1RZ4A

Crystal structure of human eif3k
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
213
Chain Sequence
AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADEQIFICSQEESIKPKNIVEKIDFDSVSSIMAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human eIF3k, the first structure of eIF3 subunits
pubmed doi rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
molecule keywords Eukaryotic translation initiation factor 3 subunit 11
total genus 69
structure length 213
sequence length 215
ec nomenclature
pdb deposition date 2003-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10075 CSN8_PSD8_EIF3K CSN8/PSMD8/EIF3K family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rz4A02
1.25.40.250 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat ARM repeat; domain 1 1rz4A01
3FM5A 1G6NA 4OMZA 2H27A 1U5TC 4UHTA 2V1XA 4G7OF 2G9WA 2CFXA 1QGPA 2ESHA 2HYGD 3K1MA 1U5TB 3RI4A 1SFUA 4WXHA 2F5DA 3LA3A 1T2KA 2L4MA 5JI6A 4L18B 2L4AA 2DAOA 3HTUA 2QQAA 3E5UA 2GZWA 3GFLA 3WE3A 2XV4S 4YFXF 5EEHA 2MLKA 5L3CA 2E1NA 4UNOA 2NS0A 4EVIA 3PFIA 3DV8A 3E6DA 4FHTA 3M7GA 2DK8A 4RB1A 5L3FA 1ZN2A 2XVCA 1V4RA 4GYGA 4G7ZF 4HV6A 2Y75A 4UVAA 2D1VA 4A12A 3HSRA 3RYPA 2EJRA 3LA7A 1JGSA 3JTGA 3I59B 5LHGA 3Q9VA 2NYXA 4R79A 3D5LA 3M1EA 5K5OA 2KIUA 4KDPA 1WWXA 3C18A 2Q8KA 3BPXA 4ZZDA 4E70A 2PFBA 5FD6A 2GQQA 3E5QA 4EJUA 2H6CA 4KMUX 4K2EA 2VC1A 2D2WA 1UHMA 1R1VA 2R7DA 4MHGA 2HKOA 1JHHA 1K79A 1ZRDA 1FY7A 4FX0A 4PGGA 2VBZA 2XAQA 3CO6C 2LKPA 4N9HA 5E18F 2WC2A 4IXAA 4M74A 4P9UA 2XUBA 1STZA 4EMSA 1ONVA 3BP8A 3U1DA 1G3SA 2L3DA 5ILVA 4BQAA 4RGRA 2W84A 2EWNA 4CGZA 1XSDA 4MNUA 3GX4X 1LEBA 4UVCA 2KIMA 3DKWA 1WI9A 2QM3A 1FSEA 3QU6A 2DI3A 2V79A 1F5TA 2M5WA 1RZ4A 3J80K 2V1UA 1K78B 3FMSA 4JBAA 3C3WA 2A69F 4MQ9F 3PQKA 4IRGA 4L0ZB 3KEOA 1A04A 3IWFA 2XKOA 3CUOA 2HOEA 2E7XA 2VT3A 1U5TA 4AIJA 2FSWA 4UVBA 4YIFA 3ZMZA 3RKXA 1PDNC 2MC3A 2GWRA 4A0YA 3RJPA 1QNTA 2VN2A 2MLGA 3V4GA 2QBYA 1KU9A 1D8JA 4KIBA 3ZMSA 4M73A 1BC7C 1R58A 2CGPA 5E20A 4PDKA 5AIPA 1HW1A 2QZ8A 2ZCWA 1WSUA 4ASNA 2RGVA 1K7AA 1BOAA 3KP7A 4XLNF 2EV5A 1T39A 3ECOA 1IZ1A 2A6EF 1RUOA 3P9CA 2IVMA 5K5QA 5D5UB 5BPDA 3KLOA 4M9XA 1YW9A 3ISPA 2ZKZA 3JAMZ 3HIFA 5FLXK 5AONA 2ISZA 1KQ0A 1LVAA 3CDHA 3V8LA 4LD5A 5HS8A 3FXQA 2K02A 4RAZA 2IP2A 3U9GA 3SZPA 2NAZA 3TDZC 2IPQX 2P8TA 1TW2A 3HTSB 2L02A 2DLLA 2FMLA 5DCFA 5FGMA 3HSEA 3I59A 4LLGF 5IT3A 2XAJA 4ENJA 3E6BA 4Y15A 1XB4A 1XD7A 3LQRA 1S8NA 5LHHA 3L7WA 2LF8A 4S05A 2ACJA 3JAMK 1Y0UA 5DCMA 4U7DA 2VT2A 4M71A 2ZNYA 1PUEE 3JW4A 1W7PD 4HAMA 1XCBA 2Z3YA 4XBFA 1XGMA 2IA0A 3BWGA 1KYWA 2NRAC 3CUQC 1KU2A 1Z9CA 2XASA 1FBQA 5HDGA 2HQRA 3NQOA 3EUHA 4YG2F 2KIFA 2OU2A 4CYDA 3CUQB 4L5JA 3FXRA 5H20A 2VONA 1P92A 3GO5A 1NHAA 3TOAA 2M45A 2LF7A 3F8MA 3EYIA 1B59A 2IRFG 4RGSA 4OIPF 4ENMA 3RKWA 4AD9A 2DT5A 1FWZA 3GEZA 3I64A 5JHUA 2MH9A 3SFZA 2O03A 2PBIA 1EH8A 2GA2A 1KA8A 2IA2A 3BZ6A 1D3YA 3TO9A 2W25A 1GVJA 1HKQA 1TNTA 4U88A 3WTZA 4EJVA 1P2FA 1FNNA 3ZPLA 1LDJA 3KFWX 4MTEA 1BIBA 3KP5A 3R60A 4EQQA 2FBHA 3TKYA 2H09A 1UCRA 1FZPB 4BHPA 3GLXA 1J0RA 5IT9Z 2WTEA 4BAYA 3FM3A 3H92A 1ULYA 2JT1A 4HF0A 3ROUA 5L3EA 2GXGA 4OINF 4M9ZA 2P7VB 2HKXA 2OZUA 1U78A 2M87A 2FNAA 2CG4A 2H94A 1UB9A 2ZMEA 3E6CC 3D0SA 4BNCA 3WTYC 2ZXJA 3KEQA 1R5GA 3IWZA 1DPUA 2RVCA 4FT8A 1B9MA 2YR2A 1LJ9A 3ABTA 2ZO4A 2HZTA 3WGGA 2V9VA 2M30A 3T1BA 1BIAA 2K4JA 3EDPA 4AWXB 2UXNA 3WODF 2FXAA 4LG0B 1MGTA 3Q9SA 1ZGJA 4ZZLA 5LGNA 4KIGA 1G3WA 4WXCA 3F6VA 3QRFF 1IRGA 3FX3A 3IRQA 3MFKA 2C6YA 4F7ZA 1B1BA 1BC8C 4GXOA 1D8KA 4S04A 2PEXA 1SD4A 4LB6B 3P7NA 2JRTA 3WE2A 1ZAOA 4OOIA 3SHFA 4N0BA 2JZYA 1ZREA 3L9FA 1IN4A 1W5SA 2MH2A 4R1HA 4EV0A 3WGHA 4GCVA 3RPUA 4KYWA 3ZMDA 2OQRA 5LRSA 1FOKA 3L09A 1UFMA 2DQRA 4U0VA 1JHFA 4HW0A 2A68F 2QYOA 3W6JB 4ZYGA 3W6KB 1O3RA 3AAFA 1R5HA 2RQPA 5DCMB 1E2XA 3C7JA 2BV6A 1HXDA 2J5PA 2FRHA 4HZFA 2FE3A 1ZLJA 2VBWA 1FPQA 4EM0B 5LBQA 2FMYA 4LLNA 3MZYA 5LRRA 1FYLA 1R22A 4DQ2A 4A2UA 4Y17A 3WU1B 2VOPA 2XAGA 2VOOA 1ZG5A 4AVPA 2A5YB 4AIKA 4A5MA 2FU4A 3O2PE 4PZJA 2A07F 1YIOA 4RB0A 1YFHA 2M8EA 1VTNC 5ED4A 3IKTA 2NNYA 1W4MA 1LDDA 2YX7A 3DPLC 2A61A 2OZ6A 2L54A 3JTHA 4JQFA 1O3TA 2VE9A 4LK1F 4HX4A 1XSVA 1QO0D 3ZMUA 3BROA 4IF4A 3J81Z 5DV5A 1MJ9A 2BBYA 1F4KA 3LFKA 1GXQA 2K27A 1USSA 3BY6A 2MBFA 2KKOA 1YS7A 5DYMA 2ZJ2A 5E8IA 2P7CB 3F8FA 2D45A 3ZP5A 2OA4A 4KFCA 4MTDA 3HRUA 1JE8A 2PN6A 2OD5A 4L9VA 3QPTA 1SFEA 2EB7A 1BN5A 3ECHA 1I5ZA 1O57A 2B0LA 1YS6A 4M72A 2WWYA 2CQKA 1J5YA 4GYIA 3ZN0A 3ZN1A 3F23A 3WTUC 3LA2A 1IXCA 3F6OA 1QQIA 2DW4A 5DD4A 1ZYRF 3BJOA 3GZ5A 2L01A 3RYRA 2IW5A 1FYKA 1K78A 3TO7A 2COMA 5BMZA 5L3DA 1OKRA 1ZRFA 4HX8A 5ICFA 2VBYA 5L3BA 4BYYA 3DPTA 2JPCA 2JSCA 1YO5C 2WV0A 3ZQ7A 1LEAA 1X3UA 5CVRA 3GXOA 3MQ0A 3PQJA 2STTA 2VC0A 1MJBA 2GXBA 5CVUA 3MWMA 2GAUA 1T0FA 3FMRA 2Y0MA 1LB2A 1KU7A 4NHJA 4D0PA 1IN8A 3FXUA 1BM9A 3N4MA 1Z1DA 1YTYA 2W85A 4YFNF 2EA4A 4QLCU 3QOPA 2DTRA 2FQ3A 5FFXA 2CW0F 4IRHA 1HQCA 2DK5A 3I53A 1F9NA 4UXNA 4I02A 1XMAA 4A6EA 5E1WA 1LQ1A 2CSOA 1YLFA 1T98A 1RI7A 1B4AA 3CJNA 2RDPA 2EFOA 4OIQF 1P4XA 4YFKF 1OR7A 5E1ZB 3TDUC 3FMQA 4M9SA 2O0YA 4YIIA 1HKSA 5LEJA 3CTAA 4G94A 1V3FA 3DFGA 2RC4A 