4AJWA

Discovery and optimization of new benzimidazole- and benzoxazole-pyrimidone selective pi3kbeta inhibitors for the treatment of phosphatase and tensin homologue (pten)-deficient cancers
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
916
structure length
765
Chain Sequence
KKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNQPFSIELIEGRKVNAVQAGLFHGNEMLCKTDISVCDLPRMARLCFALYADCPIAWANLMLFDYKDQLKTGERCLYMWPSLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLTAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
total genus 212
structure length 765
sequence length 916
chains with identical sequence B
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4ajwA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ajwA03
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ajwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajwA01
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4ajwA04
2MA9B 4LDCA 2RPQA 4TV3A 2WXGA 1QASA 1WZ3A 3A9JA 3B0AA 1UGMA 5DCNA 3RUIB 3UINB 2X6HA 2IO3B 5D2MB 4F91B 4FULA 3L16A 4MJSB 5LXIB 1DJZA 1FXTB 2L0TA 4TQ0A 4EFOA 4TUUA 1QATA 3A9KA 4BBNC 2FAZA 3H7PA 3GOEA 3QAQA 3B1LX 3U30A 5J18A 2LRUA 3QCAA 4Y1TA 4BKSD 2DHZA 1LXDA 2KJ6A 4HWIB 3EECA 5E6NA 1IP9A 5G55A 3PREA 3N30A 4II2B 4V11A 4MGIE 2BYEA 2ZNVB 4ANUA 4P7IA 1YQBA 3JW0X 2D2QA 1DJWA 4HK2A 4NS0A 2K8MA 2A4ZA 3OHMB 1W16A 1BDYA 3KWUA 2FCSA 2GOWA 2KMCA 4LJOB 3OJ3A 4K7UA 4LDTB 4DHJD 3KVFB 2K4AA 2EKEC 4NJ6A 2ENJA 4G3XB 4EOYA 3VUXA 2WXOA 2ZVOA 1WZ0A 2GBKA 1OQYA 3DPDA 2YOAA 1XD3B 3K9PB 5D94A 1J8CA 2L7RA 1SE9A 3QK0A 1WGGA 3JVZX 2LZ6A 4FBJB 1VCBA 2Z59B 4KDIC 3VTWA 4HCPB 3VVWB 4DHZE 1XQQA 1P3QU 3VQIA 3TCAA 1WE7A 5E6PA 4NPJA 3UF8A 1UBIA 2MQJA 2MRPA 4M8NA 2KWUB 2ZVNA 3LDZE 4FJVB 2Y3AA 4B9KA 4ZYNA 4IWPA 3APDA 1SIFA 2NR2A 1NI2A 2WXHA 1ZGUB 4TQ1A 5DPRA 3ZDTA 1A25A 2K6DB 4PYZA 1H4RA 3RULA 3FDWA 3PHWB 4RM8A 1WXMA 1YD8U 3V6EB 2JQZA 3X0WA 2XK5B 2K8CA 3KUCB 2LRWA 2G4SA 4HXDA 1P1AA 1DJHA 1Q5WB 3L9BA 2BYFA 3PVLA 1MG8A 2WWZA 3HM3A 4LDTD 1TZ1A 3MJWA 2BPSA 1Y8RC 1YX6B 2C5LC 2GMIC 1WFMA 2CHDA 1NBFC 1WJ4A 5JHBA 2ASQA 1BYNA 2D10A 4KIKB 4NQKE 4N9F4 1WJUA 1M94A 3ZKJC 3OLMD 4L2YA 2Z0DB 3KYCD 3H7SA 4MELA 3VHTC 2NCEA 2WXIA 3PLVA 3PPAA 4IWOA 1CJYA 3IHYA 1WXSA 2DAFA 4RMAA 4DDID 2N1WA 5DPSA 3PSEB 1UH6A 2KDEB 4PYUA 2AYOB 2LUEA 3IG3A 1NDDA 4W9HA 3AULA 1E7UA 4K1RB 2EMSA 2IO2B 2DYOA 4AUQC 3A4SC 2LD9A 3A1QA 3ZRFA 4DHJB 4F8CB 3QJZA 4L1BA 2LHAA 3VH4B 2XBBC 3P2BA 3A4RA 3ZLZA 4A3OA 3H6NA 5L95C 2NBWB 2O6VB 4W9JA 2IY0B 3PGEA 1ZW7A 4BOSC 2I9CA 1V80A 3KW5B 3QWZB 2DENB 1L2NA 2KLCA 2FK9A 4PS3A 2W9NA 2CHXA 4NAWB 4RM9A 4A55A 2LJ5A 2WXJA 1CMXB 3WAPA 1BCIA 5KHOA 1WGDA 1EF1A 4HVBA 1X1MA 2N1VA 5CX3A 3QIJA 4ICUA 2Z0EB 1Q0WB 3DVNV 4ANWA 1LQBA 3DBSA 3PRPB 4WEEA 1RFAA 3TL5A 4KIKA 4I6NB 3Q3FA 1WFYA 4IWQA 4GU2A 2ZKMX 5D6JB 2KFKA 2KNBA 1RRBA 5DPTA 1V27A 2O2VA 4I6LB 4ASWC 3L0WB 4GDLA 2D07B 4GN1A 5T8IA 1OEYA 3NOBA 4NNJB 2JWZA 4W9GA 4TKNA 3PRMB 1UELA 1WX7A 4YL8A 2BWFA 2MBEA 2LXAA 4FJZA 5KHQA 4LCDE 4CYEA 4WJPA 3QR1A 3UQAA 4NPNA 1E8ZA 2MSED 2ZZPB 4MSQB 3ENEA 2MBOA 4ZRKA 4I6PA 5BO4B 2FIFA 2CU1A 4WWPA 2RD0A 2DMHA 1WXVA 4B6WA 4WQOB 1V6EA 4E74A 5CHWA 2HE7A 5HKHA 2N7EA 5CCJA 2HTHA 3TBLD 2GBNA 1YRKA 3VUYA 3ZTCA 4CHKA 4W9KA 4DK5A 4IQHA 1E8WA 1H8CA 4WWOA 4ZRIA 2MX2A 2ISDA 2DZKA 3ZNGC 4XE0A 4GB9A 3F05A 2PJHA 3BY4B 3DBHI 1V81A 2X38A 2CS4A 2EMTA 2N9EB 2NS5A 4WJQA 1V9JA 2O2VB 3SU8X 3TIXA 2JY6A 3B08A 2NPTA 2LXCA 1WR1A 4DWFA 1WRDB 2K45A 2KDBA 3DOWA 3HM6X 1DSYA 4FJYA 4KSLC 1VD2A 5CTRC 4DHZB 3HN8A 2WYQA 3IFWB 3PLUA 2B3RA 2WXLA 2R83A 4EEWA 3JYUA 3U7DA 2JF5A 1V2YA 2HD5B 3L17A 4II3B 4GOCA 1RAXA 2M8SA 4JGHB 2O6VA 2ZJDA 1WM2A 1WXAA 4MJSA 2BKFA 2C60A 3V61A 2IBIB 2I1KA 3O65B 2OJRA 3MTNB 2LVPA 4WJNA 2R2QA 2GBJA 4X57B 3RZFA 3VFKA 2AL6A 2FCNA 3JSVB 4ANXA 5AEKB 4F92B 5JHAA 3W56A 3AU4A 2QZQA 1CJAA 5IAAC 4W9IA 1U4AA 3HIZA 2PPHA 1GC7A 2KZRA 2IZVB 4GIVA 2KFKB 1WIAA 3CSFA 3APCA 1Z2MA 2DZIA 3ZO5B 3LS8A 3QR0A 1V5OA 1DJIA 2UZPA 4HPLB 2KXJA 4GDKA 2KQ7A 1UOVA 2NSQA 2CHZA 2IYDB 3PS6A 2LGYA 3PZDA 3AI5A 4DNLA 1RLWA 2WXNA 3F04A 2KDIA 4UWFA 1WR6E 3WALA 1GJZA 4OYSA 3RZWC 1KLVA 5EDSA 4L1LA 2MBQA 2WX1A 1RLFA 3EC8A 1TBEA 2GBMA 1LFDA 3KUZA 3UGBB 3PFQA 3RT3B 2V1YA 5CHFA 3W1SC 4HDOA 3F01A 1DJYA 1R4MI 5G2NA 2XK5A 3RD2A 2A5UA 3W1YA 4G50A 2WX0A 4HPMB 2VRRB 3A33B 2KO3A 4UWLA 2J0KA 3C0RB 3RDJA 1TTNA 2Q3XA 1DJXA 3DCGA 1K8RB 2BWQA 3R7RA 2KK8A 3PT2B 5E6OA 4IW0A 2N1TE 2JXXA 2O6VD 3ZVVA 3ZRCA 4JIOU 3RPBA 2OOBB 1P98A 1WFJA 2WXFA 3ZUNA 2UYZB 4AJWA 4BGDA 2ZNVC 3JSVA 4F93B 1TJMA 2UWQA 2X6JA 4KVGB 1BT0A 2BWES 2MBHA 3UIPB 4IHBA 2JUOA 1J0GA 3QHTA 4EZKA 2AEHA 4FLHA 1PQSA 4BFRA 4QAMB 2HJ8A 2KHWB 5GMVA 3V62A 4KZ0A 3ZTDA 2NBUA 5H4ZA 4FADA 3FBKA 1GMIA 2FCQA 2NVUI 3PHXB 1E5WA 2GBRA 3QC8B 2J0JA 2DX5B 1V5TA 4LCVA 2FCMA 2KD0A 2CM6A 3QA8A 4MEMA 2KKCA 2AWTA 3ZDMC 4IUMB 1QZEA 3TJPA 4OVUA 3QX1A 3GPEA 3QQ8B 1WH3A 1YX5B 2M4NA 1WX8A 5AZGA 4AJYB 1C1YB 1WGHA 3VTUA 5AZFA 1WJ6A 1TGZB 2REXA 5IA7A 3KUDB 2ZCBA 2JPHA 2KANA 4NY0A 1WMHB 4BKTA 4NAWA 5FR6A 4URKA 1LM8B 2CJSA 2NBVB 1GNUA 2J0MA 5TR5A 2M17A 2RSUA 1D3ZA 3A1QB 4XZ4A 4BKGA 1YJ1A 