1RZ4A

Crystal structure of human eif3k
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
213
Chain Sequence
AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADEQIFICSQEESIKPKNIVEKIDFDSVSSIMAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Eukaryotic translation initiation factor 3 subunit 11
publication title Crystal structure of human eIF3k, the first structure of eIF3 subunits
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 213
sequence length 215
ec nomenclature
pdb deposition date 2003-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10075 CSN8_PSD8_EIF3K CSN8/PSMD8/EIF3K family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rz4A02
1.25.40.250 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat ARM repeat; domain 1 1rz4A01
1Y0UA 4JK1X 3I58A 4EJWA 2A07F 2M8EA 2FU4A 1ON2A 4LLNA 3HHHA 3KETA 4EJOA 3KCCA 3HUGA 1IRGA 2KIMA 4LK0F 1LDKB 5CLSA 2NRAC 4ZZLA 4CGZA 3J80Z 5HS7A 1FT9A 1ZN2A 2JZYA 1V4RA 1FBQA 2FNAA 1XSVA 2QQ9A 1K79A 3R6SA 2L02A 1F4KA 3F8CA 2BYVE 3F8NA 2CFXA 3DPLC 4MQVA 2FBHA 1R1UA 3QP5A 2O61A 3TKYA 1BI3A 2HYGD 3QU6A 5E17F 3AAFA 3LAJA 3TDZC 2V1UA 1MD0A 2OQGA 1P92A 4M6YA 3RKYA 4ZH4F 4M72A 4IJAA 4RAYA 2QYOA 2DFIA 2DBBA 3G73A 3NRVA 1J75A 1I1SA 2GZWA 4UV9A 3HRTA 2RVCA 1U6GA 4ETSA 3FF5A 4I0AA 4BYYA 5L3FA 2GA2A 3F22A 4A6DA 2W24A 3TO7A 2Z9OA 1HKSA 1ZG3A 2ESHA 3WGIA 5KK1A 3TO6A 4EM1A 5HS9A 2NYXA 3KZZA 5BPDA 2BE5F 5FD6A 2LNBA 4KIBA 1WRJA 5CYVA 1IAWA 1E2XA 4KMFA 4L9TA 3K69A 5E1WA 4WX9A 2W25A 2RV8A 2EFWA 2ZCWA 4MTEA 5D5XB 2X0LA 3RYRA 5E8GA 1HW2A 3ZMVA 1YO5C 4RB3C 4M9ZA 1LEAA 3MZHA 4LK1F 5HLIA 2A3SA 1Z91A 3WG9A 3MEXA 3RJPA 4N9HA 5IT9K 1G3YA 2H27A 4BHBA 5HS8A 3K1PA 3O6BB 1Z9CA 1FY7A 2QENA 2QQAA 2VE8A 4WCGA 1HKTA 4AIJA 2QWWA 3F8MA 4BXUA 4WXHA 2A6EF 1H9GA 1SFXA 2HQNA 2BEOA 5EEGA 1Z6TA 1YQAA 1ZARA 5ICCA 1J59A 4I01A 3WE2A 4OU0A 2H6BA 3G3ZA 2P5LC 1XGNA 2L3DA 1HSJA 2O0YA 4UVAA 2EK5A 1ZH5A 1FNNA 2EV6A 1GVJA 4RGRA 5CVVA 2W57A 2HYFA 2YSRA 1B9NA 2FNPA 1XSDA 1RIOH 2H6CA 5HDGA 4NB5A 3ZMSA 2DO7A 4A2UA 3HOSA 1L3LA 1BI0A 3FXUA 4RAZA 4BHCA 4MEXF 2IW5A 1XGMA 4KICA 4P55A 4K2EA 3TGNA 4HZFA 3I54A 1G3WA 1HW5A 2PN6A 1WSUA 1OYWA 2YX4A 2L4AA 4YFKF 2VBZA 3HTSB 1XDUA 5D4SA 1WWXA 4MNUA 1BI1A 4CZZA 2IRFG 5AONA 3B73A 3ERED 4A0ZA 4HX4A 2QBYB 4HDVA 2XRNA 4YFNF 3LSTA 1I1GA 1XGOA 1FBUA 3I53A 4DNCA 5JI6A 4UV8A 1W5TA 3RPUA 4P96A 2VOPA 4A0XA 3V7SA 4HV6A 5E1XA 1SD6A 1TNTA 3QPTA 2RNJA 4RGXA 3GF2A 3GEZA 3V7RA 3WTXC 3TO9A 2XKPA 2Y0MA 2VBWA 3MAJA 3P9KA 5L3BA 1KGSA 2FE3A 2RQPA 3I5UA 1GHCA 4FX0A 1IXRC 2HGCA 