1RZ4A

Crystal structure of human eif3k
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
213
Chain Sequence
AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADEQIFICSQEESIKPKNIVEKIDFDSVSSIMAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human eIF3k, the first structure of eIF3 subunits
pubmed doi rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
molecule keywords Eukaryotic translation initiation factor 3 subunit 11
total genus 69
structure length 213
sequence length 215
ec nomenclature
pdb deposition date 2003-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10075 CSN8_PSD8_EIF3K CSN8/PSMD8/EIF3K family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rz4A02
1.25.40.250 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat ARM repeat; domain 1 1rz4A01
1JHFA 2VBYA 2ZMEB 4GO1A 4A0YA 4Z2YA 1XSXA 4L9NA 2FU4A 2WTEA 2A69F 2H6CA 1XGMA 3HUGA 4RAZA 1S3JA 2WV0A 4BHCA 3RYPA 5LHGA 3FMSA 3C7JA 1W5TA 4G7HF 4I7HA 1KYZA 2DO7A 3LA3A 4P9FA 3TKYA 2VODA 3MQ0A 3CDHA 4M9XA 3JW4A 4M74A 2F2EA 3L7WA 1O3QA 4ENJA 3LAJA 3TGNA 2FBIA 4HF1A 3FXUA 1FBQA 3ZMVA 4A6DA 3KEOA 2LF7A 5JR3A 2VBXA 4M73A 4R79A 4M72A 3HRUA 1QZYA 2V6CA 3LQRA 3W6JB 2XAGA 3VB2A 1ZGAA 4F7ZA 4H0EA 2A3SA 2O61A 4HAMA 3Q9SA 4EJTA 5HDKA 1R58A 2P6TA 2GAUA 2QQAA 5HS7A 4FX4A 2ADUA 3KZZA 1EV7A 5ICCA 3C1DA 3ECHA 3MCZA 1KU7A 3N97A 2F5CA 1H9TA 3HOSA 4UXNA 4FX0A 1W7PB 3E3VA 1YS7A 4KN4X 2ESNA 3K1NA 3HSFA 4OMYA 3E5QA 4R8HA 3J81K 1KQ8A 2XGXA 1A04A 1TW2A 4KT5C 3LAPA 4EGZA 2O8XA 3IKTA 3V7SA 2P5KA 1TTYA 3I59A 4BH9A 2PJPA 3K0LA 1ZLKA 4A5MA 1TNTA 1T0FA 2W57A 2P5LC 3WGHA 3ZMTA 1FNNA 2GXGA 1LNWA 1I1GA 2WC2A 1CGPA 3HHGA 4ESBA 4LG0A 3TDUC 3KP6A 1EH7A 2RDPA 4B8XA 4MTDA 1B9NA 2UZKA 1LB2A 1CF7A 3DXJF 2FF4A 2KJCA 4YIIA 1TQIA 4KYWA 4ESJA 2G9WA 2EJRA 3JAMZ 4M6YA 2IVMA 1T2KA 3M1EA 2A68F 4KDPA 2VOPA 1YFHA 2P7CB 5BOXA 3KLOA 3GFLA 5HLHA 1MZBA 5L3DA 4OOIA 1R1TA 5K5RA 4ESFA 2L3DA 2PMHA 5CVJA 2G7UA 3DPTA 2A6HF 5K5QA 4O3MA 3B73A 4GYGA 4A2UA 2XKOA 4KNYA 5HS8A 4N0BA 2LF8A 1B59A 2STWA 5A2QZ 3T1BA 4MNUA 2YSRA 2A5YB 2CWEA 5E1WA 5IT9Z 1YQAA 3DKWA 3FWEA 1JHHA 2D1HA 5E18F 2ZBKA 1O57A 4RGSA 3RKYA 5FD6A 2P8TA 2IA0A 3CUQB 1J9IA 2V9VA 4UV9A 2DQRA 1J5YA 4HW0A 3QP5A 2FQ3A 1MKMA 4IRGA 1FBSA 2JPBA 3F8NA 3LWFA 2BEOA 5K5OA 1BI1A 1TQMA 1PDNC 2J5OA 3V8KA 2H27A 1IZ1A 4XLNF 3ZP5A 4P96A 4HOBA 4PCQA 2MLGA 4I0AA 1FP1D 3U9GA 3C3WA 4A5NA 2MH2A 4A0ZA 3HSRA 2BE5F 2H09A 1UCRA 4KMUX 2CYYA 3VOEA 1RI7A 5BPIA 2PMUA 1G3WA 2CO5A 3C18A 3WODF 5LHIA 2WWYA 2EA2A 4N9IA 1WRJA 3ABUA 2JT1A 3SXYA 3HTSB 1FZPB 4GXOA 4RB2C 2K86A 3M7GA 3F23A 3KP3A 2BYVE 1P6RA 2E7XA 1R1UA 2O03A 1DUXC 2QUFA 1SD4A 4BNCA 3GEZA 2QQBA 4XBFA 3O6BB 3R61A 5E1XA 1HSJA 1B1BA 3I71A 2D1VA 2EV0A 3H3UA 1KQ0A 3V7RA 3HHHA 5E8IA 3WU1B 4MHGA 3GZ5A 5FO5A 4O5VA 1QBJA 5ICGA 3BJAA 1YLFA 1ZRCA 1Z9CA 2V1XA 2DTRA 4LJZF 1YTYA 2Z5UA 2M30A 3BY6A 2FOKA 3FXRA 4NQWA 4HF2A 2CFXA 1RNLA 4EQQA 3DP7A 4LLLA 4MEXF 5BS6A 5H6RA 3L9FA 2EFOA 1ODDA 1FX7A 2FNAA 5D5XB 2VXZA 3T5XA 2ZXJA 3FM3A 4XSZF 4L0YB 3V4GA 2VT3A 2PI0A 1AWCA 4U7DA 1SD6A 4R1HA 1QO0D 4YIFA 1ZRFA 2OQGA 4RGUA 3GFJA 1E2XA 2OBPA 1XB4A 2FMYA 3L2CA 1U8RA 2A6EF 2W84A 2R7FA 4FHTA 3SZTA 1YW9A 4ENMA 5A2QK 2W25A 1L3LA 1XMAA 1P4AA 1XSDA 2HEOA 1SD5A 2YPRA 5CVIA 4BYYA 1U78A 3U2RA 3GLXA 4YG2F 3J7AO 5FFZA 3QU6A 2EFWA 3RPUA 1T98A 2M87A 1ZREA 1VTNC 2VOOA 1HQCA 5DUKA 5LEKA 3F6VA 1YW8A 1U2WA 4Y17A 2DU9A 3LA2A 4NHJA 4L18B 2HQNA 3NEUA 5DD8A 2PLYA 4UVBA 4CGZA 5EEGA 2F5FA 1G3TA 2X0LA 4K2EA 1KQ9A 3RPQA 2JZYA 2V1DA 2NNYA 5LRSA 3K2ZA 4Q5SF 4G7OF 3F8FA 1YG2A 4LMYA 2DW4A 4G9YA 2P6SA 1JXSA 1T39A 4RS8A 2KKOA 2L54A 2IJLA 3HRSA 2ZKZA 2IW5A 3ZN1A 2KRFA 2HYGD 5D6EA 3TO9A 3HTUA 3EETA 3O3KA 2RKHA 1I27A 1MJBA 1SAXA 1O3TA 4D0PA 4LLNA 4WX9A 1J59A 3KFWX 1G4DA 4S04A 3FHZA 3EYIA 5JVTA 2TDXA 3H92A 4BAYA 1L0OC 4WXDA 2FE3A 2OA4A 2O3FA 1I5ZA 1LEBA 2VC0A 3WG9A 1TNSA 1B6AA 3NQOA 1XDUA 3WTSC 4G6QA 3WTUC 4IHTA 4OIOF 4JBAA 5ICFA 2STTA 5DDGA 1R7JA 4YFKF 1TW3A 5HDGA 2P7VB 3DEUA 5DCMB 3KP2A 1XCVA 2L4MA 5DEQA 2EV5A 4U0YA 1LEAA 2EFNA 3ISPA 2D45A 2H94A 1ULYA 2CG4A 3IL2A 1BJAA 4ZH4F 2VC1A 3ZMSA 1Z1DA 5FLXK 2VBWA 4L9JA 3MFKA 3MEXA 3G3ZA 1OKRA 2HQRA 4MTEA 5AIPA 5AONA 4OIPF 4CHUA 1KU3A 1ZH5A 2DBBA 1GVJA 4LG0B 4HQMA 3WU0A 2CQKA 3ML6A 1D8JA 3QOPA 1QPMA 2LNBA 4KIFA 1IXSB 2FSWA 3GW2A 3I54A 1PP7U 1U5TB 1FYLA 4E70A 5BMZA 4I2OA 2HDCA 4U88A 4A6EA 1KGSA 3GUDA 4CICA 4UHTA 4LB6B 2C6YA 5FLXZ 2ISZA 1GHCA 4Y15A 4RGRA 2ZNZA 3OV8A 2Z99A 4IF4A 1XDSA 4ASNA 3CO7C 1F4KA 5LLQA 3I0TA 2AXLA 4U0VA 1U3EM 2A61A 1QQIA 3REOA 3GFMA 2Y48A 5CVUA 1O3SA 1SFEA 1Q1HA 1ZYRF 1UB9A 3QU3A 5KK1A 1R5GA 5KVRA 2IT0A 3LSTA 1IUYA 3K69A 3F6OA 4KIGA 2P5VA 2H6BA 1KU9A 4ON0A 4L5JA 3LFKA 4AIKA 3NRVA 1G3SA 2VONA 3ZQ7A 1SFUA 1G3YA 3WTYC 2RV8A 1MDMB 3R60A 1SMYF 2PEXA 2EFQA 3P7NA 2QYOA 3KETA 2V1UA 3CUQA 3F8MA 3ZPLA 3QPTA 5TJJA 1LJ9A 2OAZA 1J7KA 2HZTA 2DAOA 3R6SA 2XROA 1QNTA 2HTJA 3V7CA 1X3UA 2FBHA 4HDUA 1C0WA 2EA4A 1XMKA 4A12A 4IRIA 4EJUA 3BDDA 1HXDA 1YS6A 2EFPA 1IN6A 3L09A 1RZ4A 4HX4A 3FF5A 3JTHA 4WF2A 3CJNA 3CO6C 4GYIA 1F1ZA 2XUBA 4ENKA 3RIRA 2XVCA 2PQ8A 5H20A 3GO5A 2MC3A 2QWWA 1BIBA 4L9TA 