4AJWA

Discovery and optimization of new benzimidazole- and benzoxazole-pyrimidone selective pi3kbeta inhibitors for the treatment of phosphatase and tensin homologue (pten)-deficient cancers
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
916
structure length
765
Chain Sequence
KKLINSQISLLIGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAAHRQQLGWVEWLQYSFPLQLEPSNRALLVNVKFEGSEESFTFQVSTKDMPLALMACALRKKATVQPEEYALQVNGRHEYLYGNYPLCHFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNQPFSIELIEGRKVNAVQAGLFHGNEMLCKTDISVCDLPRMARLCFALYADCPIAWANLMLFDYKDQLKTGERCLYMWPSLLNPAGTVRGNPNTESAAALVIYLPEVAPVYFPALEKILELEHEKDLVWKMRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCYVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLGRALANRKIGHFLFWHLRSEMHVPSVALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKEMMHMCMRQETYMEALSHLQSPLDPSTLLEEVCVEQCTFMDSKMKPLWIMYSSEEAGSAGNVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLHSDTIANIQLTAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE CATALYTIC SUB
publication title Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
pubmed doi rcsb
source organism Mus musculus
total genus 212
structure length 765
sequence length 916
chains with identical sequence B
ec nomenclature ec 2.7.1.153: Phosphatidylinositol-4,5-bisphosphate 3-kinase.
pdb deposition date 2012-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase
A PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain)
A PF00792 PI3K_C2 Phosphoinositide 3-kinase C2
A PF00794 PI3K_rbd PI3-kinase family, ras-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.11 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-/4-kinase, catalytic domain 4ajwA05
1.25.40.70 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ajwA03
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4ajwA02
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4ajwA01
3.30.1010.10 Alpha Beta 2-Layer Sandwich Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 4 4ajwA04
2MBBB 3B1LX 2KFKB 2M8SA 2K1FA 3W1SA 4LDTB 2I1JA 1WX8A 4GMVA 3QR1A 4WWNA 4IQHA 5J18A 2CJTA 2UWQA 2MQJA 2DMGA 4TQ1A 2JVCA 3PRPB 3SDLC 2Q0ZX 2L0TA 2FCMA 5KHQA 3A4SC 1WYWB 3F05A 4KZ0A 4HVBA 1KJTA 3A9KB 2X38A 1UELA 2DAJA 3EFUA 2L8JA 1VCBA 4GB9A 4WWOA 3L13A 3DVGX 2M0XA 5L95C 3QARA 2YRBA 2XBBC 1WRDB 3AULA 4RM8A 2N7DA 4ANVA 1CMXB 2KKCA 2KO3A 5T8IA 3A33B 3NHEB 3PVLA 1EF1A 4GN1A 5D7GA 2Q3XA 1IPGA 5C23A 2AL3A 1WXAA 2Z59B 2MX2A 5BO4B 4MGIE 2BF8B 3NY5A 4HCNB 4K81A 3ZTDA 2R2OA 3SHQA 2R2QA 1OGWA 4XX5A 2KTFA 3TJPA 3UIPB 3R7QA 3VH3B 4EFOA 3R7RA 3WAPA 3QX1A 4NJ6A 3Q3FA 2K8MA 2NBVB 3V6CB 1L7YA 2L76A 3B7YA 4XE0A 1KOTA 2K3HA 2MWSB 2K8HA 3VAWA 5JHBA 2IO3B 4KZCA 2NS5A 2N9EB 3V61A 4KIKA 3U8ZA 5ANLA 4IHBA 3ENEA 4W9JA 4NQKE 3TIXA 2OJRA 4HPLB 5J2RA 3N32A 3PLUA 1V86A 3QK0A 3Q3JA 4G0NB 1L2NA 1RSYA 4G3XB 1JRUA 3WALA 4NY0A 1EF5A 3EECA 3WIMA 2BWFA 3TL5A 4AWJA 2X6IA 2NBUA 3QA8A 4ICVA 3L16A 4FHJA 1UBIA 3IM1A 3D32A 4WWPA 4TUUA 1Q1OA 5ENNA 2CJSA 3PRZA 2CHDA 2C7MB 3TWYA 4MSMB 1GG3A 4KDIC 3IVFA 4G11A 4WAFA 1WGHA 4BKGA 2V1YA 2LVOA 4MH0E 3UF8A 1WGRA 1DJZA 2GBJA 1WJUA 2CKHB 2KLCA 3B08A 1V27A 2LRUA 3PZDA 4IWOA 1WFMA 2LHAA 2PE6B 4JQWC 1E90A 1BDYA 1TJMA 4Y1TA 2RD0A 1RFAA 1OTRB 3KUZA 2BYEA 2DAFA 3RULA 1YQBA 4W9KA 2KJ6A 2J0JA 2WXHA 5LLIA 4NAWA 4BFRA 2OOBB 3ONSA 3RYTA 4ASWC 4YL8A 1P98A 2J7QB 3ZRCA 4NPNA 4MGZE 2JRHA 2FCQA 5AZFA 3PFQA 4J6IA 5AZHA 3IHPC 3QQ8B 1UD7A 4Y1SA 4MM3A 1GC6A 2BGFA 4QAMB 2C5LC 3LDZE 4W9EA 1UOVA 2M4NA 4BOZB 3RT3B 1Z5SB 2LXAA 3OHMB 1ISNA 2QHOA 4GXBA 4K1RB 3PT2B 4HJKA 3CSFA 4QJ4B 3A9KA 2RSUA 4KV2A 2MBOA 1XQQA 1TBEA 1ZW7A 2N1WA 2KI6A 3IBEA 2AL6A 3MJWA 2K4AA 3PTFC 4KIKB 5E6PA 3VUWA 4ANXA 2DYBA 3AXCA 3H7PA 3N3KB 3PRMB 1DJWA 1E7UA 4WQOB 1QZEA 3MTNB 2DMHA 2FUHB 4MGKE 4E74A 2NCNA 4FADA 4PS7A 2MRPA 4JPSA 2L7RA 2LGDA 2O6VA 1LQBA 1XD3B 2LI5A 3DVNV 4TKNA 3TBLD 4NNJB 5LXIB 1EO6A 3ZNID 3ZTCA 1WM2A 4GU2A 3F00A 4XC2A 2HJ8A 5D94A 2MW5A 1WGDA 2FJUB 4FBJB 1WGYA 2YOAA 1AARA 1ZKHA 1WFYA 2ZKMX 1WGGA 4ZRKA 4ICUA 1YRKA 2AWTA 2K39A 2KNBA 2KC1A 3VH4B 2EKEC 1R4NI 2MBQA 2LUEA 1R4MI 4DK5A 1WXMA 4MJJA 4ZYNA 3CF6E 4LDTD 5G2NA 3W57A 5GMVA 2WXJA 5CTRC 2MCNB 3ZNHB 3DDCB 1UZXB 3L0WB 4BOSC 4OVVA 2WXOA 2ASQA 3QHTA 4PS8A 4FULA 4F7ZA 3AU5A 4NAWB 4F91B 3WA0A 2WXIA 3APFA 2ZCBA 3HM6X 2NSQA 3KUCB 2L00B 2D2QA 5KJ7E 2K8BA 5TR5A 1WH3A 1UH6A 3KVFB 2GBNA 1I42A 2K45A 2Y5BB 2MP2A 1IYFA 2Z0UA 1LFDA 2IO2B 1BYNA 1NI2A 3QWZB 1KLVA 5L83A 4AOFA 2FCNA 3QCAA 2ZVOA 1TZ1A 3M63B 4M8NA 3UGBB 4DBGA 2RR9A 3ECIA 2LASA 1C1YB 1YD8U 1DJYA 2G3QB 2PE9A 3TCAA 2JZ3B 1KM7A 2CS4A 3ALBA 4EZKA 2M17A 2L0FA 3RDJA 3L54A 3JW0X 3H7PB 2GBRA 4I6NB 3RZFA 4F1SA 2LWPA 2K25A 1C3TA 4WEEA 3DCGA 3M3JA 4BGDA 4DNLA 5DPRA 4KDLB 2O6VB 4PH4B 1UBQA 4M8MA 4UWLA 1K8RB 4QJ5B 2LGYA 2C60A 4IM2A 4X57B 2ZNVC 3PPAA 4HDOA 3VDZA 1J8CA 4GIVA 2RGFA 4AJWA 1V49A 3IG3A 3T8MA 3VUYA 3K9OB 4DHZB 5AZGA 1Q5WB 3CSTA 4IM0A 1WZ0A 3X0WA 4KITB 4DWFA 3S2AA 2WX0A 4NPJA 1TGZB 3LS8A 4NS0A 4V11A 4WJPA 3U7DA 2MBEA 3RZWC 2WXPA 3RCZA 5CHVC 2BPSA 5C1ZA 2ZNVB 1SGHA 3WAOA 2UYZB 5CCGE 1CJAA 2DZKA 4ANUA 3L9BA 1WXVA 2WDTB 4IW0A 1SE9A 2KK8A 2LZ6A 3ML9A 4CYEA 2LVPA 4BKSA 2D3GA 4GNKB 3P2BA 4W9HA 2PJHA 1WR6E 3PYCA 1YJ1A 