1RZ4A

Crystal structure of human eif3k
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
213
Chain Sequence
AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADEQIFICSQEESIKPKNIVEKIDFDSVSSIMAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human eIF3k, the first structure of eIF3 subunits
pubmed doi rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
molecule keywords Eukaryotic translation initiation factor 3 subunit 11
total genus 69
structure length 213
sequence length 215
ec nomenclature
pdb deposition date 2003-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10075 CSN8_PSD8_EIF3K CSN8/PSMD8/EIF3K family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rz4A02
1.25.40.250 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat ARM repeat; domain 1 1rz4A01
2MBFA 3EYYA 4U0VA 4LB5A 3KZYA 1W7PD 4OIRF 4IPAA 4R1HA 1R5HA 4NHJA 3SZTA 1KQ8A 1ZARA 1S6LA 3KP3A 1TQPA 1WRJA 1V3FA 5CLSA 4M9XA 1ZN2A 4BH9A 2GAUA 3HRTA 3GZ5A 2BEOA 1AOYA 3ERED 2V79A 4LLGF 1O7LA 2DBBA 1ONVA 4M72A 1KQ0A 1U5TA 1XSXA 2QQBA 3L2CA 2O61A 2G7UA 2FBHA 3HOSA 5HDNA 5HS9A 1YW9A 1EV7A 5K5QA 3I64A 4HX7A 1CF7A 2X4HA 2A6EF 4EV0A 1D8KA 2P5LC 2EFOA 4RGRA 1KU7A 2FU4A 4KICA 4ZYHA 1GHCA 2K4JA 3F6OA 2VODA 1I1GA 1FP2A 2XVCA 4ZYGA 5IT3A 1R58A 1QPMA 4EQQA 1ZGAA 5FGMA 1SAXA 3DXJF 4HAMA 2FNPA 1IAWA 5HDKA 4ENNA 2VN2A 2Z5UA 1BI2A 4KT5C 4HDVA 2EJRA 2EV6A 1ZHFA 5FD6A 1WWXA 4EJOA 3HRUA 3PQKA 3V4GA 1KYZA 4TV7A 4HYEA 3U2RA 2GXGA 2DK5A 1S8NA 1FNNA 1REPC 2ESHA 2JSCA 1P2FA 3BJ6A 2DFIA 3JSOA 4U7DA 2JPBA 2BE5F 4A0YA 1OYIA 4LLLA 6PAXA 5ICGA 1NHAA 2LDUA 2EFWA 3I54A 4BHCA 2ZKZA 2STTA 4NQWA 2HGCA 4I98B 2O3FA 4EM2A 5ERIA 5DV5A 4KNYA 3BJAA 3T8TA 1O3TA 3MCZA 2G9WA 3QP5A 3QPHA 3TDUC 3FM5A 4HV6A 3EETA 1SD5A 1ZG5A 4Q5SF 2OZ6A 4HLYA 1Z9CA 2LF7A 2PN6A 2FE3A 2Y0MA 1BBYA 1H9GA 3WU0A 2RC4A 5LHHA 2OQGA 1J2XA 3GFIA 1TW2A 4CO8A 1YIOA 2Q2EA 5JFRA 3SQNA 1FX7A 4YG2F 3WE2A 3JSPA 2HYFA 4XRFA 4L0YB 4KDPA 2L3DA 3REOA 1EH6A 2VT2A 2ELHA 3VOEA 4D0PA 3K69A 4WWCA 1J9IA 1IW7F 4O6JA 2ZO4A 2CYYA 3KZZA 2VONA 3DF8A 3RPUA 2KIMA 2V1UA 2FEZA 4QLCU 3VEPA 3JTHA 1SD6A 3U9GA 4MTDA 5HDGA 2A3SA 4BYYA 4CYDA 1MKMA 1S29A 4L9NA 5KK1A 5H20A 4LMYA 3M8FA 2CO5A 4RGXA 4IHTA 1S3JA 2GA2A 4MHGA 4Y13A 5HS8A 1SFXA 5BQTA 3GX4X 2Z99A 1TNTA 3TQNA 2DAOA 2RGVA 2O03A 1ZRCA 2Z33A 4ESFA 2G7HA 2M1BA 4HX4A 3ZMZA 2RQPA 2XKOA 5F1RA 2UWMA 2W25A 1IN4A 2A6HF 3LA2A 4LJZF 1XSDA 5E18F 2D1HA 3B73A 4IJAA 1BI3A 2OAZA 3CDHA 3MZHA 5ILVA 2HKXA 1P4AA 5L3DA 4ENMA 3WTSC 1BC8C 1WI9A 3DPTA 2DK8A 3V8JA 1XGOA 1D3YA 1QZYA 2XRNA 3G3ZA 2K02A 1KQ9A 1TW3A 1FZPB 1SMYF 3IRQA 1RUNA 4RB3C 4U0WA 1IXSB 1ZGJA 4EVIA 3E6CC 4UHTA 1R5GA 1UCRA 1GVJA 1O57A 4I2OA 4KUMA 3EQLF 5FD5A 1KA8A 2DT5A 2PQ8A 3V7CA 5CYVA 1YO5C 1R22A 1U2WA 1WQ2A 4UUVA 1R1TA 1H0MA 1MJ9A 1OR7A 1ZAOA 4KA4A 3LWFA 1JE8A 4BXUA 2XGXA 3EUHA 2EB7A 2PJPA 3F8MA 2W85A 5JVTA 3J81K 3ROUA 5D6FA 2FNAA 4HBLA 4RS8A 5A2QZ 3L7WA 2HQRA 1YW7A 2ZMEA 5BPIA 2VBWA 2LF8A 3D5LA 3CLOA 4P5OA 3BPVA 2HDCA 2IJLA 2ZMEB 4I0AA 3WG9A 1TQIA 3KCCA 2RNJA 2V1XA 3F8CA 5CVJA 2FA5A 1SD4A 4UNOA 1FBQA 1L3LA 2Y75A 2MD5A 4HW0A 3QPTA 3I5UA 3ZMTA 1RUOA 4LLNA 5DUIA 2R3SA 3LAPA 3P9KA 3I4PA 2V1DA 4CGZA 4K2EA 3BP8A 4YIFA 3BJOA 3GVAA 2VXZA 2QLZA 3EYIA 3JAMZ 1IUYA 2MLKA 1OPCA 5LLQA 5H6QA 2JZYA 3E6BA 2ZBKA 3H3UA 2A07F 2COMA 4MEYF 2UZKA 2MH2A 4OIPF 3WTXC 4PZJA 3RTRA 1BOAA 1U6GA 2L4MA 4EGYA 2IA2A 3T0YA 5E1XA 1OKRA 3GZ6A 2GWRA 2XKPA 5LGUA 1XN7A 2C6YA 2K4BA 5AIPA 4F7ZA 4G6QA 3COAC 4A2UA 1RIOH 1PDNC 1P92A 2CQKA 3BOQA 3HUGA 5TJJA 2M8EA 3RYRA 3QU6A 2BYVE 2ZXJA 2KJBA 4LD5A 2P6TA 3P9CA 4GGGA 3VFZA 1O3RA 3C18A 3HRMA 3G73A 2MC3A 3WGHA 3I0TA 1JHHA 4FX0A 2M5WA 3O2PE 1YFHA 2LKPA 2CFXA 2NNNA 1S7OA 4YFXF 1K7AA 2XAJA 5HVQC 4IRGA 3IKVA 4DQ2A 1TTYA 3WU1B 3C7JA 2HFHA 1FBSA 4I0BA 2Z3YA 5F64A 2FMYA 3HHHA 4G94A 1IXCA 2YX7A 4YFNF 4XLPF 1KU3A 5FFXA 3MWMA 2F5FA 3MQ0A 4RB0A 4YFKF 4ETSA 2B0LA 3K1PA 2F2EA 4IF4A 2CW0F 2P6SA 1YLFA 5ICEA 1TQMA 4ESBA 1YQAA 3ML6A 3GO5A 2V9VA 5DCMA 3LA7A 1Y0UA 3M8EA 3GUDA 2ZNZA 1BIBA 1K78A 1DUXC 4M9SA 3KLOA 5BPDA 1G3WA 2Q0OA 3R6SA 1E17A 5TRDA 2A61A 4DNCA 2QBYA 3FZVA 4AIKA 1Z1DA 1GXQA 1TBXA 1I1SA 3TOBA 1T38A 1U5TC 2CSOA 5J8FA 3WODF 4G9YA 1W7PB 2HKOA 1C0WA 3KFWX 4HDUA 3V8KA 3ULQB 3RIRA 4HQMA 4IHSA 1YYVA 1YS7A 5DUKA 3W6JB 1IN7A 1T39A 1FSEA 5CVRA 2EWNA 2HZTA 2KRFA 5AONA 2VE8A 2OU2A 3FHZA 4GYIA 2PMUA 4L9JA 4RGUA 3S2WA 4XBFA 1OYYA 1KGSA 1LNWA 1U5TB 1YG2A 1XDUA 3P7NA 2DQRA 4MQVA 3R0JA 4U0YA 3WTZA 2VOOA 2HOEA 1ZG1A 4BNCA 2XASA 2XAHA 2IT0A 3FMRA 4QWQA 4R79A 3MZYA 1XGSA 1USSA 5LRRA 1Z91A 3HOTA 2JPCA 1ULYA 4E70A 1F5TA 2PBIA 3ZP5A 3ISPA 4LG0A 2VE9A 1B9MA 3TO9A 4JK1X 1BN5A 3HRSA 3E3VA 3WGIA 2ADUA 2HEOA 2F5CA 5D6EA 3T1BA 3HSRA 2H09A 1QNTA 3HTUA 2GXBA 4XSZF 5DCMB 1F9NA 1FPQA 3M7GA 5E1ZB 1OMIA 5ILSA 5ICFA 2OBPA 5DDGA 1FOKA 4Z2YA 2P7CB 1TNSA 2XAQA 3M1EA 3FMSA 1MDMA 3SXYA 1LQ1A 4OIOF 4CHUA 2PG4A 2W24A 1W5TA 4HF0A 5L3FA 3RKWA 2CWEA 4KN4X 2WWYA 5LHIA 2ISZA 3T5XA 3LQQA 5DYMA 1HXDA 1LEBA 5E8IA 3DPLC 2ACJA 5LGTA 1HW2A 3K1MA 2BGCA 1YS6A 3FF5A 1LDJA 1MZBA 3J80Z 2MH9A 5EEGA 2DI3A 3GF2A 3CUQC 1G3SA 3IKTA 1T0FA 4ENJA 2L54A 4GYGA 