZYKA 3LDZA 3S2AA 3PZ3A 4MKTA 4KZCA 3CQGB 2R17C 3DPDA 2ILRA 1TNZA 4FC8A 2R59A 3FFLA 2RG8A 2FEZA 5FWQA 3KEAA 4ATZD 4J0UA 5CECB 4J8DA 1PY1A 4A1SA 1Q2ZA 4EHMA 3ABME 4JXTA 5LCWC 2PQRA 3FULA 4L23A 2QZAA 3UPVA 2XCBA 3QKYA 3UQ3A 2IF4A 2A4ZA 3NZSA 2AWIA 4GTVA 4GZCA 2DCPA 3D9LA 4OVVA 5BT1A 2IOLA 2BKKB 2XENA 4E85A 5EILA 3IHVA 3FTUA 3AG4E 4NURA 4B93B 2AJAA 3E32A 1YYHA 2L6BA 1BI7B 3CK9A 4BWRA 1KZOA 4CT0A 2HR2A 4AP2A 4DX5D 2WXKA 2VSOE 3CSFA 3DEOA 4XI0A 4RVBA 3V2XA 3PNTB 3AG1E 2EIJE 4TUMA 4GZ5A 2WXJA 1SQMA 5EX0A 4ANVA 4XX5A 5AQ7A 3B7TA 4ILHB 5ITZF 3FUJA 3CK8A 1QNFA 4Z68A 3L16A 4WNFA 3ASDA 4YDOA 1N52A 5EYPF 4AXHA 4GA2A 2ZGDA 3B7BA 3SO8A 2NYJA 4XI9A 2UY1A 2BTDA 2WQ7A 4XEIG 3HRAA 3HXCA 4G8KA 2PNNA 2EQXA 2LAIA 4YDEA 3TWTA 2Y69E 1IHGA 4C9BB 1HG2A 4LNGA 4U95D 4WNDA 3ZKJA 3NAWA 1N0QA 5ENRD 3T5XA 2CHWA 1H6KA 3CVXA 2H6FA 3C72A 3UI2A 2AXVA 3ULYA 1ELRA 2RFMA 5FQ4A 2L0IA 3E37A 2GRPB 4AIFA 1V55E 5LP0A 3QC1A 2XHEA 4J6IA 1HF8A 3ISMC 2I1JA 3BUAA 1DCQA 4N3BA 1Z6TA 1OWLA 4CGWA 4O1OA 2XCCA 3BQOA 4Q96A 3D9NA 4I1MA 4HVBA 1PC2A 2BF0X 2L0TB 1HXIA 3WXXA 3SQVA 5ENQD 1MX2A 2MYOA 3ZYMA 3AU5A 3SZ7A 4TXQA 3U3WA 3HXBA 3UX4A 2ZISA 3T8MA 3SBTB 2J49A 4PS7A 3TWUA 4TV3A 4ACKA 1MHQA 4DK5A 4GA0A 1AWCB 3PDNA 3CKCA 3ZNGA 4UWLA 4I6GA 3FWVA 4BESA 3ASFA 3FP3A 3RO2A 4A1GA 3UMVA 4EZJA 4I6JA 3APDA 3RO3A 4WNEA 2P9IG 2V0PA 4EBAA 3C5RA 2WM9A 1X81A 3LKUA 3ZRHA 4UQXA 1DCEA 3RRMB 3FUIA 5AYWD 3B95A 4XZ4A 1FPPA 1D8DA 2XPYA 1RZ4A 3BG1B 1L5JA 1JCSA 4HBDA 4QQIA 4DLQA 5FT9A 4G24A 2QYJA 3JUIA 1S0PA 3QNKA 3IV0A 2C0MA 2X6FA 2XZTG 3L82A 4YVOA 2YNQA 5JA4D 2H6HA 1HU3A 2WXGA 2WXQA 3UM2A 2GRLA 3CV0A 2GW1A 2I9CA 3NOGD 3IKOB 3T5VA 3CK7A 3FH8A 3LEWA 2R05A 3TWVA 1N0RA 2LUHA 4BERA 3AS5A 1TEZA 4V3IA 3D9JA 1SVXA 2J09A 1WDYA 1TNOA 4RQIA 4BFRA 3RU0A 2XEHA 4URKA 4GTQA 2WXFA 3ABKE 2KATA 1YCSB 3DSTA 1A17A 4XKBA 1TNUA 1UN9A 5KJLA 4CEMA 1SA5A 5T4YA 4G2VA 3I4RB 3RIBA 5EIBE 5CRUA 3TWSA 5CCLA 2PZIA 5G55A 3TXNA 2V5FA 2WXHA 5AQBA 4CDMA 3ZN3A 1MX4A 3V31A 3PE3A 1DC2A 2ZGGA 2KC7A 5LX8A 1N4SA 4BSXA 2J08A 3FU3A 1KZPA 3SBSA 3MKRA 4CZ2D 2P9KG 4GB9A 4J8FA 3B7UX 1OXJA
chains in the Genus database with same CATH topology