5JR3A 2QQ9A 1KGSA 1U6GA 1ZGAA 2G7UA 3QP5A 1XMKA 4ZYHA 4IPAA 1ZH5A 2M1BA 2EV0A 2KJBA 3IC7A 3WGIA 3HHGA 3LAJA 2XIGA 5A2QZ 4KA4A 1FLIA 5DUKA 4KNYA 2ELHA 5F64A 1TQMA 3RDIA 2EA2A 3RPQA 4B09A 3NEUA 2DPUA 2K7LA 1I27A 1O7FA 5IT9K 4HQMA 4LGWA 1IF1A 5HLIA 1Z6RA 1I1GA 1IW7F 1KYZA 4WX9A 1SD7A 3KE2A 4P96A 2VE8A 1DUXC 2ZBKA 5KVRA 1Z7UA 1XN7A 2FOKA 3RKYA 1IUYA 4LB5A 1WKMA 2HTSA 5ICEA 1HSTA 2FBKA 2GIVA 4KT5C 3I71A 5FFZA 1Z91A 3KP4A 2A3SA 4I01A 4FX4A 2P5LC 2O61A 1ZHFA 2QVOA 3U2RA 4HQEA 3F22A 3HUGA 4LG0A 3E97A 1IRFA 1KQ8A 1GXPA 3P9IA 3GUDA 4HF1A 4OIRF 1E17A 4ENNA 4L9TA 1OYIA 3KLNA 3C1DA 2Z99A 4U7BA 2TDXA 4QWQA 3JSPA 1J2XA 4I09A 4MGRA 1W7PB 3TOBA 1B9NA 4KMFA 1J9IA 4U0WA 4I2OA 3N97A 4A6DA 4I7HA 1EH6A 2MA3A 5D8KB 5E1XA 4KUMA 2PJPA 5ICCA 4BHCA 1F1ZA 3B73A 3VFZA 1D5VA 5LEKA 4EJTA 1RIOH 2GA1A 2BE5F 5D4RA 2J5OA 2W57A 3R0JA 2ZNZA 4KN7X 4PCQA 3KP6A 4OIOF 2LSOA 4WK8F 2FF4A 4OMYA 5D5XB 3KZZA 3QAHA 5J8CA 4KN4X 3BJAA 1BI3A 4L5IA 2DU9A 4IVNA 2JTVA 1T38A 2KRFA 4CXFA 2Z9OA 5CJ9A 2XAFA 5FB2A 1MDMB 4Y13A 2RV8A 4ETSA 4NQWA 1EH7A 5HLHA 2O6GE 2EV6A 2ETHA 3MZHA 1TNSA 3DEUA 1Z6TA 3O3KA 2ISYA 4M6YA 2Z5UA 2JPBA 3GW2A 5KK1A 3M9AA 3FF5A 1FC3A 4BXUA 1FP2A 3HYIA 5CLSA 1RUNA 5ICGA 3IKVA 1HW5A 2HR3A 3IRRA 1MZBA 1GHCA 1MDMA 3J81K 4G9YA 3LSTA 2LNBA 4JK1X 2EFQA 1REPC 4CICA 5BQTA 2D1HA 3GYHX 2DBBA 4RGXA 2AS5F 1YYVA 2XKPA 3MEXA 3COAC 1YW7A 4HF2A 1HBXG 4L9JA 3GFMA 4MQVA 1PP8F 4BH9A 1OMIA 2HWVA 4A0XA 1ZRCA 4IHSA 3K1NA 1Q1HA 4XSZF 2DFIA 5D5VB 5D5WB 3L2CA 3V7CA 3FZVA 4A5NA 3M8EA 3REOA 1H9TA 1FBSA 4WCGA 2R3SA 3CLOA 1TW3A 1HW2A 2O3FA 2OBPA 3R6SA 3MAJA 4O3MA 2F5FA 2G7HA 3R4KA 3SXYA 2P6TA 1PP7U 1B6AA 4Q4ZF 4EM1A 5L3GA 2LDUA 4R8HA 1UHWA 1W5TA 4OU0A 1WQ2A 2PLYA 1R36A 3KP2A 4ZYEA 2STWA 1MKMA 2HDCA 5DEQA 4EGZA 3KETA 2RN7A 3DP7A 1BBYA 5BS6A 2X0LA 4IHTA 3ML6A 3K0LA 2ESNA 2QQBA 4AIHA 5F1RA 3DXJF 1XDSA 3F3XA 5K5RA 5BOXA 1AWCA 3BDDA 1ZARA 1YG2A 2IT0A 2P6SA 2ZFWA 3GFJA 1JXSA 3Q5FA 2XGXA 3SQNA 3WG9A 1CGPA 1ODDA 1T6SA 5EEGA 3T8TA 5HLGA 1S7AA 3ZMTA 1KU3A 2VXZA 2FEZA 4WXDA 3E3VA 3VB2A 5J8FA 2XAHA 2VODA 4HBLA 3HHHA 4HOBA 2FNPA 4EJWA 1YQAA 4CZZA 3V7SA 5D8LB 1QBJA 4A0ZA 4ZYDA 3QP6A 1FBUA 2RNJA 1BI2A 5ERIA 1TQPA 5H6QA 1R7JA 1K6OA 3KZYA 1J75A 4N9IA 4G7HF 4ZH4F 5DUIA 4XSXF 4UUVA 1EV7A 1S3JA 1P6RA 3ERED 4U0YA 3B02A 3E6MA 1R00A 4HX7A 5CVIA 4WF2A 1S7OA 4RB3C 4EJOA 3M8FA 2P5VA 5D6EA 1CF7B 2H6BA 2OQGA 5LGTA 3IL2A 5FD5A 1CF7A 1SMYF 3ELKA 2A6HF 3DF8A 3CO7C 2CWEA 2Q2EA 3I0TA 3G3ZA 2K86A 1YW8A 2YPRA 3I5UA 2VBXA 3HRTA 3K1PA 1FYMA 1IN5A 1QZZA 2QENA 2EFWA 4LK0F 5DDGA 1XGNA 4LFUA 4KIFA 4GGGA 2RKHA 4H0EA 3E5XA 3WU0A 2HTJA 5J6XA 2R7FA 1ZLKA 4B8XA 1LNWA 2NNNA 3I54A 1LDKB 2Y48A 4Q48A 3F8BA 4HV5A 1IXSB 2YSRA 4P5OA 2DPDA 4TV7A 3SZTA 3ULQB 4HLYA 2Q0OA 3S2WA 5LHIA 1FSHA 4CO8A 1G3YA 2O8XA 1BI0A 3OOPA 2YX4A 4MEYF 5E8GA 3RIRA 2CYYA 1O3SA 1HSJA 2AXLA 2CO5A 4G6DA 3LAPA 1O3QA 4G8XA 2UWMA 1H0MA 3F8NA 1TQIA 1TTYA 2BGCA 3WTSC 1IAWA 1RNLA 5HS7A 3J80Z 4I0BA 2XROA 1XCVA 1J7KA 3V7RA 2X4HA 4HDVA 2EFPA 2V6CA 4RGUA 2FA5A 3EETA 1AOYA 2IJLA 3V8JA 1G4DA 3P9KA 1SAXA 4EM2A 3DQVC 1FP1D 1U8RA 1IXRC 3WTWC 5FO5A 3BJ6A 4GO1A 2F2EA 4NB5A 4Q47A 4LLLA 1L0OC 5E17F 3TQNA 3H3ZA 5DD8A 5D4SA 1OPCA 1HKTA 4O6JA 2EK5A 5BPIA 1KQ9A 5D6FA 2PQ8A 4RB2C 4P9FA 4I0AA 3TGNA 5HDNA 2HGCA 2QUFA 3MCZA 4IRIA 2KJCA 3V8KA 1ZG1A 2ZMEB 1ON1A 3K9TA 4HYEA 3HOTA 4RAYA 5CVVA 5LGUA 2PMHA 4L0YB 3HRMA 1QZYA 5HOOA 2PI0A 2FBIA 4ON0A 1QPMA 1R1TA 1O7LA 1IN6A 3F21A 2UZKA 4O5VA 4DNCA 5FLXZ 1H9GA 2Z33A 1BJAA 3T5XA 4RS8A 4BHBA 2DQLA 1U3EM 5K1YA 1SMTA 5H6RA 4KICA 3LQQA 1MD0A 4CHUA 2HYFA 1XSXA 4IJAA 1S6LA 1DP7P 3WTVC 2ADUA 4M6XA 3J7AO 1ZG3A 4UV8A 1G3TA 1I1SA 3T8RA 1R23A 4WWCA 1SD6A 3BOQA 4LJZF 2UXXA 1S29A 3KP3A 4L9NA 4MEXF 1XGOA 4UV9A 3R0AA 5HS9A 3OV8A 3I58A 2HEOA 1Z05A 2IA1A 5TJJA 1BI1A 2P4WA 3CUQA 3GVAA 1SD5A 1R1UA 2HS5A 2EFNA 3KCCA 2PMUA 2E7WA 3FHZA 2XHKA 3EYYA 2PG4A 1OYWA 1J59A 1ON2A 3NRVA 5CVJA 4CDGA 5HDKA 5HVQC 3HSFA 3JSOA 4HA8A 4ESJA 3K2ZA 6PAXA 1P4AA 3FWEA 1L3LA 2W24A 1TBXA 3LWFA 1P4WA 3VEPA 4ESBA 2MD5A 1FT9A 2HFHA 2DO7A 3HOSA 2V1DA 3RTRA 1I6XA 3VODA 3IHUA 1C0WA 4P55A 4LMYA 3L00A 4Q5SF 3BPVA 3F8CA 4ENKA 5JVTA 1XGSA 2YU3A 3QPHA 2QLZA 5ILSA 3HRSA 3H3UA 4XLPF 1SFXA 2HQNA 1U2WA 1W7PA 3I4PA 5ILUA 3WTTC 2QWWA 3WTXC 3G73A 1WRJA 2F5CA 3GF2A 4PGHA 1TLHB 4I98B 5CYVA 1MJAA 1DPRA 5F6FA 3TO6A 2E1CA 3K69A 4EGYA 2OAZA 1IN7A 4Z2YA 4HLXA 4ESFA 1FX7A 3O6BB 3T0YA 1DDNA 5AIQA 2P5KA 3GWZA 5JFRA 1OYYA 2K4BA 5A2QK 5TRDA 3R61A 2BEOA 4XRFA 5LLQA 3F72A 3VOEA 3GFIA 3GZ6A 2F5EA 3EQLF 3ZMVA 1USTA 4HDUA 4G6QA 1XDUA 2XRNA 2QBYB 2BYVE 3ABUA 3QU3A
chains in the Genus database with same CATH superfamily