5CLSA 2ESHA 1IRFA 3RKWA 4DQ2A 3OOPA 5AIQA 2EB7A 5HVQC 2LDUA 3HRMA 1V3FA 1ZG3A 3FM5A 4G6DA 4M9SA 2QVOA 1IN4A 2VBZA 1FYKA 2GWRA 3M8EA 1U5TC 3T8TA 5ILUA 3P9CA 4L5IA 1IW7F 4AD9A 2QENA 1PP8F 1WWXA 1K78B 2COMA 4OINF 5HS9A 1GXQA 3KCCA 4P5OA 3DQVC 3EQLF 3J80Z 1OYIA 4JQFA 4BXUA 5D4SA 3GWZA 5DCMA 2Y75A 4EM1A 2ISYA 2M45A 5ED4A 5D6FA 2M1BA 1PUEE 3RI4A 4RB1A 2MH9A 5FB2A 5K1YA 2XASA 2F5DA 2Q0OA 4AIJA 3J80K 2YX4A 2VT2A 3V8JA 2M8EA 4LB5A 4QWQA 3I59B 2RVCA 3TDZC 2HKOA 1I6XA 3IWZA 2RN7A 2R7DA 1BI3A 2RC4A 2XAJA 2XKPA 2GQQA 2NYXA 5L3BA 2Y0MA 4UVAA 4HV5A 4U0WA 4ENNA 1ON1A 1U5TA 3BOQA 3SZPA 4KN7X 4RB0A 3FZVA 3RTRA 1TBXA 2YR2A 1KYWA 1Z6TA 1KU2A 3WTVC 2RNJA 3JSPA 3J81Z 2Q8KA 2L4AA 5HOOA 2CGPA 5LGNA 1WI9A 1W7PA 1HW5A 5DD4A 1W5SA 5FD5A 2XRNA 1XD7A 1I1SA 3WE2A 3GZ6A 5LBQA 2K4JA 2QLZA 4AIHA 2O6GE 1D3YA 3G73A 2HWVA 4P55A 1RUOA 4HX8A 2MLKA 4M6XA 2IP2A 1D8KA 4HX7A 1ZN2A 2EWNA 2IA1A 4ZYGA 1XGSA 3R0JA 1G6NA 3COAC 3K1PA 1Z7UA 2Q2EA 2ETHA 2FRHA 2K4BA 5CYVA 1JGSA 1HKSA 4I0BA 1LVAA 2M5WA 2UXXA 2JSCA 5HDNA 1SD7A 1R00A 4PGHA 1OR7A 1DDNA 2DQLA 3GF2A 5ERIA 1R5HA 4HF0A 2L02A 4WXCA 2MA3A 1MJAA 3HRTA 1U6GA 3WGIA 1E17A 5D5VB 4ZYEA 3QP6A 4NB5A 2UWMA 5LHHA 4RAYA 1K7AA 3CUOA 1SMTA 3HIFA 1LQ1A 2Z9OA 1ZAOA 3GXOA 1V4RA 4QLCU 1IN8A 1R1VA 2J5PA 4IPAA 1ZLJA 3E6MA 4CXFA 3DF8A 2LKPA 1UHWA 2HYFA 1STZA 4OMZA 5CVVA 4XLPF 2UXNA 2AS5F 3F8BA 4XSXF 1LDJA 3BPVA 3Q9VA 2K7LA 1FY7A 1O7FA 1ZG1A 3FMQA 4CYDA 3WE3A 5D8KB 3WGGA 1Z05A 1XN7A 5JFRA 1QZZA 1FYMA 4N9HA 2QBYA 3M9AA 1WQ2A 4XRFA 3B02A 1R23A 2X4HA 3LQQA 5BPDA 3U1DA 1BBYA 3WTXC 3KP4A 2GZWA 1ZGJA 1EH6A 3P9IA 5HLIA 1FC3A 2MD5A 3PQKA 3F21A 1RIOH 4ETSA 3HOTA 4M9ZA 4EMSA 4CDGA 3EUHA 2JRTA 1HW2A 2QZ8A 1UFMA 3E5UA 3KP5A 3KEQA 2GXBA 3I5UA 4GCVA 1Y0UA 1FWZA 1IXCA 3RKXA 2OQRA 5EEHA 2BGCA 1S6LA 1D5VA 1S7OA 1IF1A 1XSVA 4MGRA 4WCGA 1BOAA 2QBYB 1H9GA 4BQAA 4L9VA 3T8RA 1YYVA 3FX3A 2V79A 3TO7A 5DV5A 3S2WA 2DPDA 1O7LA 4EV0A 3D0SA 2ZFWA 1BI2A 2Z3YA 2QQ9A 2DT5A 2KIMA 4KIBA 1P4XA 3K1MA 2JPCA 1ZRDA 4OIRF 3TQNA 5LEJA 1ONVA 4UUVA 4FT8A 1ZARA 3GVAA 4ZYHA 2VE8A 2VN2A 2ACJA 3VODA 4O6JA 4HV6A 1MJ9A 3ELKA 3DV8A 1B9MA 3JSOA 4PZJA 1HW1A 3MAJA 3E6BA 4LD5A 2OD5A 4WK8F 4BHPA 4I01A 5D5UB 3CTAA 2OU2A 1O3RA 1MDMA 1TLHB 1ON2A 2PFBA 3WTZA 2GA2A 2G7HA 1MD0A 1TQPA 3I58A 4IHSA 3W6KB 4HYEA 3SFZA 1EH8A 1S7AA 2HS5A 5FFXA 5D5WB 2K02A 3M8FA 4HA8A 5F1RA 1BM9A 2BBYA 3H3ZA 3N4MA 2ZJ2A 1HKQA 3IKVA 4GGGA 3I4PA 4B09A 1XGOA 3VFZA 1K79A 1IAWA 5J8CA 2HR3A 3E5XA 1FSEA 2EK5A 2ELHA 2RGVA 4EM0B 5DCFA 5F6FA 2A07F 1IN5A 5L3EA 3JTGA 4KA4A 2XHKA 2XAHA 2W24A 5HLGA 4P9UA 4M71A 3BPXA 1J0RA 3SHFA 3E6DA 5ILVA 2ZO4A 4G7ZF 1AOYA 3VEPA 2ZNYA 4RB3C 1FOKA 5J8FA 2CW0F 3WTWC 2W85A 1BIAA 3L00A 3ABTA 3KP7A 3GYHX 3IRRA 1ZG5A 2KIFA 3KE2A 1OYYA 4HLXA 4MQ9F 1K78A 1S8NA 3I53A 1OMIA 2DFIA 1S29A 3ZMZA 3R4KA 1RUNA 2IA2A 4Q47A 5F64A 4ZYDA 1YIOA 1HKTA 1F9NA 5ILSA 6PAXA 5LGUA 2E1NA 3WTTC 3TOBA 2R3SA 4IVNA 2RQPA 1BN5A 3CLOA 1W4MA 2Z33A 3F8CA 5E1ZB 2PN6A 5L3GA 4UNOA 1IN7A 4Y13A 4KUMA 1Z6RA 3IRQA 4RGXA 4LK0F 2ZCWA 3HSEA 2FMLA 5ICEA 1H0MA 5JHUA 4EVIA 2PBIA 2YX7A 1W7PD 1CF7B 4ZZLA 1OYWA 2P4WA 4EJWA 1REPC 1P2FA 4UV8A 4IXAA 5CJ9A 3O2PE 3EYYA 5E20A 2PG4A 2FA5A 4KMFA 1YO5C 4LFUA 3BJ6A 3F22A 3R0AA 2YU3A 1BC8C 1BI0A 1HSTA 4IRHA 2L01A 3LA7A 4G8XA 1FT9A 5E8GA 2XAQA 3KLNA 4HZFA 3EDPA 2BV6A 1R36A 1R22A 4Q4ZF 5LRRA 4WWCA 1FBUA 3PFIA 3FXQA 5D4RA 2GIVA 4MQVA 3ZMUA 3ECOA 5DYMA 4IJAA 5L3FA 4OIQF 5FGMA 2HOEA 4YFXF 4KICA 1UHMA 1DPRA 2JTVA 2ZMEA 1B4AA 3MZYA 2NNNA 1OPCA 1USTA 2DPUA 4JK1X 4AVPA 1KA8A 3K9TA 4I09A 4I98B 3Q5FA 3ZN0A 4L0ZB 3CUQC 1FP2A 4WXHA 2DK8A 4ZZDA 4EJOA 3GX4X 3F72A 5CVRA 4LLGF 4HDVA 2IRFG 3BP8A 1MGTA 5IT9K 2VE9A 3RDIA 3IWFA 2DK5A 2O0YA 4PDKA 2XIGA 4LGWA 4EGYA 1J75A 4OU0A 2NAZA 2QM3A 2CSOA 2FEZA 3AAFA 1JE8A 4MEYF 4BHBA 3TOAA 2HKXA 4S05A 1ZHFA 1WKMA 2D2WA 5IT3A 4G94A 1DP7P 1USSA 1HBXG 1J2XA 1YW7A 1LDDA 3KZYA 1BC7C 5H6QA 3MZHA 3IHUA 3RJPA 1GXPA 4HBLA 5LGTA 3TO6A 5E17F 1XGNA 3PQJA 2FNPA 2GA1A 2NS0A 3BWGA 3QRFF 3IC7A 1DPUA 1Z91A 2KJBA 1LDKB 5DUIA 2XAFA 3HYIA 3QAHA 2B0LA 3ZMDA 2MBFA 1K6OA 3I64A 3E6CC 4AWXB 2K27A 3T0YA 2OZUA 2IPQX 2DI3A 2E1CA 3ERED 2FXAA 1T6SA 1FPQA 1F5TA 1FLIA 4PGGA 5TRDA 4A0XA 3BZ6A 5JI6A 1WSUA 4CZZA 1QGPA 4CO8A 1FSHA 4UVCA 1P92A 2DLLA 1IXRC 5D8LB 3GFIA 4I02A 4Q48A 2F5EA 4U7BA 2HTSA 3FMRA 1IRGA 4DNCA 2XV4S 1XCBA 2OZ6A 4HQEA 1SFXA 3F3XA 4YFNF 3RYRA 3ULQB 3E97A 1P4WA 1NHAA 2FBKA 2LSOA 4HLYA 4TV7A 3SQNA 3JAMK 3V8LA 2E7WA 2NRAC 2HFHA 4LK1F 4KFCA 1T38A 3QPHA 2KIUA 2EV6A 5BQTA 3P9KA 3D5LA 3DPLC 5J6XA 4EJVA 3DFGA 3BROA 4EM2A 3BJOA 3ROUA 2HGCA 5L3CA 3MWMA
chains in the Genus database with same CATH superfamily
