4AJWA

Discovery and optimization of new benzimidazole- and benzoxazole-pyrimidone selective pi3kbeta inhibitors for the treatment of phosphatase and tensin homologue (pten)-deficient cancers
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
916
structure length
765
Chain Sequence
KKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNQPFSIELIEGRKVNAVQAGLFHGNEMLCKTDISVCDLPRMARLCFALYADCPIAWANLMLFDYKDQLKTGERCLYMWPSLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLTAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
total genus 212
structure length 765
sequence length 916
chains with identical sequence B
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4ajwA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ajwA03
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ajwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajwA01
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4ajwA04
3B08A 4RM8A 4AJWA 2WXLA 3N3KB 3F05A 2Z0DB 3JYUA 4BKSA 2DENB 2KLGA 5CHFA 2K6QA 2LVQA 4BBNC 1RFAA 2BWFA 2FIDA 2KDBA 3N32A 4B9KA 3PREA 4JGHB 3TCAA 4AUQC 3LJ3A 4UWLA 1WR6E 2KDEB 2MQJA 4HDQA 4W9HA 3WIMA 4F93B 1V49A 2N9EB 2K39A 2DMHA 2GOWA 2N9PC 3A4SC 3L16A 3ZRCA 4FHKA 2G4DB 3N30A 4DDID 4WQOB 4KV2A 4BVUC 5E6PA 1H8CA 5DPTA 4PS8A 2AL6A 3VUWA 4GN1A 4UWHA 1OTRB 2MBBB 3H7PB 3DVNU 5C23A 3A33B 3ZW3A 1YJ1A 5AZGA 2B3RA 3ALBA 2ENPA 4DK5A 4ICVA 4JLCA 4WJNA 1ISNA 3U30A 3UINB 3TJPA 1NI2A 3EC8A 3PFQA 1K8RB 3VUXA 2KC1A 2BWES 3TIXA 2R2QA 1YRKA 2LXAA 1ZKHA 1QASA 1AARA 5IAAC 2G3QB 4JL9A 4CYEA 1KJTA 3NS8A 4CHKA 1YD8U 2PE6B 2ZJDA 3AULA 4GOCA 3NZSA 4MGKE 2REXA 3UF8A 1V27A 3DQVA 3HK0A 3ENEA 4PS3A 1DJIA 2DMGA 2QZ5A 1WR1A 2V4LA 4K81A 4F1SA 4WJQA 4E3CA 1UD7A 2O6VA 4B6WA 3UQBA 2XBBC 1WJNA 2Q3XA 1V6EA 4NAWA 1Y8RC 2WDTB 5D2MB 3QQ8B 3QK0A 1CMXB 4A3OA 4GU2A 1I42A 3APCA 4ANVA 2MW5A 2B3AA 1WYWB 4GGQA 3OAWA 3VAWA 2NS5A 1WFYA 1WGGA 2CM6A 2K4AA 3HM3A 3DPDA 4JIOU 4WWNA 1KLVA 3APFA 1WGHA 2DX5B 2KX3A 3PRMB 3L08A 2Z0UA 4A3PA 2CKHB 3Q3JA 4F8CB 4I6NB 2HTHA 1JRUA 3AXCA 3VH4B 4G50A 1WE7A 1LXDA 4AJYB 5C1ZA 2JPHA 2ENQA 4EKUA 1P0RA 2KD0A 2D8KA 3GOEA 3LS8A 1DJZA 2AYOB 3PZDA 2GBMA 4WAFA 1Z5SB 2KJ6A 3QARA 3QAQA 4II3B 5CX3A 2K3HA 3ZLZA 1E8YA 1WXSA 3AU5A 1E7VA 1XT9B 1WGDA 1WGYA 2KHWB 4HPLB 2LVPA 3ZDTA 3APDA 1WXVA 4MDKE 5G2NA 2NPTB 3NOBA 3H7SA 1Q1OA 4ZRIA 3VXWA 3RDJA 2AWTA 3EFUA 2UYZB 1WE6A 2ZPNA 2KO3A 2MRPA 2FUHB 3ZVVA 2EKEC 3PHWB 2NVUI 3D32A 1SIFA 3KH0A 3JVZX 1UOVA 1V5OA 1WH3A 1V2YA 5LXIB 2IO1B 4W9IA 4HDOA 5J2RA 2G4SA 5TR5A 2HE7A 3VTUA 3RZFA 4IWOA 3UGBB 2KNBA 4WAAA 2K6DB 1YX5B 2HD5B 4NQLB 2LXCA 4W9FA 1A5RA 4KDIC 2IY0B 1GC6A 5DPRA 1U4AA 3OHMB 2N9XA 4HXDA 2CR5A 3LDZE 4W9CA 2LJ5A 1P1AA 2DHZA 1E8WA 2L00B 2WX0A 4DHJD 2LZ6A 4ANUA 4WEEA 1WX9A 3R66C 3PPAA 2W9NA 3WANA 2NCNA 1VCBA 4EZJA 2KLCA 3ML8A 3CMMB 4AWJA 3KYCD 1BCIA 1RLWA 2AL3A 2M8SA 3BY4B 4WJOA 2DYOA 2KDIA 2ZEQA 4BBNF 4IG7B 1IPGA 4MM3A 3JW0X 4NP9A 3NY5A 3QCAA 4XZ4A 5J17A 1FXTB 4YL8A 4K7SA 1EUVB 3RUIB 2YRBA 2BGFA 2WXNA 2LVOA 3RD2A 3T8MA 2JRHA 3H1UA 3H7PA 3IVFA 3QHTA 3U7DA 1RAXA 4P7IA 4MGZE 2OOBB 3ZRFA 2X6FA 4GMVA 4FULA 2JUOA 1Q5WB 3Q3FA 3VH3B 2BPSA 3N5AA 4FJVB 2JQZA 2K8BA 3L10B 2WXJA 1GC7A 4L2YA 4L1LA 2BKRB 5AZHA 1WI0A 1BYNA 4IW0A 4W9LA 2XK5A 4WWOA 2KKCA 4HJKA 3K9OB 4Y1TA 2M4NA 4RMAA 3TBLD 1WM3A 2GBNA 2IBIB 2C7NB 2DZKA 1GNUA 3KUCB 3CSFA 3VDZA 4FN2A 4EFOA 2MCNB 4NJ6A 4GB9A 4NQKE 3TL5A 1V81A 3RPBA 2ZKMX 2WXOA 3FDWA 1S1QB 5CCHE 1NBFC 2DAFA 2LASA 2MSED 4HK2A 4DNLA 2D11A 4BOZB 4TQ0A 1IYFA 5AEKB 3TWYA 4MGIE 5JHAA 4DDGD 2DYMA 2WX1A 3AI5A 1UOWA 3R7RA 4NY0A 3SU8X 2WXHA 4EZLA 1WXMA 1V86A 2DZMA 2KJRA 3M3JA 3SDLC 4KZCA 2Q0ZX 4NAWB 1BDYA 2IYDB 2MX2A 3ONSA 4MSQB 2QHOA 4UWGA 4LDCA 2KX0A 1WFMA 2WXKA 2AEHA 3KUZA 2FNJB 3DDCB 3VTVA 5JZEB 1A25A 3RULA 2ZNVB 3WAPA 5L95C 1DSYA 1X1MA 2KWUB 2L8JA 4FHJA 2KMCA 4KVGB 5D7GA 3A1QB 1WJ6A 2PEAA 1J0GA 3DBHI 2HJ8A 4ICXA 5HKHA 1GMIA 4II2B 1EF1A 4RM9A 3NSJA 2KMAA 4OYSA 4HVBA 4HCNB 4V11A 4NNJB 1WZ3A 1UGMA 1YQBA 2NCEA 3VVWB 1I35A 2FK9A 3F01A 3A9JB 3QWZB 3ZDMC 4CO7A 3DVNV 2MBOA 2KOXA 1S3SG 3A1QA 2I9CA 4LDTD 3NZUA 2D3GA 3UQAA 2C5LC 4W9EA 4NJ7A 5ENNA 1R4NI 4M8MA 5J18A 5JH5C 3EHVA 3VUYA 1WIAA 4GNKB 2BYVE 4XE0A 2OJRA 4G3XB 4KZ0A 3V61A 3PYCA 1Q0WB 2K25A 4NPNA 2ZVNA 4HPMB 4FLHA 2N1TE 5ANLA 3IBEA 5IA7A 1RLFA 2NR2A 1UBQA 2WXRA 5BO4B 1IP9A 2KVRA 2L76A 1C3TA 4MJJA 2M1MA 2GMIC 3SHQA 4K7UA 1T0YA 2Z0EB 4OVVA 2K8MA 4BKGA 1DJYA 1G6JA 2YLMA 3W57A 2BF8B 4KDLB 4UWKA 3IHYA 2X6JA 4ZRKA 1YIWA 1J19A 2MLBA 3GPEA 3PS6A 2WXPA 2M0XA 1V5TA 3IHPC 4HCPB 2CHXA 4TS6A 4BKTA 2KXJA 4ZDVA 2O2VB 3BINA 4XX5A 2ISDA 2C7MB 1EF5A 2NSQA 1WJ4A 2JF5A 2J0MA 3IM1A 2JXXA 3DVGX 3R3MA 1WMHA 2LD9A 1TJMA 4IM3A 2MWSB 2O6VD 4J6IA 3ZTCA 2KANA 1SGHA 1KM7A 4GDLB 4QJ3B 4TQ1A 2N4FA 2RSUA 2J7QB 2M17A 4BOSC 2DYBA 1DJXA 2CJSA 1E5WA 2KZRA 3C0RB 2EMSA 5KHQA 2NBWB 4ICWA 3PRPB 1W15A 2CU1A 2O2VA 3QX1A 4EEWA 2ENJA 2DZIA 3ZNZB 3X0WA 4BFRA 3W1SA 5H4ZA 4URKA 2K1FA 3IG3A 2CJTA 4DHJB 3V6CB 3W56A 4L23A 2KFJA 2KTRB 3ECIA 4IWQA 2V3SA 2YVCA 1WMHB 4MH0E 4LCDE 2KK8A 2L3ZA 3HM6X 3VFKA 1TZ1A 3PT2B 2GBRA 1WX8A 2UZPA 3V6EB 2MBHA 2MA9B 2KQSA 