4AJWA

Discovery and optimization of new benzimidazole- and benzoxazole-pyrimidone selective pi3kbeta inhibitors for the treatment of phosphatase and tensin homologue (pten)-deficient cancers
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
916
structure length
765
Chain Sequence
b'KKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNQPFSIELIEGRKVNAVQAGLFHGNEMLCKTDISVCDLPRMARLCFALYADCPIAWANLMLFDYKDQLKTGERCLYMWPSLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLTAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
publication title Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 212
structure length 765
sequence length 916
chains with identical sequence B
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4ajwA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ajwA03
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ajwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajwA01
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4ajwA04
4LCVA 2K25A 2WX1A 4GB9A 2UWQA 3DBRI 4MGKE 2M4NA 3V6CB 2CU1A 5CCHE 1YJ1A 3ZDMC 4FN2A 4B9KA 4HK2A 3TBLD 2KTFA 2Q0ZX 2I1JA 3DVGX 3HHMA 2PPHA 1LXDA 4BKSA 2QHOA 1GG3A 5DCNA 3OLMD 4QJ4B 2ZEQA 4MEMA 2IO0B 3RULA 3QQ8B 1WZ0A 3AI5A 4Y1TA 3APDA 1XT9B 1EF5A 1GUAB 2XBBC 2C7HA 3TWYA 2IYDB 3A33B 3IVFA 1RSYA 2ENQA 5H4ZA 4HJKA 4YL8A 2X6JA 2LHAA 1L7YA 4BBNC 1WGDA 2KNBA 5DPTA 2KTRB 3ZNGC 1Q0WB 3B7YA 2K6QA 2LRUA 2KK8A 4NAWB 2WXNA 2BYVE 3GOEA 2MX2A 3QARA 4MDKE 2K4AA 2D10A 4MJSB 4K81A 1OEYJ 1BT0A 4IQHA 4B95A 2LZ6A 1OQYA 4EEWA 2KQ7A 3QHTA 2IO2B 5CHVC 3L0WB 3F01A 2KDEB 3RYTA 1WJUA 2KFKB 2REXA 1TGZB 5JHBA 2KFKA 2YRBA 2RPQA 4ANWA 3IM1A 2BGFA 3ZIMA 2NCEA 2RR9A 1GJZA 2V4LA 2HTHA 3W1SA 1EO6A 3DVNU 3SHQA 3U30A 2Y3AA 1WE7A 1Z2MA 2WXLA 1KJTA 2DENB 1WJNA 3M7FB 2DYMA 2O2VB 2KOXA 4HWIB 3EHVA 3JSVB 2L3ZA 2XK5B 2X6IA 4DK5A 2D3GA 2RD0A 1RLWA 2IO3B 2G45B 4IUMB 1IP9A 2V3SA 2A5UA 3R66C 3L9BA 1UELA 5J18A 4KZCA 1WH3A 5C1ZA 2NPTB 2HE7A 4L1BA 4UWHA 2EMTA 3RT3B 5L95C 4PS3A 1DJHA 4DXAB 2RSUA 3PLVA 4PYZA 2WXRA 4HCNB 2Z0UA 3NSJA 1V5OA 2GBNA 3MHSD 3UIOB 3PTFC 2OJRA 2RGFA 4JLCA 5G55A 2ASQA 5T8IA 1J19A 3PSEB 4TV3A 4KV2A 3A4RA 1WM2A 1MG8A 3OJ4B 4DBGA 4M8MA 3AXCA 4GOCA 4RM8A 4F7ZA 2KZRA 2NCNA 3ONSA 1WE6A 1TJXA 2X38A 1WFYA 3HM3A 2LVPA 3OHMB 4LT7A 3N30A 4GDKB 4GDKA 4IC7B 4W9GA 3VUXA 3PS6A 4DHJB 3ZKJC 3B08A 4W9EA 5H4YA 3K9OB 4HPLB 5E6OA 1GC6A 3ZDTA 1YD8U 3AULA 3QAQA 2PJHA 4II3B 3TCAA 3ZVVA 2X6HA 2J0KA 3ECIA 4PS8A 1UGKA 4IHBA 4N9F4 4EZJA 3GZNI 3P2BA 5G2NA 3T8MA 4ANXA 1DSYA 4I6PA 4DNLA 3DDCB 2GOWA 2Q3XA 2FIDA 5D94A 4DDGD 4DDID 4BVUC 3VTUA 4M8NA 4W9FA 1GMIA 4TS6A 4FULA 3PFQA 3DBSA 4OVVA 3TIXA 4WJNA 3KYCD 2WXIA 4PH4B 2K6DB 3PRMB 2EP6A 4KSLC 3F05A 1WMHB 4WQOB 4QJ3B 2JY6A 3B1LX 4EZLA 2MP2B 3IHPC 3A9KB 1QZEA 1BCIA 4HVBA 1TBEA 1WXAA 3PRZA 2FCMA 4HXDA 1J8CA 4L23A 1UOWA 5TR5A 3PPAA 4AOFA 2FCQA 4BKTA 3ZTDA 4BKGA 3KUDB 1DQVA 3ZRFA 3APFA 1DJIA 2NS5A 2DAFA 3SU8X 1P1AA 4WWOA 3A9JB 3A9JA 3AU5A 4WWNA 2KJRA 1WGGA 2DX5B 2MBHA 3M95A 3MJWA 2JVCA 1WYWB 2L8JA 1WX8A 3DCGA 2JQZA 2W9NA 3L10B 1T0YA 1V80A 2IY1B 4I6NB 3W56A 3W57A 2C60A 2A4ZA 5KHOA 2Y5BB 3NZSA 3C0RB 2WXPA 2KX0A 2O6VB 5GMVA 3VUYA 2ZKMX 2YOAA 2XEWA 1NI2A 4IM0A 4ZYNA 4G11A 2FJUB 3VAWA 1QATA 4UWKA 1TZ1A 2KWUB 4ZRJA 3KVFB 2MWSB 3CSTA 3ZO5B 2PE9A 3UQBA 4TQ0A 4MSQB 2FIFA 4NNJB 2CJSA 2WXOA 3A1QB 3NZUA 2I9CA 3A1QA 5AZFA 4CYEA 3PREA 3LS8A 4AWJA 3ZNID 1ZGUB 2AWTA 1OEYA 4XC2A 2KLGA 5J17A 2FUHB 4UWLA 2MBOA 3VQIA 2KJ6A 2C7NB 4K1RB 4IW0A 2M1MA 2G3QB 4DHJD 2DAJA 4J6IA 4WWPA 2D2QA 2J0JA 2K8MA 1UGMA 3OJ3A 2CM5A 4E3CA 1SIFA 1XQQA 3WIMA 5CCGE 2CKHB 4GGQA 3DPDA 3BY4B 5L83A 4XZ4A 3ZUNA 2MCNB 4NQLB 4KIKB 3CSFA 2N7DA 4KIKA 3WANA 4GXBA 4W9CA 2AL6A 2FK9A 2NSQA 2KANA 3ENEA 2LXCA 1EUVB 2N1VA 1X1MA 2LWPA 4G50A 4HDOA 2JWZA 4ANUA 2MSED 2N7EA 4K7SA 5DPWA 2ISDA 1E90A 2G4SA 2PEAA 4TQ1A 3R7RA 3OAWA 5ANLA 4URKA 2NR2A 4NJ6A 4PS7A 2JT4B 3CF6E 1YQBA 2MQJA 2CR5A 2MA9B 2NVUI 4HPMB 4CHKA 5IA7A 3V6EB 1BDYA 3NHEB 4MJJA 1IPGA 4TKNA 3UGBB 5ENNA 2ZNVC 2DZMA 1WJ4A 3NY5A 4IWQA 2L0TA 2IBIB 3QWZB 4KZ0A 4W9IA 2D11A 3FBKA 3SDLC 4DHZE 2KXJA 4NPNA 2DZIA 1DJYA 1YRKA 2N9XA 3QIJA 5JHAA 2KD0A 3NS8A 2MLBA 2N1WA 2FNJB 2Z59B 3KYDD 5IAAC 1KLVA 3N5AA 2KVRA 2NBWB 3L16A 3JVZX 2BWES 4MGIE 5C23A 3QC8B 3PRPB 3ZTCA 1FXTB 2LASA 3QK0A 3AU4A 3RCZA 1WRDB 5DPRA 2NBVB 1J0GA 3V62A 3RPBA 3PHXB 4E71A 5LXHA 1WGRA 4NPKA 3JYUA 2IO1B 1S1QB 2Z0DB 1YIWA 3EC8A 2O6VD 1A5RA 1GNUA 1UH6A 2K8CA 3W1YA 4W9JA 1BYNA 2WX0A 1RFAA 2N4FA 4AJWA 2FCNA 3PV1A 3R3MA 2V1YA 2AL3A 5CHFA 2J7QB 2K1FA 2EKEC 1WXVA 1Q1OA 4JQWC 2BYFA 1LQBA 1P98A 4OYSA 4X57B 3UIPB 4BGDA 3IFWB 2GBMA 1K5WA 2WWZA 4BKSD 2JRHA 4ASWC 4KITB 3VTWA 2LGXA 3L08A 2WXQA 2MW5A 2CHXA 3Q3JA 4TUUA 4JGHB 4A3PA 4NS0A 2LGDA 1RRBA 2ZCBA 4LDTB 4P7IA 3B0AA 3ALBA 2AYOB 4FLHA 4MSMB 1V49A 4GN1A 2IZVB 4JL9A 2CJTA 1CJAA 2JRIB 4IM2A 3L4CA 1UZXB 1TTNA 3PLUA 5DPSA 2GBJA 4OVUA 3H7PA 2G4DB 4AUQC 1C3TA 2ZVNA 1V2YA 4F91B 2KC1A 1V86A 4GIVA 4RM9A 4EOYA 3KH0A 3VH4B 4F8CB 2ZPYA 3WA0A 1DJZA 4WAFA 4WAAA 2KHWB 1IYFA 4LDCA 1F9JA 3VDZA 5FR6A 3RD2A 3ZNHB 1E5WA 2ZPNA 3DVNV 3PT2B 4WJPA 3UQAA 4CO7A 1E8ZA 