1JHFA 1SFKA 2XS1A 4ILGA 5GAGJ 4G24A 3JRIA 2VBYA 2ZMEB 4GO1A 4A0YA 4Z2YA 1XSXA 2K9NA 3PEVB 3FP3A 2J49A 4L9NA 2XC7A 2JA7J 2FU4A 3U1KA 4KJZA 2WTEA 5J1YA 2OTJI 2L6JA 1S7EA 2A69F 2H6CA 2K3FA 5T8IA 3AAAC 4PJJA 2HVRA 2QSGX 1XGMA 5GP9A 3RSEG 3HUGA 3ZQQA 4RAZA 1S3JA 4ZYAA 3LSKA 2BVMA 1D8EA 2LFBA 2COBA 2LP0A 2DA7A 4DJAA 3S1QJ 3LVRE 2WV0A 2L9NA 1E8ZA 2K9LA 4UWLA 4HEA2 4BHCA 2DDBA 1JGGA 2DYSH 1SANA 1FT2A 1V5GA 5GADJ 3RYPA 4DGWB 5LHGA 1U2VG 1NG6A 4G12A 4HSRA 1QZEA 2JA5J 2R92J 4J8DA 1U9OA 2WXFA 3FMSA 5A23A 4GYYA 3C7JA 1JUSA 1W5TA 4II2A 4JL0A 4G7HF 1ZTRA 4I7HA 5C1DA 4XM3A 3MZLB 4BGDA 1KYZA 2KISA 4FE7A 2AXTC 4D1QA 2DO7A 3LA3A 1RR8C 1NK3P 2R5YA 3B7BA 4P9FA 4M3FA 3TKYA 3MQ0A 2VODA 2R17C 1JWFA 2A6TA 2JN6A 3CDHA 4U0ZA 1ZELA 3KSQA 4M9XA 2F4OB 1S9HA 5IYDJ 2HM8A 3FEXA 1OR7C 3BTLA 3JW4A 2XSDC 4M74A 1VQ5I 3E0JB 4J19A 9ANTA 2F2EA 3L7WA 1O3QA 2F6CA 4ENJA 3RAUA 4F1SA 3LAJA 1S64A 2M63A 2CUFA 3TGNA 2H6FA 4BUPA 5EIBE 4CYCB 1HOMA 3S2HJ 1BR1A 2FBIA 4HF1A 4XK4A 2XGDA 3FXUA 2OPTA 2IBDA 3CQCB 4F6RD 1CQTA 3Q15A 2ZXWH 1K1BA 3RQ4A 4DIQA 1W3BA 1FBQA 3QPSA 4DZPA 2CQXA 3ZMVA 4A6DA 3AU4A 4BXXJ 3KEOA 2MW8A 2GXAA 1MBHA 5FLVA 2LF7A 2C0MA 3HGGA 3S16J 3H35A 5JR3A 1ZKGA 1OY3D 5EZGA 5GTHC 2DFFA 2VBXA 2VGEA 2BEDA 2VSYA 2NVXJ 3OAWA 2EIJH 1GT0C 2L9BA 2E19A 4M73A 4R79A 3Q79A 4M72A 1JKQC 3ESKA 3HRUA 1QZYA 2V6CA 5LD2C 3LQRA 1MH4A 1QU3A 1B8IA 3L82A 4XOPA 3W6JB 3CHMA 2XAGA 3SQVA 2L7KA 1ELRA 3MYVA 3VB2A 4EBAA 4NBQA 1ZGAA 3AG2H 3KSLA 4F7ZA 4H0EA 3LJ3A 4MRUA 1D5YA 1JUPA 3JRCA 4HS2A 2A3SA 2JK3A 3F6QA 3H1CA 2O61A 2LXLA 5B1AE 4HAMA 4AIFA 3Q9SA 4EJTA 4C2MJ 5BNWA 5JJ6A 4G8KA 5ENOD 4ANVA 3TWSA 4AY5A 5HDKA 1OCZH 3BG9A 1R58A 4C9BB 1DCEA 1V54E 2WXGA 2P6TA 2KMUA 4ATGA 3TWUA 1UZCA 3FBNB 2WY8Q 1HX8A 1E7VA 2FOWA 2GAUA 1UMQA 1A5JA 2QQAA 3KD7A 5HS7A 4G1TA 4HOSA 4PDXA 1EKEA 1BW6A 3ZYMA 1LFBA 2Q2EB 4FX4A 2O8KA 2ADUA 3KZZA 1EV7A 5ICCA 3B7SA 2ZJQF 3C1DA 4A3LJ 3CMYA 4CCOA 5FKNA 1DU0A 2DYSE 3ECHA 3MCZA 1LFPA 4ZFHA 5CEDB 5EZHA 1KU7A 2WPVA 2AWIA 4LCTA 3N97A 3EDTB 2F5CA 3LFUA 3QDNA 1H9TA 4DYQA 3HOSA 3UNGC 4UXNA 4FX0A 1R5ID 5AQBA 1W7PB 1Y6IA 2V4JC 4O1PA 1Z67A 2PMZA 3E3VA 1YS7A 1E8YA 4KN4X 2OV8A 4RM2A 3DLAA 2ESNA 5ITZF 1DGWY 3K1NA 3HSFA 3OXLA 3URZA 1BW5A 4OMYA 3E5QA 4R8HA 3J81K 2I9CA 1PVEA 3LY9A 2PX9A 1KQ8A 2XGXA 3OYAA 1VZ0A 1A04A 1TW2A 5ANRA 3R9MA 3G2VA 4KT5C 1H2VC 1DU6A 5FT9A 3LAPA 4EGZA 2O8XA 3LEWA 5EILA 5LP0A 3IKTA 3V7SA 4NURA 3AG3H 2P5KA 4ZHBA 1TTYA 3H5RA 3I59A 4GTMA 2IF4A 1LD8A 4BH9A 2CG3A 2Y30A 2PJPA 1TNOA 3WG7H 3K0LA 3NARA 4CYCA 4RQIA 1G2HA 1ZLKA 4A5MA 3FTZA 1Z77A 1OCPA 1TNTA 1T0FA 2W57A 3FXMA 3MKYB 5BNGA 3WGHA 2P5LC 3FUFA 4JA9A 1R4NB 3NWTA 3BR1A 2Y4UA 1PY1A 3ZMTA 1FNNA 2IS6A 2GXGA 3ZYKA 1LNWA 1I1GA 2E2IJ 2MOWA 4BJ6C 2WC2A 3L2VA 1CGPA 1MIJA 3HHGA 4ESBA 4LG0A 3ZQFA 4JHKA 3FTVA 3TDUC 5EX3A 2KZVA 4CDNA 1VQPI 3SF4A 2L5QA 3KP6A 2L0TB 5AN8A 1EH7A 2RDPA 4B8XA 5K7FA 2EIKE 4MTDA 1B9NA 1FIPA 4KXKB 2UZKA 1Z21A 1P5QA 4CRWA 2QSFX 3I9V2 4M3DA 3Q0VA 2VQLA 4IHWA 1LB2A 4I17A 4DUIA 1CF7A 2YU9J 3DXJF 5G04C 2FF4A 1BPOA 4BJ5C 4BEHB 2KJCA 4A93J 3PIOF 4YIIA 1UELB 3HDXA 5ENNA 5FINA 2GOMA 2ZSHB 5LFAA 1UG2A 2ID3A 1TQIA 4KYWA 5EYPF 4ESJA 2G9WA 2XSJC 2R7QA 2ZFUA 2LOOA 2EJRA 1YOVB 4G6TB 3BEEA 4NNJA 5JJTA 3JAMZ 2LC2A 4M6YA 2UWJG 2X6YA 2IVMA 1T2KA 3M1EA 2HYJA 2A68F 2FQ4A 4KDPA 2VQ2A 2XENA 4J8YA 3E7LA 2VOPA 4HG2A 4G8LA 1YFHA 2R5ZA 4UWKA 5EKQD 5FKLA 3RO2A 2CHXA 2VPRA 1IG7A 2E35A 3MKQB 4GTQA 4W1UA 5E3MA 3VSLA 5BOXA 2P7CB 3KLOA 3GFLA 3JUEA 3KAEA 3S1NJ 1QVTA 5HLHA 1MZBA 3JRGA 1SZAA 5L3DA 1XS9A 4OOIA 3D9KA 1ORKA 1R1TA 1YJNI 3G2TA 1IV8A 5FQ6A 2P2CP 5AARA 4UB6C 1H88C 5K5RA 4ESFA 2L3DA 2F4MB 2PMHA 2V4LA 5CVJA 2G7UA 2B9SA 3DPTA 3FU0A 4AVXA 2A6HF 3PUJA 5K5QA 2Z16A 3BR5A 3CHOA 2A4ZA 5EGOB 4A3TA 2XPZA 3CD6I 2L2OA 3CHSA 4O3MA 4E7KA 3B73A 2CQNA 4GYGA 4DOZA 1W5CC 5IOZA 5KJKA 2P9SG 4LNGA 2YQ8A 3BG7A 3ZR8X 4K5BA 4AJWA 4A2UA 3ABLH 4F7AA 2XKOA 4KNYA 2I1JA 1YI2I 5G05C 3SD5A 1ZR2A 4DRXE 2WVIA 5HS8A 5KJMA 4N0BA 1AU7A 2HPMA 2WBMA 2LF8A 3MEKA 1B59A 1YIJI 4NQWB 2STWA 5A2QZ 3T1BA 2XQ0A 4MNUA 3HRAA 3ZEFA 5IY5H 2AXZA 2H6HA 2DFEA 2YSRA 3UPVA 2A5YB 4YRVA 1H6KA 2CWEA 5E1WA 5IT9Z 4AM9A 1ETOA 1JKRC 1SQMA 4BE0A 2XGSA 3ZRGA 5D0QD 4XN3A 5IPAA 4A63B 3L17A 1YQAA 2F8XK 3LSJA 3CC7I 3DKWA 5F0CA 4JOMA 2HQ5A 4D7NA 3CJTB 2WAEA 3FWEA 1JHHA 4BX8A 2D1HA 3JRFA 2X6XA 4G26A 4GTOA 1WI3A 2VQCA 5E18F 1HFAA 4FJYA 2ZBKA 1O57A 4DBQA 1OXJA 2DA3A 4BSZB 2GOXB 1MNMC 4RGSA 4A3MJ 3UR3C 3GTLJ 3LSHA 2QY7A 3RKYA 1W36D 3PUKA 5FD6A 4CDMA 5KJLA 2P8TA 3Q78A 2IA0A 3CUQB 4XNFA 2E2HJ 1J9IA 4XLHA 2DIWA 4X6AJ 1XG1A 4HNVA 1XPXA 2V9VA 1IUFA 2DXIA 4HOUA 4UV9A 2GRMA 2CV0A 1U9NA 2DQRA 1J5YA 3TP3A 1RR7A 4HW0A 1JJ6C 3QP5A 2WMNA 3DEWA 4HB5A 2X6FA 3CCYA 1XC5A 2FQ3A 2QQ8A 4I6JA 1MKMA 3VPRA 4IRGA 3S1MJ 1FBSA 2JPBA 1WG0A 4FISA 4Y33A 3F8NA 2HNHA 5T3RA 2ZXIA 3LWFA 2BEOA 2DMPA 5EGOA 5F04A 3NF1A 2KQRA 4BEHA 1FVFA 5K5OA 4HBDA 1MW7A 2QF7A 3FUIA 4BY7J 1BI1A 1TQMA 1PDNC 2J5OA 2F37A 4QPQA 3V8KA 4DPRA 5KNLA 4A3GJ 3QNKA 5FQ7A 1BOBA 2H27A 2VLAA 5FZRA 2VJIA 1IZ1A 2HVSA 2GW1A 1XMXA 1AA7A 5J47A 2KP6A 1S72I 4XLNF 4GMLA 1F36A 2ME6A 4DYCA 4NACA 3BG1B 5ENQD 3ZP5A 2NOJB 4P96A 4K03A 3K7AJ 4HOBA 3D3MA 4PCQA 3JXJA 3PZ2A 3BCBA 3LMMA 2MLGA 4I0AA 5IYCJ 2LY1A 4JX5A 1FP1D 5F0FA 5EEAA 1KZHA 1HDPA 4PUCA 3CF5F 1R9TJ 3KIOA 3U9GA 5M3MJ 2Y4TA 2EPFA 5B1AH 2M34A 3QPLA 3C3WA 1H2TC 2OEVA 4A5NA 1E90A 2MH2A 2X85A 2Z2SB 1FOYA 4A0ZA 5M5WJ 2RD0A 3ENEA 3HSRA 2BE5F 1WFXA 1UCRA 2H09A 3HOYJ 3UXGA 3TG5A 3DTEA 4KMUX 4QSHA 3DEEA 3TWXA 2CYYA 3VOEA 1RI7A 2PMUA 3C18A 1G3WA 2CO5A 3WODF 5LHIA 3ASNH 2WWYA 5BPIA 3E4BA 4YDWA 1GLNA 3M4OJ 4IHXA 2EA2A 4N9IA 3RRNB 3AU5A 1WRJA 