3B7YA 4IWPA 4W9KA 1PQSA 4WJPA 3RZWC 4W9GA 1E90A 4JQWC 1DJHA 3GZNI 1CJAA 3KWTA 3S2AA 4MEMA 4MJSA 3ZNID 4LT7A 4N9F4 4A55A 3KVFB 3B1LX 1MG8A 2K45A 2LRWA 3ZNGC 2WXMA 2FJUB 2ZPYA 2WXFA 3V62A 4GSWA 3NHEB 1E8ZA 2J0KA 4ANWA 3L9BA 4QAMB 1DQVA 2G45B 2L05A 2L0TA 2UWQA 3EECA 3OJ3A 1R4MI 3B0AA 3X23A 3T9LA 1RH8A 1XQQA 3A9JA 2DZJA 3WAMA 3L0WB 2WXQA 2NBVB 2VRRB 1DJGA 4UWFA 1RSYA 4LCVA 1L7YA 1WGRA 1NDDA 2N7EA 3O65B 4FBJB 3QR1A 3PTFC 1C1YB 3QR0A 4LJOB 1GUAB 2JWZA 3A9KA 5D94A 4FJYA 1RRBA 3L17A 2IO2B 1LFDA 2NBUA 3KYDD 4MSMB 3R7QA 1F9JA 3MTNB 3KWUA 4ASWC 4AP4C 4B95A 4IQHA 1H4RA 3DBSA 5JHBA 3I3TB 3RCZA 3DBLI 3QJZA 2LGXA 2CHWA 2KTFA 3ZUNA 3PLVA 4KITB 1UGKA 2IY1B 2X6HA 4WWPA 5KHOA 4QJ5B 3JSVA 2C60A 4HLEA 2FCQA 2CM5A 1UBIA 3A9KB 2D07B 5DCNA 2BYEA 2JT4B 2FIFA 3PVLA 4M8NA 3DBRI 4E71A 4IHBA 2WXGA 2R2OA 1WM2A 4K7WA 3PV1A 2I1JA 2K8HA 1WRDB 2IO3B 4NPKA 1WY8A 2JZZA 4Y1SA 3QC8B 2X6IA 1GG3A 3JSVB 3U8ZA 4EUTA 5DPSA 1QATA 2WWZA 4IC7B 4NS0A 5FR6A 5CHVC 4BGDA 4W9DA 2KQ7A 2LI5A 3RT3B 2ZCBA 2RPQA 3UIPB 3AU4A 2KWCA 1W16A 4MGYE 4PYZA 5KJ7E 2EP6A 3PLUA 3P2BA 3MJWA 2KC2A 2ZZPB 2PJHA 1L2NA 1TTNA 2KN5A 3M62B 5GMVA 4AOFA 3W1YA 2NPTA 4KSKC 1OEYA 2BKFA 4NPJA 2QZQA 2I1KA 2Z59B 3F04A 4GDKB 4KIKA 4JPSA 1YX6B 4ANXA 2KWVB 4TKNA 5E6NA 4E74A 2KTRA 3L54A 2N1VA 1VD2A 3JZYA 3DCGA 4F92B 4KSLC 3MHSD 5CCJA 1XD3B 1QZEA 2K8CA 2YOAA 4GXBA 4QJ4B 3SD5A 1BT0A 4X57B 5CTRC 3WALA 2JRIB 2LGDA 4FJZA 1EO6A 2CS4A 4I6PA 2JZ3B 4W9JA 3RYTA 4OVUA 2FAZA 1WZ0A 2C9WB 2L7RA 5H4YA 4TV3A 3DVGY 2MBEA 2X6KA 3CF6E 4M0WB 3KUDB 5CHWA 3WA0A 4ICUA 3ZIMA 4PS7A 1DJWA 4KIKB 5D6JB 1CJYA 2EMTA 3H9DA 2LGYA 3QIJA 2FCSA 4L1BA 4GDKA 5LLIA 2ASQA 2R83A 2RR9A 2BWQA 3PHXB 3ZTDA 1TBEA 4IUMB 2N1WA 2KI6A 4ZRJA 3M7FB 4IM2A 1LQBA 1KOTA 2GBJA 4DBGA 1D3ZA 3A4RA 4ZYNA 2MBQA 1TGZB 2WXIA 3ZNHB 2A5UA 1UELA 2BYFA 3L13A 3IFWB 5LXHA 2NQ3A 2LHAA 3F00A 1GJZA 5EDSA 4F7ZA 2V1YA 3TMPB 1V9JA 3V60A 3ZO5B 3ML9A 4LDTB 3VQIA 4GIVA 1M94A 1E8XA 2JVCA 3W1SC 2MP2A 1OQYA 1E7UA 3OJ4B 5AZFA 4DHZB 3UIOB 1P98A 2D10A 1Z2MA 2PPHA 1UZXB 2ZCCA 2O6VB 3QA8A 3CSTA 2XEWA 2KFKA 4K1RB 3OLMD 4HWIB 2RGFA 3DOWA 1WFJA 2J0JA 3H6NA 3K9PB 3L4CA 1V80A 1WXAA 1ZW7A 2JY6A 4PH4B 4MELA 3M63B 4FADA 1TJXA 2IZVB 2LRUA 5L83A 4EZKA 2KJHB 2RD0A 5G55A 4IM0A 2MP2B 2IO0B 4A20A 2DAJA 4G11A 3FBKA 1UH6A 2L0FA 2LWPA 5E6OA 5DPWA 2WYQA 2XK5B 2ZNVC 3WAOA 3HIZA 1LM8B 1WJUA 2LUEA 1ZGUB 2A4ZA 4LJPB 1WX7A 3PSEB 4F91B 2FCNA 4I6LB 1P9DU 4MJSB 4DWFA 4EOYA 2KFKB 3M95A 1WF9A 4G0NB 4DXAB 4XC2A 1HE8A 2Y3AA 4TUUA 2CHDA 5CCGE 1SE9A 2GBKA 2ZVOA 3VTWA 3KW5B 1J8CA 4FA6A 2Y5BB 4PYUA 4GDLA 2FCMA 2N7DA 3HN8A 4DHZE 1K5WA 2X38A 1P3QU 2KDFB 3PRZA 3VHTC 5T8IA 3PGEA 1OEYJ 2PE9A 1OGWA 3ZKJC 2D2QA 4BKSD 2CHZA 3HHMA 2C7HA
chains in the Genus database with same CATH superfamily
3AU0A 4HS6A 1NFIE 4AGPA 1JZJA 3B08A 1WA0X 4NOFA 3GSNA 5GJTH 3DHHC 1U92A 4RGNB 3ZKQD 5E1GA 4F27A 4M8QB 4K0RA 3QVAA 4OJDH 2A83B 2N9EB 2A9AA 4FYQA 2MCPL 2GTZA 3FCTA 4J3BA 4FKHA 3GB7B 1M9SA 2WB2A 3L9YA 1S9WA 2VQ2A 2HTKC 5D71H 3U4EB 4AQZA 5LBSA 4RWYH 4W9HC 4H7XA 2DVWA 2W38A 3CWIA 2C3VA 1TEGA 2E8ZA 1P7KA 2P9RA 4IMLB 4NO2B 3PNTB 3Q6GL 3H7PB 2GFBA 4I3SL 1SSNA 3HLAA 1S46A 1PVHA 4L4TD 5B3JE 4DK5A 5I16B 3RGHA 4KJYB 4L0PB 4U8VD 2QQKH 2YUZA 1RV6X 4NO5B 3GKWL 1FL6B 4FNLH 2ZKXA 2VIRB 3BESR 3DNKA 1AARA 2JXMA 1SHSA 1TZIA 3ARPA 4WEUD 5D7LD 3VFTA 4H8QA 1ZXQA 2AXJA 1U3JA 4UT6H 4U1GC 3A67H 3FB6B 3UTPE 4D10C 4POZD 1V27A 1P7QB 3CHQA 2DM3A 3BPOB 4D0CA 1N61A 2V4LA 3F12B 4KDWA 4Q9RL 3KJ4B 3PGDB 1Y07A 3IPFA 4KH2A 3VDAA 1OTTC 1DN2A 1ZT7B 1BBDH 3RWJB 5IJKC 3NJJA 4NNXB 4UQ3A 2UXGA 1MFWA 5KSAD 3WD5H 2X4PB 3OJ2C 2CM6A 5ALCL 1KLVA 3QDMD 2CGZA 2Z0UA 4YSUA 3KGRA 5KSAC 3P1VA 5BXUA 25C8L 1KLUD 3IT8D 3EU9A 1NCDH 1CIDA 1CE6B 2K1MA 4NQDA 4P06A 3U9UA 2Z0BA 4PJDB 3OMAB 1QTYT 2Q6WB 1YNLL 3Q8EA 4I5BB 5L0QC 3MRMB 1P7FA 2RKKA 3AJ7A 1RL1A 1AWCB 3QA3B 1CK0L 3HC4L 4R3DA 3LVRE 1F11A 3LS8A 3GOEA 1DJZA 2EEDA 1FORL 4P9HC 2AYOB 1I1AC 2WTPA 3QHFH 3O3AA 4MA7L 3FT4A 3O48A 1WGYA 4MCMA 1COBA 3MR9B 4LSUL 1YYML 3KPMB 4CGWA 4DERA 1WD8A 2NPTB 1W80A 1OAXH 3LHPH 1HJCA 1RJYB 1URIA 3G6AB 4J5VA 1JVLA 2EDEA 4KK6D 4PRIB 1ZLSH 3TT1H 3HG0A 3DOIA 3EG9A 4NZ8A 1IQUA 5AQBA 1JFQH 1U8JB 3K4DA 2PYEA 5E00A 5DA0B 2AERT 2VSOE 2BHFA 3EZ8A 3BAKA 2DMCA 4W9IA 5GS2D 1UTDA 4HUXB 3QRGH 4YHNA 3UTTA 3QDAA 4PBVC 1OSPH 3LXCA 2ARWA 4K3DL 4L1HA 2EIZA 5DRZA 1U8OB 2I26N 5KSBA 1UXSB 4YE0A 2OEDA 4GS7C 4ZUWB 4HIEB 2CWRA 3V4VH 1ZSDB 2W9EH 2Y1YA 3O0LA 3H3PH 1U92B 1T5XA 2ZNXA 3KGSA 2EIJE 1ETZA 5CO1A 3GIZL 2Q5BA 1YMMD 2BSEA 1EJ8A 3BWZA 2AL3A 3SY0B 5MI0C 2DYOA 3V5HA 3O4OC 4HEMA 2H6GA 3QPXL 5EBWB 4IG7B 4MNGA 3JW0X 1I1FA 3ZJVA 4JC8A 3MOQA 4ODXB 3UABA 4GW5B 3O3BA 1T3FB 3HS0A 2YRBA 4OGQC 4AH2A 3T8MA 3LMJH 1P7KB 1EAPB 3C09B 3D3VE 4IMLA 3IPBA 4OF6A 4QF1A 1MIEH 4ZSOA 3IAGC 3V7MA 4L29B 3QO0A 2NNFA 4H8WH 5ILTL 3B2UC 2R8SH 3HS0C 4Y5VA 4KHXL 1QRNB 1UA7A 2KZTB 3GB7A 2BO0A 3Q1EA 1HNYA 3A4EA 3SGDH 1GC7A 3ARGA 3CZSA 3G6DH 3AE4B 2KXPC 4AW4A 3KL0A 5DMJB 3WCYA 2GPZA 4MDIB 5BXOA 1JGVH 2XT1B 1GHFH 4O2CA 2VLJA 2V2XB 1DQQB 3U7WH 1R33A 3K81A 4MXQD 4U3XA 1A9BB 5IJVA 2ED7A 3VXRE 3IJ9A 4GLRI 4PW9A 1NFKA 1MELA 3VDZA 1TU2B 