2MP2B 3HN8A 5J17A 4HK2A 2JQZA 4JL9A 2K6DB 2BYVE 1PQSA 1U4AA 2J0KA 2FNJB 3JSVA 1WFJA 1WM3A 3A1QB 4UWGA 2KJHB 3A9JB 4PS3A 2IZVB 1WF9A 1WJ4A 4W9IA 4A3PA 1RH8A 2O2VA 3L17A 3OLMD 2KMAA 1NBFC 3L10B 2K6QA 3QIJA 3NOBA 3PS6A 4RMAA 2WX1A 1YX6B 4EEWA 1H8CA 2ISDA 2PPHA 1J0GA 3H1UA 4F8CB 3RD2A 1GUAB 5FR6A 4JGHB 1W16A 2WXFA 1V9JA 4BVUC 3UQBA 2FIFA 3C0RB 1V6EA 3DBLI 1E8XA 1OEYA 5CHWA 3AU4A 2N4FA 3QC8B 3VTWA 5JHAA 2ZPYA 3PHXB 4MELA 3N30A 3ZNGC 4B9KA 2N1TE 2DX5B 5LXHA 2I9CA 2D8KA 2X6JA 2WXRA 1P9DU 1NDDA 4B95A 3VQIA 2CHZA 1DJIA 2WXKA 4FLHA 3ZVVA 1WMHA 2DYOA 2IO0B 2JWZA 4WJNA 4F93B 1VD2A 2NQ3A 5HKHA 1WI0A 1P0RA 2X6HA 4LCVA 3VUXA 3KH0A 3AI5A 4URKA 4AJYB 2IY1B 2VRRB 4TV3A 2G4DB 2KN5A 4ZRJA 2JZZA 4IWQA 5DPSA 1XT9B 3EHVA 2KXJA 4FJYA 1WX7A 4GDLA 3NZUA 1WZ3A 3DPDA 4HPMB 4DXAB 2A4ZA 1V81A 4L23A 3IFWB 3V62A 2DENB 1QASA 3JSVB 4AP4C 4FHKA 3LJ3A 4FJVB 1OQYA 2PEAA 1ZGUB 2DZJA 2LXCA 4LJPB 4BBNC 4I6LB 3GZNI 2O2VB 4MSQB 4IC7B 1HE8A 1E8WA 3ML8A 2KJRA 1V5OA 5CCJA 2KVRA 2IBIB 3JYUA 1WJ6A 3QR0A 4FN2A 2XEWA 3GOEA 4FA6A 2FIDA 1GC7A 2KDFB 2V4LA 3KWTA 1DSYA 2KQSA 3PGEA 3ZLZA 1M94A 2LJ5A 2BKRB 3IHYA 2KWVB 2ZJDA 4TS6A 2WXLA 3PREA 2N9PC 4W9DA 2KLGA 3TMPB 4P7IA 2L3ZA 4ANWA 3O65B 3DQVA 5CCHE 2JRIB 2ENJA 4MJSA 1V80A 3FBKA 4KVGB 4N9F4 3OJ4B 4E71A 2D11A 3WANA 1Q0WB 2KDEB 3OAWA 2B3AA 3H9DA 3WAMA 1D3ZA 1DJGA 1EUVB 2KDBA 4HCPB 2O6VD 3APDA 1OEYJ 3A1QA 1BT0A 3A9JA 1LM8B 3M95A 3PSEB 1WIAA 4W9LA 1WMHB 2IYDB 2LD9A 2JUOA 2K8CA 4NJ7A 3ZKJC 3VXWA 3QAQA 3M7FB 5CX3A 2WXNA 1WY8A 3ZIMA 2KFJA 4DHJB 2CHWA 1DQVA 1SIFA 2M1MA 2LRWA 2YLMA 3DOWA 4ZRIA 4WAAA 1TTNA 2CU1A 5CHFA 2AYOB 2G4SA 1V2YA 5EDSA 4GDLB 2ZEQA 1LXDA 3EC8A 3DVNU 3PHWB 2R83A 2GBMA 2EMSA 4II2B 3ZRFA 4EKUA 1E8ZA 5KHOA 4IUMB 3SU8X 2Z0EB 3KWUA 4EOYA 1H4RA 3FDWA 5H4ZA 4EZLA 4NPKA 1UOWA 2C9WB 3JZYA 4HXDA 2KD0A 1MG8A 2WXGA 2HTHA 2KX3A 4LCDE 3V60A 3JVZX 5JH5C 5AEKB 3R66C 3W56A 2L05A 2LVQA 1YIWA 4JLCA 4ICXA 2FK9A 1J19A 1UGKA 1F9JA 2EP6A 4GDKB 5IA7A 1WXSA 2LGXA 2BWES 3VTUA 2JF5A 3V6EB 2W9NA 3ZO5B 2QZQA 1S1QB 3GPEA 1X1MA 2MLBA 4WJOA 4BKTA 2AEHA 2KHWB 2YVCA 4MJSB 3W1SC 3F01A 4AUQC 3BINA 5DPTA 4IM3A 4LDCA 3RPBA 1P1AA 3NS8A 2WYQA 4KSLC 5D2MB 4QJ3B 2KWUB 2BYFA 3M62B 2ZPNA 4LJOB 3H7SA 2WXQA 1W15A 4XZ4A 4ZDVA 4KSKC 2GMIC 3HHMA 1GNUA 2NPTA 3MHSD 2JT4B 1DJXA 1Z2MA 2DZIA 2BKFA 4MEMA 3OJ3A 4PYZA 1WE7A 4DDGD 1CJYA 1E5WA 4M0WB 1E8YA 4NP9A 1P3QU 3VFKA 4OYSA 1RLFA 2DZMA 2MA9B 2MSED 2N1VA 5H4YA 3HK0A 2D10A 2GBKA 4L2YA 1WR1A 2MBHA 4F92B 4PYUA 1WX9A 3N5AA 2HE7A 1GMIA 3H6NA 3KYCD 4GSWA 4HDQA 2BWQA 2KTRA 1TJXA 1Y8RC 2XK5A 3SD5A 3DBHI 3PV1A 1E7VA 2REXA 3W1YA 4UWFA 1YX5B 3HM3A 4OVUA 3CMMB 3T9LA 3VTVA 4HLEA 3ZW3A 2JY6A 2KX0A 1QATA 2Y3AA 3I3TB 4E3CA 4W9CA 2ZZPB 2C7HA 3K9PB 3L4CA 4BKSD 1UGMA 2DHZA 2NBWB 2ENQA 2X6FA 4ICWA 1RRBA 2D07B 4RM9A 3NZSA 1DJHA 3BY4B 4I6PA 2FAZA 4CO7A 3L08A 2WXMA 1A5RA 1GJZA 4K7WA 3R3MA 4W9GA 4LT7A 3DVGY 5DCNA 1A25A 1RAXA 2KFKA 2FCSA 2WWZA 4A3OA 1FXTB 2KWCA 2I1KA 1V5TA 3VHTC 3UINB 1I35A 2X6KA 2A5UA 3ZNZB 4G50A 1G6JA 5E6NA 2JPHA 3KUDB 4EZJA 3VVWB 3KW5B 2NVUI 3A4RA 4FJZA 4L1BA 2UZPA 2CR5A 2N7EA 4WJQA 3U30A 4B6WA 3NSJA 2NPTB 3PLVA 2KDIA 2HD5B 2Z0DB 2EMTA 4L1LA 1BCIA 2KC2A 5D6JB 3F04A 3UQAA 1K5WA 2ZVNA 3KYDD 2IO1B 1S3SG 4CHKA 4A55A 2DYMA 4HWIB 2KANA 4GDKA 3ZDMC 1T0YA 2B3RA 3DBRI 2ZCCA 2JXXA 2N9XA 2CM5A 2QZ5A 3X23A 4II3B 4BBNF 2V3SA 3QJZA 1RLWA 4K7UA 3HIZA 2NCEA 2KQ7A 3APCA 4UWHA 2KTRB 3B0AA 4GOCA 5E6OA 2XK5B 2G45B 2NR2A 3ZDTA 4JIOU 2IY0B 2KMCA 4NQLB 4TQ0A 4DHJD 1IP9A 4DHZE 5IAAC 4MGYE 4MDKE 4IG7B 3ZUNA 2CM6A 4UWKA 1WE6A 2C7NB 2J0MA 2GOWA 2KZRA 2RPQA 4DDID 5JZEB 1WJNA 4IWPA 2ENPA 3RUIB 4A20A 4EUTA 3UIOB 4K7SA 4GGQA 4W9FA 5DPWA 5G55A 2CHXA 3DBSA 2KOXA
chains in the Genus database with same CATH superfamily
1SJXA 4E9YA 1D7DA 2FYYB 5CMWA 2IGLA 3U2SC 1Y18B 3FFLA 3ZXAC 1UA7A 1HEZA 1K5NB 2QQKL 2BP8B 1KFAL 3AEDB 1UC6A 2GRRB 2VJ0A 4M00A 2EUZA 2L0TA 3VG0H 3WTXA 2ATKB 3R0NA 4JFDD 2NT1A 1BMGA 2FH8A 3BUAA 2PYEB 4I0PB 5KZCB 4FL4C 4PRHA 4UTCA 1BMWA 4KVCH 3ARXA 3L13A 3GZKA 4N0CC 4NDMA 1I53A 5GRUH 1KCVL 4A2GA 2Y5EA 4PG9A 1GPXA 1WRDB 4GLRI 4IBWA 4RM8A 1KB5A 2KZTA 2BWIA 1G9MC 1A0QL 2J73A 4FTVA 4ILDA 2JB6B 1OXJA 1KG0B 4RMVA 3NJXA 4RMWA 1L5GB 3VTMA 2K9XA 4HCRH 4WO0A 1AKJD 2FT6A 2N3JA 3F6IA 5BO4B 1OGTA 2BF8B 3TGXA 3DK0A 1FH5H 4IRJC 5L8LB 3EGSA 2B1AH 2J12B 5DJAB 5D2LF 2JJTA 2YD3A 1TS5A 5DC9B 3OWEA 5ES4B 2IBZY 2KYIA 5FGCE 3VG0L 3MV2B 3KM2A 4WHYG 3A4EA 3ASOB 3K4DA 2VM9A 5F9DC 3TM6A 1EDUA 1G84A 3DBXA 2OMWA 1MZZA 3NG0A 5J2RA 5GRUL 3E9UA 3QK0A 3CFJA 4G0NB 4ZZFA 2R1YB 4DEWA 4LNNA 4L8SA 4X98A 1G6VK 5EN3A 5CBAB 1OGAD 2VITB 2KZ1B 5CUSH 3NCJH 3L16A 2P5ED 2UUDH 3QNYA 1JQ4A 4HCRL 1OP4A 4M7ZB 4AP2A 1GSMA 3LRMA 4KI1A 3BYTB 1T2XA 1BWMA 4MSMB 2HFTA 3ESPA 1FH5L 2B0SH 4CGTA 4PJGE 3RNQB 3MJ9A 5EBGA 4GI9A 3EHMA 4CDMA 3DRTB 2V1YA 3BFOA 1DQJB 2B1AL 1QP1A 4KV5F 3PJSB 4RMBA 1WGRA 4AQ7A 3H2QA 4P5TD 1GCYA 2VN3A 1NFDF 1QLFA 1ZHBA 1E90A 3BOVA 1P69B 4LVOC 4Y1TA 5F88A 3WFBH 2DAFA 5KVFE 4K55A 1GPOH 1JK8B 3OB8A 1L5PA 5GS1C 4CKQA 4BK5C 3B95A 4YE0A 3JV0A 4U2ZA 5CBEB 4UBDD 3VGDA 3D85B 4HLZH 1BZ8A 3FCSB 3P77A 4XHJD 4J8FA 3SQVA 1JD7A 5CUSL 3NCJL 5KYWB 4EUPH 4GU5A 1O5MA 2XWBB 3TTSA 1KELH 4KKPA 3UT7A 1LVEA 5F7YC 1ZW7A 2N1WA 2KI6A 4AKPA 1YC7A 2P9KG 2B0SL 5FKAC 1T6VN 4U6YB 