5CHVC 3DVNU 1EO6A 2L76A 2KI6A 3TWYA 4MH0E 2FUHB 4KDLB 3B7YA 3VAWA 3X23A 3ZNID 2LGDA 5AZHA 3NZUA 3VXWA 2L3ZA 3CF6E 4AWJA 2YRBA 2N9PC 1I35A 1IYFA 2KN5A 4K7SA 4PH4B 1I42A 4AOFA 4W9CA 4DDGD 4K7WA 4J6IA 2WXQA 4KITB 3EFUA 3TMPB 2CHWA 1V86A 1AARA 2JVCA 3PYCA 2D3GA 3NY5A 1RH8A 1WE6A 2G3QB 3VH3B 2ZEQA 4NQLB 5KJ7E 4B95A 3M95A 4JQWC 3L08A 4A3PA 2KJHB 2KTFA 1E90A 2JRHA 3ML9A 3DVGY 2WXKA 4JLCA 1WI0A 3WAMA 2K25A 3ZW3A 4HCNB 3NHEB 1E7VA 1WX9A 1KJTA 3IM1A 4ICWA 2C7HA 1Q1OA 3EHVA 2KTRB 3A9JB 4GDLB 1GG3A 4ZRJA 3SD5A 3HHMA 2KX0A 1P0RA 2LVQA 4JL9A 2LASA 2LVOA 1Z5SB 2PE6B 2D8KA 4ANVA 2L8JA 2ZPNA 2DYMA 3H1UA 3WA0A 1W15A 1HE8A 1C3TA 4LJPB 3L4CA 2DMGA 1S3SG 3ECIA 5JZEB 3WANA 1RSYA 4CO7A 4E71A 4QJ5B 5DPWA 1UD7A 3L13A 4UWGA 2D11A 2NCNA 4L23A 1EF5A 4IM0A 1WF9A 4UWHA 3V60A 4IM3A 2MWSB 2KWCA 1UGKA 4WWNA 4IM2A 3RYTA 4FN2A 4MGKE 4MGZE 3CMMB 4EZLA 3VTVA 3DBRI 3VDZA 2IO1B 4BOZB 2KVRA 2DYBA 2KFJA 2IO0B 3M7FB 4ICXA 2L00B 4AP4C 5L83A 2C7MB 4QJ3B 4MDKE 4EKUA 2WXRA 4MSMB 3ML8A 5CCHE 4FHKA 3T8MA 1E8XA 2FIDA 2R2OA 2KQSA 1DQVA 2LGXA 2PEAA 4G0NB 3HK0A 3L54A 3WIMA 2MCNB 2IY1B 2KWVB 2N4FA 3U8ZA 1XT9B 3GZNI 3ZNZB 5H4YA 3NSJA 1WJNA 2BF8B 3ALBA 2BYVE 2WXMA 3K9OB 3RCZA 2AL3A 4PS8A 2RGFA 2G45B 3UQBA 2X6KA 4F1SA 5LLIA 3APFA 1E8YA 4G11A 4GSWA 2G4DB 4GMVA 2QHOA 2KX3A 2RR9A 1DJGA 2ZCCA 2ZPYA 4OVVA 3F00A 2JRIB 2X6IA 1GUAB 1OEYJ 4HLEA 4QJ4B 1K5WA 2JT4B 2KC1A 5J17A 1ZKHA 1IPGA 3N32A 4MGYE 2FNJB 1UZXB 3NS8A 2ENQA 4W9LA 3SHQA 3MHSD 4FA6A 5ANLA 2ENPA 2KTRA 3DBLI 4GDKB 3CSTA 3AU5A 1WGRA 3DDCB 5C1ZA 1OGWA 4XC2A 4UWKA 2QZ5A 2X6FA 4W9DA 1ISNA 2I1JA 1YIWA 3KH0A 2MP2A 1J19A 2JZZA 4KZCA 4M8MA 2K8HA 2V4LA 2CM5A 2K1FA 2KMAA 4BKSA 3D32A 4WAFA 3M62B 4XX5A 2MW5A 4E3CA 2L0FA 3DQVA 3LJ3A 2M1MA 2KLGA 4NP9A 2YVCA 4MM3A 1T0YA 2K8BA 3M63B 4ZDVA 4GGQA 2JZ3B 3KYDD 2J7QB 2K6QA 1V49A 3A9KB 3JZYA 1TJXA 3QARA 2Y5BB 3S2AA 3PTFC 3M3JA 3KWTA 3H9DA 2KC2A 4KV2A 5D7GA 2V3SA 2BKRB 3N5AA 1WYWB 1SGHA 3OJ4B 2MLBA 4HJKA 2EP6A 4LT7A 2WXPA 5LXHA 2MBBB 2Q0ZX 1F9JA 4W9EA 3ONSA 4Y1SA 4MJJA 4WAAA 4PS7A 1UOWA 3PV1A 3VUWA 3ZNHB 4EUTA 2YLMA 1EUVB 4GXBA 1P9DU 4IG7B 4NJ7A 1JRUA 2Z0UA 4F7ZA 1WMHA 3R3MA 2LWPA 2N9XA 4A20A 1WGYA 2K39A 4M0WB 3IVFA 3PRZA 3R7QA 4NPKA 4EZJA 1L7YA 2KDFB 3H7PB 2NQ3A 1WY8A 2DAJA 2M0XA 4ICVA 2K3HA 4KSKC 1A5RA 4TS6A 1R4NI 5C23A 4DXAB 2LI5A 1GC6A 1UBQA 2MP2B 3I3TB 3SDLC 3V6CB 2N7DA 1OTRB 4FHJA 4BVUC 2CKHB 4DBGA 2KJRA 4HDQA 2FJUB 2B3AA 1KOTA 4WJOA 1KM7A 3BINA 3L10B 4JPSA 1S1QB 1WM3A 3AXCA 3Q3JA 3IBEA 4BBNF 5JH5C 2BGFA 2C7NB 3IHPC 3UIOB 1G6JA 2DZMA 3OAWA 4IC7B 5CCGE 2NPTB 2DZJA 4W9FA 3NZSA 3T9LA 3ZIMA 2KOXA 2CJTA 4K81A 5ENNA 2CR5A 2XEWA 3DVGX 3WAOA 4GNKB 2C9WB 3R66C 2PE9A 5J2RA 3W1SA 2WDTB 2L05A 3W57A 3N3KB
chains in the Genus database with same CATH superfamily
3SYQA 4WU7B 5IO9A 4XBGB 2K6ZA 3TPKA 4L8SA 4R7LA 2A73B 3NVWA 3QEHB 1TVDA 5DRWA 2R02A 2IALB 3DYMA 4KZDH 3GS2A 2CA4A 1JPST 2RA1A 3RVXD 2CMRL 2FJHB 2OKMA 1OW0C 5KVMC 2NY2B 1J9CT 3SKNB 1MI5B 2OQJB 4CKQA 3CVVA 5G05J 3UJIH 5I1KH 3LVEA 1FCCA 4NPYB 3NIGB 4Y1TA 2OJZL 3VXSB 1CICD 2DQFB 2FUQA 1CGWA 3VWJC 2X7LA 5G55A 4UQXA 2J20A 2X42A 3ZBMA 3N30A 3FQUA 1F1DA 4RX4D 2YUWA 4MJ5A 1S7RB 1X9QA 3VSQA 1JPEA 3PWPA 2ZISA 2YXVA 3PZ7A 4PRDB 4P7IA 1UYWH 1Z32X 1OT1A 3O8XB 5TTRA 2Z1PA 4UT9H 3T2NH 1CG9A 4OGZA 5E2VH 2PKOA 4F7MA 4FXKB 1H6TA 3AWEA 4ZYKB 4JNXA 4PLOB 3HJEA 3CFEA 2MJDA 5A2KH 1FNSL 3I6GB 2HTKD 4XWGH 3V6FA 4F8QA 5JPMB 3IMTA 4PRAA 1I8AA 1R19A 3C75A 2BVQA 1V55E 4XVSL 4P46D 2J4WL 5ESQB 4QDGA 1RSFA 2YJLA 3F6IA 2FX8L 2AS5M 4O58L 1GHFL 2H3XC 4ZHPA 1IGFH 1CI5A 1NGXA 4UF7C 4DP8X 3AM9A 4NURA 1KFAH 2CD0A 3ESUF 3OTTA 4KHXL 4OZIA 3INUL 3WNJA 4NRHB 5TE6L 4CBZA 1JWUD 4YVUA 5DPRA 3EW3B 4AX3A 1PNDA 2GBMA 4K7FB 4O1NA 3TYFA 2DTMH 3FUDA 3NQPA 4AVIA 1NCJA 3RE0A 4HXDA 15C8H 3PVLA 4HEA1 1N9PA 5KTEL 4LDTD 5E9NA 1NJ9A 3JTSB 1YX6B 5FDWA 4KHTH 3H3PL 1MELA 3UAEA 5KTEH 1QOGA 1UA3A 2JVUA 4PGEB 1WJUA 1I1FA 1Q94B 3CLEH 3HFMH 4BFIB 3WMQA 1WAO1 4OFDA 5KYNA 1I4FB 4JW3A 4GUOA 3W2DL 1BIHA 2K3UA 3FSZA 1JCVA 4KO9A 3GSRA 3MX0A 1NC4D 2FQEA 3PLVA 4AS1A 2DAFA 4GS7B 2DPKA 3FILA 1P4UA 3C98A 3V0DA 1YQ3B 3WENA 1KTKA 3FN0L 2VC2B 2HMIC 1YG9A 2B4CL 2WWMD 3B7RL 1BM7A 3VMOA 3A4SC 1KGJA 4XVSH 4JRYB 2YBGA 1SMDA 1JVOA 5CSBA 3UEQA 3S97C 5I5RA 2IF7A 2XU9A 5TDOA 1BBDH 4MB4A 5AAWC 3WLWC 3RHWF 2P5WE 3EIJA 3W5NA 2H88B 2FEZA 5F1OB 3KW5B 4HJUA 3AUWB 2IFFL 4LSVH 3D3MA 4RFNB 5HVFB 1J8RA 5DQJA 4GYWA 5CKAA 4A6QA 3SKOB 4RM9A 1E4WL 5MERB 2WUCL 1PYWB 3DIVA 4N8VB 4CMMA 1X1MA 4XPTH 3KD7A 4RWHA 1ZMYA 4X0KA 2FL5A 4WTQA 4NUPA 2VLRD 4MBGA 3T5XA 1INEH 1PZCA 4Y2DC 2OK0L 3CN3A 1KLFA 3BFQG 2OR9H 4S11A 3EH2A 5AYQA 4G8LA 2CK0L 1SHWA 4I48A 1VIWA 3SDDD 4ASWC 4OKVA 1BG1A 4JCWA 5K9KA 3APNA 2D07B 2EDKA 1AKJD 4RNRB 3NOBA 2NNCA 3L5JA 2KDMA 5D7IA 3KPLB 3EZJB 5LGJB 4GUQA 3UO8B 1U42A 1FIEA 4GKSA 5DWUL 1XF5A 3BC9A 3UJTL 3ESKA 4JHWL 3CHSA 4W93A 1BD8A 3ZZ1A 5IESH 3B2UD 1SNRA 3QUYB 3DHJA 3E80A 1FLRL 1WSST 1HEHC 4FX5A 2MCPL 4DWHA 4E9QA 3ZDZB 3QORA 2JLPA 3NJJA 5ANMA 1JK8B 4N2SA 2HXAA 2XA8H 4HIJA 2IPKB 4GAGL 3WY4A 2Y07L 3DX9B 1FNGA 1U8KA 1A3RH 1BVNT 4WWOA 3IU3B 3RY4A 4CMHB 3WHE1 3VFOB 2XN1A 3G6JF 2C9AA 2N9EB 