1R5GA 3ZQ7A 1O7LA 2Z99A 2LDUA 5LHHA 1FYKA 3R60A 2WTEA 2DPDA 4P9UA 2FRHA 1KQ9A 2KKOA 3JSOA 2XROA 2HWVA 2PFBA 4RS8A 2FXAA 1IF1A 1Z1DA 5D6FA 5IT9Z 1G3TA 3N4MA 1H0MA 4IPAA 5D8LB 1YLFA 4RGUA 5JVTA 4GGGA 2OBPA 2ISYA 4L9JA 2PJPA 3GXOA 4D0PA 1PUEE 4CDGA 1FLIA 4G7OF 4ZYGA 3HOTA 2RC4A 1PDNC 5DCFA 4HA8A 3K1NA 4KIGA 4ENJA 3E5UA 3V4GA 3GX4X 1YW7A 1YW9A 5FFXA 4PGGA 2ZXJA 4PZJA 5D4RA 3MWMA 3SZPA 3M8FA 5CVIA 1FZPB 2ZFWA 4G9YA 4MQ9F 4EJVA 3K9TA 1ODDA 2L01A 1REPC 2F5CA 4H0EA 4L0ZB 3E5XA 5D6EA 3FMQA 1FBSA 2E7XA 2YX7A 1TQPA 5LEKA 1P4WA 1G6NA 4M74A 3J81Z 4YIFA 3KP2A 2OZUA 4CHUA 1IXSB 4KA4A 5DEQA 1R5HA 3F6OA 2M5WA 3MFKA 1MKMA 1EV7A 4RB1A 3D0SA 3R61A 3TDUC 4IVNA 4ZYHA 5F6FA 2ZBKA 1RI7A 4AVPA 1D8JA 2EB7A 4Q5SF 3EETA 2K02A 2MLGA 3EDPA 2IJLA 3R4KA 3GFMA 4EM2A 3RPQA 3WGGA 1XD7A 2W85A 4OIRF 1W7PB 1XDSA 2P8TA 4LB5A 4M71A 2GXBA 2ELHA 2QBYA 4B09A 3PQKA 4GYGA 1XMKA 1NHAA 3GO5A 2FQ3A 4HQEA 4I98B 5BQTA 5LGTA 1FP1D 5IT3A 1YW8A 4O6JA 2JPCA 2D2WA 1FC3A 2GA1A 1S7AA 1BC8C 4KFCA 1EH7A 5ICFA 1J2XA 1B6AA 3I4PA 4KNYA 1DP7P 4FT8A 3EYYA 3E97A 2HZTA 4HF2A 4I09A 4IRHA 2OD5A 1B59A 3WODF 1EH8A 2VODA 4L5JA 2XV4S 3LAPA 1ZLJA 3T8TA 1ZLKA 4KYWA 4LB6B 4XLPF 4U0YA 1VTNC 2EV5A 1V3FA 2LF7A 1BIBA 3U1DA 3Q5FA 3BROA 5LLQA 1Z6RA 3GWZA 4AD9A 4HF0A 3KP3A 2EJRA 1ZAOA 3ISPA 2R7DA 5DDGA 2Z3YA 4PDKA 2K27A 2ADUA 3SZTA 4GYIA 5D5VB 2P7CB 1YYVA 5LHIA 4HV5A 2PI0A 4XSZF 2K86A 4Y13A 3FWEA 1P6RA 3HHGA 2Z5UA 4UNOA 4ASNA 4PGHA 2MA3A 5DCMB 5E20A 1IW7F 1I27A 5DD8A 2MLKA 4FX4A 3FXRA 1USTA 1MJAA 5CVJA 3DP7A 1QNTA 2V1DA 3WU0A 2PMHA 2KJCA 4HW0A 4BH9A 3BDDA 3WTYC 4KIFA 1X3UA 3KEOA 1FPQA 1JHFA 1TTYA 1JE8A 4R1HA 2VC0A 3CUOA 1LDDA 2XIGA 1W4MA 1IN5A 2MH2A 1E17A 1SD4A 2G9WA 3M7GA 4QWQA 4Q4ZF 2TDXA 1BIAA 2DAOA 3ULQB 3E6CC 2EA2A 4L5IA 3WTSC 1ZGAA 1H9TA 3WTZA 3C3WA 3FM5A 2K4BA 1Z05A 3OOPA 1I5ZA 3LQRA 5DD4A 2VOOA 1J7KA 3L09A 3GZ5A 5H6QA 5HDNA 4ESBA 3VFZA 2HQRA 1W7PA 1MJ9A 1YTYA 2VBYA 5HLHA 5HDKA 1T38A 3H3UA 3ZPLA 1J5YA 3VEPA 1IN7A 3IHUA 3T8RA 3ECOA 1ZGJA 2JPBA 2YU3A 2K4JA 1UHMA 4KDPA 4HLXA 3O3KA 5ILVA 5K5OA 2ESNA 1S29A 2Y48A 4Y15A 1F5TA 4AIKA 1KU3A 1QZYA 3EUHA 3OV8A 1B1BA 3HSRA 4YIIA 4ENKA 1XB4A 3GLXA 4HBLA 5BPIA 2UZKA 1DPRA 1D8KA 1IN4A 3LA2A 5FO5A 2O8XA 2R7FA 5H20A 4G7ZF 2X4HA 5ICGA 2GAUA 3KP6A 2STTA 4LLLA 3WTUC 1YFHA 5E18F 4WWCA 4I0BA 2D45A 3K1MA 3ZMZA 1B4AA 3WTVC 5CVUA 2K7LA 1PP7U 3E3VA 1W5SA 4XBFA 5DCMA 3CUQB 1MGTA 1C0WA 5TJJA 4YFXF 3J81K 3WTTC 2OQRA 3T5XA 2WC2A 3DKWA 4A6EA 1KA8A 2FBIA 2ACJA 4HQMA 2EFPA 2VBXA 3QRFF 3F8FA 3D5LA 6PAXA 3LWFA 2Q2EA 3F21A 2PMUA 3J7AO 4KUMA 2PEXA 3ABUA 