3HXEA 3HXDA 2H6HA 3KSLA 1TNBA 4GTRA 3Q79A 2IEJA 3PZ3A 4L9PA 1LD8A 1QBQA 1N9AA 3E34A 1S63A 1FT2A 1TNZA 1O1SA 1N94A 3Q78A 1O1TA 4YDOA 3HXBA 1D8EA 4GTSA 3Q73A 2ZISA 1N4QA 1TNOA 2R2LA 2H6IA 1TNYA 3HXFA 3DSWA 4GTQA 4EHMA 3Q7FA 1MZCA 3HXCA 3PZ4A 2H6GA 1JCQA 4YDEA 3DSUA 2ZIRA 3DSTA 1TN8A 4GTOA 1N95A 4GTPA 4LNGA 1TNUA 1JCRA 4GTVA 1LD7A 1SA5A 3Q75A 3Q7AA 3PZ2A 1SA4A 2H6FA 3C72A 2BEDA 3DSXA 3E37A 3E33A 1FT1A 2F0YA 3E32A 1O1RA 1S64A 1X81A 3EUVA 3E30A 1KZOA 1DCEA 3PZ1A 3KSQA 1O5MA 1FPPA 1D8DA 1NI1A 4GTTA 3DPYA 4GTMA 1TN7A 1TN6A 1N4SA 3SFYA 1JCSA 1KZPA 4LNBA 1NL4A 3EU5A 4MBGA 1N4PA 1LTXA 1N4RA 3SFXA 3DSVA 3DSSA 3DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HXE A;  3HXD A;  2H6H A;  3KSL A;  1TNB A;  4GTR A;  3Q79 A;  2IEJ A;  3PZ3 A;  4L9P A;  1LD8 A;  1QBQ A;  1N9A A;  3E34 A;  1S63 A;  1FT2 A;  1TNZ A;  1O1S A;  1N94 A;  3Q78 A;  1O1T A;  4YDO A;  3HXB A;  1D8E A;  4GTS A;  3Q73 A;  2ZIS A;  1N4Q A;  1TNO A;  2R2L A;  2H6I A;  1TNY A;  3HXF A;  3DSW A;  4GTQ A;  4EHM A;  3Q7F A;  1MZC A;  3HXC A;  3PZ4 A;  2H6G A;  1JCQ A;  4YDE A;  3DSU A;  2ZIR A;  3DST A;  1TN8 A;  4GTO A;  1N95 A;  4GTP A;  4LNG A;  1TNU A;  1JCR A;  4GTV A;  1LD7 A;  1SA5 A;  3Q75 A;  3Q7A A;  3PZ2 A;  1SA4 A;  2H6F A;  3C72 A;  2BED A;  3DSX A;  3E37 A;  3E33 A;  1FT1 A;  2F0Y A;  3E32 A;  1O1R A;  1S64 A;  1X81 A;  3EUV A;  3E30 A;  1KZO A;  1DCE A;  3PZ1 A;  3KSQ A;  1O5M A;  1FPP A;  1D8D A;  1NI1 A;  4GTT A;  3DPY A;  4GTM A;  1TN7 A;  1TN6 A;  1N4S A;  3SFY A;  1JCS A;  1KZP A;  4LNB A;  1NL4 A;  3EU5 A;  4MBG A;  1N4P A;  1LTX A;  1N4R A;  3SFX A;  3DSV A;  3DSS A;  3DRA A; 
#chains in the Genus database with same CATH topology
 4AJW A;  4BX8 A;  2DZN A;  4KT6 B;  3BU8 A;  2KCL A;  2WXM A;  3ASN E;  3E4B A;  2XS8 A;  2KBX A;  5D2M C;  4IUL A;  4CGV A;  2OVB A;  5FZR A;  1EYH A;  3MX3 A;  3FU5 A;  1S70 B;  3TL5 A;  1D8E A;  4LER A;  5JHA A;  4LSZ E;  2IFU A;  1FVF A;  4JHR A;  2E0I A;  1TNY A;  2LSV A;  4GCN A;  4FAD A;  1MZC A;  3EHQ A;  4AM9 A;  5B1A E;  3CVQ A;  1N95 A;  2VQ2 A;  1HE8 A;  4YND A;  3W9G A;  4JC8 A;  5BXO A;  2L6J A;  2VYI A;  2DZO A;  3IBE A;  1H6O A;  1EPU A;  4LRZ A;  3G2U A;  1KT0 A;  4NIK A;  3ASH A;  3G2V A;  4Q94 A;  1SA4 A;  1FT1 A;  3FUM A;  3JUE A;  5LOZ A;  4H7Y A;  1A5E A;  1HFA A;  3LY8 A;  4BX9 A;  4XE0 A;  