3MJ9L 2XIDA 2FF4A 4XTRD 5I16B 2QQNL 5E2TH 2JELL 1BXTA 4NX0A 2LXCA 1GGCH 1VESA 2PWHA 3PWLA 2AITA 5D96B 5I1AA 3QIUB 4FJYA 4FYSA 4OZIF 3GZNB 3BVDB 5CR1A 4RCAA 4HCFA 5IHBA 1YO4A 3W5MA 5E6YA 2INPE 3T2QA 3QZLA 4K5NA 2CO6A 4TNVK 5EUKB 3O6FD 3PP3K 5EN2B 3PXJA 2ZJDA 1DLFH 4P9HH 1WM2A 2EUVA 3N43B 4U05A 4X0KB 4AP2A 1J5OH 4GG6B 1NWOA 2BKFA 4WJNA 1C12A 2W07B 3K6OA 2ZX7A 4ANXA 4LCWA 4PR5B 2AERT 2WPVA 2ZCKL 3TT3L 2C9XA 3GSVA 2FO4B 2VE6A 3BCDA 3WTUA 3IMRA 1X5YA 1PCXA 3CFEB 4JREB 4OCRH 1DQQA 4GKSB 4PMFA 2OMXA 3IPBA 3NH7L 4IYPA 1K8DA 3L3GA 1CICB 4J2XA 1QI5A 2OL3A 3PS6A 2E6PA 3KNBA 4PGDB 5FYJE 2HG5A 1TNUA 1KYOK 1IC4H 2P3YA 3N9GL 4XHJD 4YBHA 4MCYB 4GG6F 1G84A 1JZ7A 1XNFA 4OLZH 4KWUA 4R3SB 1LO2L 5E8OB 3RBSA 2VO8A 9CGTA 1Q0YL 2WQ8A 1TBEA 2H1LM 5KVDL 3P40A 4HDOA 4PFEA 1NOAA 4RMRA 4ZAKD 2XK5A 5DYFA 1JNHB 5CP7A 3WSQL 3X13A 4HPMB 2VRRB 4KKCC 1S7UB 1BAFL 3N1QC 4JY5L 1KEMH 4A6YL 4ZS6D 1NC2B 3UTTE 2J09A 1OSPL 5E6JA 4DGYH 3LYRA 3R18A 4TSBL 2DMBA 3ETSA 2PABA 3VXOB 1BHGA 3STLB 2F7OA 1MPAL 1NFDE 1YY9C 1VPOL 4G7SB 3BPCA 3UAAA 1YEJH 2MBHA 3GMOB 3EIQC 1W0VB 4YR6A 3FILB 2KERA 3OB0H 2FT7A 1INDL 2IGHA 1QYMA 4ZDHA 3WNOA 3QHTA 2E9GA 2IH1A 2AEHA 2JSVX 3D9LA 3MMEB 2A99A 3GIZL 2NBUA 2OCFD 3ZNGA 3EH4B 1HIMH 2VDKB 3LPOA 3WNKA 4UMGA 3VRLE 2OSWA 3X3FH 3FB5B 3FU7B 4GTRA 4F80A 4H13C 1ZT7B 4F7TA 3GPEA 3ESVF 4L4VD 3SSGA 3TESA 4CVUA 5ADOL 4C83B 1EHLH 3E8UL 5CJBA 5BZWA 1V7NH 2YARA 1MEXL 3ILPB 2W5PA 1WZ1L 3HI6H 3AS5A 2JPHA 1YN7B 2EDQA 3LRLA 1I8KB 1TR7A 8CGTA 1JV5A 1I9JL 2CJSA 3ZFWA 2QVIA 4R0LA 3K2UH 3MXWH 4LIQL 1GGTA 5DGRA 3LEYH 4PTUA 3MRRB 4FL4C 4YE4L 3EOAA 4QFVA 3MNZA 3VAWA 3VXWA 5IHZA 3QFJE 1S64A 1EUUA 2WVUA 3D8MA 5E2VL 4QRTB 5E75A 2IPTH 2MPAH 5C0GB 3A6OA 4PJXF 1QOBA 4Z6AT 2DD8H 3X3GL 5F44A 5IB1B 1JNJA 4G1TA 4HH8A 2J53A 4ZOEA 1DQMH 3WN5B 3CAFA 3EF4A 2EO1A 3MZGB 1GPOH 5FKAC 2AXVA 3MJ8B 4LL9A 5KS9B 1AARA 3UPAA 4H26A 1VFOA 2OR8A 3ARSA 4JDZB 3GSQB 5HHVH 1OWRM 2VJ8A 2WK2A 5GSRA 3ZKMD 3QJXA 1N59A 4MQXD 2BBCA 2OA9A 2BW4A 1U3NA 3G9AB 2PXYD 3R9AB 3ZW3A 1TOXA 1BM3L 4QRPD 1A3QA 1MFAL 2VSDA 2Y23A 5FQ7A 3B9KC 2GRLA 5J6GB 1X5AA 1P5QA 4LP8A 1A7OH 4NWTH 4GW4B 3EHVA 3HHMA 3TWSA 2AXFB 1MHQA 5SX4I 1ZU2A 1ENFA 1M6OB 2TRYA 3ES6A 2HVKA 4LSSL 3WS3A 3WXWH 5E6IC 2VWEC 1X9RA 3B2VL 5EC1A 1LGVA 3Q49B 4ZMPA 4XI9A 1T22B 4E71A 2ZXEB 1B9RA 3C6EA 3ZE1E 1O1TA 3BE1H 2NCNA 3VXTB 3HMXA 3Q6BA 1QNZL 2DWSA 4JG9A 5BNXD 3IYLW 1AO7A 3V7AG 3VLEA 4WWNA 1X9UA 2BNQD 3TO4A 3HI1B 4YHOL 1IC7L 4EZLA 3JXJA 3T2LA 3AY4A 1ZPUA 3M7FB 1JW9D 2L00B 3EDEA 5CERB 4QJ3B 1MX2A 4R0LB 3V4PL 3CVIL 1AE6L 1T0NA 4PR5A 1ORSB 1PZSA 1WG3A 4FQ1L 3VB9A 3MRRA 1WWTA 2LJ5A 3BXNB 3EJYD 1FO0A 3RY5A 2KWVB 1C16A 3KL0A 1OWOA 5T5NG 2NZIA 3DUUA 3FMGH 3NSJA 4JFYA 1PIGA 4MBOA 2EILB 1HH9A 1ZLEA 3SE4A 3D12B 2IXQB 1ELKA 4X99B 2EH7H 5J4MA 3NSCA 4X9GA 3IDJA 3APFA 4EI6B 5HDBB 2PR9A 4JPKL 5K9OB 2VDPH 4LSRL 3IXEA 4WEMB 3DGGB 2KX3A 2PM7A 1N67A 1SZNA 1DN0B 4NQDE 3WN5C 4MCYA 2ZPYA 5HYJD 5HVHC 2UUDK 3Q8EA 5M94B 5K5YA 1N10A 5LGHL 1EXHA 5JDJA 1BBJB 2ZX9A 3LH2L 5D7SH 3QQXA 2QLYA 2CDGB 4PH8A 5IVZA 3VWKD 4R7DA 1S7VB 1J12A 1NCGA 4B9KC 2K1MA 1KCVH 4B95C 4JFQA 1AIFB 1BZ8A 2B1HH 5ANLA 4PRNA 2AI0L 3BUIA 3NFPB 3VX1A 3AU5A 2EH8L 5C8JB 3N20C 4BUHA 4JFDA 4I77H 2YUZA 4M03A 4Y2OA 3Q06A 5C1ZA 2WUBH 3LKRA 3IJYA 4X4XA 4Z7OE 3L4PA 2TSBA 2X6AA 2X4OA 2NTFB 1IAMA 1Z1WA 2QMTA 1DFBL 1AGBB 1BFOB 1BOGB 4QNPF 4U1IB 1BQKA 1LDPH 1UB5B 2Z0BA 2FQFA 4FNRA 4HOZA 3GTTA 3ETRA 4GMLA 5LN8A 1GZQB 4LRNL 3U82B 5I1CL 2R4RH 4I2XE 3T0ED 3GXMA 3FU3A 4JKMA 1AGFB 4ZDVA 2CR3A 1R3IH 3ARGA 3DRQB 2CR6A 3QIWB 4TL5A 1V49A 2HFEB 1AQMA 2HH0H 1FP5A 4KOBA 4YSCA 2QVFB 3RNCC 2AV1B 1T5XD 5CMYA 4KV2A 3K1KC 3V0WH 1ZK5A 3MO1B 2V2WB 3QUHA 5JPNB 1CZ8H 5GGVL 5C0CA 2X4SB 4TPRH 2W9DH 3QI9B 4DPBX 2NW2A 2HT2C 4A8XC 2Q0ZX 1UC6A 2VDLH 5KUKA 4O02A 4PS7A 1UOWA 1ZA3A 3FSOA 2RDHA 4OUOA 1FG9C 1TKGA 1E9PA 1QTPA 4N58A 3ZXPA 4M00A 4PJCA 4Z8FH 3HXEA 3WLWD 3HAEA 1KRHA 1WGYA 1HWGB 3BQVA 1FG2A 4IM8A 4AVHA 1KXTA 4HJGB 5J11C 4MVBC 3PABA 1MFAH 2IWKA 5PCYA 4CILA 1SN2A 4M7LT 1LQSR 1D9KD 2AXUA 2XTJC 4TS6A 3T08A 4DX1A 2HMID 1RUPL 4S10A 3RVWD 2R61A 3O9WB 3H9SD 1L9PA 3FT4B 5LVEA 2O6EA 2FI7A 1F5WA 1WWAX 4YHIA 3AADB 2NUTA 4PT5A 2JLBA 2BX5A 2UY6B 3ZHLA 2ZCHH 3RVXC 3KVQA 2BTEA 4XCEA 4H8HA 4HCGA 4D7PA 3G2SA 3QEQD 4JPSA 1ASPA 1H0DB 3U9PH 1E7PB 3UZEA 5KBNC 3DYPA 3QPKA 1TNYA 5D7LB 3RY6C 4S1SH 5ITFA 1CICC 1N64L 3C9NB 4Q9CA 4DGIL 5G4OA 3WAOA 4XP9L 4FI7A 4LU5L 5BV7C 2C9WB 1JDCA 4UQDA 1HNYA 1CGTA 3VGAC 2YPVL 3QJHB 4X6EA 2L05A 2GB1A 2YA2A 1RULH 4ZMOA 1CK0L 1MJ7H 3ZHFA 4EI0A 3FHEA 1QASA 1B4RA 1SJED 4WF7A 3AEFB 1NKGA 1VEOA 5AQ7A 3T77A 2QYUA 2HFTA 4FC3E 1IVLA 1KWGA 1DZ0A 2V9RA 2YXFA 2EH8H 3EGXA 2WVVA 5M95B 2Q9OA 4GRWH 3ZDXF 3UINC 4TL4A 3HYMB 1RZJL 2C3WA 4RAVB 3BUAA 5IVXF 3TBTA 4I3SL 5D1QE 1JF6A 4IMLB 3S5LA 2KJ6A 4NRXA 2WZPD 1E9PB 1N7ML 1OZUA 1RIHH 4OTXH 2M26A 2XZAH 3PREA 2CO4A 3DJZA 5C0BB 5DHXB 4II2B 1KJVB 1P4IL 1NEKB 1QUPA 1UD6A 4FQLL 3RVUC 1IKND 4YSAA 1B9KA 1S7XB 1ZY9A 5C7XH 2D2QA 4AG4H 2HWZH 4DP2X 2Y2YA 4JRYD 4OT1H 4JRXA 4MYPA 1VZ6A 4EECA 3EHBD 3Q2CA 2DQMA 1FDLL 1YHPA 2EIZB 3AEGB 2SEBB 4GY4A 1WF5A 3M1BA 3QWWA 2PPDA 