3R8QA 1AJ7H 1NBYA 4AL8H 1CGSL 2FWUA 3VGFA 2ICEB 2DBLL 4XMXA 1CQVA 5F7LB 1JWMA 4YDJA 5CS7A 2ACZB 3FTWA 2GHWB 3ASNB 2DZMA 3IKCA 1BQHG 4A63B 4XI0A 1BXVA 5CHNA 4BKTA 4W9EC 3S5LB 2IYDB 3PZ3A 1HILA 4HT1L 2XQYA 3RWJA 3MLTA 2OMVB 3VI4A 1I7RA 1IHGA 3G5YB 1CGYA 1TQWA 5DRNA 3KXFD 5IJCC 4FYTA 4A9AA 4C56C 2RIKA 4PV9A 3VG0L 4TVSa 4M8QA 3IGLA 1S7QA 3HR6A 2FUTA 2V17L 4GPKA 4N2DA 5B39A 1QFOA 1UKQA 3ZYZA 2INDC 1UJ3B 2BNUB 2VSMB 3MI6A 4ZPVA 4EN3C 3AM9A 1INZA 2APTA 1I1AA 5B3SE 3S0PA 1VB9A 5F6IB 4UAOC 2IU1A 2QEJC 4OLVL 4PGEB 5D7JD 3WIHH 3TBYB 1TY0A 4LIQE 2IVFC 2P4AB 3KXFE 1HQ4B 2YPVH 1J9SA 4M8UA 3F01A 3IU3B 3SOBH 1QAWA 4RNRA 1FL6A 4E42B 4UM8A 2UZIH 1S3SG 2MIZA 1N18A 1JWUD 3QUXD 1FSKB 4ZD3L 4W9CC 1JOIA 2F5BL 4MD5B 5E94A 5I1DB 4KPHL 1IQWH 2F5AL 3RNGC 3PYCA 3KMDA 1MCWM 2ZE0A 2OTWB 3B2VH 1BJ1H 4LCIL 4DI4A 3MROB 5T1KA 2EIZB 2XV0A 5DRZB 2R7EA 1QILA 4XVSH 5ETUB 3MYJB 2G3XA 2ERJC 3OAZH 4OVVA 3FHEA 1OCRB 2B0OE 2K8MA 1UQSA 1I7ZB 3N41B 5AL8A 2LVCA 4GBXD 5IBTH 3S3SA 1ZXKA 1EANA 2VSDA 1A7RH 3C98A 5DJCA 4RZCB 3VNYA 4YHYB 3P30L 2XKNB 1I4XA 3QHTC 4HKJB 4Z7UF 3Q48A 4HQQH 5EBWA 2MPAL 2XV3A 3QZMA 4F8NA 4QRBA 4KI1A 3PY9A 4KTEH 5BV7L 6PAZA 2NTTA 1T22A 4JFOA 5LXVA 5EC2B 1A17A 2XVGA 3UTSE 1ZSDA 4NPYB 3SDCD 1BLXB 3HI5H 4D9RE 4OLYH 1WMHA 2QSDA 4QF1B 4PB9L 4JRYD 3S34L 3GBNH 1FP5A 4J6IA 1UCBH 4NKMB 4X8JB 4GTMA 5I71B 3LKUA 4U0SA 4CZ2D 1E4WH 2EC9T 3EJQA 3WL9B 3O3AB 2KZRA 4BYHA 2GI7A 1CBVH 3GMLA 2HPOA 3OQ3B 4NRYA 1IGFL 1MJDA 3PRPB 1QSZA 2AABL 4XVTL 1RZKL 3EUVA 1WISA 4OSUH 4TLSA 4X6EB 4ORZC 3LS5H 2G5BA 3OX8B 4XWOC 2YGOA 1NSNH 1ZPSA 3ZQ4A 1MCQA 4JRYE 5A7BA 2JB6B 3Q9UC 2GAZB 1NCOA 3CK0H 3KPRD 2QILA 2PWGA 4MJ4A 1KPSB 1H5BA 4WV1C 4OZGA 5AOZA 1CF8L 4JE0A 5D7LA 1OE1A 1JDCA 4HFUH 4NQCA 5D93B 1AOZA 4L4VE 3NT0A 2OI9B 4A3OA 2DD8H 4PT5A 1PQSA 3V8CA 2BCMA 4JQWC 4QOKE 1M1XB 4I4WA 4P05A 3SFDB 1QOGA 2AXGB 2B8OT 4M1DL 4N2AA 3AEDB 1B4RA 5JW4M 2FE0A 2GY7B 4PTUB 3MMEB 5E8OA 4X6DA 5T1JA 2IDFA 2YA1A 3AUWB 3IEAA 5BZDB 4N6RA 1S9VB 1KYOJ 2YQGA 1IFGA 3GMQA 3T9WA 1HKLL 1XQQA 4N2OA 1OF0A 4ZMZA 4BFIA 4G6KH 3V10A 4F7CA 4BTAA 4A7SA 4J3UA 4FBJB 4H8VA 1PYWB 5E1IA 1R5VB 3JV5A 4UT9H 2IO2B 4MSMB 4DSYA 3MX3A 5HPMB 3W2DH 1FCCC 2QV4A 3W9CB 3CFNA 3IDNB 1UJ3A 2BNUA 4ZXBC 3HC0B 4WI0A 5CCKL 4OJFH 5KG9A 3C5ZC 2MFNA 4PV9B 2GGFA 2X4NA 4IRJC 4TOYL 5DO2D 5KHOA 3BZDA 3P77A 2VERN 3MU3A 1UVQA 5DMIL 3ZL4L 3U0WH 5DJ8B 2KZKA 3O45B 4JFTA 2EACA 4MJ5A 3ULUF 4E42A 3FQUB 5I9QC 4ZAKB 5AW3B 5ENSD 2FIFA 4L4VD 4RFOH 3TNNB 2V5SA 4MT5A 1ZVYA 4Z0XA 3MOAH 4WUYA 1FZJB 1NBVH 4P2AA 4RFEB 4EXPX 4Z7VE 4UT7H 2K8HA 4X6FA 4CAGA 2X3AA 3TWWA 3S37H 1RCYA 1TETH 1UM6H 4G6FB 1P1ZB 1X5FA 2D0GA 1OM3L 4LNFA 1CO1A 4UOJA 2LI5A 1Q8MA 3RZCC 4ABNA 3PZ4A 4TQEH 5EU3A 1W16A 5FC9A 3SCMD 4JDTH 2FX8L 3KW8A 3SDYH 2J12B 5E8NA 2XNAA 1I7UB 1IIIA 4A68A 1FL3A 2VZKB 4DGYH 5I2IB 4ODUB 1JWMB 4IRJA 3DX7B 4EI6A 3W1YA 1IEAB 3ECBA 4KIKA 2HKHH 4IHOB 3Q7AA 5FGSA 2F0CA 3O9WD 4OQ1A 4A63A 3MNVA 4ZJ9A 1FEHA 3Q3NC 1KIQB 5E6NA 2Z35B 3MYJA 4Q6IC 5DLMH 1G6RL 4XP5H 6FABH 5AENA 4NQQA 2VDLL 2CFZA 3RTLA 5I15L 2UY7A 2WQAA 5JIIA 4W9JA 3F83A 3AT8A 3DROA 5ANHA 1DSFH 2FECI 4GQ9H 4MYPA 4OFVA 4YWGH 4IRSA 3E3QE 3P11L 4NRYB 1STEA 4CUCA 5ARGA 1WSST 1OXJA 1U6AH 1TTGA 2Y2WA 3MTRA 3S7GA 2F54B 2KI6A 2XRAL 5E03A 3U6XS 4U0RC 3IFNH 1P5UB 5C9KA 3X2QE 5EZJB 1ZT1B 1HNFA 4OF3A 1H5BB 2A5UA 2CGYA 2VSXE 4M48H 8CGTA 1ADWA 2R56L 2AEIT 3RSEG 4WTZG 4HV8B 4GKSA 3V5KB 1CZ8L 1P6FA 3QJTB 1H3WM 2J53A 3K71B 1IIKA 1WBXA 4DX7D 2BSED 3LEXA 2GT9B 4Z7AA 4I6EA 1L4ZB 2EIMB 3WFCH 4BCZA 1FPTH 3RY6A 1VFBB 3MROA 5T1KB 2I5YH 3GI8H 3WIFB 1TTUA 1VSCA 3ZGQA 2KUTA 2P80A 2W9DL 1RZ7H 5DDHB 1EHKB 4DCQB 2C9AA 2BKKB 1XT5A 1MI5E 1OTUC 4MRBA 4NZUH 2E7BA 3S88H 4XNZB 4OLXL 5DQDL 1Z6TA 5IT2L 4BCYA 5LQBH 1IM3B 1DLHA 3HC3H 3ARQA 1ZGLP 5DJ0A 2OJEA 3EKCA 4BXSV 3DBXB 4FP8L 4NM8H 4AUUA 1CFMA 1HU3A 1GGTA 2FEDD 1P5QA 5L88H 1ZGUB 1F1HA 3PSEB 4KI5E 3U64A 2EZ0C 4FQPA 3GS7A 2WZAA 3AY4A 4R97C 4P9HH 5HHXL 4JRXE 4XC2A 3VTWA 3ZE1F 5ADPH 3ZYYX 2KZBA 3P0VL 4M56A 5FUZH 4FA6A 4FTVB 3KW5B 2XTJE 4L8DA 4IU3B 4HLZG 2X3MA 4DHZE 1PLCA 4QFVA 3AG1B 4HWEL 2EABA 4XNBA 5E56A 5J1AB 2BS71 2ICCA 4MACA 3N44B 1I85A 3LRKA 2WJ7A 2RCSL 3CMOL 1RIUH 3NOGD 1HQRB 4YAQA 1AXSB 1QUNB 3MLYL 3B4NA 1ZTXE 2X1WL 2CHZA 4O5LH 3T71A 1KF6B 3HBGA 2D9CA 4GG6A 4H1LG 1SJEB 1VZGA 1Q0YH 3NJIA 5DD1L 3BPNB 1KPRB 3FTXA 1GY2A 3ZZSA 2KDBA 1C79A 2ZP0T 3GZQA 3MAWA 4IK7A 3TFKD 1SYVA 3DHPA 4CBPA 1MVFA 2NY6B 2OFQA 3ZPDA 1P4BH 2BVPB 2AXGA 2WUCL 3ET9F 3ZQ9A 1Y18B 3NG5A 2IFFH 1DJSA 4HPOL 2HLEB 3DX7A 3HHRB 5I26A 3RBSA 1YEHH 2NXZB 1ETJA 4JW3A 1E65A 5IIEA 2M19A 3VUWA 1HIMH 1UA6L 2VRAA 5DS1A 3VRIA 5CBEB 1I4HA 5AYUH 4YHYC 3QJQB 4NFCA 1N9AA 4XMKL 2EILE 1QNIA 2DOCA 1Q9KA 3ILDA 1FQ9C 5T3XD 3H0TA 4ACPA 1JROA 2FX9L 5CHEE 4AYID 2VDLB 3D5OF 1IXVA 4GT7A 4BQ6A 2Q2LA 5AOIA 4PJIF 2G3QB 4JL9A 1EJ6A 3SDAA 2WCSA 5CEZE 3F85A 3KYMB 3H54A 4J28A 2K4WA 4HAKA 4NENA 2WK2A 2PABA 3VTAA 3QXVA 1UD2A 2HYZA 4LSPH 2YD5A 4L8SB 1UM5L 3VXRD 1JRHL 5J4MA 2WDQB 5CBAB 5IBUB 1C78A 4B97A 3RI7C 3QIUD 2Q3XA 5ADOH 1X7TA 3NJHA 1Y8RC 4BK5A 1OCZE 1CXFA 2WLZA 2FGZA 1P5UA 1XCXA 2B1AH 2NY1D 5IROC 5I1HL 1N0XH 5F6HJ 