4PS3 A;  2P58 C;  4GMR A;  3SFY A;  4GPM A;  3LJN A;  3UXG A;  5AIJ A;  2EIL E;  3HXD A;  4FHK A;  3EHR A;  4I1A A;  5EKQ D;  2DIW A;  1EF1 C;  3R9M A;  3L17 A;  2ETC A;  1QBQ A;  5CEA A;  2JEK A;  2XQ0 A;  1DNP A;  2IU1 A;  1E8Z A;  4ME2 A;  2WXN A;  1GW6 A;  2R02 A;  2DWZ A;  2AXZ A;  1UN8 A;  3L22 A;  3V2O A;  3DSW A;  4I9C A;  4RG9 A;  3J5Q B;  2CFU A;  1U3D A;  4C0M A;  1TN8 A;  1QQE A;  1U3C A;  4UQZ A;  3CVP A;  4GZ3 A;  3K9I A;  4N2Q A;  4U0U A;  1E8X A;  4HI8 A;  3CGH A;  5JJ7 A;  3CVN A;  2CFZ A;  1ELK A;  3FUE A;  3SD5 A;  2CHZ A;  4E6H A;  5A23 A;  5FIN A;  4JHK A;  3I3N A;  1IQU A;  1O1R A;  5H7P A;  4LG6 A;  4KVO A;  5HS0 A;  3KAE A;  3ESL A;  1P5Q A;  4IRU A;  3KSQ A;  1O5M A;  3S7J A;  5A6C A;  1NI1 A;  4GTT A;  3CLJ A;  2WXI A;  1TN6 A;  4MRU A;  3QK0 A;  3CST A;  4LEU A;  3FUH A;  1G3N B;  4MBG A;  2VSY A;  5JMN D;  3SFX A;  2Y3A A;  4EZK A;  3DRA A;  3ONK A;  3TGO A;  4HOS A;  1BPO A;  3AS4 A;  3HXE A;  3MKQ A;  2WXL A;  1K1B A;  4B0Z A;  5EN5 D;  1H0A A;  1XGW A;  4DUI A;  1RW2 A;  5EDS A;  1X5B A;  5FIO A;  4NRH B;  3CKB A;  1JWG A;  4GCO A;  1N94 A;  3C98 A;  4J8Y A;  3RKV A;  3FUD A;  5ENO D;  3VLE A;  2X38 A;  3HXF A;  2ETA A;  3EJN A;  3EU9 A;  3QWP A;  3RAU A;  3FDH A;  5B1B E;  1JCQ A;  1JUQ A;  4FA6 A;  2X6J A;  2UWJ G;  4GTP A;  2AVP A;  2F37 A;  4U8V D;  1BLX B;  3UKR G;  4K5C A;  3FTY A;  3VTY A;  5J90 A;  2X6K A;  3GZS A;  1XNF A;  2ZXW E;  3NBN B;  1FVH A;  2B0O E;  2IO3 C;  3D9H A;  3PE4 A;  3NZU A;  4ANX A;  5BV0 A;  1E8W A;  3DPY A;  4U63 A;  1WY6 A;  4B8A A;  3ZEF A;  4DRX E;  3QWV A;  3MV2 B;  2HO1 A;  1AP7 A;  4CYM D;  4W9R A;  3C3O A;  4GAA A;  2HE0 A;  2AXU A;  1H6P A;  3ENE A;  3JXJ A;  1WG0 A;  3CHR A;  3MJW A;  1MQS A;  3L9T A;  2QFC A;  3ZFW A;  2VTB B;  4HOQ A;  2BKG A;  3FU6 A;  1OWM A;  4GTS A;  1WM5 A;  1IYG A;  4CDR A;  2H6I A;  1N11 A;  3MKQ B;  3Q7F A;  5T3R A;  3SY2 A;  4ANW A;  1H2V C;  1BI8 B;  4HOR A;  2PL2 A;  5AN8 A;  3HIZ A;  5C2Y A;  4FHJ A;  4G1T A;  4TXR A;  2J9Q A;  3MYV A;  5KJN A;  1W3B A;  4HLL A;  4Y6C A;  3TG5 A;  2VJ8 A;  5DIZ A;  2V4L A;  4KBQ A;  5LCW J;  2OOE A;  5ENT D;  2WXR A;  5CMY A;  2WQ6 A;  2PM6 A;  1OUV A;  3SNX A;  3EUV A;  3CEQ A;  