4AJWA

Discovery and optimization of new benzimidazole- and benzoxazole-pyrimidone selective pi3kbeta inhibitors for the treatment of phosphatase and tensin homologue (pten)-deficient cancers
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
916
structure length
765
Chain Sequence
KKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNQPFSIELIEGRKVNAVQAGLFHGNEMLCKTDISVCDLPRMARLCFALYADCPIAWANLMLFDYKDQLKTGERCLYMWPSLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLTAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
publication title Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 212
structure length 765
sequence length 916
chains with identical sequence B
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4ajwA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ajwA03
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ajwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajwA01
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4ajwA04
3B0AA 1GC7A 4XZ4A 2DZKA 4N9F4 1WGGA 2N7DA 3WA0A 4EKUA 2JRHA 3KWTA 1DJWA 4WWNA 1GMIA 3WANA 1V2YA 1YX6B 1WE6A 4BGDA 4NPNA 2LXAA 3F00A 3QR1A 2O6VD 4L2YA 4A55A 1S1QB 4IG7B 3L17A 2C7NB 4DK5A 2HE7A 1D3ZA 3LJ3A 5KHOA 4DDGD 2KMCA 4NQKE 3AU5A 3QQ8B 3DVGY 1WXSA 4OYSA 1VCBA 4MGZE 4MSMB 5D2MB 4DBGA 3PPAA 4LDCA 4TQ1A 1T0YA 1OQYA 2AWTA 2I1JA 1CJAA 3V62A 1JRUA 4G50A 2AEHA 4JQWC 2NSQA 2KI6A 2UWQA 3L08A 4KDLB 4GNKB 3SD5A 4ASWC 1V5OA 1A25A 4JPSA 1PQSA 3N32A 4BKGA 1ZGUB 2Z0EB 2VRRB 1KJTA 1DJGA 3PHWB 3VAWA 4XC2A 3PV1A 3VXWA 4JL9A 1WGRA 1WR6E 4NAWB 2N7EA 2CHZA 4HLEA 3H7PB 4IM2A 2BYFA 2ISDA 4GSWA 1SGHA 2G4DB 4ANXA 3KWUA 2KFKB 3APCA 2I1KA 2KN5A 2MLBA 3ZRFA 4CO7A 3QAQA 2LJ5A 1K5WA 5JHAA 1RSYA 5JHBA 1WM3A 1V5TA 2LUEA 4GDKA 4DHZE 1TJXA 4WWOA 4W9HA 3T8MA 4LCVA 2CHXA 1RAXA 3RT3B 4OVUA 2WXGA 3GZNI 5L83A 2UZPA 2BGFA 2JZZA 2J0MA 3OHMB 4UWGA 4FHJA 2KDBA 3PHXB 2NPTA 1S3SG 2R2QA 2WX1A 3ZNID 3ZRCA 1OEYA 4FBJB 4IW0A 2MWSB 3QHTA 4KIKB 4NJ7A 3ZLZA 5FR6A 4DWFA 3L13A 2IO1B 2EKEC 1A5RA 3L16A 2BWFA 1EF1A 3R66C 2O2VA 4W9FA 3SDLC 2CHDA 1NBFC 2KTRA 3IM1A 4BBNC 3A4RA 4AUQC 4EEWA 4F93B 2MCNB 2ENPA 5AZFA 3CMMB 3ZNHB 1IYFA 1W15A 2K8CA 2YLMA 4HPMB 4DHJD 1BDYA 1UOVA 4JLCA 4UWFA 3R3MA 4EZLA 1V49A 4PYUA 3A9JB 1WGHA 4EZJA 4I6PA 4LDTD 1WF9A 3DDCB 2GBMA 2Y3AA 2BWES 5AZHA 3VVWB 5HKHA 3IBEA 1WXMA 2WXRA 4NS0A 4PS7A 4NNJB 3VDZA 4BKSA 3UQAA 2CM5A 3L9BA 4GDLB 3H6NA 3PSEB 4DHZB 3W57A 2L0FA 2ZVOA 2K6DB 4EFOA 1TBEA 2RD0A 1P0RA 3F04A 2WWZA 3B1LX 3IVFA 3PGEA 4F7ZA 4KSKC 1IP9A 2QZQA 5LXIB 3T9LA 2IYDB 3O65B 3MHSD 2X6HA 3GOEA 2JRIB 2KTFA 4P7IA 1OGWA 3DQVA 1DQVA 4HDOA 2RGFA 4IC7B 2MBEA 2X6KA 1KM7A 2JPHA 2DHZA 4K7UA 1HE8A 2ZKMX 5CHVC 1WRDB 2JXXA 2WXIA 1DSYA 2LVPA 4RM9A 5DPRA 4AJYB 2K4AA 1GNUA 2KZRA 3VUXA 2HD5B 2W9NA 4EOYA 2ZPNA 4IM0A 3ZTCA 4MM3A 4F8CB 3N3KB 3W1YA 3KYCD 4WJQA 5D6JB 1LXDA 1H8CA 4IM3A 4K7WA 2B3AA 4ZYNA 3VFKA 4ICWA 3A9KB 3H9DA 4HDQA 3VH3B 4LJOB 2NVUI 3A1QB 2DX5B 3TBLD 1GJZA 4G0NB 2DMHA 3CSFA 2IO0B 3A4SC 4K1RB 1NI2A 1YIWA 4B9KA 2FIFA 3N5AA 3ZKJC 2JUOA 1UELA 3ECIA 4MJSB 2K8MA 5J18A 3CSTA 4CHKA 1I42A 2WXMA 3R7QA 1P98A 4TUUA 4ZRJA 3N30A 2L76A 3ML9A 3AXCA 2KC1A 2KWVB 4G3XB 1I35A 4ANVA 4XE0A 3JZYA 2KWUB 4KV2A 4GGQA 2O6VB 5CHFA 3TMPB 4M8MA 2K6QA 3VUYA 4BKSD 3GPEA 1TTNA 3HHMA 3JSVB 2PJHA 3JW0X 3K9PB 2GMIC 2XK5B 1DJIA 2PE9A 1P3QU 3M7FB 1RRBA 2DAJA 2CM6A 2KJ6A 2KJHB 3NHEB 3NOBA 1NDDA 2K8HA 3TL5A 3QA8A 1UZXB 3OLMD 3KYDD 2KHWB 2ENQA 2LVQA 1V81A 3ZNZB 2MP2A 2MA9B 2N1WA 4IWPA 3AI5A 1ZKHA 4F92B 1V9JA 1UH6A 5G2NA 4L1LA 4EZKA 3V6CB 3VHTC 4BBNF 3DPDA 1GUAB 3VTUA 2CKHB 2CU1A 3WAPA 4FADA 3ZW3A 3V61A 2NCEA 3ONSA 1FXTB 1YJ1A 3A33B 2MQJA 2A5UA 3ENEA 2LGDA 2LGXA 1RLWA 4GU2A 4HXDA 2L8JA 2WXJA 2R83A 3DVNU 4W9CA 2M4NA 1C1YB 3CF6E 5AZGA 3L54A 5EDSA 2EMSA 2V3SA 2DYMA 3H1UA 2DAFA 3WALA 2L3ZA 1Q0WB 4E3CA 5J2RA 2FCMA 2JQZA 5CCHE 5ENNA 5CCJA 1VD2A 1E5WA 2KNBA 3DVGX 5D94A 3U7DA 2FCNA 4KSLC 3RD2A 2FUHB 3M95A 2X6FA 3WAOA 2V1YA 2DENB 1Q5WB 4ANWA 4DDID 1E8ZA 3PZDA 2NBWB 3TCAA 3UF8A 4BOSC 2QHOA 3TWYA 3M63B 5LLIA 1WY8A 1WMHB 4WAAA 3AULA 2KX3A 1YRKA 1YQBA 4ZDVA 3ZNGC 1WX9A 3KH0A 1QZEA 3F05A 4GMVA 2HJ8A 1J19A 5JH5C 4JIOU 3UIOB 4QJ3B 3I3TB 4GOCA 1C3TA 3DOWA 3APDA 4HJKA 3RZFA 1IPGA 4W9JA 1WGDA 4W9KA 3V6EB 4QAMB 2C60A 2J0KA 4IQHA 2ZPYA 4XX5A 2PE6B 2D2QA 1LM8B 1R4MI 1WXAA 1YX5B 4FJVB 4DHJB 2GBJA 3PTFC 2KDIA 4OVVA 2CS4A 3LDZE 2ZVNA 2BKFA 2X38A 5DPWA 3PRPB 4F91B 2IY0B 4HCPB 4BOZB 4LDTB 4MSQB 2CR5A 3M3JA 5CX3A 3VQIA 3VTVA 5KHQA 4W9EA 3LS8A 2WXLA 1UGMA 2LWPA 4NY0A 2C9WB 3V60A 5JZEB 3OAWA 3U30A 2ZCCA 2DMGA 2Q0ZX 1UBQA 2NBUA 3ZIMA 2Z0DB 3IFWB 2ZJDA 3OJ3A 1E7UA 4I6LB 4MJSA 3VH4B 4A3OA 1V80A 4WQOB 1WFMA 3VTWA 1WFJA 2JT4B 2KJRA 2KVRA 4IWQA 1KOTA 2WXOA 2WXNA 2WXQA 3PLUA 2JVCA 3BINA 3UIPB 5DPSA 2LXCA 4TV3A 1WZ0A 5T8IA 3EECA 2FK9A 2X6JA 4L23A 2GBKA 4W9IA 2X6IA 5IAAC 3KUZA 5AEKB 2LRWA 4GDKB 1WI0A 5L95C 4GB9A 1RH8A 3TJPA 1EUVB 1WM2A 1E90A 2K3HA 1YD8U 2BYVE 2KD0A 2O6VA 1QASA 2FAZA 4MGKE 4W9LA 5CHWA 2KX0A 2WDTB 3MJWA 3HM6X 3JSVA 4MGIE 4RMAA 1WE7A 4LCDE 4TQ0A 2L00B 2XBBC 4FA6A 5C23A 2KKCA 1GG3A 1WJ4A 2NS5A 4TKNA 2KOXA 5GMVA 2KDFB 2LHAA 