2MEJB 1KXQA 1PQZA 4XPTH 2CJNA 1YMMA 1KNOA 3D8MA 4JKLA 3KLHD 3VWJD 4PYHA 5G4OA 3KNBA 4BH7B 3DBRB 2NCNA 5AW7B 2AAVA 3WFBL 3FN0H 4XTRC 5E2WH 2ODIA 1GPOL 2W9EH 5D94A 4NWUH 2WHIA 2EVFA 5KBNC 3LXBA 5J1AA 4FBJB 1Q9OB 4GZDA 2VLKB 4ZRKA 3MNZA 5GGVH 4B8AA 1F4XH 5EIIB 5BJTB 1XH3A 1YEIH 5ALBH 1UT2A 3GKZA 3HC4H 1YA0A 4Z7VE 4X4YB 3QQ3A 3L1EA 2KZKA 3B7SA 1UZXB 2IFUA 1BBJA 2ZUVA 1A6VH 2NZ1A 4PJHA 1KELL 3FCGA 3BP5A 4JDZA 4NJAH 4KJYB 4XPTL 5CD5D 3A33B 2PXYA 3KCPA 4I48B 2ZU6B 3ATBA 3RY6C 5GRWA 4AVXA 1I3UA 5E2WL 1DOIA 2Z93A 4X5LA 2L83A 2W9EL 4BQ9A 3GZSA 3ISRA 4NWUL 5JORB 4L8CB 1UUPA 1UJKA 3KHQA 3WG7E 3M63B 5BMIA 5C0CB 4XN2A 3NT0A 4ZAKA 3DRAA 3RKPA 2E8YA 4HS6B 5I2IA 5GGVL 1F4XL 2K0PA 2SEBD 1YEIL 5ALBL 2ZOLB 3U1SL 2CPUA 3HC4L 2ED8A 4WUUA 2GBRA 3BVZA 3RN9C 1WC7A 2LWPA 1VZIA 1EVUA 1UXSA 3GKWH 4KDLB 2HVKB 3DXAD 4CVXB 5IFHH 1A6VL 5DZPA 2YMXH 3HW7A 3FFDB 1K8RB 5AUIA 2ZNVC 1WAPA 4NJAL 4XMXA 5D1ZA 3AE1B 2P5WD 2YPLD 2O26U 3MTXA 5AEAA 1E5BA 1WZ0A 4BERA 4ZUWA 3CWIA 2WYTA 3JT0A 2J8OA 2BTEA 3NABH 3R06A 4YPGB 4KKJA 1B9ZA 3HBGA 4HAKA 2WY3B 2XVGA 4HC1A 2GI9A 4XCNA 4C7YA 2E7CA 2R2CA 1A8JH 2ZUQB 3VFMA 1EZUA 3QYNA 1X6LA 3GSVA 4PJ9B 4DX6D 4LNOA 5DQJA 3TH3T 2UYLB 2DWDB 3EOBA 4M7KH 1ILSA 1QI4A 2WLLA 4W9HA 3GKWL 1HK6A 2YR3A 1YJ1A 3ZZSA 4PRHD 5IFHL 5KEZA 3HN8A 4K9EH 5D4IA 2ICIA 2YMXL 3N85H 1FNSH 4YIQA 4GA1A 5JXED 3RQ3A 1SBBA 2K5PA 1MQKH 2V7HB 2XFGB 1TN7A 1B4LA 4FFTA 4FTVD 4Z7WE 4W68A 1FO4A 1RJZA 5KN5A 3P4OB 1O6SB 1T89A 5HSFA 5E5MB 4G5ZH 4JFPA 1SA5A 3NABL 1W2KT 1XF2B 4U63A 2MOGA 3ILPA 3HCVA 3QUZB 5I1DA 1E10A 2ISDA 2PPHA 4ODTH 3R4DA 2Z35A 3JTTA 3ASDA 4GUCA 5FR6A 3NQKA 2VL5B 5DMKB 1W16A 1AO7A 5JQIB 1C7SA 3HB3C 3CDCA 1NCGA 1WIOA 5HGBB 4LBEB 4M7KL 4KKRA 1IM3B 3N04A 3IXTB 2BY1A 2XIIA 3LQZB 4K9EL 3N85L 1FNSL 3C87A 2VUOA 1NDDA 3II1A 1MQKL 2H47C 5I8CB 4FLHA 4XBEH 1TQWA 3ZHDA 5FA3B 2YJQA 3RUGA 4IHOA 2OMVB 1CFQB 2QADC 4HSAC 1EBPA 4HOXA 4P3DB 5AKVA 4PW9A 4Z7WF 5HRYA 1BJMA 4G5ZL 4AJYB 4WTQA 1HXYA 1XF1A 4P2CG 2AK1H 2HRGA 3AU0A 4LNRB 3L5XH 3EU5A 1A9EA 2A2QT 4ODTL 5LBVA 5DIZA 1TQCB 1CE6A 3WKMH 4YHYB 2H0PA 5HGGS 1V81A 4L23A 2DBLL 2DLGA 1TJGH 4FHKA 1HSBB 1YPZF 1C8PA 1SUJA 3QR2A 1AGEA 1U8LB 4R4NC 3FILA 4LLQA 2PEAA 2UUDK 3ZHEB 3CV5A 4PJDB 3JUEA 1KBVA 1LD7A 4DRXE 1KFYB 5CMAB 4CT0A 4IC7B 1IU1A 4P9HC 1P4BH 2KVRA 1IGMH 4JLRB 4QOKB 1Q0YH 4KNQA 2NXZB 1G7QA 1UYWH 5DZVA 4HAGA 3LZFH 2WQ6A 2Z6FA 4HOTA 2JE8A 2XWJB 4XBEL 1NUNB 1UWFA 4JRXE 3WGVB 3NJVA 1ZT7B 2FATH 2L4OA 3EDTB 5FHBH 4Y5VC 1SM3H 3L2NA 3ULVH 3PWVA 4CNIA 4MCZB 5AVWB 4AVHA 1IHGA 3QEQA 1UFUA 2AK1L 2FL5B 1KBGH 2NY6C 1OARH 3L5XL 1H8LA 3CQGB 1SJHB 1FFTB 1YMMD 5DJCB 3WKML 3WTVA 4QXTB 1N64H 4G26A 3WAMA 3NSYA 1TJGL 3H2WA 4HUUA 2R29H 4JFEA 1KZPA 2Z8VC 4AUUA 5KBAA 5G5GA 5CX3A 3UADA 1USZA 3SIKA 3PV6A 2CHWA 3U4EA 4AQ1A 3MRJA 1P4BL 4WO4A 1DQVA 1KTLB 1IGML 1PZ5B 1Q0YL 2DPKA 2VDMH 1XEEA 1UYWL 4KGJA 4PHXA 1OAYH 2HT4C 1CDIA 3LZFL 1I7UB 2AYOB 4JHRA 1F1DA 1ZDQA 5EO0B 2R83A 1P7QB 1YQVH 1A9BA 1JVLA 2P4AB 3O3UN 2BKGA 2FATL 3W3BA 4N8VA 5FHBL 1SM3L 2QFRA 4LARH 4ZMWA 3ULVL 4XB7A 1SIJA 4UQDA 3MBWB 1UOWA 2ADJB 3MROA 5EE1A 1OARL 4GQPH 4JQVA 1M42A 2CBTA 5I4DA 1N64L 1RUKH 2PXYD 5BV1A 3CZUB 2R29L 3AXLA 3FB6A 4NUQA 2LGXA 3DMMB 1I4FA 3AG2E 4IRUA 1AXSA 1WBYA 4MMXC 4KX6B 5KS9A 1ROEA 2QZQA 1E3ZA 4WDIA 1FNUA 3BVNB 3VXQB 2VDML 4JANA 4ZAKD 4IYKA 2F8YA 2XY1A 4BCXA 1YCSA 1OAYL 4O02H 4O9HH 3MP9A 1XX9C 2E7DA 3GMMB 4BH8A 1J0ZA 2H45A 1V54B 4MBOA 1S9XA 1YQVL 2ZPNA 5EX3A 5JLZA 4KSKC 2NY5C 4JJ5B 4LARL 2YA1A 5HHQB 1E4HA 5D1ZD 1UH2A 4LFHG 3MJ5A 1U93B 1X5YA 4G6FB 5I6KA 5ISZB 1E5WA 4F27A 4NP9A 1P3QU 1KYDA 1RUKL 3K5RA 3KBEA 4AVIA 1IMHC 5F0JB 3WN5B 1ZTMA 4BTAA 4ELKB 2FAUA 4PYUA 1I3VA 1A7NH 2NYZA 1GMIA 1QSZA 3W9EB 3HG4A 2KBGA 1JWSA 4I6JA 4KJPC 3BPOB 3VFNA 1UVQB 4OVUA 2J57A 4O02L 4O9HL 5DSCA 4CN1A 2Z8LA 2H6PB 1QATA 1MAMH 2Y3AA 2C7UA 5AVZB 4G9FE 4U49A 4YXHH 2QDFA 3L3OB 2XLLA 2AS5M 1NDMB 2DHZA 4YUEH 2KT6A 4S0SD 2NY3B 4J8RA 4RM9A 3QORA 2D07B 3MRNA 4GKSB 1BQHB 5KNGA 2Y3NA 2EE3A 4GAAA 4DN4H 3GF8A 3CHPA 1NC2B 4YX2H 1GA2A 4BQ6A 1N12A 4LT7A 1ZLUK 3HUJA 4XVTH 4YSUA 4HJEA 1GW0A 2FBOJ 3MX0A 4ZFGH 1I8IB 1FAIH 1JCKA 4QKXB 3PNWB 3VHTC 4XMVA 3X3GH 1MPEA 4F5CA 5SWSE 4YFLI 3A22A 2DIBA 1KLUA 1NCCH 4BCYA 2OMXB 3CSYB 1A7NL 1CS6A 4PT5A 1D7FA 5CBNA 1OAJA 5FO2A 2APXA 3GZNB 4HLJA 2AXUA 3SO3B 3LNHA 3MRCB 5F7AA 3RIAK 3I57A 1AO7D 4N5UA 1JERA 3RWJB 3IT8D 2EXTA 2DH3A 3TC9A 4BSVB 1YN3A 3BZDB 5JA9A 4YXHL 1MAML 1N0LA 3PJNA 3N2JA 4OCSH 2RHEA 5TGBB 5I66A 1T3FB 2UV3A 3PABA 4OBSA 4YUEL 2ZW1A 3FH8A 3BISA 3ZDMC 4XN8A 4DN4L 1BFOB 1WK0A 3NIDF 4DPCX 1N2RB 1R3IH 2X6AA 4LLDB 4YX2L 3HZYA 3MC0B 2IAMB 5TE4H 3KPLA 1OQRA 4GOCA 3OKYA 2D3NA 3GMRA 3V5KB 3ESOA 5DFTA 5C07B 1FAIL 3RBSA 1B2WH 5AUKA 1E65A 3X1NA 3X3GL 2LGSA 5LBSH 5IAAC 5FQ8A 4MGYE 1HNFA 2MNJB 3N1MC 1NCCL 1SHMA 3MLWH 5ARFA 3DDFA 1HXYD 4E9RA 5FK9C 5H8YE 2D0HA 5FA4B 1WJNA 4IWPA 1SRDA 3IJEB 1FPTH 4H0IA 3FO2B 3RZCA 2TSBA 3EJJX 1P7KA 2VXTH 3GM8A 4ZMTA 2R0ZH 1YEEH 3UTTE 1PY0A 4GIAA 3UKRG 3URZA 1ETZA 4PTTA 1RU9H 4X5WB 4HX1A 1KLFA 4RBPH 5CSZA 4ZMVA 3P54A 3QR1A 5DUBB 5B38G 5K69A 4YTPB 4BUQA 2VLME 4IJTA 1QILA 3TCXA 1R3IL 2J6WA 2WLJA 4XDDA 1SDAB 2DAVA 5E94A 5CEYB 5TE4L 3SDXF 1NBYA 3SKOB 5C0FB 4N20A 1JNHB 2I26N 1KTDB 1WZMA 3KBFA 4M7LH 1B2WL 2Y0SA 3DJ9A 3I9IA 3EU9A 