4AJWA

Discovery and optimization of new benzimidazole- and benzoxazole-pyrimidone selective pi3kbeta inhibitors for the treatment of phosphatase and tensin homologue (pten)-deficient cancers
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
916
structure length
765
Chain Sequence
KKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNQPFSIELIEGRKVNAVQAGLFHGNEMLCKTDISVCDLPRMARLCFALYADCPIAWANLMLFDYKDQLKTGERCLYMWPSLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLTAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
publication title Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 212
structure length 765
sequence length 916
chains with identical sequence B
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4ajwA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ajwA03
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ajwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajwA01
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4ajwA04
2G4DB 4G50A 5CX3A 2D07B 4KITB 1UD7A 2R83A 4GMVA 5D94A 3DPDA 5KJ7E 1I42A 4DWFA 1E8WA 4WAFA 5G55A 2KX3A 3B0AA 3ML9A 4K7WA 3ENEA 3OJ4B 2J0JA 1DSYA 4FHJA 2CS4A 2JVCA 2JQZA 1J19A 1OEYJ 3ALBA 3M62B 4PYUA 2DZMA 2L0TA 4AWJA 4XX5A 3DBLI 2JF5A 1P0RA 1WGDA 3PHWB 1DJXA 4F8CB 1V5TA 3CF6E 2IZVB 5CHWA 4TS6A 4E74A 1VD2A 2N9EB 2JRHA 2NS5A 3PGEA 4NQKE 4WJNA 3RCZA 1K5WA 2JZ3B 3H9DA 2KJ6A 2L3ZA 4A3OA 3PRZA 1RLWA 4GGQA 1UGMA 2WXRA 3VUXA 1BCIA 2Z0UA 5H4ZA 1WMHB 4RM9A 3UIPB 2YRBA 1WYWB 3ZTDA 3WANA 1GC6A 3ZRFA 3ZNHB 4RMAA 5G2NA 4BOSC 2W9NA 2O6VA 3A9JA 1PQSA 4HJKA 4KV2A 4WWOA 2FCMA 2LASA 3ONSA 1BDYA 4FA6A 2BWFA 2MW5A 4LDTB 1E5WA 2MBOA 2D10A 2WWZA 3X23A 5H4YA 1GJZA 1KOTA 3RDJA 2WXHA 4L23A 3KUCB 3W56A 4GSWA 4W9FA 3QAQA 1XT9B 2AYOB 2IYDB 4HDOA 2EMSA 2N1WA 1WJ4A 2N1VA 4FBJB 3W57A 1ISNA 2O2VB 2HTHA 2D3GA 4CYEA 2JT4B 4ICXA 4LDCA 3LJ3A 4NPKA 3Q3FA 3QWZB 3DVGY 4IWQA 3L10B 4HPMB 1V81A 1WR6E 4AJYB 2C5LC 1WM3A 4KSLC 1UOVA 2ZVOA 2BKRB 3KWTA 4OVVA 2K4AA 3RZWC 2B3AA 2GBKA 4NAWA 2ZPYA 5LLIA 1BYNA 4DHJB 2OJRA 3H6NA 2QZ5A 1EO6A 2MBHA 4WWPA 1WZ3A 3QHTA 4BKTA 3MTNB 4IG7B 3LS8A 1L7YA 4AUQC 2C60A 2QHOA 1Z2MA 1NI2A 1YRKA 2IY0B 3R7QA 1WMHA 3DVNV 4K81A 2ZNVC 4GDLB 4TV3A 3VVWB 1E8XA 3U8ZA 3DBSA 4LDTD 4BBNC 2CJTA 2K8BA 3T9LA 1RLFA 2D11A 2LRWA 2GBJA 3KW5B 2K8HA 2KK8A 1WX9A 4IHBA 3IBEA 1NBFC 2NVUI 2BWQA 1XD3B 1LM8B 4PH4B 2O2VA 4DHZB 4IUMB 4A55A 3BINA 5LXHA 2KJRA 1U4AA 1BT0A 2CHDA 3JYUA 1QATA 3OJ3A 4HXDA 4NQLB 4NJ6A 3VUYA 5ANLA 2FAZA 2FK9A 3QR1A 2RPQA 4IWPA 2KLCA 2GBMA 2IO2B 3R3MA 3HHMA 2LGDA 1TGZB 3IG3A 3DVGX 4QAMB 4GXBA 1WJ6A 3QARA 2LGYA 2ENJA 1JRUA 2FNJB 2V3SA 3VH3B 4NPJA 1WRDB 3ZKJC 4F91B 1OTRB 4II2B 4L2YA 2FIDA 4MSQB 5LXIB 1C3TA 2V1YA 3C0RB 1RH8A 2N7EA 4EEWA 3IM1A 2LUEA 2XBBC 3DVNU 4JQWC 1L2NA 1CMXB 4UWHA 2CU1A 2KFKA 4XE0A 2LRUA 2UYZB 2A4ZA 2KDIA 5E6OA 3RD2A 4EZKA 3PVLA 1UOWA 3FBKA 4EZLA 4IW0A 2AL6A 3H7PB 2MX2A 4J6IA 1AARA 2ZPNA 2KOXA 3UQAA 4MDKE 2X6IA 2ZCBA 3PT2B 1DJGA 2Q0ZX 2G3QB 2KDFB 4EFOA 1WGGA 4KZ0A 2ISDA 3HIZA 4EZJA 3QR0A 3RUIB 3QK0A 5J17A 2ENPA 1DJWA 3F01A 4HLEA 2BYEA 2Z0EB 3W1SA 1FXTB 1WFYA 1E90A 1ZGUB 3VQIA 1WI0A 4PS3A 1TTNA 4MJJA 3KYCD 3VDZA 1RFAA 4NS0A 3B1LX 2CHZA 2NPTB 3Q3JA 2IO1B 4BKSD 2C7NB 2J0MA 5CHFA 3WAOA 1WIAA 3VAWA 3UIOB 1GG3A 4ANVA 4XC2A 3PRPB 3JZYA 2PPHA 3M63B 3AU5A 3TL5A 3KWUA 4CHKA 2Y5BB 1V27A 3M7FB 3VFKA 2KVRA 1K8RB 2WYQA 3L08A 3W1YA 3TCAA 2WXNA 2K39A 3UGBB 2FIFA 1SE9A 2LXCA 4M8MA 4UWLA 3L0WB 4NAWB 2I9CA 3ZW3A 1UELA 3SHQA 2KN5A 4XZ4A 3VTUA 4EOYA 5ENNA 3R66C 5DCNA 3PSEB 4GB9A 3H7PA 3VH4B 4ICWA 1DJYA 1P1AA 1RRBA 1E7UA 2BYFA 5D2MB 1P98A 3V62A 4WWNA 2KC1A 2CHWA 1DJZA 4MGZE 2DENB 1DQVA 2DYBA 2O6VD 2PEAA 4W9GA 5J2RA 2X6HA 2KHWB 1W15A 2KJHB 3QA8A 1YIWA 4G0NB 4MJSB 5DPWA 5D6JB 1WXSA 3KYDD 2Z0DB 4B6WA 2AWTA 3F04A 2N7DA 4ZRKA 3TMPB 2FUHB 3PLVA 4DDGD 5KHQA 4DDID 2NQ3A 3O65B 1IYFA 4JPSA 1G6JA 3ZLZA 1Q1OA 2NPTA 2MRPA 3NZUA 4IQHA 1S3SG 1YX5B 1KM7A 2YVCA 1OGWA 3DBRI 1GC7A 4P7IA 4IWOA 1WF9A 1KLVA 4EKUA 3A4RA 3AU4A 3DOWA 5J18A 1WJNA 4ICUA 3TJPA 3R7RA 2I1KA 1WXVA 4DNLA 3APFA 2HJ8A 3F00A 1YQBA 3I3TB 3SU8X 1WFJA 4FULA 2KDEB 4WAAA 1V2YA 1WX7A 3ZNGC 4K1RB 5E6NA 3X0WA 3NY5A 3ZUNA 1P9DU 2WXMA 1UH6A 3ZIMA 2KQSA 1M94A 2ASQA 3N3KB 3RYTA 2BYVE 3PTFC 1QZEA 4W9KA 4AJWA 1HE8A 2ZNVB 4B9KA 1W16A 2AEHA 2C7HA 2Y3AA 2I1JA 4WJQA 2YLMA 3PZDA 5AZFA 3WAPA 3S2AA 2IO3B 1X1MA 1WGRA 2KDBA 2ZZPB 2MBBB 2KFKB 2BWES 1TJMA 2WXGA 5AZGA 1A25A 3FDWA 3WA0A 1D3ZA 4MJSA 3HM6X 4Y1SA 1DJHA 2WXQA 1Y8RC 2IY1B 4E3CA 1GNUA 1S1QB 1WXMA 2JPHA 2ZJDA 3DDCB 3RT3B 3VHTC 2MSED 3L54A 3JVZX 1WH3A 3PRMB 1EF5A 2FCQA 2DMGA 2WXLA 1LQBA 3UINB 2DHZA 1GMIA 2KTRB 3A33B 4GU2A 4LJPB 4NY0A 3U7DA 5DPSA 4EUTA 1LXDA 4NJ7A 3APCA 4W9EA 3IVFA 2CM5A 3ZDTA 1J8CA 4HDQA 4IM3A 3OAWA 4DHJD 2RD0A 4Y1TA 4PYZA 2Q3XA 2XK5B 4YL8A 4BGDA 2X38A 3PS6A 2NR2A 4A20A 3D32A 2X6JA 3EFUA 3IHYA 3KH0A 2CR5A 5CTRC 2K25A 3MHSD 5T8IA 3A9KB 2MBEA 3AI5A 4FJYA 4IM0A 1IP9A 3A1QA 2R2QA 1GUAB 2CKHB 4LJOB 5GMVA 4F7ZA 2MP2B 1WM2A 2LVPA 2LHAA 3ML8A 4ANUA 2D2QA 2ZVNA 2EP6A 2KMCA 3A4SC 1C1YB 3EECA 1V86A 4ANXA 3NOBA 2N9PC 4MH0E 3GOEA 2KMAA 2UZPA 2KZRA 3PFQA 4E71A 