1BECA 4DVRL 2J44A 4A6YH 2B3AA 3FQUA 4XCYA 1EUTA 2K4AA 2KH2B 1PKQB 3H9HA 3HA0A 3BVXA 2H9GA 3APFA 5L4IA 1QFUL 3U52E 3ZYMA 3B3BA 3MJ6A 2HX9A 3NJKA 1GCYA 5AW0B 1JRUA 3VFUA 3ZE2B 2GB1A 1U8NB 1HSBA 2ADGA 2WVTA 1X5ZA 2HLFC 2VDML 3WTSA 1O9WA 3W9EB 2XGMA 3GBEA 4LCUB 3V0AC 3QRBA 2QCZA 2F9BT 1L9PA 3C6SA 3M07A 1Z5SB 3TCTA 5CX3A 4TRPL 1OANA 1QSFA 4N3CA 3C3RA 2I69A 2QGBA 5K1VA 5JNYA 1XT9B 2LVPA 1WXVA 4E41A 3DJTA 4NQ0A 2IBZX 4CC4A 3NOBA 1MWAH 4CDMA 1SXSA 3GO1L 2FZ3A 5T5NF 2IDTA 4ZTPL 4XPTH 1VENA 3K8KA 1N8ZA 2AJ3A 3PHWB 2ALAA 4ZQTA 4Y4HC 1DOXA 4KBPA 1IVLA 3QWNA 4R4BB 5FKPB 1V5OA 5BV7C 1GGCH 4DUIA 3VXSB 1Q10A 2R4RH 5HGHA 1MFVA 1PLGL 4IDJL 1ZLWH 4KK5D 3BDBA 4Y6CA 4GAJL 4TVPL 4HDOA 1ZWIA 2PYFA 4YHLH 5EBMB 5DJ0B 2WS3B 1FNVA 5BYSA 4OZ4A 3OKKA 3KS2A 5AVYB 3CZJA 4DKAA 3VXUA 4N1HB 4KZDH 3SZ7A 3UM3A 1H3TA 5HFYA 5I5IA 1OF2A 1YCSA 2IY0B 4Y4HD 1U4AA 2JJTC 1YZZA 4P46A 1HE7A 1P1AA 3MLSH 1TYQG 5KS9A 5MERA 5G4NA 1ADQA 1KB9K 1NC4D 2GUYA 3QNZB 2OQJA 2N56A 4WK2B 3OTTA 2CKBL 4R90H 5DRWA 3UYRH 1B0GB 4NCDA 1WITA 3D9AH 5ESAB 1MRCH 4NHUA 4WJ5A 5F88B 1BQHA 3ESUF 1WEJH 2X6VA 4O02H 5LFAA 2XA8L 3QCAA 5E6JA 1DVYA 4FQJH 1A1OB 4U49A 3NVQA 4YHIA 4XVJH 1NUNB 5E8PA 1EUVB 1TS2A 3BUIA 1G87A 3P0GB 4YH6A 4A6QA 4MQ7B 5F1SA 2C3HA 3IRZA 2GK2A 4DN4H 4HUKB 3NG0A 4ZK8A 4P7IA 3O41B 5IQ9A 2Q86B 2VT0A 3ZHKA 3SFEB 5F3FA 4G8KA 2XACC 3OC8A 3HC2A 1OE3A 2E9JA 2YEVB 1NGWA 3EOTH 5LGHL 1RD6A 2WXJA 1AIFA 3BK2A 5AZHA 1QD0A 3U48A 1K3ZA 1URZA 2FJFB 2G2RA 3ZHLA 2OJEB 1K4DB 5BUGA 1KENH 1SXNA 4YDIH 3NZ8B 5C6TH 1KCUH 2G0LA 1RUPL 4U04A 5HHQB 2VLLA 1PQZB 3ULQA 3ZT5A 3NP4A 1FNAA 1D6EC 2OSXA 2YN5A 2J88L 2Q7YA 2WMOA 2BZ7A 4NXKA 4RQQB 1TSRA 1V81A 3WFBL 1TEZA 2DS4A 4U0UA 4ZUUA 3UTOA 1ZVNA 1F8TL 4HF5L 4PJ8A 5GRJH 3F7VA 1TNBA 5IJKA 4I48A 3HNVH 1P5UC 5IROA 5E4OA 3EAKA 4K7PY 2DTSA 2Q87A 2XFGB 3SDLC 4UILH 2D0FA 2OYKA 4C48B 4M03A 2L7EA 4E9VA 5KVEE 4X0KB 3AH7A 2NYYD 5IOIA 2VXUH 4ZQKB 1BG1A 5FLUA 4YXKH 1K8IB 2XCCA 3MNZA 2ZD0A 5E6RB 3FU5A 1XH3B 3FRPB 1OP9A 3UT4A 1RIVH 1UM4L 4PM1A 3HE7B 2NX5E 4ODVL 4OI7A 3KHQA 3A1QB 1UGNA 4DQOH 4V2BA 1KCSH 5HHOA 2BVPA 3CFKA 2HJ8A 1M7IA 4KV5F 5CZVH 1NC4B 3ARUA 2QSVA 3ZYOA 3W9DB 3BH4A 4OYSA 4J8RA 1FNSL 3NOIA 4F57H 2KLSA 3SODB 3LCAA 3S98A 5LG6A 1J86A 2HRPL 5DVKA 5C09B 3TO2B 3FCUB 2UX7A 1ZHBA 3OAYK 2VN6A 4Z8FL 1EEQA 3AWGA 1BVNT 4UAOB 3S4SG 3FQRB 1U8QA 3MV01 3AABA 1N5YH 1WFOA 2PYFB 1CU4H 5EU6B 2EVHA 2YLHA 1NFDA 3EHMA 4XE0A 2GUOB 2KQ4X 4IRZL 1PGBA 4G3XB 3UXFA 5IBLC 5KBMA 5K69A 3MCKB 1RFDL 5E6SB 2VOTA 4CDGC 3UP6A 4TSSA 5D8JH 3STBA 3TTSA 1ORQB 1V3MA 2H6OA 3HUJB 3MLRH 3FTVA 2IAAC 2ZOLB 3DX8B 4FXKC 4ONGH 1LO5D 4OI9A 1A70A 2FWLB 5DQ9A 1AQMA 3DVIA 3IKOB 2YLMA 2ZWLT 3ULUL 3U6XA 5AVWB 4B41A 3T2PA 4G7VH 2DL2A 3RWIB 1F4AA 3GQFA 3P1UA 4JR9H 3NJNA 4NQXA 1PCXA 1G7HA 5JO5A 1ACXA 1A5EA 2PPFA 3FK3A 2AXZA 3KPSE 4NYLB 4TS6A 4XP6L 3TPKA 1AR1D 3GEFA 3Q3OC 2ADGB 1A4KB 2YINA 2EYRA 1YAZA 1YEGH 1KGYE 3PHQA 4DGUA 3MFGA 4IM3A 2MWSB 4NN6B 5K9JH 2QVIA 4QJ3B 3JV6A 3FQYA 1FC2D 2YAMA 5D7IB 2IH1A 2G9HD 1D5MB 4XPHH 4C0MA 3FFCA 1CF1A 5F3BB 1ZHKA 4XAWL 4ZFZA 1A7OL 5ABZA 2ENJA 2Q1EA 4KK9C 2DZIA 5JPMA 4YIQB 2R27A 1OARL 4URKA 1FFQA 4GKLA 4XNXH 4YSSA 2ADFH 1SA4A 4IBVA 5B39G 1AFVL 1TCRB 2YVCA 4PVMA 1T0OA 2W65A 3DBHB 1TZ1A 3MC0A 4ZS7L 1S7RB 2IEJA 4AQ7A 3T2LA 3X12B 1U95B 2NXPA 1Y6MR 2A74B 1Q1JH 2QR0A 5C07D 1XNFA 2NW2B 1D3CA 1VADB 3L4UA 3KWTA 1NGYA 2XG5A 4EDXB 2AS5M 3HRZC 2LRWA 1R1CA 2K45A 2PETA 3FUIA 3Q43A 3UZQB 2YRLA 4GO8A 2L0DA 3E1ZA 1WWAX 5AUMA 1MI0A 4QRUA 2XENA 1TZHB 1MI5D 3L9BA 4L9LC 3UPCA 2UWQA 2XPYA 1MFDH 4QHNB 5SV4A 4Z3IA 4ZQKA 2X5PA 3BKML 3I75B 3CK9A 3T0BA 3HEIB 3O65B 1KTBA 2EH8H 2VXSL 3OKNA 4HIJA 4PLKD 4TTDD 2R4SH 4AKOA 4G8FB 3FB5A 4CU8A 3PTFC 1V8CA 1K6QH 3C5JA 1TN6A 3KAAA 3FO1A 4F9PA 2IPKA 2V8MA 4GQQA 5F8RC 2Q7FA 1FC1A 1MG2C 4HWZB 4WSJA 2C26A 2YIHA 3WG7B 2Q20A 1L6VA 1CTNA 1WS7A 5D1ZC 3QXUA 3CQGB 5C86A 3R18A 3ABME 3CPUA 3QJSB 4WU7A 1E9OB 5ISZA 3MNZB 1FVFA 5E99L 5FYKU 4BH7A 4WIPA 1Z9SA 4AVHA 5IM7B 1UZ6F 1O6SB 3ELQA 3LV3A 3R8BB 1YPZE 1M7IB 3QDGD 1M3IA 2VDRB 3FW6A 4JG5A 3FKUS 3QUMB 3ARXA 3Q7FA 4G6JH 4KTDH 4NUQA 4HORA 3GJFH 2BW5A 1OEZW 4LEOB 4XKCA 5LCVH 4XKBA 2G2RB 1NGQL 5DZ9A 4ZNEE 1RK7A 4JFZH 1AKJD 2MSPA 1Q0XL 2WYTA 4E68A 2YC1A 4OF0A 4Y1SA 3U8ZA 1MUJB 1QATA 3WEXB 2VLRD 3G5WA 1JPTH 1I9RH 4PJ9A 4WO4B 4AYEC 2BT6A 1YN5A 2Q7YB 5IFAH 1I7HA 2WGXA 3F7LA 2HWZL 2KWCA 3CVVA 3SGEH 3L1OH 4LKXB 1S9KC 2W07B 4I3RL 1RP8A 1OT1A 3BPCB 3SKJH 4YNDA 1XGPA 4QYOB 4UZGA 4XXDB 5FGCE 4F58L 2Y5CA 2YAQA 4FZEH 3Q05A 1PNDA 1BMZA 1OEYA 2VCOA 5ICZA 2ZX7A 3AT0A 1X5AA 3O11A 4X80H 5KVDH 1QSFD 1K1BA 3MLWH 5F96H 1LO4L 1KXTB 1OGTB 3TIEB 3ZRCC 1E6JL 2ZOLA 1MRFL 3E8UH 5DTFA 3TP4A 2NW3A 4XCNB 1D7FA 1TYEB 1BJMA 2YOAA 4APXA 1QZEA 4JHZA 1DVPA 2HPTA 2QHRL 4BEPA 2X7LB 3NIDF 4I9WE 3AZUA 2BFVH 1LWRA 1CYGA 3HG1B 4NQXB 2OMBA 2R2HB 1NDTA 1X9RA 5GGTA 2NUTA 4YFEA 2XXFA 5KYYA 1MFUA 5M72A 5F3BA 3PE9A 3GHEH 1DC2A 4Z23A 3L3OC 5F9JB 3UAJD 3PNRB 1LF8A 2R23B 1M7XA 1ZV9A 4HUMB 3K91A 4RA3A 1H2UA 1Y6IA 2YRPA 4GKZA 3CVDA 4LRIA 4DBGA 2NNAA 3X13B 4HBDA 2DWDA 4WI3A 1J18A 5JHLL 1WSPA 5CJBA 4JWUC 1MRDL 5LXHA 4CKQA 3H8HA 5HI7A 5T5FA 