1JZJA 4L4VB 2EDTA 4O2FB 4Q89A 5EU4B 3QOUA 2ACZB 5LBSL 3MCG1 3KGRA 3BLBA 3MLWL 4UOZA 1HL9A 2BOBB 3QEQD 2A38A 5EOCH 1SNRA 2VXUH 4MAYA 1FPTL 4Y16A 3DSFH 4M01A 5JW4N 5C23A 5EZIH 3O3EB 3HS0B 4HS3B 4C00A 2VXTL 2MX2A 2R0ZL 1YEEL 4JFED 2C9UA 4G80B 4WW1A 5E99H 3VRBB 4P4KA 4D8OA 4HPOH 5IESH 3IFNH 1RU9L 3NVYA 1J0IA 1FFPB 5KUMA 1IGYB 3KPMB 2VSMB 3Q2VA 1OB0A 3WAPA 4WO4D 5MENA 2E4TA 2W9LA 2Q7YA 4LASH 4AGOA 2E0IA 2IANE 1NYRA 3CN0A 2YLHA 2MWSB 3S3JA 2IPKA 3IVKA 3ZE2F 2CLVB 2Q3AA 2N9EB 4TLUA 1I7RB 4M7LL 4GLRH 2Y4TA 3AQXA 1JP5A 1PL3A 2OZ4A 2XQYA 1MHEB 2IQCA 1K72A 2WGSA 3IMVA 4L3AA 3TO4B 5EOCL 1VGEH 2VXUL 4DK6A 3CX5J 3DSFL 2LABA 5EZIL 3EUDA 1WYJA 2RMNA 1AQHA 5E99L 3L3GA 5KWYC 4HPOL 5IESL 3IFNL 1MJ0A 1QOAA 4BKGA 1ZHLB 2DKMA 4FQIH 3BVVA 3GW4A 3MV3B 1UB5B 4ACTA 1NL4A 5IMOA 3N42B 2H9GA 3RULA 3N43B 4LASL 4MA1C 1OTRB 1CR9H 2BZCA 1ZT1B 3HG1A 3RL1B 1CYXA 4RAVB 4XX1E 3TJHC 1HN1A 3VXNA 3K6FA 1K3ZA 3VGBA 4IOIE 3QPKA 3V52H 2HG5A 2W9DH 2JRHA 4KQ3H 2VSYA 2JKJA 4YDKL 5HGAB 5IROC 3VA6A 3PDNA 4DX1A 4LEOA 2DWEB 1A4KB 3VDCA 3RT3B 5EWIH 1VGEL 2UXVA 4RCAA 4HHAA 5LKNA 2M56B 1I8MB 1ZHKB 3MN8A 3DRQB 4R84A 4U05A 4GSRA 4OZ4B 4GTMA 2K4AA 3IMBA 5CS7A 5MEQA 5F1OB 3RNBC 1YY8B 1BFVH 4FQIL 1MRDH 1QO3A 1QZEA 1JWSD 2N59A 1N63A 4MH8A 4PCTA 4YGVB 4PS7A 1X5MA 4K3BA 1C08B 1VFBB 3REVA 1CR9L 2KDYA 3U64A 3L4UA 2VLJB 3BKMH 3KMDA 4MCMA 4XWGH 3DHUA 4XXCA 1OQOA 1P4IH 4NQVB 2FECI 3V52L 3QORD 2W9DL 4QMEA 3PE9A 4KQ3L 4L4TE 3HS9A 1GGYA 2VZKB 1OP3H 3ULAB 2P8MA 3VXSE 4DK5A 5EWIL 2Q5BA 2CIKB 4LDTD 2FWOA 4P4RA 3Q7AA 3J9CA 1AD9A 4NIKA 3CWGA 4N4YB 5JO5B 3P9LA 4DT2A 2WPVA 4WFHE 1KLUD 2FEDC 4HKQA 4YSEA 1G6RA 1JNJA 1MLCA 1BFVL 1SXCA 1MRDL 5FC9A 1LEIB 3SFEB 2V2XA 1OCOB 4PJ8C 4GMJA 5FDWB 2LTQB 1JCQA 3AKLA 1FG2B 2Z0UA 3WIFA 5I16A 2CG3A 5EE9A 1IYFA 5EFIB 1G7PB 4YN3A 5DBKA 3BKML 4Z7OE 4XWGL 5FDYA 3ZGQA 1KEGL 1P4IL 4WKZA 3MKKA 2Y4UA 1YZZA 5BOZG 3WNKA 2Q7FA 4I43A 3O11B 3CQQA 2DQTH 4UNIA 1XCWA 1Y07A 2EYRB 3DC0A 2FR4B 3H7PB 4JRYB 1MH5B 4NAJA 3BIKB 4Q2JA 1FC2D 2DLFH 1DC2A 3F7VA 5D1QB 3AY4A 3G2VA 5DLLA 3M17A 3WKYA 4EPSA 1T20A 5ACZA 5B1AB 4AEIH 2XTJC 4XNZC 2DLEA 4LG6A 2JCCA 3S3CB 4XI5D 3UTSA 2QFPA 3VXTA 3BZ4A 1H6EA 5DD0H 3MCKB 1Q5WB 4DZBA 5BUPA 3RZCD 3Q69A 5E6SB 3TIEA 2MEKA 4P9HH 1OCCB 5JHDE 1TYEB 3DHHC 43CAA 2H2SD 1RZQA 4S1QH 2HX8A 2NZIA 3KLDA 4ZW8A 5CEDB 2YUZA 2ZCZA 4M6AA 3GB1A 2R2LA 4ZUTB 1TNUA 1EFXB 1NLBH 5H94A 3A67H 4GRLC 4E42A 4Z7OF 4B96A 1BVLA 1RZFH 2VE6A 1ESOA 2DQTL 2ZWLT 4MNQE 2CWRA 5B3SB 3QWOB 1SDYA 2N56A 4FG6D 5HJGA 5I1LB 2CBQA 3CHXA 2MP2B 2FF4A 4A7TA 4MRUA 3D9AH 2JQZA 1CGUA 2D7QA 4S1RH 1Z32X 4AEIL 2X4SB 2ZXEB 3QPXH 4CADB 2GTQA 4PJ5B 4LSQH 3ZYLA 4GZ3A 4JL0A 5DD0L 4BXVA 4H8UA 4XVJH 4NO2A 4Y16D 5IW1B 3T5XA 1RH8A 4TTDD 4P9HL 3GSNH 3TBTB 4Q97A 3NGBC 4YK4C 2JIXB 4IJ3C 3WENA 4P4KD 4S1QL 1C9SA 4C4VB 2G2NA 2A6IA 1IO4C 4WSGA 2H32B 3RGVC 3ARFA 1KPSB 2X1WL 1RAMA 2HTLD 5T1KA 4X5PA 1J0GA 2VSNA 4U2YA 4J8QA 4LRIC 3RWIA 1KN4H 4BAXA 5MEND 1NLBL 3JYCA 3A67L 5CGMA 1RZFL 3UQBA 1I85A 2G9HA 1TR4A 2PO6C 2HXAA 1KF9B 1U8KB 2IPKD 2CSPA 4JE4B 2HJLB 5IJVA 1FNVA 5DK2A 4BKTC 4FF9A 3BQOA 1ZXKA 2F2HA 2AFNA 1O0VA 4Y1AB 2QVKA 4B9KA 1I8LA 2R0LH 2EH7H 3D9AL 1A6PA 1MCWM 4L3EB 2EVHA 2H6HA 4H8QA 1P5QA 1ECYA 3QPXL 4RFBA 3IXEA 1T21A 4LSQL 4OTXH 4TNWF 4I1PA 4Y9GA 3D0VA 4XVJL 2DTSA 1GZHC 3GSNL 1T5XD 4LDLB 3TPKA 1OWOA 1T1ZA 3IMTA 5C0IB 5ECJE 3B9DA 5HI5D 2KN5A 4LNGA 3QXAA 1RHFA 4FQJH 4J8DA 4NLAA 1YN6A 1KN4L 1D9KB 1U3DA 2NY5H 5ICUA 3LV3B 4GCOA 1XIWA 3HG1D 4M6MH 3STLA 4FJVB 1IAOA 3H54A 3MLRH 4GXFA 4MYPA 3PCYA 3T6VA 4AZUA 1JWAD 1SMOA 4NN6B 4F3VA 5CCJA 3WNIA 2O93L 2R0LL 2EH7L 1LD8A 4ZW7A 4OZIA 1TVHA 4HJGA 4OTXL 3ROLB 2MNWA 5JOPD 5IHZA 4AYEC 3S8GB 2A83B 1HEHC 4WURA 4RAUB 5C0BE 3M88A 4R0LA 2LJ5A 3X13A 2HLFD 3EYVB 4N2OA 5EILA 3Q2CA 1MCDA 3LPFA 1EGJA 2LVEA 4JN1H 5CJXA 1YC8A 1QSEB 1R19A 2F6AA 1CXEA 4FQJL 4LOFA 4X0KB 2DYRE 3LKNB 2OMYB 5C6WH 3QJOA 3SPHA 2NY5L 5HI4D 3QQ4B 3QO1A 2FIKB 4G8GE 4LLWB 1WIAA 1I1YA 4M6ML 2WLIB 4APQD 2JYTA 3ES6A 4HEMA 2EDHA 3MLRL 4I0PC 4LOUC 1S7RB 1MCHA 3RFRA 4Y8DC 2VLRB 3KZ8A 2KFJA 3H7BB 3KLAB 2Y1YA 4RDBA 3CFDB 5HBBA 1JWFA 1ERNA 2WN2A 4FGMA 3BUYA 1E9PA 4IIQA 2M1MA 3MRPB 1Y56A 2HO1A 5FM5M 2FEEI 3T0EE 3VMPA 2CDFB 3T08A 4KUZH 4G6AD 2F54E 3FOMA 4MS8D 1DBBH 5DD6B 4PJ7B 3S5LG 5JZ7D 1PPIA 4JN1L 1ORSB 4C80A 3VFRB 4HRMB 1MVKA 1S7VA 1WCBB 5IUSA 4GTOA 5KVMC 5IFJB 2D9CA 2IXQB 2IDTA 5FQ4A 3KS0J 2KCVA 3ECWA 4I1MA 2Y23A 3FMGH 3GC3A 3IMUA 1YIWA 3LEYH 4M61A 2FK9A 1WQVT 1OP3K 1BJ1J 1W8OA 1XZ0B 1J19A 4PB9L 4A2HA 2BWES 4B89A 3VTUA 3BP4B 4HIIB 4EXPX 1IC7H 3B43A 4OLUH 4FP8H 2AC0A 1S1QB 5BMFH 4UANA 5DFVD 5LN4A 4A68A 1UFGA 4N58A 1KIPB 1K2DB 3INOA 4F1ZA 2X3AA 5DPTA 4L48A 4GRWF 3BWAB 4KUZL 4R7LA 1ROWA 4NUJA 4DW2H 4LJOB 4YJZL 1DBBL 4M7ZC 4U3XA 4U1HB 5IW6A 2OTUA 3KJ6H 1CK1A 5D4JA 3LYYA 3UTSD 4XX1G 4MEMA 2D9QB 3U0PA 2QSCH 1HAUA 3X1GA 2WLBA 2L0DA 3VFKA 4GKZA 3FMGL 4E36A 3PO0A 3LEYL 2Z91A 2W0KA 4WNJA 4PJFE 3ZO0A 2D10A 4TTGA 4Z7UB 5HHXH 2EIKE 1GMEA 4QPEA 3NPZB 2XQYK 1BFSA 1NFIA 2LMCA 2Z4TA 3LHAA 2HE7A 4GJTB 3UERA 4C4BA 1HL8A 1IC7L 4OLUL 4FP8L 3ZTDC 3T9WA 5BMFL 3NCYS 1P1ZB 2BP0B 3DVNA 4P5TC 5JW3H 4GXUM 1KC5H 2V17H 2XN2A 1V7NH 3UKUG 5EU6A 3VM7A 5JYLA 4JHWH 4CGWA 5CHNA 1FNGA 3PGCA 4DW2L 3QZWA 3O8XB 1UG3A 4JR9H 5KOMC 1WO2A 2BVEA 1H5BB 3KJ6L 1EHNA 5E6IA 4HRNA 1WTGT 2RQ8A 4XHJC 4K3EH 3WBDA 2QSCL 1ECZA 4Y19B 3TCTA 1DZBA 2AJ3B 5GS2D 5BYSA 3DX6B 5IOKA 1Q9KB 1ZXHA 4RA3A 5GQBA 1UJ3A 3NPSB 2EDLA 4CJ0A 5HHXL 5IM7B 2J88H 1JBJA 3UXFA 1YO4A 3DWTA 5I6MA 4S2SB 2R2HB 4LCWB 5T1KD 3NACH 4PJFF 1S7QA 5JW3L 5BV7C 4KKBC 3RVXD 5GZNA 1KC5L 2V17L 1VGKB 1V7NL 3BCDA 5HYQA 2ADYA 1FL3B 1K5WA 2G9HD 4YTMB 3UQAA 1JOIA 4JHWL 1MFVA 2CR3A 3T77B 4E9LA 5LUMA 1PZSA 2XZTG 1XGUA 3QJFA 4QYAA 1S8DA 2NW3B 1F00I 3W9CB 3D87B 2B1OA 4FXTA 4JR9L 1FXAA 4U1MA 2Y2WA 1CFMA 1HJCA 5CZVH 4G2VA 4UCFA 4H40A 3U2JA 3CUPB 3PUUA 5F7EH 3BSZA 2BQQA 2KLRA 5E6OA 2J5LB 4K3EL 5IJBC 1K1BA 1P4LA 2C3VB 4NQLB 1IP9A 4QO1B 2ZX7A 4W9EC 3NF1A 1HH9B 4DHZE 2J88L 4AVKA 3P1MA 3NJLA 3HS8A 4A7VA 1LEKA 3SGKC 2EDWA 3NACL 2H89B 3O9WB 2DOCA 3IRCA 3TF7C 3OMAB 1AE6H 5DRXA 3UAJA 2PCYA 2BEDA 3CDYA 3CXHJ 4QDGA 1XIWD 5I73C 5KYUB 1G7JB 2CLZB 2DWTA 3KDMA 1DEEB 3QXUA 5JNYA 4FEMA 1WBZA 1ADWA 3EJTA 2GUOA 2MQJA 2UWQA 4TQ1A 4OGAD 3CKCA 4Y88A 3S37X 2WBJD 3GSOB 5CZVL 3A4SC 5B1CA 2BS71 5F7EL 5FM5O 1OTTC 1SY6A 3DUSA 4PRIB 3LNDA 1VCBA 2PTUA 4PRDA 4C59B 4JFFB 3T0WA 5KSVA 2M0XA 4EO5A 2P46B 3OKMA 4NQUA 2ZOWA 1MAJA 4BWUA 2N7DA 3NHEB 5LGYA 1FCCA 4HWBA 3ULSA 1XCQL 1H19A 3REWA 3VB8A 5IB2B 2ZUQC 4PJ9C 3GXMA 3LXAA 1P9MC 3ARDB 1AE6L 2ETWA 2AGJH 2N7AA 3TFBA 5ADOH 1JZ8A 1P7BA 4RF1A 2R2QA 2OTWB 5D70H 4MAZA 4PD4J 4RVBA 3MA9H 3ZKQD 1PYWB 2G75A 3PDOB 3ZDWA 4NJ6A 4U7KA 5HDWA 4PUCA 4YSZB 3BH9A 1NKRA 3BKCL 3H7LA 5D2LB 3NJGA 3T2PA 1JYWA 4IHBA 1FFOA 3SZKC 4HZ1A 1CBJA 4NQKE 1ND0A 3SKNB 2ATPA 5C7ZA 3BO8A 1I1FB 2NY1D 3Q5OA 4XCYB 4GMLA 5JXEC 2GSMB 3QUZC 4U1LB 4AGMA 3TT3H 3FRPB 4AIFA 1KJ3H 5BMGA 4V1DA 4TNEA 1XSKA 3BC9A 4X6DE 5EN2B 5TFSH 2D3BA 3VFPA 1HINH 3Q14C 1JIBA 2AGJL 3TWYA 3WY1A 5ADOL 4UI9J 4Z7QF 5D70L 2Z8WC 3N44F 3KGTA 3MA9L 3TA4D 2BVCA 2AQQA 2DM3A 1UWYA 1RZIA 4Z68A 4LMQI 2OMUA 4ZYKA 1JCVA 4OLVH 4MNGA 5D7LA 5I6LA 4QHNA 1IM9A 3AAAC 4WK4B 2WQXA 2ETBA 4N39A 1YAZA 3IAQA 1E0ZA 5E5LA 4FC8A 4LERA 1VKXB 1G9HA 2AQRA 3D3VA 4O1OA 4RFNC 2Q7AA 2Z7YA 3WFDH 1Z5LB 2WINA 3N3EA 3VJ6A 4ZFFA 1X5LA 3OG6B 1XFPA 5BRZE 5CAYB 5CP7B 4PSPA 1TKEA 3CN4A 4J6IA 2D0GA 1Q4NX 1JD9A 1UD7A 2DM4A 1OXYA 2BGFA 1KIUB 3TT3L 4MHHI 1KJ3L 4L0PB 4I18A 3FT0A 1Z5SB 1L9SA 1J8SA 1TQCC 2LLLA 4MJ6A 3PY9A 4K1RB 2B16A 4UM8B 5TFSL 1DO6A 3BZFB 2MBOA 3H8HA 3ZTNH 5J12B 1HINL 5JIPA 5IQ7H 2Y7OA 1Z3XA 3BN9D 2J43A 2PYEA 3TYFA 3IBEA 5HPOA 2AL6A 4KIKB 2K9UA 43C9B 1H9DA 4W81A 4X6DF 3U9PH 2OX5B 4OLVL 5FS5A 2FUHB 2ZWNA 3AEGB 4FADA 2MRPA 1J7VR 1ILUA 1L5GA 5ECGA 2JB6A 2JI1A 1OT4A 4TXQA 5EU6D 4AM0Q 1FZJB 4BZ2A 5B3JE 2O5XH 3QNXB 1TVBA 3WFDL 2JQAA 3AS5A 4X8GA 4XP4H 4EMZA 5EC1B 1L9RA 5AWNH 5BUAA 3C72A 2AMUA 4B3VA 2YXVA 1WFYA 4I1AA 1JXFA 5D4HA 5IBLD 5DJAA 4HV8B 5E6ID 3E2HB 4HUVA 2J4DA 3FU8A 3C8HA 1R4MI 3JSSA 3Q0HA 1IE4A 3CF6E 1YMHB 3LKOA 1OAQH 2PCPB 1TEGA 4LL4A 3AMKA 4OVVA 4B3EA 2AK4B 3ZTNL 4C83A 1FBIH 1HH6B 4MNHB 5AJDA 3MGOB 3EDDA 1J88A 1TY0A 2ITDB 3WA0A 1RZJC 3GBNH 4Z3IA 3ZYMA 2LV4A 4MDIB 5KJ7E 3U9PL 2K8BA 1I42A 5CBAA 4MM3B 3NFPB 5GZND 4AEEA 3ETBJ 2H1LM 3G5YA 1BYNA 2IO2B 4RMQA 1NZRA 3C12A 3VXPB 3M8OH 2FQEA 2D2OA 2O5XL 2ZF8A 4ONHB 4DBGA 4XP4L 1A4BA 3MZTA 4KK9D 4I2XA 4Q9QH 5AWNL 1DJYA 3RNQA 5AVSB 1OM3H 3ALBA 3FCUB 4IRZA 5JW4R 3QZOA 2R05A 1G7IB 2BT6A 5C09E 5E8NA 1BG9A 1WWTA 4YTNB 4LP4A 3T0AA 1J7CA 1OAQL 2ZP8A 4C56E 2O6VB 3DHIC 1EANA 2YAFA 1CDBA 5C0DB 3PWUA 4F7MB 1MJJB 2P52A 1AHKA 1FBIL 4DP0X 5GS0H 3DMMC 2EICA 5L8JB 1V49A 1CVSC 4CC1A 1WTLA 3HE7B 3QZNA 4PBWD 4K3GA 3UYPB 3D85A 5KANI 2WO4A 2C9QA 3DIFA 1T0RC 3VX1A 3ARZA 1XVSA 3EOTH 1KV3A 3S2AA 1H6KA 4JC8A 5EZPA 5GRZA 5BZWA 3UAJD 2XJLA 1QLRA 2XPGB 1FV1A 4KMTH 3I02B 3I4RB 3M8OL 3IEGA 2VM4A 2XWBA 4YVUA 2X0WA 3VB9A 4WFED 3GSUA 4JUTA 5D0QD 1B0RB 4Q9QL 3KWLA 2E6XA 2GJ6B 1MLBB 4FDWA 3DTXB 1OM3L 4FS0A 3CG8A 1I8KA 2Y7LA 3GSRB 4LOEA 4LK4A 5GSRB 2VTFA 1A3LH 1F6AB 3MGAA 5I8OH 1O75A 3SYAA 1KB9J 1T7VA 2BY2A 4H0HB 3WN5C 4WJG3 4R97B 1SLUA 4JL9A 4HT1H 5GS0L 3ZRHA 2WNMA 4U95D 1ZJAA 2RCSH 4OFQA 4JXTA 4S11A 5BQ7B 4QRRA 5EIIA 2AXFA 1WJ4A 5F1KC 5FUCE 3RB5A 3EOTL 4OFPA 3V79C 2YWZA 5FYKH 1NPUA 4H25B 1A2YA 1OGSA 4KMTL 4I2ZA 3QFDA 3QJUB 4JHAH 3P4NA 2D5GA 2Z92B 3L5HA 1IARB 5LX8A 2MJWA 1YNKH 1D5ZB 4ENEC 1DVFA 5TDNB 3OKLA 2CQVA 1V6EA 3DBLI 1VPOH 3AACA 2DM7A 1YYCA 1A3LL 1T1XA 2HB0A 4I48A 4N2DA 2ZGDA 5I8OL 1WFUA 2E7LC 2YIHA 3VD3A 5DC2A 2EINE 3V2XA 4HPPA 2H26B 2J3SA 4L8CA 1XWVA 4HT1L 1RPUA 5EZJB 2YLKA 2JWZA 2I9TA 1BQLH 2EXWD 4DJMA 4WUYA 4HS6A 4V1DD 5M95B 2VISB 4I6EA 1P0RA 3LJNA 2ZOLA 4OZHE 3BLKA 4QAYA 3NFSH 4URKA 2ZP0T 4G6MH 5FYKL 4JFQB 4ZX6A 3ZU8A 4NIYE 4CVXA 2NRDA 3HG2A 3FFDA 4JHAL 3SOBH 1N5YH 2NY0B 4Z7WB 4F33B 1YNKL 3RU0A 5D7LD 4ILGA 4CCAA 3Q5YA 1IM9D 3JSVB 1XGRA 2APFA 3WCYA 2HJKA 1I75A 1R4NB 1VPOL 1RUPH 4ARCA 2BIHA 1ZGUB 4WI7A 2XZQH 3D3VD 3DSXA 4BT9A 4NNYB 4OB5H 4A2EA 1YPZB 2ZNWA 4U7MA 4MACA 5EF2A 2XI9A 4FN2A 4DUIA 1Z9MA 3B5GA 4FA6A 3PV7A 2FIDA 2MJ3A 3NFNB 4TVPH 2KQSA 3BN3B 5B4MD 1BQLL 3U1PA 1E5AA 2WKOA 2BSSB 3LDBB 2Y2YA 3EAKA 1X5HA 4W9DA 2KLGA 1C5BH 3NFSL 4JAMA 4G6ML 4ABNA 5DO8A 4OAVB 2YD6A 5CEZH 2ENJA 2YEZB 5H7PA 1BYOA 1PAQA 1WITA 1ZVSB 1V80A 3CQPA 3OJ4B 3B9VA 3FZUD 4OZHF 3RYMA 3SOBL 4R7VA 1N5YL 1P7EA 2K7PA 3NAWA 3LIZA 1GJUA 3ASWA 3RAUA 2KQNA 3M95A 3PSEB 1LM8B 3VD2A 2ZKYA 1WMHB 2ALWA 2V5SA 1RUPL 