2NPTB 4WJPA 2M1MA 2RSUA 3HK0A 2JZ3B 3F01A 3K9OB 5C1ZA 4A20A 1J8CA 3ALBA 4IUMB 3QR0A 2D10A 4NPJA 1WX7A 3EFUA 3FBKA 4F1SA 2AL3A 3M62B 4X57B 2O2VB 4NAWA 1SE9A 3ZTDA 2ZEQA 3APFA 2KTRB 3H7PA 3PYCA 2NCNA 4QJ5B 1WFYA 1BT0A 3ZDMC 1ISNA 2KFKA 3NZUA 2XEWA 5CTRC 2FNJB 2B3RA 4FJZA 3MTNB 2DZIA 1DJZA 2FCQA 3KW5B 2FIDA 3EC8A 3QJZA 5J17A 4UWLA 2KC2A 4GIVA 4ICUA 4PS8A 4WAFA 2MBBB 4J6IA 5H4YA 5D7GA 3QARA 1LFDA 2IO3B 1E7VA 4M8NA 2N1TE 2D3GA 2FJUB 1SIFA 2GOWA 2Z59B 3WAMA 3BY4B 2R2OA 2C7MB 4PYZA 5KJ7E 1H4RA 1K8RB 2PPHA 4E71A 1RLFA 4GXBA 4UWHA 2QZ5A 2DZJA 4AP4C 5IA7A 5E6PA 2ZNVC 3W1SA 1KLVA 3RDJA 2Z0UA 2K45A 4QJ4B 2JY6A 2BKRB 1TZ1A 2OOBB 4KIKA 4FHKA 2G4SA 3H7SA 1E8WA 2MX2A 4YL8A 4KVGB 3PRZA 4FN2A 2YOAA 4B95A 1UBIA 1WX8A 4GN1A 4KZ0A 1BCIA 3DBLI 3PRMB 4HCNB 5G55A 3PS6A 3RZWC 3Q3JA 1V27A 2KQSA 3HN8A 4AWJA 2ZNVB 3DVNV 2N9PC 2M8SA 4G11A 3JVZX 4HPLB 4ANUA 1WH3A 1EO6A 2A4ZA 2ASQA 2J0JA 3RUIB 2D07B 2KK8A 2HTHA 4KITB 4RM8A 4W9DA 3A9JA 4PS3A 1P9DU 4IHBA 2L7RA 1AARA 4ICVA 3SU8X 3DCGA 4UWKA 2MSED 1V86A 2LGYA 2N9EB 2Q3XA 4GDLA 2K1FA 2AL6A 1XT9B 3DBRI 2WYQA 3KVFB 4Y1SA 5BO4B 2CJTA 4WEEA 3IHYA 2KFJA 1X1MA 1ZW7A 4LT7A 4NP9A 1OEYJ 3ZVVA 3IG3A 3TIXA 4MH0E 2KDEB 1F9JA 4BKTA 1CJYA 2N1VA 4LJPB 1DJYA 1W16A 2IZVB 2YVCA 3QC8B 1Y8RC 3W1SC 3RULA 2WX0A 2LI5A 3C0RB 3QCAA 2MRPA 3AU4A 3ZO5B 2NQ3A 5E6OA 2KANA 2DYOA 3VUWA 4TS6A 2C7HA 2NR2A 4AOFA 3L0WB 3PFQA 2IY1B 1WJUA 4ICXA 4PH4B 1XD3B 2M17A 1CMXB 5ANLA 2JWZA 2BPSA 1DJHA 1UD7A 4W9GA 4WJOA 1L7YA 2EP6A 1WR1A 3JYUA 2N4FA 4MDKE 3OJ4B 3UQBA 2ENJA 3PREA 4I6NB 1RFAA 3A9KA 2FCSA 2D11A 2EMTA 3ZDTA 1WZ3A 2MP2B 3A1QA 4K81A 4NQLB 3D32A 3EHVA 3Q3FA 3X0WA 1EF5A 3QK0A 4FULA 4MJJA 2BF8B 3NSJA 3UGBB 2K8BA 3RYTA 2WXKA 3X23A 2L0TA 1QATA 5LXHA 2ZZPB 4MEMA 3HM3A 3RCZA 3RPBA 3FDWA 2DZMA 2LASA 4FJYA 5TR5A 5H4ZA 4E74A 1P1AA 5CCGE 3DBSA 1UGKA 2V4LA 4KZCA 3R7RA 2L05A 2Y5BB 3PVLA 2G45B 3S2AA 2MBHA 4M0WB 3ML8A 1BYNA 5DPTA 3UINB 3B7YA 2UYZB 4WWPA 3L4CA 2G3QB 1V6EA 2D8KA 3NZSA 3KUDB 1J0GA 1UOWA 2MW5A 4HVBA 1LQBA 2BYEA 4DNLA 2KMAA 1E8YA 4A3PA 2LRUA 2XK5A 4CYEA 2KO3A 4URKA 1WJNA 1WYWB 4BFRA 2MBQA 2KLGA 2J7QB 4II2B 4DXAB 2WXHA 3NY5A 1WGYA 3W56A 3QX1A 1U4AA 4BVUC 4L1BA 4II3B 4HWIB 2YRBA 2LZ6A 5E6NA 2K39A 4FLHA 1WIAA 2N9XA 2LD9A 4V11A 4K7SA 4MELA 1OTRB 2K25A 3KUCB 2CHWA 2I9CA 2M0XA 4NJ6A 3B08A 1L2NA 1TJMA 2GBRA 1M94A 1R4NI 2ZCBA 1Z2MA 4MGYE 4AJWA 3U8ZA 2C5LC 3P2BA 1TGZB 1XQQA 1Z5SB 2OJRA 4B6WA 2JF5A 5DCNA 1WJ6A 4NPKA 1MG8A 2KLCA 1WXVA 2WXFA 2KXJA 2DYBA 4WJNA 3HIZA 1Q1OA 2BWQA 3SHQA 1GC6A 3PLVA 2AYOB 2KQ7A 4ZRIA 2MBOA 4ZRKA 2RR9A 2RPQA 2KWCA 3QIJA 2IBIB 2GBNA 3IHPC 2IO2B 2CJSA 3PT2B 4JGHB 2PEAA 3QWZB 1DJXA 4IWOA 3L10B 4HK2A 4EUTA 4KDIC 3ZUNA 1E8XA 2WXPA 2LVOA 2NBVB 3NS8A 2REXA 1G6JA 3WIMA 4Y1TA 3DBHI 1WMHA
chains in the Genus database with same CATH superfamily
4K7PX 4R96B 4WTQA 3PAYA 4PS4H 4UF7C 2WMPB 3P2TA 1YUKB 4R8WL 4XZUB 1GMIA 4X5WA 4KX6B 4LL1A 3V2XA 3ARFC 4G72B 3DX9B 2JB6B 4L2YA 4A55A 1HHJA 3MFGB 4L5FE 3L4TA 5DU7A 1EZSA 1P9MC 4G8GA 43CAA 4F2ME 5IESH 3ZUVB 2KMCA 4DDGD 3DVGY 5AQ0A 2M83A 5E24E 4PGDB 4ZHPA 5D2MB 3N41F 2I60H 5EIQA 2A73A 3SDYH 3V8CA 2AWTA 5CJXA 3V0HA 1MZYA 3KYMA 4HIHB 3RKDD 3I75A 3PJLA 3QO1A 5ANMB 3VW3H 5C0CD 4R3DA 1PKOA 3VI4B 3ONKA 1EFQA 1OPOA 1OTUC 1QSEA 5CKGA 5G05J 5D2LA 5F70A 4U63A 3S3CB 4AV0A 3N32A 1MRFH 1RXLA 4XMLH 4R4BA 4K71C 4KO7A 2GITB 1ZIAA 3T2NL 3O2DL 2CU9A 4FFZH 3OXLA 5CP7A 3Q6FB 3FTVA 3EO0B 2GEQA 1IGFH 1ZE3C 5F96L 2JI1A 1ZANH 2XBZA 4GYOA 3G5WA 5DA4A 3KWUA 4JFQB 5JIPA 2F53D 2PNDA 1XDTT 4WFFD 5JHLL 1JWMA 4PRPD 1EU3A 2CO4A 4ZMWA 4UQ2A 4YDYA 2WJ5A 3HW7A 1F4YL 3W11D 4MJIE 4D8PB 5FW6A 1WFUA 4OVUA 1EX0A 1MPAH 5E5RB 1A64A 5BMFH 3DETD 3BVZA 4RCOA 1FO4A 3A6CH 1VACA 1CWVA 4C47A 2SEBA 4UWGA 3PHXB 2NPTA 1AJ7L 2VH5L 3AVEA 1OEYA 2HKFL 1NCWL 5INCA 2ED7A 2X9ZA 4L4TA 4PPTA 1FZKA 5IVZA 4LHUA 1MHPL 5SV3A 4NYLA 4IDLA 1E9PB 3HG1B 4ZQKA 3FFCB 5I8CB 1EF1A 3QO0A 2KDMA 4GPVA 4L8DB 2DI8A 3PJNA 3MI6A 1J1PL 4JRFA 2NX5E 4GMJA 4AY0A 4MA1B 1JN6A 3ULYA 3ARPA 1ZLUK 3SBWA 2MH4A 2Y07H 3G5ZA 4K5CA 2WQWA 3D4YA 3IXAA 3M45A 3UO1H 4CRPA 2VL5B 3IFPA 4G7VL 4PJFB 1PFDA 3V6OE 4NQQA 3ABME 1BEXA 3LPPA 4ZRPA 5DRZA 1NC4B 2WCSA 4JRYA 4FG4A 1E0OB 5IUSA 2GBMA 1TTUA 2UYLA 4HPHA 2WC7A 2MIZA 5GSRB 3UQAA 3PP4L 4FQXA 1B2WH 1Z3GH 4JJ5B 1SEBA 4GTPA 1E42A 4MJ5A 4KZEH 1GCYA 1SXAA 4XP1H 4Y4FD 2K6DB 2XZCH 5JDSA 3KS0J 2CK0H 1P0RA 3IVFA 3U9PH 5LBSH 4IJTA 3SDAB 4M5SA 2X10A 3GLAA 2ZD0A 4DZBA 3VM5A 2ZCLL 1IFHL 1VFAA 1NGZA 1TVBA 4OQTL 4WVRA 2LUMA 3JZ7A 2UUDH 2B77A 1FO0L 1IQRA 1UURA 3BPNB 1TKGA 3DQVA 4B5ZA 3QFJB 3Q43A 3WJJA 4A6YB 4DGWC 2MBEA 5A6CA 2I27N 5KVFH 1J8HD 2X09A 5KVMC 3SPHA 1H0DB 1J0HA 4ZAKB 5DPRA 3ZEFA 1EF1C 1ZGLP 3IDMB 2HD5B 3SPVA 4IRZL 3ARDA 1A7OL 3UM2A 3B5TA 3LKNB 2PR4L 1I3RB 4WUUA 2K22A 3OTTA 3SBWC 2PPAA 1R0AL 1MHXA 2E9IA 3RAJH 3UI3A 2H6FA 1A5FL 1DQDL 1EHKB 1ORQB 1XIWD 3LZNA 5EA0L 3CJJA 3H9DA 4OLXH 2XQBH 3W39B 3DSNA 4OIIH 5KSUA 3SO3B 4OI8A 2PTLA 2XGMA 1U30A 2IO3C 4HKJB 2EDOA 2Y2WA 4ZW6A 3SZ6A 3WE6B 5LXVA 3KWWB 3QJHB 5FB8A 1KLGB 4B9KA 4OGAC 1R5WB 3KPRD 1L6UA 5IKCB 2H1LM 3FB6B 2V4HC 5EO9B 4ZFGL 4JKLA 4OLWL 4XCFL 2KT6A 3L4PA 3L3IA 