1IGML 2DQHL 1A3LH 4G6FD 3DLQR 4KO9A 4PWJA 2XBDA 3MXWH 3TEZA 2QR0B 3NJVA 1NIFA 4XWGH 4BH8B 1K51A 1KGJA 2O26U 2VYRE 3W1SC 3N9GL 3FUHA 2MP2A 4WJKB 3MYZA 3D05A 5HJGA 4J8SA 3UP1A 4ELME 1UWXH 1KLGD 5DEFA 3AE5B 2D10A 4OJAA 2KYWA 2AMGA 2UYLB 4FQ1H 2JCCF 2RGFA 4YSYB 2QGEA 1NMAH 3DXAE 1V80A 5AOJA 3E33A 1PG7W 4CGTA 1A1NB 2X2YA 5KBKA 5L2KD 1NDMB 3VDBA 2NCMA 2BWDA 3LS4L 5AOLA 5KTEH 1IILE 4IM0A 1V54B 4FFYL 3STZB 4ZFOL 1U8MB 3FBKA 2G3MA 3ZX1A 1ZHNA 3QXTA 4NYLA 5D2NA 2HKFH 1WFUA 1YA0A 1Z9MA 3KPOA 5EG6C 2A4ZA 1RURL 3FT0A 3EADA 2OJZH 3RVWC 4ZFHA 3QUYD 2VDQL 3M95A 3KS0J 2W54A 4PRDB 1A6UL 1T0PB 1J8CA 1IAKA 4PRPB 2BJMH 2WU5B 2CHNA 2RTTA 1HWHB 1GXEA 2YPLB 4IK6A 1QHQA 1K5WA 4R97B 3O0RH 5HHPB 2WLMA 3TBVB 1NGZA 4PJCB 5EFIB 5LNGA 1DVTA 3UPAA 4XPGH 1P4IL 4YIQA 5D7KE 3VFWA 2C7HA 1FVCA 1A5FL 4UU9A 1ESFA 5J90A 3N3KB 3F05A 4OFDA 4QHPA 3O6LL 3TV3H 5CHFA 2XX1A 1U3HD 2ADIB 2WKLA 1KB5B 1QOAA 5E8EB 3QCTH 3PO0A 5GRWA 1DTUA 3NDYE 2HVKB 4RMVA 5F9OL 5I1AA 1MQKH 1NM4A 4XZUB 2OW6A 3ZQWA 2Y5PA 2BSRB 4A7VA 1K4CB 3GSQB 3A4SC 2RJMA 4YZFF 2P1YA 1NGYB 1G1OA 2XG5B 4EDXA 1JG9A 4LSSH 1V7ML 3DVGY 2OYMA 2YUWA 5I1CH 4JCWA 2N59A 4GXVL 1G7MB 1U9KA 4IIQC 4WHYG 1QZ1A 5G5DB 5E7FA 1KXTA 1OGTA 2DQEL 3TIEA 3TIDA 5EUOB 3WD5L 3CDGB 5I6KA 4WJNA 4DPCX 2YKKA 3MRGA 1HEHC 3O8XD 4P9ML 4YN3A 4ZMAT 4WSGA 1IGIH 4ZOAA 5IO9A 3TPUB 3UTTD 3IVKB 4LK0M 3QORA 3OMNB 5JZ7C 1N4XH 2OL3A 2RDHA 4ENEC 3EUB2 4WNFA 3RTQB 1R17A 1VF5C 2W60A 1PZDA 4EIGB 2PM6A 2V5YA 2NYJA 2WQWA 4GYWA 4FKKA 3NS8A 2XTJD 2INCC 5G05C 2IQ9H 5AIJA 1NQBA 4APOA 3CX5K 1B3IA 2WSPA 3ESKA 1YNLH 3OXGA 2UWEF 1E7PB 3EHNA 4MXQC 5HP5A 1FUNA 3MV8D 5DTFB 3ALXA 2O5NA 5EULV 3LOWA 4B6WA 1OHZA 2YNQA 3BEWB 4HUVB 4MA7H 3B7BA 5I16A 3SNXA 5LWYH 4PJHF 4HJGA 3K8LA 4P57B 2NNAB 5D2NC 3WO4B 1CMXB 2P2CP 3L4TA 3P3TA 3C72A 1UFGA 4L8SC 4PRIE 4Y19E 4ODWB 1MHHE 5KYYB 4N58A 5F7DA 3TT1L 2CGRL 1TN8A 3PWJB 4GPVA 2JWUA 5MEND 4A3PA 5DZAA 1X5LA 2BIMA 3VD0A 4JB9L 3QDGE 1I9EA 2C7UB 3CDZA 4LEXL 4G50A 1TITA 3Q13A 1Z5SC 3SKMA 2EUWA 4D9LH 2CK0L 2DWDB 3T6VA 5ESVB 3V7AE 3L9EA 4EE2A 4Q74A 1FV1A 1UOKA 1OSPL 3CFCL 4Y4FA 3G9AB 3FQNB 2BVQA 3Q3MC 3QARA 4OV5B 2K3HA 3CPLB 4DEUA 1Z9PA 2RBLA 1UB5B 1YA5A 4GBXB 5J13C 1WFIA 3CV0A 1XGPB 3APDA 1AD0B 4AQ8A 3ATEA 3BYYA 1NCTA 4XNYH 4L5FE 5DUMH 5KSUB 2Q8AH 4JFEA 3H3PL 3HFML 4X7SH 3TN0D 1CE6A 2O6CA 2BFGA 4MDJA 1MHXA 1OV8A 2C4XA 5DS8B 1BXXA 5EORL 1OP3K 1C16A 4JMXA 3N1YC 5CKAA 1KN4L 1RERA 5IKCB 1AZUA 4AG4H 2Y7OA 1WH3A 1TYRA 3ATFA 4BDVB 3QDMB 1IU1A 3U1PA 4PLNC 4IJ3C 2J42A 2WYZA 1NCAL 1KNOB 3VTMA 2KNBA 5LDSA 1KYOK 1UENA 2PTTA 3FRUB 2GY5A 4JDEA 1RJYA 3G6AA 3OHMB 1Y6NR 4PVNA 4W9JC 1ED3A 3RIAF 4YVUA 2IGLA 2DHZA 4JZNA 3VFWB 3VTXA 1S6NA 4PJBB 2ROXA 3I57A 3L5XH 4N2KA 4LLGM 4OZBA 1II4E 4S0SD 2GIXA 1ETA1 2XDHA 5HDBB 4CCAA 2X8XX 2HAZA 5K93A 2MEJB 1P1VA 4YDYA 2Z8WC 3S9DB 2XJLA 4LHUA 3BY4B 3H2WA 1I1AD 4JFUA 1NM9A 5DD6A 3FT3A 1NKRA 5DJ2A 4BH8A 3IU4H 4NP9A 2Y6TE 2WM0A 2NXYC 4M6OL 4QRFA 2WZ0A 3BT2L 2XWZA 3RZWA 4I1PA 4GI9A 5HI4D 5C0RH 2JFCA 1N62A 5HG2A 4CN1A 4CMHC 1AJ7L 3IVFA 4KO6A 1WTLA 2PCXA 2VQ1B 5E8EA 2DBLH 2OXGB 4N3TA 4E5XA 4MGZE 1T21A 4EIBA 4BUGA 3PV6B 4OJCA 3P2TA 1YG9A 5KBLA 2F74B 3VA2C 3ZE0F 4F53A 1JNJA 2NY2B 1XB6A 4UIKL 2BPSA 4OCSL 5EF3A 1S78D 1T7YA 4NM4L 2K70A 4S1RL 1KULA 2K8BA 3PP4H 3P4SB 4YLCA 2MQ0A 3ESNA 5HHNA 1BYNA 3TC9A 1I1FB 1SOQA 4IW0A 5FGBA 3OKEB 3QZBA 4WWOA 4G1MA 4RISL 1YJDH 2PW2B 4NO0B 2A6IB 4HJTA 3KVPA 2VXTL 5FECB 1FNWA 3PXJA 3AREA 5F1NA 3SPVB 1XIWA 3IV0A 4OFQA 5AAWA 3H6JA 3Q06A 4FN2A 1GGBH 4I5BA 1P5VA 2HZHA 1AKJA 4H5SB 4PRDA 4Z0BH 3RTQA 4HOSA 4HOXA 5JHMA 3L9RA 1FYTD 1T66D 1VA9A 2XG4A 4DEPB 5C3TA 2BIPA 4XPAL 1NMBL 5DJDB 3T04D 1BXUA 1JV5B 2F15A 2G3ZA 1QRND 3BKCL 3MLZL 4GTQA 2DDQH 2W0PA 1L0QA 3SU8X 2RHEA 4XXCA 1FFRA 4XC3L 2YPVL 4DTGL 1HZ4A 2A9ML 3IFOB 4K0OA 4V1DB 2CRYA 3QEGL 4DEWA 3DO7A 3I02A 5FYLD 5GRYA 2VMFA 5A2LH 1TR7A 1WG3A 3MUUA 4MJIE 4XCCL 4JFYA 1F02I 2G5UA 4QCIA 4ODWA 4JE3B 4QI3A 3KYKL 1IQWL 4JGJA 1PIGA 1TU2A 4ETYA 3NESA 5DR5L 1T7ZA 4HCRL 5FHAL 4S1SH 4XPFL 5IB5A 3A6CL 2GSGB 1X4XA 2WZ6A 5B21A 4PS4L 3ZU7B 1AD0A 1JK9A 4MCYB 3US1A 2LSUA 2BP8B 3NCFB 3NSJA 1WCBB 4FQXB 4UQAA 1VDGA 4ATTA 3GM8A 5SWZD 4N1CA 2ZCLH 1A7RL 3DURA 1F45A 3QUML 3FB7B 4Z7WF 3MBEC 1PZ5A 4N0RA 4X4ME 2PKOA 1L2NA 3QORB 4I77H 4ELMF 2KOXA 4BSVA 1KY7A 4F20A 1YN4A 1ZPLA 5F7EH 1ZAGA 4NJ7A 1NCNA 3UM2A 3VUYA 2XZAH 1JN6A 1JPFA 3FMGH 4G3YL 3OHXB 4IGBB 1S7SA 3CQCB 3BUQA 4U6YB 4MD4B 3QZLA 4LCWE 4Y16D 3CXDL 1WF5A 1A6WH 1HHIB 1ICTA 1T83C 5LNDA 3O3BB 1I75A 1U3YA 4L9DA 5DUBB 1BD8A 2BK8A 1GRWA 2ZXCA 1ED3B 1OVZA 1U3HB 4OF8A 4QHLA 3RP1A 1XVSA 1C3TA 1KJ2A 5JW4N 2GMIC 4HJGB 4CA4A 1T0YA 3D51A 2PQRA 4BT8A 3NB2A 3W57A 4EUPB 1WO2A 3IHYA 4OLEA 3AXLA 1NSNL 1IFHL 1JAEA 4OGZA 4ZRKA 3AY4C 1E3ZA 2C3WA 2QSCH 1UWEH 3OB8A 2OEVA 3QISA 3FT3B 3BXNB 4MMYA 4YBLB 1V5TA 4GMJA 4DP2X 3MRFB 2H26B 1LHZA 3BINA 4DXGA 1H15A 3L3GB 1QT9A 3SKMB 3C6LC 1OW0C 3IBOA 5DJXA 1Z0MA 2BMKA 3QEHA 3GM0A 4I2XE 1CFVH 3DETD 3L7EA 3IDMA 1DVFD 1HO8A 4Z68A 2EMSA 3NFPA 4CGUB 1MFEL 2B5IC 1QBML 1QFPA 4O2EB 3RIBA 4NZJA 1HCZA 1TENA 4WO0A 3LY6A 4MCZB 3O8XA 3ZKNC 1NOAA 4L23A 3LIZL 1A1MA 3ECIA 4ARIA 