5HNFA 1O4XA 4B3AA 4GAAA 1Y1VJ 2FD5A 1ZGWA 3ABUA 1WJAA 3ZQGA 3HBLA 3P5JA 2JT1A 1HZ4A 2EIJE 2PZIA 3OXFA 3NAWA 3SXYA 3DTIA 3HTSB 1FZPB 4GXOA 4RB2C 3ML8A 2K86A 3M7GA 3GMEA 3F23A 3KP3A 2M7AA 3T5VA 5GPAA 2BYVE 4APOA 1WJFA 1YJWI 1P6RA 2E7XA 3J5PA 3CV0A 3B7UX 3UT7A 3T9KA 2LUHA 1R1UA 2O03A 5AQ7A 4RVBA 3HUGB 3GYZA 3ULEG 3ZU7B 3IUOA 5B3SE 3ZKJA 1DUXC 3HVEA 2J9QA 3SZ7A 1V55E 4V2GA 3FULA 3L08A 2QUFA 2KZGA 4PJLA 2VUMJ 1OWLA 1SD4A 3HPHA 3J7ZI 3S17J 1IRXA 1SVLA 2GBYA 2XGOA 4N3BA 4BNCA 3DEPA 4HLLA 3JYSA 3KEZA 4F92B 3GEZA 2XEVA 2HQAA 2LYCA 2QQBA 3AL0C 4XBFA 3FU3A 3O6BB 3R61A 5E1XA 3Q5MA 1HSJA 3A1YA 1RKTA 4A3BJ 2FX0A 1TJFA 1B1BA 3P2BA 4A1GA 2ECCA 3DKXA 3I71A 2D1VA 4LSZE 3IV0A 2EV0A 1D1AA 4G25A 3H3UA 4ANJA 3JRAA 1KQ0A 1AKHB 3V7RA 4C48B 3HHHA 2CHWA 2KM4A 2EIMH 5E8IA 3WU1B 3NB2A 5CHEE 1JCSA 3A2KA 2PM7A 3UM3A 1P9QC 3UIOC 4MHGA 1JJ8C 4O6FA 3GZ5A 2OVFA 2CFUA 1H8AC 5FO5A 4O5VA 1QBJA 2DJIA 5ICGA 3PIPF 3QQAA 1VQ8I 3AL0B 1PC2A 2L9VA 4XLEA 2C2LA 3V2OA 1SEUA 3CVWA 5CRUA 3K4BA 3M1CA 5DS9A 3BJAA 1YLFA 1ZRCA 5CQGA 2I6HA 4UUSA 1Z9CA 3DWLE 3Q0WA 4LG6A 3FDHA 2V1XA 2DTRA 4LJZF 1YTYA 3GZSA 2IAIA 3S7DA 2X51A 2Z5UA 4XOTA 4JHRA 4XX5A 2VYIA 1MMNA 2R2LA 2M30A 1VQNI 3BY6A 4GTRA 4HRIA 3C3QA 1BR2A 2FOKA 1VI0A 2XCCA 3FXRA 3ZOBA 2GIZA 2Y69E 4NQWA 2VI6A 3PS6A 4HF2A 4J7WA 4EZLA 1IC8A 2P81A 3CCSI 5K7HA 4GZ6A 2CFXA 4JEUA 3FU5A 1ETVA 3HJEA 3EJNA 4RLYA 2ZGGA 3PE4A 2GM4A 4I9EA 1RNLA 3I4RB 2NS7A 1FEXA 1K83J 4EQQA 3T8MA 3DP7A 4LLLA 4U95D 2Q1ZB 4MEXF 5BS6A 5H6RA 3HOVJ 3LKUA 4AM3A 3L9FA 2WXQA 4L2LA 1FOWA 2EFOA 2W82A 1RKWA 4BQQA 1FPPA 2KCKA 2XPYA 3CP8A 3APDA 1ODDA 1FX7A 2H6IA 2ID6A 1MZCA 2FNAA 3SFIA 3FUJA 3PO3J 5D5XB 5FIOA 3QYFA 4PS7A 2VXZA 3T5XA 2ZXJA 2OCCE 3FM3A 1UJ8A 2DOAA 3BR6A 4XSZF 2OVBA 2PL2A 3IHYA 4I9CA 1WJ5A 4N5CA 4TRQA 2XGMA 2F48A 4EATA 2HOTA 2XF7A 4L0YB 3V4GA 3V79K 2VT3A 2PI0A 1AWCA 4U7DA 2CG2A 4YVOA 1SD6A 4XRMA 1HO8A 2LREA 4HLEA 4R1HA 4BERA 2BW3B 5FJYA 3LXUX 3EPZA 5AYWD 1MBEA 1QO0D 1R4MB 4YIFA 1ZRFA 2ZIRA 2OQGA 4RGUA 2VGXA 4CEMA 3GFJA 1E2XA 2OBPA 5FRMA 1HXIA 2AO9A 1ENHA 4ANWA 1SVMA 1XB4A 2FMYA 3CP2A 4J01A 3BTCA 3L2CA 2MHKA 2DJNA 5M5YJ 5EYRA 3H9QA 2A6EF 1U8RA 1OWMA 2W84A 3D5RC 4A3IJ 3BG0B 3FUDA 2R7FA 5AIJA 3OMYA 4FHTA 3LYAA 4KVOA 1RETA 3SZTA 2V5QC 1YW9A 4ENMA 5A2QK 2EILE 2J4BA 1D1BA 2W25A 4XLFA 4RAFA 4U07A 5CBNA 1L3LA 1XMAA 4M3EA 2IS2A 3IAS2 2WXNA 1P4AA 2JA8J 1XSDA 4OAZA 2HEOA 1AKHA 2X6WA 4DX7D 3LL7A 3TP0A 2YNQA 1SD5A 2YPRA 3OL3A 5CVIA 4BYYA 1U78A 3CK8A 5TISC 2A5WA 3U2RA 4B0ZA 3ZN3A 3GLXA 4YG2F 4C30A 3D9NA 4GCOA 1S63A 2R7RA 3QJZA 4A3FJ 3J7AO 3DRAA 2HZDA 5FFZA 3QU6A 2EFWA 3ZPJA 4O60A 3G1OA 2BUGA 3RPUA 2ZU6B 1T98A 2M87A 1ZREA 3L2RA 1VTNC 3ZHEB 2XGCA 5KCMA 2ETBA 2VOOA 3SEZA 4CZCA 3ZYLA 3CCMI 3ZUVB 1HQCA 4JW1A 3RIBA 1TEZA 5EYLA 1U3CA 3DWLG 1MQSA 5DUKA 5LEKA 3F6VA 4E7ZA 3PUBA 4N2SA 5EIDA 1N77A 2ZGDA 3CLQA 2JA2A 2L7FP 1OCZE 1YW8A 2DYRE 4W97A 3ABLE 2NSZA 1U2WA 4TV3A 2L9SA 4Y17A 1E0EA 3EIJA 4RAGA 2DU9A 2WXHA 4AP2A 1BJZA 2WXMA 3LA2A 1LKXA 1EF4A 1NI1A 4JZYA 4NHJA 4M3BA 4L18B 2HQNA 1MBJA 3NEUA 5DD8A 2PLYA 3AG2E 3ZHEA 1IO2A 3OTNA 1N25A 4UVBA 4IO9F 1WJCA 3LCAA 4UI9J 1Y8RB 4FTHA 4CGZA 1PUFA 1KZPA 1E96B 5EEGA 2EILH 2F5FA 1G3TA 2Y9ZA 2CQ7A 2QZAA 2X0LA 4K2EA 5BUZA 1KQ9A 4QPOA 2BY0A 3RPQA 2JZYA 2V1DA 2VXDA 2NNYA 2BKKB 3MGBA 3FH5A 3NOCD 4V2FA 1MSFC 2GRQB 5LRSA 3HYMB 3AG1E 3K2ZA 4N3AA 2QCOA 4MFDA 1A35A 3H3VK 4Q5SF 3OY9A 1TNBA 3LJNA 4G7OF 3F8FA 1YG2A 4DX2A 3WXXA 2DCEA 1E8WA 4LMYA 2DW4A 1N75A 4G9YA 3ERMA 1Y8QB 5J1UA 2P6SA 1JXSA 5JVGF 3KEAA 2BXZA 4GB9A 1T39A 1TWFJ 4RS8A 5FZQA 3S32A 2KKOA 4TUMA 2L54A 2IJLA 3HRSA 2ZKZA 4ZDPA 2IW5A 3G1LA 4Q69A 5J08A 1D0ZA 1OISA 2Q7FA 3EUHC 2KRFA 3ZN1A 2HYGD 4XRSG 1X58A 4UWHA 5D6EA 4I2ZA 3TO9A 3HTUA 1UJJA 3FU6A 3EETA 3O3KA 2PNNA 4A55A 4PFPA 2R05A 1IRZA 2RKHA 2V9PA 3AS8A 2CV1A 3S93A 4WNFA 2X6JA 3MD2A 1I27A 1MJBA 1SAXA 3K10A 1O3TA 2Y3AA 5EJCA 4D0PA 4LLNA 4WX9A 2WQ6A 4D5FA 3JXIA 1Z7LA 2XRLA 2ZB9A 1POGA 1J59A 4ME2A 4TXRA 3KFWX 4KYOB 3PZ4A 4YDEA 5D0OD 3HG9A 3CCEI 2O9LA 4JVSA 1G4DA 1J09A 4S04A 3FHZA 3EYIA 5JVTA 2TDXA 3Q47B 3H92A 3CVNA 4BAYA 3PREA 1L0OC 2J8SD 4WXDA 2P9UG 2FE3A 2Y0SA 4AIDA 2OA4A 2O3FA 1I5ZA 3CCVI 1LEBA 4IEJA 2VC0A 1K4SA 2BHZA 3D9MA 3WG9A 4PH4B 3FIWA 4IOAF 4ACLA 1TNSA 1B6AA 4B94A 3MCXA 3HB9A 3AG1H 3NQOA 1XDUA 3WTSC 2NXNB 1U3DA 2WM9A 3IH2A 1MJ0A 4G6QA 4KT6B 1ZK8A 3WTUC 1KT0A 3DBLB 2XF6A 1KZOA 4IHTA 2CV2A 3CQZJ 4OIOF 3UUXA 4JBAA 2JMWA 3LS8A 1YRNB 3ONLA 5ICFA 3GCMA 4CCLA 2STTA 4HI9A 3RPUD 3U66A 5F08A 5DDGA 4V19K 4GPKA 1R7JA 4JYKA 4YFKF 5E3OA 2QGUA 1TW3A 1JI8A 5HDGA 3TW7A 2P7VB 3RKQA 4YEJA 3DEUA 4U63A 2HPIA 4JA7A 5KWDA 4RLQA 4LEUA 4DX6D 5DCMB 3ZIMA 1WGXA 3W2WA 3KP2A 1XCVA 3HG0D 3S1RJ 2L4MA 1VNDA 3CIAA 3SDGA 3GZNB 1RC9A 1SW6A 2KZTB 4BTAA 5DEQA 4JC8A 2EV5A 4U0YA 1OFCX 4ACKA 2PMZN 4JD2G 4BWRA 1IYGA 4HVBA 1LEAA 2EFNA 2CW7A 3ISPA 2D45A 2RFAA 1GV5A 2R7ZJ 4HRLA 2H94A 3ZCOA 1ULYA 2CG4A 2KPMA 2H8RA 3IL2A 4GFBA 5ARGA 1LVKA 4FA6A 1OCRH 1BJAA 4ZH4F 1Y56A 2VC1A 3ZMSA 3DSXA 4FHKA 4PSXA 1Z1DA 5FLXK 3GLLA 2VBWA 4L9JA 3MFKA 3FY4A 2DBAA 3ZQIA 3MEXA 3G3ZA 2KC7A 2KXPC 1TNYA 1OKRA 2HQRA 4MTEA 5AIPA 2B0OE 3LY8A 3G2UA 4BEPA 