4A5MA 5LRSA 2QUFA 2FF4A 3FXUA 3ZQ7A 3K1NA 3KP7A 3W6KB 1IRGA 1J5YA 1FYKA 4A12A 2XHKA 2PFBA 3WGGA 4R8HA 1HKSA 2P8TA 2CG4A 2RN7A 1RZ4A 2L02A 1IXRC 4CXFA 2PMHA 4Q47A 1K78B 2PLYA 4ENKA 1P4XA 3ECOA 4P9UA 5HOOA 1HW1A 3MAJA 2VOPA 1O3SA 3Q9SA 2Z9OA 4LG0B 5D4SA 3FX3A 5JR3A 1JHFA 2FMLA 2STWA 4BHBA 5FO5A 1QO0D 2BV6A 3ZMSA 3T8RA 2HQNA 1PP7U 1ODDA 5D8LB 1XMKA 4LK0F 1BI1A 3J81Z 2K86A 4OMZA 1R7JA 5EEHA 3P9IA 2QENA 1IRFA 5BMZA 4RB1A 2AXLA 1ON2A 5J8CA 1T6SA 2P5KA 3J7AO 4KMFA 1ZLJA 4PGHA 2WV0A 4CDGA 1RI7A 1H9TA 5FB2A 3DV8A 4EJTA 1CGPA 1UB9A 2QYOA 2EK5A 2ZJ2A 1HW5A 4PGGA 4L5IA 1BIAA 4N0BA 5IT9Z 2K7LA 4GCVA 3CO7C 1U3EM 3E6MA 3B02A 4KIBA 4WXCA 2NYXA 1IN6A 3F3XA 1G3TA 2VT3A 4M74A 5E8GA 4ASNA 2ZCWA 3PFIA 1MDMB 2DW4A 4N9IA 3U1DA 2O6GE 4HLXA 1J75A 2TDXA 3V7RA 2LSOA 4BHPA 4A0XA 1XGMA 1G6NA 3NRVA 3VODA 5HLGA 3K0LA 4IRHA 2M30A 1MGTA 1STZA 4L0ZB 3KETA 1W7PA 3QOPA 1ZYRF 4OOIA 3BZ6A 5K5RA 3I59A 4IVNA 1FWZA 5DCFA 2NNYA 4S05A 2IA1A 4P96A 4ZZLA 2NAZA 2VBZA 4A0ZA 3SFZA 5L3GA 4ZYDA 3LAJA 1FT9A 3V7SA 3ZPLA 3RKXA 5CVVA 4N9HA 3IHUA 3WE3A 4PDKA 4PCQA 3TKYA 1LVAA 4G7HF 5E17F 2HS5A 2EA4A 1D5VA 3DFGA 5ILUA 3F6VA 3PQJA 1YTYA 4EGZA 1I27A 4A6DA 1S7AA 5D5WB 2V6CA 2O8XA 3L09A 4OIQF 4KIGA 2QZ8A 2HTSA 2M87A 1W5SA 3LQRA 1IN5A 1XCBA 2NS0A 2VBXA 2H6CA 5FLXK 1I6XA 3QP6A 1FYMA 3AAFA 2YSRA 5F6FA 3EDPA 3C1DA 3J80K 2ESNA 2KKOA 4AVPA 5BS6A 3ABTA 5JHUA 4GO1A 3WTWC 2JT1A 3GXOA 2E1CA 3DQVC 3R61A 3ELKA 5J6XA 2YX4A 5CVUA 3FMQA 4G8XA 1FYLA 3TO6A 3CUQA 4WCGA 2HTJA 4I01A 5BOXA 2DTRA 3CUQB 2GA1A 4EM0B 3IRRA 2Q8KA 1I5ZA 2X0LA 1HSJA 2J5OA 3N4MA 2CGPA 4LB6B 3SZPA 2FRHA 2AS5F 4EMSA 3GWZA 1Z7UA 4LK1F 4FX4A 4P9FA 1JGSA 3IWFA 2OZUA 5LEJA 1LB2A 4HX8A 2XV4S 4HZFA 2KJCA 1XGNA 2XIGA 1BM9A 3GFJA 1ZRFA 1FP1D 1T2KA 2ISYA 5D5UB 1O7FA 4HA8A 5E1WA 2DPDA 4MNUA 1IN8A 2IVMA 4KMUX 2DO7A 4UVAA 2IA0A 1SFEA 4JQFA 5LGNA 2RVCA 5E20A 2W57A 2QBYB 4U88A 2DPUA 2FQ3A 5LEKA 4WK8F 4M9ZA 1EH8A 1LDDA 4A6EA 1U78A 4CICA 4OU0A 3F8FA 1MD0A 2QQAA 2XAFA 2F5DA 3C3WA 3DP7A 1XDSA 4UVCA 2WTEA 5D5VB 4KN7X 2W84A 4Q48A 2HR3A 5AIQA 2O0YA 1FY7A 4I7HA 4P55A 3ZN1A 4B8XA 3R60A 4I09A 2QQ9A 3ECHA 1F4KA 4O5VA 3GFLA 3LSTA 3CO6C 1SMTA 3JAMK 2GQQA 2D1VA 5K1YA 3QAHA 1Z6TA 3F22A 1OYWA 2HWVA 4M6YA 1USTA 2D2WA 2EA2A 4IRIA 2A5YB 4BQAA 1QQIA 4L9VA 1R1VA 4GXOA 2J5PA 3L00A 3E97A 4WF2A 5L3CA 1L0OC 1J7KA 2QVOA 1K6OA 2UXNA 2M45A 1HKTA 3KEQA 2ZFWA 3GEZA 1UHMA 2KIUA 1DPRA 4AIJA 4FT8A 3RDIA 4ZH4F 1VTNC 4WXDA 1B9NA 1HQCA 2R7FA 1O3QA 3ZMDA 3FXQA 2PI0A 1W4MA 3HHGA 3KP2A 4AIHA 3F8NA 4O3MA 1HSTA 4Y15A 4Q4ZF 4CZZA 4EJVA 1UFMA 2IP2A 1SFUA 2QWWA 2XAGA 5LBQA 1X3UA 2FOKA 4RB2C 1FSHA 1BI0A 1HBXG 1T98A 2XROA 1LJ9A 3O6BB 3QRFF 4UXNA 3FM3A 4UV8A 3M9AA 2H27A 1CF7B 4UV9A 3ZMUA 1ZRDA 4BAYA 1D8JA 1RNLA 1Z6RA 1XSVA 3GFMA 5HLHA 4MQ9F 2FBKA 2LNBA 5K5OA 3HYIA 2MLGA 2FSWA 2QM3A 4WXHA 3KEOA 3IL2A 2OA4A 3E5UA 4LFUA 4NB5A 2EV0A 3F23A 3DKWA 4M73A 1P4WA 1ZG3A 2VC1A 2IPQX 3KLNA 4IXAA 1PUEE 4RGSA 4KFCA 1IZ1A 4MEXF 1DP7P 3E5XA 1ZREA 3KP5A 1B6AA 3BDDA 4XLNF 1WKMA 1AWCA 3BROA 4OINF 5D4RA 1B4AA 3SHFA 3KE2A 3L9FA 3N97A 1BJAA 3BWGA 2F5EA 1KYWA 1F1ZA 3CTAA 1WSUA 3KP4A 2FXAA 3MFKA 2RDPA 4OMYA 4S04A 3I58A 3CJNA 4Y17A 1ZH5A 5HS7A 1MJBA 3HSFA 4MGRA 1LEAA 1PP8F 1XCVA 3ZMVA 4KYWA 4M71A 2P5VA 3QU3A 4FHTA 2DU9A 1J0RA 2FBIA 2GZWA 2BBYA 3K9TA 3TDZC 3F21A 5CVIA 1QBJA 3D0SA 2D45A 1ZLKA 1P6RA 3H3ZA 4I02A 2EFPA 1TLHB 3DEUA 3O3KA 2RV8A 1BC7C 2YU3A 4A5NA 5A2QK 3F72A 5JI6A 1KU2A 5ICCA 3GW2A 2MA3A 2VC0A 3Q5FA 3WTUC 5D8KB 2E7XA 4LGWA 4EJWA 4EM1A 3VB2A 1B1BA 4KIFA 4U7BA 4YIIA 3BY6A 3ABUA 5FLXZ 5L3EA 2H6BA 3I53A 2GIVA 4XSXF 4M6XA 2ETHA 2E7WA 4HV5A 1FLIA 3RKYA 3R4KA 4WX9A 1GXPA 3IC7A 2EV5A 2VBYA 3RYPA 3ZN0A 4HF1A 2OD5A 4UVBA 4AD9A 1EH7A 1FBUA 3LFKA 2KIFA 2EFNA 2A68F 1A04A 1V4RA 2P4WA 2A69F 3OOPA 2YPRA 2IRFG 4AWXB 4L18B 4B09A 2UXXA 3CUOA 2DQLA 1UHWA 3WTTC 3WTYC 1MJAA 2H94A 5KVRA 2K27A 2Y48A 5L3BA 3TO7A 5D5XB 5DD4A 1U8RA 1DPUA 4EJUA 3GLXA 2XUBA 1XMAA 1ON1A 2YR2A 1DDNA 2OQRA 3KP6A 5LHGA 3BPXA 2JRTA 4L5JA 2IW5A 3IWZA 1XD7A 3HTSB 4MTEA 5H6RA 5FFZA 1QGPA 1R00A 4ZZDA 3Q9VA 4RAYA 4ON0A 3TGNA 1YW8A 2P7VB 3FWEA 2EFQA 4HOBA 1Z05A 3JTGA 1Q1HA 1K79A 2E1NA 1R1UA 1G4DA 3FXRA 1R36A 3HSEA 5CJ9A 2L01A 1LDKB 1E2XA 3RPQA 3WTVC 2ZNYA 2RKHA 2DLLA 3I59B 3RJPA 3H92A 3K2ZA 3HIFA 4HQEA 4HF2A 4JBAA 2JTVA 3I71A 2R7DA 3LA3A 3E5QA 5DEQA 1FC3A 4ZYEA 1QZZA 5IT9K 1G3YA 1IF1A 3OV8A 4L9TA 4G7OF 1JXSA 2WC2A 3NEUA 5HLIA 4H0EA 2PEXA 1J59A 2HYGD 3E6DA 1B59A 4G7ZF 1R23A 1SD7A 5ED4A 3JW4A 3NQOA 2L4AA 1KU9A 3F8BA 3TOAA 4ESJA 3GYHX 1HKQA 3RI4A 3R0AA 2NRAC 4RAZA 4G6DA 3V8LA 3MEXA 5DD8A 1XB4A
chains in the Genus database with same CATH superfamily