1I82A 4LDEB 1BLNB 5JMOC 5IT2H 3FTYA 4ODXB 5FUCE 1SE9A 1EJOL 4TUOA 2X09A 1NEZA 4DKTA 4EOWL 4N5CA 4CADB 1VCBA 3E34A 2PW2A 2V5TA 1I8IB 4K55A 2QPUA 1X7TA 1SYVB 2OMZB 4TNEA 4P5TC 4YZFF 3QO0B 3QSKB 2OOEA 3A4EA 3DRAA 1M9SA 2VLKE 4LO9A 5FYJU 3TGXA 1E50A 1OPOA 4F7CB 2GPZA 1FN4A 1BAFH 4A6YH 4EPSA 4QMEA 1H4RA 2FJFA 3KLLA 1LYQA 3IFNH 4OLUH 3UCRA 4UANA 3FAXA 3GB1A 2YGQA 5J12B 1D3CA 1GYAA 1PGAA 1QNZH 2G4SA 3RWIA 1DJHA 5KOVC 4LMQI 3P11L 1XGRA 4D2NA 4FKKA 1AIFA 5AJDA 4ALAC 4GW1B 4Z7VA 1R3JB 2F8XC 5FKPB 2ASQA 2WTRA 1E4KC 1QSED 3L5HA 4YWGG 3JWDL 4EI5A 2ATKA 1CYXA 2BTDA 2ITCB 4MA7H 2EYTB 2YD6A 3Q1EA 1HF8A 4UNVA 1EGJL 3ZLQC 5BPPA 4W81A 3VR8B 1Y6NR 4UQ3B 1BZ7A 1LLAA 1NCWL 3TA4D 5BO0D 1KV7A 3VYPA 4X7EC 3P4QB 5FB8B 1AACA 4ZHBA 3P9LB 4PSPA 3ZE2B 4JO1H 3FOMB 3LN9A 1U6AH 2EH7L 2AAAA 1U0QA 1ZSDB 3BDYH 5L9DH 3CBRA 2G1EA 1CFBA 2XKNA 1HH6B 1FL3A 4NQCD 3ZX1A 3LS5L 1T80A 4QO1A 4DUXA 3UAFA 1O75A 3ZXAC 5BXFB 4K73A 4OFKA 1EF1A 3C3QA 3N9YC 3V95A 3LTVA 4ZS7H 1IB5A 3OKMA 2K9FB 1KB5A 1N9AA 3O4ZA 2X4UA 3V6OA 3LVQE 4KK6D 5IVXE 5HGDB 2NY0D 3QW9A 1E9OB 2MYOA 4G72B 4KKAC 3TIDA 3U83A 3RNAC 1YNTF 2R23B 4DH2A 5DS8B 1QLFA 3CLWA 5JDSA 5DURD 4BRJA 3KGSA 4JDEA 3WIHH 5D93C 1V7NL 2MH7A 1UXWA 3SKJH 3VWKC 5C0JB 3BP7B 4FJZA 3D06A 5E2JA 1N2RA 5KBDA 3ZYMA 3SGEH 2FLMA 1CFVL 3TV3H 3QIWC 1YLBB 3ZZLA 2MSED 2HVJA 4QOKE 3L3JA 4L9LC 3E32A 3GSNL 2EEBA 4G26A 2W88A 1SGKA 4PJGF 5DHVB 3BW9B 2DM2A 1HHJA 3FPXA 1H8NA 4F7PB 4BX9A 5CCJA 1OB1B 1TYGB 4UM9D 4HRLA 5EDXA 3TCTA 3ARZA 1P4LB 1T2QL 2ISDA 1S46A 5FT9A 4L3EA 1OCWL 4N5QA 4ZPTA 5AG8A 5C71A 4P07A 1KT0A 5D0OD 3MJ7A 1W6LA 5A23A 2ZKWA 3FU8A 3PPEA 3IFWB 4ABNA 3N41F 2R83A 3VA6A 4UUCA 3JYUA 4R3DA 2SEBD 3U7DA 3BUQA 2WVVB 5F0PB 4HJIA 4WNEA 1QQEA 1E4WH 2OTWB 1OGSA 3MUY1 5IIEB 2HDEA 3Q14C 5D2NC 2IDTA 2NY2C 3OKMB 2YEZB 2B4CC 4BKSC 3ZSTA 3GBNL 3CVCA 3C8HA 4AEIL 2IWGA 1MH5A 4NCC2 2GBJA 4X57B 2IMNA 5EB9A 3EOBA 2VM4A 3BAJA 4W9KC 1DP0A 2WU5B 2JI3A 1EU4A 4FP7A 5A7DB 5I15L 3BN9C 4L29B 4NOBA 4WW2A 3TJHD 4OV5B 1U4AA 2G9HA 1ZXQA 2X7LB 3BH8B 2ZOOA 1PC2A 2NSMA 3QR0A 3CN1A 1PGXA 5I74B 4MCMA 2FWLB 5BCAA 3N50A 1SQ2N 1FXIA 2LV4A 2CHZA 2NY1B 4P04A 3AS4A 4QUOA 5CEZE 3PZDA 1S8DA 3SKMB 3AI5A 4OZHB 2VDNL 2BIIA 2J1KA 3H3PH 1MNUL 2BSRB 2LOEA 4EIZC 3Q44A 4QLWA 1HKLH 2BM3A 5GGTA 5CHFA 3V5HB 3SZKC 4F7PA 3WNIA 1GR7A 5CRVA 3IXTA 3BX7C 3FRUA 5C09A 2WMPB 3MRQB 1PZ2A 3FKYA 2GUOA 1COBA 4AGLA 3CVQA 4G8GA 3EYOB 1K8RB 1JZJA 4M7LL 3U0WL 3VD2A 4JJOA 2N1TE 4JRXE 4LLUA 2KH2B 2P7TB 3D9AH 1T66D 3B7BA 2F58L 4Y88A 3RI5F 2B08A 2X1PA 3VFRA 3U2SA 5IG7A 4GKLA 2XGOA 5I1DB 3Q6GH 3CDGB 1RZGA 5DD3H 3B95A 1KIUA 4NHCL 5F9JA 1ZDQA 2BWDA 3KXFB 3RX5A 1PY4A 4CN6A 1HEZB 2VKWA 3G7TA 3QEGH 4AGNA 7FABL 4Q9QL 3U4EB 3HLAA 2EILE 1X5MA 2DVWA 3DSVA 4YVQC 2HAZA 5T3ZD 3SE9H 1C7SA 2HFGH 4FLHA 3ZYZA 4ODTL 1GZPB 5GMVA 2NDGA 3Q8CA 4J8FA 4U4IA 5FB8A 4FADA 5KJLA 4JR9H 1BJ8A 2ADJB 2OYLA 4AUJA 2GBRA 3CFDB 4FKEA 1A4BA 2CM6A 1S9KC 2GEQA 1BIIB 3P4SB 2XKNB 4RMVA 5L8LB 4EEEA 4YAQA 1G9EA 3V9CA 5IMMB 3TURA 5TDOB 4HG4K 1Q1JH 2G2NA 1L9QA 1S2EA 2IWFA 3U7ZA 4EBQH 3UABA 4NBYB 2X70A 4P2QB 2KANA 1MRDH 1O9ZA 1ZVYA 4P2RD 5I1JL 4NAWA 2FSDA 4N28A 4HOWA 3RI5K 4RIRB 5GS1C 2GAZB 4K3GA 3L6AA 4ZFFB 5DRZA 1HHIA 1MPEA 3SE9L 2JKNA 3DTUB 3FKUS 1WWBX 4KFMA 4NCC1 5D4IA 5ANHA 3S96B 5DMKA 3GTNA 4POZD 1EQWA 4I4WA 3QZWB 4YBLC 2WO2B 3MLXH 5F1NA 2SODB 3WG7B 4AENB 5AOMA 1I35A 2P28B 3BWSA 2EQXA 1N70A 1PZBA 2VXQL 3WEXB 4PJ8D 5K59E 4Y16C 3A5VA 2APWA 4PJHB 4Q9QH 2NNFA 3K4DA 4XOCA 2MEJB 1KF6B 4FNPA 4LKCB 1F42A 4PMEA 5ENSD 2EQDA 2HVJB 4NHCH 4NJ9L 2JTDA 3A47A 5CHNB 3TWTA 2MCAA 3DWMA 1NGYB 4KAQH 1YZZA 1PSKH 4A39A 3NY5A 2OP4L 5J8OA 2XKSA 4GT0A 2MOQA 1HHJB 2B4CH 4U7SA 3DVGY 3VXRA 2CUAA 2Y7NA 2CKBB 1KGIA 3BN3B 4NYLB 5CILH 3TT1L 2LFIA 4X7CC 1L5PA 3BVNA 3FTUA 2BOCB 2IPKA 2QR0B 5ILTH 2DQJH 2A77L 4JC8A 1MLCA 3V5DA 5LXVA 3AE9B 2Y69E 1GG3A 3W2DH 4BSVA 3CXDH 1CPUA 2XBZA 2DLIA 3PJSA 3ASOE 5I75C 4Y16B 2W60A 2V2XA 1UJTA 5I2IB 1QWNA 4CSZA 1LXMA 3L13A 5H7PA 4IRJC 4Q7DA 1ND0A 1NBZB 4LHQB 4TUKL 5D1XD 4AC4A 3A6BL 3MJ6A 4FN2A 3T1WA 4BOZB 3CMMB 3ECVA 3FFCB 4XXCC 3VDZA 3ZE1B 1H6UA 5TE6H 5GXBB 5GS1B 2BZ7A 1VFBB 3MYVA 5E08H 2MNJB 1H5BC 3WXVL 4QXTB 4E9LA 1MIMH 1TTFA 3ZR5A 3GI9H 3CHPA 1HQ4A 1QSZA 2LGXA 5AQBA 3EO9L 3WIMA 4DAGL 2NY7L 2JI2A 2JZPA 2A9ML 3E0GA 1WJNA 4YDJB 2INDC 3P9MB 4F9PC 1WPCA 4PJEA 4WY7H 4BM7A 2X87A 4IEFB 4A7UA 1ZAGA 4BFBD 4G11A 3NA9H 5IQNA 1VRAB 1GIGL 1EAJA 2VW4A 1QNFA 3DA0A 3EGSB 2QHOA 4LKCA 3GBDA 3P69A 2OS7A 4REZA 3RFZA 4ENZA 1FAIH 4Y2DA 5F7EH 4GIPD 5GGQH 3M1CA 4HLEA 4PJ5A 4LPYA 1ONQA 5DEZA 3CZLA 4JN1L 1OTUC 4YXKL 3HC3L 4WFEE 4HAKA 4N0CC 2KC1A 3TIEA 2AMGA 1W9XA 2KLRA 4NN7B 1BD2A 4HNAD 1YYLL 3ONLA 4B8AA 2VMJA 3D07A 3GC3A 4HEPG 4JRXD 2QR0A 3SQBB 5DJ8A 2P9IG 4FA6A 3MUUA 3O4LB 3KZ8A 1XSKA 1FORH 2QHRH 2EUZA 3QZOA 4FTVD 3NZHH 1UWMA 3ZXVA 3DDCB 1N4RA 1JNHA 3ARDB 4GMSL 5JW5A 3PJSB 1KIQB 5IY5B 1WIUA 1KSRA 3HC0B 3BCFA 2JZZA 1BZOA 3VU1A 3EU5A 2DTML 5B1AE 2OV8A 4JM0A 4PWFA 5DFWH 1AO7D 1HU3A 3LB6D 3C6LA 3OAYK 3MACH 3WOVA 4F58L 3VD9A 2YXWA 1JHKL 5HYFA 1H0AA 4HFWA 4P2QD 5AALA 1T0YA 1DUYA 1FIGH 3EU9A 3PXHA 2VM3A 2OQJA 2FX8H 2OCJA 1GZPA 