4ON0A 4Q48A 5D5UB 3W6KB 5AIPA 1KU7A 3M1EA 1U3EM 3L9FA 3P9IA 1LB2A 3CO7C 2V6CA 2XASA 3RDIA 2DW4A 2DU9A 3I64A 1SFEA 3FX3A 4Y17A 1BOAA 1ZG1A 3E6DA 1RUNA 1O3QA 2ZO4A 1D5VA 4N0BA 2RN7A 3LA7A 3EQLF 4I02A 4U7BA 1O3SA 5FD5A 3ZN0A 3COAC 2OAZA 5TRDA 4CXFA 1EH6A 3E5QA 1USSA 3V8LA 1RUOA 2NNYA 1KQ0A 1RZ4A 3W6JB 1R1TA 1IN6A 2EWNA 3DPTA 4WXCA 1SMYF 1R22A 3V7CA 5E1ZB 3K2ZA 3WTWC 2V9VA 1HSTA 4M9SA 4OIPF 5ERIA 2IA2A 1MJBA 1LNWA 2COMA 1KQ8A 1YG2A 3WGHA 1XCBA 3GVAA 1OYYA 2ZKZA 4I2OA 1FSHA 4HX7A 2O3FA 1LJ9A 3JAMZ 3BJAA 4OMZA 2KIFA 3RTRA 1HQCA 1ZRFA 2FF4A 4YG2F 4M73A 2XUBA 4UVBA 2W84A 1K78B 4Z2YA 2BGCA 5FFZA 3TQNA 5BS6A 4LG0B 5DV5A 4CICA 2PLYA 4IRIA 1DUXC 5CJ9A 4UXNA 1SD5A 2EFOA 5LRSA 2GQQA 4A12A 2FMLA 4R8HA 3IKTA 3I0TA 4WXDA 3LA3A 4O5VA 4GCVA 5HVQC 3HRMA 1UCRA 3GFJA 2L54A 5L3EA 3FM3A 1IZ1A 3CUQA 3HSEA 3E6MA 3IRRA 1HBXG 2V79A 1GXQA 4EMSA 2EA4A 5D5WB 2XAJA 2DT5A 2FA5A 4LJZF 3HYIA 2F5EA 3DEUA 2V1XA 1TNSA 1AWCA 2QUFA 4ESFA 1O57A 3WE3A 3ZN1A 3TOAA 2BBYA 4F7ZA 4U0VA 2DK8A 1U78A 1XGSA 2KIUA 4N9IA 1ZYRF 2XHKA 3ZMUA 5LHGA 3GZ6A 2QVOA 1K7AA 2EFNA 5JFRA 5A2QZ 2A5YB 3I59B 2VXZA 3RKXA 4EGYA 2P6TA 2UXXA 2JTVA 5H6RA 1STZA 1YS7A 2HFHA 4UHTA 3TOBA 1GXPA 1PP8F 4NQWA 2M45A 1QPMA 4ENMA 2RKHA 1WI9A 1L0OC 4EGZA 4G6DA 5L3CA 2H94A 5F1RA 3KZYA 2D1VA 3HRUA 2QLZA 4DQ2A 4Q47A 4RB0A 3L2CA 1K6OA 2Q8KA 5LGUA 4KN4X 5FLXZ 4IHTA 2HR3A 2CO5A 3PFIA 4G7HF 4IRGA 2Z33A 3DF8A 1DDNA 1S7OA 4AWXB 2Q0OA 4A5MA 2ZMEB 3JSPA 5K5QA 1OYIA 1JHHA 3BY6A 1CF7B 4EVIA 5BMZA 1YS6A 4P9FA 2LF8A 4KT5C 1BC7C 2P5VA 3HIFA 1XMAA 3IWZA 1U5TB 4IF4A 4A0YA 4FHTA 3V8KA 1K78A 1IXCA 1TQIA 2GXGA 4HAMA 4S04A 5FGMA 4LG0A 4B8XA 5JR3A 3CUQC 4XLNF 2XAQA 3HRSA 3KEQA 1ZRDA 1Z7UA 3ABTA 4EM0B 1FYMA 5KVRA 1ULYA 5HOOA 1XN7A 3LQQA 2F2EA 2G7UA 2RGVA 2R3SA 3C1DA 2PBIA 1UB9A 1U8RA 5ILSA 4ZZDA 2HDCA 2M30A 3GUDA 4QLCU 4A5NA 4HF1A 4GXOA 4HLYA 1TQMA 1TBXA 2A69F 2B0LA 1XSXA 1D3YA 4IXAA 1WQ2A 1O3RA 1KU2A 1WKMA 2NS0A 3BPXA 4KMUX 5E8IA 2PQ8A 2HTJA 4HDUA 1G3SA 1SAXA 3KP5A 1HKQA 2NAZA 1OKRA 3GFLA 1JGSA 1FSEA 1R7JA 4KN7X 2E1NA 2GIVA 5DUIA 2J5PA 2CYYA 4RGSA 1QGPA 2H09A 1G4DA 3RYPA 3KE2A 1P2FA 2BV6A 2IP2A 1FWZA 5JHUA 3REOA 2D1HA 3NQOA 1ON1A 3VB2A 3R0AA 4L18B 1S6LA 3QPHA 3SFZA 5DUKA 4HOBA 4CO8A 2QZ8A 2IVMA 3PQJA 3I59A 4OIOF 4PCQA 3FZVA 3F8BA 4ESJA 3KP4A 1KYWA 1XCVA 1P4XA 2LSOA 2PG4A 2Y75A 4MHGA 3CJNA 1BM9A 1QO0D 2MC3A 2ZJ2A 2A6HF 3GFIA 5EEHA 4LMYA 1TW2A 4OINF 3JW4A 4ZYDA 3JAMK 5J8CA 1IUYA 2FMYA 2VT3A 2OA4A 2DPUA 5K5RA 1S8NA 4EV0A 1KYZA 3IWFA 1T6SA 4BHPA 3B02A 1O3TA 1T39A 4U7DA 1FX7A 2ZMEA 1FP2A 5HLGA 3BOQA 