3ZVVA 3DTKA 4UUSA 1X4PA 3FM5A 1G6NA 2DA3A 2DMUA 4OMZA 5EF6A 2H27A 1M1EB 1U5TC 4UHTA 1UN8A 2V1XA 3FUKA 2DT6A 2F4OB 2VJ8A 3L2RA 4G7OF 2G9WA 1H6KA 2LY9A 2CFXA 2VPLA 1KZPA 2LC2A 1OISA 4RAGA 4IO9F 3J5PA 3HXDA 3PRZA 1Z21A 3OYDA 3ZQQA 1PC2A 5KBAA 1QGPA 3TL5A 2HI3A 2ESHA 2HYGD 3K1MA 5J47A 2R05A 1U5TB 3RI4A 1SFUA 3JQ0A 5FQ6A 4CCLA 2CH0A 1XTAA 5KHDA 4BY1J 4F91B 4WXHA 2F5DA 3LA3A 1T2KA 2L4MA 4DZJA 5JI6A 1YOVB 3CC4I 4L18B 3L2UA 2L4AA 2DAOA 3G2SA 3HTUA 5CHEE 2QQAA 3G2UA 2B7EA 3E5UA 2GZWA 3GFLA 1X81A 5AQAA 2EZIA 4N5QA 2OC6A 3Q4AB 3PO3J 3WE3A 4M7CA 2XV4S 4JOMA 2P9UG 4YFXF 2K85A 4GA1A 4PK4A 2MLKA 2R4GA 5EEHA 5L3CA 1X5BA 3BG0B 4OAUC 4C2MJ 4J00A 4N5CA 4NURA 2E1NA 2PJRA 4UNOA 1TNBA 4HNTA 2NS0A 1HF8A 3FTUA 5C1DA 4EVIA 3PFIA 3DV8A 3E6DA 3ZHEB 3OR2C 3DLAA 3DKYA 4FHTA 3M7GA 4QPQA 1TNOA 1TNYA 2OCCE 3VLDA 2DK8A 4RB1A 3ABKE 3UKRG 5L3FA 5ANLA 1ZN2A 4WWOA 3P2BA 4YVOA 2XVCA 1V4RA 5F0FA 2LXMA 4GYGA 1AKHA 3I56I 4ILHB 1OCZH 3I3LA 3RAUA 4C3JJ 4G7ZF 3SFXA 1WDYA 4HV6A 2Y75A 4UVAA 4IYPA 2R7ZJ 1VQ5I 1U3DA 2D1VA 4HFGA 4A12A 1H6OA 3LJ3A 5E3NA 3HSRA 4TRQA 2HR2A 3RYPA 2IFUA 2EJRA 3UKUG 3LA7A 5KWDA 2DXIA 1SC7A 4ZHBA 3ML8A 1JGSA 3JTGA 1QRYA 3I59B 2B0OE 5JHFA 5IPAA 3ZXPA 1YX5A 5LHGA 2R7SA 4JVSA 2DODA 2IONA 3Q9VA 4TXQA 2NYXA 4R79A 1IV6A 3D5LA 3E34A 3TWWA 2R5ZA 3M1EA 3TAXA 5BV1A 3GZNB 1RPWA 5IOZA 3LSHA 5K5OA 1TC3C 2KIUA 1SVLA 4KDPA 1WWXA 2HZDA 1B89A 2F6CA 3C18A 3W9GA 2Q8KA 3BPXA 4ZZDA 1VQ6I 1WAO1 1ITYA 1HLVA 3ABLH 4E70A 1E8ZA 4QPOA 2PFBA 3S3NA 5FD6A 2DYRH 2GQQA 3E5QA 2R02A 4A3KJ 1OWNA 3CEQA 2GM4A 4EJUA 4DX2A 1N94A 4A3GJ 1UJJA 2VQHA 5C44J 2H6CA 3QYEA 4KMUX 4K2EA 2V0PA 5FKKA 1FOWA 5GPCA 3ZRHA 3SD5A 2OJED 3I3NA 2VC1A 4PJNA 5EJCA 4PS7A 4U0UA 2LBFA 1WI3A 1MMSA 2D2WA 1K3ZD 5EZHA 3V30A 3WXXA 2FJ1A 3HVEA 1UHMA 3CHQA 4CYCB 1R1VA 2R7DA 4MHGA 2HKOA 3L2VA 3ASHA 3V79K 4RM3A 1SVMA 2ME0A 1JHHA 1K79A 2Z1DA 1ZRDA 1FY7A 1KPSB 4AY5A 4FX0A 4PGGA 3KSLA 3BR5A 4XE0A 2VBZA 2XAQA 3CO6C 4HOTA 2LKPA 2ECCA 2JK3A 3RPUD 1ZR2A 4N9HA 4TUUA 1OFCX 2PNNA 1IGNA 5G05C 5E18F 2WC2A 4IXAA 4M74A 3Q79A 3TWTA 4N4OB 1S72I 2V1NA 2XUBA 5FKLA 4P9UA 4DX5D 1STZA 4P1WA 3PFYA 4EMSA 2VASA 3AS5A 2LRDA 3A01B 1NK2P 4L2YA 1ONVA 3BP8A 3JCUC 3U1DA 3QK0A 1G3SA 1N95A 2L3DA 3IHVA 4GB9A 2ZGDA 4DX6D 5ILVA 1YJNI 2VIXA 3D3MA 4BQAA 3PNLB 3A4CA 4O6FA 4RGRA 2W84A 5HQ8A 2EWNA 4CGZA 2QA4I 1XSDA 4MNUA 3GX4X 3NWTA 1LEBA 4IL6C 2R59A 4EBAA 4UVCA 2KIMA 3LS8A 3DKWA 1JUPA 3D9OA 2EQXA 4HLLA 1WI9A 5EILA 3DXMG 2QM3A 1SA5A 1TWGJ 1FSEA 3QU6A 4MLOA 2V4HC 3JREA 3B7TA 2DI3A 2V79A 3NBNB 1F5TA 3LVRE 2M5WA 4FLBA 1I3AA 3FXOA 1RZ4A 3QQAA 3ONKA 2KIQA 3J80K 2V1UA 1K78B 2PQNA 3FMSA 4JBAA 3C3WA 1YCSB 2A69F 2NVQJ 1XS9A 4MQ9F 3PQKA 1TZLA 4IRGA 2CFUA 4L0ZB 3KEOA 4XN0A 1A04A 2QY7A 3IWFA 3CKCA 1K6YA 2DT7B 4LG3A 3FDHA 4UWKA 3K70C 4M3DA 2XKOA 1E0EA 1H0AA 2OCEA 2BVMA 4G24A 2LH9A 3FHNA 4J8DA 3CUOA 1PYVA 1YHQI 2HOEA 2E7XA 2VT3A 5GTIC 3FTZA 4O1OA 1R9TJ 1MX2A 3OYKA 2LK2A 1G3NB 4U04A 1U5TA 3K4NA 4AIJA 1IC8A 3KSQA 2LKXA 2FSWA 5AJLA 1U0JA 2CUZA 1WJFA 4UVBA 2ETBA 1SVOA 4PS8A 3X2QE 3AG4H 4V2FA 4YIFA 2WQ7A 3ZMZA 3RKXA 1PDNC 2MC3A 2IGKA 2GWRA 1IDYA 1D5YA 4JYKA 4A0YA 3CLQA 3RJPA 2VSXE 3HOUJ 2E1MC 1QNTA 1UOHA 2HQ5A 4PSWA 4UUSB 3PDNA 4CRWA 2VN2A 3J7YJ 1V55E 2F37A 3TXNA 1XNFA 2MGQA 4D5CA 5JHAA 2MLGA 3V4GA 2DYRE 2QBYA 4X8QA 5B3SE 1KU9A 1D8JA 4KIBA 3ZMSA 3VPRA 3AG1E 2JVHA 4M73A 2WB1A 3DSTA 1BC7C 1R58A 1Z7LA 2CGPA 2KT0A 2W48A 5E20A 4PDKA 5AIPA 4BUPA 2E2JJ 2HQAA 2XHEA 1HW1A 1UMQA 2DA2A 3OYIA 3FTVA 4J01A 3PUBA 3FISA 2P9KG 1RESA 1MBHA 2IGOA 2RD0A 3N71A 4BETA 2QZ8A 2ZCWA 3GTMJ 1WSUA 5CCMA 4ASNA 2L7FP 2RGVA 1FVHA 1K7AA 3KIOA 2CRGA 4IQ4A 1FT2A 1WY6A 1BOAA 2XRYA 3KP7A 4XLNF 2EV5A 5EEAA 5F27A 3HXBA 4YDEA 4ABZA 1T39A 3ECOA 4XI9A 3A01A 1IZ1A 4BKXA 1N75A 2A6EF 1RUOA 3GTGJ 3P9CA 2R5SA 1UG0A 2HPMA 3ESKA 2K5CA 3UM2A 2IVMA 5K5QA 1SA4A 2MYOA 4DZPA 5D5UB 3W6VA 1NK3P 1VQ8I 1JKPC 5BPDA 3SGHA 5B1AE 4XQFA 1XMXA 3KLOA 4M9XA 3OYLA 1YW9A 2OCCH 3L6AA 2XGEA 1OWMA 3LYAA 3C5RA 3ISPA 3CIAA 3CJRB 3H9QA 1OCRH 4A3JJ 4WAFA 2LBFB 1Y1VJ 1V54E 2ZKZA 3JAMZ 3LJNA 3HIFA 4ATZD 5FLXK 4AEZC 3SZGA 2QF7A 2XB0X 3M1CA 5AN8A 3F6QA 3A2KA 3SDBA 5AONA 1VQKI 3Q9UC 4PSXA 1KQ0A 2ISZA 3NAUA 1DP3A 2M3AA 1LVAA 3HB9A 3PM1A 1ELWA 4FC8A 3CQGB 4GZCA 3CDHA 2WXLA 3V8LA 2EPFA 4LD5A 1E8WA 3IKOB 5GP9A 2AVPA 2K9LA 1MMAA 3BTLA 5GADJ 5HS8A 1X1DA 3FXQA 1H2VC 2K02A 3ABME 3UT8A 4RAZA 3UKGA 1IG7A 2IP2A 2GOXB 3U9GA 1QQEA 4BSXA 3SZPA 2NAZA 3PSFA 2IJGX 5EIBE 3TDZC 2IPQX 2P8TA 1TW2A 2EILH 3RCOA 4XM3A 4YRVA 2WPVA 3ZGQA 3CVVA 3HTSB 2CFZA 2L02A 2DLLA 3IH3A 2XPVA 1UN9A 5G04J 4O60A 3Q0WA 4GTVA 4AVZA 2FMLA 2PMZA 1SANA 3I4MJ 5DCFA 3UM0A 4B8CB 4FADA 1MIJA 5FGMA 5GAHJ 2XGSA 2RAEA 1JGGA 4UB8C 5C4XJ 2DMQA 1OCOE 1PAQA 3HSEA 3KAEA 3I59A 4LLGF 5IT3A 3SFYA 2XAJA 4Z6YA 1OWOA 3RZOJ 3QOUA 4ENJA 1ETXA 3E6BA 3GTOJ 4Y15A 1XB4A 2F48A 2DVWA 3FDYA 1XD7A 2CHXA 3LQRA 3GYZA 1S8NA 2LYCA 3E33A 1MSFC 5LHHA 1UJKA 3L7WA 2GRPB 3F9KA 2JEKA 1MJ0A 2WM9A 5GTHC 2LF8A 4S05A 3EIJA 3CVWA 1LF8A 3ZUVB 1MQSA 2ACJA 3ZGKA 1R71A 1XX5A 3S1RJ 1GV5A 1AKHB 3BR1A 3JAMK 3PUJA 2FD5A 4E7ZA 1SFKA 1Y0UA 5DCMA 2B9SA 4AYBA 4WNFA 3IEGA 2JJ7A 4U7DA 1NP7A 2GROB 2Y3AA 4UQXA 4CUGA 2VT2A 4M71A 5M5WJ 4YDOA 2ZNYA 1PUEE 1NA3A 5ENOD 5BXUA 3JW4A 1E8YA 4D7NA 1W7PD 2L6BA 3VDXA 4HAMA 5DM6F 1XCBA 4PJJA 4MBGA 2Z3YA 4XBFA 4BE0A 1XGMA 1S64A 2AHQA 1V5FA 2IA0A 3BWGA 1E3PA 1FOYA 1FOXA 2OEWA 4B89A 1QPIA 1KYWA 2NRAC 3BCAA 1V5EA 3CUQC 1TR4A 1KU2A 4BJ6C 3KEAA 1Z9CA 3PJRA 3C98A 3QAQA 2XASA 4GZ3A 2JVGA 1DGRM 1FBQA 3MJWA 3TL4X 5HDGA 4E4HA 1RR8C 2HQRA 3NQOA 1X1PA 3EUHA 2MABA 4YG2F 5KAIC 4LUNU 4RG9A 2KIFA 4L5EA 2OU2A 1H19A 1N11A 3MV3B 3MZLB 4CYDA 