2DMGA 3F00A 1UBQA 3Q3FA 5AEKB 1RH8A 4NJ7A 3M63B 4WEEA 5KJ7E 2YLMA 1WXSA 2WXFA 4QJ5B 4JPSA 2KN5A 2M0XA 3EECA 4IWOA 5EDSA 4GNKB 2C5LC 4G3XB 3U7DA 5CCJA 4UWFA 2N9EB 3QX1A 1L2NA 3KWUA 1V9JA 1WFMA 2KFJA 2KJHB 1H8CA 2ZZPB 3H7SA 3MTNB 3V61A 4FJVB 1E8YA 4EUTA 1XD3B 4GDLA 5HKHA 3NOBA 1GC7A 2L05A 1I42A 2NBUA 3F04A 5LLIA 2LVQA 3QCAA 1V6EA 2BWQA 5D7GA 4F1SA 2D07B 2K45A 2DYOA 4ICXA 3RZFA 3U8ZA 1S3SG 1ZKHA 3ZW3A 2KDFB 1EF1A 1VCBA 2GBRA 1W15A 3RUIB 3HN8A 2BKFA 3K9PB 2KI6A 1E7VA 2DHZA 4II2B 2D8KA 4KVGB 4ICVA 3L54A 2QZQA 1V81A 4WJQA 4MGYE 2WXKA 3S2AA 2FCSA 1WM3A 2J0MA 1CJYA 1LFDA 2Z0EB 2YVCA 5KHQA 4FJZA 5CX3A 1WIAA 2B3AA 4LDTD 2B3RA 1SE9A 4QAMB 2LJ5A 1UBIA 1Z5SB 1YX6B 2K3HA 5D6JB 2BYEA 4ZRIA 4A3OA 1UD7A 3BINA 2L76A 1ZW7A 1W16A 3M62B 4IM3A 1OTRB 2R2OA 4AP4C 2KDIA 3KUCB 3VUWA 4L2YA 3DVGY 2MRPA 4MH0E 2KTRA 2OOBB 4NAWA 5E6NA 2X6FA 4NP9A 2FAZA 2N9PC 5CHWA 4AJYB 4EFOA 4W9LA 5AZHA 2KWCA 4MJSA 5J2RA 2JPHA 1E8XA 4EZKA 1V27A 1K8RB 2HD5B 3T9LA 1P3QU 2K39A 4NPJA 1WR1A 3DBLI 3N3KB 3M3JA 2BF8B 4ICUA 4KDIC 4GSWA 4W9KA 4B6WA 4BFRA 1Q5WB 3JZYA 3DBHI 1Y8RC 4W9HA 4ICWA 3X23A 1LM8B 1WGYA 3KWTA 2DZKA 2LRWA 2ENPA 1R4MI 2BWFA 2JZ3B 2WXJA 4RMAA 2M8SA 2LVOA 3N32A 2C7MB 3WAMA 3X0WA 2GBKA 3L17A 3VFKA 2K8BA 4V11A 4NQKE 3VXWA 2IY0B 2LXAA 4IWPA 3A4SC 2O2VA 4Y1SA 4NY0A 3JSVA 1H4RA 3LJ3A 3TJPA 1DJWA 1ISNA 2XK5A 4IG7B 4FHJA 2ZVOA 2WXGA 1M94A 1R4NI 2KMAA 2ZCCA 3QA8A 3ML9A 2JZZA 4DHZB 2LUEA 3HM6X 4F92B 2NPTA 4BOSC 1WGHA 4FJYA 1U4AA 1WI0A 1KOTA 4KDLB 4K7WA 4MM3A 2KC2A 5CTRC 1RAXA 4EKUA 2KX3A 1WX7A 4JIOU 2KWVB 5E6PA 1QASA 3TL5A 2DZJA 2I1KA 5LXIB 2WXHA 3ZLZA 1E8WA 3TMPB 1P9DU 2KDBA 2R83A 2DMHA 3HIZA 2NQ3A 4LJOB 2QZ5A 1WY8A 3HK0A 3I3TB 3PGEA 3APCA 3VTVA 3W1SC 3WALA 1V5TA 3EFUA 4XE0A 4WJOA 1HE8A 3WAPA 1DJGA 5BO4B 3L13A 2R2QA 1WZ3A 4M0WB 3WAOA 3KW5B 3ML8A 2X6KA 3SD5A 3ZRCA 2L00B 2UYZB 3H7PB 1SGHA 2EMSA 2GMIC 3H6NA 3PZDA 3CMMB 2M17A 4ZDVA 3PYCA 1P0RA 3JW0X 3QJZA 2CM6A 2MBQA 3D32A 2JF5A 2WDTB 3KUZA 4DWFA 4FBJB 3DQVA 1RLFA 1TJMA 1JRUA 1CMXB 1WR6E 4PYUA 2KO3A 3VVWB 4A20A 4A55A 2LI5A 1C1YB 3QR1A 4LCDE 2WXMA 2DYBA 5JZEB 1VD2A 5D2MB 2HJ8A 1WFJA 4BOZB 1WXMA 2L7RA 4MELA 1D3ZA 2MBBB 4MGZE 5JH5C 2JUOA 2KKCA 4FHKA 3PHWB 1G6JA 2LD9A 2JXXA 4F93B 1WMHA 2C9WB 3O65B 3VH3B 1A25A 4ANVA 2CHDA 1YX5B 2WYQA 1KM7A 3IHYA 4K7UA 4W9DA 3H9DA 4ZRKA 3RZWC 1OGWA 3GPEA 4HLEA 2KLCA 2MBEA 2MP2A 1AARA 3A9KA 4BBNF 2KMCA 2UZPA 2VRRB 3H1UA 2KQSA 4L1LA 2L0FA 2LGYA 3QR0A 4FA6A 1E7UA 2K8HA 3LDZE 4GDLB 3DOWA 1WX9A 2AEHA 4G0NB 1NDDA 1DJXA 4FADA 2CS4A 1I35A 2PE6B 3UF8A 3UINB 2ZJDA 2CHWA 1UOVA 3V60A 1NBFC 4UWGA 4GMVA 3IBEA 1PQSA 3IG3A 3FDWA 3PVLA 2BKRB 4XX5A 2BPSA 4HDQA 3RDJA 2ENJA 1WF9A 4GU2A 2ZNVB 4HCPB 4I6LB 4LJPB 2CHZA 1WJ6A 2O6VA 5AZGA 3ZNZB 4KSKC 4E74A 2N1TE 3VHTC 3R7QA
chains in the Genus database with same CATH superfamily
4JHAL 4LCVA 3RMKC 3H56A 1EGJH 4CADB 5K93A 3VDCA 2D3NA 4PJIE 3EJYC 4YNYA 1SXBA 3WIHH 5DFAA 3LS4L 3RKDC 3LKPA 1N26A 4C56D 4N39A 1UXSA 5GGTH 1FP5A 5F1KC 4ATGA 2EO9A 2JKRM 1D9KB 5T1DH 2AI0L 1KXTB 1Z6TA 4PJ6A 1KN2H 3QFJB 3LIZA 4G43A 2EDWA 1EFQA 4ODUA 4TVPD 5CJBA 3TVMC 1OZTG 5A23A 4F58L 1H3PH 2LHAA 2J07A 3ZXAC 2H3KA 2BJMH 1G4MA 2PUQT 4A68A 1A66A 2DMCA 3ZNGC 5E1AA 2KK8A 4FDWA 3GOEA 1JNNL 3QARA 2FEEL 1M9SA 4K5NA 4FKHA 2P49B 3JUEA 1KJ2H 2FQFA 3B34A 1HDMB 1OEYJ 5FLVA 3RY5A 2F2HA 4B94A 2VJXA 4QHMA 5DZVA 3QHTA 4W4OA 3ZXVA 3SPVB 3MX3A 3OBAA 4XMLL 1CU4H 2KDEB 3V2OA 3GKWH 5EUOF 3D18B 3V9EA 4MA3A 5SWZB 4N5UA 5CEZE 1E42A 4NZJA 2UV3A 2NCEA 2BGFA 1KBKA 1XCTB 3L22A 3RGHA 2A9ML 2WQYB 4PJ8A 1OB1A 3MOBL 3LXAA 4AGMA 2ED8A 3GMQB 1A4JB 2O5NA 3FZUC 1C16B 1N0XL 1YMMA 2ZXGA 4GA1A 2XZTG 1QLFB 3X13A 4P5TC 1HTYA 2KVZA 3F7LA 5B1JC 3T2NH 3TLRA 2ODIA 3SFXA 3EF4A 1U3DA 3OQ3B 1J8RA 1FLTX 1MX6A 5FYLL 3H9SB 1CI5A 4NERA 2NMSA 4LLWB 4PS3A 3B7SA 3WCQA 1M1SA 2Z0UA 4TTDD 4AMXA 2B20A 4ZODA 4XAWH 4PRDB 1P4IL 4TV3A 1SA4A 3TIDA 2CUHA 2EUXA 4BELD 3F7QA 2G60H 5CBAA 5K9OA 4OB5L 43C9A 1AFVH 2JYTA 2P46B 5GZOD 4YHIA 4G83A 3FQ4A 4MB1A 1TJFA 3VD3A 4X7CC 2J42A 3U2SC 1KTLA 5FUOH 3EO1A 4W9IC 3QJSB 4IGBA 1GC6A 4BFJA 1OCZE 1G6RL 2C4XA 4NLHA 4QYOA 3HC4L 2SAKA 2RFXA 4GAGL 3SJVA 3ZIYA 1D9KD 4MQTB 1D7FA 4PP2A 1Z0MA 3CWIA 4FRWA 3QFJD 3LKSB 4GIPD 2J4DA 1DSYA 2NY1B 4DNLA 3T8KA 4N6RB 2CBQA 4IRSC 1X5BA 4M8NA 4KH2A 4TVUA 5D70L 1FNGA 2NXZB 4J8DA 3CUPA 4MDIA 1KBBA 4JLRB 1OWRM 4WJNA 3NJIA 5ABDE 4AL8H 1FL5B 1WCQA 3TWTA 3BVDB 5F9WC 4X6CA 4XAKE 1DL7H 2AQ2B 3DO7A 5DRNA 1ZS2A 2WVUA 3L82A 2OXHA 2J43A 3EJRA 1J9SA 4JKWA 3A9KB 2XV6B 4GW5A 1LF8A 3BVNB 3QWWA 1YCSA 4S2SB 4XCNA 5KYUB 2BSTB 1SXCA 3E30A 5DT1L 5SWZD 5B1CA 4KX7A 4GSDL 3WMPA 1LQSR 3MLUL 5E5UB 3MBEB 3IGLA 3FT2A 2O30A 1X3DA 3KCPA 5DMGC 4QRFA 1OL0A 4C9BB 2UVEA 2OZ4L 3MJ6A 4IKJA 2KJRA 5EBLB 3ULUF 1CFQA 4POZD 3CIQA 1EJOL 2YN3A 3HBPA 5BRPA 1YQVL 2ORBH 3BJLA 4YLBA 3IDUA 1VCAA 1UH3A 2FB4H 2IY1B 1GYUA 1F00I 1ZCRA 4NNXA 3TIEB 2O6VB 3H9SD 5F7UA 2BSRA 1NEZB 1Z3RA 5D7SL 1EVTC 4FLOA 2DQMA 4I4WB 4MMYB 4ZOHC 1A6AA 3CH1A 1XB6A 3RIFF 4LSPH 3HG1B 2JQRB 3MRHA 2D3LA 1F6AA 4ALAL 1QEWB 3P11L 2QLYA 4FAAB 5K9JL 3FILB 2WQ6A 5F9JA 1ZGUB 3FRPB 2CR3A 2IDQA 4QY8B 3PCYA 5IBUB 1IQDA 3L5XH 4OT1H 3W2DL 