1N9AA 2CW8A 3G4SI 2L0IA 1BR4A 5AONA 2N8GA 3V42A 3CF2A 2NVYJ 4OIPF 2KDZA 4J8FA 3HXFA 4CHUA 4K0RA 1KU3A 3OXGA 3TEDA 1ZH5A 2DBBA 1GVJA 4LG0B 4HQMA 3WU0A 2CQKA 2JRMA 3ML6A 3NAUA 1D8JA 3UI2A 1MMAA 3OIOA 1VQ7I 1WJDA 3QOPA 1QPMA 2CFOA 4EQFA 2E5NA 1MX2A 2LNBA 4KIFA 2V5FA 1IXSB 4IQ4A 1WAO1 1OWPA 2FSWA 2ZXHA 3GW2A 3I54A 4EECA 5FZSA 4I43A 1PP7U 2X6IA 1U5TB 1XTAA 1FYLA 4E70A 2W1OA 5BMZA 2KIQA 4I2OA 2HDCA 3BZCA 3B13A 2JJ7A 5EF6A 4IL6C 2MG4A 4U88A 3I3LA 4OVVA 3UM0A 2VJ4A 3OR1C 3E32A 2JUCA 4A6EA 2KLOA 3CHPA 1KGSA 3NBNB 3IXEA 3OYNA 3GUDA 2HYZA 3CSFA 4CGVA 5AJDA 5LCWJ 2LVSA 1X19A 3W2AA 4CICA 3LOCA 4UHTA 4LB6B 4TXPA 3UMVA 2C6YA 5FLXZ 2ISZA 1TR4A 1GHCA 4Y15A 1BD8A 4BDZA 3J5QB 1SZ9A 4XZ4A 4RGRA 2ZNZA 3DBRB 3OV8A 3LDZA 3PNTB 4Y6CA 2Z99A 3L16A 4IF4A 1P7JA 1XDSA 4RG6A 3GZ2A 3S3OA 2DZOA 4ASNA 3CO7C 2KCVA 1F4KA 5E3NA 2LBFA 2IGMA 2JSPA 1X1CA 5LLQA 1Y0NA 4APFA 4MKTA 1PYVA 3I0TA 2AXLA 2LAHA 4U0VA 4BBRJ 1U3EM 2A61A 5K7ZA 3U4TA 4EHMA 2R93J 1QQIA 3REOA 3GFMA 2Y48A 5CVUA 3PM1A 1O3SA 3K4KA 4XL9A 2Z1DA 2CHZA 5B5EC 1SFEA 2R4GA 2E1OA 2NS8A 3L2UA 1Q1HA 2ZJRF 4GZDA 3BTJA 2QYUA 1ZYRF 4XEIG 2RG8A 3MVPA 1PJRA 3HXBA 1UB9A 4XKBA 4HOQA 1H6PA 4GYOA 3QU3A 4N4OB 5KK1A 3H9JA 5J4VA 1R5GA 4FLHA 1YE9A 5KVRA 2IT0A 3LSTA 1IUYA 1W1WE 1B72A 3SFYA 3K69A 4XORA 5DM6F 3F6OA 4KIGA 4Q96A 2P5VA 3D1NI 3O4ZA 2H6BA 4UUSB 4NC8A 1KU9A 1K61A 3FTYA 3B95A 3MKWB 4ON0A 4L5JA 4AVZA 1MNEA 1OCOE 3LFKA 2GRNB 3V30A 5IYBJ 4AIKA 3NRVA 2MYOA 3S7FA 4E7IA 5J4YA 4B1RA 1ETWA 4F3VA 1G3SA 2ZMEC 2EZKA 3QB2A 2VONA 3CR3A 3ZQ7A 3IV5A 1SFUA 4A3EJ 4TUUA 3ASGA 4GMRA 3KS2A 4MLPA 1HG2A 1G3YA 2O7OA 1EJ9A 1HE8A 2F5VA 3WTYC 3TJPA 2RV8A 1MDMB 3R60A 2EIME 4M3GA 1MHQA 4IULA 4B47A 1SMYF 2M2EA 2XRYA 2KRCA 3FTXA 1WVRA 2PEXA 2V7FA 3TXMA 1I3AA 2EFQA 5G05J 3I4GA 3P7NA 4I6EA 2QYOA 1VF9A 4F91B 1EF1C 3BQOA 3BU8A 3KETA 2E2EA 2JLBA 2V1UA 3CUQA 3F8MA 3ZPLA 3C3RA 4CZ2D 3QPTA 3S2AA 4WWNA 3GTQJ 1B89A 3KPHA 5TJJA 1LJ9A 1NG7A 5LX8A 2OAZA 1J7KA 5IP9J 2HZTA 2DAOA 2X9DA 4GRIA 3R6SA 2XROA 3A0BC 3CCJI 3RZOJ 1QNTA 3HKZN 4NC7A 2HTJA 3GW4A 3V7CA 3SFXA 2IU1A 3BG5A 3FUNA 5BPPA 1X3UA 2DODA 2FBHA 2YUSA 3WU2C 5B3SH 4HDUA 1UHSA 1APLC 1C0WA 4K5CA 5FTPA 3TWQA 2EA4A 1XMKA 4A12A 4IRIA 4EJUA 1OCOH 3BDDA 4XQFA 2AVPA 2FI7A 1HXDA 1YS6A 1FMWA 3OYDA 2EFPA 4GYWA 5ARFA 3K70C 1IN6A 2P58C 3OIPA 4Z68A 1OCCE 2F0YA 2KFDA 4U0SA 3L09A 3PNTA 1RZ4A 4OAYA 1KLXA 4HX4A 3Q9UC 1ETYA 3FF5A 3JTHA 2HXOA 3MMYB 4BQNA 5KNGA 4WF2A 5BV0A 3CJNA 3H5AA 1NL4A 3CO6C 4XRSA 1X4PA 2K9MA 2IGKA 3OWTA 3QWLA 1JKOC 1I3QJ 3EHQA 4GYIA 2CUEA 5HODA 3BZKA 1F1ZA 3H0DA 4NQ0A 3C98A 3FDYA 3DSVA 3NZUA 1H19A 3QWVA 2XUBA 4ENKA 3RIRA 2XVCA 5E3LA 2PQ8A 3PSIA 5H20A 1UAAA 4FULA 3ZVVA 4N2QA 3GO5A 3HOWJ 3DU6A 4XN0A 2HOSA 3I56I 2MC3A 5AJLA 5E75A 4U8YD 4DZJA 2QWWA 1RRJA 1BIBA 1TT5B 3HGYA 3DXMG 4L9TA 3K6GA 4CCJA 5CLSA 2ESHA 3MV2B 4C9YA 1IRFA 4EZKA 2MRIA 3RKWA 2K40A 3ASHA 4IRUA 4L1BA 4DQ2A 2R7XA 4BACA 1QQEA 2HVQA 3OOPA 2MSYA 3LY7A 5AIQA 2V26A 5B1BE 2K85A 4OWRB 2EB7A 5HVQC 3MKZA 2LDUA 2JWTA 3HRMA 3QYBA 3CC2I 4MS6A 1V3FA 1ZG3A 3WG7E 4UB8C 3FM5A 1HC8A 4B93B 5JHAA 4G6DA 4I6GA 4M9SA 4I1OB 1T33A 3DSTA 4C3IJ 1TP4A 1A31A 2DFHA 2QVOA 3CDLA 4IZZA 1NZNA 1NA3A 1IN4A 2VBZA 2YS9A 1FYKA 2GWRA 3M8EA 1U5TC 3DPUA 2BW3A 2I10A 3T8TA 5ILUA 3G2SA 4Y4RA 4XI9A 3P9CA 4L5IA 1IW7F 3LSPA 4AD9A 1RESA 2DT6A 2QENA 2LRDA 3PJRA 3RO3A 5CECB 5ANLA 1PP8F 1FMVA 2FUG2 3U21A 1QPIA 2IS1A 1WWXA 1K78B 2COMA 2NXPA 4U87A 4OINF 3L1PA 3Q49B 1LF8A 2XPWA 5HS9A 2J4DA 3ABKE 4EBAG 5EG0A 4J00A 2P9NG 4OYSA 1GXQA 4C3JJ 2IO2C 3KCCA 4I76A 4DK5A 4BDYA 3VYRB 3UM2A 4RM3A 4P5OA 4ZJZA 3B7RL 3DQVC 2HDDA 4U04A 2W4SA 4AYBN 3EQLF 3J80Z 5FQ4A 1GW6A 3UQ3A 1OYIA 2X6KA 2OOEA 4JQFA 1TN7A 4H7XA 4BXUA 5D4SA 1T8IA 2LNIA 4GZ5A 4J0UA 1OCRE 4RBOA 2OV7A 3GWZA 3EU5A 3U3WA 5DCMA 2VKHA 2Y75A 3E34A 4EM1A 4E7LA 5HLTA 3ASDA 5HKPA 2ISYA 2M45A 3B6CA 1MMDA 1YHQI 1JKPC 4A1SA 4BT9A 5ED4A 3HOXJ 5D6FA 5F1JA 4U8VD 2E36A 2M1BA 4BY6A 2ELKA 4XKVA 3UINC 4JX4A 1WZ2A 1PUEE 2IOSA 2XEHA 3N71A 3FXJA 3NWSA 4LRZA 4C2TA 4DX5D 4JP0A 3IAM2 1IQRA 3RI4A 1V5EA 2P9LG 2WAFA 4RB1A 3IEGA 3LSMA 2KHMA 4NC6A 3Q7FA 2MH9A 3D5SC 2M4GA 4BX9A 3B6AA 2L7ZA 2E5ZA 4V3IA 5FB2A 1AHDP 2L9RA 5K1YA 4UWFA 3OOUA 4FQGA 4AC0A 3DXKG 1I50J 2W7NA 2XASA 3ISMC 2F5DA 4LERA 2Q0OA 3HIZA 4AIJA 3J80K 2IJGX 2PQNA 4CH7A 2YX4A 1HG5A 4D7MA 4HFGA 2VT2A 2P9KG 3V8JA 2QEXI 2OCEA 1ZR4A 1TWHJ 1Y8MA 2M8EA 3FKJA 4LB5A 4QWQA 3I59B 2RVCA 2ME0A 3TDZC 2HKOA 2GRLA 1I6XA 4JEHA 3IWZA 1D0YA 2VSNA 3K2AA 5M3FJ 2RN7A 2R7DA 1VQ6I 3S2DJ 2LAIA 2IONA 1BI3A 1H89C 5CKTA 2MC4A 2RC4A 4E7SA 2XAJA 1OJLA 2EQRA 3ASOE 2XKPA 2GQQA 2NYXA 2MD0A 3HXLA 4Y3OA 3APCA 1Z3YA 5L3BA 4BE1A 3PSFA 5E76A 2M9HA 2LLKA 2Y0MA 3TWVA 2BY2A 1QRYA 4CCKA 4FP7A 5KAFC 1IGNA 4UVAA 4RLFA 4HV5A 4UUCA 4U0WA 1WH7A 4ENNA 3AKZA 1ON1A 1U5TA 3BOQA 3SZPA 4KN7X 5C3EJ 3A03A 4RB0A 3FZVA 3PNYA 3ESLA 3RTRA 4E4HA 1TBXA 3ASNE 4RSYA 2YR2A 1KYWA 2IXSA 1UW4B 3PZDA 4AY6A 1Z6TA 3ZXPA 1I39A 1S0PA 1KU2A 3WTVC 2RFMA 3SBSA 1TWCJ 4D9JA 3VDXA 2RNJA 5KNHD 3JSPA 3J81Z 2Q8KA 2L4AA 5HOOA 2CGPA 3ASFA 3W3CA 5LGNA 1OT8A 2FO7A 2XS8A 3DPYA 4IQJA 1RPWA 1WI9A 4GZCA 2MABA 4BBSJ 1W7PA 1HW5A 5DD4A 3ABME 