1IXV A;  4APF A;  1UG3 A;  4FLH A;  5AAR A;  3CHP A;  5FQ7 A;  2P9S G;  3EU5 A;  4UI9 C;  2C0L A;  1OCR E;  2Q7F A;  4U96 D;  5AJL A;  3DSS A;  2LNI A;  4GYW A;  1NFI E;  1QYM A;  5KJK A;  1E7V A;  5AQA A;  4TXP A;  1LD8 A;  4N39 A;  4N5C A;  4CT4 A;  2WPV A;  3L54 A;  2J4D A;  4NAC A;  4APO A;  2NXP A;  2RFA A;  3CIA A;  3B7S A;  4A63 B;  3PUK A;  4YDY A;  2FO1 E;  2V4H C;  3Q5M A;  1PAQ A;  4H7X A;  3HVE B;  4FJZ A;  5ARG A;  3FUK A;  2YIN A;  4HB5 A;  3UT7 A;  3FTS A;  2IQC A;  5FQ8 A;  5CHE E;  3PZ2 A;  5JJ6 A;  3LPZ A;  4U0S A;  1SZA A;  2YHC A;  1ZBP A;  5G05 J;  3L6A A;  1Y6I A;  3MCX A;  4BT8 A;  3ZYQ A;  3N71 A;  2F0Y A;  2FF4 A;  1MYO A;  1VDY A;  3U64 A;  4KMO A;  3E30 A;  2IY0 C;  4OAV B;  4YDW A;  3FH7 A;  3TWW A;  4G23 A;  1ZB1 A;  1TN7 A;  2Y4T A;  2XGO A;  3MV3 B;  2FBN A;  4CCA A;  3ML9 A;  4OVU A;  3VTX A;  3I4G A;  1N4R A;  4J7W A;  5G04 J;  2F8Y A;  3FH5 A;  1DVP A;  2XGM A;  3B13 A;  2WXO A;  1WAO 1;  5E75 A;  4O6F A;  4DI3 A;  3QAQ A;  4BT9 A;  4GTR A;  2KM4 A;  2I6H A;  2IEJ A;  4ZFH A;  4N5Q A;  3NF1 A;  3T9K A;  3PEV B;  4DI4 A;  1O1T A;  1ZU2 A;  2V8S E;  3ZHE A;  2R2L A;  5HKP A;  3LYA A;  3ABL E;  3PZ4 A;  3VLF A;  4M7C A;  4WWP A;  5KWD A;  2H6G A;  3LVQ E;  3QOU A;  3U4T A;  2ETB A;  3AU4 A;  2XS1 A;  3R7R A;  5AJD A;  3D9P A;  2FUL A;  1YMP A;  3OAW A;  3APC A;  3Q7A A;  3RRN B;  2Y4U A;  3CVU A;  1BU9 A;  3EDT B;  2OND A;  5AAO A;  3FEY A;  3G2T A;  4MS6 A;  4WWO A;  3LXU X;  4U8Y D;  4WNG A;  4JL0 A;  2R5S A;  2XZD G;  2WXP A;  3LJ3 A;  2QC9 A;  5CCM A;  4A3V A;  1IKN D;  3DXM G;  4KVM A;  4A3T A;  4AY5 A;  5KNH D;  4CDN A;  4U8H A;  2VGY A;  4GA1 A;  2PQN A;  4JEH A;  1U2V G;  3L13 A;  3P2B A;  4JB8 P;  5IY5 E;  3UT4 A;  1TR4 A;  4GZD A;  4WWN A;  3GZ2 A;  4HS2 A;  1LTX A;  4M3O A;  4JHJ A;  2KXP C;  3GW4 A;  1UW4 B;  5B3S E;  4F1P A;  3WG7 E;  1TNB A;  3KS2 A;  2X3M A;  3TWR A;  4B8C B;  2MRI A;  3UIO C;  5M72 A;  3O4Z A;  3PVL A;  3JQ0 A;  5ENP D;  4I9E A;  3ZUV B;  4A55 A;  1K3Z D;  5HRY A;  1UJK A;  3LS8 A;  4C0E A;  2DYR E;  2ION A;  3HYM B;  2WB2 A;  3Q73 A;  5AQ9 A;  4YVQ C;  1N4Q A;  2DYS E;  2E2E A;  5FQ6 A;  3ZYL A;  2P9U G;  1E7U A;  3PH0 C;  4J8S A;  4U7E B;  2DVW A;  