2MBFA 3EYYA 4U0VA 4LB5A 4GZ6A 2VTBB 3KZYA 1HA8A 1W7PD 1ETYA 4OIRF 1UJKA 4IPAA 4CZCA 4R1HA 4CCMA 1IQRA 3JRGA 2H8WA 4HEA2 2AW6A 3QNKA 3HXFA 1R5HA 3LVQE 4Z68A 5H7PA 2KISA 4AU7A 4NHJA 3SZTA 1S72I 1KQ8A 1QVUA 1ZARA 4U8VD 2KLOA 1OUVA 3U64A 1S6LA 2W7NA 3KP3A 4N3CA 4GMJA 1TQPA 1T56A 2L0KA 1H6OA 2C0MA 4GYWA 2ZJPF 4QFVA 1WRJA 1A36A 1V3FA 2FX0A 2OCEA 2A5WA 1IO2A 3S2DJ 3HOWJ 5CLSA 4M9XA 2DN0A 2FO7A 2GM4A 3DTKA 4UWKA 1ZN2A 4BH9A 1S64A 3BG9A 1VQOI 3GZNB 4NC8A 1KZOA 5AYWD 3UINC 1OLTA 4EEFG 2GAUA 3ZR8X 2CFUA 3HRTA 3QPSA 3GZ5A 1LFPA 3QPLA 4E6KG 1VQMI 3FUIA 1NFIE 4FJZA 4D1QA 3UM1A 4YEJA 2BEOA 1AOYA 3DSSA 1JKOC 3ERED 2V79A 2GRRB 4XLEA 4CDNA 4J0UA 1Y39A 4LLGF 1V55H 1O7LA 3LEWA 2DBBA 2QF7A 3FU3A 1E3PA 1ONVA 3A02A 4BGDA 3SDGA 1DCEA 2RD0A 4M72A 1KQ0A 1U5TA 1XSXA 1LF8A 4ANUA 4DK5A 2QQBA 3L2CA 2O61A 2G7UA 2FBHA 3HOSA 2P81A 4FU3A 4ZFHA 5HDNA 2XCBA 5CQEA 5C4JJ 1FMVA 4I2WA 3OXLA 2E60A 5HS9A 1YW9A 1GW6A 1EV7A 5K5QA 3S15J 2EZLA 3FBNB 1TEZA 3I64A 3H5AA 1M1EB 4HX7A 3L2UA 1YITI 2VQLA 4XORA 1Z3YA 3OIQA 1CF7A 2X4HA 2R59A 2A6EF 4EV0A 4WNDA 5FROA 3VLDA 1D8KA 2P5LC 3Q73A 4DYQA 2EFOA 3S8PA 4RGRA 1FCHA 3FULA 1MYOA 4G12A 1KU7A 2FU4A 2V9PA 1JKQC 3BU8A 4KICA 5FINA 3KSLA 2LH9A 2V4HC 4ZYHA 2XAUA 4LNGA 2FQ4A 3EJNA 4PFPA 1GHCA 4AYBN 1UJJA 2XGMA 2K4JA 3F6OA 2VODA 1I1GA 5B1AH 2IGMA 1EDUA 1SQMA 2WXFA 4U7EB 5TGTA 1FP2A 2XVCA 3ZQQA 4ZYGA 1R58A 5IT3A 1ELWA 3LSIA 3DRAA 3ZUVB 1QPMA 3D9HA 2HOAA 4X6AJ 3ML9A 4AM3A 3OYEA 4EQQA 1ZGAA 2P9IG 5FGMA 4RSYA 1NI1A 4H7XA 4ZHBA 5J4VA 1SAXA 3DXJF 1ETQA 3LDZA 4UQYA 4C3IJ 4A1SA 2E0IA 3ZU7B 4HAMA 2HOSA 3G2UA 2FNPA 2TCTA 4DJAA 1IAWA 4N3BA 5CRUA 5HDKA 4ENNA 1W0UA 2E1OA 2VN2A 3B7RL 2ETCA 5JHAA 2Z5UA 1BI2A 4KT5C 4HDVA 2EJRA 2J07A 5CQGA 4E7IA 2EV6A 1ZHFA 2P9UG 1UZCA 5FD6A 2VGXA 1WWXA 4Z6YA 3HKZN 1BR2A 4EJOA 3HRUA 2W1OA 3PQKA 2NVUB 3V4GA 1YHQI 1KYZA 4TV7A 3S2AA 1X1AA 4HYEA 3U2RA 2GXGA 3VPRA 2DK5A 2J09A 1S8NA 3LMMA 1MMDA 1FNNA 3GTJJ 2ESHA 1REPC 2HO1A 2JSCA 1P2FA 2XEHA 3BT9A 2I9CA 2F5VA 2WV1A 2X6YA 4IQJA 3S17J 3BJ6A 3OL3A 5D66A 4DRXE 3W6VA 3CKBA 2DFIA 4BETA 3JSOA 4U7DA 1E3OC 2LKXA 3QODA 2XCCA 2JPBA 2E36A 4IQ4A 3FU0A 2BE5F 1WJEA 2X38A 4A0YA 4CA0A 3OR1C 1ZB1A 1OYIA 1UHSA 4LLLA 1YRNA 1FEXA 2EQRA 1IG7A 3JYSA 4CCJA 6PAXA 1H6KA 2JMWA 5ICGA 3RAUA 1NHAA 2LDUA 4V2GA 2EFWA 1VQPI 2LVSA 2MFZA 4G25A 3PE3A 3I54A 4BHCA 1YRNB 1T0FC 1E8YA 2W82A 2ZKZA 3GTGJ 3B7UX 3FUMA 1EKEA 2STTA 1Z5SC 4NQWA 4JHRA 3RU0A 2HGCA 4I98B 2GW1A 1FVHA 2O3FA 4EM2A 2LR8A 3EHQA 4XI0A 4MRUA 5ERIA 2OEVA 3HEFA 3JUEA 5DV5A 4HRMB 4GA1A 4KNYA 4XN0A 3BJAA 1Q2ZA 3Q0WA 4EPZA 3T8TA 2H6GA 2OV8A 2HQAA 2V0PA 1O3TA 3ZNGA 1ETWA 1D0ZA 3MCZA 2GOMA 1U9NA 2DXIA 1ITYA 2LBFB 2G9WA 2FULA 3QP5A 4JXTA 3FTXA 4CT4A 4NIKA 2CUZA 3FK7A 3QPHA 3FM5A 4HV6A 3TDUC 3LXUX 3CHRA 3EETA 1E7VA 1SD5A 1MIJA 1ZG5A 4Q5SF 3JR9A 3W3CA 2OZ6A 3ASGA 5AJDA 1UN8A 4A3JJ 2L9BA 4HLYA 1Z9CA 3I4MJ 2LF7A 2PN6A 3HG0D 4F53A 3LY7A 2VJIA 3ESWB 5F1JA 2FE3A 3B95A 2Y0MA 2V5FA 2EH3A 3PEVB 1GLNA 4GYYA 4FE4A 1BBYA 2DOFA 4FCYA 3CK7A 1H9GA 1ACIA 3WU0A 3S93A 2A4ZA 1SZAA 3L16A 2O7OA 2RC4A 2M63A 1K8KG 4HNVA 5LHHA 4DX1A 2OQGA 1J2XA 3HYMB 3GFIA 1TW2A 2VI6A 3SEQA 4CYCA 4CO8A 2R5ZB 4B8CB 1YIOA 5J1UA 2Q2EA 5JFRA 2QFCA 1LE8A 4LNBA 4A69C 3SQNA 1FX7A 5C44J 3S32A 2AVPA 3IEGA 4YG2F 3WE2A 3JSPA 2PJRA 3OIPA 2HYFA 2CW8A 4XRFA 4CDMA 3FTWA 4RAFA 4L0YB 4KDPA 3M07A 4GPMA 2HXIA 2L3DA 3DWLG 1X3WB 3BZCA 1EH6A 1V54H 2VT2A 2QCOA 3REOA 4AXHA 4B94A 1FT1A 3PH0C 4HRNA 2ELHA 3CLQA 3VOEA 2F8XK 2KHMA 4D0PA 2QC9A 4KMOA 4FA6A 5HRYA 4KITB 1HOMA 3K69A 4WWCA 4XKWA 4J00A 1J9IA 4RBOA 1I3AA 1IW7F 2MG4A 2ZO4A 2CYYA 4O6JA 3KZZA 3IAS2 5LD2C 1BLXB 1HX8A 2VONA 2EINH 1V5FA 3DF8A 1FT2A 3RPUA 4Q94A 3DXMG 2KIMA 5D2MC 3RKQA 2V1UA 2FEZA 4QLCU 4UUSA 3VEPA 2DMUA 2F4OB 2HU9A 1U3DA 3JTHA 3FUFA 1SD6A 4FISA 2EIKH 3AS5A 3SNXA 3U9GA 4MTDA 3EUVA 2E2IJ 4HOSA 5HDGA 2A3SA 4BYYA 4CYDA 3CCMI 3Q9UC 4DX2A 2VQHA 3AG2E 2CHXA 1MKMA 1H2VC 2L6JA 1S29A 1E3HA 2DT6A 4L9NA 2JA7J 1H89C 3PZ3A 5KK1A 4BE2A 2WAQA 4GTOA 3G1OA 3RQIA 3L2VA 5J47A 5H20A 4KZ0A 4LMYA 4L2YA 3TWXA 4C3JJ 5GADJ 5JA4D 2Y69E 3M8FA 2CO5A 1TNYA 4RGXA 2DOEA 2W4SA 3IHVA 4IHTA 2PNNA 4BERA 1S3JA 1JTXA 1ZGWA 4DI4A 1Z21A 3ZVVA 2LSUA 2GA2A 2YS9A 1D0YA 4MHGA 4LNUD 4Y13A 1WG0A 2UY1A 5HS8A 5FKLA 1SFXA 5BQTA 3GX4X 2QEXI 2Z99A 1TNTA 3TQNA 3S1MJ 2DAOA 1I6HJ 1BJZA 2O03A 2RGVA 1FTZA 1X1BA 5AN8A 1ZRCA 4F91B 1N4SA 3SBSA 2Z33A 4ESFA 2AQFA 4M3FA 4JC8A 2I2OA 2G7HA 5CCLA 2M1BA 4UY8I 2EIJE 4HX4A 1HG2A 3RKVA 2VIXA 3ZMZA 2RQPA 2XKOA 1X2MA 3Q75A 3W9FA 5BPPA 3ASOH 5IYBJ 3OYHA 3N71A 5F1RA 3FH5A 4FLHA 2GRMA 2JN6A 1FOWA 3EUKL 3CVVA 2UWMA 1QU3A 2Y0SA 5B66C 2D5VA 2W25A 1IN4A 2A6HF 3LA2A 4GYOA 4LJZF 2XEVA 4U87A 4AV7A 3GTOJ 2NVYJ 4XRMA 1XSDA 3BG1B 2DA6A 1MH4A 2XS8A 3FXJA 4GB9A 1EYHA 5LX8A 3HPGA 3L9TA 5E18F 2ETAA 2ECCA 1R49A 3TL5A 2DJNA 1A35A 3QQAA 3E4BA 3OXFA 4JX6A 1R4MB 5IP9J 5ITZF 3KEYA 5K7HA 1UJ8A 2R7VA 4R7LA 3PE4A 5ENPD 2D1HA 3B73A 1OCZE 4IJAA 2XRZA 3F0CA 3K4BA 5IPAA 3L13A 2MD0A 2LY9A 3UM3A 2DA1A 3C3RA 2H6IA 2KDZA 1Z7LA 2KZTA 4PS7A 1BI3A 4P29A 1WPKA 2VXDA 3CDHA 2OAZA 3KZIC 3MZHA 4F3QA 5ILVA 4F92B 3FUEA 4YDOA 2HKXA 1P4AA 5L3DA 4ENMA 4GTMA 2ETBA 2OUMA 4L5EA 3WTSC 3E37A 3OYBA 1IRZA 3QOEA 1BC8C 4IOAF 1KZPA 2H1KA 3CVUA 1ZR4A 2DVWA 3IH3A 3ENEA 1WI9A 3DPTA 2DK8A 3V8JA 2KDOA 5JLXA 1WJCA 1XGOA 4YDYA 3F9KA 4JYKA 4A3IJ 1QYMA 1R4NB 1D3YA 2CH0A 2WQ7A 1QZYA 4BUPA 3FWVA 3DPUA 4E7SA 4U0UA 2Y31A 1ERDA 2XRNA 3R7RA 2JUCA 2K02A 2KQRA 3G3ZA 5FLVA 1KQ9A 1TW3A 2OJED 1FZPB 1MSEC 2M2EA 3T8KA 1SMYF 3BR6A 3IRQA 1RUNA 5KAIC 3K4JA 1P5QA 4RB3C 3G2TA 1E8WA 4U0WA 1IXSB 1ZGJA 4J8YA 4B4CA 4EVIA 1HZ4A 4A1GA 4ANXA 3E6CC 4UHTA 3VWBA 4KZCA 