1N0RA 4E7JA 3CUQB 4L5JA 3D1NI 3PNTA 4OYSA 4GTMA 2XF5A 4JX4A 3FXRA 4CCMA 3HC7A 5H20A 2VONA 3DSVA 4XKVA 1P92A 4PJMA 3GO5A 1NHAA 2ZXIA 3TOAA 2H6FA 2M45A 2LF7A 2QYJA 2VJ5A 5FRMA 3ZEFA 4BXXJ 3F8MA 2DMPA 3RIBA 2DA6A 5CBOA 3RQIA 3EYIA 3CCMI 3HZJA 4BESA 3S3OA 1B59A 1IDZA 2WXGA 5IYDJ 2NVYJ 2NXPA 2F0YA 2PX9A 5IP6A 2IRFG 4RGSA 1TWHJ 2HDWA 4OIPF 1OCZE 4ENMA 1YJ9I 1SQMA 1K8KG 2X1CA 3RKWA 4AD9A 3UIOC 1J09A 3FUJA 2I8DA 2WAEA 3AU5A 2DT5A 3CK9A 1FWZA 3GEZA 3I64A 2NXNB 5JHUA 2MH9A 3SFZA 2XGDA 5JHBA 3AG2E 1UZCA 2O03A 2PBIA 1EH8A 5D0OD 4JX6A 3TJPA 3CR3A 1NTCA 2GA2A 3V42A 2IO3C 3ONLA 3LY7A 4JZYA 3Q15A 4E6KG 4HNVA 1KA8A 2ELJA 3TP0A 3L2WA 2IA2A 3BZ6A 3VLEA 1T95A 5ENRD 4JP0A 3JRGA 3M4OJ 1LE8A 5HODA 1D3YA 2DJIA 2W25A 1GVJA 3TO9A 3PH0C 1HKQA 4XLHA 1TNTA 2P9SG 2ZIRA 2JSPA 2KLOA 2R5YA 2HDDA 2RQQA 4HOQA 4B47A 5BXOA 3HOWJ 4NBQA 4U88A 3W2WA 3WTZA 4EJVA 3QDNA 2H1LA 1P2FA 4U87A 3FKJA 4H7YA 3C2HA 3CVNA 4A1SA 2IEKA 1JCQA 2LFBA 3WU2C 1FNNA 4E7LA 3ZPLA 1LDJA 4PDXA 3CF5F 3KFWX 4MTEA 4U95D 3IBEA 4K5AB 3RSNA 1BIBA 3G71I 5F0CA 4F52A 3KP5A 2OTLI 2VGEA 3R60A 3BQOA 4A3TA 4PS3A 3ZNGA 3QPSA 1NG7A 2HM8A 4C0EA 2F4MB 4EQQA 4WNDA 3URZA 4LNBA 2FBHA 3TKYA 2H09A 1UCRA 5KNLA 4C48B 2J07A 4GYYA 4UQZA 3L16A 1SZ9A 1SFOJ 1FZPB 2WXHA 2JRMA 3SO8A 2HOTA 1MMNA 1UJ8A 3DRAA 4ILIA 4KYOB 4BHPA 3GLXA 2RFAA 3OS0A 1J0RA 1EA3A 5IT9Z 2QC9A 4PFOA 3CDIA 4YNDA 2WTEA 4BAYA 3HJEA 3FM3A 3H92A 1ULYA 2E71A 3G2VA 2JT1A 1Y56A 3V2OA 3TWUA 5CQGA 2I2OA 4HF0A 4E7IA 5ARFA 4U07A 3D9JA 3S15J 2Y9YA 3QODA 4FQGA 3ROUA 3JRIA 4ZDLA 2JA8J 3VSKA 2FULA 2IOSA 2J49A 4NRHB 3BR3A 1KZHA 4RLYA 4M6VA 5L3EA 2GXGA 4OINF 4M9ZA 5DS9A 2RKKA 3K4CA 2I5UA 1QBQA 4ZDOA 3LSIA 5EGOA 4M3GA 3Q0UA 3AG3E 2P7VB 3CDLA 4QTRA 1HCRA 3JXIA 4CDRA 4TXPA 2HKXA 4A3BJ 2OZUA 1U78A 2M87A 2FNAA 4XL9A 2CG4A 2H94A 2Y69H 1A6IA 3ABMH 4XKBA 4I2ZA 3ASNE 5FZRA 4F7AA 3LSRA 2YUSA 3ML9A 2V6EA 4X1EA 4OVUA 5BV0A 1UB9A 1WJDA 4QIWN 4XOTA 3D9HA 4Y7NJ 2X6XA 2ZMEA 4CT0A 2XZTG 3E6CC 4I1MA 3D0SA 3MGBA 2R5YB 4BNCA 1MMGA 3DEPA 3BT9A 2PQRA 3FULA 3WTYC 2ZXJA 5AIJA 4N2SA 1VQOI 4GA2A 2L7ZA 5HNFA 4HORA 4BXFA 3CCUI 3KEQA 2BW3B 1R5GA 3IWZA 5J3LA 5EYRA 1ZB1A 2Y0SN 3CVXA 1BU9A 2WB1N 2WXQA 3BR2A 1UHSA 3CVLA 1Z67A 2KZGA 2W4SA 3ZQHA 1DPUA 2RVCA 3OYJA 4FT8A 3RU0A 1AA7A 2XAUA 1HG2A 1B9MA 2YR2A 1LJ9A 4CA0A 4E7KA 2R7XA 2XS1A 4MRUA 3ABTA 3CHMA 3I4RB 1JT6A 2HZTA 2ZO4A 3PS6A 5FIOA 1N4SA 3WGGA 2X6KA 1TJCA 2DOEA 2V9VA 3DTIA 2M30A 1DGWY 3T1BA 3QKYA 2EIKH 3OIPA 3PEVB 3TBIA 4QQIA 1BIAA 5LD2C 4XZ4A 2K4JA 3B13A 5ENQD 1BOBA 3EDPA 2KDOA 4CCJA 3VYRB 4AWXB 5T4YA 3OYEA 2WXMA 5M3FJ 1XC5A 2UXNA 3T5VA 3WODF 4N3CA 2FXAA 4C2TA 1HX8A 4LG0B 3HUGB 1MGTA 2XRLA 4U8YD 3Q9SA 4CDNA 1ZGJA 4ZZLA 3BCBA 3HM5A 2YS9A 4KIGA 5LGNA 1G3WA 4WXCA 4YEJA 3OSFA 1Z5SC 4FLHA 3F6VA 3QRFF 1IRGA 3FX3A 2P81A 3MFKA 4W1UA 3IRQA 1ZU2A 2C6YA 1SW6A 3B6CA 4F7ZA 3W2AA 2R17C 4DK5A 1B1BA 1BC8C 1YA0A 1R6RA 1D8KA 4GXOA 1FMVA 4S04A 4DYQA 2PEXA 1SD4A 4LB6B 3P7NA 2O9LA 2JRTA 2OUMA 3FP3A 4DOZA 3FK7A 3K4JA 3WE2A 1ZAOA 4OOIA 4OWRB 3SHFA 3LMMA 4N0BA 3CCVI 4DBRA 2XCBA 3D9KA 5FT9A 4G25A 2IO2C 2JZYA 3WG7H 1ZREA 3EU9A 3L9FA 1IN4A 1W5SA 4L7TA 1JPLA 4CDMA 2MH2A 4BACA 4R1HA 2HYZA 4XIFA 3CSTA 1CQTA 4EV0A 3WGHA 2JWTA 4B48A 4GCVA 3RPUA 2YHEA 2J08A 1PJRA 4U96D 3U64A 4KYWA 3ZMDA 2BY1A 2IXSA 3IH4A 1N77A 5FQ8A 2OQRA 5LRSA 3RZDJ 3L09A 1FOKA 4BJTA 1UFMA 2DQRA 4U0VA 3LNQA 3CMYA 5CECB 1JHFA 4HW0A 2A68F 2QYOA 3W6JB 4ZYGA 3W6KB 3AG3H 1O3RA 4CSWA 2P9PG 2Y2ZA 3UX4A 3AAFA 1R5HA 2RQPA 2XEEA 5DCMB 1E2XA 3C7JA 2I1KA 2BV6A 3I55I 1HXDA 2J5PA 3PIOF 2UWJG 2DA5A 2FRHA 4UUTA 4HRNA 4HZFA 4DX7D 2FE3A 4BEHA 2L7KA 1ZLJA 3ASOH 2L0TB 2VBWA 3PNVA 3AJIA 5A7DB 1FPQA 1S7EA 2GBYA 4XX5A 3TWSA 4EM0B 2X1DA 3M8JA 5LBQA 3LEWA 2FMYA 4LLNA 3PZ3A 3H35A 3MZYA 5LRRA 1FYLA 4B93B 3VYSB 1R22A 4DQ2A 4BBSJ 2WXNA 1UELB 4WWPA 3S7BA 4A2UA 2DIWA 4Y17A 3WU1B 2VOPA 2XAGA 3BZKA 5FROA 3OSGA 3FU0A 2M4GA 2VOOA 3OL3A 1TNZA 1ZG5A 3NQPA 4AVPA 3H9GA 3SBTB 3RK6A 2P0WA 3OWTA 3HGYA 4AIKA 2KZTB 2X6HA 3AU4A 3ZW3A 3QWLA 4A5MA 5C2YA 3CCRI 2FU4A 3FH8A 3CQZJ 3HKZA 3O2PE 4PZJA 3E30A 1ZK8A 2CV0A 2A07F 3NF1A 3MVPA 1GV2A 4ACKA 4ACLA 1YIOA 1WJEA 4KITB 4RB0A 1YFHA 1OWPA 3A0BC 2VQGA 1LKXA 1N54A 2BHYA 3MKLA 2M8GX 2NSZA 1QVUA 4KISA 2LLKA 2XPZA 4G23A 5EKQD 3DBRB 3R9MA 2M8EA 4KBQA 1VTNC 5ED4A 2CW7A 4G26A 3IKTA 2QQ8A 2NNYA 4XLCA 5DBKA 2M9HA 1B8IB 1OCTC 1W4MA 2BTDA 1LDDA 2Q2EB 2YX7A 3DPLC 2A61A 1S70B 1JJ6C 3EJNA 3D5RC 2OZ6A 1H6PA 1LFPA 4NDLA 3G6EI 4AVXA 2QFCA 3G1MA 2DFHA 2HXIA 2L54A 5GPAA 2XGCA 3JTHA 4JQFA 1O3TA 3B7RL 3MX3A 2VE9A 4LK1F 2C0LA 4HX4A 2WAFA 3TXMA 3TMOA 3DTEA 2ID3A 2R92J 1XSVA 4EEFG 4MKTA 1QO0D 3JRDA 3ZMUA 3BROA 3GCMA 4IF4A 3Q75A 4B3AA 1MZCA 2LOOA 2W00A 3J81Z 5DV5A 1MJ9A 2BBYA 4XLAA 3LFKA 1F4KA 2VSOE 4YVQC 2P9NG 4C0MA 2L9NA 1MNMC 1EF1C 1GXQA 2K27A 1USSA 1OY3D 1VI0A 3BY6A 3O8GA 2L9VA 2MBFA 2R7OA 5J1RA 1P9QC 4GTPA 2KKOA 2V26A 4LOCA 5TGTA 2CG2A 3CQCB 1YS7A 5DYMA 2ZJ2A 1JJ8C 1D0ZA 5E8IA 2P7CB 2WXOA 5AARA 5BW8C 4ITVA 2VUMJ 2KC7A 1OWLA 3F8FA 1ZQ3P 2D45A 3ZP5A 3HDDA 2OA4A 1NL4A 4PJLA 2C2LA 2GRMA 4J8YA 3FU5A 4KFCA 2UY1A 2IS2A 2HNHA 5J90A 2NVUB 4MTDA 5IY5H 1YYHA 3HRUA 4FJZA 1JE8A 2PN6A 