4F92B 1UBIA 5AZHA 2WXFA 4OYSA 2M8SA 2LXAA 2XEWA 5IA7A 2WXKA 3V60A 2KNBA 1EUVB 1Q5WB 3ECIA 1YJ1A 2KFJA 4TQ0A 2IBIB 2MLBA 4DBGA 2DZIA 4ASWC 2KTRA 2KO3A 5L95C 4NPNA 1TZ1A 2WXJA 3OHMB 4ANWA 2KWUB 2EMTA 5L83A 3TBLD 5CCJA 1UBQA 4MGIE 4HK2A 4KSKC 4UWFA 3QQ8B 2L8JA 2DYOA 2XK5A 1CJYA 3QJZA 2KTFA 1UGKA 1IPGA 3PPAA 3ZNZB 2J7QB 5BO4B 1WJUA 2RGFA 1VCBA 3SDLC 3L13A 3A9KA 5JH5C 1TBEA 1Z5SB 3V61A 3SD5A 5CCGE 4I6PA 3PV1A 2MP2A 5C1ZA 1E8ZA 2M0XA 1R4NI 2CM6A 2CJSA 3JSVA 2N9XA 2YOAA 1LFDA 2L76A 2REXA 3IHPC 4BVUC 2WXOA 2A5UA 1R4MI 1WE7A 2PJHA 3AULA 4KDLB 2AL3A 3VTVA 4FLHA 2ZCCA 2DAJA 2JUOA 5E6PA 4HCNB 2M4NA 4W9CA 2DX5B 3RZFA 4BKSA 2GBNA 3M95A 4BBNF 5JHAA 3APDA 1RSYA 1UZXB 2WDTB 4GIVA 1WFMA 4DHZE 3ZDMC 3DQVA 2HD5B 2MA9B 4B95A 2KWCA 3VUWA 4QJ5B 4HWIB 4MGKE 1J0GA 4KDIC 1V9JA 2B3RA 3CSFA 4PS8A 2C9WB 3TIXA 3V6EB 3ZVVA 3KUZA 4L1LA 4GDKA 2L0FA 2FCSA 2M1MA 2IO0B 4WJPA 3U30A 3ZRCA 2RSUA 1ZKHA 1Q0WB 4UWGA 2KLGA 4ZRJA 2V4LA 3T8MA 4DXAB 2GMIC 4MSMB 4F1SA 4TUUA 3JW0X 1T0YA 2NSQA 2LZ6A 2QZQA 3L9BA 4V11A 3N5AA 1YX6B 3QX1A 4ICVA 4L1BA 1CJAA 4G3XB 4K7SA 3QC8B 4KVGB 4JIOU 4IM2A 3DBHI 3LDZE 3TWYA 3DCGA 2ENQA 4LT7A 4MGYE 3NSJA 2KANA 3N32A 2ZKMX 2LVOA 3K9OB 4MM3A 1V80A 2N4FA 2GOWA 3A1QB 3K9PB 2K8MA 4BFRA 2KXJA 2MCNB 2D8KA 2NCEA 1SIFA 1WGHA 2DZJA 2G45B 3H7SA 3KVFB 4W9HA 4GNKB 4ZRIA 2X6KA 1KJTA 1P3QU 2K8CA 2LWPA 2M17A 2JXXA 4I6LB 3B08A 3PHXB 2JRIB 2C7MB 4N9F4 3GZNI 2BF8B 5IAAC 1E7VA 4M8NA 3WAMA 4FHKA 1WY8A 1RAXA 5FR6A 4BKGA 3L17A 2GBRA 1V49A 3RULA 4FN2A 3P2BA 4W9IA 5C23A 4TKNA 2R2OA 3BY4B 4OVUA 2DYMA 2K45A 3B7YA 2OOBB 4II3B 1A5RA 4PS7A 1H8CA 4FJZA 3HM3A 2FJUB 2CHXA 4TQ1A 1WXAA 2RR9A 2UWQA 4FJVB 4KIKB 4AOFA 3QCAA 2ZEQA 3HK0A 2NBWB 1DJIA 1MG8A 1WX8A 2LJ5A 4LCVA 2NBVB 2Z59B 4BOZB 4ZDVA 2JWZA 3EC8A 2WXIA 1QASA 2BGFA 4QJ3B 5KHOA 2VRRB 3KUDB 3V6CB 4URKA 3F05A 2PE6B 3AXCA 1EF1A 2LGXA 3PLUA 4ZYNA 3VXWA 2LVQA 4IC7B 2WXPA 2K6QA 4F93B 5EDSA 3WALA 1NDDA 3PYCA 5TR5A 4NNJB 1WE6A 2LI5A 5CHVC 3JSVB 5D7GA 1OQYA 5DPRA 1V6EA 1OEYA 3IFWB 2X6FA 3ZO5B 4W9DA 2L7RA 2JZZA 3W1SC 3L16A 3HN8A 2BPSA 1YD8U 2MBQA 3M3JA 2K6DB 4GOCA 4JL9A 4WJOA 2NCNA 1E8YA 4AP4C 4MEMA 3H1UA 5AEKB 3VTWA 4MELA 5CCHE 5JZEB 3RPBA 2HE7A 4FADA 5JHBA 3N30A 3NHEB 4WQOB 1WZ0A 5DPTA 4I6NB 2DZKA 1ZW7A 3ZNID 3ZTCA 4CO7A 4UWKA 2L05A 4HVBA 4KIKA 4HCPB 4X57B 4GDLA 1TJXA 3WIMA 2KX0A 3NS8A 3NZSA 1WR1A 4M0WB 1F9JA 2K3HA 1V5OA 2JY6A 4K7UA 4KZCA 2DAFA 4GDKB 2EKEC 4A3PA 4G11A 5HKHA 2N1TE 4WEEA 4JLCA 1WGYA 1I35A 3UQBA 3OLMD 3EHVA 4RM8A 4GN1A 3CMMB 4DK5A 2KC2A 2L00B 2KI6A 2KKCA 2KQ7A 2LD9A 2MQJA 3GPEA 2BKFA 2WX0A 1SGHA 2WX1A 2MWSB 2O6VB 3A9JB 2FCNA 4HPLB 2J0KA 4JGHB 2G4SA 3L4CA 1XQQA 2K1FA 3UF8A 2DMHA 4W9JA 3PREA 2KWVB 4W9LA 2PE9A 3CSTA 1H4RA 4LCDE 2KD0A 3QIJA 2NBUA 3MJWA 4NP9A 4QJ4B
chains in the Genus database with same CATH superfamily
3BZ5A 4ELKB 5EC2A 1C1EL 4Q2JA 4M3OA 1HCYA 1IZKA 1HZLA 3MRLB 2F5AH 4O4YL 3PPSA 4PJFF 4NFCA 4FG2A 2A9MH 3P69A 2WLLA 2XYCA 4HXBH 3ZL4H 1H2VC 1HAUA 2VABB 4Y16D 4DW2L 4QRFA 2ZG1A 2L0TA 2Y1VA 5AW0B 1M05B 1GKEA 2O5YH 3PWPA 4CDHA 5EZJB 5DUBB 4YDLC 1WGDA 5ANMB 4Q8BA 5I1CL 3UI3A 4NQKE 1J7VR 3GBML 4M8RA 1C79A 5I17B 2ERJC 1RAMA 4G80A 3T3MB 2A83B 2NY7L 3TA4D 5K9KB 3LNDA 1Y0LB 4N26A 2HRGA 4QTIL 4RG9A 1CUOA 4XDDA 4AY5A 3II2A 4L29A 1KJ2H 3B56A 5E4IA 2AF2A 3P9MA 1UD8A 2YPLD 2F8VA 2Q3ZA 5FA3A 4LDTB 2C9VA 2ZOLA 3MV9E 3QA3B 32C2A 4OCRL 3WAKA 1FZKB 2UXVA 3N1ZC 3QAQA 4APQA 4KY1L 1KBBA 5EUOB 1NCIA 4MA1C 4WO0A 2F7RA 4D7PA 1XEEA 5DRXB 3DVGB 4XVSL 1MCJA 5GGVY 5BV7L 4N6EB 3V9FA 3SKJL 4JFTA 1DHKA 4FC8A 4KBQA 2DKUA 2WYIA 2ITEA 4GQQA 3WHXA 5I1EL 1EJ8A 3LXFA 4MYWB 1OZUA 4KXBA 4JFDE 4PMEA 5J1TC 4HI9A 2ESVE 2ZXDA 1C5DA 1BGXH 2MKLC 3ZKNC 2GBKA 1PZ2A 3K6IA 3L5WA 4DKAA 2A9NH 4P07A 1EO6A 1LO5D 2HTME 1KC5H 3QHTA 4TUOB 1L5PA 4RF0A 4GKLA 3HB3B 4AW4A 1AGBB 2ADFL 2WWMD 3KYNB 4DXFA 3B7UX 1WMHA 1KCVH 3VWJD 3AFLA 3BZEA 4KDTC 3DVNV 4XGAB 3L6FA 3BMWA 3SDAC 4GUQA 1GZQB 2LFEA 1OSPL 3PHAA 4G43A 3DBSA 2ZF9A 3VXMA 4EI5D 4FTVB 5IQ9B 3O3UN 5FM8A 1QHOA 1QLRA 3HNSH 1D5IL 1SYSA 2QQNL 1YEIL 2R29A 2WVVB 4OF5A 4Y9FA 3VLDA 2BWQA 4HUMB 5FYLD 5LGYA 4PH4B 1QG3A 1NGQL 3GHBL 1MCEA 3QQ3B 1CQKA 3VB9A 4FABL 1UTDA 4ZS6C 3SDXA 3ZE1E 3JYUA 2WIIA 4YGAB 1HG5A 3SCMC 5EN5D 3WS3B 1ITCA 2CIIA 5IW1A 4IKLA 1DDHB 5HHPB 3KAEA 3LKRB 4WUUD 4YHOL 4AYBA 3SE8L 1NVID 1MW3A 1ZA6A 4GW4A 3UYPB 4PJXF 4JZJC 2RQ8A 4IBUA 5B3JE 1MFBH 3L6AA 3MLVL 3T2NH 4AQOA 3QARA 1QSEB 1SDAB 3SE3C 4OZIE 3VH3B 2QQQA 4IOSD 4X4XB 1MUJA 3H3PH 1LE5A 2EH7L 4J8FA 4HKJA 1IHGA 5EU5B 3FFCD 3LRKA 3SDYL 3UTSD 3QDNA 4E6HA 3ISWA 1VCBC 2L7UA 4ZTOH 5JDJA 1SJHA 1R3LB 1PZDA 1UOWA 4IW0A 1J0ZA 3S35X 4U7EB 4JB8P 2J2ZA 4ATTA 2G3NA 4PTTA 2R5SA 2BVEA 4KAQL 2VDPB 2ZCBA 2Y7SA 3DMMD 4ODBD 3UM1A 2YGQA 4GZCA 2CU3A 1BZOA 1JPEA 3CZKA 3KPLB 3PP4H 3QCTH 3QDGE 5I6NA 5KG9B 1C9SA 1AGFB 4RQIA 2C8NA 2ZZUT 3PXHA 4GRLB 2ESVB 1SB3C 2PCFA 1IGFH 4LCUB 3P4RB 3C60C 3QUXB 1USZA 4Y4FB 1CK0H 3IDNB 2OYLA 1BQUA 3GB7B 1IC5L 3ZO0A 5ADOH 4TRPH 3EFDL 3LYYA 3LKSA 3M63B 4Y2NA 3Q7AA 2EILE 4Y9GA 4XP4L 1FG9C 3EUUA 2WYQA 1MFEH 4P1BC 4C00A 3SI5A 2BVQB 2BNRE 4XTRC 3ZW3A 4JFFE 4OIIH 3VTUA 3CFEA 3HG4A 1BXVA 2VR8A 3FFDA 