1R5GA 1UCRA 1NK2P 2CV1A 2WMOA 3LVRE 1GVJA 1O57A 3AL0C 4I2OA 4KUMA 4IOCF 3EQLF 2LXMA 5J1RA 5FD5A 1PUFA 4K5BA 1KA8A 4D9JA 3GZ1A 4C0MA 1ZBPA 3OIOA 4BJTA 2VJ4A 3IBEA 2DT5A 2Y1LE 2IS2A 3K9IA 4JOMA 5KHDA 2ELJA 2DFEA 2PQ8A 3V7CA 4TXQA 1Z77A 2TRTA 5CYVA 3BG6A 1YO5C 1YOVB 1R22A 1U2WA 1SVXA 2HVRA 3H9QA 1GV2A 1WQ2A 2I1JA 3B7TA 5FZSA 3ULYA 4GTVA 4UUVA 1R1TA 3QB2A 1H0MA 2ZGDA 1MJ9A 2K3PA 3FISA 4L1BA 4RLYA 1POGA 1OR7A 1ZAOA 3CHMA 1D8EA 2Y4UA 3WG7E 4DW6A 1OY3D 4KA4A 1IHGA 5BNGA 4Y4RA 3LWFA 1JE8A 4BXUA 3ZHEB 2EIME 5F0FA 5FQ8A 3HM5A 3TW6A 2XGXA 1MMSA 3EUHA 1IKND 4UQXA 2Q7FA 3BQOA 1TNZA 2XRLA 4NACA 2EB7A 3PNVA 2R5SA 2KCLA 3UKRG 5DS9A 2PJPA 3OTNA 3V79K 5ARGA 4M6VA 3F8MA 5G04C 2W85A 5JVTA 3J81K 2DMNA 5IYDJ 3AS8A 3ROUA 3PDNA 1Q1VA 3CDIA 5G05C 5D6FA 2FNAA 1H88C 4IHYA 1D1AA 1RR7A 1VQ4I 5C4XJ 3LY8A 3S7DA 1SC7A 4HBLA 4OAYA 4RS8A 2Q1ZB 3S1RJ 1MZCA 2ME0A 5G05J 5A2QZ 3L7WA 3OYGA 3NB2A 2HQRA 1YW7A 2ZMEA 5BPIA 4ACLA 2VBWA 3B6CA 2LNIA 4Y6CA 3TP3A 2LF8A 3MCXA 2R7TA 5ENQD 4FHJA 1SW6A 3D5LA 3CLOA 4P5OA 3BPVA 4A3MJ 2XS1A 3CSFA 5A23A 2HDCA 2IJLA 2ZMEB 4I0AA 3WG9A 1OT8A 4I1MA 3BR5A 3QWLA 1TQIA 3KCCA 2ZISA 4N39A 3KEAA 2K5CA 2RNJA 2V1XA 3F8CA 1TR4A 5CVJA 4C48B 2FA5A 1SD4A 2IGNA 1FBQA 1VQ8I 1L3LA 4UNOA 1HO8A 1R6RA 1PJRA 2Y75A 3PUBA 2MD5A 2VUMJ 1FOXA 2XENA 2XPVA 4HW0A 1H8AC 1VZ0A 2DA4A 3QPTA 2WXMA 1MH3A 3AG3H 3I5UA 3ZMTA 1RUOA 4LLNA 2ZGGA 3K4CA 5DUIA 3JRAA 5A7DB 2XSDC 4HRIA 5LOZA 2XDVA 3S1NJ 5KNGA 2R3SA 3LAPA 1ETKA 2KCKA 1AKHA 3P9KA 3FUNA 3ZKJA 4F6RD 3I4PA 4N5CA 4BBSJ 3MGBA 3M8JA 3FXMA 2V1DA 4CGZA 4B43A 4K2EA 3BP8A 4YIFA 3DBHB 2GXAA 3BJOA 3GVAA 3QK0A 2VXZA 2QLZA 3K6GA 2WM9A 2WVIA 4F1SA 2X6XA 2JVHA 3V42A 3CHQA 1N25A 1TNOA 2R7OA 3MKQA 3EYIA 5ARFA 5FJYA 4LOCA 1GT0C 1JCRA 2KC7A 2FO1E 1AP7A 3BTLA 3A01A 3U21A 3JAMZ 1X4PA 2MLKA 1IUYA 3FH7A 5BNWA 1S7EA 4E4HA 3BCBA 3LSRA 3FFLA 3PREA 4BXXJ 2LRDA 4HRLA 1OPCA 4FE7A 5LLQA 1MX2A 5H6QA 3B7SA 2JZYA 2WXPA 3AU5A 4Y33A 3E6BA 2OF7A 1E8ZA 2KBXA 3BQZA 4CCKA 1B72B 2ZBKA 1JWFA 3H3UA 2R0QC 3CVNA 2A07F 2COMA 2OOEA 4MEYF 1PVEA 2UZKA 2Z16A 2MH2A 3SJMA 4OIPF 3C5RA 3EHRA 4HS2A 3WTXC 3NBNB 2BVMA 2O5RA 1O1TA 2BW3A 4PZJA 2CQQA 3PUFA 3RTRA 1BOAA 4MS6A 1U6GA 2L4MA 4EGYA 4CYCB 1WH5A 1KONA 2IA2A 3JCKC 2YHEA 2GRLA 2K40A 3T0YA 5E1XA 2OCCE 5LCWJ 1OKRA 1YX5A 3GZ6A 1SVMA 2M4GA 2HR2A 3P2BA 2GWRA 2XKPA 5CEAA 5LGUA 3TWUA 1ZELA 4CCLA 2MYSA 1XN7A 3ABLH 3CCRI 3DTEA 2C6YA 1DCQA 3TWTA 3CMEI 2K4BA 5EYRA 5AIPA 1OCTC 4F7ZA 2Y4TA 2KZGA 4G6QA 3COAC 1BR4A 4A2UA 1JCQA 2HE0A 1RIOH 3LYAA 1PDNC 5AARA 1P92A 2CQKA 4KBQA 2UWJG 2X1DA 2M9HA 3BOQA 1S63A 1T33A 3HUGA 2M8EA 5TJJA 1ENHA 4A3KJ 2C2LA 3NOCD 1ETOA 1IRXA 2CG2A 3RYRA 2X6HA 3TWRA 1BU9A 2LOOA 3E32A 2BOLA 3EIJA 1ORKA 2BYVE 3QU6A 5KJLA 2ZXJA 2KJBA 4LD5A 3MEKA 2P6TA 4ANWA 3RRNB 4BBRJ 4GTSA 4MO7A 1TJCA 1ZU2A 3P9CA 5FZQA 2L7FP 4J19A 4HQDA 4GGGA 3DEWA 2LBFA 3VFZA 1O3RA 1F43A 3C18A 4HI9A 4WWNA 3HRMA 4I76A 4RA2A 3G73A 1SVOA 2MC3A 1HG5A 1N9AA 3AS4A 3WGHA 1Z3XA 3HOZJ 3I0TA 1MBEA 2PMZA 1JHHA 1V54E 3DSWA 2DA2A 3FTSA 4HOUA 2CFZA 4FX0A 3UT8A 3L82A 2M5WA 5KNHD 3O2PE 2AQEA 3FXLA 4GPKA 1YFHA 5AQBA 2LKPA 3ZCOA 1MX6A 2CFXA 5EDSA 2NNNA 2V7FA 1S7OA 2V1NA 4YFXF 4JD2G 3DU5A 3JCUC 3LSGA 1K7AA 2XAJA 2LKSA 5HVQC 3KYDB 2FBNA 4KT6B 3K2AA 2BY3A 4IRGA 1V55E 3IKVA 4DQ2A 1WZ2A 2UY1B 4HB5A 1TTYA 3PFYA 3WU1B 1IUFA 4I6EA 3C7JA 2DMPA 3K4LA 2HFHA 1SAUA 3HXCA 1FBSA 4I0BA 4U96D 4KVMA 2Z3YA 5F64A 2YQ8A 5EYLA 4BJ5C 5GPCA 2FMYA 3CGHA 3DBLB 3QDNA 4PJJA 4XRSG 4BFRA 3NWTA 2PX9A 3HHHA 4NC7A 2NS7A 2X1CA 2P9NG 4AIFA 4DUIA 2A6TA 2WB2A 3UTMA 2JRMA 4G94A 5DM6F 4IYPA 3Q7AA 1IXCA 1KT0A 3AG3E 2YX7A 1D5YA 2KXPC 3MZLB 4YFNF 2VQCA 2DMTA 3IP4B 4XLPF 1Z67A 4U8YD 1KU3A 5FFXA 3ABME 3SFYA 3MWMA 3ZW3A 2F5FA 3MQ0A 3CR3A 4RB0A 4N4NB 3J5QB 4YFKF 3I3NA 4XIFA 4ETSA 5CCMA 3EUAA 3HPHA 2B0LA 3EHNA 5E3MA 3LNQA 3CMYA 3P1UA 2ZXWH 3K1PA 2F2EA 1IC8A 2HQ5A 1WDYA 4IF4A 2VQ2A 2CW0F 4A93J 2R02A 2VLAA 2P6SA 3TJPA 3H0GJ 2VSYA 2J4BA 1YLFA 2KCVA 5ICEA 1TQMA 1OCOH 2DTZA 1QHHD 4BU2A 4ESBA 3H3VK 4XOTA 1YQAA 3ML6A 4NDLA 2AXTC 3T8MA 2EIJH 5FLMJ 4RAGA 1HFAA 4M3GA 4PJMA 3GO5A 4XR6A 2VJ8A 2V9VA 5DCMA 1VQ5I 3LA7A 1Y0UA 3M8EA 3QWPA 3GUDA 5JJ7A 3LSJA 3APFA 1TN6A 3E30A 1YX3A 3HOVJ 4XM3A 4W9RA 3PZ4A 5GAHJ 2ZNZA 1BIBA 1E8XA 2EPFA 4EBAA 4N2SA 3UT7A 1N4PA 4J7WA 3JQ1A 1K78A 2ZB9A 4M9SA 1DUXC 3KLOA 5BPDA 3ZXPA 4BESA 1WM5A 3LSKA 4HSRA 1G3WA 2Q0OA 2IY0C 5EX3A 3R6SA 2DFHA 1E17A 1K83J 1OWOA 2ZIRA 4ME2A 1NZNA 5TRDA 1BI7B 2A61A 3PEUB 4WWOA 4DNCA 2QBYA 4AIDA 3FZVA 4AIKA 2PL2A 3I4RB 4IL6C 2PM7A 3X2QE 3G1MA 1JPLA 5IY5E 1Z1DA 4Q96A 1GXQA 1TBXA 4U8HA 3ZQFA 3L54A 4UI9J 2ILRA 1Y6IA 1WJBA 2XF5A 1EF4A 1W3BA 4GTRA 3HRAA 5E76A 1I1SA 3TOBA 1T38A 3IV0A 2R7ZJ 1U5TC 3RZOJ 1TN8A 2CSOA 5EZGA 5J8FA 3WODF 2AXVA 3QWVA 3OYNA 4G9YA 3S3MA 3NAWA 3K70D 1LTXA 3LPZA 2RNGA 1W7PB 2HKOA 3KFWX 1C0WA 1PAQA 4HDUA 2L7ZA 3J7AY 3V8KA 3ULQB 4I6ZA 3RIRA 2LC2A 4HQMA 4IHSA 1HU3A 1YYVA 1YS7A 4I99C 5DUKA 3W6JB 1IN7A 4IX7A 2R17C 4DX5D 4HLLA 1T39A 3BQYA 3LJNA 1IQUA 3DSVA 1FSEA 1UG0A 1HC8A 3DPYA 1MW7A 2GOXB 5CVRA 4E7JA 5GAGJ 2EWNA 4BS9A 3BG0B 2HZTA 2BY0A 2KRFA 5AIJA 4XKBA 5AONA 2BKKB 3FHEA 5KJKA 2IO3C 3MN2A 2VE8A 