1TPXC 1A14L 1A7NH 2L52A 3QUMA 4RH6A 3H9DA 3ASHA 3VXME 4PJAE 3RIAK 2CFZA 1FYTD 3HC4L 4XGAB 2P9RA 5LAXB 2O93L 1S7RA 1N4XH 3OR7A 1OL0A 2GSGA 4HIEB 1KUMA 2GITA 1E3XA 4GXBA 4NJ7A 1I3RA 4N8PA 4ZAKB 2W92A 4YNYA 5KSVB 3QXAB 2ZF8A 4JM2C 4CVXA 3IN0A 1F3JB 5L9DL 3KPMA 3KYCD 3OKOB 1X5LA 2RMNA 4H4NA 4YDMA 2IWEA 4DQOC 2VITA 1FT1A 4RFNC 2H32H 1I8KA 1OSYA 1PMYA 3EJUA 5TF1H 4OJDH 4DKFH 3KPQA 4GBXB 2IOLA 5D55A 4ZAKC 1OTRB 2I27N 4KZDL 1XLPA 4NLHA 4LOFA 2B3AA 1R0AL 4Y1AD 2VDRH 5IMOA 1AY1H 4PJ9A 4WJOA 3ZHKA 4ZT1A 5JPMC 2C9RA 4OGYL 4S0SD 2Y36H 5IEKB 5JQIB 3Q78A 4DQAA 4J3VA 1HNGA 2A7BA 5SWQA 5D1ZB 1OQQA 2DKMA 4X2UA 3PAZA 1P5VB 1QRKA 1CTOA 2EO9A 2F5AL 1HINH 2OTUB 3IETA 3MUGA 4KI5C 1L9RA 4KROD 4OCSL 4UTBL 5FDWB 3RU8H 3WN5A 4DFHA 5IW6B 2ZKYA 3P63A 4KQ4L 1Q38A 4P59L 5EEZA 3DVGX 3LKPB 1WQVT 2H6UA 2JKRM 4P57A 4WNQB 3CFIC 2AQTA 4OJAA 2XV0A 4ILGA 2FB4L 3WELA 1B4LA 5IB3A 5BVPL 3DO7B 1U8CB 3UTOA 4E9TA 3RUIB 2R2CA 3UTSD 1HCVA 3ZHEA 2WM0A 1A9BB 3CDZA 4P0DA 4EUPA 2KAJA 3L16A 3QQ9D 4XXWA 1O1RA 4P5TA 1IE4A 3ET9F 4PJ9C 4KUZH 2GHZA 5AZ2L 4QRRA 3E1F1 1QBBA 1ZT4A 3AVEA 4AQEA 4A63A 3MV01 2Q8AL 3BT2H 1WCQA 2NY2D 3AE1B 4GA0A 4MXQC 2EIKE 4RA0C 4ODBD 2K8MA 2A4ZA 3ARGD 3OHMB 4NQSB 4DP1X 5FHAL 2AX5A 2B5IC 2JLLA 2LW3A 4KMQA 4DHJD 1NCAH 4G7RB 1WFUA 4EI5C 4NCDA 5IN7A 4LEUA 1DN2A 4HB5A 3EYVB 1OQYA 4G43B 2EDOA 3KPPB 2FTAA 1XIWC 3WI9A 4Z7NE 5EA0H 2VXTH 1PX4A 1NL0H 3FCSA 5E8PA 4RQQA 2DQUH 2L04A 2EIME 4NC1E 2VRQA 3VWJB 1RIVL 2NR2A 4HSCX 1CD8A 4OI7A 2I60H 3O6MH 4PYZA 2D2CC 2OTUA 3HHSA 5F7YC 3DEPA 2H8PB 2VUYA 3V4VB 3O9WD 3B9KB 4E0RB 4PLKC 3KL5A 1AZRA 4K3DH 1LE9B 1KZYA 4OD3L 3QPQC 4E42A 3SQBA 3HM3A 4HZAA 3VFNA 4NUGH 1D4BA 2WJ7A 4MX7A 5HY9B 3TWWA 1K8KG 1BVLA 4KIKB 1T4KB 3VMPA 1LDSA 1NSNL 1KTLB 5F9DC 3ZTEA 1B0GA 2L6BA 1LQBC 2ZUYA 4OQ1A 3S6CA 1VFMA 5EO9B 2QADC 5I26A 2NY5C 1WXSA 5DMGC 3BAWA 1ZT4B 2CLVA 3G5VA 4GKOA 4NM8L 3QRFM 4AQEB 3QBTB 5C0AE 3BLKA 5LCVA 4ZFOL 3OVUB 2HZHA 4AUQC 1AGCA 4Y9FA 4Z95L 3RA7L 2PO6D 2DWZA 1RUQL 5A16B 5ESVB 3SDCB 4HUVA 1QW9A 4R83A 2PLPA 3CVPA 3PGEA 3GIZH 3MBXH 3EJSA 4B97A 3KGTA 1N4QA 4HXAL 4JRYE 5E6SB 1QKZA 3NZ3A 2HJFB 4AK2A 1CMXB 2R51A 1PX8A 1QFOA 4ILIA 2P5WB 3ZDZF 3MOBL 2C3VA 3QIJA 2GSGB 4HIEA 4K5BA 3FL7A 4PV8A 3DBSA 2H3KA 5JPNA 4LVHC 1KCRL 4IRJB 5SV4A 4NNPL 2KNBA 4I6LB 2FX9L 3U7AA 1DVFD 2GT9A 3ZDYB 4GAYA 4JWSC 3IKOB 3AY4C 2DEXX 4JWUC 1OM3L 5GIRA 4HH9B 2BHYA 4J12A 4NQDA 4XN5A 1CE1H 2CRIA 4XXDA 2HRPL 4L2LA 2E56A 4AYBA 5I1CH 2QC8A 1PU0A 4FE9A 4NQCB 3TYFB 4DZBB 1BGXH 4MSQB 1WY6A 4ATZD 3WFDL 1U58A 1ZHNB 1GL4B 1JL8A 1AOZA 3F6JA 2LVEA 2VN4A 2ILLA 2X2HA 1MCCA 3GB7B 2BHFA 2GQHA 2W0FA 3VGAB 5JPNC 1NDMB 2FATL 5BRPA 3PHOB 1AZUA 2BS4B 2HTHA 3QIUD 4DK5A 3EG9A 3IDYB 4BFIA 3ZNGC 1HHKB 1U8MA 2PKDA 2JKTM 4U6HA 2QL1A 4OF0A 1JUFA 3ZK0A 1NIDA 3F7PC 1YUHA 4AW7A 2NPTA 3C8KA 4LOUC 4OFYA 5A16A 5IFHL 3IGAB 5EUOA 3SFYA 3RL1B 4X6DB 5LGHH 2WYQA 5DZ9A 1TTAA 1V05A 1OCOE 3T9WA 1VHPA 4D10C 4GRLB 1DR9A 2HPTA 4GOCA 4RG9A 3RRMB 1E4KA 4GKZB 1BEYH 3M17B 4I1MA 1OTSD 2YPLB 4KMLB 4LSRH 5HDWA 5CJOH 3RMKC 4LNOA 1S5IL 1YY8A 3KPNB 4HC1H 4Y4KD 2XWXA 3FB5A 2CBPA 3NIGE 3BGMA 1TSRA 2LVPA 3E37A 3Q47B 2NXZD 3GHPA 3Q9PA 2CLZA 1OAXH 5MERA 3VFKA 3HVEB 5DXWA 1ORQB 1TQVA 2XTSA 4IKKA 4YFLI 5E7FA 1NI3A 2AL6A 1IX2A 4C83A 3W9EB 1CJAA 2W0KA 4TNFA 4UU9A 3T1FB 3UAJA 4J8SA 1E30A 4JFFB 1W8EA 5DD0L 1RY7B 1NMBL 1AE6H 4OIIH 5D2NE 4DGVL 5CEZH 5D7HA 1TO5A 2VL5B 3DGDA 5AIJA 3VFPA 4DX2A 1AR1B 4PB0H 4B0EA 4O2FA 2AJSH 3SCMD 4NZRH 4DX7D 2HKFH 3PWJB 3MV9E 3MNZB 4ANKA 3QIBC 2NZ1A 1A5EA 4WHDA 4X7TA 5LGJA 3AN1A 3VG9C 4CJ0A 1SB3C 1E28A 3V0JA 1N5AB 4UDUC 3TZVB 1KJMA 4A7SA 4EDWH 3EO0B 5JORA 1DJYA 1LL1A 1CO1A 1ECYA 2NY6B 1LK3L 5F6HJ 2VAAB 3RTQA 3ABLE 5CJQL 1L0PA 1JK8A 2FJGB 5DGQA 4S1RH 4HDIA 1T5KA 2JI1A 2BWQA 3QA3B 2PO6B 1F41A 4RISL 3VRBB 4HU2A 1NBYB 3RUGB 5EF1A 1YYLH 4M4PA 3CGHA 1T4KA 5IHUL 2ADFH 1EHAA 4YEFA 1T20A 2IDCA 1M9WA 4J3OD 5FO8A 4JN1H 4XEIG 2R1XB 5D7JA 5HBBA 3SZ7A 4OGAC 4D3CH 4KVGB 2JWUA 4AYGA 1TY2A 5D1QD 1EO7A 3N1YC 3QUML 2DICA 4PRPD 3MRPA 3GSXB 4EI5B 4JZYA 5DO2D 4WO4D 4MRUA 2EDEA 1IBXA 2DLEA 5C0FB 5HVHB 3ETTA 4JMNA 2A9NH 2ZOTA 1JVLA 2F1AA 3MAWA 4F3FA 1I9JH 5H4ZA 4XPBH 3W9EA 5LB1A 1C5CH 4BQ8A 4GXFA 2FHFA 3KLSX 4YHZL 4YDVA 3S7GA 4PCKA 1N52A 3LVRE 1SDYA 4LLQA 3V0FA 5HYIA 1QFPA 5G5GA 4JFEA 4IKNA 4M5YH 1WGHA 2LTQC 3MV9B 4H20L 3BQUD 4HC1A 3LEWA 2ZF9A 3MV11 2REXA 3T0EC 4MZ3A 3MRCA 4HXBL 1FL3B 3S7DA 2VR6A 4WWKA 4K71B 1OSZB 1GNUA 3CLEL 2GC7C 3GTVA 1QLBB 2X0UA 1KJMB 4H44C 1IC0A 5J0BA 4K9EL 2W65A 3QZPA 4X6BA 5GGUB 1CI3M 3B7YA 4EAEA 2KQNA 2E3TA 2XQBL 3CF6E 2R4SH 1TQUA 1KH0A 2EDJA 4N2QA 2DI8A 1R24A 2JXMB 2NY6D 4G7VL 5FECB 1ZUD2 1HL9A 1LWJA 2W91A 4LEXH 4Z7NB 4J6IA 5EFIA 4AIZB 2YZ1A 1BQ5A 4Z77B 1R4NB 3BEEA 4C0MA 3CHMA 1CLZH 1E27B 3LKSB 1CFNB 1JGUH 1S63A 1LHZA 2YSTA 1LM8V 1IIIA 4LLYA 1Y18B 5CMAA 3V0HA 2G3QB 4B95A 3NFNB 4TVUA 5T33L 1YNLH 1D7FA 1OP4A 4EBAA 4YHPB 3LKOA 3STBA 1PSKL 2J57A 8FABB 1H3VA 1K1BA 1A7PL 4JGJA 3F7LA 4KDTA 4IBTA 3BIID 1G4RA 3FY4A 3T0XA 2GRMA 1MNNA 2ODHA 3V0GA 2XHNA 2UZYA 3QE5A 3WE1A 5BYQA 3A9JB 5FKAB 2R29A 3V4UH 1IC4L 3SDYH 3IGAA 4HF5L 3FN9A 3ECIA 5CFHA 2ZCLL 2WLNA 