4LCIH 1LE9A 1XIWC 3OKDA 4MSWA 1BZOA 3CMOH 3WFEL 4IW0A 5CEYB 3WHE1 1N4QA 2ZP8A 4LNNA 2AERT 4ZX4A 1YY9C 1XGQA 4A7GA 4E3CA 1XCXA 3NZ8B 5JW4N 3WXVH 4DPBX 3EYFA 3I3BA 4KIKA 5LHDA 4W9CA 1KB3A 2ZGGA 5FECA 3WG7B 2JI1A 4I85A 2NY1D 3SY0B 4X4YA 3FHAA 4ZUSA 2RR3A 2MSED 1NLDL 3HZKA 3NJGA 2ISDA 4GG8B 1OWLA 3EO0B 3JWOL 3DV4B 4YT0B 1QSEA 2NXZD 4B3EA 4NIYE 1JPSH 3LY9A 2JXMB 3LZNA 4NM8H 3WKPA 2IU1A 4YZFF 1MVUA 1RP9A 1NGPH 4TSSA 4IU3A 4QXTB 3VI3B 4QWWD 4ZFOA 2YXWA 4NACA 2APFA 1AAJA 4A7QA 1HA5A 1EXHA 3A6OA 4WKZB 5GGUA 4XEIG 1FQ9C 5K9QI 4XNZB 4UQAA 3DGGA 2BP8A 2C4FT 5KTEL 2QFCA 5EO1A 5JNYB 1T6VN 2BMKA 2ZTBA 3MBED 1NCNA 3NGBC 4JRWA 5JPNC 5SX4H 3V6BR 3A4DA 5I1DA 3F85A 1INQA 1IEBA 3MTXA 3QK0A 2Z7ZA 4YVQC 3H3BC 4F7CA 5FPIA 1GSKA 4R8WH 3U0WL 1FXTB 5KYWB 4E71A 3HBQA 1LTXA 3S4SG 2XN9C 3II3A 2QJLA 2Z0DB 2O6VD 2VDPL 3BVVA 3GB1A 4AJWA 4LRNL 4DESA 2E7LA 3ZZLA 2V1YA 1PZ2A 1YC8A 2EEXA 2IJ0C 3C09B 1OP3H 4C47A 2DAVA 3HG1D 3ETSA 2CDFB 2FBRA 4I3RH 1LQBA 3RJQB 2QMTA 3IV0A 1FMAD 1T5WA 3D4ZA 2YXVA 3BIID 1FFNB 3MRRB 1QOBA 6FABH 3CGHA 1Q90A 2GQHA 12E8H 3MRBA 4Y16C 4KITB 5I30L 2JIXB 4Q2ZB 4CNIA 3UXFA 2WXQA 1MUJB 5E9AA 1AZCA 3LOWA 4FERA 4ZTPH 2V33A 2V9RA 1XB8A 1HCYA 3K6IA 4OZIE 4PJ9B 5A6IA 1IC5L 1E4XL 1OWPA 3Q5MA 2VZ1A 4KRPC 5IVXF 2AYOB 3MREB 4JL9A 5BVPL 4Z7UB 5E7FA 4PHXA 4GSQA 3AREB 1WO2A 3EH2A 3CK8A 3PY9A 1SJXA 5CP3A 5GRZA 4EMZA 1TN8A 4M8VA 1AHMA 2D31A 2VSKB 4G7YH 4LSRL 2O5ZH 3VYOA 4YDMA 2VR5A 4F91B 2QCZA 1MWAH 1VZIA 1H2UA 2D2CC 4Z7OE 1BQ5A 1NCAL 5F7EL 4ZMVA 1GAFL 3V7MA 4PV9B 1SMAA 3LEVH 1TYJA 3WXWL 1DTUA 1REIA 2WBWB 4JZJC 4WJPA 2EXSA 2ICEC 4G3YL 1A3LH 5K33A 4XPAL 5E03A 2JV6A 4JZOA 1P1ZA 3CLEH 4EOWL 2YSSA 4HU8A 1LO3H 4PVBA 1IAOA 3IAQA 4MXQC 4F7MA 4K07A 2Y69B 4IWOA 3TV3H 2N9EB 3EFCA 1FNSL 1BF2A 2WJ7A 4JFYB 4FL4C 3PEVB 1MQ8A 3VXRE 2YLKA 5HVHB 2OEDA 4IJ3B 5D7IE 4YBQD 1IM9B 2ITCA 3O6LL 5CNHA 2BZDA 2XIIA 3QJFB 3KEDA 3ABKB 3O3AB 4HX1A 4MXWH 3HNTL 5HKHA 2JEKA 3V0DA 4ZHBA 3HAEB 3BXNB 4TVPL 2CDGA 4Y5VA 4ALAC 1NM4A 1X6LA 1E67A 3BGAA 1I85C 2KQNA 2K45A 4P3DA 1MCFA 4X83A 2DPKA 5E8EA 3UYRH 4G8KA 5CJXA 4TXPA 3SGDI 1NCJA 1SMOA 4ZFQA 4NKMA 2IDFA 2HKFH 1QFHA 2UZYB 4GRWE 2BY3A 3GXIA 5AW5B 1G1OA 5JQIB 3F83A 5EZOL 4NN5B 1OP5H 5BV7H 2P5EB 5EWIL 5I66A 2QZQA 5LGHL 1PFOA 3FQRB 2JIXD 3OJ2C 2WU5B 1M42A 3GMOB 1DOIA 3ABLB 2IH1A 2YUZA 5E5MA 1RK7A 4OCRL 4YPJA 3STLB 1OM3H 1CJYA 2BVUA 2YVCA 5JW4M 2HH0L 3RWEB 1SM3L 1EUTA 2EIEA 4PJ9D 5EOTB 3ZRHA 1HXMA 1UJ3A 2ITDA 2JKSA 5D6JB 3RN9C 2IMMA 4YXKH 2NXYB 3V52H 2E56A 3NA9H 5DMKA 1G9NC 2W92A 3LB6C 1E9OA 3ARED 2WANA 3O0RH 4JG1L 3JWOC 3LD8B 3WSQH 4DRXE 4W93A 3WLBB 3X17A 4L2YA 3WIIH 1E0OB 1EA9C 4YSOA 3VFRB 3FCSA 5FGSA 5I1EH 2MRPA 4HK0A 2X6VA 4NP9A 1JFQL 2RG8A 3AEDB 1DDTA 1MCRA 4A38A 2VCOA 1E8XA 2WPVA 1YUHA 3FHQA 4WW2C 1ZLEA 2XXMB 1E3FA 1NAKL 4GSWA 4BFRA 2IF4A 2D2OA 2Q3AA 2KPWA 5KBKA 2LLNA 3I6SA 3MLTA 5KYXA 1T3FA 3VRBB 3FRUB 2JZ3B 4DJAA 4BTBA 2C7MB 1MW1A 2KS0A 4MJIE 4EEEA 2JSVX 2LXAA 4IWPA 2R8SL 5GRJL 1WT5A 2M26A 3ELAT 4DKTA 2XQYG 4U07A 3WN6A 4Z5RA 3O48A 3ZHEA 1IM9D 1WA0X 5GS2D 1KCRH 1T0SC 1JV2B 1JHKL 4P2QE 4F92B 1U4AA 5AW0B 2OVBA 4HF5H 4AJYV 3OD3A 1YYHA 1A14L 3E1F1 3CPUA 3RWFA 5J12B 1E4KA 4HWZB 5IB4B 1QASA 5FKAA 2WXHA 4L7TA 2FYYB 3DA0A 5FEBA 2YMXL 1NDGA 1ZE3C 1J7CA 4M1GH 1XD1A 5B3SE 3HK0A 1WY8A 1AR1B 3U48A 2MH7A 4JWSC 3IDXL 4OZCA 5CXPA 3W81A 4F5CE 3FUFA 4OFPA 5F6HI 4A2HA 2BNRE 5JXVA 4G9FB 2OMXB 1MRCL 4FQCH 1QFWI 2R4RH 4GRLA 4LKCA 3VFMB 5C2TB 4K8RD 3MA7A 1W0YT 2P5ED 5HGBB 3T8VA 1P6WA 1PKQA 1E6EB 4LSVL 1ED3B 1ET8A 1AW7A 4IIQB 3ALXA 4MMXC 3P1MA 3PYCA 2MCPL 1IC4H 4Y2DA 4PJFB 2W0FA 1XCTL 5D1QA 3UDWC 4AITA 3VGHA 1JRUA 1JN6B 1F42A 5EN2B 1CF8L 3AAZB 2NXYD 2XDHA 1QA9B 1JAEA 3DPBA 4HXBH 4I3GA 3UTTE 5IKCB 2BS2B 4HLJA 4DEUA 1U42A 1UCBH 2P4AB 3W9GA 2VABA 1UM4H 2QFPA 4QUOA 1A7RH 2BKGA 3ASNE 1INEL 1TCMA 1JMXA 2FVNA 3K46A 4R2GC 5E56A 5KYNA 1QSVA 5A2JH 4YDIL 4I3SL 1WFNA 4JY5H 4F7TB 4NRHB 1OGWA 3WNNA 1KT2B 4DK6A 3NK3A 5FB8A 2COVD 2J49A 3SQOH 2VRRB 3GLEA 3WUWG 3NH7L 1XH2A 3PP4L 2KQSA 2R2EB 2GJ6B 3DEOA 3HZYA 1AY1L 4BV1A 4D0CB 4XR8C 3QG7L 3ZDZF 1TS3A 2NBVB 5C70A 1RJCA 4U6VH 1XMWA 1AH1A 2R56H 3FO0L 3GZ1A 5BMHA 4HKQA 5LX8A 1BD2E 3NJTA 5D7LE 4G71B 4BZ1H 4OFYD 4XN9A 4IMKA 4BSWB 5EE9A 3STZB 3G7TA 1HK6A 4X6FA 3P77B 3FQWA 3EZ8A 5B3JE 2OPCA 4LRIC 4KKZA 3BK1A 1D8DA 4C4VA 2QSQA 3DJ9A 1C77A 3ZYJA 1QBBA 2PO6B 4E9RA 5CCLA 5AVTB 2Y7SA 2OJ1A 2ZXWE 3TFKD 1IBHA 4Z76A 1AG0A 4WNGA 3P3RA 5C97A 3VG9B 2PPHA 2PETA 1AR1D 1R46A 5HHMB 3ZTDC 4B96A 1F3DH 4MZIA 4KFZC 4HZLA 4W70A 4YSUA 5IMMA 3MRDB 2WOBA 5BXOA 1H5BB 2YA2A 4GAAA 4G9FD 3DO3A 1M4KA 1XF2A 1JZ4A 3IVFA 5ANRA 4DO5A 5DFVC 4S0SD 1W3BA 3UBXA 1LHZA 5FV2A 2J1WA 1A9BB 4TUKL 1Q0WB 2K6QA 4WTXA 1QBML 5LB1A 3E6FB 3WFDH 4N2HA 1HKLH 4PJIA 1YNTE 1CC3A 1ZA6B 1ZS8A 3VFWB 5BOZG 1W80A 1BFTA 2BNUB 2NY7L 3LRMA 3MRQB 4B95A 1PLGL 3VMOA 5JIPA 3WFHA 5LJYH 5B38G 2C3GA 3L0WB 5LBVA 4G9DA 2UY6A 3VXQA 1WJUA 4IOSD 2P9LG 5IHWA 4A6YA 2ZW1A 5D3DA 4JHAH 2HVKB 15C8H 2BDNL 2K70A 4A7SA 4RZCA 4RGOH 1EO6A 1T0QC 4LNKA 2J44A 2J5LB 3FSZA 3L1GA 3BG1B 1DFXA 2O6DA 4H26A 5LNDA 1WJNA 5KVDL 4FMFA 1MVFA 4X5WA 1V8CA 1UWXK 3IMTA 1N0LA 1TOXA 5FGBC 