5DYMA 2DK5A 1O7FA 4G94A 4RB2C 3SHFA 5LBQA 4OIQF 1OPCA 1CF7A 4LLGF 2HEOA 1HXDA 2XAGA 1J0RA 1R36A 1U5TA 3EYIA 2FOKA 4O3MA 3BP8A 2XGXA 4WF2A 4AIHA 1T98A 1FOKA 4CYDA 3L00A 4GO1A 3DXJF 1SD7A 5FB2A 1SMTA 2HKXA 3WU1B 1UFMA 1R58A 2QM3A 3ECHA 5CVRA 5BOXA 2IPQX 2ISZA 1Q1HA 1QZZA 1ZREA 3FMSA 1BI2A 3H3ZA 3CLOA 4G8XA 5ED4A 5A2QK 1MDMB 4LFUA 4LGWA 1F9NA 3T0YA 3ELKA 4I7HA 2IT0A 2OZ6A 3DV8A 1JXSA 4U88A 3RKWA 4L0YB 3Q9SA 3L7WA 3QAHA 2UWMA 1YIOA 4P5OA 2CW0F 1QBJA 1BBYA 4L9VA 3F6VA 3U9GA 5L3DA 2XAHA 3S2WA 3H92A 4OMYA 3QOPA 1IRFA 3P7NA 1LQ1A 3K0LA 4L9NA 2VN2A 3MQ0A 4JBAA 3BWGA 4U0WA 2YR2A 3NEUA 5FLXK 3F23A 3MZYA 2WWYA 5LEJA 2XVCA 4EJTA 1S3JA 1HW1A 1T0FA 3ZP5A 2JSCA 5ILUA 3JTHA 4UVCA 4BNCA 4LD5A 5LRRA 3RI4A 3IKVA 2YPRA 3ML6A 2EFQA 2OU2A 2CWEA 4MTDA 3KFWX 2C6YA 1ZRCA 2CGPA 2WV0A 3HTUA 2O6GE 3MCZA 4BAYA 2MBFA 1J9IA 1DPUA 3ZMTA 2CG4A 1U5TC 3IC7A 2P7VB 3C7JA 3P9CA 3N97A 3ROUA 4BQAA 1KU9A 5LGNA 2P4WA 1ZHFA 2M1BA 2LKPA 3R0JA 3KLNA 3BJ6A 1P4AA 2F5DA 3IL2A 2KRFA 2CQKA 3CO6C 2A68F 2EV0A 4R79A 3J80K 2AS5F 2NNNA 2QQBA 2FSWA 1TW3A 4EQQA 2JT1A 3JTGA 5AIQA 1W7PD 1RNLA 1T2KA 1LEBA 2STWA 2VE9A 1I6XA 5J6XA 3FMRA 3V8JA 2IA1A 1OMIA 1MZBA 3HSFA 5ICEA 2F5FA 4E70A 4UUVA 1LDJA 4HYEA 2AXLA 4M6XA 2J5OA 3IRQA 3O2PE 4JQFA 3E6BA 2XAFA 1ONVA 4G6QA 2E7WA 3BJOA 1SFUA 4WK8F 3QP6A 3I71A 4NHJA 3KLOA 2DI3A 1TLHB 4IHSA 2DQRA 3BZ6A 2MD5A 3F3XA 1R1VA 1R00A 2GWRA 3RIRA 1A04A 2UXNA 5K1YA 3SXYA 1CGPA 1AOYA 4EJUA 2HS5A 2HTSA 2O03A 2KJBA 1UHWA 4HX8A 1MDMA 3VOEA 3DQVC 1B9MA 5F64A 2M87A 1QQIA 3M8EA 2E1CA 2ZNYA 4XSXF 4ZYEA 3VODA 5D8KB 4MEYF 4ENNA 2G7HA 4S05A 2ETHA 1ZG5A 3FHZA 3DFGA 2JRTA 3CDHA 1LVAA 4M9XA 3QU3A 3KP7A 2DLLA 4MGRA 2FEZA 2VONA 2HOEA 3FXQA 2P5KA 1U2WA 2VT2A 2L4MA 3F72A 2FBKA 2CSOA 2HKOA 3T1BA 2DTRA 4OOIA 1R23A 5J8FA 2IA0A 2VC1A 2DQLA 3SQNA 1OR7A 1F1ZA 1BJAA 3LFKA 5L3GA 1IN8A 3U2RA 4XRFA 1BN5A 3ZMDA 3C18A 2RDPA 3CTAA 1FYLA 3GW2A 2XKOA 2P6SA 2ZNZA 3BPVA 3M9AA 4TV7A 2MH9A 2A61A 3Q9VA 3GYHX
chains in the Genus database with same CATH superfamily
1Y0UA 4C9BB 4JK1X 1S5LC 2GRNB 5FQ7A 2WV1A 5FLVA 4MLOA 3QODA 4HLLA 1MH3A 5D0OD 1YJ9I 2V5FA 2LLKA 4LG6A 3I58A 1YX3A 4EJWA 1R49A 1YJWI 3ZQIA 1MX6A 3S3NA 3HHMA 2A07F 2M8EA 1GV2A 2FU4A 1ON2A 2WM9A 4LLNA 1IKND 2V4LA 2NVXJ 2ILRA 3LXUX 3BQZA 3RZDJ 3OIQA 1K8KG 3HHHA 3R9AB 3KETA 3V42A 1U8BA 5BNGA 2R7SA 3BG6A 2C2LA 2RFMA 1OLTA 3MGBA 1ZU2A 4EJOA 3G2BA 3KCCA 2NXNB 2Y1LE 3HUGA 2CFZA 4Q96A 2WXNA 4ZTFA 1IRGA 3T9KA 2KIMA 3LSKA 4LK0F 4F92B 4E85A 2ME0A 2ONDA 1LDKB 2M4KA 5CLSA 4B3AA 2NRAC 4ZZLA 1D0XA 3NWTA 4CGZA 1HU3A 2ZJPF 