1BVZA 4JW1A 1N8OE 2QSTA 2WLJA 1HXKA 1K4CB 3RNKB 3ZXAC 2WHVA 3QQ9C 4GTVA 3LDBC 5LO7A 2J12B 3LY8A 1FIGL 4DW2H 1YEWA 3DHMA 3RIFF 4D3CH 2WTRA 3MCXA 1FZMB 3T2QA 1KXQA 5HHMB 3C60A 4KVOA 3DGGB 3WNLA 5IB2B 4KXCA 1TOXA 4AYFA 3WJJC 2X4QA 3NHEB 3UP1A 3SKMA 1NDDA 2KKQA 3VB8A 3NG0A 4CZ2D 3QXAA 4NKMA 3V0DA 1KLUB 4AH2B 3BIAX 2VE6B 1RZGA 4MNGA 4DX7D 5I8EA 4HKZA 3SDXE 3ARDC 2MEKA 2ESVE 2MOQA 4GQPH 2WN3A 1C79A 3UX4A 3VXUB 3KPPB 4HKXB 4PGBA 2ZXQA 5BQ7B 3AKJA 2APVA 3ONSA 2BY2A 1RLWA 5E70A 2WB1A 2Y69E 1QSVA 3SGEI 4RQQB 2XGOA 2CJUL 1XF3B 5JXEA 3B9DA 1BQKA 1JOIA 4B9KC 5A2JH 1MRDL 3TASA 3BQVA 5T3XE 1JXFA 1CD8A 1WAAA 3H1UA 1ZHLB 2AVFA 3VVWA 2AQ2A 3UOAB 4AUUA 4N9GB 3LCAA 2R1XA 5ENNA 1I8UA 3EHNA 1PZ5A 3LXBA 3QNYA 2RCSH 2R23B 4KSLC 4Q6YA 3QKYA 2VW4A 1S9XB 2F0CA 4TVPD 1UB5B 7TAAA 1RUAH 2ITCB 1MI5E 4APXA 3FWVA 1XCQA 5DHXB 1E8ZA 2DM7A 1D6VH 3D0VB 3V7MA 3C60C 4FXTA 3HZVA 4ODSH 3H9YA 5L6YL 4I13B 2JKSA 3CVHL 2ADGA 4U1SA 5EZOL 4DQOL 5EWIH 3KH0A 4LCIL 2DM3A 2BZ7A 4OT1H 4QJ3B 5D1QB 3L4XA 3I3TB 1EMTH 1T7ZA 4X5QA 3I9IA 4GKZA 4PM1A 3WLBB 3NRZA 5BW8C 3LKPA 3PQYE 2NCMA 2V0PA 1L9PA 4JMNA 5PAZA 2C60A 2KAJA 5GRUL 3OZKA 1LM8B 2IVFC 1IIIA 4PJ9D 4A66A 5HYJA 3V4PB 2Z8VC 4KJPD 4OVVA 3BEVA 5BRZD 2OSWA 1C4AA 4QTIL 4CMMA 3G3LA 2BKFA 3ZXVA 2CUAA 3QJOA 3HNSL 1W9XA 3X11B 1T0SC 1T21B 4PJHB 5DSCA 5JXEC 3VTVA 4I5BA 5TQ0L 1RU9L 3VXQB 1KFYB 2CLZB 2X87A 5FYJE 4M43L 2ZOUA 3LV3B 3K6DA 3OX8B 4XP6L 2AERT 1OY3D 4Z3EA 2Z0DB 2J88L 3TX4A 4A3OA 3LZQA 5EO1B 3BE1H 2AQNA 2VIRA 1JGEB 3PU7A 2LAAA 2JYTA 4LLMA 1A9BB 4KKBC 4NRXB 5ALBH 2J4WH 3RDTA 5AW8B 2JLBA 3DXMG 4C9BB 1QLEH 2PP9A 3HC3L 3QHTC 4I0PB 3TWUA 4L4VD 4LKXB 1XSOA 3PPSA 4GT0A 2OMVA 4L18A 3HM6X 3FDHA 2YKLL 4TQ0A 4G6FD 1AO7E 3PV7A 1EEZA 4Y19A 2HT4D 5EO0A 5I0DA 1PZBA 4BBNC 4GEIA 1CB4A 1SA5A 3AKLA 1NFIB 1S7VA 3V2OA 2ZCKL 2WQXA 2LFGA 1RK1B 1YMMD 3BWUC 4A20A 4P46D 2VXSL 4B8AA 4HWUA 2GB1A 1TU2B 3OZ9L 4F1SA 5F88A 3EFUA 4M3OA 2GK2A 1ULVA 3LZLA 2JCCE 3GTNA 3DJRA 3ETBJ 4JHWH 4OF7A 5ICYA 5DK0B 4X6DA 2VLKD 4AV4A 1WDYA 1YLBB 2B3RA 4R84A 2DZIA 1AIFA 3S6CA 1NM4A 3D4CA 3DV4A 5BO0D 1EM7A 3KW5B 5FQ4A 2R39A 2W9DL 4FNSA 1EEYB 4J1UB 4L8BA 5KBMA 4F27A 1BBDH 2YIHA 4WAFA 2BSTA 5C0IB 3WE1A 2WTPA 3SKNB 1KGUA 2LT9A 5KBNC 5KJRH 2X4SA 4PG9B 3S3PA 3A4DA 3BVNA 4HMCA 5D7JA 3SI5A 3NFNB 4M3JA 5C08D 3V6BR 3RDTC 3AU1A 3ASNB 4X5LA 2AV1B 3OKLB 2QZ5A 3GDBA 4DP7X 1KMGA 1EHNA 1MN4A 4GW4B 5DEGA 1LEIB 5HXMA 2CDEA 3N43F 1UZ6F 3Q3NC 2F37A 3TZVD 1KF6B 3VXRE 1AR1D 2C3XA 4GTSA 3LPOA 2AXFB 4FN2A 4KMOA 1YCSA 2EINB 2J8UB 4XBEL 1KFGA 3DGDA 3I9AA 1ML0A 1XGTB 2WLLB 4K3JH 4P5TD 3GUTB 3EAKA 3FCTB 5IMKB 4HPLB 5SWQA 5C0EA 3DOIA 3MZGB 4UT7L 5E8NB 4BUQA 1F6AB 1E6EB 2R2CA 2J0JA 2J44A 3B9KA 4PJ5A 4WW1B 1M6UA 1RIVH 1XGYH 2E5EA 3PAZA 4PJIF 4UDTA 4KK6C 3FRPB 1PKQE 3GYZA 1Z5LA 3QQ3A 4XXWA 1E6JH 3GBMH 3IMWA 1V86A 4P9HC 3MGAA 3D18B 3IPEA 4MSWA 3TWCH 1MLCB 2EYRB 3ZYYX 2VMDA 5BO4B 1SHSA 1XVSA 4Y9BA 1PS3A 1HNGA 4Q89A 4DKAA 1NC2D 4NP9A 1DR9A 3TT3H 3VMPA 3AH7A 5D7JC 1S7SA 2AEIT 5CEAA 1IRAY 2E76C 5EUOB 4UI9C 4BFNA 2IJ0A 3FQRB 3ZSTA 4NEHB 1F9JA 3EH3B 4ENEC 4LJPB 1NGXB 5K1NA 4LCYB 2IGTA 2PXYA 2V9RA 3HCVA 2MRPA 4Z3TA 1DQTA 1ZT4A 3MBEA 1OB1A 4LHUG 3SIKA 4J4PD 2A6JA 4B94A 4UT9A 2NR2A 4AOFA 3CBKB 2IQ9H 3EIQC 1WJUA 5DRXA 3DVNA 1GC1H 1FN4B 4HUWA 4EBAG 2VDLB 3GJEA 1U3JA 3P73A 4QOKD 4G6KL 1KXHA 1J0KA 3EGSB 3GKWH 3MA9L 2JJVA 2EP6A 1ECZA 5E5UB 1Z3YA 2NY0D 3FQ4A 4LESA 1EO8L 2YPKA 4OFQA 3HVDA 4B7LA 3O3AB 3RWHB 1GGYA 4LLAA 3WY3A 2YXMA 3Q3FA 4G7YL 1LILA 5CGBA 3LIZH 3VSQA 1HOEA 4AIEA 4XXWC 1NCDL 1SBSH 3JSSA 1MCOH 1O6VA 3DUHA 1R34A 3N1MC 4KFMA 5CU9A 5C0AE 3RU8H 2DEWX 2PYEE 4UB0H 2R7EB 1FL3A 2VQTA 1UGKA 2NTSA 3LXFA 3FHEA 2Y5BB 4N2GA 4B0EA 3C6LD 1C9SA 2IJ0C 2DBLL 1QFWL 2G3QB 4XE5B 4MS8C 3NZSA 3PGCA 2X0UA 2PXYC 3MTXA 3TV8A 2BC4B 5I9QB 1NCAL 2F1BA 4JDVB 3MBEC 5DJYA 1RZKC 4PWHA 2H41A 2P52A 2UWEA 5IHZB 4DEPC 4HWNA 3F83A 1YQVH 3T2OA 1CLOL 1INQA 1CMOA 3RVVC 3T8XA 3TBVB 4IGBD 4Z7WB 4JUSA 5BT1A 2BTEA 3Q13A 1F90L 1GSMA 1Z9LA 1MCIA 2FX8H 2Y5TB 4XMZA 3VFWB 5CKAA 1ZGLB 3UYOD 3X14A 3BISA 1F3DH 3VD1A 2AANA 3E80A 3UMTA 2CJNA 4LNUD 4P9MH 5AZ2L 5BZDB 5I6NA 2EIDA 2AQ1A 2XTJC 4JM4L 1E43A 4YX2L 1F4XH 1KCRH 3ZKMD 2FULA 3U0WL 3LKSA 4RBPH 2WLYA 1GA2A 1SN2A 4ODUB 1R4NB 3EYVA 5HHVL 4F24A 1Q1OA 3OKNB 1OLLA 1OCOB 2XRAL 4YJZL 1T1XA 3CVUA 2L8AA 1WRFA 2V2WA 1YC7A 5LGHH 1Z2KA 3DRTA 4G2AA 2KUTA 3KPSA 4M48L 5MHSD 4HAGA 3LKOB 5ILTH 2IPKB 4KRPC 1JFQL 2NXZC 1OT1A 1I4XA 1KIPB 4NT6B 5DCCA 3ULVF 4P3DA 1OT8A 5GS2D 5JR1L 1D9KC 1U8IA 2F5AL 1SDDA 1TY2A 5G5GA 4LOUC 2AJUH 1WGGA 2OVFA 4M7ZB 1A2YA 1T5WB 2COQA 4N20A 4PLKC 5KZCB 3ZDZB 3OXRA 5IHUH 1RW2A 5L8JB 4P29A 3EYFB 3HS0B 4GI6A 1HQ4A 4QCIB 2PL2A 3LEYH 3MXWL 3PGDB 1QQEA 4P99A 2EELA 4DK5A 1RZIA 4YHKL 4YDJB 4PGEA 2HJLB 2D5GA 1LWJA 1TENA 5AVQB 2BP0A 5CSBA 1OCCE 1YECH 2D3VA 1AGCA 3O2DA 2I1JA 5CMYA 4KRNA 3AXLA 4FYTA 2AEHA 4OR1A 3KLSX 4GRLA 3OM3B 2BSCA 5HDQH 1TKWA 3ZYJA 3OKEA 2B2XL 4PT5A 3TWYA 4JPSA 4Y4KA 1G6RL 5K9KA 4NCC1 1KBVA 2EO7A 4P5KB 1BQRA 2O5XH 3QDJE 4IYKA 3IXEA 3QYNA 5IOKA 1UD8A 2HXAA 3LNDA 4XVSH 4JL1A 3NZ8A 1DGJA 4ILHB 3LEVL 3QI9B 2LNIA 3Q4AB 1SLXA 4ISVA 4YDKL 3QAQA 1FCLA 3KZ8A 