4Y4FC 3ZDXF 5KVFH 3JSVB 1UA3A 4RFEA 5HYQB 4NCC1 4JN1H 3G5YA 1UELA 3EG9B 2APXA 2GJ6D 1TZHB 2NTFA 1UYWL 3KPTA 1JNNH 3RNFC 5FYJU 1V5OA 4BGLA 1XCQB 3HZMA 4BCXA 1K9TA 2WYZA 4OJFL 4GRMA 4EUPH 2JE8A 1C9FA 1AXTH 4P07A 4AQ1B 3FYIB 4NO3A 4QXUH 5CJ8A 5I73B 4XMLH 4BJLA 3RPKA 4HSCX 2J8UA 3HM3A 2BSSA 4K23H 4LOVA 4NDMB 1N60A 2Y0BG 1RUAH 4H8UA 4M4PA 3N30A 1FVHA 1TKWA 2YD6A 2PO6D 5GRVK 1G7HB 1P4BL 3PZ8A 5JHLH 1YD8U 3AULA 3TOPA 1O1SA 4P6VF 3S7BA 4HP5A 1UQSA 3H2PA 3SFEB 2G9HA 4DKFH 2AV7A 1LEIA 1OT4A 2EICA 3GZNI 3CC5A 2Z7YA 2VIRA 2HTKD 3PV6A 4MHHG 1IILE 4PJAF 1VJKA 2GOWA 4CQNA 2K3TA 4PJGE 2N56A 3K2UH 4K55A 1HHIB 2W0PA 2YD2A 5I1LA 2A99A 2QPUA 1GKEA 2PP9A 4O58H 4ENED 4A2EA 5F96L 2RBLA 4OVVA 2F7QA 1UC6A 4I5BB 2BOBA 3WEXB 3KLHD 4PH4B 4G6ML 4M5ZH 1M57B 1TF4A 2EP6A 4ARCA 4W9JC 1P4IH 2EXYC 2QR0A 2WTPA 1EIBA 4NENA 1ZVNA 2E86A 4RVBA 3Q15A 3UT4A 3B1LX 1PX3A 32C2B 4EZLA 4Y2OA 1TSRA 3CFKB 4BXVA 4MYPA 4K7PH 4Q52A 4DUIA 2OMWA 3FFDA 4JPWH 4IRJC 1DEEB 4LBEB 1JPGA 3AT0A 1KJVB 3DK0A 3RVUD 2XV0A 4L05A 2FO1A 3EUB2 2B1HH 2CRZA 5E8OB 1FHNA 2WUBL 4ZQKA 1N94A 2CO7A 2XZCL 2CJNA 2V2XA 4KMTL 2JVCA 4XCFH 1IKNC 4LCYB 2UWEA 3O6KL 3E2HB 3B9EA 4BFKA 3AXHA 5BW7A 4Q14A 3WTSA 4NKDB 2Z4QB 4HUXB 2X4OA 5AAWC 4YE4L 4ZYNA 4GMRA 3ATBA 3TG4A 4Z7IA 3BIBX 5JPMA 3V5DA 3ZO5B 4PYGA 4DUWA 2VSMB 1N19A 4YHOH 2QADC 1Y6KR 3F58L 4N59A 3LKPB 4JZYA 3F6QA 3BAWA 1K6QH 5AYWD 1Y0LA 35C8H 1OCRE 3GI8H 1UXSB 1QOFA 2EDXA 3TU6A 2CO4A 3TWQA 3BW9A 1F3RB 1C79A 1IBFA 3CVHA 1PNDA 2B4CC 4XBGA 1SF5A 1VA9A 4G6FB 4ZO9A 3WELA 4G43B 2NXZC 1JCQA 5DT1H 5F7FA 2WYIA 4ODUB 3PE3A 2C7NB 2DLHA 2GKIA 4XNYH 1MFBH 2EUWA 2NW3A 4XBMA 2D2QA 5L0QC 1MNNA 1ZGLA 3JYCA 2OZ4H 4JPQA 5E1AB 5L83A 1OD7A 1U8QA 3ZQXA 5MEQA 2EIBA 4D0BA 2PTTA 2PWEA 5D4HA 4B0MM 5IJBC 3V79K 3AROA 1HCZA 3SKNA 2YEVB 4QHMB 5LVEA 1U41A 5C86A 4WO0A 4TULL 3T3MB 5DHDA 4I88A 4H4NA 2QC8A 3EDFA 4MA3B 1IAMA 1HH9A 5HDBE 3RY6A 2IBZX 1TKGA 4KAQL 3FQTA 1UH4A 4TMPA 5JDSA 3IPFA 4PJ8B 4AS1A 1OB1B 1HH6A 2VQTA 2JT4B 4UTBA 3RAUA 4ALAH 1BJ1H 3NCJL 5K9JH 1ACZA 4AYSA 4NZDA 2MFNA 1MFAH 4EI0A 1YMMB 4HI8A 1PG7H 3GSXA 3X13B 3Q05A 3QBTB 2ZNVC 2XSKA 3W2DH 5BRQA 2YEPF 1BFSA 5CCKL 3O81A 1CFBA 1FFQA 4Z7WE 1KJMB 3H7BA 3WFEH 4DHZE 2JF1A 4M6NH 4QO1A 1BI7B 5I17A 1VPOL 3SEBA 2FD6L 2MJWA 3E8UL 3D4YA 1FRGL 4R5VA 1UFUA 1N6ZA 4JJ5A 3URZA 3ETRA 3QC8B 3VXOA 3J27A 2GB2A 3INUL 1D4BA 4GTVA 3TIDB 4FNUA 2VR3A 3KR3L 3DXAE 4L1DA 4YVNA 5IVOA 5CBAB 43C9B 1G9NH 3E38A 2Y6TE 5FO7A 3OXFA 4KKPA 4JW1A 3JWOH 4I9WE 4YHIB 2FGWL 4OR1A 3QUMH 1QYGH 4GXUN 4CU6A 1LWJA 1KTLB 3EO1B 1RJLA 4JQWC 3CKCA 4BWRA 2OMTA 2X12A 4FFZL 3NUHB 2EINE 3CZEA 4QYOB 3ZKXB 5DC9B 4C4BA 2RFXB 3NCBB 2KZWA 3SJVB 4KPHL 5DWUL 2FQEA 3EJCA 4PP2B 4G6FD 3OKKA 4QXGL 4TF4A 3DBHB 3SDXF 4B0MA 1CLOL 2GUYA 3RJVA 3E9TA 3VLEA 1N6QL 2ZGDA 1FNGB 2NZ9C 3CUPB 4MDIB 1RZFH 3OX8A 3EFDH 4LARL 2A5EA 1EQWA 1QSFE 2BIOA 1KN4L 1A7PL 1BWMA 4HFWA 1KB9J 4X6CB 5CWSA 2H7WA 2L83A 1I31A 3RGBA 4JB8P 5H37A 4OLEA 5EOQL 5DRNB 4AZ8A 3U0WH 5CO1A 3DO7B 2ILLA 4USAA 2OXHB 1EHNA 3JXJA 2WMPA 5CUSL 1CDJA 4GW5B 3JV4A 4XCNB 1YCSB 3CDFA 3GBDA 3MHZA 4LE8A 3RX5A 4LRNH 5AOZA 1N6VA 3EGSA 3RJDA 3ZNHB 1Z9LA 2QLVB 2ZCKL 3FT2B 1JD7A 3KCPB 3WLWC 4PJ8D 4EI6A 4OZIA 1PFCA 5D2LE 3AMKA 2E7CA 4HEPG 1DR9A 1YMMD 1ZE3H 5A16A 1CFQB 2CSPA 4GQPH 4YE0A 1TQBC 3GZQA 3LTVA 4GS7C 5DLLA 2J53A 4LRZA 3ZYMA 3AZUA 4UQ2A 4AIXA 2HFEA 3X1EA 3ZO0A 5IHUL 4NNXB 3QX1A 4ZXBA 2BSRB 5AAOA 1E4XH 1HNFA 3BKJH 4YLQT 1AXIB 1A6AB 1NFAA 2RTTA 2VDNH 3CH1B 2K5PA 4E41A 1IGCH 2AK1L 2F53E 3CSPA 3MRHB 1F6AB 1OPGL 4GDLA 5CEAA 4XVUD 5F9JB 4LSRH 4CC4A 5I15L 4NFCA 3NFNA 2V9HA 4KDVA 5AVZB 4A2GA 1TLMA 1LE9B 3OKDB 5F7EH 4MSWB 5B4MC 1GAFH 3CVBA 1ZKHA 1NMBL 3O6FA 3OMZA 4NX0A 2VDLH 4PEEA 4FQ1H 4G3YH 1A3ZA 1XGQB 3VXRA 3JVGC 4P99A 4XPAH 5D7IA 5EU5A 5C7XL 3EYFB 1Z9PA 4EOWH 5C0GB 4FQPA 4WJQA 1E3XA 3SJVD 3BHBA 2X05A 3ZZ1A 5IO9A 1UM6L 4GT0A 3TWCH 5FECB 3GRWA 5AAMC 4JJHA 3AY4C 4X4YB 3KYNA 1FNSH 1OT8A 2OI9C 4ZUSB 3HZKB 4JEUA 2HZHA 3N43B 1L3WA 2LJ5A 3QXAA 2ADGA 4LCWE 3D9AL 1QSEB 2DBLH 3KAAA 2IFFH 4BEPA 1MVUB 5B1BB 4IU3B 1JF5A 3HNTH 1MG2C 2FQDA 3SOBH 2V2TB 1H3VA 4DP0X 3TWRA 1GY2A 4MA7L 5GGUB 4BETA 4W9LA 4H25A 4KKBD 2LU7A 2BP8B 1P5QA 3HR5A 3N3KB 5FYJH 5EO1B 1TPXB 2BMKB 1HI6A 2JLBA 2PMZA 4GXVH 3FUEA 2KYIA 3AN1A 3HPLA 4OLZH 1SJEA 3W9DA 3IE9A 3MRCA 1IEBB 1INQB 3ZGQA 4MCMA 3P73A 4RFOH 4F7CB 3P4PB 3VFKA 2H2PD 1E9MA 4JBSA 4PVMA 2OAAA 1NTDA 2ED7A 5HPMA 1PEZA 1MFVA 5JUEH 1SHSA 3B56A 1X5MA 5ABZA 5ICYB 1G9MC 1XGRA 1NICA 1DQJA 5CBEA 3TT1H 3Q47B 2KLRA 2B5IC 3GZKA 1F0ZA 4K7WA 3K6OA 3Q3OC 3O9WC 1SE3A 1RU9L 1T5WB 43CAA 2XS1A 1ZD6A 1NBYA 3AT8A 4KKQA 3MRBB 4JM2A 3ZLZA 3QNXA 5IV2A 3VB8A 3QISA 4CNIB 4I87A 5IBLD 4DTGL 4MJIA 2BNQB 1F41A 1KB5A 1MFUA 5E2TH 3VTVA 4B93B 2C4FU 4ODHL 4XWOD 2KZBA 4JE3B 4X5LA 5IF0A 1M2VA 5AQBA 4GTSA 3NFSL 2BP5M 2P3YA 2VDMH 3ULEG 1QHPA 4FQQB 3WAOA 3U1SH 4FF9A 3D09A 3OXSA 3EU5A 4FFYL 4MQSB 4P2QA 2WUCH 1ZLVK 5CGBA 3ZRCA 2D31B 3FN0H 1INDL 1IO4C 1CDBA 2EMSA 2HO1A 1CICA 4B60A 7PCYA 1CN4A 3N6YA 4FMVA 5GRJH 3JW0X 4DX5D 2EILE 3G5VA 2E46A 3D1MC 5F0MB 4UT7L 4Y2NA 3QDAA 1QSED 3AE4B 1RCYA 3MFGB 3BT2L 2H3XC 1BFOA 3EYOA 1OLZA 4HS8L 