2OD5A 2BXZA 3DPDA 4L9VA 3UUXA 4ZFHA 2EH3A 3QPTA 5BPPA 2EIJH 3OS2A 1JUSA 1OXJA 1I6HJ 1FVFA 2CV1A 2KBXA 3HYMB 1SFEA 2EB7A 1E90A 3OYFA 4FU3A 4N39A 4EZLA 2WB2A 1BN5A 4XICA 2MG4A 3ECHA 3JUEA 1IYGA 2L9BA 3TEDA 2EBIA 1HFAA 1I5ZA 1MBGA 3LSKA 1O57A 3S7DA 2HPIA 3C72A 2B0LA 1YS6A 4M72A 4HB5A 1WCMJ 5DM7F 2WWYA 2CQKA 2WXIA 2ZGGA 4LERA 1EF4A 2WQHA 2YINA 1J5YA 3SEZA 2QCOA 2PM7A 2WMOA 3AG4E 4GYIA 2Z16A 3ZN0A 3ZN1A 2VSYA 1OCCE 1S63A 3WTUC 3F23A 5CCLA 3LA2A 4BJ5C 1BJZA 1D0YA 1IXCA 1W36C 1I39A 3F6OA 2H8RA 2IS6A 4GA0A 4B0ZA 4DYRA 4ZDPA 4JXTA 2E1OA 3UINC 1QQIA 2DW4A 5DD4A 3UT4A 4B8AA 1ZYRF 3AAAC 3BJOA 3GZ5A 5B1BE 1T56A 2LKSA 1MBFA 1D1CA 2PM6A 2V4LA 4U0SA 5M5YJ 3CESA 2DDAA 2JQ7A 2L01A 3RYRA 2IW5A 1ELRA 1ORKA 3PNYA 1FYKA 3ULYA 2HVQA 1K78A 3K4KA 4GYOA 3TO7A 1OCOH 2ETAA 3ASDA 4XRSG 2COMA 1NH3A 1U3CA 2H6IA 5GAEJ 4I6GA 5BMZA 2K9SA 3ASNH 1OKRA 5L3DA 1ZRFA 2XQ0A 4HX8A 3H5AA 1MHQA 2WMNA 3FUIA 5ICFA 3J5QB 4XRSA 3LOCA 3EUKL 1MX6A 4GMLA 4I17A 2VBYA 2R7TA 5L3BA 4J8FA 2MRIA 4I6EA 2ZMEC 2VI6A 4BYYA 4UWLA 5CPRB 2MHKA 3BEEA 2L7MP 1ZTRA 3H9JA 3DPTA 1WJAA 2AO9A 1YI2I 2VQCA 3BG7A 4QFVA 5T3RA 1UW4B 3G4SI 2XGOA 2PMZN 4A3MJ 3DXKG 4EZKA 2JPCA 3K4BA 4O1PA 1JUQA 3ZYLA 2JSCA 3HOVJ 4FJYA 3SF4A 4B44A 2ZC2A 2EZKA 1SEUA 1UAAA 1YO5C 5D2MC 2WV0A 2H6HA 3ZQ7A 4J6IA 1LEAA 5H2FC 1X3UA 3EPZA 3W9FA 5CVRA 3GXOA 3MQ0A 1TT5B 2JN6A 3PQJA 1HDDC 4F55A 1FPPA 2STTA 2GRQB 2VC0A 3LCAA 1MJBA 2GXBA 1MH3A 5CVUA 9ANTA 4RA2A 3VSLA 1OCRE 1IUFA 3MWMA 4UI9K 2GAUA 1DU0A 1T0FA 4A3DJ 5D0QD 3FMRA 2Y0MA 1LB2A 1KU7A 4NHJA 3S1QJ 5IYCJ 5DIZA 4W97A 4XLEA 1ETQA 4D0PA 4ZTJA 3HVEB 3L13A 4IRUA 4PUCA 1R49A 1IN8A 3ZCOA 3FXUA 1BM9A 2Y30A 4XORA 2R7VA 4GZDA 2OF7A 3N4MA 2W7NA 2J09A 4L9PA 1XG1A 1Z1DA 2TRTA 1YTYA 3EUVA 2W85A 4C9YA 3EHNA 1HC8A 4YFNF 4B43A 2EA4A 2RNGA 5HS0A 2AQFA 4Y6WA 2MW8A 2KISA 2LVSA 4K0RA 5ITZF 4QLCU 3FXMA 3QOPA 1LPQA 2DFEA 2DTRA 3MKZA 4IN3B 4TUMA 1E8XA 1F36A 3E4BA 2FQ3A 1QU3A 5FFXA 2CW0F 4IRHA 4HLEA 4ANVA 1HOMA 1HQCA 2DK5A 3I53A 1L5JA 2VLAA 1F9NA 4UXNA 2WAQA 1RW2A 2UY1B 4I02A 1N25A 1XMAA 3IAM2 4A6EA 1BA5A 5E1WA 4P29A 1LQ1A 1YMPA 2CSOA 2LSUA 1YLFA 1T98A 1RI7A 1B4AA 4I76A 2LY2A 3CJNA 5F08A 2RDPA 3F0CA 1Y39A 4RQIA 3MKWB 5FLVA 5E3LA 3OYCA 2EFOA 4OIQF 5AAOA 1P4XA 1HE8A 3L1PA 4YFKF 1IRZA 2RREA 2L0IA 2KL4A 1X2NA 2WXJA 5HI7A 1OR7A 2VPRA 3LSGA 3ULEG 4WNGA 1IRXA 1S5LC 5E1ZB 1H89C 3TDUC 3FTWA 1X19A 3FMQA 4PFPA 4A3EJ 1VQ4I 5EYLA 1FIAA 4M9SA 2CQXA 2CU7A 2O0YA 5M5XJ 4YIIA 3L9TA 1HKSA 2IF4A 3EUAA 5LEJA 3RO3A 1LD8A 3APCA 3JCKC 2VKVA 4MIMA 3MEKA 3QC1A 3CTAA 4G94A 1V3FA 3DFGA 4HRMB 2NC9A 3V31A 2RC4A 5JR3A 4PH4B 3HL2A 3PUKA 2QQ9A 1O1RA 1KGSA 3QOEA 1ZBPA 1U6GA 1ZGAA 3PE4A 4V3IA 3ZHEA 3CHPA 4JB8P 2G7UA 2IQCA 1WJBA 3SEQA 3QP5A 3U1KA 4G2VA 1XMKA 1B72B 4ZYHA 3OXLA 4N4NB 2LSVA 2LP0A 3CKBA 4IPAA 1D8EA 1N52A 3O8HA 4FP7A 1ZH5A 1IQUA 2M1BA 3UNGC 2I9CA 2EV0A 1O5MA 4BEPA 2XF7A 3SQVA 2R03A 3FTXA 1W0TA 2KJBA 4II3A 5ENPD 5G2NA 1BW5A 3IC7A 5EYPF 3A02A 2H8WA 3BC8A 3HHGA 3WGIA 2ZJRF 2GGFA 3LAJA 3Q0VA 2CQQA 2XIGA 5A2QZ 4KA4A 3OYMA 1FLIA 5DUKA 1E3HA 4UI9J 1NI1A 4KNYA 2GRNB 3FUEA 4MS6A 2KQRA 3LSMA 4JEHA 1JTXA 1MMDA 1Z3YA 3HKZN 3S8PA 4CCOA 2AXZA 2J9QA 2ELHA 4XKWA 4FE4A 2DA4A 5F64A 3FTSA 1TQMA 2E34A 2EA2A 3PSIA 3RDIA 3RPQA 5FQ7A 4HVBA 2LNIA 1OLTA 2C0MA 1VQ7I 2DOAA 3OMYA 3VYUB 3FBIB 5CKTA 4B09A 3NEUA 3ASOE 4ANXA 1X3ZB 4OVVA 5AQBA 4G8KA 2YU9J 1ZR4A 3DSSA 2DPUA 2HVSA 2K7LA 3DPUA 1N78A 1BL0A 5AQ9A 1I27A 4ZYAA 3TG5A 4D10C 2OEVA 1O7FA 4DLOA 3HHMA 4BS9A 1MNEA 5B66C 5C4JJ 2P2CP 4NIKA 5IT9K 1A5EA 3NWSA 3H1CA 2G0EA 4HQMA 5M3MJ 4CEMA 4RSYA 4LGWA 1IF1A 5HLIA 5EDSA 1Z6RA 4LIVA 4BQNA 3G1LA 1T08B 1TN6A 1I1GA 1YJWI 1APLC 1IW7F 1KYZA 4Q94A 4TXRA 2GRLA 4WX9A 3RRUA 1SD7A 3KE2A 2E5NA 2V5FA 3EDTB 1S0PA 4F1PA 4P96A 4F3QA 2VE8A 1DUXC 2ZBKA 5KVRA 4BSZB 1RKTA 4C2UA 1Z7UA 3HPGA 5LP0A 2BXYA 2XPUA 1XN7A 3CMMA 3LFUA 3GBGA 3JYSA 5ENSD 5AYWD 3ZKJA 2FOKA 3RKYA 4GTTA 3PL8A 1IUYA 1Y8MA 2E35A 3C2BA 4LB5A 4XI0A 1WKMA 2HTSA 5ICEA 2Y0BG 4G8LA 4NC8A 2XRZA 1HSTA 2FBKA 3ABLE 2KRHA 2BKGA 2GIVA 2LAHA 1V54H 4KT5C 3I71A 4A1GA 1VNDA 4NC7A 3BR6A 5EG0A 3S16J 4APOA 4AUXA 4JX5A 1TL8A 2CS3A 1VZ0A 1Z91A 5FFZA 3KP4A 2A3SA 2K9QA 4I01A 4FX4A 3S7JA 2ICWG 2P5LC 3L22A 3NOCD 2O61A 1ZHFA 2QVOA 1D8DA 4LNGA 3U2RA 2V7FA 3NARA 5IOYA 1SZAA 4HQEA 4BFRA 3F22A 2KFDA 3HUGA 4LG0A 3A03A 3HPHA 1GDTA 4IOAF 3OY9A 3ASGA 3IAS2 3E97A 2EQRA 1IRFA 2BY2A 3SFIA 2YNQA 4BT8A 1KQ8A 2R93J 4GFBA 3D9MA 1WPKA 3I9V2 1W0UA 1GXPA 1TWCJ 1BD8A 3P9IA 3B7BA 4HQDA 3LKUA 3GLLA 2A6TA 1R4MB 3GTLJ 1WVRA 4HSTA 3GUDA 3CF2A 4HF1A 4OIRF 1E17A 4ENNA 4D9JA 1POGA 4L9TA 4C9BB 1OYIA 4NNJA 1YRNA 1KT1A 3ZPJA 3KLNA 3C1DA 1LTXA 2Z99A 4M3BA 1YE9A 2DCPA 4HOSA 5K7ZA 2CJJA 4U7BA 2X6OA 1TJFA 1WM5A 2TDXA 2VGYA 4QWQA 3PE3A 4F53A 3FU3A 4CCAA 1DCQA 3HOZJ 1Q2ZA 1O1TA 2AW6A 4I6JA 3JSPA 1IHGA 2WXRA 1J2XA 4I09A 4MGRA 5EZGA 1IQRA 1W7PB 3TOBA 5FINA 1B9NA 1DQUA 4XK4A 3VTYA 4KMFA 2OTJI 1JCRA 3FUDA 2OVBA 1J9IA 2BW3A 4U0WA 3Q9NC 5FWQA 4I2OA 3T9KA 4EPZA 5FKNA 3N97A 1E7UA 3VWBA 3MMYB 1FJLA 3TP3A 4BX9A 4A6DA 1HF0A 4BQOA 3IHYA 1E3OC 4I7HA 1EH6A 3EHMA 4GPKA 4BDYA 1WH5A 2MA3A 2W1OA 5HNHA 3ESLA 4AM3A 5D8KB 2L2OA 4KVOA 