4IU2A 4KRLB 3N9GH 1EF5A 1KJ2A 4HIXL 1XF4B 4AQAB 2WBWB 5JOPD 1CLOL 1EUTA 4A37A 2J8UE 5LBSL 1OIOA 2FO8A 4PJCE 1TTGA 2L7QA 32C2A 1G94A 2F08A 4LLDB 5EBLA 3TT3H 4LGSB 4LPXA 4G6KL 4NZTL 1JWMD 1JDDA 2FSEB 2X4PB 2A83B 4WWKB 1A2YA 2C7MB 2BNRB 3QHFL 4U8HA 4KMOA 2V6HA 3I02A 3V6OE 5A2FA 2RQEA 1NGZB 1HHHA 2YR3A 2XZCL 4G0NB 4I2XB 4IOFD 4N2KA 1EEYB 2D9CA 4J8EA 4F8LA 1GRWA 3ULVL 2N4FA 1TQCB 4FG6C 4OI8A 4X9BA 1MCBA 3O4OB 4UZGA 5EOTA 3VFGH 4R96B 5M7QA 3TA3D 4BSWA 4TSCH 3I63C 3CVHL 3ISRA 3GLEA 3L4XA 4Z7QE 5T1LB 4D0DB 1T89A 5LCVH 3FRPA 2FD6L 3BKJH 3I75A 3U79A 4CQNA 1R24B 2JXMA 2E8ZA 1OAKL 1JZ8A 1TCMA 1MFBH 1QG3A 3H0TA 2DM7A 1YEEH 1RURH 4Y2LA 2QGDA 4G24A 3ILEA 1LD8A 1A6TA 2K22A 4MLSA 1JGVL 1MRCH 3L4YA 3N85L 5C0GA 3UBXB 5E70A 3TBSA 1OEYJ 3BFWA 4M61B 1NMCB 4MSWA 2FIKB 3PG2A 3KS0J 3ECUA 1I3VA 3IFOA 1EWCA 1WA0X 4MGYE 2EKJA 5IFAL 3O11B 3B13A 4KVCL 4JY4B 3Q5YA 1DYQA 4DLQA 1LO4L 2O5ZL 4N59A 4GIOA 5CFAA 5KBLA 2ZYHA 2QQQA 4G5ZH 2XWBA 3IXSA 1F8TL 1SJXA 1AIZA 5DRXA 3WFEL 4CN4A 3FCGA 3ZE0F 4KZCA 3AW5A 2E7CA 1DSWA 1U2HA 3MRKA 1DBML 5EU5B 4OY9A 2C0LA 5CJXA 4LLUB 1AQDB 2CO1A 5C0CD 2M1MA 3EBAA 2MOVA 3Q13A 2G5UA 3WFZA 6TAAA 5AB2A 4WI5A 3B2XA 2J5WA 2PWFA 2H9GA 3BWZA 3K91A 4XP1L 4GGQA 2A6IB 3SJVD 3VXMB 4EKXA 5C0FA 2QKSA 2I07B 3S36H 3VXTA 3QARA 2VUKA 4ACLA 1ACZA 3NK3A 4AIEA 1J8HD 2Z7YA 1UH2A 3ISYA 4DGUA 3PTFC 1XGUA 4KY1L 4H8PA 2OMYA 5C7ZA 5DK2B 4KMTL 3MROA 2HJKA 4RFOH 4CNIB 1KJVA 2A3TA 2NY4C 1D5XC 5LXHA 2MBBB 1FFQA 2HX7A 1E5YA 2XG5B 4LQFH 3VSUA 4DZ8B 2EXYC 3DXAD 2YLKA 2ZP0T 4FLSA 2WW8A 3BUDA 4FQQB 4HUWA 4ADIA 1QWHA 2RTTA 2YQ2A 2AF2A 2BW2A 1KLUB 2ZAIA 4N2BA 3I9AA 2W9EL 3UBXA 3W9DA 3IJHB 4X6DF 3V0AC 5HQ8A 2UYLB 1YY9D 4XMLL 3MNWB 3DGGA 5AYTA 5E6ID 3BWUC 4HG4J 3BRGC 1STEA 3PNWA 3RGVB 3B9EA 3NFSH 1YNLL 5DFTA 3HXDA 3P4MB 5CHEE 5DDHA 1JV2A 1CU4H 2AEWA 3EZ8A 4MD0A 2BFVL 3V05A 4OW0A 1KM7A 1DEEB 2KMMA 1MZZA 1AVAA 2XN9C 2CZNA 5F71A 3SBTB 1E4JA 1RK0B 2BSTB 1E10A 4JD2G 5JXED 5MP6H 3ZKMC 2YMXL 3CX5K 3OAWA 4WHYH 5CCGE 1C79A 4F27A 2P1YA 2ESVE 4AM0Q 4JFDB 4Z7VB 1HSAB 2JXTA 4V1DB 1AQDA 2CR5A 1DC2A 1MCIA 3MFFA 1VACA 1IGTB 1NCCH 1RZFL 3GGWA 2VR7A 4JO4L 4QF1A 3QJQB 5AW0B 5C2BL 2Y6SD 1MCKA 3F64A 5E9DE 1PDXA 4ZSOB 5DCNA 3L1FA 1XSOA 5EN2A 1TTRA 1UT9A 4UQZA 1N6QL 3DURB 4XNYH 3AG4B 2FEJA 5DFVD 2GRIA 1IKFH 4QRPA 2P49B 3JUYA 1BZ7B 3T0WA 4HZ1A 3QWNA 4HIIB 1SF5A 4JKWA 1X5JA 1XF2B 1KJ2B 2L0IA 1OF0A 1TJFA 1G1KA 4W9JC 3CSYB 4U0ZA 5CLTA 4JFZL 3TG4A 2WN2A 4O9HL 2H0FA 4H8WC 1UYWL 1DQQB 2ZNVB 2VISA 1N4SA 1MHPH 5EU4B 3DX7B 3D4YA 5H92C 3SB3A 3IMWA 2BC4A 1BDYA 1FPTH 1RK7A 1KBWA 1P7KB 2H6PB 2M1KA 3A4AA 3IU4L 4FTVE 4JO3L 4QIRA 2FWSA 2V3PA 4LDTB 2Y2WA 4E41E 4G6FD 4J8RA 1UD3A 3QPXH 5IROD 5EOTB 1YNKH 1AD9A 4O60A 4HIQA 4PRIB 1XCTA 4IJ3C 3KYNA 1WZ0A 1BA9A 5D94A 4X9YA 3PABB 3I75B 3QK0A 1LO5B 1X7QB 4PJ9D 1T7VA 3MBEB 2W81C 3UG5A 1WRDB 4XP5H 4XOBA 1RM6C 1ZANH 1VFUA 5FCSH 1LD7A 1UBIA 3L1GA 3P3SA 2YRLA 4Z5RA 3P9MA 4B9KA 1EGJH 3P0VH 2BJMH 1D5MA 4CZ2D 4UAOB 4RGMC 1CFTA 1S9YB 3J9CA 4S1RL 3PQYA 2X88A 4RM8A 3LB6C 3V6EB 5F97E 1F11B 1RERA 4MQSB 4DQOL 3O8XC 4X5QA 4Y4FC 3K6IA 4EDWL 3O11A 4MRCA 3MJWA 1Y6IA 2QY7A 4F8OA 5L88H 1DVPA 3PL6B 3E6HB 2R7EA 4Y5YA 4DETA 1OQRA 5AKRA 2VXVL 1RWSA 3VGDA 3EXLA 2Z91B 4OF5A 2J6EL 4Y1AA 5I76A 5EX3A 4PJXE 1JCKA 4NRYA 3D33A 2Z0DB 2HUHA 1QVOB 2Q6WA 2ARJA 4B3VA 1FA4A 3IT4B 4MELA 3FU0A 1F2RC 1NUDA 4OD1H 4JO5A 4WZ9A 5DPSA 5GZNA 4F7MB 1C4CA 4PYUA 2GTZB 4JG1L 1YN3A 4WH4A 2BS3B 3PCYA 4I0PA 3LY8A 1F6FB 2YUVA 3B9AA 3NJFA 1W2KT 2BVQB 5JZ7C 4F8CB 1I31A 4YC2B 5BXUA 4LFHG 1OAXL 5A2LH 3BLPX 3MRMA 5TE4L 1AKJA 1KENH 1PLCA 4AV4A 3WNNA 3MREB 3P42A 2O1AA 2IJGX 4FQJL 3M7OA 1BEYL 4L3EE 5BUZA 2LABA 5KHOA 3GBML 2Y5TA 5D5MF 5LGYA 2FCBA 1QI3A 1EZSA 1KCSL 5L4IA 3PRPB 4JRXB 3TL5A 3P3TA 3Q3FA 2R56L 4M6NH 3IRCA 2UU7A 2N7AA 2XEVA 5DPTA 1S78D 3GZPA 4I3SH 2A9CA 5J7CC 1JWSB 1NJ9B 2NNAB 2B2XH 1D5ZB 1DE4A 1HO8A 5DD1H 2O5NA 4A7GA 4N0YH 5T8IA 2OSYA 2WWNA 4JZJA 4W9GA 4M7CA 1I8LA 2PPCA 5EO0B 1SY6L 1D9KB 2Q7NA 4XP6L 2UV3A 1DBJH 5G04C 4QWWD 3PNWB 3RGVA 3HG0D 3MKQA 4GQRA 4PJ8B 2P24A 4N87A 5L0QC 5KHQA 2CHNA 4MJ4A 5E8EB 2FJFB 2WWMC 2HLEB 1IM9D 3GJFA 2DBAA 4OZGB 1OAQH 1DEEA 4JFED 1AP2A 2E9WA 5EO1B 3GLDA 1RD6A 1ACXA 3QNXB 5DJAB 4WLCA 1ZLWK 2K3TA 4NRYB 1JCKB 2X9ZA 4GU5A 4L4TA 2QKIA 3HBPA 3NABH 2BNRE 3EDKA 1G1CA 3BUPA 3O2DA 5KBPA 3KW7A 4LVNB 4A7VA 1M6OA 4IQHA 4PJEF 5FFLA 2PR4L 5EC1B 4NI3A 3U1SL 4IDIA 2O2VB 1SY6H 4N8VA 4CMMB 3J5PA 1TLKA 3IETB 5CUSL 4W70A 2A6DB 4I1RA 3KH3A 3TBYB 4L8CA 1PG7W 2WXLA 1JAEA 3MRDB 1U3HA 4OZ4A 1T1YA 3HS0A 1Z3GH 1CD1B 4B5ZA 4HIIA 2V9HA 4JGHB 1A3LL 3OHXB 1U8HB 3V30A 2GJZA 2K9UA 1UN8A 3IBOA 3V61A 3CKCA 3MTNB 1I9IL 1PLBA 3GHBL 4K4KA 4HMCA 4U7MA 2J4DA 2D3CA 5B8CB 1U8JB 4YHLH 4F92B 4GCNA 1BV8A 2VQ4A 1VDYA 2GB2A 3WEBA 1MI5D 1P53A 5IAAC 1UXLA 4F3VA 2OL3L 1ZEAL 4FXCA 2IO2C 4RGNE 5B7FA 3DSWA 2NX5D 2UZPA 1AD9B 4YBQD 1E65A 2WHVA 1J7AA 1UQSA 2B3IA 4KXAA 4TTDC 4B0MB 1IO4C 4A3VA 4BK4A 1BBJA 4KRPD 1THCA 1K6QH 3VFOA 5J13C 1GJZA 1G9NC 3DKHA 1FI8C 4Z5RB 3VG0L 2CDEB 2Q7FA 5BMHA 1SJVA 1N2RB 2XRYA 4NQVB 2AEPH 4Q6IB 1GH7A 3WFHA 2EDYA 1N95A 4AY6A 2Q20A 3QWQB 4AXWA 5KYYB 4D9RD 4FXGB 