3QR1A 3IAM1 4LCDE 3DHUA 1JHKH 3EBGA 3HI1A 5FM4A 3STBA 2HUHA 3KW7A 2DBYA 4F5CA 5BO1H 2BNRA 4I2XE 2Q2EB 4U6YA 2XEEA 1QRNE 4JZOB 1P1ZB 2C34A 2MBBB 2YSSB 3EHQA 1IAOB 2LD9A 3FL7A 4HMCA 4D9RD 1J12A 1ZBPA 3IFPA 3VGGA 2GG1A 2MCG1 1A25A 1XH0A 3EHNA 4KUZL 4GEJA 1MIEH 4W9GC 1OQXA 4OLUL 1S9WB 1KT0A 3IDXH 5AARA 3U6RA 1XCQL 1UASA 3VD1A 1FWXA 1PGBA 4M3OA 3DEPA 2YGQA 1WXVA 3SDDA 4HX1B 4MLIA 1J11A 1DJXA 2WDQB 3DTXA 4WW2F 4NOFA 2HYMA 3L4PA 1J0ZA 1MIML 2CDGB 3UINB 4DP6X 4Y5VB 1LD7A 1F86A 2J8HA 5KANG 3QWQB 2FR4A 4UQ3A 4P3DB 2MHJA 5E8EB 3QVAA 1SLUA 2I69A 3K91A 4E9LA 2BK8A 2NY2C 4HDQA 3L6AA 2X42A 4NKMB 1WTGT 1TJCA 3BLKA 1C08A 3G04A 1KTKE 2K25A 5CHEE 1NIFA 3QZOA 1BM3L 1IJ9A 3UTZA 2QQKH 1OEZW 5I66B 2APTA 2M4NA 2UWQA 2R4SL 2B59B 4IOFC 1DCEA 1INEH 2BXZA 1Y6MR 2IH1B 1I4FA 2CGRL 3QXUA 4P2RE 5E5MB 3U9PH 2BNQD 4Y1AE 2CXGA 1VB9A 4BCZA 1J1PH 4ACLA 3GGWA 4W68A 1HS6A 1HXMB 1BD2A 1UJ3B 2CKBA 2ITDB 1OTTC 1CPUA 2ZNWA 4H5SA 4PGCA 3PP4H 4U1GC 1UZ8A 3APDA 4OLYL 5D7LA 4QLWA 2AJ3A 5DMKB 2XBBC 2LNIA 1QD0A 1E9OB 4K3EH 3U6XA 3RDTC 4I9CA 4H40A 3MUGA 1AY1H 3FCSB 3B7YA 5AG8A 4HK0B 2BYVE 1WZ1L 25C8L 1I75A 3QWVA 3E6HA 1ERNA 5LCWJ 3PUKA 3EFOA 1V3MA 3SKJH 4M5YL 1YUHB 3M8OL 3B9DA 2YKKA 1P5UA 3SE3C 2M19A 4ODTH 1FFOA 2KQ7A 3WJLC 1T66D 5KYXB 3MLTB 3C6LC 2P8MA 1T3FB 4I77H 3K0YA 2XBZA 4TQIA 4M6ML 1ZJAA 4B0ZA 3MLXL 3QA3A 2H41A 2X6AA 3S97C 1WE7A 2B4CH 3MLWL 2ATKA 3CQPA 3IWUA 4WEMB 2L3ZA 1F1AA 1YNTA 4Z5RB 1TT6A 3SGKA 2D3GA 3UGUA 3ZHEB 1I3GL 2C9AA 4X9FA 3MCKA 2EVFA 4IUMB 1IP9A 4JMXA 2AJUH 3B3IA 1DBBH 5AVUB 2HR2A 3BZ4A 3H53A 2N7SA 4N3TA 4NN6C 2R5SA 1EERB 3T3PB 2KQMA 4OLVL 5INCA 4Q9RH 4TUKH 2IH3A 3RWFB 4H8PA 2ZD0A 3LIZL 5FKAB 4ACTA 4P04A 1EWCA 4DWHA 2Y07L 3F5WA 2NY7H 5ITFA 1NDGB 2F37A 4EVNA 1CI3M 3HLAA 4OCWL 1MG8A 1KLGA 2X28A 2BTEA 1PLCA 5F8QC 5K5YA 5LXGL 3X3GH 1J05A 2QMKA 2WB2A 2NCNA 3F84A 3SODB 3GNML 4GRLB 1JHLH 4ENEC 4LKCB 3C98A 2BDNH 3MLVL 3D4GA 3MA7B 1I9RL 3WO3B 1CZ8H 2GSMB 1J9CT 1PKQB 2AJXL 4GMLA 4FEMA 4HPLB 2R2CA 2WQ7A 2YQGA 1UACL 5KVDH 2B0SL 3F64A 3N20C 4FI7A 4Y2DB 1UWXA 2W0FB 5D1QB 2R03A 1V05A 3NSCA 3G6AA 5J90A 1NBZA 5EU3A 1A5EA 4LL4A 3KD7A 3DPBB 4YEFA 3C6EA 4C8XA 5T3XD 4RBPK 3TS8A 1GMIA 4KYOB 2VABB 2NMQA 5D7EA 4ARIA 3S3CB 4WUKL 3IJ7A 2WB1A 3JT2A 2RFMA 1BOYA 2XWEA 5B1AE 3RIKA 3ZDWA 4HFGA 4HAKA 4X7FC 1LO4L 2C5DC 2NY3C 4OZFA 3I9V1 3UZQA 4L5FL 4RGNE 5FB8B 4HVBA 1TBEA 1O1TA 3PRZA 2EIMB 2AJZA 3CVCA 2PP8A 4KDTC 4R83A 4X7EC 3N91A 2AANA 3X12A 2FCQA 3TJHC 3PPAA 2Z31A 3SYPA 1DBKL 3MRGA 3RNCC 1HWHB 5E00A 3HZYB 3ZRFA 4PJGA 2GW1A 1L9SA 5DD0L 4BX9A 3SU8X 4ELMF 3AEFB 2G75A 3VWKC 4AQ1C 4HOZA 3P9WB 5T4YA 2EDEA 1HL5A 1DQML 2YUXA 3IJEA 4QFVA 2JVUA 2B15A 1WYWB 1X44A 3RSEG 4YO0A 3W3BA 4KI5E 2L8JA 4Y4HC 1JWSA 2GSIA 4YSTA 3SHQA 2EADA 3N85H 3NZSA 4X6FB 3FQWB 1WWCA 1J8HE 4B9ZA 1O5PA 2Q7AA 2DIEA 1FCHA 3FU0A 2NZ1A 1R0AH 3E9SA 2F19L 4C4VB 3TH3T 4NNJB 1BFVH 5IFAL 1GZPB 1QBLL 3VXTA 5FQ6A 2I9CA 2BLFA 2W0LA 1LNUA 4Z76B 5DZJA 1PKOA 2GK0A 2WCSA 3HNVL 4OV5A 2OR8A 2WLIA 4UMSA 5C0BE 4HZLB 5E4IA 5IMMB 3R18A 3Q75A 2KATA 2PYEE 4Y9BA 2W82A 1DBAL 4GRLD 1XF2B 4A90A 4YSSA 5G5HA 3VCLA 4K2UL 3KGTA 2R51A 4UQDA 3UBXB 4NHCL 4HJJL 1XQQA 2WUBH 3QIBA 4XMWA 5TE6L 1ZSDA 2OMYA 3C19A 2AXVA 4PJIB 4X4ZA 4Y2DD 1EO5A 1ZS8B 3ZTNL 5D1QD 3CZFA 2AXFA 1ZHNA 1TLKA 1IL1A 1U4EA 4R96A 1EUVB 2N1VA 3H8HA 4FQIH 3WFHB 4BFIA 1I7HA 1D5ZC 2JWZA 2R69H 4YE4H 2N0KA 2UY6B 4G9DB 3VXQB 2MRIA 4A6YB 2DZEA 1VACA 5DJYA 5FHBH 3OWRA 4Z3TA 3BN9D 4RZCB 1KZQA 4JL0A 2E7DA 2WNGA 1F4YH 1O7SA 4H26B 3FU3A 2RIKA 1N59A 5HJGA 2CR5A 4CUCA 4X7TA 4X5WB 4RMBA 2NX5A 3MAWA 5HDLA 4QCIA 4RFEB 1T83C 1MRDL 3G5YB 3SDLC 2HDEA 4EKXA 4HHAA 2NTFB 3AC0A 1LILA 5JHAA 1CLZH 1NCHA 4ZRGA 5F93C 4NZRL 4GLRH 2Z59B 2ZWNA 3S8FB 1KLVA 1WIUA 3VFGL 1E5AA 2FHCA 2DTMH 1NAMA 3HZMB 3C2AL 4DGYH 2I60H 4M9PA 4GRMB 2H8PA 1AWCB 2D7TH 4YGVA 3RPBA 3FT1A 4NO3B 3RYMA 4KQ3H 2IO1B 4K5LA 1EV2E 2J8OA 3SFYA 4TULH 4IHOA 4F2ME 1XQ4A 5IQMA 1A5RA 2WAQA 2J8UB 4IBQA 1IYGA 2YZ8A 2WX0A 4EECA 4NI3A 2BSSB 1RFAA 5ANHA 4Z7WA 3PGCA 1F4XH 1TKWB 2K1FA 4Y89A 4UQ9A 4HT1H 3U4KA 3DOIA 1P98A 4OYSA 4KXCA 3UAAA 3NAWA 1AG6A 4FQ2L 4H0IA 2Y24A 5T3ZD 4YIQA 2G9HB 2LGXA 3B7UX 4HRNA 2AV7B 5AEAA 2YARA 4Q6IC 4YHLH 1LEIB 3CC5B 3VTXA 4ZFOL 3PV6B 2VIRB 4PHZA 3D08A 3SN6N 1ODUA 1HSAA 1PX8A 3DXAA 5F3FA 3LPPA 1YY8A 5LN4A 3D9IA 3JV0A 3M6DA 2XZAH 1I4GA 3E8UH 3UC0L 5I1LB 4ZAKC 4MSMB 1Q0XL 2IZVB 3PLYA 2BOBB 2MRYA 4KVPA 1KFYB 2UWJG 5AL8A 4NENB 2QR0B 2EQXA 1OCZB 3NJHA 1G9MH 3KVDD 4NNPL 3FEXA 1FG2B 3DUUA 1TQTA 4Y2OB 5J3HC 5J13C 1B0GA 4EOYA 3U2JA 3HRPA 4OF3A 3CVQA 3MA5A 3KL5A 2KH2B 2OMWB 3FFDB 4ZMXA 1M9WA 1G7MA 4HULB 2XACC 4WGVB 3FAWA 4HOXA 1JPGB 5HGAA 4KKIA 3CQFA 2ENYA 4WTWA 3WXXA 1OK8A 2NR6A 3Q5YA 2CO7B 3QS3A 2WLJA 3TEYA 2V2XB 2QGDA 2YLMA 1J8SA 2HT2D 2MOQA 2UWEB 2QQNL 3EECA 1GJIA 4APOA 2YPLE 4F8NA 5LDSA 4G3XB 1INZA 1YECH 2X4OB 2BIPA 2AEWA 1CLOH 5IB1A 2FO7A 3KWUA 2MKWA 4IGBC 1ZTXL 3CBKB 3MRIA 2BVCA 5CIPH 1JNLL 3V5DB 3VM7A 4CVXA 5A7BA 1E8YA 4UM9A 1EAOA 3V95A 5CEZD 3VD0A 4F37K 1QNZH 1A7PH 1R4XA 4ETYA 3Q8FA 1CTOA 4KX6B 1TN6A 2O4EA 3ZDYE 1Y0LB 2VMDA 1NIEA 3ZTJG 2E9WA 1PY4A 3ARGA 3QIUB 5CILH 4XBGB 2LGNA 1IMHC 4ZD3L 