1AE6L 1WT5A 1WMHB 5DS8A 4LCDE 2PWFA 3DJRA 3QWRA 3E9SA 4RGNA 2GBTA 1BQKA 3A6BH 2VN7A 3UROR 4WH4A 2E4TA 2J1YA 3CLFL 4LKCB 1XGRA 4G7YH 2ILRA 2X4RA 1J11A 4PRBA 1WM5A 4ZRGA 2A73B 5LHDA 1D5XA 3JVGA 5DJDA 2BX5A 5TGBB 4FC3E 1FNGA 3K6SB 3VO0A 2AZUA 1AZNA 4YE4H 4RMTA 4EMZA 3U7AA 4R3SB 3GP7A 3G6JF 1JXKA 2GFBB 1YAIA 5GIRB 4M01A 4EHMA 3GHBL 3BW9A 2P26A 3MBWA 2AXHA 4LOVA 5TDPB 4WZ9A 4Z7VB 4HSCX 4ZFOB 1VZ7A 3UKRG 5ALBL 2P9LG 3TZVC 1JV5A 3MBXL 4PWGA 3VDCA 1UN9A 2XHNA 3CVLA 1XXDC 4N0YL 5JQIB 1INEL 2AI0H 3ARDD 5I1DA 5DUPL 3QORD 3IFOA 4W9DC 3R7QA 2HLFD 2J07A 3HG3A 4PLOB 3LQAL 2J8HA 2XWJA 4XI5C 1MYOA 3UH8A 3V05A 4JDTL 2KTFA 2ZUVA 3H53A 1KXVA 1ID5I 3MZLB 4U3CA 1IRAY 4C83B 2ZYSA 5FIOA 2C8NA 3B6SA 3IS0X 3CFJA 2AC0A 4H25B 4MJ6B 4W93A 3PL6D 1CTMA 1FFVA 2GBUA 3PABB 3PVLA 5HDLA 3TYGH 2JKNA 4UIMA 1URLA 4U1SB 1ZA6B 5DHYB 5HI5D 2AP2A 3IDNA 1AQHA 1WM2A 5IB2A 3DKHA 1VGEL 4BK4A 1H6UA 1BQRA 2QQKL 4CSTA 5DK0B 5C0FB 4DN3H 4K3CA 2X6IA 1GG3A 4M93B 3BP5A 3T6WA 2A1WH 4N87A 1EVTC 3NCWA 4IC7B 3FSAA 4GQ9L 3HLAB 1P5VB 4NGHL 1VFOA 3FTUA 4LNBA 4OT1H 3A67L 2A83A 3TBWB 5C0GB 3FL7A 4G0NB 5KJ7E 2EP6A 3AE6B 1CFSB 3PDOA 4GAGH 2BIQA 2DJUA 2F54E 2HTLC 5F89A 4ZAKA 5EYPF 1IKNA 1XSKA 3RX5A 1YSOA 4LRIC 1U8IA 4I1RA 4FMVA 1B89A 1WWTA 2NPTA 2WLIB 5CZKA 4NPJA 4TL5A 5CU5A 2PW1A 1JGLL 4PW3A 3SFYA 1AGFB 1C12A 4TKNA 3SHFA 3VFRB 3DO7B 5B38G 1P7QA 5JXAH 4M48L 3FQ1A 3L54A 3QAZC 1H15B 3L3GA 1VD2A 2WUBH 5EO0A 4KSLC 1TVBA 1EVUA 1MFBL 1NCBL 2Y7LA 3UAAA 4HJ1A 1CZ8H 4JN1H 2E8YA 3SYAA 1G84A 2JRIB 2CS4A 3IE4A 3EGDA 3Q78A 3W39A 5D3IB 1REIA 3O4LE 4MMYB 3N71A 2K0RA 3L3JA 5AB9A 2VLMD 4ZODA 4JHRA 5T3ZD 5AKVA 3AUVA 5GGSA 5I6LA 1WIUA 2WLYA 1DJWA 1IBGL 4FJ6A 3TJEL 3KSQA 3RWDB 4GSDH 4A7GA 4D0CB 5D6JB 5TE7L 1KBWA 1RZ7L 4D8PA 4EIUA 5I1JL 2YBGA 3SE9H 5FOBB 2E47A 1FORH 3B5HA 4UV4L 3S88L 1XH2A 1FL5B 5JDSB 1UELA 3CFEB 4QT5B 2KC0A 4FP8H 4KKAC 4Y8DC 3LHPL 2WNKA 1NLBL 4JM2D 1KCBA 3IETB 4PJGF 3BWSA 3ETSA 2J2ZA 2VSKB 3EHBD 1UC6A 4Y4KB 4B9FA 3W37A 5IFJA 1Z6JT 5B4MD 1JFQL 1UWGH 2P8MB 4FTVE 3SE8H 5ICXB 3NS1A 4WI0B 4DHZB 4XOAA 3B9EA 2IANB 3C08L 3EYOB 2YWZA 3CSTA 3WFHA 2YSSA 3ERXA 3NEEA 2BHYA 4FKEA 1A9VA 2E0IA 4NZTH 4A7TA 4DPAX 3VXNB 2ZOKA 3M63B 4FADA 3G2UA 5L83A 1HG2A 3BRDA 1XO3A 5E08H 5HBBA 5FV1L 5SWQB 4Z0XB 1JCRA 1T6BX 4O1PA 3ZO9A 2WHIA 3K71A 2IG2H 3D69B 4M3HA 4JN2B 3QZWG 4FI8A 5FO7B 1CURA 2K8QA 3ETRA 1SEBA 3H4FA 1PY9A 4U0QB 2BCKB 2AK4E 4AIEA 4AT6B 2WUCH 1UWXA 4I6GA 1T0NA 3U46A 3ARED 2FQGA 5CUSL 5TDNB 5ITFA 2FBJH 1ZANH 3GMPA 3IDMB 3SDDD 1K3IA 2EE0A 3CXFA 4YDJB 1R3LB 1ZVSB 1GL4B 2F19L 3LMJL 4C4VB 1QO3A 5HPOA 1TMCB 2WLHA 3QH3A 1EU4A 4FEIA 3QORC 3VRAB 2FX9H 4ACLA 4HXAL 5I1GL 3S5LA 3VGBA 2XY1A 1NWPA 3MSPA 3K6NA 1B0RB 1MG3C 1A8ZA 4A3TA 3G08A 2UZYB 1XR9B 3N32A 3Q6FB 3VXMA 3G6DL 4HDQA 1KUMA 4L2LA 4LSPL 1A6AA 3ZK0A 1D2OA 4WTXA 2E75C 5TGBA 3N30A 1L0VB 4C9BB 3NABL 4KV2A 2A2QT 4RGNC 3EYSH 5D66A 1SXCA 1U8IB 4NJ9L 1V1PB 5DPTA 4PS8A 4Z77A 4H88H 4GN1A 4OZIF 4YL8A 2B1AL 1EAPA 4Y1AD 4AL8L 4A6YL 1EGJH 2VLJB 3VFGH 1JHTB 5KJNA 3VGEA 4GQRA 5IB4A 1NEZB 1ZT1A 3PFQA 5CP7A 3ZDYB 3E38A 4GAYA 5MHSE 3ZE2E 4XC1L 2BNQD 5IOPB 5FYLH 1EXGA 1RZ4A 1HESA 3NAWA 2ED6A 5F8QC 5BJTA 1DVUA 2JTDA 3IF1B 4HT1H 4R7VA 9PCYA 5IMLB 4I1NB 2CPUA 3BIID 4MNQE 4C4KO 4I89A 4J39A 4M62L 4QNPF 3RNBC 4QWWD 4UNVA 4GIPD 1PD1A 5EO0B 1DUZA 2XXCB 1HHKB 2KC7A 5MEQA 3HS8A 2G4EA 1YN6B 4W9GC 5B8CB 1W8OA 1IC5L 1GOHA 5I0ZA 2LJIA 2R0ZH 3HVNA 1FL5A 2BSSB 1F2RC 4M7JL 2KCKA 2X42A 3U36A 1NAKH 2IOLA 1HNGA 4Q2JA 3EH5B 2FB4H 2PTLA 4LQ1A 1S7QB 4GZCA 2LU7A 3EHBB 2XKNA 1OCOB 1N0LA 1MLBA 3COOA 2KX3A 1RMFL 3VXSE 3BH9A 2C9VA 5D2MC 5T3RA 2Z4QB 2X09A 4GJTB 3WI9A 1XLPA 3BQVA 1UZ6E 4DO6A 4HROA 3AXCA 3AE2B 1T22B 5ICXA 1K5NA 1YPZF 1AHKA 2J8UB 1I1AB 1GW6A 2X88A 3QWRD 4F7TA 4KZEL 4NWUL 3R1GH 5IG7B 2GBAA 4L37A 4TVPH 2UZXB 2NY3D 2RR3A 5CEXA 5LDUA 4ZD3H 1P0RA 2H2PC 3CVBA 2QPSA 4KRPC 1Q4NX 3CC1A 2YMTA 1RHFA 4WUUD 2E3TA 4EI5B 3AU5A 1X5JA 2DWEB 4LCIH 1WGDA 3A3YB 2KHWB 2HB0A 4TSCH 1WUNT 1D5RA 4B9CA 4ZRIA 1DFXA 1GGUA 1PUTA 3Q14C 4KRLB 4OM0H 3T3PE 2MRPA 5JLZB 3DV4B 1TVBB 5AB0A 4TSBH 2ICES 1C4AA 1CE1H 5IJDC 2BBCA 4UNUA 1PAZA 3S35H 5T5NG 3ULVE 4X4YA 3LEVH 3J07A 4JXTA 1IC7H 5ARFA 2MKLC 1JWSB 4GS7B 3S4SB 3U30C 3VA6A 4GA2A 1EDQA 3DTUB 3HZYA 1BZ7B 1I3RA 5C1MB 2FD6L 4QO1B 2OTWA 3GXUB 4WNDA 3ZUCA 3GBNL 4PD4J 4D8PB 2LLLA 1OOAA 4GKOA 1OWWA 2LABA 4BETA 4QRSB 4KKLC 1KMGA 2L00B 2VW4A 3GLAA 2BUGA 3JWNE 1VCBA 4EZJA 2PTVA 2IO3C 3MA7A 2AABH 4GRWF 4XVTH 5PCYA 2KLCA 1R24A 1KENL 2P5EE 3QJHA 5L6YL 5GZND 4WNEA 2R61A 4LZKA 4OZ4B 1X3DA 3AM8C 1EHLL 4F3VA 1OD7A 2R0LL 3RZCB 2L7UA 3D39A 4N2MA 3GS2A 1R19A 3BIBX 4NPYA 1SZ9A 2LVOA 3U7DA 1F3JB 1HK6A 2BQQA 4IN3B 3ZDXE 3V6ZB 2X4NB 3VXMB 4YO0A 3SQVA 2RALA 2J49A 4IYKA 4GMVA 4FC8A 1ZMYA 3BSGA 2YAEA 2Y1LE 3O45A 3V6FA 3W81A 4BE6A 3TLRA 3NRFA 3RURA 1MDAA 4NRHB 5IUCA 4KXZI 2GVYA 3IRCA 5GZOD 2BM3A 2Y72A 1M4KA 1QWHA 2IV9A 3TWCH 4I4WB 1WE5A 2GSIA 3BP6B 3V4PA 2KMMA 2ZOWA 4YXKL 4RMAA 2P9IG 4KXAA 1A47A 1INQA 2DQJH 2NX5B 4G6KL 1CLCA 3WJJC 3FQWB 1SW6A 3E6HB 4RBPH 4EPZA 3W9EA 2WB7A 4ODVH 4WSKA 1S9VA 4AT6A 4NQKE 4ZXBA 1G43A 3UO1H 2PXYB 2CA3A 5IFHH 4HK2A 4BOZB 