1TYJA 2WUBL 1IAIL 1MCPH 1WE5A 2HA1A 3O2WH 2PNDA 5TDPA 4S0HA 1PFCA 3DCGA 3ABZA 1K5NB 3HUJE 3ARDD 3NN8A 5FM5O 3FEYA 1PS3A 2YAHA 4XPHH 2ESVA 2IH8A 3KXFE 3TNNA 2L32A 4A6YB 1L6UA 2W07A 1D5IL 5GGTH 1FUNA 4AI7A 4ZMTA 1OK0A 5FF6A 2VDPB 1PL3A 4AJWA 1YMHA 3DLQR 3QCVH 4G6AC 1DQJA 3CVDA 5HHOD 4P3CL 3TV8A 2OCCB 3I9V1 1WVZA 4EJ1C 4MMXB 2HRGA 3AU0A 3LZRA 1MX4A 2H4EA 4F1PA 2GJZB 2RPVA 1QBMH 3AJ7A 2LJIA 4P4KD 2DLGA 4RFEA 2ZUQB 4NKDB 1KENL 1KNOB 4UB0L 3ZJAA 1KG0B 3ARBC 3NQIA 1P84J 5HJ3A 3QDAA 2ZE0A 1F2RI 2NVUI 4XN7A 5DK3A 4J3OH 2KD0A 4X8GA 4H8WL 2AWTA 3MREA 2Y06L 4BQBA 2QGCA 1WCBB 1TN7A 3UBGA 2GCYA 4NQ0A 1VFBA 4L8SC 4OD2B 1TTBA 4K3CA 5DT1H 4XODA 1MXGA 4WFHE 1EMTH 3BD4A 1LO0L 3H9SE 4XHQA 1SDDB 4OGAD 5CZXC 2OMTA 3P54A 1G87A 4GQ9H 2H6FA 5CP7B 4QHLA 5IA7A 1TNOA 2WBJC 4XKBA 3KJ6H 1M2OA 4IOSD 4TVPD 2J0MA 1U4EA 2WYZA 3MA7B 4OZFH 5DJZA 1D5ZA 2V8LA 3S7JA 3N2JA 5I74C 3IAS1 4PV8B 3VDBA 1DVQA 4DPCX 4PLNC 1S8DB 3SEPA 3QIUC 4MH0E 3ZUCA 1DDHB 5AZHA 4XPGH 2N9PC 1CXKA 4OZAA 1I7ZA 3A6CL 3STZB 3WKMH 1CGSL 1ZIAA 3C87A 3Q5TA 2F8YA 2XVGA 4Y2DB 5J3HC 2UZIL 1ONQB 3CDFA 4ZRPA 3OX8A 2VQTA 2ZUUA 4LP4A 3CFJB 3WJLC 3I4RB 2IV9A 3CKBA 2R17C 4UQYA 1M7UA 1NKOA 2VLKB 1EPFA 3AUVA 4XO3A 5D2NB 2L3BA 5ICUA 5CF3A 4A3PA 3P2DA 3UX4A 3HZ3A 2NY1D 5HHVL 2DYPD 3NSFA 2W1NA 2AQ1B 4URTB 5E4OA 4HD5A 4ZFZB 1KIQA 1KEGH 1E7VA 1WSPA 4P5MA 1XIWB 1UD2A 4JFEE 4Y4HD 1XLQA 2WMOA 1HYRC 3QDGB 3RNGC 4LHUB 2JJSA 4TTGA 5FUOH 3UI3A 3UXFA 2NXPA 3T6XA 2ZPNA 5BRZB 4JRLA 4MAYC 1WGKA 1SEQL 2FJHA 5K1NA 3UM1A 1WFIA 1HHKA 2QSCL 3LD8B 1P7FA 3D85B 2RDGA 1BD2E 3LNEA 3IJSB 4GQZA 4RGNC 4X7SH 3T6ZA 4AKQA 1AD0A 3E56A 5D1QB 3ABMB 4QOKB 1N8OE 2XG4B 3UTZB 1HU8A 1SE2A 1BW8A 2ZWKA 1EXUB 4O1OA 2B15A 4I7ZC 3PDGA 3TGOA 5EU6A 2J08A 2IH9A 3H3BC 4HK3J 4AP4C 5HYJA 4GYOA 2PMZA 2WZ5A 3CIQA 3Q3GB 3CG8A 3G6AA 5D6CA 5A7EA 2KMWA 4RGOL 3VWKB 1U95B 4AVJA 4JE3B 3QG7L 2J43A 3DSFL 3SGDH 5HPMB 2VR5A 2X6VA 2IADA 3HK0A 2MCNB 4ERSH 5A2AA 1CXLA 4KJQD 3L1OH 3ASFA 2BF8B 3MRBA 3GSQA 3VXUB 2BYVE 2QJLA 4AYFB 1KGYE 2EE2A 4DN4H 3T1FA 1XF3A 4FNSA 5ESQA 3R4DA 5MHSE 4GUPB 1DBMH 2YMXH 3WTYA 3W0WA 1NGXB 4PWGA 1CVRA 4D9QD 2LGNA 2JRIB 3NIGF 1CFQB 2AKRA 3ARFC 3VXUD 1A6AA 4HLZH 1NPNA 3TO4D 1MG2C 3TP4A 2MOGA 3NPZB 4N3BA 1L0XA 4PLKD 3SQOL 4N3AA 1L9OA 1MQKL 2LU5A 3HZVB 1NDGB 5E8NA 1DBAL 1UKQA 1SVXA 2RAMA 2ZVOA 3P77B 2VIRB 3KMDA 2D9QB 1F0LA 5EZLB 2CO2A 3CZGA 3IJ7A 2PTLA 4AVKA 2WVIA 4YDLC 4QNPE 1XR9A 3BVNB 3ALWA 4A6YA 5B3SB 4W9DA 5TQ0L 3VCLA 2MP2A 3AREA 2K8HA 3A24A 1EWHA 4GAJH 3WN6A 1MF2H 2D3VA 2L0FA 2D5GA 3ABGA 1NBYA 1ZB1A 3J2PA 2IONA 1UZ6F 3BXNA 3DHPA 4N8UA 2OSXA 3BI9X 4AZ8A 1A9BA 3RSEG 4EUPB 3ARED 1XVSA 5I1IL 3ZMNA 4MM3A 2AW6A 4JM2D 3Q7AA 2X89A 5EUOE 2P8LA 1YA0A 5SWSB 2M56B 1TZAA 1RJZA 1T04B 4UM9A 3V0EA 1EO8H 2Y72A 3GE3C 1NAML 3NBNA 5AENA 3VH8B 2F68X 2WPGA 1NQBA 2O4EA 1U95A 1QP1A 2XFXA 1QKZH 1CDJA 2OI9C 3EJRA 4NGHL 5I9QB 3U36B 3NK4A 3V9FA 3N5AA 1RZIB 4QGYA 3WIIL 5LXGL 3VW3H 2QGEA 1CURA 4F2ME 4FQHA 5FK9C 5C2TB 2F7PA 3MCXA 3C19A 2X5PA 2VERN 5DMGD 1YDPA 3HE7D 1XF3B 4NN6B 2EIJE 3LKNB 5CINL 3RVTC 4HIXH 4OCYL 1A4AA 2IH3B 4F8TA 3LXAA 3NZ8A 4QHLB 4V33A 3TNMB 1W8NA 4N0FB 1SY6A 2OLDA 4Z7OB 1YJIA 3HG1A 3PPSA 2K39A 4HF5H 4HJJH 3GRWL 1L7YA 3H7PB 1C1EL 3VXNB 2IANE 2AJXL 3O2DH 3R0NA 1JROA 2LI5A 4US9A 5LBGA 1Y0LB 2NQCA 3MOAL 2NTFA 4G83A 4OB5L 2H41A 2HRHA 3PHAA 4FHJA 2CGRH 5EH1A 3DBHI 1G7LB 4EN2A 1ZTXL 4NN7C 1IAII 1HCYA 1NCTA 5CLYA 3GJFH 1J5HA 3ESMA 2BYTA 2ZNWA 5EOQH 1FNVA 2XPGB 2VQ2A 1YEDB 3Q3JA 5A7BA 3QCTL 4ZW3A 2JX5A 4KX6B 4KXKB 4L3EB 3T04D 3VDCA 3REVB 4APQC 4CGTA 1WXMA 3ZKJA 4WUUA 1K8IB 3NIFE 3RG1C 2W94A 1FVEB 1YUKB 1BJ1J 2VYIA 4K81A 3TJEL 5G5HA 1HX8A 4E6HA 2FAUA 3O45B 4ODUB 1QEWB 5C3IA 2MTPA 1N3NA 3GNMH 2L7JA 3PGFH 3EJNA 1RJZB 3JVFC 4HK0B 2F19H 2IG2H 4LEOB 5SX5H 3SDAD 1WZ3A 5ENTD 5FYKD 2OTWA 2WBJB 35C8H 3W82A 2WGSA 1N5YL 4BHUI 4J3XA 3KPOA 2YEZA 2Y4SA 5CJ8A 5F3BA 4HUUB 3HAEH 4TQ0A 1MH5B 3KM1A 4HXBH 4H8VA 2DQGH 4KX7A 4NUJB 3EHNA 4Z7WA 4HOUA 2B1OA 4JFHD 2EKSA 1NMAH 2OR9L 4L4TD 4Q9RL 1QFWM 2NX5B 4O02H 1CXEA 2B59A 1H6FA 1VKXB 3NZ8B 3ZO9A 5EU6B 3UUXA 1OT8A 1EA9C 4P9HC 1M1XB 4YHZH 3RZCB 5EBMB 4Z7NF 3RRNB 1O6TA 4NAMA 1U8PB 1X4ZA 3IDMA 1BFVL 2O30A 4LSUL 2FCSA 32C2B 5IY5E 3HS9A 3SKMA 3E3QC 3HZMA 3QEQA 4JJ5A 1FHGA 4ZMZA 1J48A 1K4CB 2V5QC 2EDRA 1KYAA 2B39A 2W55A 1MN4A 3B5HA 3VGFA 4YLCA 4BIKA 1CLYH 1A7PH 2J8OA 3LNFA 3K9PB 3X2QE 3OKNA 5E0FA 2VITB 4X4YA 2Z59B 4HS6A 4N68A 4HCPB 1IHGA 1MFMA 3I50H 1WH0A 2X4NB 1F4YL 3GJEA 1T5WB 3RWFB 3LDZE 4BSWB 2ON8A 2FH8A 1E5ZA 1Z0NA 2ADFL 3EJTA 4IOIA 3IN2A 3BZDB 2YAOA 3Q2VA 2KUTA 5I1EL 2XK5B 3QORD 4K5AB 3BAYA 4AT6A 3KUCB 1W8OA 4ZO8A 3T2PA 1WV7T 4ODUA 1P1AA 1NDGA 3L9BA 3CC5B 5I8CB 3ELAT 1CFSB 4TQEH 4Y2DD 4KRPC 3AT0A 3GUTB 4J3SA 1AC0A 1NBFC 2WCPA 3MTRA 1IL1B 5CGYC 2Y7QB 4MD4B 1YQVL 3VTYA 3BK2A 1EO5A 3FB7A 1HTYA 4OFIA 5F3BB 3PWPE 5GRZA 4PWEA 4BINA 4JCMA 1IKNA 4IWOA 3OPZL 4WDIB 4FTVA 2DYPB 3BGAA 4JHBA 1KFAL 4KHXH 1YEGL 4AZ8B 3ZQXA 3E9SA 4U1GC 4H7VA 4C7ZA 2R03A 2EVJA 4JDVB 3ZRFA 1W3BA 2Z93B 5IZ7A 4Y8AA 4UM9B 3I5PA 4C48B 5DJ0A 1N0XH 3QDHA 1FNSH 4XWGL 1N4PA 1U3CA 5F93C 4AMKL 2OMZA 3VLFA 1UASA 3JVGC 3L3OC 