4JA9A 2OU2A 5HNHA 3ZHEA 3EPZA 4N3AA 3FHZA 4RDUA 4J6IA 4GYIA 2L0IA 4XE0A 2PMUA 1IV8A 4L9JA 1X3ZB 3QYEA 4YIRX 3GTMJ 2QY7A 4RGUA 3S2WA 4FLBA 4LIUA 4XBFA 2B63J 1OYYA 1L5JA 3QAQA 3CEQA 3TWSA 1KGSA 5KWDA 1LNWA 4PSXA 1U5TB 1YG2A 4KJZA 4G8KA 1XDUA 4GMRA 3P7NA 3CMAI 4DBRA 2NOJB 2DQRA 4MQVA 1ZQ3P 4KT6A 3D1NI 3R0JA 2ID3A 4U0YA 4IO9F 4BWRA 3WTZA 2K9SA 5CPRB 4FTHA 5ANRA 3ZEFA 5E3OA 2VOOA 3U4TA 2VKHA 2HOEA 1U3CA 4XKVA 3MKYB 3HIZA 1ZG1A 3LSPA 4BNCA 3BZKA 3S2HJ 1E96B 3PIOF 5CECB 2XASA 2XAHA 5B5EC 2IT0A 4G8LA 2VL8A 4RM2A 3FMRA 4XLFA 4QWQA 4R79A 3MZYA 4I17A 1MBHA 2IS4A 3V2OA 3O8GA 1EF1C 4LSZE 5KJMA 1XGSA 3LKUA 1USSA 5LRRA 2M8GX 1PUFB 3JXJA 1Z91A 2ID6A 4CDRA 5CKTA 4S0HB 2JPCA 1ULYA 4ANJA 4E70A 3HOTA 1F5TA 3EDTB 2PBIA 3ZP5A 3ISPA 4QPQA 3CVXA 4LG0A 3R9MA 1WCMJ 1B9MA 3PIPF 2VE9A 1JUSA 3MV3B 3TO9A 1W5CC 4ABNA 2E2EA 2L9NA 4JK1X 1ELKA 1BN5A 3HRSA 4X0GA 3E3VA 2OTLI 1TZLA 1X5BA 4BT9A 5BUZA 3WGIA 3SEZA 2ADUA 1AKHB 3ONLA 2DYRH 3HUGB 2HEOA 2IU1A 2F5CA 4AM9A 5D6EA 3T1BA 3HSRA 3LSMA 2H09A 1QNTA 3UXGA 1H2TC 4OVUA 1OISA 3HTUA 4RLFA 3OYCA 2GXBA 1BW6A 3E34A 5CBNA 2V26A 1UELB 3BG3A 4XSZF 2VKEA 1F9NA 5DCMB 1FPQA 1U9OA 1XC5A 3M7GA 4UB8C 3LS8A 4Q69A 5E1ZB 4B3XA 1OMIA 5ILSA 5ICFA 2OBPA 5DDGA 1FOKA 4H7YA 4Z2YA 5T3RA 1Y56A 2P7CB 4B0ZA 2KZVA 4BDYA 2M0CA 1TNSA 1WJ5A 3KX2A 4UWHA 4XICA 4UWGA 1R9TJ 2XAQA 4HVBA 3M1EA 4URKA 3FMSA 2F4MB 1MBFA 1MDMA 5FJ8J 3SXYA 4BJ6C 1TWAJ 4IKFA 2ZXHA 1OWNA 2CHWA 2XZTG 2KT0A 3IUOA 1LQ1A 4OIOF 4CHUA 2PG4A 4RQIA 2IS1A 1JKRC 2W24A 1B8IA 2WXKA 2LTPA 3ML8A 1QZ2A 1O4XA 1D1BA 1W5TA 2L2OA 4HF0A 1E90A 2M7BA 5L3FA 3RKWA 2EIMH 2CWEA 4HOTA 5GPAA 2X85A 3H5NA 3J7ZI 2RREA 4KN4X 1OFCX 4C30A 3SF4A 3WHCA 1P9QC 2WWYA 5LHIA 3Q5MA 3LY9A 1K1AA 5ENNA 4JHJA 2A5UA 2ISZA 1MBGA 3T5XA 3LQQA 1XPXA 3PO2J 1JT6A 5DYMA 4EZJA 1HXDA 1LEBA 5E8IA 3LCAA 1WY6A 1XX5A 2CFOA 3DPLC 3CMMA 2ACJA 2IS6A 5LGTA 3FKJA 1HW2A 3K1MA 2BGCA 1YS6A 5FKKA 2R5YA 4ZYAA 2JJ7A 3CF2A 3FF5A 2K3FA 2V4LA 2NS8A 1DGRM 1LDJA 2DDAA 2LY1A 3D5RC 4E7KA 1OWMA 4YNDA 2WQ6A 4KXKB 3NAUA 3A2KA 2XPYA 1MZBA 3J80Z 2MH9A 2G0EA 4AOFA 5FTPA 3Q49B 1U8BA 5EEGA 2DI3A 3GF2A 3CUQC 1HDDC 1G3SA 2DA7A 5JHFA 2RAEA 2LAIA 4A55A 1X1DA 2NOGA 2XPUA 3IKTA 2HYJA 1K4SA 1MNDA 2K9QA 1W36C 1YA0A 1VDYA 3TW7A 1T0FA 4ENJA 2X6IA 4DPRA 4G26A 2L54A 4WUYA 1MX4A 4GYGA 1SA5A 2XF6A 4A5MA 3ZGKA 5LRSA 1TNUA 2QUFA 1QA6A 2FF4A 1FMWA 2XF7A 3FXUA 3ZQ7A 3LJ3A 3K1NA 3KP7A 3W6KB 1IRGA 4PH4B 1J5YA 4DYRA 1I50J 3GTLJ 3V31A 5AAOA 1FYKA 4A12A 3CC2I 2XHKA 2QYJA 3HVEB 5B1BH 2PFBA 3WGGA 5E79C 2HPMA 4R8HA 3IKOB 1SANA 4C9BB 1HKSA 3CDLA 3HXLA 3CCYA 2P8TA 2CG4A 4XQFA 5M3FJ 1HF0A 3OL4A 2RN7A 3BR3A 1RZ4A 3KYCB 4I1AA 1MMAA 2L02A 1IXRC 3H9JA 3O4ZA 4CXFA 2PMHA 3OAWA 2DMQA 3I56I 3D9PA 4Q47A 4FP7A 1K78B 1VQ6I 1E0EA 4DX6D 3DSUA 2PLYA 4ENKA 1P4XA 4AC0A 3ECOA 4P9UA 3PM1A 2P9LG 5HOOA 4CT0A 1HW1A 2WAFA 3GLLA 3MAJA 5IP7J 1FIAA 2IEJA 3C2HA 4CCOA 2VOPA 1O3SA 3Q9SA 2J4DA 3G2WA 5D0OD 4NBQA 1K6YA 3DCFA 1WJAA 3F6QA 3HOXJ 2Z9OA 5EN5D 4GCOA 2CU7A 4LG0B 4O6FA 4W97A 3HDDA 3HC7A 5D4SA 3FX3A 3ZYMA 3ASHA 2OC6A 5HLTA 4TV3A 5ANLA 5JR3A 2MABA 2E35A 3OMYA 4GCNA 5KJNA 2BY2A 2BXYA 3WU2C 1H6PA 3BLYA 2VASA 2VSNA 1DVPA 3I4NJ 3DEPA 1JHFA 2DA3A 1ETVA 2FMLA 3A4CA 4B3AA 2OCCH 3OS2A 5M5WJ 4IHVA 3TXMA 4ILIA 4ANVA 2STWA 4OAUC 3VSLA 2NYJA 1W36D 4BHBA 3OYIA 2JA2A 4C2MJ 3IV5A 4A3BJ 3Q15A 4BTBA 5FO5A 3HDXA 1QO0D 2BV6A 2XPWA 2CQXA 3T8RA 3ZMSA 2KRCA 1EPUA 2ZXIA 4XN3A 2HQNA 1PP7U 1ODDA 5D8LB 4V19K 2H6FA 5F0CA 3ZYLA 3BTCA 1XMKA 5EIBE 4LK0F 2UV1A 1BI1A 4FJYA 2JK3A 4I9CA 3J81Z 3G2SA 4WNEA 2K86A 4FASD 2JA6J 2VSXE 1D9SA 3L2WA 4OMZA 3K4MA 3JXIA 4KISA 1IDZA 1S5LC 5JLWA 2X6WA 3AAAC 1WH7A 1R7JA 5EEHA 3P9IA 2X6FA 3D3MA 5DBKA 2XB5A 2QENA 1O1RA 1IRFA 1WGXA 4DOZA 1G3NB 2DIWA 3HB9A 1YJNI 3PL8A 5BMZA 5FT9A 4RB1A 2AXLA 5DIZA 4Y52J 1ON2A 3TL4X 2KM4A 3KAEA 4YELA 4J8DA 2K9MA 2ZSHB 3LOCA 3TP0A 2Q2EB 1T6SA 2P5KA 3K4KA 5J8CA 1RR8C 3GTQJ 3J7AO 2LG4A 4KMFA 1QRYA 2EZKA 3IAM2 2B0OE 4I1OB 5T8IA 3TGOA 4A3LJ 2PJRB 3ZQLA 1ZLJA 3UMVA 4PGHA 2F0YA 2CUEA 2I10A 1LD8A 3FUDA 2WV0A 4CDGA 4WWPA 2L7KA 4JZYA 1RI7A 2I5UA 1H9TA 3TBIA 5FB2A 2BHZA 3DV8A 1MMGA 1OQYA 4E7HA 4EJTA 2BEDA 1CGPA 1UB9A 3C98A 1BL0A 2DCPA 3ONKA 2QA4I 2L7MP 1G2HA 2EIKE 3OXGA 2YINA 2QYOA 3NOGD 3DKXA 5LCWC 1X1PA 2EK5A 2ZJ2A 4OAZA 3ZXSA 2DFFA 1HW5A 2W48A 3FIWA 4PGGA 3OYJA 2KZTB 3FDHA 5LP0A 4L5IA 1RETA 2O8KA 2J49A 2HNHA 1BIAA 1AU7A 3RZDJ 5CEDB 4F3VA 5FQ6A 4N0BA 3EHMA 5IT9Z 5GTIC 1TWHJ 2K7LA 2GRQB 2J08A 4GCVA 3CO7C 1U3EM 3E6MA 2WQHA 5KBAA 3L2RA 1YMPA 4K5AB 3W2WA 3ULEG 3B02A 4GA0A 3K70C 4KIBA 5FRNA 4WXCA 4GTPA 5AQ9A 3CCJI 2MC4A 3CC4I 2NYXA 1IN6A 4UI9C 3NZUA 4XI9A 2VJ5A 2WAEA 5ENSD 2MYOA 1H19A 4TRQA 3F3XA 1JWGA 3X2QH 5CMWA 9ANTA 1G3TA 2VT3A 3J5PA 3DLAA 5EJCA 4M74A 4KVOA 5E8GA 2WA0A 4ASNA 4GMLA 3UM0A 2LD5A 2ZCWA 3PFIA 3TWWA 3S7BA 3HXBA 1MDMB 4F1PA 2DW4A 2PMZN 4YDEA 3I4GA 1BPOA 4EATA 1OCOE 4N9IA 4IULA 3U1DA 2O6GE 3R9AB 3KD7A 4HLXA 1QHGA 2TDXA 3V7RA 1J75A 2LSOA 2R2LA 3DSXA 3BG7A 3DBRB 3J7YJ 3KS2A 2IO2C 4BHPA 4D5CA 1TL8A 1Y8MA 4HOQA 4TXPA 4A0XA 3VYUB 3IH4A 1XGMA 2VKVA 3E7LA 1G6NA 3NRVA 4QSHA 2CQ7A 3VODA 5HLGA 4RG6A 3K0LA 5A6CA 1NA0A 1K4TA 2AWIA 