3VQLA 4TQ0A 1FVDB 2GI9A 1YYLL 2AWIA 3K6IA 4Y19D 1EXUA 3FQXA 2NXYD 2LU5A 3IN2A 4MFHA 3L6AA 4PRHB 4KZCA 1NL4A 2VDKH 7PCYA 2BY1A 3GWJA 1RIHL 2KM4A 2MX2A 2HR2A 5AB1A 3BKYL 3ONSA 4ZTOL 4L8CA 3MLXL 2ZJSH 5FYJH 5DJYB 1CU4L 2O61A 2XPGA 2BW4A 4MHHI 4FU3A 4XDDA 1FHGA 2Y5QA 4MASA 4IRZH 1UVQB 1ZT4A 3I9GH 2F1BA 5IK3B 4PJ7E 5CXPA 1LO3L 4U1LB 2XWCA 1MHQA 1A2YA 3OLIA 3F7VB 4NQEB 4QHMB 3S37L 3ZKMC 3BRFA 5D8JL 2EDWA 1JGUH 3FSOA 3Q3GB 4BSWA 1AO7A 4WI9A 5D70H 3CFIC 3GTVA 1BIIB 4P46B 1J05A 2IGFH 4X8XA 4JVUA 1XGYL 1Y1DA 4CC4C 1KCVL 1JHTA 4PJGE 2H2SC 1I35A 5EZJA 4EBAG 4DGYL 5ANMA 4JR9L 1TIFA 1HHGA 4TRQA 3LQZB 4UQ2A 5I6XC 4NX0A 2N9KA 4DK6A 2CO6B 2HKHL 3UC2A 5FLVA 2FL5B 5BS0E 4H20H 3TASA 5CGTA 2EE2A 5JH5C 2ZQKA 4M43L 3RL2A 2E7DA 3GNMH 2HTLD 3HFFA 4IKNA 4BWUA 3TM6A 5E8PB 4A04A 1KGCE 4U6VH 5D7IE 4TLUA 4U1KB 3IWVA 5FIEA 5LX8A 1KJ2H 3PHAA 1UBQA 4FG0A 2Q86A 1ZU2A 3U7YL 3QC6X 1NKGA 2DJSA 3QQ4B 3SKNB 2XCMC 5GS1A 4HB5A 4HOQA 3PWLB 5I18H 4LO9A 5D1ZA 3W1ZA 1RZFL 1HJBC 4XNXL 2A0LD 2DH2A 3H7PA 3W5VB 2WYIA 1TF4A 1UXLA 2CRZA 2CDFA 4N8PA 4NQDD 5H2BB 4HOZA 4YSEA 3W9GA 1RPKA 2CNYA 2P9UG 3EO0A 4XX5A 2DKMA 4F7TB 4X5LA 5A6IA 2BIOA 1WJ4A 4MXWL 4LLYB 4Z78B 1EZSA 1ZIAA 2R2BA 5GRUL 4BWWA 1JYNA 2LD9A 3SDAC 1N5AB 3TO4D 3JWDH 2ZUUA 4NT6B 4LVHB 5C0CB 2N4FA 3LX9A 2VITB 1LP9F 2M17A 3AEEB 3C6LB 1R3IL 4KMQA 3BGAA 2BYTA 4FG2A 1PD0A 2AHIA 4YAQB 5AW9B 5BNXD 3RI5K 3VWJD 4BFRA 3GXDA 3V4PB 2VLRA 4PJ9D 1PY4A 1ASOA 4MWFB 4PYGA 4HLJA 4NZUL 2B59B 2DB8A 4TUKH 1ADQH 2AKRA 5DQJB 3RGVC 2MTAA 1JD7A 2B7DT 3DV4A 1VFBA 3IGUA 3HC3L 1TFPA 1WGOA 2BOBA 1VESA 3KPRA 3O8XC 3BP4A 1YQ2A 2QTVA 5CJ8A 3WYRA 3WG7E 4IWPA 4G43B 4NM8L 4NQCD 3EOAB 2V5QC 4LLWB 4RGMB 4RQIA 1FVDA 4TQPA 5D4JA 3I50L 3SBWA 3DSTA 3KVFB 5C0DB 4PREB 5JIQA 4REZA 2VGXB 1JXGA 2J6EL 2WP3T 3O6KH 3WY2A 4F7EA 2ZPYA 5ADPL 2E3VA 4M02A 4PJEB 5CBEA 2X4QA 1E8ZA 3VRIB 5J12B 1U8CA 4OCWH 3Q01A 4WNJA 4Y2OB 4AY0A 4N8UA 3L0WB 2O61B 5CLTA 2RCSH 5AW4B 4EVNB 7PAZA 1L7YA 5C08A 1SE4A 3QR1A 3QR0A 1GUAB 1QR1A 3A9KA 2ETBA 2X1QA 2XTSA 4YVQC 3DBXA 3LKNB 2QDVA 3KWUA 4PJHE 1YOVB 3ZXSA 4L8SA 3H1ZA 2IH3B 3QS2A 3DBLI 5FKAC 4YSQA 4ILIA 2HJ1A 4I3RH 2F53B 1TJFA 4DF9A 2B4CH 5KS9F 1M7DB 2C60A 2AV7A 2OYLA 2N0SB 4HLEA 4G6AC 4P2CG 2HX8A 5TH2A 1OTSD 3PE3A 1GJUA 2CAKA 1S5IL 4OCYL 5CN3A 4HKZB 4AENB 2H3XC 1C8PA 1XCTL 5CF3A 1KLGA 1MRFH 3CVCA 5HI3C 4MAZA 5I1KL 4A1SA 4NKOB 4XX1E 2VKWA 2YD9A 1MNUH 3W11C 1U8NA 5AUKA 1DVSA 1SJEA 3L45A 5I24A 1OSZB 1F6LL 3GSXA 1HXYB 4WY7L 4ERSH 5JMOC 2DI7A 4X9GA 2EVIA 3AACA 4BH7B 1QLBB 2H88B 3RT3B 4X7FC 2VSYA 3MJWA 3GHEL 3V6OE 3QQDB 5EE1A 1Y18A 4ODSH 2KN5A 3DX6B 4J0UA 3NUKA 4FFVD 2QKSA 4TQ1A 3LKRA 4Y4KD 1KTDA 1NGXB 5BQ7A 1N6QL 1FLRL 2CA4A 2CJOA 3MBED 6PCYA 3CDFA 2WDVB 2DQHH 1WC7B 4R83A 2CO2A 1OT8A 1TZGL 4ELMB 2C9XA 1BT0A 1QFUH 4XBGB 4PLKC 3CVPA 4WI7A 1C08A 1KXQE 3BLKA 3CZLA 3J7HA 3QIBC 5IW3A 4AK1A 1ORSB 2L7RA 1DO5A 1OGAB 2VXVH 2WKOA 1C9SA 1ZD6A 5F9DC 5KANG 3N85H 4ZX5A 3DXAB 4FQ1L 3UZQA 5F7HA 3O11B 1NMAL 1GZQB 2E46A 1V54E 4HIXH 1TZHA 3LS4H 5TD4A 2L0TB 3ZT7A 1HSBB 5KTEL 2OQJB 4JG9A 1TGZB 4TNWF 2WXIA 4J6RH 5FO9A 2AFNA 2ZUXA 3ZNHB 2Z1KA 3WJJA 4JG1L 1X6NA 5IHBA 3H9HB 2QL1A 1V9JA 3ML9A 1R3HB 2EE9A 1B9RA 3VQIA 4UBDD 4KQ4L 1E8XA 1OAZL 3KL3A 1IJ9A 3WHXB 4PRPE 4AVJA 5FDWA 1NANH 1JYVA 5GZNA 4E41B 1WIPA 4N2LA 5BS0D 1A6UH 5BRZD 1EM7A 1LILA 3IAPA 4N0UA 5DHEA 1CGUA 1JMXA 2PPHA 4PJEA 2CLVA 4GAJH 2O6VB 4B9YA 5KVFE 3ZMEA 4YHLL 3CZNA 1S3RA 1MVKA 4PJCE 3KPPA 2VISA 3ZKSD 4OV6F 2AV1A 5K9QI 2F8OA 3T3NA 2BSBA 2Y0SA 3O0RL 4LVOC 4C7YA 4NB7A 4R4BA 4YFDB 2M0AA 4JO1L 1FCGA 2YKLH 4J8FA 3AT9A 4G8GD 1UN8A 1UCTA 4XPGL 3D08A 2RD0A 5EF0A 5L2JB 4LQFH 1WY6A 3WNIA 2EEFA 5JHDE 1UH6A 4UDUB 5DBKA 1WZ1H 4J2QA 3O6LH 2CDFB 3TV3L 4CVZA 3UTMA 2X4QB 1VJKA 2JK5B 4RAVA 4Q4EA 2OL3H 3NZ8A 1GMEA 1RXLA 1NFDF 4ZYKB 2LUEA 3HMWH 1D9KB 2CKBH 4R90L 5C2UB 5IW1A 4E9YA 2JJVA 5MENB 1WX7A 2FCNA 5D5MA 1MQKL 2P24A 3C8KA 2AJYL 1BXTA 7CGTA 5DC2A 2EKIA 5HI1A 1SVBA 1NTDA 1V7MH 5CD3A 3IXTB 4XOBA 4WUKL 5F44A 2FCMA 3V4PH 3DWGC 1C4PA 1YY9D 3C6LA 4PJ8B 3V0GA 4HH8A 3LKNA 4DPBX 1GB1A 4XP9H 4I48B 1MZYA 5AW2B 3PHOB 4O58H 5ICZB 4BWRA 3ZGZA 3RFZB 3OWEA 4J3OC 2IH3A 3EJRA 4JDZB 1QPXA 1MH5A 2R29L 5C0ND 4QGYA 3CAFA 5CSZB 3UTQA 1GYVA 2B9BA 4PJ7F 2IQCA 3FF8A 1SVZA 3D4YA 4KKAD 1I9IL 2DN7A 4MQ7A 5AWNL 1Z9NA 5TH2B 3D0AA 2XSKA 4JM4L 2ZWZA 4W9HA 3BP4B 1RZGB 2NXZC 4IM8A 3WIMA 2LFIA 3CH8A 4X99B 2CO4A 3HG1A 4YDIL 5AALA 3L9TA 4M0WA 1J8KA 3H8NA 2B08A 4NWTH 4ZOHC 4BVUC 5BUAA 2HRLA 3DX6A 3OXRA 3PAZA 2JI3A 2XEVA 3UC0L 1MHHB 1LD8A 2PCYA 4YDVB 4KJQC 1GR7A 2B3RA 3O41A 2W94A 4DAGL 5IQ9B 3MACL 2Q2EB 2OMWA 5A3ID 5C97A 1ISNA 2YK1H 3U7ZA 1QSVA 3EF7A 3EGSB 2J08A 1G9HA 3QG7H 4JO2L 4YDKH 3TIXA 2MCMA 3T1FB 4BBWA 3ZO0A 3Q47B 2XOTA 3RVVD 5DVNA 3AMKA 4R5TA 3U1SH 4CHKA 3LVTA 3ZZQA 1K4DA 1QZNA 2G60L 1KIPB 4JANB 5TE4L 3O4LD 2LOEA 4X5XB 3DQVA 1IGYB 1HYRC 2VXUL 4JPIA 4LVHC 4UINL 4UOW0 1WC7A 2DYPD 2FO4B 1C5CL 4P2OA 1VCAA 4YFLI 5EUOA 4PJIE 4PHZA 3KH4A 4DQOL 5E76A 1QF6A 4MS8D 3QQ8B 1NDMA 1NFIA 2A0LC 1H6KA 1AGDB 1OSYA 3EJPA 3MX0B 4XNYL 2P5WE 1FDLH 3A6OA 3QEQE 5HY9A 1WYWB 3ULSA 1X5GA 4F6RD 5JR1H 4PJAA 1GTFA 5FDYA 5DSCA 