3BDXA 1I7ZA 3ZUNC 3V62A 5L88L 3MBEA 2D0FA 4NN6C 2W54A 1NPUA 4MGZE 1BIIA 3FU3A 4ATGA 4MYPA 3EYFB 3HDXA 1RIUL 2HA1A 4I2XA 5IHZB 1QUPA 1TO4A 3SDCB 2WKOA 2ON8A 4DDGD 3ZU8A 1F4YH 4KK6D 3RWDA 1T21A 4OZIB 1ZOYB 4G6ML 3KLAB 3KVDD 1GPOH 1T3FB 3DO7A 3GSXB 1I7TA 4ZUWA 1UACL 1DOXA 4IIQC 1K8IB 5L9DL 1OPOA 1XT5A 2DICA 3TJHD 4B50A 3DV4B 3DBLB 3MV7D 2XS1A 2LLGA 2QSTA 3QWVA 1V3JA 4N2SA 4TPRH 4QCIA 2J8UB 2NYKA 4I85A 3QQDA 1VSCA 1FAIL 4IOFD 3MR9A 3VRJB 4FULA 2B3IA 5I6LA 5IKCB 4NLAA 2E3TA 1SOXA 1WX7A 1XGPB 3WS6C 3DTXB 3HVNA 5I1KL 3IT4B 1UT2A 3CH1A 2I9TB 2XIDA 4XBMA 1ZSHA 1P9DU 4IW4C 5D1XB 3ZX1A 2E7CA 1P5UA 1SLUA 2FATL 2KHAA 4TLKA 3TA3D 3VG9B 1CF8L 1T5XB 4K94H 5DLMH 5HI5D 1FXIA 4W9KA 3G9VA 2INNE 4EQFA 4R5VA 1KOAA 4AG4L 3H6JA 2GTWB 2EICA 3MLSH 4FXKA 3NCJL 2QKIB 2EJ1A 1JK9B 2VSMB 1IGJA 2X44D 2JX5A 5FIOA 3V0HA 2WXGA 4E41D 5AZGA 3WA0A 2YKKA 3VSVA 3L9YA 3IDGB 1CVSC 3KJ4C 4LLVB 2WXQA 4TSCL 1ZIAA 4FXGC 2OEVA 4BKLB 5CEYB 3HXEA 4W6XB 2Y5PA 3V4PL 2W3SA 3OAZK 4WRLA 2LU5A 4Y1AA 3A4AA 3NP4A 5IMOB 3D0VA 1WF5A 4D10C 1HL4A 2ZKHL 3AITA 5AZ2H 5JNYB 4OV6F 2XGOA 4FKEA 4PJBA 2H6PA 3EYSL 2I9LB 1QX1A 5GS2H 2XFXA 4LNGA 1MJJA 3UZEC 4BBWA 5IQ7H 2CM5A 2V17L 2YGPA 2J52A 1F3JB 4L9LA 3WUWG 5KYWB 1VFUA 5LNGA 3BIID 4DHJD 2I38A 3L9RA 5EWIH 1WQVT 3F12B 3RO2A 5FO9B 5BO1H 1EGJH 1TN6A 5L2JA 1IQDB 2WPGA 4FFWC 5LXVA 5F72S 2LGXA 1PU0A 1B3IA 4AYFB 1GSMA 2DDQL 4HHAB 2YD4A 2D7PA 1JRPA 1ET6A 4I9EA 1ZPLA 4K15A 1SE3A 3NABH 2B1AH 4Y19A 4WW2F 4YDVB 1N5AA 3PGCA 4GAJH 3UAFA 4MJ6B 4ZMZA 1QBLL 1FNGB 3WKMH 3SNXA 5FO7A 3DRTA 2LE9A 3EGDB 5M94B 4URTB 4OFPA 4UQ9A 3QH3A 4L4VB 2WXKA 1ZA3B 3RILA 5IW3A 3Q2NA 4Z8FL 4DBGA 2X2HA 1BLXB 4KKLC 1TS2A 2P5ED 2HKFL 1P7HL 1KIRB 4XCCH 4Z7IA 1BQ5A 2IANE 3F8UB 2E27H 3TBLD 4KK9D 1BLNB 2CG9X 3FZUD 3LV3B 4APOA 2AW2A 3TBCA 4FFVD 5IESH 1OM9A 4YO0A 3IV0A 3QCUH 4ZFFB 1QPPA 2QPFA 1ZHNA 2ZX7A 2R0LL 4W81A 3VWKA 3W11C 5DC9B 2OYKA 1VA9A 5GGSY 1PEWA 1VERA 2F8YA 1S9VA 3PWPD 3L2MA 4I0KA 4XR8C 4NT6B 5EE1A 1E8ZA 1PAQA 3ZDXB 4NKOB 2IBBA 1JZ3A 4R4ND 4N3BA 3CFCH 1KJ2A 4K5OA 2BK8A 1XCTL 5ID1B 5GS1B 1D2PA 4MMYA 3LIZH 2OTUA 1W8NA 2EKJA 2HH0L 4NN5C 1JERA 1BX2A 4XVTL 2AK1L 1BG1A 3ARDB 1I1AA 4MRUA 3N04A 4LLQB 2ICCA 5KBNC 4F8OA 3LN5A 2K78A 2Q10A 1ES0A 5LBVA 5ES4B 2R56L 5T1KA 2OV8A 1HYSC 1JTOA 3CSYA 3WYRA 4Q89A 1GCYA 3EOBB 3MPCA 4DP1X 5JOFA 1C5BL 1V9JA 2KH2B 2OX5B 5CFHA 3TIXA 5BS0E 3QJHB 5AVQB 3ZVVA 4ZQKA 4TULH 4JHWH 4OGQC 2NY4C 3CNKA 1XFPA 3GXTA 4FQIL 5D7JB 1PUTA 4PLNC 4HLZH 4BK4A 1IBGH 4HIJB 4C56E 1M3IA 1VGKA 2IGFL 2YLHA 3CIAA 1EDQA 4MAUH 4YC2B 4YPJA 2AQ3B 2KATA 2E7LC 2IPKB 1A6PA 4ME2A 3TX4A 3JW0X 4WWKC 4G3XB 2GAZB 2XETA 2Z31D 3G5YB 4IRZL 4EIUA 3QC8B 4OLXL 3HHSA 2QVIA 3PY9A 1ELWA 1NCAH 1UM4L 3BH9B 3QRGH 4JEHA 1GAFH 4GQ9L 3RNKA 3ZZQA 2KANA 3V6FA 2ZKMX 4MNQA 1JXFA 1DQKA 3TG4A 4IRSB 4OI7A 2IWFA 3FQRB 4F7TB 4QRPE 1GJIA 1HEZB 1SHMA 3H85A 3EYOB 4RNAA 3VXMD 1IM3B 1CDHA 5ICXB 1P3QU 5BV0A 1Q72L 4C8XA 3B08A 3ZQ9A 5HYSB 1TFPA 3CVCA 2HWZL 3FUHA 4I2XE 4UOQA 4CC4C 2AJAA 2ZIDA 4Y5XA 5JMND 1P1ZA 1SVZA 2V9QA 3HYMB 4ZMTA 3BLKA 5ANHA 3WO4B 4PJDB 5MENE 1KWGA 1QF6A 1E4JA 4II3B 4FLBA 1F4XH 1H5BA 2FBWB 3LEYL 1SXCA 4MNHA 4C83A 2VM3A 3B95A 1MHCB 2BSTB 4LP8A 1B4LA 4OFYD 2JIXA 2VUYA 5TK2A 4FGMA 1QLEB 2IDFA 5I8EA 2LJ5A 3QPXL 3FNKA 4UIKL 5LWYL 2OW6A 4AKOA 5D4IA 3SBPA 5DK3A 1ZT1B 3QDJA 2V9RA 5B3SB 3PLUA 1N59A 2OOEA 1CICC 4L0YA 1TIFA 2LVQA 5AOKA 4OCXL 2A7BA 4H7YA 1GGIH 2WBXA 2Z34A 2ADYA 4OQ1A 3FH5A 4V33A 2PW2B 4Z7OE 3PYCA 1KT1A 3MA9L 3ULVE 1Z6JT 2H5UA 1JN6B 1WE6A 2LI5A 5D2NB 4NHUA 3STZA 1M7DB 2VDRH 1OQYA 2FX7H 3VMPA 5IGXL 4XE5B 3WFBL 5BS0B 1TCMA 5HQ8A 3HC0A 4WFED 2JFCA 4FG0A 3MJ5A 2B9AA 1AD0B 1QR4A 2BVOA 4U2ZA 3CLWA 2QSDA 4W9LC 3V9CA 4WJOA 3QJSB 1D4BA 3ABGA 1X9RA 5I0XA 4DETA 3HZMA 4RETB 5J3HD 1MI5B 3SQRA 5ARGA 1DEEB 1SEBA 2YRZA 3NQPA 4UWQB 4DKEH 1EEZA 1H6UA 4O2EB 4OLUL 3RDTD 4HF5L 3B3BA 1D7DA 2AABH 3BZDA 1N61A 3MZGB 2EEFA 2DQIH 2LGNA 5E9DB 1XGYL 3IEGA 2VGXA 4NNPH 5IM7B 1F6LL 1F8TH 1HAWA 3MRKB 1TT5B 1S8DA 3RRUA 1JWSB 3EJRA 1UVQB 3JV0A 1G87A 5ITZF 3DX4A 4ZUVA 2M2DA 1CLOL 2LT9A 1RK7A 5IP4D 2QPSA 4MDRA 1OAZL 2YD2A 1SGHA 4BQ9A 1Q1PA 4JFQB 3KPQB 4F58H 1YLBB 3MRRB 3ZTDC 4JFPB 1PY0A 2NY6B 4OW6A 4TQEL 2R2HA 2UWEA 4HX1A 4LESA 4HFWA 1M7UA 5JW4M 4HLZG 1F58H 4MD5B 2KAJA 5FKPB 3U4EB 4UQ2B 3MRIB 4RQQB 5PCYA 5JPMC 4S10A 3LNFA 4N90E 4Z0BH 1UXSB 3NB2A 3VB8A 5EEZA 1TR4A 1TR7A 2A6JB 2YEQA 4AITA 1T04B 3PAYA 3GS4A 4M61B 4K7WA 1DUYB 3IGAA 2PPFA 1N4XH 3WE6A 3M62B 1LYQA 5E1AA 3LSOA 4Z95L 4AENA 1WXQA 3MLWL 2EKIA 1IL1B 2FD6L 3AMKA 3MV8D 3WXVH 3B5TA 4UDTA 2INPE 3CF6E 4YVUA 4DI4A 3K5SA 4J4PD 3TZVD 3MUHL 3PGEA 3KPSD 4W1TA 3R06B 3T5WA 4Z7OB 5AAWA 1OQOA 5C09B 3S8FB 2WXRA 1IFGA 1I53A 1BCIA 5HDLA 4Z7UF 4BOSC 3MLRH 5FK9A 5D2MC 3DYOA 3RA7H 3RKPA 2FSEB 2FQFA 4L1HA 2PWEA 2NPLX 5HPMA 1XR9A 4KROC 3UTOA 3KLSX 4PJIF 1CJEA 1YPZE 3DVNA 3FN0L 3IETB 1VADB 3ZYJA 4N0CD 3V6OA 2D3GA 4G24A 4R2GD 1AZCA 1ETZB 5L2KE 2AEPH 2ZSWA 3T1WA 3OZ9L 1MIMH 3NQKA 1UYWH 1R4NB 43C9B 2C5LC 1A6TA 1UGNA 1RZ4A 2HVJB 5IEHA 2L3BA 2MPAH 5KG9A 4OUUA 2BKRB 4FQXD 5E4AA 4XRCA 1HHJA 3S5YA 1L9NA 3HXDA 2ZPYA 3O0LA 5KVMC 1FO0L 5I6MA 1ASPA 3C2SA 4KRNA 1EGJA 