5I74B 3IDGA 2XZQL 1O6SA 2ZYSA 1CICA 4OB5L 3KJ4B 4PBXA 5E5MA 1GS8A 1XF3B 2IQAB 3U6XA 1YY9D 5K9QG 3Q3GB 3DEOA 3HXBA 5DJ8A 4TVPL 3N9GH 3QIUA 5EDSA 1I8AA 1P1VA 5GGSB 2E47A 1E8ZA 2N7BA 3WMSA 2CD0A 4O5LH 3HS0C 4OJEH 4G8EB 1C5BL 3HPLB 5BV7H 3ALWA 1TS3A 4WW2F 1TZHB 2B15A 5CEZL 3IXTA 3MV7A 4LCYB 5DRWB 5D7SH 2R59A 1ZDXA 3QDNA 3FUMA 4LNVA 4BRJA 1NKOA 2KHAA 3D9LA 1MG8A 5KYXB 3WJMB 4B7LA 4FYRA 4Y4KA 3KBHE 4MJIA 5HHVH 3V4LA 5AQ0A 5KSBF 4NKQB 5AARA 1MHHE 5IA7A 1NCBH 2LT9A 3MREB 3CVHB 3IETA 3TBWA 4P3DA 1MJUH 3GXUB 3K72A 1S63A 4BFJA 3GPEA 4JFWA 2AVPA 4XNMB 2YVCA 1BQSA 3CX2A 2X2HA 3W1SC 4AUQC 3DYMA 3GMQB 4JY4B 1QNFA 2MHKA 3TO4C 5K9KA 4KK8D 1X81A 2WO3B 3N9GL 2DRUA 3KPOA 3MRGB 4LAQH 3ULVE 9CGTA 3S36X 5EOTA 1Z9LA 1KPVA 4O5LL 3S35H 5EEUA 1KTJA 1NFAA 4LCCA 4DP8X 3I6LE 5FECB 2GMIC 3VACA 5BV7L 2DYPB 3IJHA 4N2AA 1GNUA 3ZHEA 3LNEA 4PJDA 5AOKA 1DJXA 1NLDH 1OW0A 3Q4AB 2NXYB 5AAMA 5D7SL 5SX5H 4N86A 5E5UB 3C6SA 3TVMB 4HBCH 3F7RA 4NO0B 1D5IH 2M26A 4WI8A 3AMZA 2GK0B 1SDDB 2D3CA 5LAXA 3D85D 5T1JA 1QA9A 2NYJA 2UZIH 2MA9B 5HHVL 2XWJA 1NCBL 1UB6A 1RUML 4LCUA 2FD6H 1OALA 4NQEA 3KYCD 2XSKA 1MJUL 4JNXA 3CNKA 2FEEL 2HX7A 3IGUA 2FL5A 4H5SB 4QYOB 2OCCB 1NCUA 4G8KA 1OF0A 4HXBH 5HHPB 1A02N 4W9CA 4LAQL 2GJZA 3AG2B 5FM8A 3CHQA 1X7SA 3S35L 1TKYA 3HR5A 4X5XB 3GRWH 2GCYA 1WT5A 4I9WD 1FO0H 2WK2A 5IQMA 3ZYJA 1NLDL 1XB6A 5T3ZD 4U0SA 1HTYA 5DCNA 3VI4E 5AQ9A 3US0A 3SCMA 4HBCL 1PZ5A 5E9DE 1D5IL 4QRRD 1C16A 2BB5A 1I7UA 1JGDA 2H1PH 1FT1A 2UZIL 4H0GA 3L6AA 3H0TA 1NIFA 2R03A 4TRPH 5DD1H 5EO0A 4ZQTA 1JUFA 2FD6L 1Q10A 3VFVB 1SVCP 2ITEA 1S9YB 3GIZH 3CVYA 4Y5XA 5DF0A 4NENA 3NSJA 3PLVA 1CIDA 3E6HB 4PJBE 2YQ3A 1RULH 2ADJA 3AQDA 3MBWA 4LDOB 4LEBA 3OLEA 1AANA 1DVFD 2XWXA 3NP4A 1RLBA 3F04A 1A7PH 1CTNA 1DBMH 2NZ9C 5DDHA 5G4NA 5HFYA 1H3XA 4HXBL 4RFOH 3MRIB 2O6CA 3B9KA 2AQ3B 4QHKJ 1KCBA 3ARUA 2EC9U 2I2OA 2FX9H 3GRWL 3OXSA 1FO0L 3BVMA 5EUOF 3X1EA 1QZ2A 2ZD0A 3O6FB 3OPZH 3APCA 2BVQB 2P5PA 2CG2A 1QPXA 2QEJA 3FB7A 3OG4B 3ZYOA 2OL3H 3NIDB 3UG3A 4HLZG 4FABH 4N0UE 3MUGB 2D7PA 1N59A 2LTQC 5J89A 2H1PL 1R0AH 1OY3B 3BH8B 4TRPL 4P5MB 5DD1L 5H2BB 5HDQH 4XO4A 4EUPG 2GBUA 1SXSA 3OPUA 3C2AH 3PLYA 2CM6A 5JPMB 4OV5B 5JZEB 3B9JA 3EUB2 4NQCB 3GIZL 1EWYC 1F58H 3F5WB 1E43A 4X99B 3WUWG 1L0QA 1RULL 1ZS2A 1OPGH 3CZFB 4KHTH 1UKQA 1IJNA 3NZ8A 5I18L 4K71B 1A7PL 5ISZA 1X5GA 2QDWA 1DBML 5SWSB 3N9YC 2K1FA 4FNRA 5LGHL 1UZ8A 2A6DB 3ARGA 4RFOL 5D1QC 4OH2A 4IQHA 4MJ5B 2YOCA 5HYJA 3C60B 1UWMA 4C7ZA 3L48A 2FX9L 3L22A 4CMMA 2P3YA 2R69A 3RI7C 2XETA 3W9EA 3ZTCC 4P49A 3EJZC 3LCAA 4HVBA 3D9KA 1SVZA 3CVUA 4WTZA 3OPZL 5GSVB 5IN7A 5SWZA 2OL3L 4FABL 3EFUA 3OVUB 5IMMB 2UWEE 1EU4A 2H6PA 3SDXB 4UAHA 1R0AL 5HDQL 3L3OA 1NDMA 5D6CA 4YNYA 4K2UH 3QARA 1IBYA 3C2AL 4XI5C 4UTBH 2P8PA 1K53A 4FXGA 1F58L 3MRMA 4UWQB 2Q3XA 4GTPA 3PZ2A 2K4WA 1YYHA 3D52A 1C5CH 1OPGL 4KHTL 4AW4A 3NY5A 4HQDA 2NSZA 2XXMB 4MLIA 4Y8AA 4IRSB 4I0CC 2WMOA 1CICD 3CIQA 1CE1H 4UZGA 3CSYA 5GJTH 4RZCA 1HYSC 3RKDD 5E1HB 2K7QA 4HH9A 1KOAA 3QIUD 4N5CA 3ARVA 3MO1A 3SPJA 2IO3B 2A5EA 1T66D 1RZJH 5C92A 3BZDA 3PU7A 4PP2A 4XXWA 4DKAA 3ZE2B 4HPYH 1T3FA 3B2UC 4FFYA 4YBQC 2ICWB 1I7ZA 3FT4A 3MV7D 4K2UL 5KG9A 1W91A 1PDKB 1EF5A 4UTBL 3GWJA 1OL0A 2NBUA 4GQQA 2P9RA 3V5HB 2X4PB 3OJMB 1N6QH 1MWAH 2N01B 2IAMA 4PREB 4Y4KD 1JPEA 1C5CL 1ZA3B 4N2FA 4MJID 3WEXB 5KVEH 1D8DA 2V5QC 3LVRE 1UG9A 4XDCA 4LUNU 1PMYA 3VFWB 4E0RB 4KUCF 4A2FA 4M93B 3HA0A 3QWQB 4FKEA 1CE1L 2CLRA 1EJOH 2X3BA 2XWRA 4IWOA 1V27A 5GJTL 4WHCA 2LHAA 3OHXB 3TTYA 4G6KH 3TN0A 1VESA 5FA4A 2BYEA 3UAEA 4Y4HB 4L29B 1K8IA 1ES0B 3WNOA 1BI8B 1FYTB 1RZJL 2VDOH 4LQFH 5DURB 1KFGA 2QKSA 2J7QB 4D0DB 3O2DA 5F6IC 4N85A 2YEQA 4HPYL 4BKSC 3IDNB 3IHPC 3NJMA 3M1OA 4Y1SA 3FPXA 5ERWB 1GC6A 4UQXA 4FOMA 1JYNA 4FTDA 2M4NA 2YAOA 2X6CA 3N0AA 4GTVA 4ZO6A 1N6QL 4DSYA 1MWAL 1D9KC 3CSFA 3DSUA 5KVEL 1IUEA 3UZVB 4YWGH 1ET7A 4EXKA 3ETSA 2JJSC 3VR9B 3MMEA 1YEHH 4L4VA 4NQED 3FTSA 3N3KB 2D3AA 4WQOB 4Q4IA 4N0FB 4F7KA 1CF1A 3CHRA 1EJOL 1U8HB 3RPIB 4JPSA 1FT2A 2P9LG 1R4XA 2VERN 3MOBH 4G6KL 4GIOA 4LGRB 4F8NA 1XD3B 4OUUB 2QPUA 3O3EA 4TSCH 5LO7A 4LQFL 1INZA 2VDOL 5LNEA 4G80A 4C4KT 3U4BH 4DKEH 2B2XH 4I3RH 1IIIA 4J3SA 4DVRL 1O6TA 4A63A 3SE3C 4ICUA 5CEAA 1IGYA 3KPMA 2KQMA 4LF3B 4FQHA 1SF3A 3VU2A 4CBZA 3SCMD 1A6AB 1ZU2A 4MJJA 3UACA 3ZE1F 1TJEA 4JE3B 4L5FH 3QG6A 1QAWA 4C9BB 2HLFC 1S7XB 3RI5F 3J5QB 1WA1X 3P02A 1RWSA 1N3NB 4YWGL 4GTQA 4IOIB 2F53A 2ASQA 2R4RH 5KBMA 4K3HA 4KQ4H 1YEHL 3DVGA 2BPBA 4F7ZA 4DTGH 3V05A 3LAFA 4A7GA 5J6GB 1HNGA 1F1GA 2BSRB 3D08A 3QXVA 4BZ1A 1PAZA 1UWXH 5HYEA 4WEBH 2K6YA 3CXFA 4DUVA 4MQTB 4HXIA 2K45A 2P8LB 3MOBL 4NBXB 3VH8A 2H6GA 4ETYA 4APQC 2V3FA 4HFWA 4F53A 4TSCL 3BESR 3RPKA 5D72H 4DP5X 2WWOA 1EHAA 5LN8A 3U4BL 1JTTA 2B2XL 1AYOA 3B9KD 4I3RL 4PR5A 1ZHLA 5D7IE 1VJKA 1U2VG 5A7DB 3II2A 1MW3A 4AK1A 4G6AC 4L5FL 4DNLA 1O7SA 3CDGA 1ZT1A 4RAVA 3P9MA 2R4RL 3MR9A 2WU5B 3WLWD 4KQ4L 1QBQA 4JCMA 4K5OA 4DTGL 4OZBA 4L4TB 3V4UH 1LO5A 2HX9A 3SBTB 3T9KA 1IFHH 2NX5B 2JKLA 5HGAA 2BS2B 2H8PB 2AVFA 4WEBL 2X0UA 3L4ZA 4AQ8A 5F1IB 4J4PA 2V8LA 4P57A 4KH9A 4QUOA 4AJ0A 4NI6A 4NPJA 2MNUA 3VXUA 1TIFA 1PLGH 4OD3H 5CJ8A 4XP5H 1NCNA 1VADB 4NS0A 5I5RA 2DWQA 1ZHKA 4K5LA 5D72L 2E7HA 1BLNB 3ARGD 1U8CB 3CR3A 4PMFA 4QRQB 4HIEB 5HYJD 1A1NB 4APOA 4TRQA 2MH7A 1A6UH 2PTLA 5JW4Q 4X9IA 