4IRHA 3NZSA 4QIWN 4I6JA 4JW1A 3UQ3A 2M30A 2KFDA 2GGFA 2DOAA 1MGTA 1STZA 4L0ZB 2VTBA 4J8FA 5B1BE 3KETA 4XRSA 2WAQN 1W7PA 5CRVA 3QOPA 1ZYRF 3QYBA 1Y1WJ 2J9QA 3CP2A 3EU9A 4OOIA 3DTIA 4HG2A 2VSOE 3CLJA 4JEUA 2JA8J 2L6BA 2EILH 4FHKA 3A1YA 3BZ6A 1V5EA 5K5RA 3I59A 2MOWA 1MMNA 1JUQA 4IVNA 2WB1A 1SVLA 1SZ9A 2N8GA 1FWZA 2XHEA 2F4IA 3TWVA 1PC2A 5DCFA 2NNYA 4S05A 4FULA 2Y30A 3OS1A 2MHKA 3SZ7A 3ABKE 1TT5B 2IA1A 4P96A 4E7LA 3D9JA 3CCVI 4ZZLA 1OCCH 2KMUA 4U0SA 2NAZA 4D7NA 2MGQA 3I9V2 2EILE 3ZRHA 2VBZA 2LY2A 1N78A 4EQFA 4A0ZA 2WXOA 2IEKA 3SFZA 4AYBA 3FU5A 2EZIA 3OSGA 3FUJA 3FDYA 3LL7A 5L3GA 4C2TA 4XLCA 1KPSB 4UB6C 4Y6WA 4I43A 1ELRA 2O9LA 4DIQA 1EJ9A 4ZYDA 3ZOBA 3LAJA 1B72A 2BF0X 3FTUA 3BTIA 1FT9A 3V7SA 3OYKA 3S3OA 3ZPLA 3RKXA 2PQRA 3ABLE 5CVVA 3MZ8A 4N9HA 3RO3A 3IHUA 3WE3A 1GVDA 3GTPJ 2OVBA 4PDKA 4LRZA 3JRFA 3SZGA 4PCQA 3TKYA 4EBAG 5F08A 3Q79A 1LVAA 4G7HF 3SQVA 2BKGA 1UOHA 3OYLA 3SFXA 4JA7A 4HNAD 2FD5A 2ICWG 5E17F 2Y69H 2Y0BG 4ACKA 2HS5A 2EA4A 1CQTA 2HPIA 1D5VA 1TJFA 3DFGA 3GW4A 4ZTFA 2JA5J 1S70B 1RPWA 3S1QJ 5FRMA 5ILUA 4K0RA 5ENTD 3F6VA 3PQJA 1YTYA 1N54A 2WXHA 1FVFA 4EGZA 1I27A 4A6DA 1S7AA 1N0QA 5D5WB 1DNPA 3UX4A 2V6CA 2R03A 2O8XA 4IEJA 4F52A 3L09A 4BQNA 4OIQF 4L9PA 4BY6A 2WXQA 4KIGA 2QZ8A 1SFKA 2F8YA 2HTSA 3UT4A 2M87A 1W5SA 3DEEA 3E1SA 3LQRA 1IN5A 3PO3J 1XCBA 2NS0A 1AA7A 1N11A 4WAFA 3W2VA 3AU4A 5M72A 2DBAA 4NUBA 4UUTA 3DWLE 2VBXA 4E6HA 4HLEA 4X8QA 2H6CA 1JUMA 5FLXK 2DZNA 2KP6A 1I6XA 1NTCA 2LUHA 3QP6A 1FYMA 2HVSA 4BTAA 1DGWY 3AAFA 2PZIA 2JSPA 2CJJA 2YSRA 1MHQA 5F6FA 1OWPA 5HQ8A 2HDWA 3Q9NC 3EDPA 3C1DA 2HVQA 2XRYA 4AUXA 3J80K 2HOTA 3CQGB 2ESNA 2KKOA 2Y9ZA 1VQKI 4AVPA 5BS6A 1S0PA 2VJJA 3OYDA 3FEYA 4JHKA 3CZ6A 3C3OA 3ABTA 3FHNA 4XLHA 1Y0NA 4BL0B 4BX9A 1P7IA 4GO1A 5JHUA 3WTWC 2IOSA 1INZA 5FKNA 1Y8RB 3GXOA 2JT1A 5FQ7A 2E1CA 2LMDA 3DQVC 4GTTA 3R61A 3ELKA 3GZSA 3RRUA 4HSTA 3CHSA 3JRDA 5J6XA 2YX4A 2GLOA 5CVUA 2AJAA 4JL0A 3FMQA 4G8XA 3OYAA 1WHUA 4OYSA 1FYLA 3NWSA 5JVGF 2XC7A 1B8IB 3TO6A 1NL4A 3S7FA 3CUQA 4WCGA 3CQZJ 4ATZD 2P9KG 3SFIA 3ASNH 1KT1A 2HTJA 3TMOA 4OAVB 4I01A 3N05A 5BOXA 2DTRA 5EGOA 1HE8A 3HHMA 3UM2A 2GIZA 4HI8A 3CUQB 5FIOA 4XEIG 1U2VG 3QKYA 2X9DA 4N5QA 3CCEI 1LPQA 3G4SI 2GA1A 4EM0B 5IOZA 3IRRA 1K61A 1VQ7I 2IQCA 1SFOJ 2V9KA 4K5CA 3ZN3A 2Q8KA 2HDDA 4GA2A 2ZC2A 1I5ZA 2X0LA 1HSJA 2JEKA 3GZ2A 2J5OA 3N4MA 2GRPB 2V5QC 2CGPA 2WPVA 3FEXA 4LB6B 3SZPA 2FRHA 2AS5F 2MSYA 4EMSA 4PJNA 3GWZA 2R7WA 2IJGX 3C72A 1Z7UA 4M3OA 4LK1F 2IGKA 2RFAA 3BUAA 3RK6A 4FX4A 4P9FA 1JGSA 4HBDA 3IWFA 5J3LA 2I8DA 1P7JA 3W2AA 4IHXA 4L23A 2OZUA 5LEJA 3S14J 1LB2A 4HX8A 2RG8A 5AJLA 3FTVA 3U66A 4MFEA 1A6QA 3HGGA 2R93J 5KCMA 3CCQI 4PFOA 3Q47B 2XV4S 4HZFA 3MKRA 1HS6A 5JJ6A 2OV7A 5F0HA 2M0MA 2KJCA 4APFA 4A3TA 1XGNA 3G2VA 2XIGA 4IHWA 3ESKA 1BM9A 3H1CA 2WXNA 2CS3A 2Z2SB 3GFJA 3HJEA 1ZRFA 1FP1D 4FC8A 2KL4A 1K3ZD 1T2KA 4G6TB 2ISYA 3OS0A 4ZDOA 4FETA 5D5UB 2H6HA 1O7FA 1QVTA 2WY8Q 4HA8A 5E1WA 2I1KA 2DPDA 2VYIA 3FH8A 4MNUA 1X2NA 3UIPC 3DEOA 1IN8A 2IVMA 5IYCJ 4F93B 2WXRA 4KMUX 4UWLA 5EEAA 3ESLA 3UNGC 2DO7A 4UVAA 4RG9A 3A01B 2IA0A 3PZ1A 1NG7A 1H0AA 1X58A 4L7TA 1SFEA 4JQFA 5M5XJ 5E3NA 2IAIA 5B3SH 1NH3A 5JJTA 5LGNA 4UWFA 3MA5A 1W0TA 1A5JA 3QJZA 2L9VA 3HKZA 4CEMA 2RVCA 3CJRB 4BQOA 2CV2A 2E5NA 5E20A 4D7MA 4GZ5A 2B6CA 2W57A 2QBYB 4U88A 2DPUA 5HNFA 1NA3A 2LFBA 4ZC3A 4LEUA 1ZTRA 5E75A 2FQ3A 3C2BA 4BEHA 4BSXA 3ABKH 5LEKA 4RVBA 3ZFWA 1MNEA 4WK8F 5EYPF 4M9ZA 1EH8A 1LDDA 1X4OA 4A6EA 5J90A 1I3QJ 1U78A 3CP8A 3ZQIA 2CHZA 4CICA 2WBMA 3B13A 2QKLB 2XGOA 3PNLB 4OU0A 3Q7FA 3TG5A 3F8FA 2XB0X 1MD0A 2QQAA 2XAFA 2F5DA 3C3WA 4G11A 4NURA 5J08A 3DP7A 1XDSA 2WXLA 2X6KA 4UVCA 2Y0SN 2NVTJ 2WTEA 4Y3OA 3PUJA 2R7QA 5D5VB 4FQGA 3PSIA 3PUKA 3GTKJ 2EBIA 3ABMH 3HBLA 5J1YA 4LITA 5EKQD 4B93B 4KN7X 2OVFA 2W84A 4Q48A 3HOYJ 4LCTA 4BE1A 2L9SA 3HL2A 1MQSA 2I6HA 2K9NA 1MJ0A 1BR1A 3RSNA 3UUXA 3AFHA 4ABZA 3DLLF 2HR3A 3QWWA 5AIQA 4G23A 2ZSIB 4LERA 4CYMD 4D10C 1JKPC 4XOPA 3GCMA 2YNQA 3K7AJ 4QTRA 4E85A 1B89A 1WFXA 5C3EJ 2ME6A 2O0YA 1FY7A 1IDYA 2CW7A 3MKWB 4I7HA 2DZOA 2XQ0A 1LUJB 2X3MA 4P55A 4JP0A 3ZN1A 2HI3A 4B8XA 3JREA 3LSHA 1LVKA 2ZU6B 5C1DA 3R60A 4I09A 2NSZA 3JRHA 1JTYA 3FP3A 2QQ9A 3ECHA 3MMYB 1F4KA 1N52A 5CERB 4O5VA 3GFLA 2H1LA 4ILGA 3RJVA 1YIJI 4TXRA 2VPLA 4CGVA 4DBQA 3G2BA 3GBGA 3LSTA 4M3DA 3CO6C 2KATA 2X6OA 4U0ZA 2LK2A 1VI0A 1SMTA 2D1VA 2E71A 2GQQA 3JAMK 2JWTA 4NC6A 2BTDA 5K1YA 3OYMA 2R5ZA 2NVQJ 1AHDP 4ZDLA 3QAHA 1FJLA 1JUPA 1Z6TA 1TT0A 4NRHB 2DCEA 1AWCB 1XTAA 3TG4A 3DKYA 1RW2A 3C2GA 2HM8A 4PJ0C 2COBA 2F6CA 3F22A 3M3YJ 3QOUA 4II2A 3UR3C 1OYWA 3BTJA 3B7BA 4IRUA 4B47A 1KLXA 3ZRGA 2HWVA 4M6YA 4G24A 2WADA 1USTA 1YJ9I 5AQAA 2D2WA 4CUGA 3SI5A 4ITVA 2LXLA 2EA2A 1LE8B 4IRIA 3E33A 2A5YB 4BQAA 1QQIA 1R1VA 4L9VA 4BY7J 4GXOA 2J5PA 1JJ6C 4J8SA 3O48A 3CSTA 5BXUA 3L00A 2CUJA 3E97A 4WF2A 5L3CA 1N77A 3DU6A 2QYUA 1L0OC 5FWQA 1J7KA 2QVOA 3WG7H 2M7AA 1K6OA 2VQGA 3HXDA 2UXNA 2E5ZA 2M45A 3ASOE 1HKTA 1BI8B 3KEQA 1X19A 2WB1N 2ZFWA 3GEZA 3ZQGA 1UHMA 3BC8A 5KNLA 2UUZA 5B1AE 3L2QA 2KIUA 2KIQA 4F55A 3SYTA 1DPRA 1DU6A 3SD5A 3MKQB 4AIJA 4FT8A 1A5EA 3TAXA 1ZK8A 3RDIA 2OEWA 4ZH4F 4CRWA 1EA3A 1VTNC 1TNBA 