4ZUSB 4DP0X 5ADPL 2H1PL 1Z2MA 3BAEL 2Y1ZA 3GBEA 1GOZA 4IRJA 4PSRA 4Z7VF 3WFEL 3MO1A 4OZGA 2A6DB 3ME0B 5DHVH 3K3QA 4AQ8A 2VLLB 1JZ2A 2WDRB 3DSFL 2C7UB 4LOFA 4X99A 25C8L 3WEBA 1CFBA 2LRWA 1VZ6A 4FC3E 2WQYB 2K8HA 1NA0A 1YA0A 1FHNA 1F18A 2ZXEB 5I8OL 1C16A 4QHUA 4AMKL 4C54A 3PAZA 4Z7WF 2X2JA 1SMOA 2FX9H 1IAKB 4MNQE 5LFAA 2Q8AH 2XPYA 1M6OA 5EFIB 4RMVA 3OJ3A 5ANLA 4YUEH 1CL7H 4M5SA 4A37A 3CWGA 5AD0A 5J6HB 3DHIC 3CHQA 3FUJA 3CZEA 1BZ9A 2K70A 3TWXA 5SX4I 3GEWB 2IOSA 5DMJB 5ISZA 1D5ZC 1VZGA 5DFWH 4G1EB 4Z7NF 3HUJB 1JRHI 4TNEA 4N1CA 3JUIA 3L3IA 3FZUC 3KEHA 4QGTA 2DMCA 3QFDA 4FKHA 3UTTE 2YPKA 3CU7A 3V4VH 3V5HA 4D3CH 1RK0B 5IQNA 1YPZB 1T1YA 4PWIA 4ERSL 2DQFA 3Q7JA 4LOVA 1MLBB 4O5LH 4B9JA 1EVUA 5L7XH 2FBOJ 3S2CA 2MX2A 1JS4A 2AEQH 3GB1A 4JDTH 5PAZA 5L2KB 3UQAA 5E1IA 2OTWA 2Q0ZX 2X6MA 1XF3A 3ZYKA 3VFPA 3LIZA 4N68A 2GITA 4A2EA 4XCNB 3F7YB 3TIEB 1DQQB 1Z7JA 2IJ0A 3AU1B 4W9CC 5IFAL 3S8GB 3GSOB 1OAQH 2OMBA 4F8QA 2R17C 2MQGA 1PD6A 3WFCL 4DX2A 1RPQA 2XOTA 2JE8A 3BWUC 5I24A 3B1LX 2CHZA 4OZHF 5AFAA 5IVXB 2R8SH 1TETL 2O61B 4PGCA 3CVNA 3AT9A 3D87B 3OMAB 2AZUA 2GB2A 3CIRB 1A6VL 1L0XA 4KGJA 2J1YA 3TL5A 1AXTL 2WYZA 3IRCA 5LDSA 4HOUA 3CQFA 5DEGB 4HIHB 4PJ5B 5CR8A 2WINB 4F9LA 1DJSA 4CADB 3KBHE 1SHXA 1UELA 4Z3TA 3I75A 2EC9U 3GMRB 1O75A 2QQLH 3R9MA 1HKFA 2GYSA 2VTFA 4I1MA 3WTSA 2Z8LA 1PL3A 4NNYB 2K7PA 3LN9A 4R83A 3T2QA 1MNNA 1T0NB 3N42B 5DWUH 4K7PH 1BFTA 1ZP0B 4M00A 4HS8H 4HWUA 3CC5A 4HOTA 2HJLB 1JGEB 4ESKA 3RFZA 2A74C 3NN8B 2F0CA 2X41A 2GIMA 4LO9A 4CILA 4UV4L 2AWTA 2R0ZH 2P49B 1JTTA 4MRBA 1NMAL 1G6JA 2FWSA 3GJEB 4G6KL 3HS9A 1QAWA 1B3JA 1HXMA 1VDVA 4G6JL 2XWTB 2A77L 2VOTA 1D5XB 1MCSA 1Y6IA 1L4DB 3UTTB 3UROR 1K52A 5T1LB 1W0VA 5J18A 4QTHA 4H8UA 4XN1A 4RBPK 1QWNA 2LAGB 3MUGA 4XNBA 3HBPA 4ODHL 4DNLA 4N2BA 2BCKA 1ANUA 3P3SA 3I3TB 4RGMB 4Z5RA 2WM9A 5EO1B 2B5IB 2Y22A 4P3DB 2EXWD 4RAVB 3PL6B 4PJCA 5AG9A 1FT2A 3ZIMA 2KQSA 3Q5YA 3G6JF 4AV7A 1KLGA 4FQQA 3NGBB 4P3CH 4NGHH 1JPFB 4PRBA 5CJXA 3EYVB 2EYRA 2AXJA 4O00A 4ODUB 4P2RA 3S2AA 1A2YA 1WVZA 2Y1AA 2JIXD 3MCG1 5HYJA 2Y4UA 2BYTA 4ACKA 2MBBB 1E9OB 2IDCA 1U92A 1EJOH 3A6BH 3BVXA 5BQDA 3L3KB 4X9HA 1FH5L 1CO1A 2P42B 2JQRB 1S9WA 4Q4EA 3VGFA 3P3UA 4NSKB 4RDBA 4PP2A 3VQ2C 4KGTA 1UD2A 2VLKB 3II3A 3E30A 2FL5A 2BTEA 1JHLH 5AOZA 3THMH 3VXTB 5JHDD 4A04A 4OCYH 4FQJL 4YFEA 3PRMB 4P4RB 2OZ4H 4I6EA 2YAEA 3V6OE 4AXWB 4H26B 3D39A 4FLRA 5F3HB 1SQMA 4YX2L 1S7SA 4EDXB 5CKGA 3ZDTA 3IJSA 5F6HJ 5CLXA 2Q7AA 2QMKA 3CZUB 2R4RL 5HHNB 4QRRA 5J3HC 2XV3A 1WG3A 4BGDA 1CGTA 1FRGL 2ZW0A 3NSXA 2CR5A 3RWFA 3MHSD 1SEBD 3GGWA 2R2QA 3V2XA 4M7LT 1F5WA 2HT2D 2LHAA 4KQ4L 3HI1A 5TPWL 2D2QA 4GH7B 4E9WA 3AG4E 3FTYA 1ZVYA 3PQYD 1C1YB 1V86A 4ANXA 4LLDA 3UPRA 1F11B 4GTQA 2NRDA 1N10A 1DVPA 3NK4A 4X7SL 5K93A 3UTQB 1P1VA 4NC1C 1QSFD 2WXFA 4R97B 1N2RB 3L4WA 2JXMA 4P5KB 5E2TL 2P8MA 4MAYD 4R4BA 2DLFH 4N2CA 5CBEB 2G9HD 1FBIH 1TPXB 3VRIA 2VDQL 3WHE1 1B9ZA 3R9AB 2IDYA 4NPNA 5IB3B 2NY2B 5C0RH 1CLZH 4Y0GA 3BMVA 4APFA 1NGZA 2BHFA 3QUZC 4GLRI 3SE3A 1T20A 5LG6A 4MGIE 4YIQA 5GS0C 1AKJA 1BAFH 3LCYA 5TF1H 1J5OH 1RFDL 5KJRL 1TQBC 5I19H 4X98A 2DTML 3VU2A 3CLJA 1F0LA 1W72L 2RCSH 2HG0A 4FYTA 5BQ7A 1IKNC 1NC2B 4QLRA 5GGSB 2R0WH 4C4KO 4FAAB 1VCBA 1WJUA 1OTSC 1CFNB 4JHVA 3EOTL 4J7WA 2LQRA 1I85C 4P2QD 4J4PC 1HL9A 3SE6A 3SZKC 4XHJD 5IW6A 1K2DB 2HFEB 4NC2B 3GHEH 3ARTA 2MJEA 1CF1A 4O2CA 4XPFL 5C0FB 5AYUL 3ULUD 2ZSVA 1YDPB 1TLKA 1PGXA 5AJDA 4Q6KA 2ZUQB 1DR9A 2DAJA 4XAWH 3F7VA 4HK3N 4IJ3C 1U6AL 1P7BA 2C9QA 2XWJB 2ROYA 4HDIB 4X83A 3KBFA 1VRSA 1S70B 1GC1L 1QLFB 3NSCA 1Y56A 2CGZA 1YMMA 3CBKB 5ENOD 2ATKB 1FT1A 2EUXA 3UJTH 2A6KB 3SJVA 3ZU7B 3G5ZB 1ZB1A 2MIZA 4ZX6A 4U8HA 1R0AH 3B7TA 12E8H 1HKLH 2OL3H 4L1LA 1ONQB 1WZMA 3BEVB 2P9KG 1G9HA 2P45B 3DGDA 3KW7A 5H94A 3ARBD 4C4KT 2NXYD 3Q44A 4C4BA 3V31A 5BV7C 1JDAA 3U30A 4ZO6A 2ZXWB 4RESB 1P4LB 3BZ4B 4R84A 3QG7H 3HXBA 3U0TA 2BF0X 2CNYA 2GJRA 4LCIL 4M7ZC 5EUKB 2JK5A 4RMWA 2NSQA 3EJSA 4GQRA 5DHVA 1FZOA 4JREC 5G5HA 3AADB 2DN7A 2XTLA 3LDZE 2CO6A 1OGTA 3TNMA 5D1QC 2QY7A 4MGYE 1UFUA 3VD4A 2Z1KA 5J12B 4KKCC 2ZE0A 2LUMA 4GRMB 4IRJD 2XZZA 3X14A 1NCCL 1KCUH 2C3XA 4IKKA 3NCEB 4NQCB 4S11A 4ZMLA 3X13B 4GNKB 3AQYA 4WNFA 2OPCA 2K8CA 1JXDA 4HQQL 3KGSA 3BSHA 4IIQA 3Q8CA 2ZOOA 4ORGA 4U8VD 2XWBA 3EO1A 2ARWA 3OKDA 1IEBA 5IY5B 5FR6A 3W0WE 4RAUB 3TYFB 3U9PH 3GBDA 5DJ8A 3P2BA 4FN2A 5BUPA 3GHPA 1PSKL 1S7WB 2R69H 1TLMA 1R5VA 1HSAA 4D0CB 1X5XA 5F8RC 4I8DA 2XKSA 2ZEQA 3L5XL 5D6DC 2D03H 1X5LA 3KYOA 4M4RB 1AOHA 1EO5A 2AV1B 1J5HA 1HXKA 3V4VA 3TUOA 2HKHL 3WNKA 4E0RA 2Z59B 2ZW1A 5D4HA 4S0RA 2OSLB 3K0YA 1RUAL 3GF8A 3QEUB 2B4CL 1MAMH 1KCRH 3ETTA 4G9FD 5I5JA 3WFZA 3WEMA 4F57H 4Z3IA 4Z76A 4MZ3A 4P46B 3BRDA 1OFFA 3OSKA 4ZMVA 1UOKA 6TAAA 2PW1B 3AAZA 5JIIA 5TR5A 2IDTA 2IAMA 4FXGA 4N22A 1NLBL 4Q6IA 4GSDH 3O4LD 1RU9H 1A6AA 3UP1A 2BHYA 2YIHA 3T4AA 2V2WA 2BS2B 4UB0H 1YN7A 3P42A 3LPZA 3FK3A 5BRPA 3CXHK 3MNWA 5FINA 1OWNA 2NCNA 1E8YA 4LCCC 1L7TH 5C0GA 4XNQB 4ODXB 3ABME 4HBDA 5T1MB 3HI5H 4YXKL 3I9GH 1TVBA 2E47A 2IADB 2VDKL 3GKWH 4OIFA 4DP2X 1AQMA 2PIAA 1F9JA 5D96C 5KJKA 2CO7B 2P28B 3OKOA 3CHPA 1HHIA 3LS5L 5E2VH 4L8BB 4J6RL 5MHSE 2QHRH 1JNNH 1P53A 4PGJA 