1W5SA 2BTDA 2R7UA 4DLQA 1N0RA 4KITB 4LIVA 1ACIA 5FD5A 2XRNA 3IH3A 1Q1VA 2PQRA 2B6CA 2WADA 2X1CA 5BV1A 1XD7A 2HXIA 3DBHB 1QA6A 2J08A 2X3MA 5C44J 1I1SA 4J6IA 3TG4A 3WE2A 1N78A 4JX6A 2QFCA 5KJNA 4IHVA 3GZ6A 1IQUA 5LBQA 2K4JA 2QLZA 3CJQB 4XE0A 2WY7Q 2HR2A 4AIHA 2O6GE 3AG3E 1D3YA 3G73A 2HWVA 4A3VA 2RKKA 4F55A 2HDWA 4P55A 1RUOA 4HX8A 2MLKA 4JPSA 4CUGA 4M6XA 2IP2A 3D9IA 1D8KA 4HX7A 1ZN2A 3PZ3A 3LSIA 1WHUA 4K5AB 5HI7A 1X1DA 2EWNA 2IA1A 4ZYGA 1LD7A 4I1AA 3D9OA 2A5EA 4FADA 1XGSA 3R0JA 1FJLA 2OC6A 1G6NA 4PSWA 3COAC 2HE0A 2UUZA 2XB5A 3JRDA 1MSEC 3FXLA 3K1PA 3HXEA 2IO3C 4LG3A 4FU3A 4MBGA 1Z7UA 1LE8B 2Q2EA 2ETHA 1TNZA 3FK6A 3P1UA 2FRHA 3LSRA 1V5FA 2GROB 2RNGA 3FWVA 1E3HA 2WB2A 2K4BA 3CDIA 5CYVA 1JGSA 1HKSA 4KISA 3DPDA 4BU2A 4WNGA 5EN5D 4I0BA 2QKMB 2L0KA 1LVAA 1OLTA 1NP7A 2M5WA 2WQ7A 2UXXA 2JSCA 5KAIC 1SD7A 5HDNA 1IV6A 3LVQE 1R00A 4UQZA 4PGHA 1HLVA 1OR7A 2IGOA 4AU7A 1Y1WJ 4A3DJ 1PUFB 1IDZA 1DDNA 4I1MA 4ILHB 2DQLA 4KZ0A 4F1PA 3GF2A 3F0CA 5ERIA 5M72A 4WNDA 1R5HA 4HF0A 3GTKJ 2DN0A 2L02A 4WXCA 5FKKA 2MA3A 1MJAA 3HRTA 1U6GA 2DA2A 4C2UA 2Y1LE 5E79C 3CVLA 5ENTD 2OF7A 4KVMA 3WGIA 2R7TA 1E17A 5FJ8J 5D5VB 4ZYEA 5JLXA 1TN8A 2XZTG 1JT0A 5JJ7A 3QP6A 4NB5A 1R6RA 2UWMA 2HI3A 5GPCA 2AXVA 4A3JJ 3C2BA 5LHHA 2MGQA 4RAYA 2WXLA 4U96D 4ZTJA 4BESA 5J1RA 1K7AA 3CUOA 1SMTA 2IEJA 3HIFA 2P9PG 3HL2A 1LQ1A 2Z9OA 1ZAOA 1R71A 2XPIA 3GXOA 1V4RA 2HU9A 1NFIE 4QLCU 1IN8A 3S14J 3C2GA 1DGRM 1O1RA 5A7DB 4FHJA 2M4KA 3I4NJ 4GPMA 4UI9K 3OR2C 1R1VA 2J5PA 4E7HA 1N4QA 2ZC2A 4IPAA 2H6GA 3Q0UA 2XDVA 4XLAA 1ZLJA 3E6MA 3CESA 4ANXA 3SEQA 4CXFA 2V0PA 3DF8A 1SVXA 2LKPA 1UHWA 2HYFA 1STZA 4OMZA 5CVVA 1MMGA 2R5SA 3CLJA 3ZGQA 5F27A 2AJAA 3CK9A 4GU5A 5HQ8A 4XLPF 2UXNA 1JCQA 2R03A 3NQPA 2AW6A 4URKA 2ZXWE 1SVOA 2M3AA 3OYMA 2AS5F 4HPQA 1VQ9I 1VQOI 2XHEA 3DLLF 3DSSA 3V31A 3TAXA 3F8BA 5FKMA 2WXRA 4H7YA 2D5VA 2CJJA 1XX5A 1B8IB 2NVTJ 4XSXF 3HVEB 1LDJA 3BPVA 1DNPA 1RW2A 3OYCA 4RA2A 3DTKA 4F53A 1EYHA 3S7JA 3Q9VA 3ZGKA 1WPKA 4HQDA 2K7LA 1K4TA 1FY7A 4ATZD 1O7FA 2R7OA 3BQYA 4M7CA 4DYRA 4DI3A 5J3LA 2VIXA 1ZG1A 2LMDA 3FTWA 2LR8A 3FMQA 3MKRA 4CYDA 5FQ8A 3SNXA 3CEQA 1HF0A 2CRGA 1YA0A 4E6HA 3WE3A 1W0UA 2G0EA 4HSTA 3JRBA 3CVPA 2LG4A 5D8KB 3WGGA 1Z05A 4PFOA 4UUTA 5KBAA 1XN7A 3N05A 5JFRA 1IJWC 2WB1N 1BI8B 1QZZA 5H7PA 5JHBA 1TYQG 3TL4X 2R5YB 4N5QA 1AWCB 2LBFB 1FYMA 4N9HA 3CKCA 4HRMB 2QBYA 3RK6A 2WAQA 3M9AA 3ZQLA 3JQ1A 1JT6A 4IN3B 1YCSB 1WQ2A 4GZ3A 2DA4A 4XRFA 3B02A 3GTPJ 1R23A 2X4HA 3LQQA 1TT0A 5BPDA 1AP7A 2W48A 5CRVA 4DX1A 1VQMI 3U1DA 3R7QA 2Y69H 1BBYA 3WTXC 3KP4A 1QHGA 4FC8A 1VDYA 2GZWA 1ZGJA 3TWTA 1EH6A 2XZDG 3P9IA 3QARA 5GAEJ 5HLIA 1GUUA 3MKLA 1FC3A 3H5NA 3TMOA 2Y0BG 4L9PA 2KCLA 4L2YA 4B43A 1ELWA 4XKWA 2MD5A 2KZTA 3UKRG 2PJRB 5J90A 3PQKA 3F21A 2AHQA 1UOHA 3L13A 3VTXA 1DP3A 3MZ8A 1RIOH 4UQXA 1YJ9I 4ETSA 1F43A 3BR2A 3HOTA 3CJRB 3DU5A 4M9ZA 4EMSA 2P9IG 4CDGA 3L2WA 3EUHA 4LOCA 2JRTA 4D5CA 3CCUI 3ML9A 1UN8A 1HW2A 2QZ8A 1KONA 1UFMA 3E5UA 5JLWA 5GTIC 1JUQA 3FKIJ 3JCUC 3HPGA 5CPRB 2QA4I 3KP5A 1SFOJ 2X38A 2MYSA 3UKGA 1MH3A 2DA6A 3FXKA 3KEQA 2GXBA 1K8KG 3UX4A 3I5UA 4GCVA 3X2QH 2FO1E 1Y0UA 2VGYA 3JQ0A 4BXFA 1FWZA 2LY2A 4GA2A 1IXCA 3C3OA 3CKBA 3ONQA 5B1BH 3RKXA 3SJMA 2LH9A 1Z5SC 4PS3A 4OAVB 4IYPA 5D66A 2OQRA 5EEHA 3MKQA 1Q2ZA 2BGCA 4C3HJ 2VB6A 1S6LA 1D5VA 1X5BA 1S7OA 2DOEA 1IF1A 1XSVA 3OYLA 1DC2A 4MGRA 2VSXE 4WCGA 4HI8A 4FASD 2QC9A 4U8HA 3FISA 5JMND 1BOAA 4PUSA 5C4XJ 2V8SE 3K70D 2QBYB 2X6HA 2J09A 2B63J 2RAEA 1H9GA 4BQAA 4JB8P 4L9VA 4F93B 4J8EA 4WUYA 3T8RA 1YYVA 3UT8A 1X1BA 3FX3A 2ETAA 4CT0A 3U64A 2V79A 2ZISA 1NTCA 3TO7A 4PJ0C 5DV5A 4XI0A 3S2WA 1LFUP 3E33A 2EH3A 1FOXA 2DPDA 1X2NA 4HXIA 4ABZA 2DCPA 3LSGA 1O7LA 1ETXA 5DTDA 3LNQA 1JUMA 4ZDLA 1TL8A 1IXVA 4EV0A 3QWPA 3D0SA 3DEOA 1K6YA 3VSKA 2ZFWA 4U0UA 1BI2A 4RG9A 1E3PA 2XB0X 2Z3YA 2QQ9A 3FK7A 3UT4A 2BF0X 1HF8A 3E1SA 4G11A 3SBTB 3BR0A 1G59A 3Q7AA 2DT5A 2KIMA 3OSFA 4DBRA 3FEYA 4KIBA 1P4XA 2DVWA 3K1MA 3W9FA 2JPCA 1ZRDA 3CHRA 3ASOH 4BL0B 2TCTA 2DMQA 4OIRF 2NYJA 3TQNA 5LEJA 2K5CA 3QODA 1U0JA 1ONVA 1X1PA 4UUVA 1I6HJ 1FCHA 4FT8A 3CCQI 1N4PA 3KZIC 1UJKA 4FETA 3HHMA 3RZDJ 1ZARA 3GVAA 1MX4A 4ZYHA 5KHDA 2DWZA 1VQKI 5T4YA 3SGHA 4H4KC 4P29A 1WCMJ 1D9SA 2VE8A 4HRNA 3CVXA 2XF5A 3FBIB 2Y9YA 2VN2A 3B7TA 2ACJA 2FBNA 3EHNA 1OWNA 4F3QA 3HOUJ 4M6VA 3VODA 4O6JA 2KRHA 3PRZA 2R7VA 1TJCA 3FFLA 2JVHA 4J8SA 4HV6A 1MJ9A 3ELKA 2ELJA 3TBIA 1EDUA 2WXOA 3DV8A 1ELKA 1B9MA 1LE8A 2XPVA 5F0HA 3JSOA 1VFCA 4TXQA 3OYBA 4PZJA 1HW1A 3MAJA 3E6BA 3E37A 2VKDA 4LD5A 2V4HC 1ZQ3P 2KATA 3ZNGA 3K4NA 1OUVA 2OD5A 4WK8F 4BHPA 2I1KA 4QIWN 4I01A 5D5UB 1N94A 1BU9A 3CGHA 3WHCA 3NOGD 3BLYA 2LKXA 3QKYA 1G3NB 3CTAA 2OU2A 1O3RA 4GA0A 4QFVA 2JUGA 1WDYA 2IFUA 1FTTA 1MDMA 1MNDA 1OQYA 1ON2A 1TLHB 2PFBA 3PH0C 5CMYA 3WTZA 4FJZA 5AAOA 3H9GA 2GA2A 3Q73A 2G7HA 1MD0A 4BTBA 2LSVA 1NK2P 3A01B 1TQPA 3I58A 1E3OC 1GDTA 1JTXA 4XONA 4HYEA 3W6KB 3G6EI 3SFZA 4IHSA 3LPZA 1EH8A 3GZ1A 1IDYA 1S7AA 2HS5A 1SAUA 2TRTA 2WAQN 5FFXA 1WY6A 4W9RA 1T95A 5ENSD 5D5WB 2K02A 3JR9A 1MMSA 2V1NA 3M8FA 2O5RA 3RJVA 2XEEA 3DCFA 4HA8A 2IY0C 5F1RA 4C0EA 2IGNA 2W00A 3ESWB 4P1WA 3CVUA 2E0IA 1BM9A 2BBYA 1N11A 3CC4I 2DOFA 