3CESA 4WXDA 1B9NA 1FPPA 1HQCA 2KRHA 2R7FA 5BV0A 1JCSA 4A3GJ 1O3QA 3ZMDA 1QQEA 2ZJQF 3FXQA 4DZPA 2PI0A 2ONDA 3UIOC 2V8SE 3OY9A 1W4MA 2IBDA 3HHGA 1O5MA 3KP2A 4AIHA 1N95A 3F8NA 3MD2A 1A17A 3PZDA 2WXIA 3Q4AB 3ZPJA 1TWFJ 2QKMB 4APOA 4O3MA 1QZEA 4X1EA 1HSTA 4Y15A 4Q4ZF 2PQNA 4CZZA 4EJVA 1UFMA 2IP2A 1SFUA 2QWWA 2XAGA 1XNFA 5LBQA 3CKCA 4D5FA 1X3UA 2FOKA 4TUUA 4RB2C 4M7CA 3HGYA 4PSWA 1PYVA 1FSHA 3FXKA 1XMXA 1BI0A 4XIDA 1HBXG 1OCRE 2B7EA 3D9KA 4O1PA 5HI7A 1T98A 4B89A 1DC2A 2XGCA 2XROA 1N75A 1LJ9A 2V4JC 3O6BB 1T08B 1IV6A 2XPIA 4HXIA 4DI3A 3QRFF 4UXNA 2FI7A 5CMYA 3ZYKA 3ERMA 4E7ZA 3FM3A 5FZRA 3SGHA 3OOUA 4UV8A 1VFCA 3M9AA 4DGWB 1N0RA 5C2YA 2IGOA 2H27A 3AG4E 1CF7B 4UV9A 3ZMUA 1ZRDA 5F27A 4BAYA 1OCPA 4II3A 5HODA 1D8JA 1RNLA 1Z6RA 1TYQG 2LSVA 1XSVA 4HORA 3GFMA 5HLHA 1G8XA 4MQ9F 2NC9A 2FBKA 2BVLA 3RRMB 1VQLI 4U07A 3V30A 2LNBA 1IJWC 5K5OA 3HYIA 3RCOA 2JQ7A 2MLGA 3BR0A 4DLQA 2DODA 4F7AA 2QSHX 2FSWA 2QM3A 4WXHA 1MBKA 2HYZA 2WMNA 4GFBA 4BX8A 3ZGQA 3CHOA 3KEOA 1XG1A 2A05A 3IL2A 2OA4A 3E5UA 3VSKA 5EF6A 3NQPA 4LFUA 4BE0A 1VNDA 3O8HA 2WY7Q 3AG1H 5AENA 4NB5A 1MSFC 2EV0A 3H0DA 4JB8P 2XPZA 1OXJA 3FUHA 5KAFC 3KPHA 1LD7A 3ZQCA 3F23A 3DKWA 4WNFA 2XSJC 4C0EA 5TISC 1OR7C 3H35A 5EDNA 4BEPA 2R7RA 1BA5A 4M73A 1P4WA 1ZG3A 4U95D 5JMND 3Q78A 1DQUA 2VC1A 2IPQX 3QYFA 3HVEA 3KLNA 4O60A 4IXAA 1PUEE 2P9PG 3H5RA 3M4OJ 2FUG2 3D9MA 4RGSA 3D9NA 2R05A 1MNMC 2E2HJ 4KFCA 1Y1VJ 2NVXJ 3SDBA 4YVOA 4B8AA 1IZ1A 4MEXF 3K4NA 1DP7P 4PUSA 1LFBA 3E5XA 1ZREA 1F36A 4CH7A 3HOUJ 4BXFA 3KP5A 1E7UA 4IN3B 1B6AA 4XL9A 4ATGA 4L2LA 2CRGA 3BDDA 1WKMA 3MKLA 4XLNF 1AWCA 3BROA 4OINF 3FTZA 3A03A 5D4RA 4XONA 1B4AA 1HF8A 3SHFA 3KE2A 3L9FA 4XX5A 4RM3A 3AKZA 3N97A 3D5SC 1BJAA 3MKZA 3BWGA 2Y9YA 3S7JA 2F5EA 3FUKA 3PNTB 3RQ4A 1KYWA 3ASFA 2M4KA 1F1ZA 2LP0A 3CTAA 1WSUA 3K10A 3KP4A 5HS0A 2CUFA 1N4RA 3JQ0A 1UG2A 2FXAA 2X48A 3H9GA 1UAAA 3CCUI 4XLAA 2DYSE 2R4GA 1FTTA 1NP7A 4CCAA 1NG6A 2XGDA 3HZJA 4BY1J 3FKIJ 2L9RA 4NQWB 3MFKA 2RDPA 4OMYA 3EUHC 1G59A 4S04A 1S9HA 3CJNA 3I58A 1UW4B 4Y17A 1ZH5A 5T4YA 4U63A 3Q0UA 2X1EA 5HS7A 2LYCA 4XK4A 5IY5H 1K1BA 4DYCA 3QARA 3IHYA 1MJBA 1GV5A 1R5ID 1QPIA 2WXJA 3HSFA 4MGRA 1LEAA 3KEZA 2V6EA 3NF1A 3CCSI 3UKUG 2E19A 1UN9A 3SBTB 1PP8F 5EIDA 4LIVA 2JUGA 4AP2A 1XCVA 3ZMVA 2WXGA 4KYWA 3RPUD 3DXKG 4I2ZA 4M71A 2P5VA 2AXUA 4MBGA 2RKKA 4HFGA 4ZDPA 1DU0A 1GUUA 3I55I 3WHBA 3QU3A 1VQ9I 5G2NA 2K85A 3CVWA 2F48A 4FHTA 3DBSA 2Y2ZA 4BACA 4A3CJ 4BKXA 2BY1A 1MBJA 1KZHA 4BDZA 1SEUA 1YJWI 1NK3P 2DU9A 2E2JJ 2R7SA 1J0RA 1PY1A 2FBIA 2GZWA 2BBYA 3K9TA 1OJLA 4H4KC 5CVIA 3B6AA 3D0SA 3TDZC 3F21A 4IZZA 1QBJA 1HCRA 2D45A 2VGEA 3CF5F 4XZ4A 3R7QA 2ECBA 1ZLKA 1P6RA 3AG2H 3H3ZA 4I02A 4GU5A 2CV0A 5DM7F 1XGWA 2EFPA 1TLHB 3C3QA 4JX4A 3ASDA 3OR2C 1WAO1 3DEUA 3O3KA 1TWCJ 4J8EA 2RV8A 4LG3A 3ZIMA 4CCNA 4DX7D 1BC7C 3VDXA 2YU3A 3CD6I 2AXZA 2E34A 4A5NA 4LUNU 3VYSB 3JRCA 1N4QA 1TN7A 2P58C 3UKGA 5A2QK 3F72A 5JI6A 1KU2A 4I9EA 2QSGX 2XEEA 4JX5A 3CJQB 1I39A 5DTDA 5ICCA 3GW2A 2LREA 2YU9J 4PUCA 3DSTA 4J01A 2W00A 2MA3A 1A6IA 1X81A 4B1RA 2VC0A 3GMEA 4AJWA 3CVPA 5J4YA 2HZDA 3Q5FA 3WTUC 5D8KB 1T95A 3LFUA 3L1PA 4XMYA 3MYVA 2E7XA 2OTJI 4I6GA 3DPDA 3ULQA 3IXEA 2VB6A 4LGWA 2R7XA 5M5YJ 2K9LA 1LFUP 5G04J 4EJWA 4QPOA 1TWGJ 3VB2A 4EM1A 2R7UA 4HNTA 4KYOB 4UQZA 3UPVA 1B1BA 4KIFA 3BR2A 4U7BA 3L17A 1FIPA 4YIIA 4DLOA 3JUIA 3BY6A 3IH2A 3WXXA 3ABUA 1BOBA 1WJDA 1ZKGA 5FLXZ 5L3EA 3D9IA 3BCAA 2H6BA 2L5QA 3FXOA 3BG5A 3I53A 2H8RA 2LAHA 5BW8C 1UG3A 3FTYA 1TP4A 3BR1A 5D0QD 3OWTA 1UMQA 2GIVA 3EIQC 2P2CP 4UUSB 4XSXF 3EU5A 4M6XA 4V2FA 2YUSA 2LLKA 3A0HC 1BW5A 4BT8A 1X1CA 2ETHA 2NXPA 1JJ8C 3RO2A 5E3LA 5B3SE 2E7WA 2GBYA 3FBIB 4HV5A 3U1KA 1FLIA 4NQ0A 2VPRA 3RKYA 4B44A 3SO8A 3R4KA 4WX9A 1GXPA 1OCZH 2CQNA 2FJ1A 4QQIA 3ISMC 4NNJA 3IC7A 2EV5A 2VBYA 3VLEA 3RYPA 3ZN0A 5JHBA 1W1WE 4HF1A 3PRZA 4Y7NJ 4A3DJ 3CQCB 4HNUA 5BT1A 5IP6A 3L6AA 1QNFA 4M3BA 2OD5A 4UVBA 2QZAA 1OWLA 1JT0A 3FU6A 4AD9A 1EH7A 5EG0B 2X6JA 2KPMA 1FBUA 3Q0VA 3W9GA 4A63B 4AY5A 3LFKA 2KIFA 5LFAA 2EFNA 2A68F 5GAEJ 1A04A 4YRVA 1V4RA 2P4WA 2A69F 2FOWA 5GP9A 2R92J 4BEHB 3E0JB 3Q3SA 3ZQHA 1D1CA 3RSEG 3AG1E 1RC9A 3TEDA 4PJLA 1WVRA 5CHEE 3OOPA 2EZHA 2YPRA 4OWRB 2IRFG 4AWXB 2VGYA 2IONA 2DJIA 4L18B 4B09A 4JPSA 2UXXA 4CGWA 3GYZA 4C2UA 4O1OA 1IGNA 3CUOA 2DQLA 1UHWA 4PS3A 3WTTC 3WTYC 4GAAA 1JGGA 1MJAA 2H94A 3CVYA 5KVRA 1DP3A 3V2XA 2K27A 2Y48A 5L3BA 3U9WA 4AVXA 3TO7A 2Z1DA 2DYRE 1J09A 5D5XB 5DD4A 4G1TA 1U8RA 3L22A 1DPUA 4XKCA 2ELKA 4B48A 4EJUA 4P1WA 3GLXA 2XUBA 1XMAA 1ON1A 2QQ8A 2YR2A 1YYHA 1DDNA 2ZFUA 1VQNI 3FY4A 2M34A 2OQRA 4DZJA 3KP6A 4RLQA 3BPXA 5LHGA 2JRTA 4GZ3A 4L5JA 2IW5A 3CV0A 3IWZA 4W1UA 3D9LA 1U0JA 1N94A 3OSFA 1XD7A 2P0WA 5F04A 3JRIA 3HTSB 2EINE 4MTEA 3UI2A 3URZA 2BHYA 2XGEA 5H6RA 3SY2A 1D8DA 3KIOA 2A5EA 3MX3A 3CHPA 5FFZA 3VTYA 3U3WA 2YHCA 4AEZC 1HLVA 2BZTA 5M3MJ 2P9SG 3ONQA 1JI8A 1HH8A 2DA5A 1QGPA 2DYSH 3G1LA 1R00A 2RQQA 4N4OB 4CSWA 3TWQA 2PM6A 3PZ2A 5FKOA 4ZZDA 3Q9VA 4RAYA 3FK6A 4ON0A 3PNYA 3TGNA 3APDA 1IXVA 4YVQC 2M3AA 2GROB 1YW8A 2B9SA 1YI2I 2P7VB 4HPQA 3PNTA 2VGXB 3FWEA 2IFUA 1ZR2A 3I5PA 4U04A 3S3NA 1BD8A 5EG0A 2EFQA 3T9KA 2BUGA 3M1CA 2MW8A 5FQ4A 