3CMMB 4TVPD 3NA9L 2Y5TB 4PIRF 1VGEL 2CK0L 3V7AG 3DBRI 3L45A 4N28A 4Y6CA 2BVPA 4X9FA 4DGYL 1MHQA 2FTAA 4YAQB 3MHZA 3U1SH 3L4CA 2CFZA 1BM3H 1TNOA 2CGRL 1A7OL 4HJGA 4U1NA 5E6ZA 3SO8A 3H56A 2FI7A 4OAUC 3FW6A 5J56B 5IQLA 4S1RL 4M1GL 2DD8H 1DQMH 4HV8B 2NQCA 1PZBA 3AS0A 5TDNB 2Z8WC 1TJIL 1I42A 1OWOA 4IYPA 2F53D 3QW9A 4CU7A 3UX4A 5J11C 3QEQE 1IAIL 3ARGC 3HW7A 2BCMA 2J0JA 1DSYA 1SJMA 4L3ED 4LQ1A 3QOUA 1HESA 2OP4L 4XX5A 3F62A 4LRIC 4KVNL 2ERJB 5C2YA 4NB7A 3ZLQC 1JPSH 2X4PA 1PLGH 5BRZA 4OLZH 4BFOA 3IU4H 3QPQC 2WNWA 4WW2C 4GG8B 2P9UG 3QFJB 4N0YL 2P3YA 5TQ2L 5I18H 4XP5L 2BC4A 1MCLA 1IC7H 2JCCB 5AL8A 4X80H 4BKTC 5CFAA 2B08A 3E8UL 5GRZA 2NXZC 5KCMA 3L3JB 3LQZA 1BJMA 4NIKB 4B9KC 2UU7A 1YYHA 2P9PG 3NH7L 4ETQA 2H26B 2WLMA 4QOKA 2IG2H 3D3VB 3L4XA 3OHXB 1CGWA 1KLGD 2GW1A 1FL5A 2QVFB 5CZVL 3B9VA 3BQVA 2GHZA 3FUMA 3T0EB 5HYJD 4HPYL 4G82A 5SWQB 1I1YB 2VDNH 3KPNB 2ZT9C 4RMTA 5I6OA 3IXTB 3PJNA 3G7TA 2DLEA 3HBQA 3PCYA 4LDCA 4XMKH 5A6LA 3Q3FA 3SPJA 1UD5A 3C87A 5A2FA 3LRGA 4KT6B 3AUVA 1FWXA 4JX0A 4DK6A 1WRFA 4OJFL 3POCA 3BYTB 3CFBB 3E2HC 4FQ1L 5C07D 4E9RA 3NAAL 4WSKA 3D0LA 5I15H 1TJFA 2X2UA 2ZYIA 2CO4A 4ADGA 3SJVE 3EGXB 2I5YL 1FRRA 1NUGA 4C80A 2GW5A 2BNQB 4E42B 3D2UD 3C5ZD 4X4ZA 5GGTL 3LS8A 5DO2C 5MEPB 3UYRL 4PJ8A 2E7LA 1MVYA 2YR3A 5DS8B 1IBFA 3SFXA 2MMXA 1IXVA 4CGUB 1YRKA 4JB9L 4RA3A 1JHKL 4GO8A 3VA6A 2HG5B 4UAOB 4TV3A 4CT4A 4L4TA 2VXQL 3ARUA 3OXGA 1U95A 3P0VH 3SQOL 9CGTA 4QD2E 4OF0A 3T9LA 1J87A 1JRHH 3G9AB 3PE3A 1IQWH 3HG0D 4MBGA 1HOCB 2W95A 4NRYB 1FCCC 3U2SC 4OQTH 2O2VA 1FNVA 3QEQB 1HDMB 2UXFA 2R9HD 2APTA 2WVIA 4N0UA 3T77A 4H44C 4GW1B 4JZJB 4K2UL 4HXDA 1KCBA 4A8XC 4X8CA 3JYBA 5HI1A 4ZUTB 2CRZA 3NVQA 3ETBF 4U3SA 3F7LA 1JXJA 2JABA 1KUMA 2BRRH 2UZXB 3HRZC 2EDHA 4FFYL 4UNIA 5CEXA 3GRGA 1U8HB 1JRUA 1BBJA 1QWHA 1VFOA 2ZPKH 3MV11 2F0YA 4M6ML 2XWRA 1BOGA 2DBLH 3CDYA 4CEMA 2NUPA 1AGDB 2EVIA 4K3JL 3GMMA 4BD4A 2KCVA 4TL5A 1L3WA 1E0OB 4X7FC 1TNUA 4LAQH 3ZYOA 2X40A 3R4RA 5TE4H 3RD2A 4S0TD 3PVLA 5DD1H 4DGIL 1JWAD 1CICA 3QC1A 1DQLH 1X4XA 1K51A 3H7PB 4JA9A 3FO2B 4K71B 1WAAF 1MJUH 3O2WH 4H40A 2Q7YB 2VAJA 4UT9L 2BVTA 4LXFA 1RJLB 4XHJC 4MCNA 3RWIB 4CW1A 4L8SB 2G3QB 1IFHL 2DWEA 3U66A 4K4KA 3QR0A 3RUIB 1SFDA 4P2CG 2NY0B 3MA7B 3C60B 5TJWK 3FPXA 1S7UB 4WJ5A 2X70B 2XZTG 3STLA 1C8PA 1FXTB 1U91B 4ZFGH 5CCKH 1N0LA 1YNTE 4HNAD 1SJVA 4H8QA 4LCWA 3IVKB 3VDZA 2XQ0A 3UADA 1XF2A 1QNFA 4LLWA 1R4XA 4G8AC 2XCBA 3E8VA 2CBTA 5C8JB 2GEQA 1K3ZD 1WIAA 5D5MA 4C7YA 4I89A 2NOYA 2NUTB 4F7MA 4XC2A 1FLRL 2Q7NA 2WDVB 1KV3A 4HWBH 3SYAA 2G3XA 4HMCA 3ULSA 1XR8B 4ECNA 2Z91B 1DVUA 4C48B 1XF5B 5DEFB 4QWWD 3U36A 3RNBC 3TCAA 5T33H 4R9HA 1J0JA 5IUCA 1KZYA 2PYED 1E4XL 1GB1A 2GC4C 3AW5A 3MREA 3H54A 2V7NA 4EI6A 4L8CB 2VZUA 5KANI 4EN3D 1G7LA 2BYFA 1GHFL 4AV5A 3N9YC 1JUQA 1NH6A 2VTBA 1DJZA 1H3PL 5D7LE 3TN0A 4DPAX 3FCTA 4PJEB 3WJMB 5I4DA 5ERWA 5JJ6A 3H8NA 5TGBB 5EZOH 1ZE3D 3QA8A 4JVUA 5EU6B 3JTTA 4R3SA 4JM2A 3KYDD 4P2OB 5JPMA 1R3HA 4NQDE 3RUGF 3F84A 2HUEA 4WENB 1CVRA 3VACA 3WJLC 1RL1A 1OY3B 3JV5A 4WDIA 5JIMA 1WRIA 2V0PA 3MGTA 4HJGE 1MI0A 4OZFB 4PRHE 3P4OA 4LPXA 4JN1L 2MCAA 1D6VH 1F56A 4PWHA 3DOWA 1YJDH 1CD1A 3MNVA 5AARA 2R69A 5GS0H 1WJNA 4JFOA 3VRLE 4L18A 1NBVL 3CH8A 1C1EH 4PVNA 1YQBA 2W92A 4WEBL 4ODTL 4OKDA 4O4YH 3QUYA 2P5WE 4QYOB 3DYMA 2YGNA 2X6UA 3VFTB 4DW2H 2BY0A 3K8LA 4U6TA 4U1GC 1M94A 3N3KB 3ROOA 2KLRA 5TDPA 4D2NA 3RX8A 1HL8A 5BRZE 4I48B 5ID0A 2O6EA 4I17A 3GDCA 3ARYA 3CFNA 1MREL 3DC0A 1UZGA 4ADJA 5I1CH 1G84A 2QC8A 3RL2A 2EXYD 3GBMH 4BUHA 1YNTB 2R7EA 1NEZG 2NY7H 4A6YH 1PFOA 3J9CA 1XF4B 2Y0SA 4QTIH 4U1KB 4V2CB 3MYZA 4BQCA 1E3FA 2I2YA 2WB7A 4PJHA 1BD2D 1J1OL 2EEDA 1QLBB 3KEAA 4YQXL 2YPLE 5JHLH 3D0AA 1S9KC 3B2MA 3RK6A 4A3TA 2BKKB 2FHBA 4LDOB 3ZDZF 3ZL1A 1QOBA 3GDBA 4GW5A 4AUUA 5FQ8A 1EQWA 1YOVB 4KY1H 4YVNA 2VC2B 2V5MA 4LVNB 5DPSA 1KY7A 1FVHA 1JSYA 3PWLA 3ZE0F 4BZ1L 3BFOA 2JQMA 4H8VA 4XVSH 4LL1A 5JOPD 2H2PD 2DYPD 1K8DA 3SKJH 3WCYA 2FJFA 4PYZA 1WAPA 2LU7A 8FABB 3PS6A 5I1EH 2NMQA 2I07B 2W1NA 3MLXL 2WLIA 4HBCH 4IK7A 4PJGE 3TEXA 2AK4A 3HG1B 1U8OA 4BEPA 4I88A 3CUPB 4IM0A 3C98A 3PUUA 3A1QA 4GLRH 5EPMA 2JQAA 5CAYB 1GXEA 4JX1C 4NQDB 3O6ML 4XZUA 2ADFH 1J5DA 2AMGA 2XC8A 3UPAA 1D6EA 1JNLL 5DK0A 4I5BA 1H3XA 4PRHB 2FGWL 4PBDA 1OWMA 1V7NH 4AEHL 5BT1A 1BEXA 1OSPH 1LWHA 2DB8A 2SEBA 4NENB 2CDGB 3RI5K 4QHLA 5BVJA 2LXAA 5FYJU 1T1WA 4DGVL 3H7BB 2XTJC 2NYJA 1D5IH 2QQNH 3OKMB 1YEIH 1TZHB 3QUMB 3WNJA 1MJ8L 1HQRD 3O13A 2WXJA 1NGQH 3FTWA 3GHBH 3NRPA 5IFJB 1GGTA 4Y16B 1I75A 3VYNA 5I5IA 3DIFA 5CD5D 2GBUA 2ETWA 4B0EA 2UXGA 4JFSA 4MLPA 2YKLL 4GFXA 4JY4A 1IKOP 3B3IB 4Y4KD 4M62L 5JPNA 1YHPA 4WUUE 1EUUA 4PGBB 2VZSA 3H6AA 1JBJA 1IPGA 1BXTA 5KSBF 3CR3A 4GTMA 2L7QA 1FCHA 1WIOA 3B5GA 4HJSA 5CECB 2FX8L 4XPHH 4U6YA 1NDMB 1QRND 1U3HC 1Q9OA 3NPZB 2XG4A 4YK4C 3HE6C 4BWRA 2EH7H 2INCC 1KACB 3FFCE 4UM8A 4XVOA 3SDYH 4NN5B 3NACH 1R4MI 1DE4B 4JCMA 3UTSE 2QMJA 4S0SD 1FFNB 1C78A 2JUOA 3K6OA 3F65A 1U8IA 1ZJAA 4PUCA 4KX7A 4TXRA 4Q6YA 1U2YA 4W9CA 3WL9A 1B88A 3BSGA 2CBQA 3PPEA 3RIKA 2K9UA 3V10A 2YA1A 4ETYA 3OQ3B 5IQOA 3UGUA 2B1HL 5HYIA 1GJWA 3EG9B 3LTVA 1WTLA 4GI8A 3V0EA 3O41B 5C0IA 2JZPA 2IFGA 4G8FB 3WLBA 