5CLWA 4Z8FH 1I4XA 2WZ5A 5SWZD 2XWDA 1CD0A 4Z7OB 2LU5A 4NRXB 3EYQD 3MI6A 3R19A 4G3YH 3AB5A 1OLLA 2CA3A 2J9QA 3FTZA 2DQMA 4IS6A 5FZRA 1IJ9A 3RTQD 1QZNA 2XICA 3V4UL 1IFHL 3ZYIA 4D0BB 5CGTA 5CD3A 2KJHB 3C5ZB 5ESQA 2GBTA 3CZLA 3GB7B 5D1XB 3FB8B 1FXIA 3ATDA 5D5ME 1E96B 2CO2A 3DO3A 1PLGL 4OD3L 4XP5L 4NQDE 1I1AD 3NN8A 4R26H 5MHSE 1V3MA 1E3XA 5JO5A 4BZYA 3O8XC 4H8WC 2W3SA 1OUVA 3OKKA 3T09A 4M3KB 2GEQA 4JGHB 3N91A 3OSKA 1H5BC 1A6UL 1SGKA 1CQVA 2BSTB 4MCYA 1KXVC 3MEKA 5JHDB 4Z8FL 2WVIA 4AT6A 4GYYA 5KSAB 4U3SA 1MEXH 1QUNB 4NKOB 5A6LA 2ZPYA 4GAGH 2MCPH 3NPSC 5D9SB 4G3YL 4CVZB 4JQIA 2EUWA 5LXHA 1PD1A 2GW1A 1FLRH 1P6WA 2X6JA 3DX9B 2G3ZA 3T4AA 2GQHA 3A6OA 1P9DU 2LGIA 2CHZA 2B1HH 3ZYKA 4E68A 4MNQB 4HOSA 4APXB 1D7BA 3WV0A 3C8KB 4RNRB 2BNRA 2C4XA 2W60A 1PW3A 1WPCA 2IAMD 5IJDC 3VUXA 1MH5A 4GYOA 1IGFH 4KVPA 3ZXRA 3ROOA 4IMKC 4NC1C 2JKIS 3MNVB 3VTTA 4WFFE 4R26L 2KLSA 3EHVA 3RSEG 4KI5E 5BS0A 4JKNA 3F7QA 2I6HA 2FBRA 5HPMB 3UROR 5LXVA 2DENB 4XNUH 3TN0D 3MCKA 1INQB 4DX5D 4HF5H 1XQ4A 5D7KE 5I18H 3LKQB 3U4TA 1DVZA 4YHZH 2FBJH 4AUYA 5I8KH 4KDWA 4LJPB 1N9PA 2E0PA 5J3HD 3D0LB 4WIPA 3AREB 2BCMA 4GAGL 1V5OA 2YZ1A 4KKCC 1BREA 2MCPL 5H37A 4JWSC 1RL1A 3GOEA 1LO4H 2J8UE 1HO8A 1FLRL 5ICYB 1U58A 5H35A 5IEHB 5JOEA 4GLSC 1SPDA 2B1HL 2ZSWA 3KW8A 4KJWD 3DA0A 4GBXB 5HJ3A 2BKRB 4EI0A 2ZJDA 2Z4QB 3O9WC 4N2CA 4WI9A 5HHOE 1HQRB 1ZEAL 3QWOA 3NQPA 1UD4A 4ATGA 1IGFL 1RZKH 4WENB 2GGFA 1EO7A 1IGJB 3L3DB 1R3HB 1V3JA 3K71A 1G9EA 3HFMH 3ABKB 2K3UA 3L3HB 3RNFC 3K0YA 1T83C 2OMBA 2X4SA 3L5WB 3TBYB 4CADA 3S9DB 3SBWC 2LU3A 4UUJB 3DTDA 4KKAD 2WQ7A 3APDA 2BZ7A 1XDTT 2C0MA 4XNUL 5L2JA 1OEYJ 1OWWA 1ORQA 3OQRA 4DXGA 5IW1A 4KI5F 2R17C 4HF5L 4EJ1C 5C9JB 1EVTC 1N9AA 3AC0A 4YHZL 4CJ1A 2FBJL 4NACA 1EYHA 5I8KL 3TBTA 1WY8A 3ZIMA 2DBYA 2JIXA 1B9RA 1WS8A 1QBBA 2DEXX 2WBJC 2H32A 1V1PA 3EJUA 3MRBA 1QR1B 1LO4L 2CU1A 3OR6B 5CZRA 4H2AA 1F4WH 4AGQA 5FO9A 5B1JC 3RJOA 4F7EA 2G4SA 4GDLB 4L1SA 3VU1A 2CK0H 3I85A 1L0XB 2NR6A 2VDKH 1E9MA 3KCWA 3H8NA 1WBXB 1O7VA 1U95B 1U8KA 3ARDC 2F53D 4EOYA 1D2OA 2HJLA 4AYBA 4NFDA 4NAMA 4X8JB 3BZ5A 1DVPA 4DI3A 3EBHA 5ID1A 3IDYB 1IQWH 4Z6AT 3HFML 1D7CA 3C5SB 5JH5C 2DBAA 5FQ6A 5AEKB 3V79K 3AG4B 2DZEA 2VDLB 3VQLA 3FRUA 3Q8CA 2XN9A 3QQDB 4BE6A 2VDQH 4N2IA 4ZHBA 4CVWA 3QIBD 3H9SE 4BA0A 1C4CA 2Y24A 5DJXA 4DIXA 4NRZA 4XODA 1V05A 5C0IA 1UXMA 2DYRB 3LMJH 1N0QA 3VXME 4UINH 2AEHA 2EIZB 2X4TA 3SQBA 3ZNGA 1ZSDA 5IBUB 2PMVA 5ICZB 3PWJB 1T0MA 1UWXK 1P4UA 1SXNA 4G42A 4MSWB 4P46D 2CK0L 2ARWA 2VDKL 1W15A 1CT8B 3DURA 3LV3A 1SQ2N 4P16A 4XKBA 2NY1C 3LRSB 2ETCA 3QDJB 3GS4A 4P9MH 3NEEA 4CN6A 3GS7A 2OYLA 5DS2A 3CAFA 1IQWL 1XD1A 4Y5YB 4K3DH 5F0MB 1LO5D 2XWZA 4R8WH 2OI9B 1M7UA 3T0EB 1O1SA 4M0WB 1KXTB 3LKPB 4F7TB 4OI9A 3C5RA 1DE4B 1HDMA 3ROLA 4A04A 2F54B 4J4PD 2MSED 2A83A 3HNVH 3ZQWA 2O61B 1SBSH 3VXUD 4B97A 2A73A 2VDQL 3LKUA 4UQAA 3EYVA 2OYMA 1TF4A 2Q6WA 5C1DA 2MBHA 3GT6A 2CGYA 5IF0A 4GSWA 2WKGA 2CIIB 4HUXA 4DHLA 1NPJA 2QPDB 1Y8RC 4UNTA 3LMJL 1QSEA 4DAGH 4UINL 1EXUA 3GSXB 1LTXA 2REXA 4X0KA 4QRPE 3W1YA 4UDUB 5MERB 3FO9A 5ICXA 4J27A 4HLEA 3H9YA 2PYFA 1FJ1A 2OMYA 2VQ1B 3G7TA 2F15A 4N2LA 5I1KH 3FT3B 5DEZA 1Z5SC 2QC8A 2AVGA 3I5JC 3K9PB 4LVEA 4LLWA 3UMNA 4ZFOA 1G1OA 1BOGB 3NZSA 2HVJB 3B8SA 4OF7A 5J12C 3L08A 4HKZE 2GTWA 3F6QA 1W8EA 4P9ML 3AE6B 2VLRA 1FVHA 2F8IA 2FSDA 1S0PA 4EQ3A 5TSSA 4K3DL 3FJTA 5JW5A 3QHZH 4R8WL 2YEPF 4P1CC 2Y69E 1T22B 2RAMA 3IF1B 3MRPA 3VQ2C 3VXRA 4OKVA 4E2OA 1KSRA 3OKNB 2X6KA 4JD2G 5EBLA 5EU7C 5BXFB 3HNVL 2MTPA 1SBSL 3VI3E 1V55E 3PQYE 5DD6A 1LNUB 4NUPA 3OXFA 2KERA 2Q76B 4J3UA 1BAFH 2NPTB 2ZCKH 4E6HA 4JZYA 2HA1A 4DAGL 1A6ZA 5IFJA 2ADIB 1BCIA 2BDNH 2KC2A 4PJEA 4R3DA 3E2HC 4NQSB 4XH2A 2R2EA 3GMNA 4DI4A 4H13C 4PJFB 4KBQA 3D07A 5I1KL 1XLQA 3DOHA 5HI1A 2QR0B 4PJXA 5BO0D 4QRTA 1YYMH 2B5IC 3PZ4A 3T65A 1F13A 1NKGA 4Y9FA 4X4MA 4FNTA 3BPLB 4YDEA 3RNKB 3O0LA 1MVYA 4P2YA 5IBLC 4P0DA 3HKZA 4YFDB 1KPUB 4NCC1 2BYTA 1G1YA 5DK0B 2KTRB 3QHZL 1KIPA 3B9EA 4PJAA 4GKNB 2BNRD 1SVBA 1XZWA 2KZRA 2KS0A 4DDID 3VWKB 2DH2A 3RUIB 5DJ2A 5BS0D 1BAFL 2ZCKL 3V6FB 1RY7B 5LCWC 2OSXA 2BDNL 2PM7A 1MOEA 2NTSP 2QHLA 4HUCA 1OANA 3TT1H 2Y7QB 4G70B 4NSKB 4BK8A 5GZOC 3B2DC 3KLQA 4GG6F 1SZNA 4OM0H 5JJ7A 1DYZA 1YYML 2CJTA 4DN3L 4N25A 3UP6A 5FOBA 2HFFA 4UOQA 1J10A 1QFOA 4KZ0A 1OSYA 2BP0A 4PJCA 3PP3H 1VFAB 2QKIB 1LE5B 2RKKA 1JV2B 4WI6A 1XHHA 4GB9A 3ZPJA 2WTRA 4LCTA 1BZDA 1SYVB 2WLZA 32C2B 3B5TA 3DVGX 5IKCA 4ZPVA 3PPSA 5E8DH 5D7GA 1M6OB 4QLRA 1P2CB 1S7UB 4YHPA 2KTFA 3IGAA 4HHWA 4NOBA 4U96D 5CRVA 1FIEA 4JFYB 4O2CB 4BINA 2VQ4A 3P9WB 4HOZA 1TN6A 3LN4B 1Y8MA 4OZGF 4ZUUB 2R2OA 3HE6B 4M03A 3WD5H 3TT1L 7TAAA 1JWUB 3GUTB 4F6RD 3GBMH 4U6HA 3DO7B 2OBGA 3KVPA 1GY1A 3R7QA 3OX8B 4OM0L 2DIEA 5IM7A 2EE2A 1KGJA 3SDDB 5E9AA 4GPMA 2GIYA 3V6CB 1DCEA 4LCWA 3BUBA 3L6FB 4A6YB 1NCHA 3V61A 4KZCA 4M62H 3E6FA 3KQ4A 4NO3A 2ICEB 4LESA 1FL3A 4FA8A 2GHZA 3ZKMC 3NIFE 3T77A 1H6UA 2F37A 2BC4B 3ZT5A 4M5SA 4WI0A 3WIHA 3PGDB 4QEGA 5E8DL 4AWJA 3RWGA 2X6IA 3T6QC 3QA8A 3O41A 3D32A 1D5ZC 4TXRA 3U1QA 1TJFA 3EHBD 2XN9D 1U8QA 3D34A 3WD5L 3B13A 3JTSB 1ZE3D 3IVFA 1IC0A 3GBML 4QO1A 5B7FA 3LXCA 4XGZB 3CBJB 4HNAD 4ZQKB 2GBJA 2CO6A 3B08A 1J1XH 2KLCA 1QHOA 2B59A 2C9RA 4Z7QB 2R9HD 1T0SC 1C9FA 4PRPA 3PUJA 3N44B 4UQCA 3S7FA 2YBRA 2PPCA 1BAGA 4YFLF 1BQUA 5LLIA 