4KBQA 1U8BA 1FT1A 3H3ZA 3M07A 4FE4A 1Z3XA 3N4MA 2ZJ2A 1HKQA 3AFHA 3IKVA 3HKZA 4LIUA 5C2YA 2VPLA 3SDBA 3PE3A 2H8WA 4GGGA 2WA0A 3C5RA 3FHNA 3I4PA 3QWWA 2VSOE 4U7EB 5HNHA 4B09A 1XGOA 3VFZA 2GRPB 4EZJA 1TN6A 1K79A 1IAWA 3G2WA 5CQEA 3BTIA 2NVQJ 3UM1A 5CBOA 5J8CA 2DZNA 3VWBA 2E60A 3VYUB 1MBGA 4AXHA 2EIKH 4AV7A 2JEKA 2HR3A 3E5XA 1FSEA 1GV2A 2EK5A 3OS2A 3ZYQA 1GVDA 1T0FC 2ELHA 2RGVA 4EM0B 3JREA 5DCFA 5F6FA 2A07F 5FRNA 4G2VA 1T56A 5IOYA 1IN5A 4N39A 5L3EA 2VTBB 3SZGA 2DA1A 5EDNA 3S15J 3GBGA 4XR6A 4HNUA 2VJ5A 5B66C 3JTGA 4KA4A 4XIFA 1TWGJ 2XHKA 2XAHA 2W24A 5HLGA 4P9UA 2KT0A 4M71A 3FTSA 2DMTA 1J0RA 2I8DA 2M8GX 3BG3A 3BPXA 5IP6A 3OYEA 2ILRA 3TWWA 3TWRA 3CVVA 3SHFA 3GTJJ 3E6DA 2X6OA 5ILVA 3QK0A 2ZO4A 2OEWA 2IEKA 3QC1A 1BL0A 1K1AA 1UN9A 1E8XA 4MLOA 2AXUA 4G7ZF 2UY1A 2P0WA 1AOYA 4PS8A 3VEPA 2ZNYA 3G71I 3ULQA 3KYCB 2ONDA 4RB3C 1OCCH 1FOKA 5J8FA 2CW0F 4D10C 3WTWC 5CMWA 1QHHD 1MX6A 1ETKA 1WJBA 4Q94A 3EU9A 4GTVA 2ICWG 1BIAA 2W85A 1VQLI 4S0HB 4XKCA 1EA3A 3L00A 2CU7A 1S5LC 2BXYA 3ABTA 3KP7A 3RRMB 4X8QA 4ANUA 1H6OA 3GYHX 3HDDA 3IRRA 3EIQC 1SA5A 2E71A 4MFEA 1QYMA 3BT9A 4B3XA 1ZG5A 1T08B 2KIFA 4JXTA 1OWOA 3KE2A 1ZU2A 1EPUA 2L7MP 1OYYA 2HOAA 1N4RA 2DYRH 4HORA 3FUEA 3OYJA 4HLXA 3D9JA 2DMNA 4MQ9F 1K78A 1S8NA 3I53A 4II3A 1OMIA 4CCMA 2DFIA 3GTOJ 1IHBA 5AQ9A 1S29A 3TW6A 3ZMZA 3W9GA 2WXJA 3RU0A 5EDSA 3R4KA 2XRZA 1RUNA 3OSGA 1X4OA 2IA2A 3ABMH 3BCAA 3PFYA 3PNLB 2MFZA 4Q47A 4BSXA 3IP4B 5F64A 3VYTB 4ZYDA 2NOGA 1YIOA 3X2QE 1HKTA 2CQQA 2YINA 4LNBA 1F9NA 4X1EA 5ILSA 6PAXA 1H0AA 2J07A 5LGUA 3R7RA 4MO7A 3PO2J 2E1NA 1O1TA 5CERB 3WTTC 1YYHA 4CDRA 3TOBA 2R3SA 3GTGJ 2RQQA 2LY9A 4IVNA 2BY1A 2RQPA 3AS4A 5EX0A 1LUJB 3O8GA 1BN5A 1MBKA 5G2NA 3CMEI 1VQ4I 3CLOA 4YIRX 4C0MA 2BOLA 2UV1A 3EUAA 1W4MA 4BQOA 2WQHA 2Z33A 2M7BA 3F8CA 3QOUA 5BT1A 5E1ZB 2PN6A 5L3GA 4UNOA 1Z0XA 1N95A 5G55A 4DLOA 1IN7A 5HS0A 4CCNA 4Y13A 1DQUA 3OYGA 3MX3A 2CUZA 4KUMA 3S7BA 1L5JA 1Z6RA 2GRRB 3IRQA 4RGXA 3MN2A 2ZCWA 3HSEA 4LK0F 2VASA 4KT6A 4F52A 4G23A 4CCAA 2FMLA 2NC9A 2KL4A 5ICEA 2C0LA 3DSUA 5CCMA 3TL5A 2R7WA 1G8XA 5JHUA 4EVIA 1H0MA 2PBIA 2YX7A 1W7PD 1CF7B 3SYTA 4ZZLA 4Y7NJ 3VLDA 1OYWA 3RQIA 2P4WA 2VTBA 4EJWA 1NH3A 3W2VA 1P2FA 2I5UA 2ZSIB 3F9KA 4UV8A 1REPC 4Y6WA 4PJMA 3HC7A 4IXAA 3GTMJ 3VTYA 5CJ9A 5IY5E 3O2PE 1HDDC 4ZTFA 3EYYA 5E20A 2XCBA 3IKOB 2PG4A 4Y52J 3FHEA 2E34A 2FA5A 4KMFA 4LUNU 5ENPD 1YO5C 3OYIA 4LFUA 3BJ6A 3HXDA 5D2MC 2CFZA 2OCCH 4NUBA 3F22A 1V54H 2BVLA 3QYEA 4A3KJ 1R49A 3R0AA 2YU3A 2NVUB 2QSHX 2HO1A 3CVQA 4BJTA 2OTLI 1XGWA 1FIAA 2BY3A 2LTPA 1A17A 2VL8A 2E1MB 4A3CJ 4YVQC 1A6IA 1N52A 2IOLA 3QAQA 1FTZA 1M1EB 5EG0B 1BC8C 1BI0A 1HSTA 1NA0A 3H36A 4IRHA 4HNTA 2L01A 2DTZA 3SO8A 2EINH 3LA7A 4G8XA 4GTTA 4GTPA 3OS1A 2X48A 3JCKC 1FT9A 3CHQA 2DA5A 5E8GA 2XAQA 3KEYA 3KLNA 4IKFA 4HZFA 5H2FC 3EDPA 3ZQCA 5DIZA 1QNFA 2BV6A 3CMAI 2QYJA 4BS9A 1R36A 1R22A 4Q4ZF 2PM6A 5LRRA 3ABKH 2VJJA 3I5PA 1W36C 3EUKL 2R59A 2CMPA 4WWCA 2XAUA 1X3WB 1YX5A 1FBUA 3PFIA 1X81A 4QQIA 3FXQA 2PJRA 5D4RA 2GIVA 1A5EA 4MQVA 3L54A 4GA1A 3FH8A 3FTUA 3ZMUA 3ECOA 4ZC3A 4GDFA 5DYMA 1N4SA 2V6EA 1XNFA 4IJAA 3BQZA 3NZSA 1BA5A 3AS5A 3ONKA 3ZFWA 2WXIA 3JUIA 1YITI 1BLXB 5L3FA 4OIQF 2VQHA 5FGMA 4ITVA 2HOEA 3S3MA 4YFXF 3KYDB 1X3ZB 4KICA 2H1KA 1ERDA 2I2OA 3D9PA 3D9HA 5HRYA 3IHVA 1UHMA 2DT7B 4YDYA 1DPRA 2JTVA 2X1EA 3FUMA 1HCRA 3WHBA 2ZMEA 1B4AA 2A05A 2CS3A 1ZB1A 3MZYA 2R0QC 2NNNA 3HM5A 4BKXA 1OPCA 4NDLA 1USTA 3OYFA 2L6BA 2DPUA 4B4CA 1TZLA 4JK1X 3J7AY 4AVPA 3M3YJ 4UY8I 1P7IA 2YHEA 2F4IA 3PZ1A 1KA8A 3DKYA 3K9TA 4I09A 3KYLA 1YX3A 4B8CB 1V55H 3G2BA 3IH4A 4WAFA 3CZ6A 4AOFA 1X1AA 4XICA 3HZJA 2LXMA 4E6KG 3JRHA 1IKND 3PDNA 4GMJA 4I98B 1TWAJ 3Q5FA 3ZN0A 3SY2A 4L0ZB 3CUQC 4ZDOA 1FP2A 1N0QA 4WXHA 2XGEA 2DK8A 4ZZDA 4EJOA 3GX4X 5J40A 4E7JA 1YMPA 3F72A 5C4JJ 1MYOA 5CVRA 3FUHA 3PVLA 2R5ZB 4X0GA 4PJNA 3ULYA 4LLGF 3H0GJ 4HDVA 5A6CA 1H2UA 4UQYA 3K4JA 2K9QA 1W0TA 2VGXB 3CCRI 2IRFG 1WH5A 3BP8A 4NIKA 2FULA 1MGTA 1LPQA 5IT9K 4MIMA 5FROA 3C72A 2BKGA 3Q9NC 5G04J 3L2QA 2VE9A 4OAUC 3RKVA 3ZQHA 3RDIA 2LD5A 5CCLA 3IWFA 2DK5A 3I4MJ 3L22A 1N54A 4RDUA 2JQ7A 3K9IA 3EUVA 2O0YA 4PDKA 3S3NA 5JHFA 2M0MA 3PNVA 3PL8A 3FUKA 3FXOA 3L6AA 2K3PA 2XIGA 4LGWA 4EGYA 3IBEA 1J75A 2M0CA 4OU0A 2GLOA 2NAZA 2Y0SN 2QM3A 3CSTA 3BUAA 1JTYA 2CSOA 2FEZA 1JWGA 3FH7A 2EINE 3VYSB 2UY1B 5JA4D 3L9TA 3AAFA 4ILIA 2E2JJ 4IHYA 1O5MA 1JE8A 3CQGB 1QBQA 3RRUA 4MEYF 4BHBA 3TOAA 4GTSA 4DI4A 3KX2A 3K4MA 1KPSB 4B8AA 5BW8C 5BXOA 2HKXA 4S05A 2ECBA 1ZHFA 1YRNA 3ZRHA 3T8KA 3UIPC 1WKMA 2D2WA 1SA4A 2IS4A 4UWGA 2DDAA 2X1DA 3OL4A 4L5EA 5GAHJ 2ZJPF 4FCYA 1FVHA 2OUMA 2WXPA 3U9WA 5IT3A 1OCTC 3CK7A 5IP7J 4G94A 1DP7P 3APFA 4CT4A 3QOEA 1USSA 2IQCA 4AEZC 1HBXG 3PUFA 1J2XA 1YW7A 1LDDA 2YHCA 3KZYA 3UTMA 2R02A 1HU3A 5FKOA 1BC7C 5H6QA 1A36A 4M3OA 3MZHA 4HOTA 2WMOA 3IHUA 3RJPA 1GXPA 2Y2ZA 4HBLA 3TO6A 5LGTA 2VQGA 3HXCA 4HNAD 5E17F 4BT8A 1XGNA 3PQJA 2FNPA 3CCLI 3MJWA 2GA1A 2NS0A 4FLBA 1HS6A 2K9SA 3O48A 2ETCA 3BWGA 1K3ZD 3QRFF 2RREA 3D9LA 3HOZJ 2AQEA 3IC7A 2B7EA 4B48A 4WWOA 1X2MA 3OYHA 1DPUA 2LSUA 4DW6A 5DBKA 4XIDA 4JHJA 3C2HA 3OIQA 3AG4E 2DMUA 1Z91A 2KJBA 2JVGA 3E30A 4WWPA 1LDKB 5DUIA 2XAFA 