3SF4A 1X5LA 4LMQE 3FZUC 1N4QA 1TQVA 7PAZA 2HX8A 3BIKA 4ODBD 2FQFA 3N3EA 4DUVA 3CNKA 4JHAH 1DCEA 1ZK5A 2NY2B 3VXME 4ETQB 4ZMVA 3S35L 2WPVA 1X7TA 2BNUA 3D05A 2JZZA 5LDUA 3WU1A 4XB7A 4YDLC 2YINA 4N2FA 4HXIA 4N2LA 4ES9A 4KK8D 2H6HA 4JDEA 3Q9PA 4TQEH 1M2VA 1N4XH 2FQDA 3AG4E 3KYNA 4DWFA 2EIZA 4HKBA 4OM1H 3QWQB 4Q2ZB 3AE2B 4Q2JA 5DQDH 3KEAA 2AK4A 3D3VD 1CDJA 1EIBA 1KBWA 4GRLC 5IQ9A 4QUOA 4LNKA 4MBGA 3DSFH 1CFQB 5FW8A 1PBYA 1YSOA 3O9WA 4Y2OA 3T4YA 3CMMB 4IOIE 3DWTA 4NHUA 2LQRA 2BY3A 2VSMB 4P04A 4GEJA 4DPAX 2G3ZA 4UWFA 2XSKA 1V49A 3HXBA 3K71A 3P3RA 1B0GB 5HRYA 2HPOA 2R2BA 3NCMA 2ZSVB 4M6MH 5IK3B 1PAQA 3ZKNC 2JSVX 3DDCB 4OCSL 3MJ9H 1R3KA 4M7KH 4F7MA 1IBGL 1FO0A 1T04B 3LVRE 1VFMA 3S7FA 4M9OA 3FQNA 2CM5A 3MKGA 4NIYE 4DHZB 3NCJL 1NMAH 2A99A 1QR4A 1CFNA 3KM1A 3FOMA 4ZUSA 2K1MA 1U3DA 2KZKA 2V5SA 1WIPA 3PGEA 2J73A 1MEXL 3IK2A 3O45B 5EBWA 3DROA 4IRZA 2QQNL 5I0YA 2HFFA 4TSBL 2OZ4L 2WQRA 3I6GB 3X3GL 2EVGA 5E4AA 4BWTA 4KTYA 3IDIA 1ZV9A 4WKXA 1BZ9A 2IDSA 3FQ1A 1OO2A 1T83C 4MASA 5AKSA 2QGEA 3ZE0E 3AS4A 4WHDA 4A2HA 4AEIH 4O02A 1CTMA 5SX4I 4N90E 2RA1A 5E00A 4B9JA 1HWGB 2FX7H 2MCG1 1IT9H 2K9UA 2VDNL 4BT8A 1EJOH 4YAQA 4CVWA 5ESVA 5I1KH 4PI0A 5FO8A 4K4KA 3SE9L 3KYCD 3D30A 1ZXHA 5CHNB 5BW7A 2Z92A 4A1SA 2I7SA 1M71B 4JREC 4ZYNA 3SODB 1NDGA 4WFGE 5E2UL 4J3VA 1C1EH 4TPRH 2VUKA 3BGAA 3MUGB 4RZCA 2AAVA 3KPLB 2E6JA 4EF3A 3GMRA 3C5ZA 3C09B 4QFVA 2BM3A 4GPKA 4A37A 2PWHA 3ABLB 2BHZA 3N04A 1SJEB 4RFEA 2ADYA 5J18A 2V9HA 2V37A 3U46B 5I71B 3TH4T 4PVBA 2HCZX 5EEYA 2R59A 4APFA 1I82A 1QRNA 1VHPA 1G4RA 5JQ6L 5J4MA 3WG7E 4AGQA 1C12A 3RB7A 3UPVA 1RJLB 2R29L 4GGQA 5FYKL 5JHDD 3TMPB 3HHMA 5TE7L 3IN2A 1P3QU 1N64L 4HFWA 3U7WH 3KR3L 4D0DB 1MUJB 4F9LA 1JMZA 1ETJA 1C77A 4FQHB 3VI3E 1NA0A 2OI9B 1CE6A 1Y6KR 1GVIA 3VJ6B 4B9FA 2N1WA 5JW4M 3MU3A 4EZKA 2ZXWB 2EABA 4F7EB 1JNLH 3BZ4A 1QFUH 5BW7C 3WNIA 2WMNA 1H5BB 3M17B 3Q8BA 4A67A 1I75A 3AG1B 1UA7A 4LSTH 3UBXA 1T2QL 2GIYA 1O7DE 4Z5RA 1E5AA 1FM0D 1FXTB 1JYNA 3GHEL 3CLEL 1VF5C 4KO5A 1FPTL 4KDVA 4HGWA 4QHKJ 2C7UA 1WLHA 4KO6A 4C8XA 1I7UB 5FECB 1S3RA 1WGVA 5L4JA 1SFHA 1GGIL 1W6LA 3CVHA 3P54A 4PJ7B 1CJEA 1OGAA 1P5VB 4AYGA 3AV8A 3IKCB 5J2RA 5B21A 2JQZA 1H3XA 5C0RH 4A7GF 4UQYA 2DB8A 4W70A 1INDH 4GXUN 1WV7T 4YSTA 4Y1AE 4ANWA 1FJ1B 1HH9A 3H2PA 1FCCA 1H2TC 4OLVH 1A6UH 2EXTA 1X5ZA 3ESVF 4AQAB 2OMYA 3T2LA 1IE4A 1M05A 1U92B 5GISH 3QQXA 1G7LA 3AZUA 4PWEA 4NKOA 4F9LC 4GMVA 2Y7MA 3SBSA 3N42B 4N85A 2DYPD 3AS5A 5C9JA 2QVKA 3DOWA 1U3HC 3OB0K 1ORSA 4ZUWB 3NABL 4QAMB 3FT4A 5MEPB 5FWQA 1YEGH 3NCEB 1HA5A 4ONGL 1KPVA 3ZYZA 4UIKH 3PZ1A 1L9QA 4FQ2H 5TE4H 5MEOB 5ENOD 1WXAA 2AKRA 3OR7A 2BIHA 4Z7OB 1HL8A 3QUZD 4GW5A 4LL9A 5DA0B 1M3IA 3VAEA 1CXEA 1QA9B 1S8DA 3PRPB 4APQB 2BSBA 1UD5A 4LDTB 4GO9A 4MWFA 3W5UB 5FKPB 3MBXH 2OR9L 1UGMA 3P11H 1MFWA 4WGWB 1MFAH 3TIDA 1QMUA 1EFXA 2P58C 2Q0ZX 1HJCA 2DYSE 1LO3L 4RMBA 3ZIMA 3NFSL 2XXCB 3ZL4H 1QUPA 3KVQA 1WCBA 2XBDA 1FL6B 4JRXD 3S3SA 1N9AA 4L8SA 1C16A 3BQUD 3H9SE 1TS5A 3BP4B 4AK1A 2EDLA 3EOBA 2X7LA 1ZVSB 2FJHB 2HUHA 4KBPA 5I6OA 1QBAA 1T1ZA 1FCCC 2X6IA 5L95C 2QMJA 4TTDC 5FCUH 1RH8A 3QDGA 4JDZA 4YDNA 1NDMA 1D5BA 1L7IL 1WD8A 2Q86A 5EZIL 2WDTB 3N9YC 3PDDA 4FLSA 4F33B 4PJCE 1OKEA 3TPUB 1H15B 4LCDE 4XO9A 1A6WH 4JK0D 3AY4A 3JV4A 2GROB 5ICXA 1VESA 3UYPA 4UUJB 4O1OA 4C58B 1ZHBB 2JABA 2V3FA 1A0QL 4R3SA 4BQCA 1WGOA 1QR1B 3X1FA 3BAJA 5C07A 3KNBA 4K7PY 2XCMC 3O6FB 4KXKB 4B97A 4NPJA 2C4FU 4UTAL 1YMHB 4IDJL 4OV6F 1RLBA 2E75C 4OZIB 1YY8B 2ZUWA 1WS8A 2D9QB 3NQIA 4JFOA 4MAYB 2G2RA 3KJ6H 3EFOB 5ID0A 4TNGA 4HA1A 1P5UC 1K4DB 3MJ8B 1WFYA 4J8FA 5HVHB 4CC0A 1R5IB 4BH8B 5GRZA 1Y8MA 2Y7QA 3HI6L 2P28B 1CZ8H 3DX8A 2HRPL 4OBRA 3OPZH 5EU7E 1RZ7H 3NUHB 3CLWA 4NGHL 4X98A 1AQ8A 4PS8A 5IROA 1OPGH 2QLVB 1B4RA 5G5DA 4DAGH 4XNMA 1MH5B 2BSSB 3D2UD 4L8SC 2FJUB 2HFEA 3H6JA 3HB3C 4EUPB 3E6HB 1KWKA 3C3RA 4DIXA 3RIAF 1K8RB 1YEFH 3R9AB 2DZJA 2HT3D 1N6QH 1PYWD 5A2KH 3WXXA 3D85A 1JJUA 2VZVA 3BLBA 1M4VA 4HC1L 4N3BA 4LSRL 5C2TB 1NMBH 4TN9A 2V0GA 1DEDA 1JERA 1MHEB 3AY4C 4YHOH 4F8LA 2VXTL 3QWRD 5ERWB 3BKMH 1OARL 1T03L 3BN9D 4KXDA 4I48A 4I6JA 2AV7A 5D7IE 1PDXA 2ZNVB 1V3KA 2YEPF 5I17B 1DVYA 1IM9B 5ITZF 1ZSDA 2OJ1A 1R3JA 3BT0A 1B4LA 1VPOL 4JM2B 5DJ8B 5JW3L 1FAIL 2BNRB 4DX1A 1UH3A 4PW9A 3ZL2A 4CKVX 3FO1B 3X3FH 3DHJA 1EJ6A 4IHBA 1AARA 4MZRA 3E8UH 3DMMA 3HE7B 2MSED 4CEMA 4ZMTA 5EU6D 3IMVA 2IXQB 4G2VA 4MLIA 2VABA 2FSDA 3TBSA 1ENFA 4NQCB 4HORA 3KVFB 4AYMC 4WW2C 5IROC 3QORC 5D7SL 1X1MA 3GXTA 4HCIA 3ZVVA 3MRIA 4WWKD 5KAQF 3WTWA 4YSUA 3GW4A 3RL1A 3TO2A 2P2CP 1N68A 2CIKB 1NIFA 2F54A 3CK0L 2XZTG 2AXHA 3D09A 4ZUVB 3X12A 3HUJE 3BRFA 1UXLA 1JWSD 2LI5A 3JTSA 5I8KH 4M93C 3QDHA 3IRPX 2VH1A 4E68A 4C59B 3BSGA 4AK2A 3OLDA 2QQQA 5T3RA 4BWWA 4F8TA 4DGYL 2VXUL 1C08A 1XD3B 5D7LD 4I3RH 5B38B 2VOTA 1IQDA 3GWJA 4U1JA 2G60L 2BYVE 1HKLH 2WMOA 4IM2A 3AXIA 3U0TA 3VFVB 1EEQA 4W9GA 3FT9A 3O8XA 3KH3A 3ZU7B 4OGQC 2GABA 3P3TA 1I1AA 4YO0B 3P0VL 1U91A 4W4NA 2EC8A 1HH6B 5BRPA 3O3DA 4LSVL 1F2RI 3FP3A 5HI3D 4A6YL 1BLXB 3QUMH 1AQKL 3QWOA 4P23B 5SWSA 4QRPE 1OCRE 1OF2A 4NWTH 4URTB 1BHGA 4PBDA 2K8BA 3DMMC 5IHBA 2J3SA 3FUJA 1FNSH 3VTYA 4F3VA 1Z32X 5EPMB 2VISA 3HM3A 1DLHA 3E30A 2MRYA 4I1RA 3KSLA 1VKXA 4J7WA 2XTJE 2O5ZL 5IWLC 1JK8B 4TUOB 4X4XA 5EUKB 3UM0A 3T0AA 3ZR5A 3BHBA 5B1BB 3D8MA 5LLIC 3I9PA 4WWPA 1O9ZA 4ZUUA 5EFIA 1CTOA 2BYEA 4JC8A 1E8YA 2IFGA 4POYA 2LFEA 2JB5H 1VGEL 4NJ9L 3RURA 4BFRA 2B1HH 4HF5H 4L9LA 4UQXA 2ZCHL 4MXVF 2XNAC 3HG3A 3K72A 2WXHA 4LIQH 4Y4HD 4M7LH 5E4EC 1Z5SC 2R02A 3EU9A 3GBNL 4JFXB 2E0PA 4X42A 3V7AE 1NL4A 3FTSA 4JQIH 3N40F 2EDXA 4GSQA 4WQMA 1ND0B 4WWID 1WQVT 1FC2D 4H1LH 4W9GC 1UM5L 1YEEL 1A7NL 1WF5A 4ODTH 2WLBA 1I1AC 5D6CB 3NP3A 2CHWA 2G2NA 3ZQ4A 2FHCA 3NBNB 1L2NA 4ZO8A 1AD0A 5K39A 2MCPL 8PAZA 2DTML 1T0MB 4YWGL 1Z2MA 2ZCBA 5E8DH 4FP8H 3EXLA 3AMKA 5KW9L 2FBNA 1MOEA 3D4ZA 3V5KA 4WFEE 3BYTB 1BQHG 5D7KD 4Z7VE 1WXVA 2B20A 1IGTB 4OD3L 4XAKD 4LXFA 1SBBA 3W0WD 4F7PB 4YVQC 2H89B 3PLVA 3U2SC 5D1XA 2W91A 5ISZD 4G6JL 1I3UA 1RJYB 4PJ8A 4ZRKA 1WE5A 4AQ8A 3SR6A 4LFHD 1AXSA 1RPUA 1V7NL 1F4WL 1P1VA 4U1NB 5EEUA 4IRJB 2P48B 3WS3B 2IO2B 2DWEB 4IHOA 2R2EA 5T1MA 3TVMD 1HAWA 5I19H 4Y1TA 5EIBE 4I1MA 3P0YH 2UY1B 5BZXA 2DQ6A 2YBGA 4KNSA 4MDJA 3LQZA 4J3OH 4P4KC 2NUTB 2EQXA 1PCSA 3KPSE 3NFPA 2PO6B 1IL1A 5FA4B 4IG7B 4X4YB 1E6OL 4U4BA 3AG2B 3PNWA 3R1GL 2ADFH 1WITA 5TPWH 3U6RB 3BKJH 1SXTA 1GGBL 1XCTB 2DI9A 2UZYB 3QIWA 3WELA 5JPNA 3ES6A 4ZSOE 3VDBA 3B3IB 4N2BA 3IPBA 3UBXG 2RDBC 3BAEL 1A4KA 3S98A 1PVHA 2DV6A 3W9DB 1L9SA 5I66B 1AHMA 3ARED 3U4EA 3SD5A 4MMZB 1HOCB 2XN2A 2BMKB 3MOAL 1PQSA 4NNPL 3B13A 3E9SA 2VRRB 1UWGL 1QG3A 1MF2H 3QS3A 2IBZX 4M1DL 5D1XC 4PJ8C 3FB5A 2FEDC 2DQMA 2R4SH 3GSQA 4PRIB 4OLYH 1ZLUH 3S88L 2OYPA 3V4PL 2DEXX 2NY1B 5FA3B 4OZHA 4YHYC 4XNXH 1A7PH 5EU5B 3QDMA 3B37A 4PJGF 3TN0A 4ZFOA 4IW4C 3OL2A 4HT1L 4KQ4L 4JFDB 3T1FB 4V1DB 3B7RL 3NIFF 3UM1A 1TJXA 4J3WA 2YOCA 2A9DA 4G6MH 3NJKA 5FGSA 4NLAA 4H13C 4UOW1 2O61B 4HIQA 3MV9E 1OALA 3NSYA 2EIJE 3DPBA 4PSRA 4YHZH 4J8DA 2DQCH 1A6ZA 4E9RA 4I1NB 3PWPA 5GS0D 4N2SA 4M4RA 3AE5B 5A3IC 2P42B 1WWBX 3NSXA 3ZRCA 5ENRD 2I9LB 2ATKB 4OM0H 2VLMD 3WMPA 4KQ0A 4WI0A 3ZYKA 1ZHNA 3GQFA 4AYEC 1A5RA 3ECUA 5JPNC 1K5NB 4N5ED 2QZAA 5CEYB 4F2EA 1TZGL 4K55A 1IVTA 4Z3HA 3BDYH 1SQMA 4EEWA 4QXWA 3ONLA 5AUKA 2J6WA 2HWZH 2IWEA 2RPVA 1BFVH 2F74B 4UV4H 2RDGA 3IMBA 3ECWA 3LY6A 4JL2A 1NAKH 5IQNA 3Q69A 2MOVA 3Q73A 1C5DB 3H1ZA 3WFEL 4YXKH 3Q7JA 1CI3M 4YUEH 1NH6A 1ZLWK 3RNGC 1YYMH 4BFKA 3SGJA 3SYQA 3ARGB 4XPAL 2XQYA 4Q69A 3MRQB 3TN0C 4NP4L 4I0CC 3T4AB 1O9WA 2LV4A 4ORGA 1JCKA 1KN4L 3MV8D 3VFRA 2L0FA 3ELAT 2Q76B 3HPJB 2EYTB 1KFAL 3AN1A 4KTEH 1OW0A 1U42A 1TETH 4U6VL 2UY6B 4LQFL 3RFZC 4NJCA 3DO7B 3J7HA 3BEWB 1NFAA 4ZW8A 3IB4A 3OLIA 1T3FB 3M46A 3ZRCC 2KTFA 3LY9A 4JFFA 3T6WA 3SGKA 5DRWA 3GB7A 3UIZA 3X17A 2X1WL 3MODH 5KYYB 1EAJA 3B2VL 1FMAD 4AXHA 2D2CC 2ZKMX 2K8QA 2Z6FA 2GIXA 5EC1A 3ZGQA 5I1IL 4F1ZA 4EOYA 1Z9OA 4FTVD 2IDCA 2XQYK 4J3TA 5D7HA 4F58L 5E8OB 4TXPA 4Z23A 3M6DA 3D9AL 2E27H 2XV2A 4GUPB 5IOPA 1UXSB 3RA7H 1UM4H 2VLJA 3WO4C 3WNMA 3FS9A 1GJWA 3CX5J 1ZXIA 3G2VA 2XTSA 4BCXA 1E40A 4IOSA 3G08B 2QQLL 1ZEAH 1T5XB 4JY4A 4E41A 3SGJC 2X4RB 2UXVA 1IKNA 1G87A 1U8HA 3N1PC 4QRUB 5EULV 2BXYA 3N5AA 1RUPH 3RX7A 1G7HB 3GRBA 5JUEH 4X6CE 2HVKA 3CMOL 1HF8A 1O5DT 4LCUB 1Z6JT 2Q2EB 2QT6A 1N59A 4PJXF 3SHSA 5GGSB 4ZRJA 4QHPA 3V05A 5JDJA 1K50A 5IEKB 2WBJB 1Z5HA 4LSUH 4Y16B 5BZWB 2HYMA 1UKSA 4H8WH 3VUYA 3JCKC 2ZKYA 4KTDL 3IMRA 4MX7A 3SGKC 5KVGH 3QEQB 4H0IA 2XK5B 4WO0A 4OUUA 4JG1H 1OP9A 2FGWH 4G70B 4NBXB 5AW0B 3RUGE 3WN5B 1RRBA 3NVYA 4RAVA 1PDKA 3KLDA 2R0LH 3UPAA 1JYVA 4N8CH 4NZTL 1EV2E 1RZQA 2EACA 3QVAA 4ZW7A 2KHWB 1V81A 4JKWA 2WKLA 5F1OB 1FRGH 2INNE 1E50A 1UQSB 3DHIC 2VW7A 4IKLA 2W38A 3QQDA 1TNZA 3HXDA 2X4UA 5CUSH 3RHWF 4K3HA 1DN0B 1YNTA 3IGAA 1T7WA 2VDLL 4B89A 2QSCH 2AP2A 3TCTA 2CR0A 1XF5L 2B5IB 1TTRA 2W54A 4YHPB 3H4FA 3DVNU 4LGPB 5FV1L 1AP2B 4AVIA 2BVCA 3ZYQA 2IADB 2KC7A 2XS8A 4RNAA 3WKNA 1E96B 2YHGA 2JKWA 2YD7A 1FVCB 4XNYH 3HG0D 4K5BA 1N3NA 4ZX5A 4C4VA 2FUHB 3KYOA 4HIIB 3L7EB 2VL4A 5ETUA 2CK2A 4QWWC 5FPIA 3MLRH 1XB6A 5HYQB 4HS8H 32C2B 3IETA 1EERB 4XHJC 4QQIA 3OKDB 1ZD6A 2VSKB 3PHQB 4WAAA 4DGVL 1AZBA 3CHXA 4MTMA 1CGTA 3JWNH 2N7JA 4RGOL 4MACA 4KXBA 3O4LA 4NURA 1JCVA 4K5PA 1MIML 4OF6A 1KENH 2DDQL 1CBVH 2ZWNA 4M9PA 4R2GC 4UZUA 4L9PA 1MAKA 4NUGH 3MKQB 4FNRA 4U1IA 4PJ6A 5TE6L 2E9BA 4N3TA 1WGDA 4YTNB 5HDLA 3EJZC 4U1KB 5AVWB 5HD8D 3RK6A 3BYYB 1OP5K 2CO1A 3OBAA 1BFSA 2VM3A 5HI1A 1J18A 1MKFA 4J3UA 4N5QA 1UWMA 3H42L 2X38A 3ZTEA 1ZLSL 4OAVB 3Q47B 4RGNB 4MSQB 2EADA 4BOZB 4K2UL 2Y1AA 4PVNA 5DVOA 2VN3A 1XD1A 3UINC 1A9EB 4R6UA 2WOBA 3OG5A 3ILQD 5T4YA 4KKCD 4YNYB 2LXMA 1I3GL 4TMPA 4JN1H 1SJHA 3ASFA 4GZDA 3ZHLA 5FW7A 3MV7D 2KJRA 5L2JB 1QZ1A 3DSSA 3RVWC 5C7XL 4WEMB 2IG2H 2WMPA 4XZUA 5IMOB 4Z8FH 3MNDA 1UKQA 4BSVB 1UCBH 3EECA 2FK9A 3DX9A 2JB6A 3MFGA 3MCYA 3J8F7 5IJCC 3I9GL 4W9LA 1XR9B 3SDDA 1JHTA 4UTAA 4BVUC 4PGDA 3IMTA 5AVZB 2FE0A 1S5IL 2XWJA 3O4OB 5K9QI 4PBVC 5CJOL 4G1TA 4HIHA 3S37X 4ZNEE 2KOXA 3WDIA 3R2TA 3S7BA 5ANMA 4PRNB 5CZVL 3VFMB 5K9JL 5D71H 3VRJA 2DQEH 3V3XA 4TSCH 5AN8A 1BWWA 2NY4B 5FK9A 2Q3AA 1NP7A 5I1CL 3KBPA 2V9UA 5E8EB 5J9PB 5L88H 4HJEA 1ZT1B 4ZTOL 1JAEA 2GITA 2X3BA 2WUBL 2ZP0T 3ZQWA 4R7VA 3APFA 3LNEA 3Q6FA 3SGEH 3EO0A 4M6OH 2XZZA 2NXYD 4JFQA 1YY9C 2QPUA 1ACYH 5H2BB 