4M62L 4CBPA 3EZJB 3ONSA 1M1XB 1F11B 3GGWB 1GH7A 1P98A 3EUUA 3SKMB 3S8FB 2L0IA 1G7JA 3SFZA 1XEUA 1ET9A 2FCQA 1M9SA 2C9XA 2EDMA 3LZPA 3VRLE 1DEEA 1NEKB 2IDYA 3ECQA 3RWFB 5I17B 3IJSB 3D2UB 3QXDA 2V8SE 4QAMB 1MHCB 2EXWC 2JK5B 3KWWA 4QWWC 3F8UB 4BSWB 3D69B 5ESVB 1XV8A 2VIRB 2HWZH 4PRIA 3WTYA 4MVBC 5CD3B 1RJLB 5I1GH 5JA4D 3BGAA 3GHPA 4JO3H 4KMLB 1U3HB 4G1MA 2UU7A 4JFFA 3WE1A 3S7JA 3KPSB 5C1MB 1GTNA 3AXCA 1IGIH 4GW1A 4B9GA 1J1XL 1QSED 2G2RB 1DQIA 3S2CA 4B6WA 2FZ3B 1E2VA 1LQBA 4X6DB 1HX8A 3S4SG 1PG7X 3PP4H 6FABH 3ARBB 3F00A 4F9PA 2ITFA 3WFEH 5DMYA 3Q3OC 4FQXC 4XYCA 3VMNA 2OTWA 2AKRB 4MGXA 2AWTA 5HG2A 3VYOA 1PYWA 2VLRD 4RGND 5F7DA 3PDOA 3OLIA 5HDRA 2VAAA 5B4MC 4BM7A 1DQQA 2X88A 1Z6TA 2XBDA 3V9CA 2W5PA 3VRLF 3DDCB 3VXRD 3QXWA 5EU5B 3BRDA 2HWZL 4H8WH 2L32A 2XWTB 4JRWA 4PS8A 1UENA 5FGBC 5FGRA 4LDEB 5GISH 5BRZB 5I1GL 2N9LA 1Z2KA 4NAWB 1EHKB 3EDKA 4JO3L 4PJ6A 2WXIA 3FZUC 5I74C 5BYRA 1J18A 1GC1C 3MJ7B 4XCYA 4JM2A 4G8FA 1IGIL 4X7TB 3UPCA 2XTJE 1HXIA 3KVFB 4UQ2A 5GXGB 2WVVB 2YD7A 3I4GA 35C8H 2BNUA 2Y5BB 5DWUH 3JT2A 3QH3A 2B77A 3BPCA 1EERB 1JPFB 3FOLB 3PP4L 4ZXBB 1EA9C 3QCVH 6FABL 3KXFB 4YFEA 3HLAB 1BVOA 1IEBA 2OV8A 3WFEL 4DO4A 5K9OA 4HMCA 4FLOA 4NZLB 1YD8U 1BZ7A 3T8XB 4D8PA 1WFNA 3TCAA 4JY6B 4UTAA 4P3WA 4QI3A 4HBQA 1EQWA 3H9HB 3AWGA 5IOIA 3GFUA 4N3AA 1VACB 4JW3A 1C3TA 5CP3H 5DVKA 3RWHB 4L37B 4NM4H 1EXHA 4TQHA 3BIID 4H8WL 2ZQKA 4JG5A 3ONKA 1DUYA 4LTUA 1Z5LA 4N90D 1F5WA 5GISL 4DCQA 3VDZA 4XBGB 2BVPB 3VR8B 2ZKWA 1K8DB 1PZ3A 5CP7A 3UEZA 3GLAA 1GKEA 4KDVA 3QFJE 1BZEA 4AQAB 1A5EA 2J1ZA 4KXKB 2BW4A 4XWOC 2XKNB 4HP5A 5DWUL 4JEHA 3HZVA 3TS8A 3TG4A 1I82A 4JGNA 1ZAGA 3QCVL 1DN0A 1Z9OA 2X89A 2WXPA 3OKEB 3CC5A 4IMLA 1NBZB 4HZLB 2J5WA 2HN7B 3MV9E 4R96B 5BV0A 1WWAX 1S2EA 1CFTB 1I7TB 5LXGL 4PGZA 3TVMC 1SE9A 2OX5A 4GS7B 4PRAB 2LVPA 3MV8D 3RK6A 3VD0A 4NM4L 3O13A 1ZIAA 4FNSA 1GZQB 1FZJA 3MGBA 4HK2A 5F0PB 1AXTH 1CXFA 2HFGH 1WJ3A 4PJGA 4WH4A 3Q7JA 1V10A 1WFJA 3IXAA 4Q9CA 1AC6A 4EUPB 4ABUA 3P4RB 5A6CA 5C09B 1AP2A 2P9UG 1HHKB 5AW2B 1CU4L 1QFUH 2G3XA 2QSQA 1NMAH 4HV8A 4XNXL 5CJOH 3RWCB 2WNWA 4A3PA 5IVXE 4C56B 4AQEB 3AAZB 4YVQC 2V8MA 2WV3A 2X4UA 4GUPB 3PP3K 1NBFC 2YXFA 4UZSA 2C1PA 5I6NA 2C8NA 3EDJA 4J1UB 5MEOB 2YEVB 1HF8A 4I8DA 4M5TA 2LOEA 1HH6A 3W9DA 5IJCC 3MGOA 3DX3A 3LB8C 4LNKA 4L1DA 5KYNA 5A16B 4OZFB 4LB8A 2IWEA 1XF4B 4ZW6A 4YSYB 4J2XA 4MELA 2HT2C 3GNMH 2KATA 1OAXH 1SXTA 2DX5B 1AXTL 1Z5YD 1HXKA 2HFGL 5A2JH 1IC4H 1AVAA 3CK7A 2D8KA 3D9NA 3ZDYE 1DJIA 2D4FA 2V9UA 3DOIA 4B9CA 4F93B 3DV4B 1QFUL 3FYEB 2YSSB 1NMAL 1A47A 2XQ0A 3Q7FA 1R3JB 4P23D 2X6HA 2NXPA 5CJOL 5E8EB 1QKZA 1ASOA 3OGCB 3US1A 2AQ2A 4LXFA 4L3CB 2JZPA 5EIDA 5B7MA 2GT9A 3MGTB 4NP4H 1AS8A 4M1GH 3VFSB 1NIBA 3AU1B 4OJDH 4ZUVB 1HHHB 3HE7A 3O6FC 4PRPD 4PUBH 8FABB 3ULUD 2BS3B 3RDTA 4JL2A 1AOZA 4Z7VA 5B39G 1OE3A 1GS7A 1H15B 2W38A 4K23H 3FUHA 5LHDA 1HSAA 1CFNA 3OKOB 4LK0M 1WF5A 1FWXA 3CU1A 3GNML 1J05A 1OAXL 1XGQB 3MODH 4FN0A 3SPGA 4KKZA 1IC4L 2EIEA 3OXLA 3KD4A 3CH1A 4X6CE 3IDIB 5JPMC 2KDFB 1UW4B 2PKOA 5D2NB 1GSKA 1DUZA 1FUNA 5FYKE 1MLBA 1Y6IA 2AQTA 2QCZA 2EECA 3F7PC 2OTPA 4L9DA 1S9VB 4MQSB 1NBVH 1F6AA 2EINB 4YZWA 5D7EA 4Z7IA 3BQUB 2BKKB 4Y2DA 2DI9A 4JVSA 4NP4L 4M1GL 5J11C 1HILB 3C60C 3V2OA 2ZYIA 5CIPH 1THCA 4ZK8A 1EUVB 2KDBA 3HG5A 4OZHB 2BK8A 4PUBL 2EDRA 3UBXI 2V5RA 3AE5B 1I4RA 1SUHA 1EJFA 3BDXA 4K23L 1F42A 2ZX9A 1CXKA 2WXNA 1FNEA 3V55A 5I0XA 5EEWA 4H25A 4OGYH 1VZ7A 4FLBA 2AJYH 3ASOE 1PKQB 3VFOB 3TXMA 4J3OF 5J6SA 3F12B 2IOOA 1PYWD 5D96B 5B38A 2X4OB 1BVKA 1LXDA 3V0EA 5EU3B 4X6CF 4IUMB 5KHOA 2GC7C 5KJLA 3B7BA 1NBVL 4KXBA 4NYLB 2NTSA 5D3DA 3VMOA 4YDLB 2AX5A 1XCTA 4IRSC 4YE4H 2EQXA 1ZVNA 3V0JA 2IDSA 2OV0A 2PP9A 2WVUA 4JM2D 4WW2B 1I9IH 2X7LA 4PGDA 1R5IB 3W56A 5EZJA 1Q9WB 3K80A 1UXWA 3FB5B 1CXHA 3HMXH 1TQBB 5EEVA 5ETUA 4M5ZH 4OGYL 2FJSA 4TVPE 4JFQA 2AJYL 2R39A 3JBG7 4NGHH 5KSBB 3CVQA 1EFQA 1J9SA 1J7AA 4U1KB 1S9KC 5F7NC 1S78D 4Z7WA 1UF0A 3NS8A 3ECVA 2P24A 5D2MB 3VVWA 5CEZE 3M62B 1PF3A 3AW5A 4W4OC 3NDZE 5CEXB 3QUHA 4WUKH 1CYWA 3W1ZA 3OMNB 5CF3A 3HRDD 1HQ4A 5I75B 4M93C 5T5FA 4YE4L 3RO3A 2DJSA 4FLQA 1M56B 1INDH 5CJBA 2GRLA 3X12B 3PEUB 1NZNA 1I9IL 3SYPA 1QRKA 3OHXC 2J4WH 2QMKA 5FWRA 3HK0A 3MYVA 2JXMB 2NOYA 3FFCD 4U1SB 1NCOA 2GBKA 1XR8A 4Y4HC 1NEPA 2EVGA 3HMXL 4N24A 2WQYB 4GKLA 4K7FB 2NC9A 2VDPB 4TSAH 5E1QA 4HDQA 2X89D 4M5ZL 4E9VA 1TJXA 3DROA 2N0MA 4HIQA 2ESVB 4NGHL 1ZVSA 2WLYA 5IEKA 4UWFA 3OD3A 1QHQA 2CALA 4EI6A 2VLKE 1HX0A 5EUKB 4L0ZA 3KH4A 5L2KB 2ONDA 4ZZKA 3CVBA 4WUKL 1BIIA 1HU3A 1U8IB 2R15A 3T0DA 4W9GA 1ZK9A 4N3UA 3CTTA 4Q6IB 3DVGY 1IQRA 3EF4A 1INDL 1N61A 3SF4A 2IQAA 3QEUB 1F02I 1I35A 4K8RD 2BS9A 1U8NB 2WZAA 2J4WL 3X11B 3EH1A 2DQGH 4G50A 4OD2B 5CLYA 2NY2B 3FQXB 3RO2A 2J71A 3KYNB 2CHNA 4LFHD 3V30A 2FEJA 5E4EC 2OSWA 1MXDA 2BVUA 3KUDB 1X7QB 2WWMC 4G8EA 1E67A 4TSAL 1J1PH 1XSIA 4OCNC 2CR5A 2G5BB 2N7EA 2JI3A 5AAPA 5IHUH 3AE3B 1JNLH 3N1XC 3WEAA 3S36H 2Q86A 4O6FA 1WAAE 3PUKA 3HNSH 3UTPD 4X7EC 3RL2B 3WJMA 5C0CE 5A7EA 1FFUA 3CFBB 3LVQE 2DIAA 4JRXA 3K4ZA 4P2RB 5IIEB 3GHEH 4YLBA 3V6OE 3ZN3A 3D39B 3Q15A 1MDTA 3OSVA 3MREA 1F6LL 4ODVH 3Q5MA 2ILRA 3A3YB 4OFVA 2O72A 4RQQB 2KQ7A 1VZ8A 1JV5B 2ZUSA 2HFEA 5EUOB 3GMQA 3SBPA 1EPUA 2FT8A 1HHGB 1GY2A 1OSEA 2DQGL 3SE4C 5J56B 3IKCB 1SEBA 4YQXH 3DXAE 3MCYA 1KB3A 4Z3EA