2X6I A;  5FZQ A;  4I2Z A;  5BUZ A;  4JEU A;  2P9L G;  2WMO A;  4ILI A;  5KBA A;  2J8S D;  3SF4 A;  3Q75 A;  4HLE A;  3ZHE B;  4G25 A;  5A7D B;  3JXI A;  3UM3 A;  3D3M A;  3PEU B;  4JA9 A;  3OXF A;  3DWL G;  3BG0 B;  2CHX A;  4EPZ A;  4HOT A;  4UI9 K;  3PUJ A;  4WAF A;  5KJM A;  1OY3 D;  3UIN C;  4BET A;  3QB2 A;  4ZHB A;  4BTA A;  2VGE A;  4OYS A;  3UM1 A;  4HNA D;  3FUN A;  3ASO E;  2ZU6 B;  5G2N A;  3LVR E;  1OCO E;  3MGB A;  3CVW A;  5HI7 A;  3ZIM A;  4G11 A;  1OCC E;  2WMN A;  4CRW A;  4TRQ A;  4O60 A;  3APF A;  1YA0 A;  5BW8 C;  3VLD A;  4L2Y A;  2AW6 A;  3FY4 A;  2Y0B G;  1NZN A;  5JHB A;  3E34 A;  5BV1 A;  1EDU A;  2KCK A;  4GYY A;  3U9W A;  1TJC A;  2VTB A;  2A5U A;  5CBO A;  3ULE G;  1OWP A;  3D9I A;  4AVX A;  5FTP A;  1OCZ E;  3BEE A;  5J08 A;  4KXK B;  4XKC A;  5DBK A;  3MEK A;  2GGF A;  4DPR A;  1NA3 A;  2RKK A;  1HH8 A;  4GTO A;  4RLY A;  2HYZ A;  3FU0 A;  3RRU A;  3C3R A;  1Z5S C;  5CMW A;  2KZT B;  3LCA A;  4HFG A;  2CG2 A;  4BEP A;  3OXL A;  2XEE A;  2QY7 A;  2LXM A;  3F6Q A;  3ASG A;  4NQ0 A;  4JVS A;  2VGX B;  3ML8 A;  2XPI A;  4ATG A;  4GZ6 A;  1K8K G;  5EID A;  4GYO A;  3ESK A;  3PNL B;  3ULQ A;  2FI7 A;  5C1D A;  3CHS A;  1D9S A;  2L9B A;  1H2U A;  4DJA A;  4LNB A;  2WVI A;  3S7D A;  4GML A;  3U66 A;  2GRR B;  1JPL A;  4LCT A;  3D9M A;  4C48 B;  2GRN B;  5ANR A;  4UQY A;  5G05 C;  2MHK A;  3FHE A;  4EQF A;  2JLB A;  3Q79 A;  2YQ8 A;  4UWH A;  4BY6 A;  3FTV A;  1N9A A;  1LF8 A;  1FT2 A;  4K5A B;  5D66 A;  1O1S A;  4U04 A;  4KZ0 A;  4HXI A;  2GRM A;  4G8L A;  2XEV A;  3ONL A;  3URZ A;  5ENN A;  4F3V A;  2C2L A;  5ENS D;  3QJZ A;  3CHO A;  3CHM A;  3HHM A;  4K5B A;  2LAH A;  3TAX A;  4FU3 A;  4PS8 A;  2GRO B;  3HVE A;  2ZIR A;  5G04 C;  2DBA A;  1MX6 A;  4B94 A;  2GRQ B;  1LD7 A;  2NC9 A;  5HQ8 A;  4FJY A;  5D0Q D;  4AEZ C;  1N54 A;  2LXL A;  3V79 K;  3JCK C;  3SHF A;  3X2Q E;  3P1U A;  2LSU A;  3QDN A;  4IYP A;  3D9K A;  1SZ9 A;  4JD2 G;  4HQD A;  3FTW A;  1ELW A;  2NSZ A;  4HRN A;  3QWW A;  4F53 A;  3DBS A;  3UUX A;  2RD0 A;  3PZ1 A;  3IXE A;  3Q4A B;  2CG3 A;  4GTM A;  3NOC D;  5FZS A;  4UUC A;  2OVF A;  1E8Y A;  3AAA C;  1NL4 A;  4PH4 B;  2WQH A;  2EIK E;  3NB2 A;  3B7R L;  4I43 A;  2J4B A;  