4PJGB 3IYLW 5FUOL 4XNMA 1KZQA 1SDDA 2OQJA 4HS3A 4IOIA 4LCWE 3JQ1A 4N9GB 3V7AE 3BGFB 2GY7B 1VFBA 3IDMA 1KGUA 3ES6B 5E6UB 2XNAA 4HS6A 2FCSA 1LO5B 3ELQA 2LHEA 1YEHL 3CN3A 1ZKHA 2RSUA 3FQTB 2APWA 5D5ME 4I9WD 2WO2B 3ZT5A 5JW5A 4WFGD 3JXIA 5FS5A 1IC5H 1TYRA 3HZYB 1KPUA 4I18C 3EFDH 4MD4A 3VWJB 1T0YA 3NTCL 2LZ6A 4L1BA 2ZXBA 4EOWL 1CDIA 2AZAA 2Q2EB 2WJ7A 4EI5B 3WEAA 1CU4H 3RVWD 2RFMA 3OC8A 4PJ8D 2EDOA 2D3VA 3DUUB 2X1OA 3T3PE 3K9OB 3RWGA 5I73C 2BOCA 2P46B 4FTDA 1AAJA 4JN2A 4YZFE 2G5BA 2H3XC 4DOHE 2ONQA 3CFJB 3T9WA 3L7FA 2G45B 4R8WL 8PAZA 5J0BA 5L88H 2YHGA 3MKKA 2GRQB 1R7SA 3DPBA 2NNFA 1R5IA 2R9HC 2X1PA 4NHCL 4WUUB 1E7VA 1RIUH 1DVFD 3T8XB 1DVXA 2GSIA 3EYQC 5F71A 2CXGA 4F24A 4BFKA 1NEZA 4RGOL 4LEOB 2PYFA 4ZFOA 4P5MB 4N2HA 4YSYB 5E8OB 4OVUA 2K45A 2D2CC 3B7YA 4HZAA 2XKNB 1UOLA 4G6MH 3OXRB 2N0SB 1A5RA 2VH2A 4J3WA 3RGVD 5K9OA 3QO1B 4TQ1A 5L9DH 3HZVA 1N52A 4YDEA 2ITDB 4AOFA 3Q8AA 4FJVB 4P4KD 2P8PA 3MOBL 2ZP8A 2XRZA 2OEDA 3UTSB 5IQMA 1M71A 4MDIB 2YUXA 3V5KA 4LCVA 2IY0C 4H20H 2I69A 4BESA 2BGFA 5I8CA 1PZ3A 4R26L 4X0KB 1GTNA 3V6CB 3TPUA 2GK0A 3F05A 3Q6FB 5I1KH 1C12A 5FB8A 1VZ7A 3KD7A 4HJ1A 2IXQA 4YEEA 1OL0A 3A0OA 4OKVB 5E23A 4F93B 2FATH 1JZDC 3DMMB 4QHNA 1CF8H 3S3BB 2J88L 2CIKB 2W0FA 4C55A 2HX9A 5ARFA 4AG4H 2WB2A 5AAMC 3O45A 4JDZB 3U7ZA 5FHBL 1V6EA 4GKSB 1VENA 4XC1L 1M2VB 4JEGB 3US1A 1ACZA 1CE6A 2X4NB 5AWNL 3DIVA 2NX5E 4A1RA 5HJBA 4TVUA 2WBJD 2D5GA 2DEXX 1AYOA 2HAZA 4JY6B 4GG6E 4GOCA 4MCYA 1IMHC 3VFSA 4TSCH 5SV3A 1NLDL 5F8QC 1JV2A 5IB1B 1J1XL 1Y07A 4F8NA 3V4PH 2VQ1B 3RVTD 1WZ0A 4KJWD 3DV6A 5DPTA 3ONLA 4HWBA 2IWEA 2ZKHH 1RK1A 4IEFA 2Q5WD 3VFVA 3QAZC 2H3KA 3B7SA 3WIMA 3EYSH 5TE7L 2K3HA 3FHQA 1JALA 1EZSA 1JGUH 4XGZB 4XXDA 2V17H 1NAML 3CHOA 1O6SB 4IBWA 2DAFA 5L8KB 3S7GA 2NW3A 3BH8A 4QWWC 4DOHB 4YEFA 2B15A 2B14A 4WI0A 3UQBA 4YXLL 4G5ZL 2AK4E 2BB6A 5I1LB 3BJ91 4BA8A 1OARL 4ZW6A 2XV2A 1JMXA 4EN3C 3K2UL 3LKNB 1IGML 5J13C 3KLHD 4PHZA 1CBJA 5EO9A 2DDQH 3FFLA 5KOVC 4YMPA 2KDMA 1A7PL 1AGEB 3AWGA 4CCAA 1ZGLM 3QIJA 1BZQK 4JDVA 2MHKA 1E9QB 3TN0D 2CCVA 3ROLA 3QULA 1QBLH 5ESAB 1P69B 1YYCA 3SYCA 3E6FB 2VJ0A 3IFNL 4UU9B 1P5VA 3QUZA 4DWFA 1LEGA 4JM2D 5HHXL 2NLJA 3MV7B 3S5LG 5KJLA 4LKCA 3B0AA 1QUNB 5DWPA 3CZLA 4P23D 3ORJA 4I3SL 4S1DD 4JE3B 3FTUA 3PNWA 2NW2A 2JF5A 3EU5A 1ZY9A 2P5EE 2HKFH 5DJYA 2IZVB 1Z5LB 1TQVA 1DLFL 5D2LB 1I85A 3TA3B 2FZ3B 2VR6A 2FH6A 2W65B 3FPYA 3ZXSA 1B6DA 1G7HA 1RLWA 1SYVA 4HUXA 4XNDA 5FOBB 2VXSL 3VW3L 1NUFA 3B9KA 2IV9A 1NFIA 2BDNL 2HTLD 2OCFD 3QUHA 3QUYD 1N54A 3HVEA 3QIWD 2R0LH 4M3JA 4YHNB 5I75B 5I76B 5BV1A 3EHRA 4BFNA 4E41B 5DJ2B 3W9GA 3REWA 4A6YA 4XN2A 1E5WA 2WWZA 4GG6B 5BUGA 4GIPD 1UQSB 4TLSA 2VSOE 2Q9OA 3DBXA 1B9RA 5BNWA 3FTGA 1KYUA 1L9SA 3ZK0A 5CWSA 5JHLA 4XH2A 1BFSA 1IRAY 3ZE2E 4H2CA 1T2QL 4OJYA 1XO3A 2HH0H 1K53A 1N5YL 2OMUA 2AK1H 3K6FA 3MNZA 4XVTH 4KSLC 4GUCA 3WFDL 3GRWH 3RZWC 2HVKA 4DHJB 2R56H 4OD3L 2K4WA 4WI8A 3T2PA 2IQCA 3DHMA 1DBAL 2EYTA 4JRXA 3ZN3A 4MJIA 1LGVA 2TSSA 1C5BH 3CZNA 2DQCL 3EBAA 3UT7A 2I7OA 4PVBA 1URZA 2V2TA 1TMCB 1SM3L 3QI9C 4MXVE 4FQIH 2ATPA 3ZHLA 4GDLB 4YSPA 2X4OA 5F1NB 5D1QA 3V6ZA 3E1F1 1E2VA 1PY4A 1F90L 4NNXB 1VB9A 5IBUG 2IGFH 1R34A 5KYXB 4NZUL 1IGTB 4GTOA 1Q90A 4S1QH 1NBYB 1R6VA 1YVLA 1I4PA 4XCEA 5DVKA 1WX9A 3ZGIA 3MKRA 1J9CT 1S3KH 2CBOA 3FT2A 4IRZH 4Y2LA 3TEYA 2ZIRA 1KGIA 4OLXH 1KLFA 2XN9D 2ICEA 1UM4H 4GQ9H 5F0PB 5LXHA 4X9YA 4JWSC 2BP3A 4OGYL 5HGBA 1TDQA 3VUYA 2QDWA 3NEXA 3O3BA 5CXPA 5FLVA 2YGVA 4HUUA 4RGNC 1MHXA 4WW1B 3GLEA 4ES9A 1D5ZB 2P5EB 4YDZA 5CZKA 4BE6A 2GBMA 4CDMA 5F7LB 3V79K 3CWIA 4QT5B 2LGDA 5JA9A 3IG3A 3UXGA 4BY6A 3L4YA 4QAMB 1HEJC 3GMNB 3MRNB 1Q72H 1YEGL 3L5HA 4U1SB 5IBLC 2Y5CA 2HWZH 2FHFA 2JJSA 3WY4A 5LG1A 2FIDA 3Q9NC 5D6DA 4PB9L 1FVFA 3T1FB 4RSYA 1AN8A 2OI9B 4GLSC 5F7DA 2DQJL 4PLKC 1CFQB 4CSZA 3PWPB 2PO6A 4QRBA 1H3GA 3R0MA 4O58L 3LEYH 4PRDB 1Z9SB 1XEUA 3TBVB 1I3RA 1P4BH 5D4JA 1FNLA 3GSRA 3L3DA 5E6RB 3F6QA 2AAVA 2VN3A 5B7EA 3CVYA 3ZE2B 5AVZB 3QPXH 2ZCHL 4OFKA 4UIKH 4EFOA 2E7MA 1OD7A 5C0DB 5LWYH 4H7VA 4Y8AA 3BUYA 5MEQA 4WZ9A 1O6VA 1NZNA 2YD5A 2NT1A 4LQFL 5HRYA 1KCLA 1I1RA 4OCXH 2BYEA 1UXMA 3EHQA 4PJFE 5CBOA 4W93A 5AQ0A 4TNGA 32C2B 3C09C 1KY6A 3F2LA 1P4IL 3MA9H 3PJLA 4MJJA 4AQ7A 1XQ4A 4FMKA 5C3TA 3Q3JA 2W9LA 2Y5EA 4YJZL 1R3KA 4ZFZB 5LN4A 5CHFA 2CLZA 5EUOF 5IGXH 3WFBH 1CT8B 3DGCR 4LPYA 3B83A 1GC1C 1QTYT 4HGWA 1OQXA 3GXFA 3TO4A 5FAAA 1SZ9A 2CRIA 2FIKA 4JA7A 3NJLA 5HXMA 2YD1A 1EXUB 4UT7L 4MD0B 4U1JA 3BAJA 4J28A 3W1YA 3QT2A 2VDPL 4M5TA 3LN4A 1AHWC 4N1HB 1C5DB 2LXCA 4CYMD 3EFCA 3SQBB 3I57A 2FR4A 2DWDB 4IRUA 3S5LA 2Z31B 4OLUH 4FLOA 2VZ1A 4HF5H 3RNGC 3F6JA 3PNRB 4AGMA 3BYYA 5J6SA 1XGYH 2XQYK 1EAJA 2R1XB 3QXUA 5LGHL 1KBKA 4GAAA 1JPLA 1S46A 1L0XB 2UX7A 1J8HA 5A6CA 3L6FB 3L48A 1YIWA 4UDUA 2MTAA 3VXMB 3QJFB 4AH2B 2QHLA 3CLEL 2KCKA 3VQ1C 4J5VA 1OAZH 4JPSA 3B9AA 2MH4A 4RNRA 4BERA 4CDNA 2YFNA 4B5EA 1AQDA 4TQEH 2UUDH 1O1TA 1IV8A 3ARGA 3SDXB 4AVKA 2BY3A 3N1XC 4B94A 2W07B 2AV7A 4W4OC 2X0UA 4UINL 1DVFC 4LRIA 5ILTL 1WH0A 1ASOA 3D07A 3N91A 5AQAA 1RCYA 1EZLA 4X6FA 2VLJA 4YHLL 1J9RA 1ZA6B 2JB6B 1HL5A 2KDEB 4WAAA 4LCYB 5JTWA 2HTKD 4WW2A 3OGOE 5MP6H 1BEYL 4M02A 1ZS8B 4Q9QL 