5DMJB 5C07E 3EC8A 3QJZA 5CZKA 3TJHD 1MSPA 4UILL 4HC1A 3BU8A 3OZLA 4GIVA 3WAKA 4D8PA 4KJWC 1MFMA 3L1GA 3WEBA 5H37H 4DUXA 2OYMA 2C7MB 3NCYP 3GMMB 3PAUA 2YQ2A 1YEKH 4GXBA 4G8FB 5IA7A 1IBYA 3KPQA 2VLRB 2GI0A 4OHJA 4ELME 3WKYA 2EDTA 5D2MC 2BKRB 2H26A 1PX4A 2EDNA 4N0UB 4AKOA 2M8XA 4HU8A 2OOBB 5DFAA 1E9PA 2A77L 4MCZB 3KD7A 5I8CA 3FFCA 2YLKA 1H3VA 5C0CB 1NEZA 2EDYA 1MCQA 3I57A 1TQSA 4L8DA 3HC4H 4I9WD 3PRMB 2BVUA 2CFZA 4WU5B 4DCQB 3WY4A 4XRCA 3MRRB 3HN8A 3VTMA 4XXCA 1KV3A 4ANUA 2RFAA 2H3KA 5EF2A 5IVXE 2A4ZA 2IBBA 4GO6B 4Z7NB 5LWYL 3VD2A 2VL5A 4PJFA 2NT1A 4ZMZA 4G5ZL 1IEAB 3R0NA 1OCZE 1NC4A 4R4FH 4OZAA 3GRGA 4KI5D 1PSKH 5HDRA 4AG4H 2XEHA 1WJ3A 5GSRA 1FFPB 4JJ5A 4K07A 1QTYT 2NY3B 2CJOA 4GSXA 3SQOL 1XT9B 2EH8H 3QXWA 4HIJA 1IEHA 3KLHD 1SLUA 4NQDE 4QYOA 1ZHKB 1G9ML 3SDAA 2EDKA 1IGDA 1CK1A 4PRHE 1DBJH 2YXFA 5E8PB 4G9FE 4J12A 1Y8RC 1M7DA 4LARL 4GQQA 1YAZA 3OJ2C 4LGSB 4LU5L 4XCEB 2M0AA 2ICEC 3QFJA 4GINA 3I5JC 1C9FA 1H0DA 2BS3B 1LP9E 1XSJA 2AXJA 3DKHA 4KROB 4U3XA 2FB4L 4WU7A 1HYRC 3IDMA 1I9IL 2H32B 2IGFL 4Y9GA 2Y23A 4AS1A 3L5XH 2E59A 4FI7A 4UMGA 3LKNA 3FHQA 4MA1C 4IMLB 1I3RA 4XXCC 1SEQH 2XZAL 3MRLA 4HZLB 1T2JA 2W95A 2KMWA 3TCXA 4K7FB 1RFAA 1TY0A 4HXBL 5DK2A 4KKZA 3W39A 1WZ3A 2MP2B 1R7SA 1IMHC 4YMPA 2BPBA 1CFMA 3WE6A 3NSJA 3QJHA 3CHPA 4J6RL 1KLGA 2XQYG 5KJ4A 1R5WA 3T3MB 1AXTH 2XYCA 3FB6A 4MA8H 1IC5L 1CLZL 4JHJA 4NI6A 2BP8B 2VC2H 5EO9A 1G5AA 3M1BA 5DUML 4P2RD 4L29A 3RCZA 3RNKA 1XSKA 1K4CA 1GS6X 3BFOA 4CDMA 5H4ZA 3DBSA 5K1JA 4KZCA 2XRYA 5FYLL 3SDAC 4JY5L 2E7BA 1BYNA 1JGLH 2D3NA 3B7YA 3KSQA 3K81A 1CDHA 3LVEA 4XWOD 3N2JA 1AG6A 3BPNC 3DGGA 5KVDL 3CH8A 4GSRA 5IB2A 3VSUA 4URKA 5I0XA 2WYIA 3HJEA 4XP9H 2ZAHA 2MBQA 4FI6A 2WB2A 1H6PA 1KLUA 1O1RA 1NCCL 3CE1A 2BDNH 3PDOB 3PF2A 4H8QA 3MTRA 4JFVA 3W56A 3X13B 3F8UB 3B1UA 1MIEH 4X7EC 4DESA 1CD1B 3Q5MA 1OAZL 4ZD3H 4MELA 1XIWB 3G6AB 3K4AA 4Y7MA 1UYWH 3T77B 3VXUA 4P3CH 3KPPA 3LH2H 1MCCA 4HKXA 5BQ7A 2H1PL 1M94A 4BT9A 1I8MB 5BMGA 1E4XI 2JF5A 3FO9A 5DCNA 1XF3A 1SGKA 2HYZA 3ZGZA 2BS9A 3SB3A 1LNUA 4X7SH 2HLAA 1CR9H 2I24N 2DBYA 1CTNA 1ZHLA 4LEBA 3QUHA 1UH4A 4N9GA 3WD5H 5FZQA 3FCUB 5KNGA 2R23A 4XP5L 2IDUA 1S9XA 1XT5A 4GKSB 3FSAA 2IBIB 1QSFE 1UB5A 3GSXB 3MLUH 3LXUX 3LVTA 4S1DC 3BRGC 3T8VA 4JGHB 2L7QA 1GB1A 1NLBL 2JIXD 3OKMB 3PDNA 3D0VA 3G6JE 4KNTA 4XP4H 5C0ND 5KSAB 2VZTA 2YXVA 3L3OB 2HMIC 1CLYL 4PH8A 5C23A 2LGNA 4X7TB 1CFVH 4C56B 1GYAA 4RGMC 1GPOH 3WA0A 1KGYE 2VQUA 3DXAB 4KO9A 3C12A 5CJ8A 3TS8A 3DBHB 1I1RA 3CFJA 3ZIYA 2KZBA 1H6EA 2E7MA 3LJ3A 3ESOA 3UTSD 1HZLA 4NQKE 5E9DD 1ZV5A 3D0AA 5M72A 1ICTA 3CHOA 3KPMA 4LDCA 4PV9B 1YEIH 5BPPA 1CJAA 5CRVA 1HE7A 4YE0A 1FD6A 1AIZA 1MRCL 1KJ2H 5LGJB 3HLAA 2WQSA 4PJHA 2FAUA 3BUAA 2NZ1A 5KWYC 3WSQL 1TT6A 4AJVA 2CLZA 1J1OH 1LO0L 1XF1A 5I5MA 2VH5H 3LV3A 3OX8A 3PV1A 4RFOH 3IBOA 2HKFH 3ZDXF 4TXRA 2E4TA 3LZOA 1JGEA 2P5EE 2QVMA 3SY0B 2I1KA 1A9BA 4NRXA 5D5MB 2IPUG 1NCHA 2XYBA 5JHAA 1DYZA 1J1PH 3Q75A 5AYUH 1JUQA 4LKXA 1RP8A 3HR5A 4L4VA 1RAXA 3RKVA 3NVZA 2FIKA 4AH2A 3C3QA 4U95D 3DX0A 5C0BE 5IB4A 3TNNB 3WNKA 2BGFA 3Q5OA 5D1QC 3M8OL 4F2MB 1RK1A 3T3PE 4FBJB 5AQ7A 2ETAA 2ZWLT 4Y5VB 4M5YL 1WWTA 3UJIL 1I4FB 4U7SA 1F1GA 1TU2A 2HFTA 2HLFC 3T3OA 2CHDA 2EJ1A 2A6IA 4AUQC 4PAZA 1GMEA 2V7HB 5DK0A 1KTKA 3EDJA 4C83B 1IFHH 1CDUA 2AHIA 4MMYA 5JXAL 1EWCA 1SRDA 3CSPA 1OP4A 4J1UA 4X9YA 4XR8C 4RZKA 1Q9OB 2GW5A 3QRLA 4WWMA 5C0IA 2EXWC 3O41B 3SKNA 1U8QA 2VTBB 4I6PA 4EZJA 4XMPL 1N61A 1HFAA 4Z7UE 4PG9A 2XKNB 1OAYH 5E99H 2YHEA 5KVEL 3ZJUA 3NFNA 4JCMA 5CIPA 1GAFL 4O2CA 1H6OA 1J5DA 1E27B 4Z0XA 5DMGD 3OKLA 5DLLA 1NIAA 4IRZH 4I0PC 1CBJA 2PR4H 2CPUA 1LEIA 1NCJA 4MJIB 3BAWA 1GGCH 3QUGA 3RJDA 1B90A 1RMFH 1DQDH 1ZXQA 5EA0H 2YN3A 3T9LA 4M7CA 3C6SB 3GHBL 2BB6A 2J8UA 1OE2A 4O02H 2XWBB 2WLLA 2E2EA 1MJUL 3D39B 2WAHA 4ERSL 2BIQA 3GUTA 4JFPA 4B6ZA 2VDKB 3FCTA 1HE8A 2EQDA 4XCFH 3RGVB 1UXMA 1JZ8A 2E47A 1QI5A 2IAAC 2AF2A 5E8NA 3ASOE 1F6AA 1HSAB 5EZJB 4WW1A 3LRKA 4NC1E 3S7JA 1YEHL 5JQIB 4HCRL 1VADB 2BNQE 2NX5B 3FRPA 1FIGH 4YZFF 5D55A 3K6NA 3LKQB 4LSSL 5D4HA 3RTLA 5M7QA 3WGUB 4UTBH 5GGTL 1FT2A 2KPNA 4JWSC 2XN9B 3D18A 1DP0A 5IT2H 2MSPA 1MLCA 1M9SA 2EYRA 1NZNA 3BAKA 3PFUA 1EUVB 3GB1A 3IU3A 3RNAC 2WVSA 3LKRB 3TA3D 3NTCH 2FEEI 3NJFA 2IFFH 1CURA 1UD4A 5E2WH 5EUOA 1X5YA 1M1XA 3SE3A 3IGKA 3FQRA 3EJQA 4I3SL 2KLSA 4NO0D 3H7LA 2K8MA 1N5YL 1NGXA 4PJDE 5C09E 1PZ3A 1FYTD 4H88H 2VLJE 3QIBB 4LCYA 2WXMA 1NFDA 3LS5L 3S5LB 5FOJA 3TZVB 2OLDA 1F18A 2A38A 2MCMA 1N54A 3NH7L 4U05A 2FWOB 4J4PA 3NACL 1IM3B 1AWDA 5KUKA 1ZDQA 2O6VB 5CHFA 1YAIA 4FCHA 3G5XB 1FN4A 5HYFA 3BJLA 2CJUH 5DZJA 5F72S 3BEEA 3EGSA 1EXUB 1BJ1J 2CFUA 3P1UA 1F1HA 3WXWH 1F13A 1A66A 1GL4B 5D8JL 1LE5B 2G5BA 3GZKA 2KS0A 3NUKA 4HBQA 3O3AA 4NQED 3CXDL 1V3MA 4LLYB 1BAFL 3RWHA 1LO2L 4P2QD 3IDNA 5IGXH 3AI5A 2DPKA 2YEVB 3L95A 4XC1H 5ACZB 3DPDA 4JANB 2V9QA 1TJHH 2CU1A 3WAPA 4I9EA 3A6BH 1GPXA 4PJBE 3OB0H 4RQIA 4XPTH 2ICES 4MA3B 1QEXA 5ANRA 2YPLE 3QZOA 1YO4A 3L2NA 2LGXA 5CNHA 1OAKL 1LDPL 4MHHI 4U1HB 4ZPTB 5EZOH 3ZMRA 4DQOH 2O5YH 4CYMD 2B9BA 2KYIA 4LCIH 5KSBA 2AI0H 2GFBA 2FNWA 4XHQA 1YN3A 2XA8L 3TIEA 2HTLD 2I5YH 4WHTB 5CILH 1OIOA 4WO4D 3V4VB 2WBKA 4RMVA 4YSPA 