4HOBA 2BW3B 1Z05A 1WI3A 2HXOA 3MVPA 1Q1HA 5GTHC 3JTGA 5CBOA 3CIAA 1K79A 2E1NA 4C9YA 3D9OA 1R1UA 1H2UA 1G4DA 3FXRA 4PK4A 2RFMA 5BV1A 1R36A 3HSEA 2J8SD 2Y3AA 3CJTB 5CJ9A 1R71A 3PVLA 3OYFA 3T5VA 1IHBA 2C0LA 1ETXA 2L01A 3VYRB 2R5YB 3JRBA 1LDKB 1E2XA 3CK8A 4BSZB 2L0TB 5K7ZA 1YE9A 4MIMA 3RPQA 1O1SA 3VTXA 3WTVC 4A3VA 2ZNYA 1Y8QB 2DLLA 2IXSA 2RKHA 3I59B 3RJPA 4GZCA 2E1MC 5J40A 2DWZA 5G55A 4UI9K 2CG3A 5ENRD 4WNGA 3KYLA 3H92A 3K2ZA 1T8IA 3AJIA 3HIFA 4HQEA 4GDFA 4HF2A 1IYGA 3QC1A 4JBAA 2JTVA 5EZHA 3H36A 3I71A 1V5GA 2DT7B 5H2FC 4JEHA 1HDPA 2R7DA 2VKDA 3LA3A 1FOYA 4M3EA 4XNFA 3E5QA 2OPTA 3G71I 3CCLI 1OCRH 2ZXWE 3L08A 4K03A 4GTQA 5DEQA 3PJRA 3CVQA 2LO6A 3TXNA 2GRNB 1TC3C 4N2QA 1APLC 1FC3A 1Z0XA 4PS8A 1LKXA 2AO9A 1QZZA 4ZYEA 2ZJRF 5IT9K 2XGSA 1G3YA 2EQXA 3VYTB 3ASNE 4FADA 1A31A 1IF1A 3P5JA 3OV8A 1RKWA 2ZMEC 2IF4A 4L9TA 2QSFX 4G7OF 5BXOA 3AG4H 4UUCA 3BEEA 4ILHB 4EHMA 4MLOA 3APCA 2IOLA 3CVLA 3HXEA 4MLPA 2MRIA 4OVVA 3RIBA 2BXZA 4MFDA 1HXIA 1JXSA 2DDBA 2WC2A 4A3FJ 4EECA 2NXNB 2X51A 3NARA 3NEUA 4JVSA 4AY6A 2F37A 5HLIA 4CZ2D 4H0EA 4MKTA 3I3LA 2PEXA 2AHQA 4ZTJA 2QGUA 3G6EI 3E6DA 2HYGD 1J59A 5HKPA 1B59A 1RRJA 3CC7I 1D0XA 4G7ZF 1R23A 4GRIA 4G2VA 4EZKA 1SD7A 5ED4A 1YCSB 3PSFA 2E1MB 3JW4A 3KSQA 3MJWA 4V3IA 3NQOA 5EGOB 1OCCE 3MV2B 5K7FA 3S16J 5AQ7A 3PS6A 2JLBA 1SA4A 4TUMA 2L4AA 1XS9A 2JABA 1RESA 3HG9A 4A3EJ 1GDTA 2XZDG 1RKTA 4PDXA 5EILA 3AL0B 5ENOD 5EX0A 4EZLA 1KU9A 1VF9A 3F8BA 3TOAA 4ESJA 3CK9A 2CMPA 1QBQA 5IOYA 3GYHX 1HKQA 3ZYQA 4BQQA 3A0BC 3R0AA 5FKMA 3RI4A 2NRAC 4AVZA 4C3HJ 4RAZA 3VLFA 4G6DA 3V8LA 4YDWA 2JVGA 3MEXA 4LG6A 5DD8A 4RMNA 4ZJZA 4GZDA 1XB4A 1WJFA
chains in the Genus database with same CATH topology
2MBFA 3EYYA 4U0VA 4LB5A 3KZYA 1W7PD 4OIRF 4IPAA 4R1HA 1R5HA 4NHJA 3SZTA 1KQ8A 1ZARA 1S6LA 3KP3A 1TQPA 1WRJA 1V3FA 5CLSA 4M9XA 1ZN2A 4BH9A 2GAUA 3HRTA 3GZ5A 2BEOA 1AOYA 3ERED 2V79A 4LLGF 1O7LA 2DBBA 1ONVA 4M72A 1KQ0A 1U5TA 1XSXA 2QQBA 3L2CA 2O61A 2G7UA 2FBHA 3HOSA 5HDNA 5HS9A 1YW9A 1EV7A 5K5QA 3I64A 4HX7A 1CF7A 2X4HA 2A6EF 4EV0A 1D8KA 2P5LC 2EFOA 4RGRA 1KU7A 2FU4A 4KICA 4ZYHA 1GHCA 2K4JA 3F6OA 2VODA 1I1GA 1FP2A 2XVCA 4ZYGA 5IT3A 1R58A 1QPMA 4EQQA 1ZGAA 5FGMA 1SAXA 3DXJF 4HAMA 2FNPA 1IAWA 5HDKA 4ENNA 2VN2A 2Z5UA 1BI2A 4KT5C 4HDVA 2EJRA 2EV6A 1ZHFA 5FD6A 1WWXA 4EJOA 3HRUA 3PQKA 3V4GA 1KYZA 4TV7A 4HYEA 3U2RA 2GXGA 2DK5A 1S8NA 1FNNA 1REPC 2ESHA 2JSCA 1P2FA 3BJ6A 2DFIA 3JSOA 4U7DA 2JPBA 2BE5F 4A0YA 1OYIA 4LLLA 6PAXA 5ICGA 1NHAA 2LDUA 2EFWA 3I54A 4BHCA 2ZKZA 2STTA 4NQWA 2HGCA 4I98B 2O3FA 4EM2A 5ERIA 5DV5A 4KNYA 3BJAA 3T8TA 1O3TA 3MCZA 2G9WA 3QP5A 3QPHA 3TDUC 3FM5A 4HV6A 3EETA 1SD5A 1ZG5A 4Q5SF 2OZ6A 4HLYA 1Z9CA 2LF7A 2PN6A 2FE3A 2Y0MA 1BBYA 1H9GA 3WU0A 2RC4A 5LHHA 2OQGA 1J2XA 3GFIA 1TW2A 4CO8A 1YIOA 2Q2EA 5JFRA 3SQNA 1FX7A 4YG2F 3WE2A 3JSPA 2HYFA 4XRFA 4L0YB 4KDPA 2L3DA 3REOA 1EH6A 2VT2A 2ELHA 3VOEA 4D0PA 3K69A 4WWCA 1J9IA 1IW7F 4O6JA 2ZO4A 2CYYA 3KZZA 2VONA 3DF8A 3RPUA 2KIMA 2V1UA 2FEZA 4QLCU 3VEPA 3JTHA 1SD6A 3U9GA 4MTDA 5HDGA 2A3SA 4BYYA 4CYDA 1MKMA 1S29A 4L9NA 5KK1A 5H20A 4LMYA 3M8FA 2CO5A 4RGXA 4IHTA 1S3JA 2GA2A 4MHGA 4Y13A 5HS8A 1SFXA 5BQTA 3GX4X 2Z99A 1TNTA 3TQNA 2DAOA 2RGVA 2O03A 1ZRCA 2Z33A 4ESFA 2G7HA 2M1BA 4HX4A 3ZMZA 2RQPA 2XKOA 5F1RA 2UWMA 2W25A 1IN4A 2A6HF 3LA2A 4LJZF 1XSDA 5E18F 2D1HA 3B73A 4IJAA 1BI3A 2OAZA 3CDHA 3MZHA 5ILVA 2HKXA 1P4AA 5L3DA 4ENMA 3WTSC 1BC8C 1WI9A 3DPTA 2DK8A 3V8JA 1XGOA 1D3YA 1QZYA 2XRNA 3G3ZA 2K02A 1KQ9A 1TW3A 1FZPB 1SMYF 3IRQA 1RUNA 4RB3C 4U0WA 1IXSB 1ZGJA 4EVIA 3E6CC 4UHTA 1R5GA 1UCRA 1GVJA 1O57A 4I2OA 4KUMA 3EQLF 5FD5A 1KA8A 2DT5A 2PQ8A 3V7CA 5CYVA 1YO5C 1R22A 1U2WA 1WQ2A 4UUVA 1R1TA 1H0MA 1MJ9A 1OR7A 1ZAOA 4KA4A 3LWFA 1JE8A 4BXUA 2XGXA 3EUHA 2EB7A 2PJPA 3F8MA 2W85A 5JVTA 3J81K 3ROUA 5D6FA 2FNAA 4HBLA 4RS8A 5A2QZ 3L7WA 2HQRA 1YW7A 2ZMEA 5BPIA 2VBWA 2LF8A 3D5LA 3CLOA 4P5OA 3BPVA 2HDCA 2IJLA 2ZMEB 4I0AA 3WG9A 1TQIA 3KCCA 2RNJA 2V1XA 3F8CA 5CVJA 2FA5A 1SD4A 4UNOA 1FBQA 1L3LA 2Y75A 2MD5A 4HW0A 3QPTA 3I5UA 3ZMTA 1RUOA 4LLNA 5DUIA 2R3SA 3LAPA 3P9KA 3I4PA 2V1DA 4CGZA 4K2EA 3BP8A 4YIFA 3BJOA 3GVAA 2VXZA 2QLZA 3EYIA 3JAMZ 1IUYA 2MLKA 1OPCA 5LLQA 5H6QA 2JZYA 3E6BA 2ZBKA 3H3UA 2A07F 2COMA 4MEYF 2UZKA 2MH2A 4OIPF 3WTXC 4PZJA 3RTRA 1BOAA 1U6GA 2L4MA 4EGYA 2IA2A 3T0YA 5E1XA 1OKRA 3GZ6A 2GWRA 2XKPA 5LGUA 1XN7A 2C6YA 2K4BA 5AIPA 4F7ZA 4G6QA 3COAC 4A2UA 1RIOH 1PDNC 1P92A 2CQKA 3BOQA 3HUGA 5TJJA 2M8EA 3RYRA 3QU6A 2BYVE 2ZXJA 2KJBA 4LD5A 2P6TA 3P9CA 4GGGA 3VFZA 1O3RA 3C18A 3HRMA 3G73A 2MC3A 3WGHA 3I0TA 1JHHA 4FX0A 2M5WA 3O2PE 1YFHA 2LKPA 2CFXA 2NNNA 1S7OA 4YFXF 1K7AA 2XAJA 5HVQC 4IRGA 3IKVA 4DQ2A 1TTYA 3WU1B 3C7JA 2HFHA 1FBSA 4I0BA 2Z3YA 5F64A 2FMYA 3HHHA 4G94A 1IXCA 2YX7A 4YFNF 4XLPF 1KU3A 5FFXA 3MWMA 2F5FA 3MQ0A 4RB0A 4YFKF 4ETSA 2B0LA 3K1PA 2F2EA 4IF4A 2CW0F 2P6SA 1YLFA 5ICEA 1TQMA 4ESBA 1YQAA 3ML6A 3GO5A 2V9VA 5DCMA 3LA7A 1Y0UA 3M8EA 3GUDA 2ZNZA 1BIBA 1K78A 1DUXC 4M9SA 3KLOA 5BPDA 1G3WA 2Q0OA 3R6SA 1E17A 5TRDA 2A61A 4DNCA 2QBYA 3FZVA 4AIKA 1Z1DA 1GXQA 1TBXA 1I1SA 3TOBA 1T38A 1U5TC 2CSOA 5J8FA 3WODF 4G9YA 1W7PB 2HKOA 1C0WA 3KFWX 4HDUA 3V8KA 3ULQB 3RIRA 4HQMA 4IHSA