2DAVA 5D1XC 5F7BA 3QRGH 1ZT7A 4JEHA 1BXUA 2BP8B 1M3JA 2X6UA 4ILDA 4NAWB 4A55A 3SE8H 1IBZA 1RL1A 4QRPE 3V8OA 3QUMH 3WO4C 4PRAB 4D8PA 1E6OL 1MFWA 3EA6A 5JHDE 1S5IH 4HC1L 1I4GA 4YWGL 1VLBA 5JHDD 4HWEL 2WCGA 4CUCA 2WLIB 1UTDA 25C8H 4WEEA 5HDBE 1MLBA 3BUTA 5D6JB 4BE5A 2YC1A 1V27A 4M3HA 2ED7A 5EZPA 5EOCJ 1V10A 2BCKA 43CAB 5FKPA 4NBXB 5GS0C 4QY8A 5F6IB 4TKNA 4PJAB 3EFDL 3D50A 3UTMA 1SFHA 4RQQB 5IHZB 2XNAB 3RL2A 1V3KA 5LWYH 1WX7A 1WITA 4JHKA 3T8KA 2MBEA 2R0LH 3ULEG 4R0LC 1I9RL 4RGTA 5I28A 3DROA 1JF5A 1REIA 1RIUH 2P47B 2ZXGA 3ZKSD 1JGEB 2XXMB 3LIZL 4LSTH 2J71A 4X5XB 3W5UB 1Q94A 1CFVH 3TV3L 1FMAD 3MLYL 3C3RA 1O7SA 2CG3A 4ME2A 1DFXA 5F7AA 1K2DB 4AH2B 4BK8A 1JI1A 4HDIB 4I1PA 4LBAA 3BHBA 2ATPA 4POZC 2CE6A 4WO4A 4XVJH 1MW1A 5F96L 4B9YA 1UWEL 5FZQA 4JFDE 3O45A 2AJZA 1C8PA 1SHXA 4BGLA 1RFDH 1NMBH 5BRQA 1OV8A 4H88L 3ECQA 1ZPLA 2DBLH 3AGWA 1ROEA 3B08A 3URYA 3MRIA 3JTBA 1RP8A 4ODVH 4HKZA 3QRLA 1DO5A 2B3RA 4II3B 4WWMA 2WZAA 2O6VA 3NCXA 1F58L 2W9LA 4I0KA 4GTMA 3EYQD 4QRPB 1B2YA 4JX0A 3KDMA 3RNFC 4JO1L 3WHXB 5JQHC 3ZYKA 4PK1A 4ZFQA 4FG2A 1T3FA 4I48B 2R0ZH 5FCUH 4C54A 4Q2JA 4Z18A 1R7SA 4F2MA 3RFRA 4XMVA 3I9GH 3U6XS 5EZJB 3WD5L 1AWCB 3L3JB 4FEIA 2PPAA 3BPLB 4Z95H 2IDFA 2YK1L 4JFYB 5C09D 2ICIA 3NEEA 5E4EB 1MX6A 1RPQA 2HT4D 2IGLA 3L4UA 5HYQA 4L4TE 2DLFL 2KXJA 2GT9B 4KKBC 4ACPA 3UIZA 3W2DA 1RUML 5AOKA 1BQLH 2MQCA 2IQAA 4WKXA 3VH8G 2IYDB 4E68A 2HE0A 4FCAA 1SA5A 4J8RB 2VSXE 1XH3A 3WJJA 3L4TA 4HGWA 5FAAA 4HRNA 1NINA 5J9PA 3ULUC 5FK9B 3B2PA 4PJHF 1RFKA 2NSZA 4C8XA 1OWMA 1XBDA 1N5WA 4KGLA 4XOEA 3BMWA 4L9LB 1EEZA 4F20A 3KBHE 5I6MA 3LKSA 4K7PH 1X4XA 2YQBA 4IRSD 5BOJA 4UWLA 5FWQA 3AKKA 2RQ8A 3QXDB 1Y18A 3QRBA 3OKEA 4Y2OB 3ARXA 1F11A 2CJUL 3MRIB 4KZEL 1XGQA 4XVTL 1HXMB 1UEMA 2I60L 2WQWA 3O6ML 4HMDA 5BO1L 3F5WB 4DUWA 2R59A 5A6IA 1ASOA 1F18A 1P98A 1U3HD 2KQ4X 4RZKA 2KYWA 5H37G 5TK4A 2FNBA 3C2AH 1K9TA 1YUHB 4GMTH 1AI1H 5ICXA 3FO9B 3N44F 3VRJA 1J88A 1CQKA 4PWJA 5FLUA 5IB4A 4BETA 1A4KA 2BY0A 1TKEA 3BH8A 4JPWH 3ZN6A 1KT2B 4ODHH 2BPBA 4WVRA 1AGFA 4IBZA 4B0MM 3M45A 4OZGF 1I1YA 4IU2B 2KHWB 1HYSC 4Q58C 3UIPC 4N2GA 3LSOB 4USAA 1CDGA 4XHJC 2XZAL 5HD8C 5IKCA 2YSSA 3C60A 4NKOB 1OF2B 4I0PB 2VR3A 2AQ3B 4R8WH 4EXKA 4IUMB 1SOXA 4M93C 2F7QA 5EZIH 2G9KA 5E9AA 2WQ6A 1PQZB 5IW3A 3EUVA 3IDXL 3MRMB 5AOIA 1IFRA 4U6VH 4LSQL 1CB4A 2PW1A 4G42B 4NZJA 4BWRA 1SXCA 1IRAY 3NVQA 2DQ6A 4P2QE 3RDTB 2VDMB 1OD9A 3S4SB 4F9LA 3F3HA 4R3SA 1T66C 3RKVA 4JPQA 5J9PB 5CECB 3WO3B 3S37H 1FFUA 3WJMA 2OOBB 4BEPA 4JREC 3L3DB 3NVYA 1M1SA 2TSAA 4W9LC 4Z7IA 4Z3GA 3F7YA 3SFXA 5AOJA 5A6LA 4M43H 4TM9A 1EK3A 5IMKB 4U95D 4M5ZL 4P23B 5DJ2B 5DYOB 5F3FA 1KY7A 1FL5A 2VDQL 3MV8D 5GRYA 1NC2A 2O6DA 4C4UA 1QQDA 4O5LL 3CIAA 4X9FA 1F6LL 2YD0A 3CPLB 5EORL 1WE6A 1WFTA 2J6WA 2VSCA 3HI5H 4H40A 2AK4A 4OGYH 4F7EA 4JQWC 4OM1H 2OMWB 5GXGB 2KTFA 2JIXB 4ZODA 2WXKA 5AVQB 3S3PA 1IE5A 4H7XA 1WWCA 2APBA 3RPIB 4D8OA 4YH6A 3HTLX 4YAQB 1O6SB 5D96C 1YEFH 4GDLB 3O6FA 2KTRB 2AJUH 2BOBB 2P52A 5DWPA 2KX0A 1YAIA 1GGUA 1KPRB 5EU5A 4JL9A 4KK6C 1U30A 2INCC 4FQIH 4OV6F 5I6XC 2ZGDA 3B5TA 4XIFA 1OF2A 4OAVB 1FPTL 3PWVA 1GKEA 2Q8AH 3T3PE 2BT6A 3ARFA 4NC1C 5D4HA 3VXSE 4RAVA 3D0VA 1YQ4B 4IM0A 4UWHA 3ONKA 3KHOA 3WFCL 1J9RA 3V60A 2MWSB 3DXMG 3O3BB 2NW3B 1MFCH 1MCHA 2APTA 2DB8A 2HTLD 4M1DL 4PN6A 3RWJB 2KVRA 4NQED 1CTNA 1HCZA 1ZRUA 3TN0A 2HH0L 3QZMA 4Q89A 3ASNB 2AQRA 3BIBX 3WKNA 3ML8A 4JFOB 1QLEH 4F2MB 1IBFA 3II1A 4QHPA 3WJMB 5C08B 3DOSB 4FQQA 1IEAA 4RF1A 1Q2ZA 3FULA 2VH5H 3CUPB 3MRCB 1NGYA 3F7YB 3GZNI 3U8ZA 3ARBA 1JWMB 2BVYA 2RCSL 5DC9B 3OAZH 3OBAA 4ZMVA 5IQMA 1EBPA 2PW9A 3LN5B 1GKOA 3K2KA 4OSUL 2FBWB 5IB1A 5TK2A 2VXSL 3UAJD 2G4DB 4WI7A 3CBJB 3FYEB 5I4DA 3NMEA 1FYTB 2APXA 1FSKC 3KYOB 4PREA 5C08D 3CFQA 5CEXA 1AP7A 1ZOXA 3DWGC 5JW4Q 1A7RH 4DEWA 1FJ1A 2AVFA 5TH2B 1GS8A 2LE9A 4M0WA 1GUAB 5BVJA 4PUCA 1KTDB 4L4VA 1JFQH 5CSZA 5CD3B 4XH2A 4GTSA 4KDVA 1JI2A 1FC2D 1H3PH 4LLWA 2GTWB 4MD5A 1DVFA 4NN5C 3I4GA 1F3DJ 4JE0A 2XIBA 1M56B 1KYDA 4IRZL 4LCCB 5KSAC 1UN9A 1NEZG 4HOMA 3AT9A 4GDKB 3NFSL 4MCZB 4OZFA 4Y5VC 2I9TA 4GO6B 4UT6L 1RPKA 5GSVB 2CWRA 4AXWB 2I26N 2LSUA 5E99L 3CN2A 3JUEA 3LRSB 2UUDH 2ZX5A 3FUJA 2PCPA 4HEME 2X2UA 4AJ0A 4QD2E 4WUKH 3AE6B 1A6WH 5J11B 3SI5A 1YC7A 4XX5A 5ARFA 1NA3A 4EPZA 3HBZA 2XX0A 3QORC 4F5CE 4NN6C 3H2WA 4KH9A 5INDA 2G0LA 4JFXB 5K9QI 4A9AA 1USQA 5EIBE 2HUEA 4NOFA 4Z0XA 1QLRA 4KROB 2J7QB 2W3RA 1KF9B 1KB5H 3TN0B 2NY7H 2BO0A 3G6DL 1WS8A 4K2UL 5F72S 4XGZA 4MMXA 2HJ1A 3AEBB 3K1DA 1MCOH 4Z3EA 2JJWA 3AXLB 1JPLA 2ZPKH 4UZUA 5ICYB 1IBGL 1U92B 2G2RB 4JVPA 1Q9KB 3UTPE 2EIBA 4F7KA 3ZJTA 3OJ4B 4I3GA 3LZFH 2YFNA 3LY9A 3QDJD 2V3NA 4WU5B 1PQZA 3VUWA 3PV1A 4JFFE 4EN3A 2V17H 1EEYA 4RGNA 3B34A 1R5VB 4I9WD 1FYTA 4E2OA 5F70A 5HGDA 3TWQA 3RDTA 1A4JB 5F89A 1FE8L 5FQ8A 1WFNA 4NFBA 3VTTA 3L6FA 4H25B 3ZKND 2CIKB 1TKYA 2BIOA 1D5BB 3ZUVB 2FHCA 1FXAA 3QUXB 4PVNA 4FXKC 4MJIA 1IQWH 3UDWA 1OHZA 1W0WA 4ZUUB 4Z7UA 4JVWA 5C0JA 1UGNA 4G1MA 1KB3A 5AL0A 3UYPB 5BZDA 5ECGA 1RK1A 1FL6A 1KOTA 3CWGA 2VQUA 2YBRA 3SE4C 4OCWH 4S1QL 3NACL 4WK0B 5GSVA 3WNLA 2VC2L 5LHDA 4EHMA 2Q1EA 3T71A 2FGWH 5IROA 2LAIA 4TSAL 3S3BB 4P5TD 4E9VA 4HJ0C 4D7BA </