4B96A 3EJCA 2BC4A 4UNUA 4HPYL 4JDVA 2AXGA 4FQQA 4JB8P 2X6FA 3ESMA 5DD0L 2X6BA 3DHGC 4PJAF 5HGDB 1LO5D 3MRPB 3TP4A 5J1TC 4IJ3B 3TBVA 1U8LA 4O58L 4Z7WA 1BXTA 2NBWB 2DICA 3VSVA 3QHFH 4RX4A 2Y5TA 4FFYH 5GQBA 3SDCD 5CM1A 1ZGLA 3BLKA 3U2IA 3VFWA 4O6FA 4N2IA 2YGOA 3HE6B 2VZ3A 3L6FB 2OV0A 3RP1A 4M43H 2AABL 4ODXB 5BZDA 3EJNA 1KELL 2D31A 1FBIL 1HS6A 5E23A 5LFAA 5SX4H 1OSZB 1JROA 4Y2DB 3V6EB 1DVFA 5DMIH 3SDXB 2C9UA 5DUPL 4ODUA 3H3PL 2DJMA 4LSPL 1ROEA 2AQ3A 1TMQA 2J2ZB 4ZOBA 2PE6B 4M7JL 3OKNA 1A1MB 1PD1A 1J88A 4NCDA 1OWNA 1BVNP 3HC3H 5BJTB 3IDJB 2BOLA 1WICA 1QKZL 3GSNA 2K4WA 2H2PC 2Y69B 4XI9A 4RGTA 1WM5A 1YOVB 3U0PA 1KEML 5T1DL 3Q1SL 2DZEA 2GJ6D 2IPKA 4ZMYA 5FDWB 1DL7L 5MEND 1DFBL 1KIPA 2E8YA 4NT6A 2NSZA 3ME0B 5I9QC 2KVRA 4UM9D 3LN4B 4QHKI 4YWGG 1UD6A 4MVBC 3BFQG 1T5WA 2KZ1B 3QUXD 4YPJA 3VWKC 2OEDA 1MI5B 1XMWA 4KUZH 3BPLC 4QCIA 3EYFA 3HS0A 4W9IA 2ZIDA 1FGNL 3PGDA 2IPTH 3TEXA 2J1WA 3P42A 4YDJA 1KZYA 1WBYB 2HJLA 3MYZA 5J08A 1HI6B 3CFCH 3ZKQD 1YN7B 3BUBA 3FUDA 2ZUTA 3CDCA 1WJ4A 4GKLA 4NUJB 4KBQA 3PQYD 1ZV2A 3CH1B 4LNVA 2ZXDA 1NIEA 1SYVB 3OAUL 1F8TH 4OIFA 3AAAC 1CLCA 4DXFA 1ET9A 1GZQB 2XXGA 1HIMH 4PP1C 5KBKA 1KJVB 5DR5L 4S1SL 1IKOP 4LVHB 4PLNC 1H8SA 2NW2B 2AMUA 1A6PA 4GMTL 2ETBA 4TQPA 2DAVA 5T3ZD 1XCTL 3RI5K 1FVEB 5IHWA 3H2QA 2W80C 2UX6A 3QI9A 2B6CA 4L1HA 2FUG1 3VI4E 3ZXRA 4M1GH 3ALXA 1KH0A 1WBZB 5EE1A 5BXUA 4U3SB 3UJTL 3QQNA 3A67H 5J17A 1CXFA 5T1KB 1TNYA 4YDMA 3U1SL 1Y0LA 5H4YA 3VG0L 3X1BA 1V3JA 1B0RB 3B3BA 2XZQL 3IFLH 4M8NA 5EV7A 3F7QA 1SIFA 3WAMA 4M7ZC 5KCMA 4JRWA 4TL5A 4UT7H 4NKIL 4ETQA 4D9QE 1NBCA 4KOCA 2B16A 3O3BB 3HS0C 3KGRA 1EPUA 1HYSD 2DKSA 3QGVA 1KLVA 4NBYB 2EXYD 4KYOB 3U7ZA 2ZWKA 2CXGA 3DDGA 1AO7B 5IBUB 5B3SE 4Q2ZA 4DN4H 3JQ0A 1BI8B 2OK0L 3CLJA 2YMTA 4M1CC 1BCIA 1IB5A 5GZND 4ADIA 1L6PA 4ATTA 1NANI 1D5RA 3AM9A 4HWEL 3O2WL 5CLXA 2KQSA 4EIZC 1KUMA 2C1PB 2I38A 2AJYH 3WIFA 1JALA 2OPCA 4HS3B 2B0SL 4HLZH 1JHKL 3ZPDA 2OCCE 2E7CA 3ULUL 3HG1E 4U8HA 3QH3B 1WGKA 3FFCE 1LK3L 2HTHA 4OJFL 2CPCA 2JCCB 3FO2B 1B0GA 4NJAL 5FM8A 1HDMB 1HXIA 2ZSVA 5IK3A 4NNYB 4ICVA 3QI9C 1AACA 4FQIL 1T04A 1WVZA 2GBVA 1NEKB 2QQKL 4RSYA 3HI1B 4E9VA 2AL6A 3WTTA 4AL8H 1EU4A 3C5SB 5C3LD 5D70L 3MA9H 4PJFE 4U3HA 3VVVA 4LT7A 1JGIA 4JGNA 1MVKA 4USAA 3O45A 3ATDA 3DBRB 1E5CA 2KDEB 3ASWA 3UG5A 3I6GA 3QRGL 3KBEA 1QQRA 1OL0A 4CW1B 4B8CB 2VTFA 3ZO5B 1NCDH 1OE1A 2C7HA 2QC9A 3VXRB 3I9V1 3FXIC 2APWA 4XX1G 3N85L 3DUSB 2R8SL 3HBPA 1QFWH 4FLQA 1CFBA 4RRPM 5CHNA 3UQBA 3RWFA 3HFMH 3QFJE 3QNFA 3VYOA 3JT0A 1M71A 4HBCL 1XO8A 3H85A 1G9MC 5HDOA 4AMKL 1JHLL 2G1EA 3ZDTA 1DUYB 4LK4A 1NCAH 3SE8L 2B59A 4PIRF 3MUGA 3KPLA 1PKQB 3KYKL 5IREA 5JW5A 4OFIA 1SHMA 1P53A 2MJ3A 4OLEA 2IOLA 1SJEA 4PHZA 3LH8A 5GSVB 1EPFA 1U8KB 4UM8B 3U46A 3JUEA 4X5XB 3VRBB 1URIA 3ARBB 3PVLA 2MBHA 1U3NA 5MERB 4AEEA 3TO4D 4YX2H 1RJLA 1SVCP 5JHMA 4N5CA 4BAXA 4P4RB 4UINL 2QV4A 5DJXB 4IOFC 3MCLL 5F97E 2KHAA 2IOMA 1MUJA 4D0DA 1AMYA 4D7BA 3UJJL 1CDCA 1PJWA 4FQHA 1Q72H 4U6YB 5FYKU 3GM0A 4RSVA 2YAHA 3VJ6A 1EZLA 4FZEL 1NJ9B 4L1BA 3RJQB 2LZ6A 3PEUB 4R7DA 4F7EA 4Q9RH 1JFQH 1H5BA 4DERA 4GSDH 3ESPA 1TJMA 2XWRA 1A1NB 1AS7A 1CE1H 1PLAA 1Y7VA 2HTKC 2OQJB 2WNWA 3CFTA 3ETTA 5LAXB 4A7VA 5FEBA 1G7PB 2OJRA 4W9EC 4WNFA 2GUOB 2F5AH 2BT6A 1SDAB 4LO9A 3SQVA 2N3JA 2EDFA 5CMWA 2WXFA 1ZWIA 3IU4L 3WHE1 4WJNA 1I7UA 1JWAD 5F2FA 4AEHL 4PJ7A 1P5VA 4E0RA 4OCXL 3FUIA 3S48A 1HXMA 1KBKA 2PYED 5I71C 4DX2A 1YUHB 5C0AB 2RPQA 1GZHA 4FABH 4OLUH 3SEBA 2GC7C 1WIUA 1BD2D 1I7ZB 2PEAA 2ZG1A 2Z59B 1FJ1A 3L10B 3IMUA 1FPPA 2WXPA 3Q2WA 2YGQA 1JV2B 1TITA 1JF1B 1U92A 5D2NE 2NYKA 4JVSA 2NYZA 2VMJA 2NUPB 5E1AB 3WXVL 2ID5A 1ZKAA 3BDXA 2OI9C 5AB2A 1O9VA 5KTEL 1KB9K 4ZUWA 3QCVL 3M86A 2ORBH 4XO5A 2XA3A 2W65B 1JP5A 5F8RC 1QBLH 4X4MA 4AQZA 5J1AB 4EI5D 1H5BC 2N01B 1ITBB 4R0LB 1RM6C 4LBEA 3RVXC 4LNBA 5IG7B 1BG1A 1X44A 1HEHC 3ARFD 4JGJA 1QA9A 4M62H 5D1QE 3QUZA 4APQA 2UWQA 1K1BA 2OXGB 4UV7L 5JIHA 4MJ6B 1V5OA 5FKPA 4FF9A 3V5DB 1LJMA 2IOOA 4XVJH 2N0KA 3MXVH 1DQJB 4NZUH 4G43B 1Q9LB 4XI5D 5ESAB 3N1YC 4ZFHA 4JB9H 1FL6A 3WIHL 4PJEE 1ASQA 3GMQB 4GSWA 2ZW0A 4LPXA 1SGHA 4C7YA 1MX6A 2DI7A 3BP4A 4BSXA 1ZVSA 2FJHA 1ZLWH 5IFJB 4R97B 1K5WA 3LN5B 3NVQA 3VUAA 2AJVH 3DNKA 1RURH 1SHWA 4GO8A 4OF5A 2DIWA 4JO4L 1P7QB 4ZAKC 4WUYA 1JZ5A 2UZIH 1HHIB 3TPUA 3LRGA 5DJAB 4G8EA 1P4UA 4ZFZB 4B95C 3IT6B 1QHOA 3G5VB 1NIBA 1QEWB 2BS4B 4UUJA 2YSTA 1OM3H 2WLKA 1ZHBA 2BSRB 1QOAA 3IDUA 2EEXA 1S3SG 4HSAC 1BAWA 1QR1A 1ELWA 2DZOA 2P47B 3KL3A 4KU1A 5HHOE 3JYCA 3Q8EA 3TWXA 1CF8L 1OCCB 3O6FA 4RGOS 1YMHA 4MQSB 3ZJAA 4OZIA 1OSPL 2FWLB 3JWNE 4QKXB 5D93B 3VGAC 4K0RA 1Q90A 2JJSA 4MAYA 2P9NG 4AYID 3FRUB 3EFOA 5B4MC 2YEPB 4G8GD 2ZIRA 1K4DA 3MJ8A 1NFIE 1MEXH 4N8UA 5FWRA 3C9NB 1R5IA 4AT6B 4BH8A 3RBSA 1Q1JL 2EDJA 3GEWB 1BDYA 3ETSA 3NIDF 3WY1A 3QDJB 5CCKH 4GA0A 4DGIH 3HG4A 3SOTA 1JRHI 4JVPA 4XYCA 4I77L 4AGOA 2OVBA 4XX1E 3NEXA 1CU4H 3OXGA 1MH5A 2BSSA 4QXTB 5F7EL 3U6XA 1QSED 4EUPA 4HIXL 3GFUA 2ZKXA 3H54A 1G7QB 4BKSA 1ESFA 3OGCB 2QPEB 3IDGB 2JE8A 5DVPA 3QAZB 3CFQA 4RCAA 3KS2A 4NQSB 2B3IA 2PKDA 1PYWA 1CLVA 5DRNB 4QLWA 3B1LX 3VXMD 1P1ZA 2OP4H 4RDBA 5DF0A 5F7WC 4F7ZA 1Y1DA 3VA2C 1A3QA 3BPOB 3KDMB 