2HXOA 5E1XA 4KUMA 2ZU6B 2EINH 4NUBA 2PJPA 1HO8A 2DWZA 2VYIA 3GZSA 2X48A 2QKMB 4KMOA 1JUMA 3AL0C 1MBKA 1IXVA 2BF0X 3FU6A 5ICCA 4BHCA 3GTPJ 1QHGA 3HIZA 3JRCA 2DMTA 2OVFA 1F1ZA 3LVQE 1P7IA 3B73A 3BG1B 4JC8A 3VFZA 4A3CJ 5LCWJ 5K7HA 1D5VA 5LEKA 2WXFA 2CUEA 4EJTA 1RIOH 4N2QA 2GA1A 4PUSA 2AXUA 1Z3XA 2BE5F 2EIMH 5D4RA 2K3PA 3AL0B 2JLBA 3H0GJ 4AM9A 3CZ6A 4EZJA 3SI5A 2E36A 2J5OA 3DBLB 2W57A 3R0JA 3BG5A 1JKQC 1LVKA 5E3MA 3Q78A 4KZ0A 4BTBA 2ZNZA 4KN7X 1F43A 4R7LA 1D0XA 4PCQA 2KXPC 3KP6A 4OIOF 4EBAG 2LSOA 4WK8F 2FF4A 4OMYA 5D5XB 2LMDA 3KZZA 2ZXWE 4ANJA 3QAHA 2X6YA 4KN4X 5J8CA 3BJAA 1EPUA 1BI3A 2B6CA 1ETOA 2V5QC 1MBJA 2WAQN 4L5IA 3CCEI 2ME6A 1X4OA 2DU9A 4IVNA 4DJAA 3VLFA 2HU9A 4HSRA 1OCPA 2WADA 5J40A 4B3XA 2E2EA 2WXPA 2JTVA 4AOFA 1T38A 3CP8A 2KRFA 2JUGA 3S17J 3SZ7A 3BQYA 4F6RD 4CXFA 2Z9OA 3CCQI 2CMPA 4GTSA 4HOUA 5FZSA 5CJ9A 3U4TA 4IULA 4YDWA 2XAFA 3JXJA 5FB2A 4Y13A 1MDMB 2RV8A 5BNGA 4ETSA 4NQWA 4TV3A 1EH7A 4U8VD 4OAVB 5HLHA 2O6GE 3BTJA 5E75A 1BR1A 1DVPA 3HG0D 3TGOA 2QGUA 4G11A 2K40A 1FIPA 2EV6A 2GLOA 2FO1E 3CCLI 1AU7A 2ETHA 2DYSH 3MZHA 1H88C 2K9NA 1TNSA 3DEUA 1Z6TA 3O3KA 4DX1A 1RC9A 4Q69A 4D7MA 4JHJA 3DBHB 3NZUA 3LSPA 1PY1A 3CJTB 1ETVA 3RRMB 2B63J 4XNFA 3EIQC 1FMWA 4CZCA 3Q3SA 4LNUD 4FTHA 4C3IJ 4BDZA 2DDBA 4J19A 1N4RA 2ISYA 3GMEA 4G12A 1X1BA 4M6YA 2Z5UA 2JPBA 3RQ4A 3UI2A 4I43A 3GW2A 1R5ID 4J0UA 4I1OB 5KK1A 3M9AA 1H2UA 3FF5A 4I99C 1FC3A 2LUHA 1DNPA 2OOEA 2V8SE 3PZDA 2KM4A 3OS1A 1X1CA 4BXUA 1FP2A 3HYIA 1JCSA 4N3BA 5EIDA 4RM2A 5CLSA 4C3HJ 1SAUA 3DWLE 2GOMA 2L0KA 3G1OA 1RUNA 5ICGA 4F92B 3DLLF 5KJKA 4UWHA 3TG4A 3IKVA 1RRJA 4A93J 3D9NA 1HW5A 2HR3A 2UV1A 2H1KA 3DSUA 4XRMA 1ETYA 2V9PA 1A36A 3GTQJ 1N0QA 4UWFA 3UM3A 3IRRA 3CVUA 1MZBA 1GHCA 3SDGA 1DCEA 3PNTB 2R2LA 3S2AA 1WZ2A 1MDMA 2JA5J 1QZ2A 3UXGA 4II2A 4CH7A 3J81K 2IOLA 4AY6A 1LFBA 4G9YA 5JA4D 5LCWC 4LG6A 3LSTA 3AS8A 4PJ0C 3MD2A 5FZQA 3CCJI 2LNBA 4JK1X 2EFQA 2BOLA 2KMUA 1YITI 3AG1H 2V9KA 4CICA 1REPC 5BQTA 1EDUA 5E76A 1T33A 2D1HA 2I6HA 4IKFA 4M3OA 2X51A 3GYHX 2DBBA 2YQ8A 2XF6A 4RGXA 4WUYA 3WHCA 2AS5F 1QZEA 1YYVA 2XKPA 3MEXA 4S0HB 1B72A 3L54A 3NOGD 5TISC 3J7ZI 3COAC 3TWVA 2KATA 3OYHA 1YW7A 2A5UA 3B7UX 4HF2A 1HBXG 4L9JA 2E5ZA 3CC7I 3GFMA 4BE2A 2IEJA 2FX0A 4MQVA 3KPHA 2QEXI 2Y69E 3V2XA 5C3EJ 3QARA 2Y9ZA 3WHBA 1PP8F 2JA2A 1LUJB 3UR3C 4ANWA 1N4QA 3GTJJ 1TN8A 4N3AA 1KZOA 2M7BA 3MV2B 4BH9A 5CBNA 1OMIA 2VKEA 2HWVA 3K9IA 4A0XA 3ZU7B 1ZRCA 4IHSA 3K1NA 2WA0A 1Q1HA 2VKDA 2DFIA 4XSZF 5D5VB 1BI7B 5D5WB 3L2CA 3D9IA 3P1UA 3V7CA 3FZVA 2W82A 4A5NA 3M8EA 3REOA 1TWAJ 5CERB 4DGWB 1H9TA 1FBSA 4EATA 4WCGA 3CHOA 4I9CA 3QNKA 3KYCB 3TWXA 2CQ7A 4KJZA 1DC2A 2R3SA 3CLOA 1TW3A 5J1YA 3OYBA 1HW2A 2M34A 2O3FA 2OBPA 3R6SA 3MAJA 4O3MA 3FFLA 4AXHA 2GW1A 2HVRA 3GTKJ 2F5FA 2G7HA 3R4KA 1FTZA 1AP7A 5JLWA 4A3FJ 2VTBA 4UQYA 4X0GA 3DEWA 2EZHA 3SXYA 2P6TA 1XGWA 1IV8A 3TW7A 2O5RA 1H2TC 3AFHA 1PP7U 1B6AA 3IH2A 4Q4ZF 4XN3A 1ZGWA 3S1MJ 4LCTA 4EM1A 4EECA 4YIRX 2KZVA 5L3GA 3Q7FA 2D5VA 1EYHA 2H6GA 2LDUA 4R8HA 5CMWA 1UHWA 2X1EA 1A5JA 3DEEA 1W5TA 2Y4UA 4RLQA 2TCTA 3KYDB 2PZIA 2R7QA 3K7AJ 1YRNB 4OU0A 3CHSA 2E0IA 4FCYA 3OTNA 1WQ2A 2PLYA 1I3QJ 4BBRJ 3KEZA 1R36A 3KP2A 4H7XA 5FKMA 3ZR8X 3L2QA 5FKOA 4ZYEA 4HEA2 2STWA 1UG3A 1MKMA 2VB6A 3FY4A 2HDCA 4CT4A 2LXLA 5DEQA 5B1BH 3L17A 4EGZA 2J4DA 3KETA 2DJNA 2RN7A 3DP7A 1GVDA 4KT6A 3S93A 2FBNA 1TNUA 2J4BA 1BBYA 4MFDA 5BS6A 2X0LA 1I50J 3HXLA 4NACA 4FULA 3FUMA 2E1MB 3ML6A 1ENHA 4HNUA 4IHTA 3K0LA 2VL8A 3GW4A 3FK6A 2ILRA 1OCCH 2DOFA 2CQNA 5F1JA 4D1QA 4DUIA 2ESNA 2QQBA 4YELA 1G59A 2GIZA 4AIHA 3BLYA 4CCNA 4BGDA 5F1RA 1HXIA 3L82A 5IYBJ 1FTTA 3DXJF 3G2BA 2FO7A 1D1AA 1XDSA 3F3XA 5K5RA 5BOXA 3OAWA 3ZQGA 1AWCA 4M3FA 3LDZA 3BDDA 1ZARA 1YG2A 4A3LJ 2IT0A 2P6SA 2ZFWA 5CEAA 3GFJA 1W5CC 3D9LA 5G05J 4BTAA 3APFA 1JXSA 3CP2A 3Q5FA 2I10A 4ZTFA 5KJNA 4IZZA 2XGXA 2Z2SB 3SQNA 3IV5A 3WG9A 1OT8A 3CK8A 1FT1A 4AIFA 1CGPA 3OIQA 2XGMA 1ODDA 1T6SA 5EEGA 5FLMJ 3B6AA 2CHZA 3T8TA 4E7SA 3ZFWA 3AG2H 5HLGA 1S7AA 2AJAA 3ZMTA 5AQ7A 3KS2A 1KU3A 1G8XA 2VXZA 3H36A 1E7VA 2FEZA 4WXDA 3E3VA 1D1BA 2M4KA 3D9PA 3VB2A 3PREA 1X2MA 3W2VA 2JA6J 1A6QA 2KHMA 5J8FA 2A5EA 1BW6A 2YHCA 2XAHA 1QVTA 3FXJA 5EX3A 2ONDA 4XKCA 2VODA 4HBLA 3HHHA 4IHXA 3ULQA 4HOBA 3FUFA 2FNPA 3LY9A 4Y52J 4EJWA 1YQAA 2EIKE 4CZZA 4J8EA 3HXEA 1P7JA 5CRVA 3V7SA 4IEJA 3BTCA 1IHBA 2AQEA 3LXUX 5D8LB 1QBJA 3X2QH 3I5PA 1U8BA 3ABKH 4MFEA 3ZRGA 4A0ZA 4ZYDA 1VFCA 2ZB9A 3QP6A 1MX4A 1QYMA 2ZJQF 1FBUA 1KLXA 1EKEA 4RDUA 2BVLA 2DMNA 2RNJA 3RRNB 3K2AA 1BI2A 5ERIA 2VQ2A 1VF9A 1TQPA 5HLTA 3P5JA 5H6QA 3FIWA 2ETCA 3C3QA 1R7JA 1K6OA 3KZYA 1HH8A 1J75A 1YIJI 4N9IA 3C3OA 2A4ZA 3PO2J 4YDYA 4DIQA 1YX3A 4BERA 3HOYJ 4JHKA 3Q47B 2R0QC 1OJLA 2R7RA 1WJ5A 3HXFA 3H5NA 2KDZA 4G7HF 4ZH4F 2HOAA 1GW6A 2HO1A 5DUIA 4XSXF 3O48A 4H4KC 4UUVA 1EV7A 3MCXA 5LOZA 2VJ4A 3UT7A 3E1SA 4RLFA 3CCSI 2GXAA 3KX2A 1S3JA 4FETA 2KP6A 1Y6IA 1P6RA 3ERED 2LY1A 4U0YA 3UMVA 3B02A 3E6MA 3B7SA 2GRRB 2DA1A 1R00A 2Y31A 4HX7A 2BEDA 2X6JA 3K10A 4WF2A 5CVIA 1S7OA 2OV7A 4BY7J 3UIPC 4RB3C 4EJOA 5FJYA 3M8FA 3MKQA 2P5VA 3BTIA 3DBSA 5D6EA 3FTYA 1K83J 1JI8A 3JR9A 1CF7B 2H6BA 2OQGA 3ZYKA 5JJTA 5LGTA 3DEOA 3IL2A 