1QEXA 2VZOA 4YC2B 2ZCKH 2FJFB 2NW3B 2DYPA 3MOAL 5AUMA 1ZGLB 4J8RA 4IS6B 3HC3H 1Q9OA 3OKYA 2YO3A 1K1BA 1Q0EA 2YPVH 5MEQB 4KQ0A 2M0AA 4KVGB 1YMHA 2F53A 2PTTB 3FPYA 4D0BB 5M94B 1SOSA 2G9HD 3MJ8A 4PY8J 3SKNB 1WM3A 5E2WL 2WCPA 5IHUH 2AQSA 2KZ1B 4JW3A 1J87A 2G2RA 2B3AA 1IFHL 2B3RA 1HH9B 1IBYA 2B1AL 5CZKA 3FQTB 2IEPA 5DVOA 5JDSB 3I75A 1R17A 5GGVL 3U9WA 1HH6B 4FFWD 1QHOA 4X6BA 4KTDH 5I15H 5DRWA 3GSXB 4KTEL 3KWWA 1EXUA 1B4JL 3ABMB 2VSNA 1B3IA 1KGUA 2CO1A 3VI3F 4TNVK 2GB1A 1F45A 1JK8A 5CJ5A 2K39A 2GBUA 2VLKE 2WIIA 4GYOA 2J73A 3H7BB 5G4OA 1UZ6F 5HHXL 1JOIA 3U25A 5FCUH 3D9LA 3NIFE 2VH2A 4QO1B 5I17B 1UNSA 1BQLH 3BO8A 1U6AH 3GT6A 1ZDQA 4LCWA 4UDUB 1QOGA 4PRHE 3L9TA 2CUIA 2WVTA 4JJ5B 4N87A 1PIFA 1EDYA 2EVHA 1XXFC 3RRNB 3VXOB 2RDHA 1JK9A 1BYOA 4V11A 4XAKD 1IZJA 1FA4A 3CC1A 3GHEL 4YDLC 2NYJA 3K5SA 4GI9A 5FO7B 1UM5L 1LYQA 1C5CL 2R7EA 4C83A 4E5XA 3PZ2A 1WZKA 2JZZA 3T8XA 5E2UL 1JZGA 1RJLB 3AQDA 1NANI 1MCNA 4KTGA 4MM3A 3VLFA 4U6TA 4XHJD 1H2VC 1MAMH 1A02N 1QFWH 5DRZA 5LBSA 3S34H 4XGZA 5DO2D 2VW6A 3WNOA 5T3XL 3QIUD 3E3QE 2KDBA 3FFCA 2DMHA 3OKKB 2NQ3A 4Y19E 1A6PA 2QEJC 4PRAA 1A6WL 4XC3L 3V5KA 1P84K 4B0MB 2GLSA 5J4MA 3U30C 4LOUD 4KXAA 1WAEA 1I9JL 4GO6B 4XE0A 4M1DL 3O2WL 1DJGA 2D7PA 3DPYA 3OX8B 4JHBA 4X4KA 4E9VA 2QVFB 1ZLSH 3BFQG 4HFWB 5CWSB 4FG4A 1AOHA 4K3GA 5KOMC 4AZ8B 4E9XA 4XXWC 5AKRA 1VEMA 2WMPB 2E6QA 4Z7UF 4B5ZA 4F27A 3EDTB 2BYTA 1RL1A 2JF5A 3ARDA 3LVTA 4P4RA 1WFIA 2XWCA 2KO3A 2HFFA 2WQVA 3EGSB 5HHOE 3AB5A 4EI6B 5JIDA 3MNDA 4K9JA 4OZIB 4TSBH 1DBML 5L8JB 1RU9H 3RGVC 1JI2A 1W8EA 3VXNA 5A16B 3LH8A 2EYSA 1IARB 3MMEA 4LASL 4MACA 5JH5C 4GAJH 1IAIH 1V7ML 2KKCA 4UNTA 2O5XL 4N3CA 3MFGA 4KUCD 4UQ2B 3R1GH 3QC6X 3TP4A 4DGVH 2HFEB 4DTGH 1YX5B 4K7UA 1WGVA 4W9DA 5BOJA 3ESVF 4ZXBB 3QCUL 3V8CA 2MMXA 4YMPA 1CL7I 2DQJL 3GXPA 4JB9L 4Z7OB 1EM7A 1FC2D 4MNGE 2PWFA 3TEWA 5BYRA 3ZDZE 4OZBA 1ZP0B 2LHDA 4E41B 4FA6A 4PS4L 5I6NA 3UBFA 3C5ZC 1IFGA 4GDLB 2WV3A 1KC5H 3UTPE 4FNTA 3VXUE 4DN4H 1OCOE 3VFNA 4LQFL 4I1NB 1OWWA 4I2XA 4OGYH 5ALBL 1XZ0A 3NFNB 2ZJDA 3UF8A 3V60A 3RU8L 4K9EC 1KCKA 2OP4H 3IG3A 2UYLA 1RUQL 3BT2H 1A6ZB 3RHWF 4QHLA 3Q06A 5KS9E 4KTYA 1WJ3A 4TM9A 3VXRB 5DUPL 1ACYL 1YJDC 2UY7B 5D7IB 4YL4A 5EU5B 3DBRI 1UT9A 3BHBB 1MW0A 3MXWH 3L3GA 5DHEA 4WHYH 3WKNA 1E5UI 4LIQL 3LXCA 1PZ5B 5DD5H 4X8JA 4TL4A 5JYMA 3JVFC 1LXDA 3KYNB 3PE9A 4HIPA 4LEOA 4OKDA 3PABA 3P4SB 5T1KA 4ZMOA 3ECBA 1FORL 1J0YA 2ADGB 3V2XA 2X4NA 3JV6A 4XPFL 2VN4A 2ONQA 5LP0A 3EJZC 2PCPA 1OSPH 4GRWB 4NEHB 5HVGB 4DQOL 1WGDA 3G2SA 2KNBA 4LZKA 4JQIL 1KTKA 1T4KA 4L9LA 3QIWC 2X10A 3SE9L 4H25B 3S5LA 3RVTC 4X9IA 5E08L 3HR5B 4FE9A 4QRPA 2YD0A 5L4IA 1W6LA 4P2RA 4I17A 3PQYE 4UNIA 1HI6B 4Y1AA 3VI4E 4WF7A 1SVCP 1V86A 2LAAA 3KJ4C 2RPQA 5I5RA 3DBRB 1KBGH 3HPLB 1SJEB 3W9DB 1BM3H 1NEZG 3MRCB 2V9UA 2V4LA 3Q78A 4L4VE 1ACXA 2XX0A 3P73B 4F7AA 3BZDA 1AD0B 3NJJA 3D3VE 1KJTA 5ARFA 1FZOB 2CGRH 4HG4J 5HPMB 1XSJA 2PABA 5DD1H 4ZXBD 4B9GA 5DZ9A 4J4PC 4KRNA 1X9QA 2J1ZA 3FRPG 1RLWA 4OKVA 2LLLA 2A5UA 5IBUG 5ABAA 4DEPB 4OLYH 4E41D 2LSUA 4L1BA 2G5RA 3PHOA 3PP3K 4ZX3A 4JKMA 5D6CA 5CBEB 43CAB 2CJOA 4R7DA 3QZNA 4D8OA 1NBYB 3QQ9D 25C8H 3D7PA 4JM2B 4KKLD 2ZE0A 3MHSD 3VGDA 3OG6B 3LH2L 2VERN 3N9YC 3QNXB 5IV2B 2E7BA 1CFTA 2MJDA 2OJRA 3HUJA 3M8OH 5H8DA 1MFMA 1WHOA 3H9HA 4MJIB 1IGFL 2CMRH 5JA4D 1KB5B 2FBJH 5EB9A 3TFBA 3UIYA 5JR1L 3MACH 4JG5A 3MYJA 3OPZH 3HC0A 4F9PA 5E0QA 5MEPA 1M2VB 5E4EB 2YUVA 3VXRD 4F7ZA 2ZCHL 3O0LA 4LOEA 4FG2A 4DN3L 1WE6A 2EKIA 1WFYA 1DQDH 5BQDA 3OXSB 3SFZA 1OSZA 4P2QB 4ZS6D 4HEME 4W9EA 3VQ2C 3WAJA 1CICB 1T7VA 4FABH 3G5VB 5DHMC 1DQTA 3OGCA 5C08E 4PS8A 1UGKA 1NCCL 1JRPA 1L7TL 4X5PA 5B3SB 1BFOB 2AQTA 3EYOB 4HUKB 3SE4A 2J08A 2XNAA 3HI1B 1SOKA 3EOAA 3LNDA 4F2EA 2WINA 2BNRB 3IGAA 2YHCA 2IY0C 2Y72A 4ZTOL 2FWLB 2J52A 1DQLH 2VDQH 3KYCD 1KUMA 2B8OT 4FTDA 4AT6A 3IFPB 2NNCA 4JG0L 2HXAA 1A17A 1JUFA 4I48A 5EBWA 4D2NA 2A6IB 1QWHA 4LXFA 1PEWA 2OTUA 3KPRE 3BUTA 5TQ0L 2GEQA 3U6RB 1MJ7H 3N1GC 2VC2B 3I02A 1SJED 4JKLA 3SDDB 2AJXH 3ZMRA 5GRXG 3DTXB 4WWOA 1B4LA 3O3UN 1UACH 1ET6A 3JTTA 3PPEA 1WGGA 4GI8A 2NC9A 3X3FH 4LHQB 3GZ2A 1IGMH 1WAAA 3ASNB 3LX9A 4UQ3B 2FR4B 4WHCA 4GRLC 4CT4A 5K9QG 3M45A 1NGXA 2P48B 3QUXC 3SKMA 3LXFA 4S1RL 4GQQA 2GT9A 2N9LA 1C08B 4IBLT 4P4KA 4TRPL 4AE1A 3G04B 4GZDA 3I57A 1X9RA 3BWSA 4R7VA 4I8DA 3AEAB 3UTZB 2IF7A 4JM2D 3AITA 4BZAA 4FLBA 3AEBB 4UILH 2V0PA 1A7BA 4CEMA 5KNHD 4HI9A 4MJID 2BSEA 3ECWA 1QKZA 2WBJC 1LO4H 2I27N 4AMKL 3GGWB 1LEGA 4NUPA 5KBDA 5EILA 3E9UA 1PUTA 1BD2B 1ULVA 2CKBB 1CQVA 2YAOA 1CGSH 5D7LB 1UZ8B 1KZYA 3BN9C 2AJ3B 2IONA 4PRBA 2VZVA 2ZUWA 4P2QD 1FNWA 4LNGA 5IMKA 2K8MA 2YJLA 3MUGB 3FO1A 1UGMA 5M72A 1E6JL 1CICD 3WIMA 1P53A 4J27A 2H6PA 3E6HB 1C4PA 3EFOB 3V6FB 3R2IA 2J1XA 3MKQA 2ZXWB 5C6PB 1P5UB 1ZOYB 2BS3B 2Q6WA 4EBQL 2NDGA 1E4WH 3GHBL 5C0BA 4K7SA 4BZ2A 2DIJA 1S5IH 4B5EA 4RLYA 2BNRD 2EO7A 2PYEA 4Q4IA 1ID5I 5C2UB 2F19H 1A7QL 2PR4H 3GXDA 2BM3A 4OZGE 4URKA 4JVSA 2CO6A 3QA3B 1QBLH 4LSUL 4U3XA 1JYNA 5BMIA 4HS2A 2VM9A 3KWLA 3BWAA 2ATKB 3HNVH 4OTXH 3ETBJ 4I89A 1BDYA 4XC1L 2ICIA 4IMKC 4HWBA 1RW2A 2X89A 1UG9A 1YNTB 1KG0A 2XA3A 3UTSE 1JUQA 3HAEG 3FH5A 1H0DA 1JWMA 4KQ4L 4N22A 2YUWA 3MCKB 