4KXZI 5EX3A 1Q2ZA 2F58L 3RY4A 4F7PA 1T7VA 1BF5A 4P4KC 3PWUB 4Z95H 1ZDVA 2LSUA 1MUJB 3MLWH 1LE5B 4B9KA 1W16A 2FD6H 4HKJB 5DQ9A 3MC9A 2XBZA 2P43B 3ZHNA 3NJHA 1FQ9C 2VDOB 1WC7A 2R1WA 3FB6A 4U1IA 4AM9A 5E95B 4ZTEA 3RNCC 1TO5A 4AQZA 2IFFL 3CE1A 5E0FA 4XMLL 5LXGL 1T5WA 2V4IB 3FWVA 2FWUA 2IY1B 1PZSA 2J2ZB 2BSBA 3R1GL 4PTTB 2B4CC 4CNIB 3AM9A 1IIIA 1P4UA 5FJYA 3DX8B 2GJ6A 4I6GA 1IAII 4PJXE 4LHUD 1G7IA 3T0BA 1H9VA 3FN0H 1WJ3A 3DOSA 3I50L 4LIQL 1PDKA 4N6QA 4EUTA 3V4PA 2W3RA 2PCFB 3VSTA 3L8QA 4QF1A 1C4AA 3OZ9H 3RDTB 1HSBA 3V8CA 3RVTC 1YCSA 2FO8A 3O6FC 1PJ9A 2WP9B 4U31A 3GXPA 3MV3B 1CE1H 5IO9A 4U1MB 4MJIE 1YN6A 3M6DA 5JXEC 1IP9A 4ZMNA 1AD9B 3J8F7 4CA4A 1OE3A 5KANG 3ZSTA 3G2UA 1OHQA 5ADPH 4MA7L 2H1PH 5LP0A 1A21A 1FCCA 1W6LA 3BAEH 5M7QA 3U2SA 3F6IA 1AMXA 3L9EA 3BUDA 4QRAA 1CFSA 5EU4B 1RJCA 2JYEA 3GOEA 1PLBA 3MBEB 2OXGB 2O72A 3DSFH 4W70A 3KLHC 3MTRA 4G1MB 3DVIA 3TBBA 5EOQL 5I8OH 1DLHB 4R7LA 3CZJA 4AMKH 3HRZA 1WYGA 1LNUA 2WK2A 1TQBB 5L83A 1CLCA 3NBNB 1R3IL 4FU3A 5LQBL 3DO7B 3N40F 4FERA 4OZIF 2FE0A 4YBLC 1VKXB 4BK5A 2I7SA 5E5UB 3BEEA 4YHIA 3Q5MA 5SWSA 3WN5C 2XK5A 4RLDA 3MV8B 1EEUA 1I3GL 2IEJA 1PYWA 5DD6A 3R0NA 4P5TD 3TZVB 1HJCA 4NO0D 4WQMA 3KPSB 2CKBB 3SDLC 2FECL 5H8DA 1EHXA 1X7QB 4HORA 3FCSA 3AE8B 2J8UF 2R23A 3P4SB 1J05A 1T22B 2NR6A 3MEKA 5J1AA 1UFGA 1BZ8A 4X5RA 5FCSH 4OM1L 2ITCB 3VFMA 3VTMA 5EZLB 1CDUA 1LFDA 5CGYD 4JBSA 4W68A 4E5XG 4GCOA 1QHPA 3BXNA 3QIWC 1QW9A 2Z35A 2DM4A 4BWUA 1IEHA 4KVPA 4KXDA 4M8QA 4IDIA 3SHSA 4R2GB 4CDGC 5E6IA 5JHAA 4FQCL 3TH2T 3UL4A 4XAKD 2Y2YA 1XGUA 1AJ7L 1JF1A 5FDYA 2KYWA 2RBLA 4PY7A 3DHGC 2IWGA 1T0MB 5IJVA 3EF4A 2GCYB 4GKNB 4CMMB 2ZWZA 5I16A 1FLTX 2YK1L 5BV7B 4KDIC 2XJLA 5IFAH 4FQXB 4M0WA 3CSFA 3GRWA 2C9WB 1TN7A 1ECZA 5HDWA 4DSYA 3WFCH 1QSZA 1TKEA 2IO0B 1F4HA 3RWEA 4F1PA 1FIQA 1JWUA 4DUWA 2X4RB 5CMYA 1MJJB 1TETH 3T2OA 1I7UA 1NC4D 3F3HA 3LAFA 4TUUA 2J21A 3D4YA 4L9LB 1A6VH 4QXGH 3P9WB 1AXTH 5IOIA 4G8IA 2WZ6A 1CFTB 4JRXD 2YARA 5F9JA 1MJ0A 4IM2A 3FTXA 5E7FA 2V8SE 5H35A 1E67A 1G6RH 3TBTA 1BYPA 4K9EL 4N5UA 5FLUA 2GOWA 3TCXA 4RF1A 1OCRE 1E5ZA 3EH3B 4IRZA 4KVMA 2KXJA 4JFWA 3GZ1A 2D3JA 1PX8A 3UO1L 4EKXA 3BG1B 4WNQA 1JZIA 4MQXD 5J6GA 5T3XD 3PGCB 4OJAA 5TFSL 1HINL 1H3VA 4KZEL 2XN9C 4MNGA 5FO7B 3DRTB 4U05A 6FABL 1KV7A 1UB5A 2VH5L 3ILQC 4IBTA 5IHUL 3TEWA 4YE4L 1V49A 1FNFA 4UV4H 4AC4A 4BSWA 3TO2A 4X50A 4XO3A 1NMAH 3MOQA 3P0GB 3T5VA 4N2EA 4PJ6A 1IQRA 1IO4C 2NTSA 1H8CA 4FJZA 4G6KH 1V7ML 1SY6H 2HFFA 4G6JH 3TEZA 5FYJH 2A77H 3WNMA 4YXHL 2KC7A 3ZJTA 2CAKA 2WO3B 2ETAA 1X7SA 3PV6A 1VACA 2W0PA 2PNDA 1AVAA 3ARQA 4HUWA 4ODHH 1WG0A 1URLA 2YEZA 4HSQA 1AZZC 1KDJA 5DA0B 5C2UB 1ACCA 1JNJA 1PDXA 3ASGA 4PREA 2R2CA 5CZRA 3IMUA 3ILPA 4XN8A 4F2MA 3CZFB 4OLYL 1CGSL 4B3VA 1YMHE 4JKWA 3DSTA 2OJEA 1S9VB 1JNHB 3EIFA 1P7KA 1TN8A 1TTGA 4KHTL 4WY7L 5AVTB 1LEIA 1UWMA 1N26A 2XN1A 4TTGA 2RG8A 3KPRA 1N12A 1NINA 3ZDXF 2VIRA 2AVPA 4JQIL 3CPUA 3NT0A 1OGAA 2KZWA 4LCCB 1ZEAL 4GUOA 4GTRA 3Q1SL 3OMNB 4NRHB 2L7RA 1FH5H 2OTUB 4N85A 2O5ZL 4PG2C 5DJCA 1BX2B 3MLTB 1WGVA 4U2YA 3QJXA 1P6WA 4U8YD 2D9QB 1IBXB 1JXGA 1P7QA 4XO8A 1QLEL 2BSEA 5JZEB 3LN5B 1WYJA 4MSWA 5JHDE 4ZI8A 5IBTL 2NSZA 3TWWA 3ULEG 2YD7A 3GRBA 4FQJH 3H42L 3VGAB 1PX3A 4Z7UA 4HC1L 1FL3A 4JHUA 4EN2A 1I4HA 2CPUA 3EUDA 3P9LB 5IJCC 2L05A 1TJXA 1ORQB 4HZ1A 2MCPL 5JOFB 3W5UB 1AG0A 4ELMA 1KBGL 4BQ6A 4YX2H 3NZHL 3LY7A 4PJIA 5CUSL 4K03A 2P8LB 3B2PA 3K72A 1KGXA 5LBGA 3TO4D 2C1OB 3SGJA 4YSRA 1OCRB 3V0JA 2R4RH 4BCYA 3UKUG 3PZ3A 1YG9A 2N1TE 3B8SA 4LSSL 4NM4L 5HKHA 1L0PA 1AC0A 3PGFL 3NJMA 3EHVA 1OCWL 1PIGA 1FRGH 4GN1A 3MRMA 3H9SE 3NJKA 5FWRA 4PWJA 4YHML 5EB9A 5EIBE 2IH1A 1G7PB 3L3HA 4TUJA 5DEZA 3BP4B 1IU1A 4TTDD 5KAQF 4LLGM 2A73A 4MFHA 1K8KG 1PAMA 2FO1A 4G6FD 2DTSA 4F37F 3UIYA 4S1SL 3TXMA 5CS7A 4ZMYA 1XSJA 2BVCA 4GBXA 2WDQB 3SDDC 3V6FB 3VD3A 4AYSA 3NF1A 5ECGA 1SE2A 1Z5HA 2IONA 4Y2DD 3UQ3A 3PQYE 3ZUCA 5CX3A 1ZPUA 1UD7A 1A4CA 1J8HD 4GU5A 1OCCB 5F89A 4RZCB 5KZCB 3VX1A 2BIHA 2E8YA 5G55A 2K7QA 3IE4A 4X7SH 4E5XA 1QSFE 1PGBA 4GPVA 1XCTB 3EBHA 3COOA 4NKDB 4ADIA 1TMQA 5DT1L 2WGNB 1J19A 3TBYA 3AE3B 3BAYA 3HCVA 1P0RA 3PHWB 3A9KB 2PWGA 3MROA 5FC9A 4CU8A 2ZTBA 2PLPA 3SOBL 5AG8A 1C5CL 4YHPB 1YMHB 4PJDF 5LLIC 1H5BB 3HE6A 5E5LA 1JWMA 3ULQA 4MNHB 1H3UA 3EDJA 4C83B 5KJRH 5KVGL 2FEDD 1Z9MA 2DTMH 4Y9EA 2JIXB 2NY5L 1W72H 1PIFA 3D69A 3TBWA 2W9NA 2FULA 5I8EB 3A9JA 3RY6C 2QEJA 3FOMA 5JYMA 4MAZA 2YD8A 1NEPA 3Q43A 3EOTH 2YN5A 1WSPA 2XENA 4M9PA 2R2LA 2GSGB 4P2QE 4PUBL 4X6CA 4YSTA 1XCQA 5A2JH 2MBOA 2R15A 3EJZD 1IBDA 2BS4B 1D9KA 4O02B 3PLYA 4NQVB 3QORC 4U6XB 5JHDB 4J27A 4H25B 2VLRA 4ICXA 3U6RB 4WK0B 4A7GA 4NZFA 3C6LC 3RIFK 5CF3A 2BVYA 3AB5A 5JA8B 1RM6C 3BC9A 2W91A 1KGYE 1IYGA 3OG6B 4EVNB 3ILEA 4XBEL 4JL0A 1GC1H 5D93B 1I4FB 3U9UB 1TVDA 5A2CA 2LAIA 2B3AA 1FL6A 3F58L 1S9YB 3JTSA 1JVLA 3CSBA 3QDHA 3NJIA 1FGVL 4CBPA 3QWOB 4ISVB 4Y88A 1JGLL 4PRNA 4XI9A 5FYKL 2C60A 1SEBB 1Q8MA 4X4YB 5I71B 1JV5A 1JCVA 1LJMA 4LSRH 1WS7A 2VWEC 4TNVF 5C08A 3F64A 2YHEA 1XXDC 3PABA 5FW7A 1F41A 1L5GB 4DLOA 3KWVA 4LDTD 3L1GA 2UWJG 4UOZA 1E10A 4LCIH 4ZFQA 1HHKA 3CK0L 3GBNL 4Z23A 3KSQA 3P4NA 4OZHA 1ZBPA 5TE6L 3OLIA 2GBAA 1A4AA 3VXRD 