1HA8A 3CMMA 2QKLB 3HYIA 3QAHA 3HEFA 4YELA 3VLEA 2B0LA 3ZMDA 4XLCA 2MBFA 4OVUA 4YNDA 3SI5A 2BHYA 3I64A 1K6OA 1S70B 3E6CC 4I99C 1DVPA 2EBIA 1TC3C 4AWXB 1ZBPA 3R9AB 2K27A 3M8JA 3T0YA 2CH0A 2OZUA 4GCNA 3PEUB 2WV1A 2GGFA 4AYBA 3ZXSA 4AUXA 5LOZA 2IPQX 2H1LA 2DI3A 2F8YA 1D1CA 2E1CA 3ERED 1O1SA 3VLFA 3CVYA 2EZIA 4CA0A 3TGOA 2FXAA 5DM7F 1T6SA 1FPQA 4L7TA 4QTRA 1F5TA 1LTXA 1JCRA 3G1MA 1IHGA 4CYMD 1FLIA 4PGGA 3BR3A 5TRDA 3I3NA 1Y39A 2VKVA 2R7SA 1PAQA 4A0XA 5AENA 3OYKA 3BZ6A 1D0XA 1E7UA 4ABNA 3OS0A 5JI6A 1WSUA 2OJED 4XMYA 4CZZA 3Q4AB 1WJEA 1QGPA 4IOCF 2XPUA 1UG3A 5AQAA 4LNUD 4CSWA 4CO8A 3I55I 4UVCA 1FSHA 4N3CA 2EZHA 3EHMA 1P92A 4L23A 2Y31A 4YDOA 2DLLA 1IXRC 3AG4H 5D8LB 2FJ1A 3GFIA 3UKUG 4Z6YA 1QVUA 4I02A 2WXKA 4I2WA 4Q48A 3A01A 4BETA 3W6VA 1UG0A 2F5EA 2HTSA 3FMRA 4U7BA 1IRGA 4DNCA 2XV4S 1XCBA 1DCQA 2A5UA 2OZ6A 4HQEA 1WM5A 4KMOA 1ETQA 1MBFA 5M5XJ 1SFXA 5LCWC 3F3XA 5BXUA 2BZTA 4YFNF 3RYRA 4BY1J 4BE2A 3ULQB 1QZ2A 3E97A 1P4WA 3BC8A 1NHAA 2FBKA 2LSOA 3A02A 4HLYA 4I6ZA 1HH8A 1TNUA 5ENRD 4TV7A 4PK4A 3SQNA 5FWQA 3JAMK 2KDOA 3DSWA 3Q75A 3V8LA 1A6QA 2JA6J 2E1MC 2E7WA 2LK2A 2WB1A 5CEAA 2AQFA 2EQXA 2KBXA 2NRAC 4BFRA 2LKSA 1B72B 3TXNA 4EPZA 2HFHA 4B89A 3RSNA 4KZCA 3A4CA 4LK1F 4A69C 4EEFG 1T38A 3QPHA 4KFCA 2KIUA 2VJ8A 3EHRA 3DBSA 4O1OA 4E85A 1SC7A 2EV6A 4RMNA 4B44A 3BG6A 2JABA 5BQTA 4CGWA 3P9KA 3AJIA 3D5LA 2CUJA 2VKEA 4IX7A 4LITA 3DPLC 4UI9C 1KT1A 3V2XA 5J6XA 1INZA 3RCOA 4NRHB 4N4NB 4WNEA 2LO6A 3A0HC 5TGTA 3O8HA 3MV3B 3K4CA 3J7YJ 2V9KA 4EJVA 3Q3SA 3DFGA 3BROA 5FLMJ 1BI7B 1JPLA 1D8DA 3K4LA 4EM2A 4R7LA 3MA5A 3BJOA 3ROUA 2HGCA 5L3CA 3S8PA 1ITYA 3MWMA 3ZW3A 2EZLA
chains in the Genus database with same CATH topology
1JHFA 2VBYA 2ZMEB 4GO1A 4A0YA 4Z2YA 1XSXA 4L9NA 2FU4A 2WTEA 2A69F 2H6CA 1XGMA 3HUGA 4RAZA 1S3JA 2WV0A 4BHCA 3RYPA 5LHGA 3FMSA 3C7JA 1W5TA 4G7HF 4I7HA 1KYZA 2DO7A 3LA3A 4P9FA 3TKYA 2VODA 3MQ0A 3CDHA 4M9XA 3JW4A 4M74A 2F2EA 3L7WA 1O3QA 4ENJA 3LAJA 3TGNA 2FBIA 4HF1A 3FXUA 1FBQA 3ZMVA 4A6DA 3KEOA 2LF7A 5JR3A 2VBXA 4M73A 4R79A 4M72A 3HRUA 1QZYA 2V6CA 3LQRA 3W6JB 2XAGA 3VB2A 1ZGAA 4F7ZA 4H0EA 2A3SA 2O61A 4HAMA 3Q9SA 4EJTA 5HDKA 1R58A 2P6TA 2GAUA 2QQAA 5HS7A 4FX4A 2ADUA 3KZZA 1EV7A 5ICCA 3C1DA 3ECHA 3MCZA 1KU7A 3N97A 2F5CA 1H9TA 3HOSA 4UXNA 4FX0A 1W7PB 3E3VA 1YS7A 4KN4X 2ESNA 3K1NA 3HSFA 4OMYA 3E5QA 4R8HA 3J81K 1KQ8A 2XGXA 1A04A 1TW2A 4KT5C 3LAPA 4EGZA 2O8XA 3IKTA 3V7SA 2P5KA 1TTYA 3I59A 4BH9A 2PJPA 3K0LA 1ZLKA 4A5MA 1TNTA 1T0FA 2W57A 2P5LC 3WGHA 3ZMTA 1FNNA 2GXGA 1LNWA 1I1GA 2WC2A 1CGPA 3HHGA 4ESBA 4LG0A 3TDUC 3KP6A 1EH7A 2RDPA 4B8XA 4MTDA 1B9NA 2UZKA 1LB2A 1CF7A 3DXJF 2FF4A 2KJCA 4YIIA 1TQIA 4KYWA 4ESJA 2G9WA 2EJRA 3JAMZ 4M6YA 2IVMA 1T2KA 3M1EA 2A68F 4KDPA 2VOPA 1YFHA 2P7CB 5BOXA 3KLOA 3GFLA 5HLHA 1MZBA 5L3DA 4OOIA 1R1TA 5K5RA 4ESFA 2L3DA 2PMHA 5CVJA 2G7UA 3DPTA 2A6HF 5K5QA 4O3MA 3B73A 4GYGA 4A2UA 2XKOA 4KNYA 5HS8A 4N0BA 2LF8A 1B59A 2STWA 5A2QZ 3T1BA 4MNUA 2YSRA 2A5YB 2CWEA 5E1WA 5IT9Z 1YQAA 3DKWA 3FWEA 1JHHA 2D1HA 5E18F 2ZBKA 1O57A 4RGSA 3RKYA 5FD6A 2P8TA 2IA0A 3CUQB 1J9IA 2V9VA 4UV9A 2DQRA 1J5YA 4HW0A 3QP5A 2FQ3A 1MKMA 4IRGA 1FBSA 2JPBA 3F8NA 3LWFA 2BEOA 5K5OA 1BI1A 1TQMA 1PDNC 2J5OA 3V8KA 2H27A 1IZ1A 4XLNF 3ZP5A 4P96A 4HOBA 4PCQA 2MLGA 4I0AA 1FP1D 3U9GA 3C3WA 4A5NA 2MH2A 4A0ZA 3HSRA 2BE5F 2H09A 1UCRA 4KMUX 2CYYA 3VOEA 1RI7A 5BPIA 2PMUA 1G3WA 2CO5A 3C18A 3WODF 5LHIA 2WWYA 2EA2A 4N9IA 1WRJA 3ABUA 2JT1A 3SXYA 3HTSB 1FZPB 4GXOA 4RB2C 2K86A 3M7GA 3F23A 3KP3A 2BYVE 1P6RA 2E7XA 1R1UA 2O03A 1DUXC 2QUFA 1SD4A 4BNCA 3GEZA 2QQBA 4XBFA 3O6BB 3R61A 5E1XA 1HSJA 1B1BA 3I71A 2D1VA 2EV0A 3H3UA 1KQ0A 3V7RA 3HHHA 5E8IA 3WU1B 4MHGA 3GZ5A 5FO5A 4O5VA 1QBJA 5ICGA 3BJAA 1YLFA 1ZRCA 1Z9CA 2V1XA 2DTRA 4LJZF 1YTYA 2Z5UA 2M30A 3BY6A 2FOKA 3FXRA 4NQWA 4HF2A 2CFXA 1RNLA 4EQQA 3DP7A 4LLLA 4MEXF 5BS6A 5H6RA 3L9FA 2EFOA 1ODDA 1FX7A 2FNAA 5D5XB 2VXZA 3T5XA 2ZXJA 3FM3A 4XSZF 4L0YB 3V4GA 2VT3A 2PI0A 1AWCA 4U7DA 1SD6A 4R1HA 1QO0D 4YIFA 1ZRFA 2OQGA 4RGUA 3GFJA 1E2XA 2OBPA 1XB4A 2FMYA 3L2CA 1U8RA 2A6EF 2W84A 2R7FA 4FHTA 3SZTA 1YW9A 4ENMA 5A2QK 2W25A 1L3LA 1XMAA 1P4AA 1XSDA 2HEOA 1SD5A 2YPRA 5CVIA 4BYYA 1U78A 3U2RA 3GLXA 4YG2F 3J7AO 5FFZA 3QU6A 2EFWA 3RPUA 1T98A 2M87A 1ZREA 1VTNC 2VOOA 1HQCA 5DUKA 5LEKA 3F6VA 1YW8A 1U2WA 4Y17A 2DU9A 3LA2A 4NHJA 4L18B 2HQNA 3NEUA 5DD8A 2PLYA 4UVBA 4CGZA 5EEGA 2F5FA 1G3TA 2X0LA 4K2EA 1KQ9A 3RPQA 2JZYA 2V1DA 2NNYA 5LRSA 3K2ZA 4Q5SF 4G7OF 3F8FA 1YG2A 4LMYA 2DW4A 4G9YA 2P6SA 1JXSA 1T39A 4RS8A 2KKOA 2L54A 2IJLA 3HRSA 2ZKZA 2IW5A 3ZN1A 2KRFA 2HYGD 5D6EA 3TO9A 3HTUA 3EETA 3O3KA 2RKHA 1I27A 1MJBA 1SAXA 1O3TA 4D0PA 4LLNA 4WX9A 1J59A 3KFWX 1G4DA 4S04A 3FHZA 3EYIA 5JVTA 2TDXA 3H92A 4BAYA 1L0OC 4WXDA 2FE3A 2OA4A 2O3FA 1I5ZA 1LEBA 2VC0A 3WG9A 1TNSA 1B6AA 3NQOA 1XDUA 3WTSC 4G6QA 3WTUC 4IHTA 4OIOF 4JBAA 5ICFA 2STTA 5DDGA 1R7JA 4YFKF 1TW3A 5HDGA 2P7VB 3DEUA 5DCMB 3KP2A 1XCVA 2L4MA 5DEQA 2EV5A 4U0YA 1LEAA 2EFNA 3ISPA 2D45A 2H94A 1ULYA 2CG4A 3IL2A 1BJAA 4ZH4F 2VC1A 3ZMSA 1Z1DA 5FLXK 2VBWA 4L9JA 3MFKA 3MEXA 3G3ZA 1OKRA 2HQRA 4MTEA 5AIPA 5AONA 4OIPF 4CHUA 1KU3A 1ZH5A 2DBBA 1GVJA 4LG0B 4HQMA 3WU0A 2CQKA 3ML6A