2K0PA 3WFBL 3NOIA 3B3IB 4ZYKA 1SW6A 3SDDD 3PAYA 1I4HA 3CVHL 3WL9A 5A2BA 3NDYE 5INCB 2IH3B 1FBIL 2OK0H 3NCFB 5DQDH 4M43L 5A43C 5CGMA 3IT6B 4BHUA 2Z7UA 5I5IA 3F5WB 5ITFB 4HALA 4TNFA 4FD0A 4EVNB 3HLAB 1HT6A 4JFOA 4U0RC 4I43A 1KLGB 3Q1SL 1QVOA 3KW8A 1WGRA 1LO2L 1J05B 4U33A 2R29H 1UH6A 4ZUVA 2D4FA 2N4FA 1EGJA 2JABA 1AYRA 1VIWA 5DJAA 1IAKB 3WIHA 4HXAL 3ZGHA 4C4KT 3VD9A 1RULH 3FBQA 5DHVA 3V3XA 4Z1PA 2E6PA 5LNK1 3TJEH 4LEUA 4W81A 3SDXE 1EAJA 2HTLD 3GBMH 5AKVA 3G6AB 4CU7A 3EKCA 1NBZB 5EU3B 1F77A 1BD2D 4UTBL 3QRFM 5E8DL 2HA1A 2FT7A 5D7LD 3GZSA 4TUUA 1JFHA 4DGIL 2LGDA 4ZOBA 1YN7A 2BVOA 1IHGA 3NVVA 3CVPA 3TEXA 2KDYA 3ZGZA 1NOAA 2CUMA 1CJAA 1WDAA 1KJ2A 2VMCA 3KDMA 2HT2C 1CXKA 2AJVH 4AVHA 4OVUA 5DJ6B 4FQLL 1WP6A 4OZFB 1KBWA 4GSRA 4GP5B 2MQGA 3EHBB 3UZQB 4E9TA 1DVUA 2EKJA 4DPRA 4PLNC 2AJZB 2YXFA 5JW3H 3QI9A 3ISMC 4L2LA 1R47A 2Z31B 5IQ9A 5A2CA 4E68A 1IBXA 3MRGB 4EXKA 5E00B 4PJGB 2DQDL 3LKRA 2ZYHA 2G75B 5ESAA 5EEVA 2H88B 3H42L 4MLSA 5I28A 2H6FA 2PWGA 1SZAA 2F54E 4AEHH 1WXSA 4YO0B 2KN5A 5EDSA 2JKNA 3ZUCA 5CCJA 1JWSB 3PUCA 2GSIB 1QI4A 2VT0A 1P0SE 4K5AB 4GKNA 3RO2A 1FJ1A 2A77H 3L7FA 3LXBA 4H0LC 4XP4H 2P9UG 3C60C 3TBBA 4ZMZA 2MJ3A 1H8CA 2ZZPB 1JJUA 4PYHA 2ON8A 1KZPA 2Y7NA 3VXTB 1LNUB 4CMHB 4XKCA 1CT8A 2GK0B 2VERA 2XWTA 4JM0A 4OV5B 4HUCA 4EKJA 4F3FA 4XNAA 1KLGD 2WLIB 1HYRC 4P46C 4J2XA 5D7GA 2BHUA 2ATPA 2DLEA 5HFYA 5E9DA 2YPLA 3APMA 1CE1H 2XN9E 3VCLB 4U6HA 2NY0C 3LEYH 4OFIA 4TNWK 2LFIA 2LMCA 3NJLA 3EZJB 3QIBB 1H19A 1ZSDB 2OMYB 3K0WA 4JG9A 2C9XA 2SODB 4NKOA 2DB8A 5GGQL 3HVZA 1UADC 1PAMA 3CZFB 4Z9KB 4DPCX 2AXFB 1ZHNB 4F2FA 2AC0A 4R96B 4YOKA 4RAHA 3Q0HA 4BFIB 5I6KA 1OCRB 4UINL 1RZJL 3T0WA 2ZKHL 4L9DA 4N6QA 5KHQA 4L8CA 1A4BA 1BREA 4G26A 1CXHA 2R1YA 1Z3XA 5HI4D 1VACB 1ZTXH 5DJYB 2R39A 2BYEA 3BH9A 4MA8L 4K7PY 1EWHA 3AM8C 1S9KC 4XE5B 3M62B 3T3MF 1T0RC 2PMVA 3RKPA 3TTYA 1N59B 4X7TB 4K9EH 5GS0C 2FCBA 4LVHB 4JY6A 4CA4A 2NX5B 3SE8L 4QCIB 1JRHL 2YKLL 3EHBD 5C09A 3MBWA 1FEHA 3LZRA 4M01A 3LAFA 4EZKA 5CRVA 1V27A 1ZMYA 4ZD3H 3WJJA 1P3QU 1YJDH 2GIXA 4PJCF 4RMTA 4TN9A 5JPMC 4KGTA 1NDTA 1N4RA 1FSKC 1S8DA 2Z31D 1I1FB 4HHAB 1TXKA 3DSTA 3FMGH 5L7XH 5HDBB 5IB3A 4LLAA 3GS2A 1A6VH 2WXJA 4DJMA 4ZQTA 2M8SA 3WAMA 3MYVA 1XFPA 1NAMB 4XP1L 2FX7L 5DHXB 3NEOA 4PW4A 2H8PB 2D0HA 4M7LH 4YGVB 2HKHH 3QKYA 4LNOA 5E2WH 3S8WA 1JWSD 2BW2A 4HBDA 1R3LA 2L7UA 3MSPA 3KZ8A 2XKUA 4FHJA 4NUMA 6CGTA 3ILQC 3FUJA 1CGUA 3GRWL 4Z7WB 3PGCB 3REVA 4DHZB 1JV5A 5GGVH 2E9BA 3HI6L 1JZJA 2N0MA 1A1MA 5CTRC 5KSUA 4XVSL 1GGIL 3AADB 4PRHA 4KTEH 6PAZA 5LXIB 4YIQB 1D5IH 2JJSA 2NY6C 4U0SA 4HJSA 1E8WA 4LSSL 5I5JA 4GQRA 4CC1A 4Q6KA 4G6AC 4M48L 3UJJH 1UD6A 1Q9KA 2XQBL 1LM8V 4BY6A 1H6EA 1HSAB 3DXAB 1KXQE 1YY8B 2XHEA 4UB0H 2TSBA 3ORJA 3GK8L 1V5TA 3O8XA 1JD9A 3QO1A 3QIBD 5IEHA 1WXQA 3A4AA 1MCIA 1A64A 3LQAC 1KT1A 5HI3C 4KK5C 1WQVT 3DX7A 4QEGA 4FLQA 4XT1C 1V54B 5A7EA 2R61A 4PJ5E 3PAUA 3ESKA 2EINB 4IM8A 2XFGB 1A4KA 3DUUB 4B6ZA 4OIFA 5G5GA 2XWRA 1B0GB 1MFDL 3F65A 3GHEH 4GW4B 4CSZA 3D32A 4L8SC 1E4HA 1L9TA 2W9DL 4X6CF 1WVZA 1UM5H 2X2YA 5H2BA 1G7MB 4Y19A 3AG4E 4AYGA 4DOHE 1NOLA 1IGIL 2EVIA 1PL3A 2AABL 4D3CL 2DKUA 4G7RB 2P8LA 3EUVA 3Q4AB 4FFTA 5J9PB 2NX5D 4KGJA 2IALA 4IRZH 1QSFB 3BEWA 4I7ZC 4ZUTA 2JUOA 2K7PA 3HMWL 2AJYH 5A2FA 1JNHA 4LPTA 2JXXA 1CD0A 1MCPL 1EDUA 3T08A 1U93A 5DQ9A 4XMZA 4XC3H 3AG3E 2BVTA 3WNPA 2WWKO 4BBNF 4HSAC 4ZUWA 3MRIB 4CVXB 4YFLF 3UKUG 4UM9B 1KB5L 1JP5A 4D2KA 4LUNU 4XNXH 2IGFL 5D2LB 5I18H 1YJJA 1YEFL 4PG9A 3HEIB 3DO4A 4ISVA 1MCJA 3ARGB 3AUWB 3SO8A 2Y0SA 3SBWA 2BKRB 1AZBA 1K8IA 4O9HL 1T7XA 5AUMB 2DYPB 4APFA 4PT5A 2CHZA 4ZMYA 3FNKA 4J8RB 5IROA 3HXDA 4U05A 5FGRA 1Q9OB 2ZUXA 4HETA 1P7FA 3FCTA 3IGKA 1YMHB 2F53B 1EEQA 3MJ8B 4MS6A 4FN2A 4A7GF 3VXUA 2E4TA 2Y25A 3H3KA 4V33A 3TSSA 2J3SA 3QAZB 1K52A 2VSXE 1P6FA 3DXAD 1EZSA 2G2RB 4AIFA 3W1ZA 1CG9A 4I9WD 4MRBA 2W0KA 3GJFK 1RZJC 3I75B 5D96C 3VAWA 2XRZA 4PS4H 4QHKJ 5E6PA 4UI9K 5KS9A 5EEXA 4X6BB 3N43F 2IOLA 4NAMA 1I3RA 4XCCH 4LQFH 5DRWB 2LR4A 1B90A 3IFLL 3KWWB 1EXUB 1MWAA 3HFMH 3SF4A 4AVIA 7FABH 3RFRA 3X14A 1SBSL 3OZ9L 4MMZC 5D72L 5I24A 1IBDA 1JK8B 5CINL 3BVZA 1NUFA 2WIIB 3BFOA 4KI1A 4PUCA 3EDDA 4EBAG 4HPHA 1KF9B 1SHMA 4U1LA 3BO8B 5IB5B 1TGZB 4YVOA 4LCWB 3ZMEA 2NR6D 4N5ED 5LCWC 5E1GA 4EQ3A 4KKLC 3ZIMA 1QSFD 4J8FA 2EE9A 1N64L 4NQTA 1JK9B 1KIRA 1PZ3A 1BVNP 4QDGA 1XVSA 4PFEA 3O6FC 3MQIA 3U82B 4HWIB 4KRLB 4X6EA 4PQXA 3JUZA 4B41A 1FORH 5L88L 2R7EB 4C83B 4UM9D 4E5XB 3RVVC 3PQYA 3T8XB 3VI4A 5AW8B 4LNUD 5HSFA 4NFDA 4W4NA 3PUUA 2FATL 4NO0A 4MM3B 2VN3A 2R2BA 2CKBL 3IFNH 3NABL 4JQIH 1OHQA 4TQPA 5DRZB 3WKQA 5MEOA 4WK4B 4XGZB 2O5YL 2WXRA 3PLVA 3MR9B 4IKKA 4RFBA 2GBNA 4NM4L 4ZOEA 4L4VA 3RVXD 3ARGD 5TD4A 5E08H 2AXGA 3FFCB 1CBVL 3MJ5A 2YAMA 4C54A 3NVWA 4PRAB 2R59A 4KJQD 2DYPD 1TYRA 1N52A 5EPMA 3Q6FA 3CLFL 2CCLA 4JREC 5E6RB 4MJ4A 2F53D 2DJSA 1D3CA 1TJIH 2X7LA 4OF5A 3BQOA 1KCUL 2ZXAA 3Q7JA 1T03L 1XF3A 1YQ3B 1DYQA 1S7WA 4UBDC 3MNVA 2Q86A 1S6NA 5FYKU 3ARDB 1XXDC 3BCFA 3FN9A 4OCXH 3CZSA 4P4RB 4IHBA 1GYCA 3SY6A 2WMNA 4EZJA 2HFFB 2QMJA 1FZJA 3MGBA 5BV0A 3DDCB 1HHGA 5MI0B 4BVUC 3GEFA 2VXVH 2WCGA 3VTUA 1G7LA 3CN2A 3LZFL 5TJWK 4JQXC 3VXNB 2EYSB 