5IB5A 1QSFB 2DWTA 3ARFA 4K7PY 3IJ8A 2QJLA 1KELH 2G9HB 4MAYB 2EINE 1E65A 3L1OL 5CMWA 3HS0C 4CN4A 2OEWA 4F53A 4WSJA 2XPZA 2GRIA 3R3MA 1WWTA 5LDUA 1VCAA 2DZNA 4JO5A 2FNJB 4HQQH 1NI1A 3MUJA 2EIDA 3GJFK 5CEDB 3RVVD 3VI3A 3FQ2A 1H6KA 3GXIA 5I5RA 5FGBC 3SGDI 2GT9B 3HAEB 4HKBB 1RERA 1XD0A 1LEKB 1FV1A 1PKQA 1PSKH 4YE0A 4BX9A 5E1AB 4JG0L 4P2QB 3VQMA 4AENB 1SJED 2IGDA 2KLTA 3MP9A 2WAQA 3MACL 1M57B 2DIJA 4I9XA 4J3BA 4AQ1C 4PY8J 2JTYA 5ESQB 3BAKA 3L5XH 3I5PA 4BT9A 2HKHH 4Z7OF 2JLBA 5AAMA 3TPKA 1RUAH 1LMKA 3T04D 4GTVA 4JKMA 3QWQB 2DWZA 2B4CH 4RISL 1JFHA 3SBTB 1DJWA 2QT6A 4UIMB 3B8YA 5G5DA 2N7JA 4IU2A 3IJ7A 5AW8B 3KPRE 1TTNA 3SE4A 3N1FC 3WEOA 5AUMA 4O51A 1KT0A 2C7NB 1OWLA 5A2AA 3O4LE 3QG6A 2O93L 2OCJA 3ECBA 3G6JA 5E6ID 1XLOA 5DHEA 4H8WH 1KGCD 2VUOA 3ARBB 5DUML 2NXYB 1U3DA 3HNTH 1H8OA 3BSZL 3MUUA 4KKBD 4B9IA 4A2DA 1V27A 1MJ7L 2BSDA 1DSFL 4PT5A 4PGDB 4H4NA 3KPTA 2F6AA 4RIRA 4Z7UE 4QAYA 1TY2A 3UMNA 3QXDB 2XZCL 3VFWB 1LM8V 1DVQA 3DX2A 1CYWA 2VDKH 1GW0A 2L32A 1E27A 1E2WA 3GI9L 4PJIE 4LLYA 2D31B 5A16A 1RRBA 4NDMB 1G6RA 2N4IA 1EXGA 5EEVA 5DA4A 4IRJB 2O6VD 3HPLA 3PEUB 2D0GA 4J6RH 5EF1A 1XGQA 1ZVSA 2ED9A 4N58A 4HG4K 4LPTA 4UNTA 5KS9B 1YEEL 4KXZH 4HCIA 4K7FA 3NA9H 4AL8L 3OGCB 1VGEH 2CK0H 5C97A 2FUHB 5F9DC 4L8DB 4M7LL 5D0QD 3D08A 1R75A 3QDMA 3AEDB 4OZ4A 1P9MC 5I6XB 1TZGL 2ZYSA 4GIAA 1YX5B 4IWOA 2CGRH 1A7OH 1SA5A 3FRUA 2HM8A 1TKWA 5D8JL 2P2CP 4PCKA 1RUQL 4U7MA 4S1RH 1XWVA 1V8HA 4M1GH 4G9DA 1SY6A 3I6GA 2F8XC 2HMID 2AXFB 1TJIH 2F53E 4Z7VE 5ABAA 3L4PA 1HHHA 1IAIH 4WHCA 3TVMC 5GRUL 4GQZA 1LE9A 2PTVA 4CGTA 1GTFA 2X4UB 1K4CA 1XIWA 3OAUL 2JU6X 3SO3C 2E7HA 3L3IB 2WTRB 3HUJF 4KVNH 3FT3A 4L1SA 5F1OB 2BBCA 3QJQB 4KGLA 3AC0A 2C7HA 4IBYA 3NEEA 2IO3B 3WAPA 4G9FB 3L4UA 4TUMA 1CGXA 1ZV5A 2BJML 4Z7WE 2ZZPB 1EF1C 2F5BL 4N0YH 4AI7A 3GM0A 5TQ2H 4B9YA 1D3ZA 1SF0A 1T1YB 5IJBC 5JIPA 3NOCD 1UT9A 1YPZF 1BFOB 1HI6A 3WIHH 1HCFX 3LH8A 1X5MA 3O4LB 3P1MA 4GSXA 3EFFA 3ZDYB 3KWWB 3ABLE 1F2QA 3NH7H 1S1QB 2F08A 2JPHA 3PWVA 4ZRGA 3AXIA 3JVZX 2Z7UA 3VFPB 2Y6SD 4AVIA 5CZVH 2WUCL 2EXSA 4H5SA 2Y06L 4Z7NE 2VLRE 4JPIB 1O6TA 1YQVH 4HPYH 4RRPA 2AXGA 1N68A 2ADJB 3CK8A 2Y36H 4X6BA 3RZWA 4DZ8B 2CG2A 3DX9A 5AOLA 5F9WB 5KBDA 4IM3A 3MNMA 5B39A 1U8MB 5ENSD 2WMPB 2VRQA 3SBQA 4OGAD 4XI5C 2X38A 1Z66A 2MHAB 4OJFH 5IVXF 3IHYA 1JGVL 3NCYS 3QI9A 4FQ1H 1F97A 2OMZB 3NAAH 4UTCA 3H4FA 4ILGA 1U8NA 2H0PA 2ARJA 5F88A 2I5YH 4OTXL 1QTPA 2XICA 2D9CA 5GGTH 4XVUD 3UYRH 4B53A 1ILUA 5C08E 3I75B 2KMCA 4NQSB 3T6VA 4JB9H 3GI8L 1JHKH 2IQ9L 3WD5L 2X8XX 3B7RL 1OCZE 2VXQH 1HZHL 1D5MB 3SQOH 2E56A 5DK2A 4F5CA 1JCKB 4N6RA 2M8SA 4OZHE 4K3GA 3MC0A 4A39A 2DI8A 1YJ1A 2KFJA 3SHFA 2XV6B 2IDQA 3NFPB 2F53B 5EBWA 4PSPA 4GPMA 4K3DH 3VXPA 1DUZA 1NKRA 4FQHA 4JDEA 4Y2DC 3T3OA 4A63A 4ANWA 2V2XB 1A9EA 2W38A 1JPTH 4L3EB 1UEYA 1JYWA 4UWFA 2XYBA 1LTXA 5E2WL 4K2UH 3QSKB 2BSSB 2EE2A 3QQ8B 4HSCX 2Y1LE 3IAS1 2Y2WA 1HXMB 3BKYL 5D7KD 4ZMAT 1NIAA 2JI2A 2QSCL 4CKVX 1W0VB 3BVDB 2EQDA 1V3LA 4FFYH 5DVLA 5BO4B 1S7TB 3MUGB 3RYMA 2X4QA 3L3OC 3ZIYA 2BCKB 4M6MH 4O1NA 2CDFB 1WSST 1LVEA 1G7QA 1QO3A 1MNUL 4U1HA 5LCVA 1XXGA 4MB4A 1E42A 1AQHA 2L76A 3ONKA 1FVEA 2G9KA 4K3JH 3AGVA 3G04A 1KLGB 4N8VB 1ZT7A 4PRBB 3D12B 2EYRB 4P2RB 1U4EA 4E9LA 3PJSA 2HSIA 5HYJB 4DGIH 4L3CA 4MXWL 1RV6X 3SFZA 1WWCA 2AXHA 3GO1L 5IMLA 1KJMA 1U92B 2N9LA 4UT9H 2VR7A 2XX1A 5GRXG 4AY0A 4ZNCD 1SBBA 2WQXA 3MUY1 4RX4A 3VFRA 5HYQB 4TNWK 1OP3K 5DI8A 4AT6A 4IIZA 2FL5B 3TWCL 2RA1A 4Y5VA 5KVEL 1IVTA 1CWVA 1RYJA 3FC8A 4U07A 1A1MA 2PR9A 5C07B 4L9DA 1ZGLB 1ROWA 3LB8C 5D7IA 1MH5A 4X6EA 4I2ZA 3KGTA 1LO3L 3NCYP 3G6JE 3C5ZB 1S5HB 3CLFL 2OR9L 1D7CA 4GAGL 1FO0B 4HAGA 3I9AA 5KVDL 4IBVA 4EE2A 1FLRH 1O9VA 3MKQA 4L2LA 1ZD6A 3IAQA 4CVXB 1RUKL 3ECVA 3MRHB 4KO6A 2VUKA 2MJ3A 1DOYA 3ESPA 3OPUA 4JM0A 5G04J 4AIZA 5AQ7A 3MZLB 1CDGA 3RWFB 5DRZA 5C0CA 1QVOB 2PYEE 3GGWB 4CVUA 5T4YA 1E4XH 4AM0A 3V0VB 1QNIA 4PH8A 4N39A 2IGHA 3O11B 5CGBA 2RAMA 1FFUA 3W5VB 1FDLL 1RJZA 3HI1B 1LWJA 4GRWB 3TFKD 1GHFH 3RWJA 2XA8L 2LWPA 3I3EA 2AGJL 1T1XB 3EJJX 1H3PH 2ZD0A 2JRIB 3PZ1A 4LLDB 3UPRB 1KTDB 4HU2A 3RL1B 1G9ML 1RUPL 2OSXA 5B21A 3RU8H 3A67H 4IGBA 2APXA 4LNIA 1MFVA 2EDBA 3RIAF 5I28A 4NZTH 1HILA 3BVUA 3BW9B 3MLZL 2JXMB 2AI0L 3QDME 1WHOA 4R4BB 4EBQL 5HI4D 3DRQB 1OQQA 4QRTA 1NGZB 4F15C 3HB3C 4JN1H 3UDWC 1U30A 2YXFA 2NBWB 3N20C 1WCQA 1PZCA 3K6SB 1NBVH 2IEPA 1B2YA 5DQDL 3I74A 1TKGA 2JWZA 4CN1A 4WEBH 4OM0L 4ODTH 3IDJB 4D0DA 5BQ7B 1PBYA 1WTGT 3GYRA 4V3IA 1JZHA 2JJTC 1F1DA 3FL7A 3EFOA 3D9PA 1NDDA 2W9EL 1VLBA 3T6QC 3PHQB 4HUVB 3WCQA 5D7GA 1MREH 1TJGL 3FTZA 4M5YL 2JV6A 2ZSVB 4J12A 2AJYL 5LKNA 4Q97A 3Q3GA 2QCZA 3F5WB 3Q06A 2H45A 1FNHA 3CHXA 2WQUA 1WCBA 1S7RB 4TLTA 5FT9A 5H7PA 5CHEE 1KT2A 1X5YA 3X2QE 4FYRA 5AEKB 3VTWA 3NHEB 1BD2E 1J1OH 2VAAA 3BO8A 3C8HA 4I6NB 3DURA 4CSPA 5CGMA 1FPPA 3BAWA 4RFEA 3OSVA 4UWKA 3O6FA 4KIKA 4Z3JA 2VITA 1OWRM 4HCPB 3APNA 3U6XS 3GIVA 1QTSA 1V3MA 4KKBC 4NQEA 2EYSB 4JWUC 4MA8L 4K7UA 4BZ1H 3SY6A 1UM5L 5JOPE 3RIBA 3ZL2A 3ZZ1A 1MCOL 4BQ8A 2JKSA 1YAIA 1BP3B 3MGOA 3QZWA 4EN3B 1I35A 3OJMB 3ZMRA 3U0TB 3DK0A 5FUZL 4TOYL 3MLXH 3VXUA 2MQJA 3DBLI 4CZ2D 3C5RA 2XPGB 3I4GA 3KXFA 3QR2A 3QQ9C 1SE4A 2HT4