4WAFA 1LFUP 3D9NA 2FUG2 3J80Z 5HS7A 1FT9A 1ZN2A 2JZYA 2KDOA 4B47A 1XS9A 1G59A 1V4RA 4PS3A 3P1UA 4D5CA 4JVSA 3MA5A 3OXLA 3CHSA 1FBQA 2FNAA 2R2LA 1XSVA 3DTEA 1HOMA 1TT0A 4KJZA 2QQ9A 1O1SA 1E7VA 5EIBE 1K79A 3R6SA 2M7AA 2HOAA 3PSFA 5FKOA 2L02A 4C0MA 2QQ8A 3A0BC 4H4KC 1F4KA 5JHFA 2GIZA 3QQAA 3F8CA 2BYVE 2KP6A 3F8NA 4BEHB 3JR9A 2CFXA 3FTZA 3S2AA 4LCTA 4AXHA 1YHQI 3FKIJ 3DPLC 4MQVA 2CH0A 2PMZN 3DBLB 3Q9NC 4OAVB 2FBHA 1R1UA 4PSXA 3QP5A 1UN8A 2OV7A 2O61A 3TKYA 1BI3A 2HYGD 2Y69H 3QU6A 3OS1A 2VQGA 5E17F 3KSLA 4G24A 3AAFA 4B0ZA 4N2SA 3LAJA 2JA8J 4IYPA 1R4NB 2KRHA 2WBMA 3TDZC 2V1UA 1MD0A 4WWNA 3B7SA 2EINH 4FE4A 4U96D 2OQGA 2R7TA 1P92A 2LRDA 1IV6A 2LD5A 4M6YA 4CZ2D 3RKYA 1S0PA 3O8HA 4ZHBA 4ZH4F 2CUEA 4BUPA 4M72A 3C98A 3QDNA 3L17A 5G04C 3CHRA 1BA5A 4GYWA 4IJAA 1ZTRA 2YQ8A 3IBEA 2QSGX 3NZSA 4RAYA 2DFFA 3Q0UA 5F0CA 1SC7A 4W1UA 2QYOA 2J08A 3CVYA 2M63A 3GZSA 3VYSB 2DFIA 3IP4B 4PK4A 3GTJJ 2DBBA 3SFIA 3G73A 3C2HA 1A35A 3E30A 4L5EA 4UWGA 1ZBPA 3OYEA 2XF7A 3UTMA 2CW8A 3FK6A 1WH5A 4ZC3A 3NRVA 1X81A 1J75A 4E6KG 3FH7A 1DCQA 4I1AA 2DN0A 1I1SA 1HF0A 4K5CA 4M3OA 2GZWA 1GDTA 4URKA 4UV9A 2VQHA 3PUJA 1FT2A 3HRTA 2RVCA 1U6GA 4X6AJ 2Y69E 4ETSA 2KC7A 1OR7C 3FF5A 4RG9A 2R92J 2EZLA 4FULA 1U9OA 4I0AA 5E3NA 4IO9F 4RLFA 2EINE 3KYDB 4BYYA 4WNFA 1LFPA 5F08A 2LKXA 4I6JA 5L3FA 3S32A 2GA2A 1HDDC 3F22A 4A6DA 2W24A 1MW7A 1KZPA 4HLEA 4RMNA 3TO7A 3TXNA 2Z9OA 3WU2C 4DLQA 4FHKA 1HKSA 1ZG3A 2ESHA 2RAEA 3CJQB 4M3EA 5KK1A 5JLWA 3WGIA 4H7XA 2JRMA 5K7HA 3PEUB 2DA4A 5JLXA 3TO6A 1OWPA 5CMWA 4EM1A 5J1UA 4A3IJ 1VQOI 5HS9A 2NYXA 2AQEA 2AJAA 3Q15A 3KZZA 3RIBA 5BPDA 2BE5F 5FD6A 5C3EJ 4DPRA 2LNBA 3E1SA 4KIBA 3FXOA 1WRJA 5BW8C 5CYVA 1IAWA 2XRLA 5HKPA 5FZRA 1E2XA 3TEDA 2NSZA 4RAGA 2JSPA 1WJFA 2OF7A 5DM6F 4KXKB 3K70C 4JYKA 4V2FA 4XOPA 4KMFA 4G23A 4L9TA 4AOFA 3K69A 5E1WA 4WX9A 1FTZA 1JWFA 4GTOA 3QWWA 2W25A 2RV8A 2VPRA 1FMWA 4A69C 1GUUA 2XPIA 3CHPA 2HVSA 2F4MB 4GRIA 2EFWA 2IOSA 2ZCWA 1INZA 4MTEA 5D5XB 2X0LA 4CCNA 4DK5A 1OCRE 1PJRA 3W2VA 3HGYA 3JRFA 3I4RB 3RYRA 3HKZN 3LPZA 5E8GA 4KBQA 2M3AA 4U8YD 4C3HJ 1HW2A 3I3NA 3ZMVA 5J3LA 3MKRA 1A31A 1YO5C 2HNHA 2CHZA 4BTAA 1X1CA 4RB3C 4I1MA 4XRMA 3QWPA 4M9ZA 1LEAA 3E4BA 3MZHA 4LK1F 2VKVA 2IU1A 2XEHA 5HLIA 5FKLA 3SF4A 2IS4A 2A3SA 1Y8MA 3L13A 4XI9A 1Z91A 3WG9A 2JUGA 3MEXA 2V4HC 4HOTA 2L0KA 4RM3A 3RJPA 3FUNA 4N9HA 3TAXA 3QJZA 2CUFA 2K9NA 5IT9K 3LSRA 5HS0A 3E34A 2R7WA 2J07A 2M8GX 3PNTA 1G3YA 4F1PA 2H27A 2PMZA 1WGXA 3TWWA 4CDRA 1DQUA 2DCEA 1A17A 5BV1A 2ZISA 3EUAA 2UY1B 3EUVA 4BHBA 5HS8A 3K1PA 2HXOA 1TWGJ 1NG6A 3O6BB 1Z9CA 3RKVA 