3T0WA 1T6VN 4FNPA 4MJID 4KUZH 3EJCA 4MVBC 4WUUB 5GGQL 5EN5D 1TZOA 3GRGA 3NDZE 5DVOA 5T5FH 3B37A 3EYUH 4X0KA 4B6ZA 3MP9A 5B1AE 5DU7A 5IEKA 2AQ3B 3EO9L 1ODAA 4LPYA 3I9V1 3JV6B 4IRJD 2OHFA 4AGMA 1JPLA 1PW3A 1CGTA 1QSEA 3UMVA 4BZYA 1JXJA 4PJBE 4DZBA 4L9LB 4UUCA 2K0PA 3IGAB 1INDH 4NZDA 2NMSA 3L48A 4ALAL 1VKXB 3EDDA 3ILPB 2W9LA 2H2SD 3VXWA 3GXMA 2WINA 4G9DA 1SXZA 4UI9C 4UU9B 1IBXA 2P9SG 3KW7A 3SGJA 3E4BA 1WV7T 3TO2A 5AQ9A 3RVUC 4G7VL 4GZ5A 3V4LA 1CG9B 4R4NC 3IU4L 4BX9A 1DVXA 1SLVA 3FHQA 1THCA 4Y4FB 1N64L 2IO1B 1NUDA 1HH6B 2NW2A 3MKKA 1OWLA 5C0RL 4UDUA 3DJSA 4ZTEA 2DTML 2XEEA 1AIZA 4IDLA 4J4PC 3SBQA 3ILQC 3L3HB 2IBGA 2CU9A 2ZKHH 1F86A 1YMMB 3ZHFA 5DPRA 3MREB 5D5MB 2PQNA 4GQPH 1VCBC 4LSVL 4GRLD 2GCYA 2YXVA 4QRUB 4URTB 4JNXA 1CDBA 5LGJA 2CBPA 2WX0A 3MVSA 2AJUL 1RUMH 1SA5A 4G5ZL 4WDIB 3ARFD 2E86A 2EYRB 2NCNA 4JFQB 3L3KA 5IMMB 2DNFA 1A7OH 2QC9A 3HRDD 4MBRA 1F5WA 4AWJA 1PFOA 1YJDL 1N12A 1SM3L 1QKZL 1GAFL 1EO5A 4UOW1 4XN8A 2LUHA 1OAYH 3GJFA 5B1JC 4PIBA 2ADFL 5CLZA 4JDZA 4TUOA 1AFVH 1XD0A 5SWZA 4POYA 5E5MA 1TOXA 3OLEA 4K7SA 3BT0A 1UATA 3RD2A 3LZPA 2YHGA 2ENYA 1FD6A 1Q1JL 4Z3FA 2I24N 4JGMA 2Y36L 3Q5TA 4DP0X 1T20A 4FS0A 2H0EA 2ICIA 4HJJH 5CINL 2JSVX 5K39B 1Q5WB 3LH2H 5DWUH 2WLBA 1JTTA 1USZA 2A9MH 5L2JA 4MJIB 3DMMB 2ITCB 4M7LL 1B1ZA 1J7CA 3PWPD 3M88A 4P8QA 2O4EA 3BAEH 4AE1A 1DQDH 3JZ7A 4K71C 4CVZB 1H5BC 3ARSA 1CR9L 4OM1L 1F90H 1IYGA 2CH8A 1CLYH 2P58C 3F58H 4DKTA 3DHGC 3TJHD 2DZKA 2AVPA 5J08A 1L0YA 2W65B 3EDFA 2MCNB 5L7XH 1FNHA 3WIIL 2Z31A 2ZKMX 1ILUA 1K53A 4XPBH 4PJ5B 3RPIA 4K5PA 5GZNC 5IROD 4P0DA 4XNUH 1KIPA 3CXHK 4GY4A 4XXDA 1OT4A 4J1UB 3ULSB 1HWWA 2DYMA 3QUXB 5JYMA 2WX1A 1ZTMA 3UZEA 4BSZB 1DVFB 1EEYA 1E4XI 2X6MA 5JDJA 1WXMA 3DOHA 1MH5B 2E7CA 2QVTA 3WNOA 2WNGA 3NA4A 3HE7C 2JCCB 3ZKMD 4NQUA 4NP4H 4NRZB 2JV6A 3QC1A 2NY7H 2FE8A 3WIHA 1OIOA 5T3XH 3DDCB 1OZUA 2XZAL 3FMGL 5IKCA 1RZ8B 4HIJB 3EYFB 1N6ZA 1DSYA 2D3JA 1Z9SB 4Z7QF 3NSYA 2EDQA 4FXTA 1T5XD 3FQ4A 2I07B 3MV9D 3G5VB 4R7NA 1BZQK 5HKHA 4X98B 4HOUA 3RBGA 1VKXA 4HWZA 2FBOJ 1JPTL 5DC9B 2PO6B 2KMAA 4GTPA 3I6LD 3T4AC 3T5XA 3HB3B 5DGQA 2XNAC 1MHEB 1E9OA 1VHPA 5ISZB 1M6UA 1QI4A 1G9EA 2XETA 4UDUC 1YEFH 4QTIL 3RPKA 3ZPJA 2QSCL 4F58H 4F80A 2Z3FA 4KQ0A 1BOGB 2V2TB 4JDVB 4PI2A 4X80L 3UQAA 1EPUA 4LHUB 5HDRA 1TXKA 4IMKA 1SJXA 5E9DB 1HH6A 2HT3D 3VXRA 3UOAB 1OK0A 1MNNA 2I6HA 1MLCB 4KRPD 4MZIA 4GNKB 1BLNA 3E8UL 2BOCB 4I2XB 1QBBA 3V61A 4NPNA 1JK9B 4MCYA 4FLHA 1GOFA 1JL8A 5L2KE 1K2DB 2VQ1A 2FR4A 3GSNB 4E9QA 2L76A 3KLDA 1ES0A 3KCWA 1F00I 1ETB1 1R75A 2A9CA 1GZPB 2FGWL 3NPZB 2CKBA 3MLUL 4UUJA 1S7VB 4H40A 4ABQA 4PG2A 3L3KB 2EDNA 4DX5D 1DUYA 2IALB 5ITZF 3NJMA 3OKMA 3C5ZA 4GIAA 5TQ2L 2LVEA 1SRDA 3GUFA 5ITBH 3FKYA 3PS6A 2HFGL 1C5DB 2ZTBA 3UINC 1U58A 3U25A 2H8PA 3AE9B 1OGPA 3VMNA 3NCXA 2OMZA 1U8HA 3PP3K 1OT2A 4ZDVA 1AMXA 2UWEA 5BVJA 2F8XK 2H7WA 4POUB 5I6PA 2FIRT 4UDTA 4MKTA 4AIFA 4WWKA 2O6VD 2XG4B 2X40A 4LL9A 2HT4C 3QCVL 2V37A 3WBDA 1WDYA 1DQJA 3KXFA 3P4NB 4PU2A 4TUOB 5DEJA 5E4EC 3U9PL 2E7MA 1HDMA 3HPLA 3U66A 2OULB 2XWTA 3KPSD 4U4IA 5H35A 3FAHA 4X6CB 1FH5L 3CH1A 3BXNA 2O2VA 1BMGA 1YNTE 1KT2A 1UD3A 1KDIA 1J8SA 4JZOA 1TG8A 2H0PA 3Q7JA 4LLMA 4UNTA 4OZHB 5DYOB 4EDWH 3RNCC 5IQOA 1D7CA 4S11A 1G7LB 1KYDA 1ZPUA 1E9QA 2ZX9A 3POHA 4PJFE 1C7SA 1JPGA 4HUUB 4TXRA 1L4IA 3FHAA 4XAKE 1BA9A 2ZNWA 3MA9L 3EH2A 4HS3A 4LEEA 4NJAL 5EZIH 3NQKA 1OGAD 2GBVA 2IDUA 2G75B 3R4DA 1U8MA 2JJUA 3ULVF 4Q9QL 3ABVB 3KQ4A 3MREA 4ZI8A 3V62A 4J8EA 3BWUF 1HX8A 1QI5A 1DFBH 1J0YA 5G5DA 3B7SA 3QT2A 1Z1WA 4MJHA 2EICA 3IDYC 3RWGB 5E6YA 3FB7A 5EA0L 1SLWA 1PZ5B 3K2UL 1XZ0B 5H94B 2L52A 3UTSA 3J5PA 2K22A 2WPGA 3THML 1VGEH 1UT2A 2DI9A 5EZOH 3X3FH 4QNPE 3QUGA 5I76B 3Q75A 4DN3L 5I4DA 3FU0A 3BDYH 1HS6A 2NNXA 2X0UA 3CGHA 4KKNA 4Z3GA 5DUBA 2C4FT 4G2AA 4K5OA 5TDOB 1OE2A 3ZT6A 1GCFA 1T0QC 3ZDZF 2Q9OA 2CHWA 1N4QA 1QWUA 3HI6H 3JV0A 3VSUA 4CKVX 2JH2A 2DWSA 3FUEA 3EYFA 3N04A 4QJ5B 3MRKA 1ROCA 3K3QA 2PYEB 2VLME 5E00B 4JRYA 2GJ6A 4H8WC 1DQML 4WW2F 4X98A 5I1AB 2IADA 2OLDA 4OZGE 3B5GA 3GXIA 4YEFA 4XAKD 2NSZA 3TG5A 2MQGA 4D7BA 1IAII 4P9MH 4R84A 3B2DC 1UW4B 4ZRQA 2JZZA 2Z8VC 7FABH 2PYED 4EUTA 3MUY1 2CD0A 4HDIB 2XN2A 1JI2A 5HHMD 3VGDA 2EDOA 3IJHA 5IMMA 3TIDB 3JVFC 3RJQB 2Z31B 2X6UA 5L8LB 4QTFA 2DLBA 2OMXB 5HI4C 1IBGH 3TJEH 2JLBA 4GSDL 3FONB 1AR2A 3KL5A 4UT6A 4I9WD 1VPOL 1R3JB 2IDQA 5I1JH 4E85A 1YMHB 4UV4H 3SIKA 3BYYB 1NJ9A 3VU1A 2OMTA 4N5EC 1IQDB 2ZOTA 4B96A 1P2CB 5D1QA 1A6PA 3OSKA 1WGVA 2MTPA 2WBJA 4K9JA 4X4XB 2BVUA 4IRSC 4DJAA 3BZFB 3C2AH 4FE9A 3KPTA 4P2RA 1CI5A 1UWGL 5FK9A 3SE8L 3ARZA 1BF5A 1ELKA 1QEWB 5LLIC 5T1DH 4AY5A 2HM8A 4NNYA 1F13A 1QQEA 2X6KA 1AG6A 3O3DA 3H42L 3LEWA 2AQ1A 4YVNA 4X6CA 3F7RA 5F7NC 1BGXH 3PWJA 3QIJA 3QIWA 4NZTL 1UGJA 2LGYA 3II1A 5LLIA 4AUYA 2R83A 2ODHA 3GMNB 3HI1B 4X7TA 1TBEA 1QBLH 4ANKA 3KPLA 2GBJA 4R7DA 1N5XA 4PWFA 1UD8A 3D8MA 4NAQA 5AVXB 1P6WA 5JXEA 2JJWA 3UBXI 3L3OB 4GKNB 2EDDA 3AREC 2PR4H 2GRRB 1R9FA 3PXHA 3VXSD 5J5EA 2WP9B 4LCYB 5D1QC 5FYKH 4F7ZA 2BVQB 2ZUTA 4R6UA 3ARFA 1WAAE 2H1PL 3L6FB 3BUDA 3L81A 1TNNA 3O6FA 4LU5L 4G8GB 4A6YA 1QZ2A 1KBKA 2R02A 1PMYA 2OBGA 2EVFA 5HHVH 1D6VH 1KB5H 4FLBA 1RUKH </