4HCRA 3AEGB 2Z8LA 3MHSD 5BO1L 5ERWA 5IZ7A 2EKIA 5EBLB 5A2CA 3E34A 3QWRA 4HUKB 2Q6WB 5E4IA 1B88A 2X9XA 3GGWB 1T66C 1L0QA 1N0XH 2APFA 2CNZA 3CQPA 3O6FC 4J23A 2EZ0C 5I17A 1IM9A 2JXXA 2VDOH 1BVKA 4GI9A 3AADB 4NWUH 2K4AA 4JM2A 2SEBD 3VXSE 4LRNL 1RZJL 2BNRA 3PLYA 4M3HA 5LP0A 4XPFL 5I74B 4NM8H 3FO1A 1MPEA 3DECA 5HVHC 1T22B 4L4TD 3ERXA 4LHUD 4A63B 3HE7A 4FL4B 4IOIB 1X4ZA 1GGUA 4LNRB 4LOEA 2IXQA 4LOFA 1AGDB 1WPCA 3N44F 4OZGF 3D2UB 3A1QB 2YRPA 3CQCB 4HAKA 3HDXA 5DUBB 4KNQA 1GJZA 2WWOA 1K8KG 3CSFA 1N0RA 3T71A 3U30B 3MRMB 3A4SC 2NNAA 3FC8A 2PCFB 5IR1B 2A4EA 1WZMA 4XVTL 2WWMC 4BKSC 2CIKA 2FWSA 4ZUVA 4Z3IA 4JEGB 3HVEB 4JO2H 3NSFA 3KHOA 3TTYA 5KS9E 1ZUD2 2YPVL 4QPEA 2YQ3A 4OB5L 2IV9A 4JRYD 5TH2B 1F11B 1P4LB 3AXCA 1A17A 1HINL 2D0HA 4OGAD 5I15H 4G3XB 1MVFA 4E2OA 1SMAA 4FQXD 5B38A 1SEBD 3CLEH 2Z7UA 3JSVB 3VFVA 4XPBH 1NVID 3RO2A 3PWVB 2PE9A 5FUCE 2WGXA 3ZNGA 3RWDB 3QQ9D 3W9FA 4P49A 3ZE0B 4YO0A 2LU7A 5JIMA 1HH6A 1HO8A 4N90D 3OLMD 4JM2C 2LVQA 2CHNA 2BZDA 3BSZL 4P23A 2OTUB 1HWWA 5AG8A 1HHHB 2GJJA 3GXFA 4Q58C 3O2VL 4L1LA 3VMNA 2NT0A 5AL0A 1ILSA 3UMNA 5HGHB 4QT5B 1UCTA 1HILB 4CGVA 2NYYC 1F2QA 3JWOH 5D2LF 3HE7C 1T0NB 3O13A 2IBGA 4GG6E 3LPZA 4UNVA 5EPMA 5J89A 1U0QA 4GU2A 3RVUC 3L3JA 4CBPA 1CGYA 4P57B 4YDOA 4W9CA 1WTGT 1OP5H 3LRSA 3ARDD 4FNPA 2D4DA 4TUOA 3DOSB 5EUKA 3EHRA 2APTA 4WUUD 4F6RD 5EDSA 5AVRB 2QEJC 5BUAA 4P2OB 2DAFA 3NZHH 1KULA 2LLLA 1XGUA 4LVOB 2Y06L 4TMAB 1CVRA 3BO8B 2BVOB 1ID5I 2C26A 3WG7B 2FATL 4YHML 1NPNA 2YO3A 4CGUB 2ZWZA 3L4VA 4JFXA 4F7TB 4GLRI 4Y4HA 3D9KA 2FL5A 1E5YA 5DTFB 1VCBC 2CWRA 4P2YA 4B9YA 1INEH 2J09A 1ND0A 2NY6B 5C6TL 5D6DC 1XH3A 3MC9A 3ZNGC 4LSQL 1WX9A 2M63A 3VX1A 5IJBC 5D6CA 5L4MA 3DBXA 4KGLA 4HNAD 4P05A 4H25A 3NBNA 2QPDB 4YL9A 1T0MA 2W8CA 4M03A 4P23C 4H44C 1DOYA 4W9KA 3C60D 1YPZE 1U36A 3EOYG 4G6AC 1YQ3B 2P5PA 3BYTA 4IQHA 1RZFL 5DD3H 3RIKA 4XX5A 1HHGA 1IGTA 3PWLB 4FJVB 3V95A 2KDIA 3QULB 1P6FA 1RJYA 5F0LB 2W0KA 4QHMB 1F41A 1NCTA 4W9CC 1QFHA 4U1NA 3I50L 5G04C 1OHQA 3DUUB 2AJAA 4IRJA 1SXSA 5BS0E 2DWEA 2XDHA 3S7DA 2VJ0A 4A04A 1WG3A 2NBUA 3VD3A 1CIUA 3IFNL 4MJSA 3G04B 2UY1A 4PJGB 3VH4B 4WQOB 4HJGE 4LEOB 4UYQA 1KOTA 4Y1AD 4BX9A 1T0RC 2NUTA 3FT1A 5JXED 2BBCA 1MCNA 3BUIA 3EJYC 3NIFB 4TV3A 3FTWA 3GMOB 3IXTB 2Q7YB 5GS3A 5ARGA 3T6ZA 2PTUA 1TZIB 5FA4A 4DN3L 2OJZL 2MPVA 2G4EA 5CINL 3UADA 4U04A 4X4YA 3PEVB 1YD8U 1FAKT 3G2WA 1X7QB 4X4KA 3U6RA 2FAZA 3KS0H 1DCLA 4MGKE 4J27A 5E6ZA 4O9HL 4PGCA 1JVKA 2WIIB 3T5XA 3EYSH 3ZLQC 5HBBA 3AMZA 5EZPA 4DVBB 3B3IA 5T5FL 3QZMA 3N06B 1QPXA 3ZDZE 2KDFB 3W9DA 2C3VB 4W9KC 3QWPA 2Q8AL 5I66A 2RSUA 1IGCL 3HK0A 2GK0B 2WQYB 4ZMXA 3WBDA 1AGEB 2BMKA 3FB7B 3E9TA 3I74A 3TBTB 1JW9D 4I9CA 3I3EA 4AE0A 3QEGL 4LCCA 4H5SB 1DHKA 1AVAA 2WYZA 4PRIA 3VRLE 3EGDB 3ZTJG 3QNXA 5C2UB 5FA3A 5T1LB 5IQOA 4QJ5B 3BWUD 3HKFA 2IO2C 4IRJC 5EU5A 1ISNA 2XEWA 3V4UH 4RAHA 1MAML 3VFOB 5KBLA 3T1FA 1AHWA 4JFDA 2DYSB 3RZCB 4CC1A 4V1DA 3F6JA 3HMXH 1UWEL 2JKLA 2O61A 1UGNA 3GI8L 1BU9A 5F9OL 3WNOA 2LR4A 2K7QA 3B5HA 3H9SB 4GAGH 4DEWA 2YD1A 1VPOH 2R2OA 2PO6C 2NQDA 3VACA 4PYZA 3EHBB 1FAIH 4YSZB 5ESQB 5E6PA 3C75A 1BXVA 1TEZA 3QNZB 3P9LB 4V33A 2I9LA 2J8OA 1FP5A 1X6NA 1FVDB 1E4WH 2GYSA 4PJCB 1QBQA 4Y2NA 5E6IC 1SLWA 4IBSA 1K5NA 3HAEB 4N2NA 4U0SA 3RDTD 2G5UA 3B56A 4E9QA 4HCNB 5G55A 4UT6L 2BOCB 4KKIA 1PZ2A 4MMZC 2F74A 1TG8A 4L5FL 4L05A 3DVNV 1FT1A 4HX1B 1O6SB 4Y19D 2IALB 1YA5A 4N5UA 2FX9L 5J1SC 1C5DA 3AC0A 1SOQA 4BXSV 2XETA 3TT1H 4MQXC 4ME2A 3CX5K 2ED6A 2YA1A 2NY1C 2VR9A 4MZ3A 3ARGA 1PGXA 4YL4A 2ED9A 2CKBB 2FLBT 2H1XA 4AC4A 4XNQA 3T4AA 3VH8B 4DGYH 4U6XB 4NSKA 4PMFA 2LGYA 3AGWA 5TK2A 1KXTA 1WAAF 4OCYH 4KRLB 4L2LA 1V05A 4X5PA 1MFNA 3HPJA 2EYTA 3QZWB 2DH2A 4ODHH 4DFHA 5E94B 4LSVH 2BZCA 2UY6A 3N20C 5I76B 5GGQL 5J90A 1T3FA 3O6LL 2EUXA 1RHHB 4KHXH 3ZHFA 2DLBA 3LNFA 4O1PA 4XIFA 2YBRB 4ZXBB 4AZUA 1KY6A 3D5OF 5BXFB 5KYYA 3ULUC 4WI5A 4FDWA 4KKNA 2D7NA 2LVCA 1UACH 4GRWF 5FHBL 5D7JD 2H3NB 2KXPC 5CAYB 5AWNH 3RPKA 1C5CH 4ENED 2FJGB 2DJ4A 1XH1A 1ZMYA 2D7PA 3RHWK 4ZYKB 2A0LD 1V55B 3DIDA 5LQBL 4FQJH 3DI3B 2D03L 1C76A 5KJMA 4GUPA 5D7IB 3BWUF 1WR1A 1UXSA 4MD5B 3U8ZA 5C71A 2ENJA 1FH5H 1M6OB 2VDKL 3JBG7 4QAWA 3G08A 1T5XA 3MZLB 1VGEH 5KANI 4PQXA 2NDGA 3ARGC 1JUFB 1GAQB 1ZDSA 1ZRUA 4QRUA 3ZUCA 1KXVA 5E75A 1Q0EA 4EUPG 3GIZH 1G7HA 5CBNA 3T4AC 3UFIA 5LXHA 3GUFA 2ZZPB 2XEEA 4RRPG 1XGRB 4NAMA 2DMKA 3E38A 3U83A 5BCAA 1UG3A 3I2CH 3B9KD 4PJ5D 5JW4R 2WWNA 1P1AA 1UM5H 5FYLE 5GGSA 1HSBB 4YGAB 1YEEH 1A7NH 3DWMA 1Z7JA 4QY8A 1A4JA 1CGXA 1HL5A 1KGCE 3Q01A 5IEKA 2WBJA 4Y16A 5BZWA 1NZRA 2MCPH 2DTMH 4FFVD 5KVDE 1A70A 4OV5B 4EHMA 3BKYL 5LDSA 3HUJB 4NQTA 3ABLE 2KMAA 3QEQA 3WEXB 2XK5A 1AI1H 1BGXH 1NEUA 4S0HA 3IRZA 1WJNA 1B4TA 4EI6B 4Y5YB 1MWAH 3CTTA 1Z3XA 4HOTA 1EWHA 5H92C 4JX0A 3RNFC 1GHFH 3RVTC 1N70A 4MS8D 3BAYA 3ESLA 2XWTB 3T2PA 1UQSA 2PXYD 2BSEA 1L4ZB 4FMFA 1DN0A 1J9CT 4JPIB 3NF1A 3MBED 5JTWA 2J6EH 3KWXA 1KT1A 2GLSA 4NJ6A 4TLKA 4KH2A 1F3JB 3NJTA 2KYWA 2P9KG 2XG5B 4P2CG 2P8LA 1JZ6A 4YHPA 1AP2A 1R24A 3DV6B 4NPKA 4QRPB 5DK3A 4AGPA 1KXVC 3AS0A 2DYBA 1VLBA 2ZXWE 2IADA 1EUTA 2W9EL 3F7KA 1NBVL 1OAXL 2ZONA 4X6DF 2AYOB 1E6OH 1GY1A 2XTJD 4OTXH 2RR9A 4UI9J 3V5H