3W2WA 1FY7A 3ZHEB 2QENA 3ZVVA 3ABKH 2AW6A 4L9PA 3WHBA 2R7UA 2AVPA 4FU3A 4DI4A 1N95A 2QQAA 2VE8A 4HXIA 1ERDA 3CCYA 2YHEA 1I3AA 4C3IJ 5J4YA 4WCGA 3C3OA 3ASNH 5IPAA 1K4TA 4IRUA 1HKTA 2AXZA 4OVVA 4AIJA 2QWWA 2K9LA 3F8MA 2A5WA 4WXHA 4AVZA 2A6EF 1H9GA 4BXUA 1HH8A 2WXHA 3CEQA 1SFXA 3ESWB 5CECB 3EHMA 2HQNA 2BEOA 9ANTA 5EEGA 1Z6TA 4I17A 1YQAA 1X4PA 3OL4A 1ZARA 1U3DA 5ICCA 4RBOA 4BE2A 2I9CA 1Z5SC 1J59A 1NP7A 4E7SA 4I01A 3WE2A 2OJED 1LVKA 2H6BA 4OU0A 4CH7A 3PDNA 4BDYA 4GZDA 3G3ZA 2P5LC 2WXKA 3C5RA 1XGNA 2L3DA 2A5UA 3L16A 1HSJA 2DBAA 3G2UA 3LMMA 5CRVA 5B1AH 3G6EI 2O0YA 3AS8A 2OCEA 1BW6A 2JVHA 4UVAA 2EK5A 3L2QA 1ZH5A 5AQAA 3C3QA 1FNNA 3QWVA 1UG2A 1Y56A 2EV6A 1GVJA 4RGRA 2LH9A 3F9KA 4IX7A 1TNOA 3G2TA 1HO8A 5CVVA 4HOUA 2H1KA 1SAUA 2W57A 2HYFA 4JX6A 2YSRA 1B9NA 5A6CA 4FISA 4PUCA 2FNPA 1XSDA 3ABKE 1RIOH 2DXIA 4DX2A 2H6CA 4APFA 5HDGA 2AHQA 2KPMA 5E75A 4NB5A 3VYUB 5F0HA 2XAUA 4Y6WA 3ASDA 3ZMSA 2BY2A 4RLQA 4UWFA 3ASNE 1TN7A 3U9WA 2DO7A 3V2XA 4BEHA 3ZKJA 1E8WA 4A2UA 3HOSA 1L3LA 5FQ6A 1BI0A 3O4ZA 3BCBA 1RETA 3H5AA 3L2RA 1VQ4I 5IP6A 2B7EA 1YOVB 1KONA 3FXUA 4RAZA 4GZ3A 4NUBA 1MNMC 4XIDA 3UM2A 5TISC 4ZDPA 4BJTA 5GTIC 4BHCA 3PZ4A 1AU7A 4MEXF 3LL7A 2IW5A 1XGMA 1OCOH 3AS5A 4KICA 4P55A 3ZQFA 4U8VD 1WJ5A 4K2EA 3TGNA 4HZFA 1G3NB 5B1AE 3I54A 4UY8I 1SZAA 4DI3A 4XLEA 1YX5A 1G3WA 1HW5A 2PN6A 1W0TA 3KPHA 1DGRM 1WSUA 2E2JJ 2XZDG 3Q47B 4JB8P 1OYWA 2CQ7A 5AENA 5LCWC 3GTGJ 4U0SA 4L1BA 1HCRA 1WZ2A 4A3LJ 3FUHA 1YMPA 2YX4A 1DCEA 3JXIA 3UXGA 3D5RC 3CKBA 2VKDA 2F37A 2L4AA 4GYOA 4GTPA 4BJ6C 2PM7A 3HKZA 3JXJA 4HI8A 4YFKF 2VBZA 3AKZA 3IUOA 5B3SH 1XDUA 5D4SA 5GPCA 3HTSB 3PJRA 2XGEA 1WWXA 1IG7A 1TNYA 5ARGA 1H6KA 3VLDA 4MNUA 1BI1A 4CZZA 2IRFG 1OFCX 4JPSA 1TJFA 5FKMA 2LVSA 2CV2A 5AONA 1MMDA 3B73A 1UJKA 4UI9J 2XDVA 1W36C 2MG4A 3ERED 4J19A 4XLCA 2LKSA 4A0ZA 4HX4A 4IL6C 4PS7A 3VSLA 2QBYB 4D1QA 1Q2ZA 1ELKA 2GRMA 2PZIA 3NZUA 3ZFWA 4YDWA 4HDVA 2XRNA 4YFNF 3L6AA 1W1WE 3RSNA 4JOMA 3ASHA 3LSTA 1N4QA 4DYCA 1I1GA 2XF6A 3HDDA 2NVTJ 3MZ8A 3ZYKA 1XGOA 3HXLA 1FBUA 3I53A 1LFBA 3BR2A 5LFAA 3R9MA 5CQEA 4DNCA 3D9PA 5JI6A 1LPQA 1N54A 4UV8A 1W5TA 2EZKA 4I76A 3RPUA 4P96A 1TJCA 3KAEA 2VOPA 4WUYA 5IP7J 4A0XA 3VTYA 1TP4A 1MBEA 3SJMA 3V7SA 1KZHA 3TWTA 3TWQA 3EUHC 4DBQA 4B1RA 4HG2A 4HV6A 5E1XA 1YITI 2KFDA 4ILIA 1SD6A 1FTTA 5H7PA 1TNTA 3QPTA 2ELKA 5M5WJ 3U66A 2RNJA 4RGXA 3GF2A 3GEZA 3V7RA 3WTXC 2YHCA 3TO9A 3EU5A 2XKPA 2Y0MA 2VBWA 2ELJA 3MAJA 3S2DJ 3ZPJA 3P9KA 1S70B 2ZJQF 5B5EC 4TRQA 3DLAA 5L3BA 1KGSA 2FE3A 2RQPA 3I5UA 1GHCA 4N3AA 5T4YA 3S7JA 1D1BA 4FX0A 1S64A 1IXRC 