2L1AA 3MMEB 3WY2A 2IAMA 3V05A 1ZXIA 4IDJL 3C87A 4OD3L 2IPTH 3TA4D 4GO9A 5GGSY 3G2VA 3KNBA 4PG2A 3ILDA 2JY6A 1CGVA 5JR1H 3FT3A 1MHXA 3DVFA 2X4RA 2VQ1A 2EILB 4JFUA 5EX0A 4KKAD 5C08A 1BCIA 4ZMNA 4LCWD 1U21A 3UMVA 2F18A 1H6PA 3LPFA 3QZBA 5EE0A 3VFNB 5KSAC 2XTLA 3HCVA 4I2XB 2CPUA 3OVUB 1QRNB 1XZ0B 2IWGA 1NWPA 3P0VL 4Q74A 1D5RA 5SV4A 2L7JA 3TVMA 1MFWA 5DEGA 1BMGA 1NCCH 2UYLB 5GSRB 1NMCB 3PNRB 3ZNGA 2ILRA 2GC4C 5J11B 1TJGH 2KBGA 1GXEA 3L10B 4MJ6A 4FG6D 5AZ2L 4QHLB 2NTTA 2A4ZA 2DV6A 3GRGA 3GMRA 4ACKA 1W0WA 1GRWA 3KLLA 5SWQA 3T4AC 4N8UA 3VRJA 2FJUB 2WLKA 4UWKA 3QH3A 5F7DA 4I2ZA 1E30A 4WO4C 1DNPA 2X53A 3VA2C 2PW9A 4TQ0A 5JOEA 3UQBA 1WHPA 3L3GB 1KBPA 4CYEA 2AQRA 3FFCD 3KVQA 4X8JB 3VTTA 5IHLB 5IBTH 2YFOA 3NYKA 4LEOB 1UD3A 2F9BT 3ZRSA 5D6DC 1G7JA 3HI5H 3ECBB 5CGTA 2X4NB 1GGYA 3L3OC 3JV6B 4H20L 4JUTA 1JGUL 1G0DA 1P84J 3ESNA 2YK1L 3QFJE 4IYPA 4LMQI 4ES9A 1HF8A 3UMTA 4PJBE 2VISA 2APWA 1WFTA 2PCPB 4P5TA 2TSSA 1AS6A 4BBWA 1J10A 3DRTA 5DK3A 4JFHE 2BO0A 2Y23A 3T2QA 1H6FA 4L9LB 3U83A 2ZX5A 1USZA 1AP2A 3ARDD 1CURA 2AL6A 3ULQA 4QGYA 4P2RB 4BM7A 2Z65C 2DM2A 4Y1AB 2LWPA 3UI2A 4HDOA 4AKQA 3SDDC 2X0WA 3TO4C 3PFUA 4YDVA 3ARFC 4TQ1A 3OR6A 5HYIA 4X5RA 1LMKA 4B50A 1TQSA 3KSQA 2Y9RT 5FT9A 4XNUL 4HIXH 5CZRA 4P57A 3BZDB 5EOCJ 4R0LC 1MCDA 3BE1H 3FWVA 3D4CA 2ZP9A 3IRCA 1L6XA 4FFVD 2GGFA 2ERJC 4JRXE 4UIMA 3UGBB 3U2SA 2G5BA 3L1FA 4KZ0A 4Y8AA 4KGRA 4W9IA 4OKVB 3KPNA 3LKQB 4UOW1 2D4DA 1LGRA 4AGQA 1KIUA 1UOHA 2ARWA 4NPNA 3PHOB 5D6CB 1CXIA 3H9SE 2JU6X 1XWVA 1NIDA 4O5LH 3ZHNA 2KL6A 4R7DB 5IFJA 1E6JH 1ETB1 4FOMA 3O6ML 4O4YH 1QRND 1T5XA 4WEUD 2J20A 3NCYP 1DVFA 2HTLC 3BYYA 4IRSA 4YR6A 1CFTB 2WOYA 3ZKQD 5DJCA 3HUJB 3DGCR 2DQUH 2YS4A 3T3PF 1CTMA 3FKUS 3MRFA 4BZ1A 1FVFA 4UQIM 1MN4A 5L8LB 3MYJB 5GIRA 3HC0B 3MV7E 3EH3B 5LGYA 5MEPB 3UTSA 1MF2L 1XH1A 3PHQA 4N8PA 1VDYA 3SYQA 3LPGA 3NTCL 5GS0H 4YS4A 1OSZB 4BUHA 1A7QH 1OAZL 2K22A 3OL2A 3PNWA 2FAUA 3B9AA 1OY3B 1S3KL 4QF1A 1HKFA 3IJHA 3CXHK 1F5WA 4XC1H 4ABUA 2PWHA 5E99H 3OGCB 1VGKA 1SZ9A 4HIEB 1HX0A 2XNAB 1GC7A 3EOAB 2NQCA 1BMLC 2WINB 3DBXA 4MZ3A 3MP9A 5DJZA 1CQYA 1FE8H 3BAYA 2W60A 3CVHH 3IGAB 1ETJA 1FBIH 2PLTA 5FDYA 3UEQA 5T33L 1TZ8A 2B76B 4YTMB 5DZNA 4AT6B 1GTNA 3Q6GH 3WTTA 1JUFB 4I48B 5EBWB 2BY0A 4N6EB 1MJJA 1V55E 4P2RD 3EH4B 2ZOKA 4WFFE 3ILPA 4PR5A 4Y1AD 1MAKA 2OTUB 2YIHA 3EOBA 4X7DC 5DMYA 4HKZE 1XTLA 3P0YH 4RRPM 5KWDA 3G6JE 1E2ZA 1NAML 4KXKB 1CVRA 1FNVA 4HH9A 3I02B 3VVWA 1L3NA 5EU6A 3RD2A 2IGGA 5C0DA 2PVGC 1GSMA 4M7JH 1VESA 4P9MH 4XH2A 1BVLA 1ET9A 4G6JL 4LAQL 2X4PA 2Z9TA 3ARBC 4DETA 3JTTB 3FS9A 2P9NG 1XIWA 3TNMA 2J4WL 3THML 3JUIA 5EF3A 3KL3A 4QJ5B 5B1AB 4GA2A 2XY1A 5TGBA 3ROOA 4V1DE 5KBLA 1NGXB 1EBAA 2GTZB 1W0VA 3LY6A 5DVKA 2OSWA 3SKMB 2GT9B 3IWVA 5T5NG 4P4KB 2KFJA 3LQAH 5IQNA 5KVDE 3V61A 2XGOA 3MXVH 3EJTA 2Y7MA 5JZ7C 2YJQA 2ICES 4LCUA 4EUPA 4R4FL 5C6TL 4WEBL 3EJSA 2IC2A 1OTSD 3US1A 3GRBA 1B89A 1DQQA 1LEGB 2JB5H 4JEGB 4LVOC 3TBWA 3MC0A 3VG0L 1IBZA 5FIEA 1RM6C 3RZFA 5E9NA 1UWEH 2F74A 3PWUA 3FPXA 3T0EC 1MJ8H 2L04A 4JL2A 5IMKB 2WWMD 1HG5A 2CCVA 4XI0A 3A23A 3FO1B 4BX8A 3CQQA 4X98A 4HD5A 3QORC 1OY3D 5JHLA 5KWYC 2EYTA 4CZ2D 3GI9L 2XPIA 1UD5A 2H6PB 2KZTA 5DK2A 4ICVA 5LCVH 2DOCA 5IY5E 5CERB 4UDTA 3MKQB 4XB8A 2H1PL 5F89A 4BHUI 3IGUA 2J5WA 2Q6WB 4H1LH 3RI7C 3WG7E 4JGJA 4PJIF 1W8OA 1FV1A 5C0BB 1V1OA 5F6IC 3ZRFC 4AEIL 3OB0K 4QAMB 4S11A 1J5HA 1Z3GH 2K3HA 2PYEB 2PYFA 2L76A 2BFVH 2XN9A 4JGUA 2CO6B 3GSWA 3U1QA 1U95A 3BWAB 4RMQA 2OOBB 1R1CA 4NWTH 1GH7A 3PF2A 2IJ0A 1KG0B 1PY9A 4EFOA 4WNFA 4YDKL 1H0DB 5A3ID 5J2RA 2VXSH 4YX2H 2GCYA 4KJPD 3DBLI 4G42A 4TYUA 3M3JA 4XXCC 3DSVA 2DTSA 4XPHL 3OMAB 1ETA1 1I53A 3WL9B 1XEUA 1X4XA 3I2CL 1OSEA 5FO8A 2Y4UA 3VH8A 5MP6H 2D3VA 3QQDA 2RKKA 4FP8L 4K7FA 1LK3H 3CCHA 1J8KA 1WBXA 4ME2A 1OGTA 1IQWH 2HLFC 4BK4A 4F57L 1AJ7L 5J6HB 4JFOB 3GYZA 1Q4NX 3JWNC 1QVOB 4HUVA 1RZJH 2XN0A 1T5KA 4GMTH 3AH7A 3ZO9A 4P4KD 4IG7B 4ZUVB 1XAUA 2W38A 5E2VH 5FYKH 3Q3MC 2EC9T 3GSNH 5DJAB 4JX1C 2QGCA 3D9PA 4FJYA 1TEZA 4M93C 4UU9A 3TAXA 2J8UF 3LZPA 2KC2A 1MLCA 4MQXC 3FT4A 4G8AC 5IREA 3KH3A 5CLYA 4JZJA 2ICEA 5FOBA 4RDBA 2R83A 3HZVA 4KI5D 3L95A 2KLSA 2WKGA 1H3GA 3V4PH 3CVVA 4U1IA 2LHEA 4JFEE 3VXSE 2H2SC 3ZL4H 5C92A 2P1YA 3P54A 2BVOB 4B9FA 3DX3A 3HB3B 3UYPA 4LVHC 5TH2A 4CSPA 2XRYA 1L7IH 1KJ2B 3W9CB 3FOLA 1CGYA 3EJQA 3KDMB 1B2WH 1FIQA 3IMBA 2J25A 1XT5A 2UYZB 1A6UL 3NZHH 4ZDHA 1L4ZB 1N5XA 2VYRE 1BX2A 1DLFL 4LEXL 1XL6A 5C0BD 4RGMC 4DWFA 4XYCA 3GD1C 2I9LA 3LN4A 4P5RA 1X5KA 1I8IA 2PYED 2GIMA 3IAPA 3QI9B 3G08A 4EF3A 5IQ9B 1CDYA 2H26A 1SJMA 1IBXB 3RIFK 3LKRB 4ILIA 1CL7H 1PMYA 5JZEB 3V79C 3Q1EA 1I85A 4ZO6A 4XVSH 1GGIH 4R4ND 5ESAB 4HBCH 2BSCA 4XN2A 4MGZE 2X89D 4G2AA 1JE6A 3MV11 1RURH 2Y69E 4FI6A 2XQYK 4H8WC 4PJ5A 3RWGA 2FI7A 3NOGD 1A0QL 1FH5L 2XQBH 4P2YA 5BYQA 1OOWA 4FNRA 5LBSL 1C76A 4MAYA 2Z93A 2ICWI 4GKNB 1FJ1B 3L7FB 5JIMA 3ULSA 4BQ9A 2UZPA 3UIPC 3K2IA 3V0AC 1T89C 4Z6AT 4JPKH 2BFGA 3QPQC 1H3WM 2IPKA 5CJQL 5IHZA 3L8QA 1DLHA 5IZ7A 3ABKE 5ADOL 2XWTB 1CT8B 1NGQL 4F3FB 1AS8A 1YNLH 1MFDH 3O4LE 3HUIA 2X88A 4AY0A 1ADQH 3GLDA 2K7QA 2R9HC 5JQ6L 1C8QA 5E9DB 1FT2A 2YPLB 5CZXC 3QUMA 1OVZA 4DVBA 3JWDL 3U52E 1V7NL