3QWPA 3MN2A 2CW8A 4HG2A 4ATGA 1X3WB 5FD5A 1CF7A 2DN0A 3O4ZA 5BNWA 5J1UA 1TP4A 3JQ1A 2CHWA 4AC0A 3MKQB 1D9SA 2HYJA 3ONQA 5EDNA 3FUNA 2EIME 4U0ZA 2VQLA 3T8KA 2DZOA 1TT0A 1SMYF 3ELKA 2DTZA 4XOPA 1V5GA 2A6HF 4CYCA 1A31A 4Y3OA 3DF8A 1NZNA 5BT1A 2K3FA 1HA8A 3CO7C 2EILE 3U21A 2CWEA 2Q2EA 3I0TA 2XPYA 2A5WA 3IUOA 1B8IA 3G3ZA 4ZJZA 1OR7C 2F4IA 3CC2I 2QKLB 3CD6I 2K86A 1YW8A 1RETA 1SVXA 2LAIA 3ISMC 3OXFA 4FA6A 1IO2A 2YPRA 3I5UA 2WY7Q 4W9RA 3MZ8A 1NFIE 2VBXA 3HRTA 3E0JB 3OYGA 3QWVA 3C3RA 3OXGA 3OYNA 3ZYMA 1JT0A 3K1PA 2X6FA 2QSGX 3CMEI 1FYMA 3PZ1A 2LD5A 1IN5A 3OR1C 1QZZA 2QENA 2EFWA 4LK0F 2UUZA 5DDGA 2EIJE 1XGNA 4LFUA 5IP9J 4APFA 4KIFA 4GGGA 3HBLA 3LY8A 2X6IA 2RKHA 4NQ0A 4H0EA 5G55A 1Z0XA 3FUHA 4C30A 3LPZA 3E5XA 1MBEA 4CYMD 2XPWA 2E60A 4IHVA 1W3BA 3WU0A 2CG3A 1NA0A 2NOJB 2HTJA 4A3VA 1BPOA 4UI9C 3ZQIA 4CCKA 5J6XA 4E85A 3L08A 2R7FA 4JPSA 4BE1A 1ZLKA 2VJIA 2KCLA 3CV0A 2M7AA 2R5ZB 5B1AH 1GLNA 2COBA 4B1RA 4B8XA 2OV8A 2XS8A 2ZISA 3FWVA 1LNWA 3SJMA 3CLJA 2NNNA 3I54A 1LDKB 2XDVA 2Y48A 4GAAA 4Q48A 3S14J 2K9MA 4BT9A 1LD7A 2KCKA 3F8BA 4LITA 5E3OA 4HV5A 4D5FA 3FBNB 4XONA 3M07A 2AXVA 2QYUA 2XCCA 3K4LA 1IXSB 2YSRA 4GRIA 4P5OA 4TV7A 5CQEA 2DPDA 2O8KA 3SZTA 3ULQB 3K6GA 2L6JA 3UM1A 1TWFJ 1OQYA 3BQZA 4HLYA 2Q0OA 4LSZE 3S2WA 2CUFA 4HRIA 2MC4A 5LHIA 3UTMA 3ZOBA 5JJ6A 2JA7J 3ENEA 1FSHA 4CO8A 1G3YA 5IY5E 3G2TA 2O8XA 1BI0A 1HG5A 3OOPA 3CVQA 2YX4A 4MEYF 4E7HA 2F8YA 2R7UA 2P9IG 5E8GA 4I1AA 4AJWA 5FQ4A 3R7RA 1MH4A 1P5QA 3RIRA 2CYYA 4JL0A 2LR8A 5BUZA 3CVYA 1DU6A 1O3SA 1HSJA 4XIDA 2AXLA 4L2LA 3ZN3A 3QYFA 4JA7A 2PJRB 2BKKB 4GTOA 4U8HA 4G6TB 2ELKA 2JUCA 3E7LA 4MO7A 3SNXA 2CO5A 3FEYA 5JJ7A 4G6DA 3LAPA 1O3QA 2HOSA 1O1SA 5KNHD 3MA5A 3BR0A 2JMWA 4G8XA 2UWMA 1V55H 1H0MA 5KJLA 4DPRA 5LFAA 3F8NA 1TQIA 1TTYA 2BGCA 3WTSC 4AIDA 5IP7J 1AWCB 2P58C 4OAZA 1IAWA 2O7OA 3HEFA 1RNLA 5HS7A 3C2GA 1JWFA 2AXTC 3PVLA 3J80Z 3BU8A 4GU5A 2XB5A 2Y0SA 4I0BA 1JKRC 2XROA 4F1SA 3HOXJ 1XCVA 3A1YA 1J7KA 3FXLA 1W36D 3V7RA 5ANRA 2X4HA 2NS7A 1Z77A 4UB6C 4HDVA 2EFPA 2V6CA 4DI3A 1WG0A 4LEUA 5F04A 4HI8A 4RGUA 1X1AA 4FE7A 2IS1A 4BWRA 2FA5A 3EETA 1AOYA 5J08A 2IJLA 3V8JA 2XEHA 3M3YJ 3DU6A 2M2EA 2ZXHA 1HS6A 4KT6B 1G4DA 4DRXE 3P9KA 4HPQA 1SAXA 4EM2A 2NVXJ 3FXKA 3DQVC 2Y1LE 4ZC3A 1LFUP 1VDYA 1VQPI 1T0FC 1FP1D 1U8RA 1E96B 2DYSE 1HDPA 2ECBA 2X38A 1IXRC 3DSWA 3WTWC 3IV0A 3Q5MA 4KVMA 2M63A 3Q73A 5FO5A 3BJ6A 4GO1A 4GTQA 3ASFA 2F2EA 4NB5A 4Q47A 4LLLA 1L0OC 2CUJA 3BG6A 5E17F 3TQNA 3H3ZA 5DD8A 5D4SA 1OPCA 1HKTA 1TYQG 3R9AB 4O6JA 4IQJA 1K1AA 1BR4A 1A35A 2EK5A 3JRAA 5BPIA 1KQ9A 3S1NJ 5D6FA 2PQ8A 5J4VA 2IAIA 4RB2C 1VQMI 3FH5A 4P9FA 4I0AA 3J7AY 3TGNA 3HGGA 4HRLA 5HDNA 4CGWA 2HGCA 1IJWC 1RR7A 2VTBB 3AKZA 2QUFA 3MCZA 4F3VA 4IRIA 2KJCA 2QSHX 4LIUA 3V8KA 1WJCA 1ZG1A 2AWIA 1GUUA 1W1WE 2KRCA 1ON1A 2ZMEB 3K9TA 4HYEA 3SY2A 3JRHA 1TEZA 3W3CA 2N8GA 3HOTA 4F93B 3I4NJ 1PVEA 3BUAA 4GPMA 1INZA 1U2VG 4RAYA 5CVVA 3EHRA 1QA6A 4L23A 4B4CA 5LGUA 2XSDC 4NC6A 4UUCA 4ABNA 4DI4A 5EX0A 2PMHA 4L0YB 2OPTA 3HRMA 1QZYA 2QZAA 5HOOA 2RFMA 5EGOB 2BZTA 3EHQA 3LSJA 3N05A 2PI0A 2FBIA 5KAFC 4ON0A 3MKRA 4IX7A 4FHKA 3B95A 1QPMA 4IHWA 5JMND 4Y33A 3H3VK 3QPLA 1R1TA 2MD0A 4GTRA 4FHJA 4A55A 1O7LA 2VXDA 4G1TA 3S2DJ 1IN6A 3F21A 2BHZA 2EINE 2UZKA 1HU3A 2X3MA 1U9NA 5J4YA 4O5VA 3ZXSA 2X6WA 4DNCA 4JA9A 1ACIA 2XZDG 5FLXZ 1Q1VA 3EUHC 1H9GA 2Z33A 2IS4A 1BJAA 3K4MA 3T5XA 1N4PA 4RS8A 2VJJA 3DSXA 4JW1A 3U9WA 2L9SA 3CJQB 4BHBA 2DQLA 3TWQA 2MFZA 3BG9A 1U3EM 4BX8A 4FASD 5K1YA 3HDXA 1SMTA 5H6RA 4QSHA 4KICA 1K61A 2KZTA 2E2HJ 2XSJC 4MLPA 3LQQA 1MD0A 3AS4A 5K7FA 4CHUA 3U66A 2HYFA 3JRFA 1XSXA 3MYVA 4IJAA 1S6LA 2CV2A 1X58A 2VKHA 3ERMA 1DP7P 4UWGA 3CCYA 3WTVC 2JABA 3CK7A 1A17A 3PZ2A 2DZNA 3DKXA 5FJ8J 1PUFB 4JHRA 3ZQCA 5EN5D 1WFXA 3NZSA 1ELKA 2DFFA 2ADUA 5A23A 2QSFX 5FTPA 3H0DA 1KONA 4FISA 4M6XA 1LE8B 1VQ9I 3J7AO 1ZG3A 4UV8A 2XPIA 1EJ9A 1G3TA 1I1SA 2KCVA 2LO6A 3APDA 3PIPF 2XENA 3DU5A 3T8RA 1AHDP 1R23A 4BEHB 3PZ4A 4RVBA 1ETKA 2FQ4A 3SYTA 2R7WA 2X85A 2Q1ZB 3PEUB 4WWCA 1SD6A 3RKVA 2L5QA 3BOQA 4LJZF 2UXXA 1S29A 3KP3A 4L9NA 4XR6A 5CMYA 5CRUA 4MEXF 3IP4B 1H8AC 5M72A 3DWLG 1XGOA 4UV9A 2ZFUA 3R0AA 1TN7A 3ZYQA 3QU3A 3OL4A 5HS9A 3OV8A 2NVTJ 2J8SD 3I58A 4RBOA 2HEOA 3QJZA 4B94A 3Q7AA 5B5EC 3S2HJ 3KYLA 1ERDA 1Z05A 5AENA 3QWWA 1WGXA 1VQNI 1R4NB 2IA1A 1FEXA 1ZELA 4XEIG 3A0HC 3LL7A 2VGXA 5TJJA 1FCHA 3MKYB 5ARGA 3CHRA 4Z68A 4WWNA 1K4SA 3HXCA 2ZJPF 3TWRA 4V2GA 3NAWA 2CFOA 1ETWA 4Y6CA 1BI1A 2P4WA 3CUQA 3GVAA 4I9EA 4GDFA 1SD5A 4NQWB 3R7QA 1R1UA 2HS5A 1Y1WJ 4GYWA 2EFNA 3KCCA 2PMUA 4M3EA 4A3IJ 3DCFA 5KCMA 4L1BA 2E7WA 3RKQA 1WHUA 3FHZA 3CSFA 2L9RA 5GAGJ 1QNFA 2XHKA 3EYYA 2PG4A 3E37A 2DA7A 4V19K 1OYWA 2RG8A 1J59A 5DTDA 5H7PA 1ON2A 2XEVA 3NRVA 4AU7A 2ZXWH 4GMJA 4J7WA 5CVJA 3ESWB 3K70D 2P9LG 4CDGA 5HDKA 5JVGF 5HVQC 3HSFA 2WV1A 3JSOA 3OOUA 4HA8A 4Y4RA 3K2ZA 4ESJA 2VGXB 3CGHA 2IGMA 6PAXA 1OUVA 1P4AA 3JUIA 4RMNA 4K5BA 2FUG2 2LG4A 3FWEA 1L3LA 1JWGA 3EU5A 3QB2A 3GZ1A 2W24A 1TBXA 3D5SC 3LWFA 2NS8A 3G2WA 1P4WA 3BZCA 5ENNA 3VEPA 1HZ4A 4KZCA 1NG6A 4EHMA 3T8MA 1MYOA 3FKIJ 2FI7A 4DLQA 2XC7A 4UY8I 4ESBA 2F5VA 2MD5A 1FT9A 4WNEA 2HFHA 5AJDA 3UPVA 2KPMA 4DBQA 2DO7A 