4QFV A;  4BSZ B;  3OXG A;  4O1P A;  5BNW A;  4BTB A;  4RG6 A;  1SW6 A;  3Q49 B;  2B6C A;  3L08 A;  3TWQ A;  1S63 A;  4K03 A;  2OEW A;  3S7F A;  1OWN A;  1INZ A;  2UY1 B;  3EIJ A;  5EX3 A;  3CHQ A;  2QYU A;  2XRZ A;  1Z3X A;  5FJY A;  3UKU G;  3RJV A;  3J5P A;  1OT8 A;  1HS6 A;  4ILG A;  3Q15 A;  4FUL A;  3DSU A;  5CER B;  2A5E A;  2V5Q C;  3T8K A;  4AOF A;  2BUG A;  2IJG X;  4U07 A;  3CQC B;  3QAR A;  1BD8 A;  3PZD A;  2KCV A;  1UJJ A;  2J07 A;  2P9N G;  2XGS A;  3AJI A;  3DSX A;  5KNG A;  1V54 E;  1Z3Y A;  1IQR A;  2LO6 A;  2I1K A;  1S64 A;  3V30 A;  3FEX A;  5EYL A;  4EEC A;  3AS8 A;  5LFA A;  2OV8 A;  3CVY A;  3JQ1 A;  4P29 A;  3ZVV A;  3G2W A;  4F6R D;  4N3C A;  5ANL A;  4TUU A;  4MLP A;  1MJ0 A;  3ZPJ A;  3RK6 A;  3S7B A;  4IN3 B;  3DSV A;  3IHY A;  4Y6W A;  5CBN A;  3FTZ A;  5JJT A;  3SFZ A;  3CVL A;  3KSL A;  3G2S A;  1HO8 A;  4HRL A;  1B89 A;  4UWK A;  4L9P A;  4I6E A;  5CED B;  4ANU A;  3TJP A;  3LY7 A;  4Q69 A;  5D0O D;  3R9A B;  4F1S A;  4HI9 A;  4LUN U;  3UTM A;  2XRY A;  4GPK A;  2F8X K;  1IHB A;  3PRE A;  3ZGQ A;  4UWF A;  1KLX A;  4R7L A;  1FCH A;  4PUC A;  4OAU C;  1K1A A;  4L2L A;  3TWX A;  4GU5 A;  3EIQ C;  3Q9U C;  2PM7 A;  1TYQ G;  1QZ2 A;  4DX7 D;  3GYZ A;  2EIN E;  3ZXS A;  4RSY A;  3I5P A;  2HM8 A;  2IOS A;  4DX1 A;  2EIM E;  4EZL A;  4KYO B;  2VSN A;  2IO2 C;  4FP7 A;  3JYS A;  5CRV A;  3W9F A;  3SGH A;  3UT8 A;  1UOH A;  4G26 A;  3EHM A;  2XPZ A;  4L1B A;  3ZU7 B;  3ZW3 A;  5KCM A;  3CVV A;  2JAB A;  1E90 A;  3RSE G;  4FLB A;  2P9P G;  1HG5 A;  4J8E A;  3AG3 E;  3Q9N C;  4AV7 A;  3MA5 A;  5BPP A;  1N4P A;  4D10 C;  2M63 A;  3UIP C;  5E76 A;  4DX6 D;  3C3Q A;  2X6H A;  4PDX A;  4EBA G;  2FO7 A;  2YHE A;  3TXM A;  1JWF A;  1HX8 A;  4JW1 A;  3DXK G;  4U0Z A;  1H19 A;  5ARF A;  2OEV A;  3Q78 A;  4UI9 J;  1KT1 A;  1TJF A;  2R03 A;  3D9O A;  3IEG A;  3LY9 A;  4DX2 A;  4DLO A;  1HZ4 A;  4JZY A;  4I2W A;  4LNU D;  2P2C P;  3HDX A;  1JCR A;  4X8Q A;  4F7A A;  3PS6 A;  2KZT A;  3Q47 B;  3NQP A;  3AG2 E;  4I17 A;  3DEP A;  4HOU A;  1Y8M A;  3KD7 A;  3SI5 A;  3FTX A;  3MZL B;  1E96 B;  4GMJ A;  4L7T A;  2BED A;  4WUY A;  5T8I A;  2Y1L E;  2VGX A;  3E33 A;  3GZ1 A;  4ABN A;  3HG0 D;  4HRM B;  4AY6 A;  3PRZ A;  4JA7 A;  3OTN A;  3R7Q A;  4UWG A;  4K0R A;  1KPS B;  3UM0 A;  4JPS A;  2MOW A;  4N2S A;  1NP7 A;  5BXU A;  3KEZ A;  4N3A A;  4B89 A;  3FUF A;  2I2O A;  1OWO A;  4XIF A;  2VSX E;  5AEN A;  2OCC E;  1H2T C;  1NA0 A;  3TG4 A;  4ACL A;  3EHN A;  3O48 A;  3ZXP A;  3CR3 A;  4I1O B;  3ZYK A;  3LDZ A;  3S2A A;  3PZ3 A;  4MKT A;  4KZC A;  3CQG B;  2R17 C;  3DPD A;  2ILR A;  1TNZ A;  4FC8 A;  2R59 A;  3FFL A;  2RG8 A;  2FEZ A;  5FWQ A;  3KEA A;  4ATZ D;  4J0U A;  5CEC B;  4J8D A;  1PY1 A;  4A1S A;  1Q2Z A;  4EHM A;  3ABM E;  4JXT A;  5LCW C;  2PQR A;  3FUL A;  4L23 A;  2QZA A;  3UPV A;  2XCB A;  3QKY A;  3UQ3 A;  2IF4 A;  2A4Z A;  3NZS A;  2AWI A;  4GTV A;  4GZC A;  2DCP A;  3D9L A;  4OVV A;  5BT1 A;  2IOL A;  2BKK B;  2XEN A;  4E85 A;  5EIL A;  3IHV A;  3FTU A;  3AG4 E;  4NUR A;  4B93 B;  2AJA A;  3E32 A;  1YYH A;  2L6B A;  1BI7 B;  3CK9 A;  4BWR A;  1KZO A;  4CT0 A;  2HR2 A;  4AP2 A;  4DX5 D;  2WXK A;  2VSO E;  3CSF A;  3DEO A;  4XI0 A;  4RVB A;  3V2X A;  3PNT B;  3AG1 E;  2EIJ E;  4TUM A;  4GZ5 A;  2WXJ A;  1SQM A;  5EX0 A;  4ANV A;  4XX5 A;  5AQ7 A;  3B7T A;  4ILH B;  5ITZ F;  3FUJ A;  3CK8 A;  1QNF A;  4Z68 A;  3L16 A;  4WNF A;  3ASD A;  4YDO A;  1N52 A;  5EYP F;  4AXH A;  4GA2 A;  2ZGD A;  3B7B A;  3SO8 A;  2NYJ A;  4XI9 A;  2UY1 A;  2BTD A;  2WQ7 A;  4XEI G;  3HRA A;  3HXC A;  4G8K A;  2PNN A;  2EQX A;  2LAI A;  4YDE A;  3TWT A;  2Y69 E;  1IHG A;  4C9B B;  1HG2 A;  4LNG A;  4U95 D;  4WND A;  3ZKJ A;  3NAW A;  1N0Q A;  5ENR D;  3T5X A;  2CHW A;  1H6K A;  3CVX A;  2H6F A;  3C72 A;  3UI2 A;  2AXV A;  3ULY A;  1ELR A;  2RFM A;  5FQ4 A;  2L0I A;  3E37 A;  2GRP B;  4AIF A;  1V55 E;  5LP0 A;  3QC1 A;  2XHE A;  4J6I A;  1HF8 A;  3ISM C;  2I1J A;  3BUA A;  1DCQ A;  4N3B A;  1Z6T A;  1OWL A;  4CGW A;  4O1O A;  2XCC A;  3BQO A;  4Q96 A;  3D9N A;  4I1M A;  4HVB A;  1PC2 A;  2BF0 X;  2L0T B;  1HXI A;  3WXX A;  3SQV A;  5ENQ D;  1MX2 A;  2MYO A;  3ZYM A;  3AU5 A;  3SZ7 A;  4TXQ A;  3U3W A;  3HXB A;  3UX4 A;  2ZIS A;  3T8M A;  3SBT B;  2J49 A;  4PS7 A;  3TWU A;  4TV3 A;  4ACK A;  1MHQ A;  4DK5 A;  4GA0 A;  1AWC B;  3PDN A;  3CKC A;  3ZNG A;  4UWL A;  4I6G A;  3FWV A;  4BES A;  3ASF A;  3FP3 A;  3RO2 A;  4A1G A;  3UMV A;  4EZJ A;  4I6J A;  3APD A;  3RO3 A;  4WNE A;  2P9I G;  2V0P A;  4EBA A;  3C5R A;  2WM9 A;  1X81 A;  3LKU A;  3ZRH A;  4UQX A;  1DCE A;  3RRM B;  3FUI A;  5AYW D;  3B95 A;  4XZ4 A;  1FPP A;  1D8D A;  2XPY A;  1RZ4 A;  3BG1 B;  1L5J A;  1JCS A;  4HBD A;  4QQI A;  4DLQ A;  5FT9 A;  4G24 A;  2QYJ A;  3JUI A;  1S0P A;  3QNK A;  3IV0 A;  2C0M A;  2X6F A;  2XZT G;  3L82 A;  4YVO A;  2YNQ A;  5JA4 D;  2H6H A;  1HU3 A;  2WXG A;  2WXQ A;  3UM2 A;  2GRL A;  3CV0 A;  2GW1 A;  2I9C A;  3NOG D;  3IKO B;  3T5V A;  3CK7 A;  3FH8 A;  3LEW A;  2R05 A;  3TWV A;  1N0R A;  2LUH A;  4BER A;  3AS5 A;  1TEZ A;  4V3I A;  3D9J A;  1SVX A;  2J09 A;  1WDY A;  1TNO A;  4RQI A;  4BFR A;  3RU0 A;  2XEH A;  4URK A;  4GTQ A;  2WXF A;  3ABK E;  2KAT A;  1YCS B;  3DST A;  1A17 A;  4XKB A;  1TNU A;  1UN9 A;  5KJL A;  4CEM A;  1SA5 A;  5T4Y A;  4G2V A;  3I4R B;  3RIB A;  5EIB E;  5CRU A;  3TWS A;  5CCL A;  2PZI A;  5G55 A;  3TXN A;  2V5F A;  2WXH A;  5AQB A;  4CDM A;  3ZN3 A;  1MX4 A;  3V31 A;  3PE3 A;  1DC2 A;  2ZGG A;  2KC7 A;  5LX8 A;  1N4S A;  4BSX A;  2J08 A;  3FU3 A;  1KZP A;  3SBS A;  3MKR A;  4CZ2 D;  2P9K G;  4GB9 A;  4J8F A;  3B7U X;  1OXJ A; 
#chains in the Genus database with same CATH homology
 3HXE A;  3HXD A;  2H6H A;  3KSL A;  1TNB A;  4GTR A;  3Q79 A;  2IEJ A;  3PZ3 A;  4L9P A;  1LD8 A;  1QBQ A;  1N9A A;  3E34 A;  1S63 A;  1FT2 A;  1TNZ A;  1O1S A;  1N94 A;  3Q78 A;  1O1T A;  4YDO A;  3HXB A;  1D8E A;  4GTS A;  3Q73 A;  2ZIS A;  1N4Q A;  1TNO A;  2R2L A;  2H6I A;  1TNY A;  3HXF A;  3DSW A;  4GTQ A;  4EHM A;  3Q7F A;  1MZC A;  3HXC A;  3PZ4 A;  2H6G A;  1JCQ A;  4YDE A;  3DSU A;  2ZIR A;  3DST A;  1TN8 A;  4GTO A;  1N95 A;  4GTP A;  4LNG A;  1TNU A;  1JCR A;  4GTV A;  1LD7 A;  1SA5 A;  3Q75 A;  3Q7A A;  3PZ2 A;  1SA4 A;  2H6F A;  3C72 A;  2BED A;  3DSX A;  3E37 A;  3E33 A;  1FT1 A;  2F0Y A;  3E32 A;  1O1R A;  1S64 A;  1X81 A;  3EUV A;  3E30 A;  1KZO A;  1DCE A;  3PZ1 A;  3KSQ A;  1O5M A;  1FPP A;  1D8D A;  1NI1 A;  4GTT A;  3DPY A;  4GTM A;  1TN7 A;  1TN6 A;  1N4S A;  3SFY A;  1JCS A;  1KZP A;  4LNB A;  1NL4 A;  3EU5 A;  4MBG A;  1N4P A;  1LTX A;  1N4R A;  3SFX A;  3DSV A;  3DSS A;  3DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...