1R5ID 1Z21A 4LOCA 1SA5A 2HGCA 1R5GA 4TUUA 3M8JA 3TL5A 2L2OA 4PUSA 3QARA 3ZQ7A 1G8XA 2GOXB 3AS4A 2WMOA 1O7LA 3FU5A 1E7UA 2Z99A 5K7ZA 4HRNA 2LDUA 2GM4A 2X6YA 5LHHA 2KCVA 4JA7A 3PO2J 3W9FA 2QSHX 2BVLA 4FASD 1FYKA 3DRAA 3MD2A 4L2LA 2IXSA 3R60A 2VKEA 4B93B 2VTBB 2WTEA 2DPDA 5EKQD 4A3VA 1SFOJ 1O1RA 4P9UA 2FRHA 2ZJRF 1KQ9A 1T33A 5CMYA 3JYSA 2KKOA 3CVVA 3JSOA 2XROA 4KISA 1UG3A 2W48A 2BF0X 5AQBA 4FC8A 2HWVA 5FQ8A 2PFBA 4J00A 1JJ8C 5EX3A 4CYMD 4RS8A 2LBFB 3OS0A 3W3CA 2FXAA 2ZXHA 4M6VA 3OYNA 1IF1A 1N4PA 2OVBA 3DPYA 3DKXA 2GLOA 1Z1DA 2ID3A 5D6FA 5IT9Z 3UT8A 2UY1A 1G3TA 3N4MA 1H0MA 1JGGA 3CVWA 4GTQA 1TN8A 4HQDA 4IPAA 5HQ8A 5D8LB 1YLFA 3HEFA 1HC8A 2DA6A 3BQYA 2CUZA 4RGUA 4GGGA 5JVTA 3PL8A 2OBPA 3VSKA 2B63J 1RR7A 4N5QA 2ISYA 1X2MA 4L9JA 3WG7E 3ZHEA 4LNBA 4BS9A 2F4OB 2XENA 2IJGX 1ENHA 2PJPA 3MV3B 1D9SA 3GXOA 3S8PA 4N4NB 2VLAA 4D0PA 1PUEE 4F91B 4CDGA 4UUSB 4LEUA 3PUBA 5EYLA 1FLIA 4G7OF 2DT7B 2WXRA 5BXOA 3L2WA 2B9SA 3GZ2A 1BI8B 3BR0A 3HC7A 1I50J 4ZYGA 2RC4A 1UHSA 3KYLA 2XF5A 3HOTA 3W9GA 4CGVA 5EDSA 2W7NA 4BU2A 1QYMA 3MKLA 1PDNC 5DCFA 4HA8A 4DX7D 3K1NA 1OXJA 3BR5A 2X6JA 4BBRJ 4KIGA 1JWGA 4ENJA 3GTQJ 3TMOA 1DU6A 3E5UA 3V4GA 3GX4X 1JPLA 2NS7A 1Z7LA 1W0UA 1YW7A 3JRDA 1YW9A 5FFXA 2LR8A 4PGGA 2ZXJA 4PZJA 5D4RA 2C0LA 3MWMA 1P5QA 1V54H 4CA0A 4RSYA 4B44A 3SZPA 3M8FA 5CVIA 3PE4A 4B8AA 1FZPB 2ZFWA 4G9YA 2QCOA 4MQ9F 4EJVA 3W2AA 3EJNA 3UNGC 3K9TA 4AM9A 3NBNB 3C3RA 1ODDA 4FHJA 2L01A 5FRNA 2LXMA 1REPC 5M3FJ 2F5CA 4H0EA 5IYDJ 4L0ZB 3E5XA 5D6EA 3FMQA 1TYQG 2X3MA 3SDBA 3ZW3A 2H6FA 1FBSA 3ABLH 1SQMA 4UB8C 2E7XA 2LG4A 2FX0A 2YX7A 1TQPA 1QPIA 3BUAA 2BOLA 1FIPA 4FP7A 5LEKA 3VTXA 3CLQA 3DSUA 4XM3A 1P4WA 1G6NA 1QA6A 4M74A 4DW6A 3J81Z 2DMTA 4YIFA 3FU0A 3KP2A 4I2ZA 5CHEE 5F1JA 2OZUA 1Y1VJ 4B3XA 4CHUA 1IXSB 2Z16A 4KA4A 5DEQA 3ASGA 3KD7A 5AJLA 1R5HA 4CT0A 4NNJA 2XB5A 3F6OA 5AYWD 2CS3A 2M5WA 3MFKA 1MKMA 1EV7A 4RB1A 1OY3D 4EBAG 2X9DA 3D0SA 4L23A 4A3TA 1NI1A 3VLEA 3R61A 3TDUC 4G8KA 2R7XA 4IVNA 3PUKA 4ZYHA 5JVGF 3C72A 2JJ7A 2KT0A 2ZBKA 5F6FA 1RI7A 4AVPA 2BEDA 3FTXA 3LKUA 2J49A 2OEWA 1D8JA 4PJLA 2EB7A 4M3FA 4Q5SF 2R7OA 3UPVA 5HRYA 1V54E 3EETA 4DYRA 2JA2A 5DM7F 2K02A 3H35A 1IXVA 4XMYA 2MLGA 1A6QA 4BXFA 1EF4A 4BTBA 3EDPA 1YYHA 2IS2A 3CCVI 3DXMG 2IJLA 3R4KA 4JHRA 3GFMA 4EM2A 1AHDP 1EPUA 5JMND 3RPQA 2EIMH 1E3PA 2CHWA 2P0WA 2R05A 2DDAA 3WGGA 4BQOA 3ABLE 2VJ4A 1XD7A 4C30A 2KRCA 1K83J 2KDZA 4ATZD 4B89A 1YRNB 4A1SA 1X1DA 4L7TA 2W85A 1F43A 2Y3AA 2VSXE 3TG5A 3M07A 2E34A 5FJ8J 4BFRA 4OIRF 4AP2A 1W7PB 4Y7NJ 3ZN3A 1XDSA 2P8TA 3DU6A 2WA0A 3UINC 3CF5F 5CBNA 