2ID6A 2BY3A 3HOSA 1K4TA 4BY6A 1JKOC 2WQ6A 4U63A 4XMYA 2V1DA 3HRAA 2PL2A 5KNGA 1GT0C 3S32A 3RTRA 1I6XA 3VODA 2I1JA 3UQ3A 3IHUA 1WH7A 1C0WA 4GCOA 4GMRA 4P55A 4LMYA 4BL0B 4JD2G 1KT0A 4K5CA 5JLXA 3L00A 4ME2A 4Q5SF 2BY0A 4OAYA 3BPVA 3F8CA 4ENKA 5KJMA 5JVTA 3RSEG 1XGSA 2YU3A 3GZ2A 3ZQFA 4HBDA 1ZKGA 2A05A 5T8IA 4CGVA 2ZSHB 2MOWA 2WY8Q 3KEYA 3QPHA 4HNAD 5HKPA 3WG7E 4KXKB 4ANUA 2QLZA 5ILSA 5F0HA 1PUFA 2BUGA 3ZQLA 2Q7FA 3HRSA 2M0CA 3H3UA 4I6ZA 2WVIA 4Q96A 4XLPF 5A6CA 1UG2A 3HG9A 3S7FA 2X9DA 4AP2A 3BG3A 1SFXA 2HQNA 4RAFA 2M0MA 3FEXA 4HXIA 1U2WA 1W7PA 3S3MA 3ZIMA 4LRZA 3I4PA 2Y4TA 3Q49B 5ILUA 3WTTC 4AV7A 2MYSA 3TW6A 4X6AJ 5D66A 3PUFA 3VTXA 1G2HA 5FRNA 5ENTD 1N9AA 2V4JC 2HE0A 5B3SH 1K1BA 3FHEA 5E79C 2QWWA 3WTXC 2ZSIB 3G73A 1WRJA 4AYBN 2F5CA 2IGNA 4HI9A 1Y0NA 3GF2A 4PGHA 1TLHB 2E19A 3CVPA 1RKWA 4I98B 5CYVA 1MJAA 3FH7A 4HS2A 4I2WA 1IKND 1DPRA 3KD7A 5F6FA 3TO6A 1XPXA 3DPYA 1MW7A 2E1CA 3K69A 2DCEA 4EGYA 2OAZA 3I4GA 1IN7A 5G04C 2IY0C 1O4XA 4ILGA 4E6HA 1BLXB 3QYBA 2NYJA 3H5RA 4Z2YA 5HRYA 3KZIC 4K03A 2VSNA 3U3WA 4HLXA 4ESFA 1FX7A 5EG0B 2WXKA 5LX8A 4J8SA 3O6BB 3T0YA 3CMAI 1DDNA 2F8XK 3RJVA 5AIQA 2IBDA 2P5KA 1MNDA 1Y8RB 3GWZA 5JFRA 2IU1A 3RO2A 3JRBA 4GZ5A 1OYYA 2MSYA 2K4BA 5A2QK 1QHHD 4BU2A 5TRDA 2NOGA 3R61A 4EQFA 2BEOA 4XLFA 4RG6A 1U9OA 4XRFA 5LLQA 3VYTB 2LREA 3F72A 3OIOA 3VOEA 4A69C 4BQQA 1T8IA 4U7EB 1BI8B 3IXEA 3GFIA 2E2IJ 3GZ6A 2F5EA 3EQLF 3ZMVA 4CZ2D 4DW6A 3E32A 1USTA 1MSEC 1JTYA 4GZ6A 1BR2A 4HDUA 4DYCA 3NB2A 4G6QA 4URKA 5CEDB 4JEUA 1XDUA 2XRNA 4IOCF 1VQLI 2EZLA 3OYAA 2LTPA 2QBYB 2BYVE 4IHYA 3ABUA 2DBAA 1Y8QB 2WBMA 2A5YB 1S9HA 4GCNA 3SBSA 4A63B 2FOWA
chains in the Genus database with same CATH topology
3FM5A 1G6NA 4OMZA 2H27A 1U5TC 4UHTA 2V1XA 4G7OF 2G9WA 2CFXA 1QGPA 2ESHA 2HYGD 3K1MA 1U5TB 3RI4A 1SFUA 4WXHA 2F5DA 3LA3A 1T2KA 2L4MA 5JI6A 4L18B 2L4AA 2DAOA 3HTUA 2QQAA 3E5UA 2GZWA 3GFLA 3WE3A 2XV4S 4YFXF 5EEHA 2MLKA 5L3CA 2E1NA 4UNOA 2NS0A 4EVIA 3PFIA 3DV8A 3E6DA 4FHTA 3M7GA 2DK8A 4RB1A 5L3FA 1ZN2A 2XVCA 1V4RA 4GYGA 4G7ZF 4HV6A 2Y75A 4UVAA 2D1VA 4A12A 3HSRA 3RYPA 2EJRA 3LA7A 1JGSA 3JTGA 3I59B 5LHGA 3Q9VA 2NYXA 4R79A 3D5LA 3M1EA 5K5OA 2KIUA 4KDPA 1WWXA 3C18A 2Q8KA 3BPXA 4ZZDA 4E70A 2PFBA 5FD6A 2GQQA 3E5QA 4EJUA 2H6CA 4KMUX 4K2EA 2VC1A 2D2WA 1UHMA 1R1VA 2R7DA 4MHGA 2HKOA 1JHHA 1K79A 1ZRDA 1FY7A 4FX0A 4PGGA 2VBZA 2XAQA 3CO6C 2LKPA 4N9HA 5E18F 2WC2A 4IXAA 4M74A 4P9UA 2XUBA 1STZA 4EMSA 1ONVA 3BP8A 3U1DA 1G3SA 2L3DA 5ILVA 4BQAA 4RGRA 2W84A 2EWNA 4CGZA 1XSDA 4MNUA 3GX4X 1LEBA 4UVCA 2KIMA 3DKWA 1WI9A 2QM3A 1FSEA 3QU6A 2DI3A 2V79A 1F5TA 2M5WA 1RZ4A 3J80K 2V1UA 1K78B 3FMSA 4JBAA 3C3WA 2A69F 4MQ9F 3PQKA 4IRGA 4L0ZB 3KEOA 1A04A 3IWFA 2XKOA 3CUOA 2HOEA 2E7XA 2VT3A 1U5TA 4AIJA 2FSWA 4UVBA 4YIFA 3ZMZA 3RKXA 1PDNC 2MC3A 2GWRA 4A0YA 3RJPA 1QNTA 2VN2A 2MLGA 3V4GA 2QBYA 1KU9A 1D8JA 4KIBA 3ZMSA 4M73A 1BC7C 1R58A 2CGPA 5E20A 4PDKA 5AIPA 1HW1A 2QZ8A 2ZCWA 1WSUA 4ASNA 2RGVA 1K7AA 1BOAA 3KP7A 4XLNF 2EV5A 1T39A 3ECOA 1IZ1A 2A6EF 1RUOA 3P9CA 2IVMA 5K5QA 5D5UB 5BPDA 3KLOA 4M9XA 1YW9A 3ISPA 2ZKZA 3JAMZ 3HIFA 5FLXK 5AONA 2ISZA 1KQ0A 1LVAA 3CDHA 3V8LA 4LD5A 5HS8A 3FXQA 2K02A 4RAZA 2IP2A 3U9GA 3SZPA 2NAZA 3TDZC 2IPQX 2P8TA 1TW2A 3HTSB 2L02A 2DLLA 2FMLA 5DCFA 5FGMA 3HSEA 3I59A 4LLGF 5IT3A 2XAJA 4ENJA 3E6BA 4Y15A 1XB4A 1XD7A 3LQRA 1S8NA 5LHHA 3L7WA 2LF8A 4S05A 2ACJA 3JAMK 1Y0UA 5DCMA 4U7DA 2VT2A 4M71A 2ZNYA 1PUEE 3JW4A 1W7PD 4HAMA 1XCBA 2Z3YA 4XBFA 1XGMA 2IA0A 3BWGA 1KYWA 2NRAC 3CUQC 1KU2A 1Z9CA 2XASA 1FBQA 5HDGA 2HQRA 3NQOA 3EUHA 4YG2F 2KIFA 2OU2A 4CYDA 3CUQB 4L5JA 3FXRA 5H20A 2VONA 1P92A 3GO5A 1NHAA 3TOAA 2M45A 2LF7A 3F8MA 3EYIA 1B59A 2IRFG 4RGSA 4OIPF 4ENMA 3RKWA 4AD9A 2DT5A 1FWZA 3GEZA 3I64A 5JHUA 2MH9A 3SFZA 2O03A 2PBIA 1EH8A 2GA2A 1KA8A 2IA2A 3BZ6A 1D3YA 3TO9A 2W25A 1GVJA 1HKQA 1TNTA 4U88A 3WTZA 4EJVA 1P2FA 1FNNA 3ZPLA 1LDJA 3KFWX 4MTEA 1BIBA 3KP5A 3R60A 4EQQA 2FBHA 3TKYA 2H09A 1UCRA 1FZPB 4BHPA 3GLXA 1J0RA 5IT9Z 2WTEA 4BAYA 3FM3A 3H92A 1ULYA 2JT1A 4HF0A 3ROUA 5L3EA 2GXGA 4OINF 4M9ZA 2P7VB 2HKXA 2OZUA 1U78A 2M87A 2FNAA 2CG4A 2H94A 1UB9A 2ZMEA 3E6CC 3D0SA 4BNCA 3WTYC 2ZXJA 3KEQA 1R5GA 3IWZA 1DPUA 2RVCA 4FT8A 1B9MA 2YR2A 1LJ9A 3ABTA 2ZO4A 2HZTA 3WGGA 2V9VA 2M30A 3T1BA 1BIAA 2K4JA 3EDPA 4AWXB 2UXNA 3WODF 2FXAA 4LG0B 1MGTA 3Q9SA 1ZGJA 4ZZLA 5LGNA 4KIGA 1G3WA 4WXCA 3F6VA 3QRFF 1IRGA 3FX3A 3IRQA 3MFKA 2C6YA 4F7ZA 1B1BA 1BC8C 4GXOA 1D8KA 4S04A 2PEXA 1SD4A 4LB6B 3P7NA 2JRTA 3WE2A 1ZAOA 4OOIA 3SHFA 4N0BA 2JZYA 1ZREA 3L9FA 1IN4A 1W5SA 2MH2A 4R1HA 4EV0A 3WGHA 4GCVA 3RPUA 4KYWA 3ZMDA 2OQRA 5LRSA 1FOKA 3L09A 1UFMA 2DQRA 4U0VA 1JHFA 4HW0A 2A68F 2QYOA 3W6JB 4ZYGA 3W6KB 1O3RA 3AAFA 1R5HA 2RQPA 5DCMB 1E2XA 3C7JA 2BV6A 1HXDA 2J5PA 2FRHA 4HZFA 2FE3A 1ZLJA 2VBWA 1FPQA 4EM0B 5LBQA 2FMYA 4LLNA 3MZYA 5LRRA 1FYLA 1R22A 4DQ2A 4A2UA 4Y17A 3WU1B 2VOPA 2XAGA 2VOOA 1ZG5A 4AVPA 2A5YB 4AIKA 4A5MA 2FU4A 3O2PE 4PZJA 2A07F 1YIOA 4RB0A 1YFHA 2M8EA 1VTNC 5ED4A 3IKTA 2NNYA 1W4MA 1LDDA 2YX7A 3DPLC 2A61A 2OZ6A 2L54A 3JTHA 4JQFA 1O3TA 2VE9A 4LK1F 4HX4A 1XSVA 1QO0D 3ZMUA 3BROA 4IF4A 3J81Z 5DV5A 1MJ9A 2BBYA 1F4KA 3LFKA 1GXQA 2K27A 1USSA 3BY6A 2MBFA