3MJWA 3DBRB 1KPSB 1O5MA 3PREA 4LB5A 4MFEA 2K3PA 1BL0A 3TWSA 2I1KA 3KX2A 1NA0A 4M71A 2WB1N 2RD0A 2GXBA 2ELHA 2Y30A 2QBYA 3BLYA 3UI2A 4B09A 4HORA 4J8EA 3SNXA 3PQKA 4GYGA 3HPGA 1XMKA 1NHAA 3GO5A 5GP9A 4BDZA 2FQ3A 4HQEA 4I98B 3K7AJ 5BQTA 5LGTA 2YNQA 4NURA 1SW6A 1T56A 1FP1D 3SZGA 5IT3A 1YW8A 3BG9A 4O6JA 2JPCA 4D5FA 2JQ7A 2D2WA 4J7WA 4KMOA 4YDOA 4LITA 1FC3A 2GA1A 3FIWA 1S7AA 1BC8C 1TZLA 4KFCA 1EH7A 1SZ9A 3IV5A 5EG0B 5ICFA 1JCSA 4LIVA 1YIJI 1PY1A 2IF4A 4B94A 1J2XA 2IQCA 1B6AA 3I4PA 2EIME 4KNYA 1DP7P 3PRZA 4FT8A 4ILGA 5LCWJ 3EYYA 3E97A 4GYYA 2HZTA 2HU9A 5H2FC 4HF2A 4I09A 2Y0SN 4QSHA 4EATA 1TWAJ 1XTAA 4IRHA 4JHKA 1OT8A 3QC1A 3RAUA 2OD5A 3A0HC 3K4CA 2VASA 3B6CA 2VYIA 1B59A 2H8WA 2IFUA 3WODF 2X6HA 1EH8A 1S72I 2VODA 4UQYA 5J4VA 3HXCA 2NVUB 4Y4RA 4L5JA 4CEMA 3QKYA 2XV4S 4JEHA 3LAPA 1ZLJA 3T8TA 3MEKA 2HXIA 5FINA 1ZLKA 4KYWA 4LB6B 4UUCA 2JUCA 3ONQA 3ZQLA 4U04A 1BOBA 1MMAA 1UG0A 1OJLA 1HDPA 1Y1WJ 4XLPF 5GPAA 4U0YA 1XMXA 1VTNC 2EV5A 3N71A 3E32A 2M4GA 5GAGJ 1MNEA 5CPRB 3VYTB 3OYIA 3RO2A 1V3FA 2LF7A 3HXBA 3NOCD 3ONKA 1BIBA 3U1DA 5ITZF 5E3LA 3BROA 5LLQA 3Q5FA 2NYJA 1Z6RA 3L9TA 1OCTC 2DFHA 2HDWA 3GWZA 2VUMJ 4XIFA 4X0GA 3LCAA 1ZR4A 3Q7AA 2QKLB 4AD9A 4AUXA 2DZNA 3S17J 4HF0A 2VTBA 4HB5A 3KP3A 2EJRA 4AYBN 4I2WA 3CESA 4J0UA 5AQ9A 3L22A 2V9PA 1ZAOA 2J9QA 4F53A 3ISPA 2R7DA 5DDGA 2FBNA 2Z3YA 4PDKA 2L9SA 5FT9A 3OOUA 2LBFA 2F0YA 4UI9K 2K27A 1HA8A 2ADUA 3SZTA 4CT4A 4GYIA 5D5VB 3AG1H 4ZTJA 2P7CB 1YYVA 5LHIA 4IOAF 4HV5A 2PI0A 4XSZF 2DMQA 3LNQA 2ETCA 4GCNA 2K86A 4Y13A 3FWEA 1P6RA 3HHGA 2F8XK 4I43A 3R7QA 3I5PA 5EN5D 2ID6A 4P1WA 2VIXA 3ZGKA 4G11A 4JEUA 2Z5UA 3ZYLA 4UNOA 2CFUA 4ASNA 4PGHA 1N94A 2MA3A 3DTIA 3CVLA 3QK0A 5DCMB 1X5BA 4GB9A 3M4OJ 3PFYA 1E3OC 5E20A 1IW7F 2LAHA 1I27A 3ONLA 3EIJA 1DU0A 4UUSA 5DD8A 2ZXWH 2MLKA 4FX4A 3FXRA 1F36A 1USTA 4AY5A 3BTLA 4J8DA 3I9V2 1MJAA 3K4NA 5CVJA 3S93A 4EECA 3DP7A 3CVXA 3SYTA 2KBXA 2M0MA 2X1DA 3U3WA 5AARA 1QNTA 2V1DA 3WU0A 2PMHA 1MBFA 1ETQA 2X6KA 2MOWA 2KJCA 4HW0A 3G2VA 5CQGA 1A5EA 1BI7B 4KYOB 4BH9A 5GAHJ 3BDDA 3WTYC 4KIFA 1RW2A 4HSTA 2XGDA 4RA2A 2WPVA 4KZCA 1X3UA 3EUKL 3KEOA 2AWIA 1FPQA 2Q2EB 3HXEA 1JHFA 2VGYA 4U63A 4JA9A 3FXMA 1E90A 3DSVA 5CEDB 3FXKA 4F1SA 1TTYA 1JE8A 2VI6A 2WB1A 1VF9A 4ANVA 3H0GJ 4TXPA 4R1HA 3K4JA 1ETVA 2TCTA 1N75A 2VC0A 3SBTB 3ZEFA 1SANA 3CUOA 3ENEA 4KT6B 4ZFHA 1LDDA 3Q5MA 5FRMA 4RDUA 2P9LG 2XIGA 1W4MA 5HI7A 2CFOA 2LP0A 1IN5A 2MH2A 5DTDA 5M3MJ 1E17A 1WDYA 4J8YA 4V19K 4NACA 4WWPA 2ZXWE 1ZK8A 2E36A 1SD4A 3D9OA 4G2VA 2X1CA 1RC9A 3UT7A 1ELRA 1GLNA 2G9WA 1K4SA 4LERA 3DSWA 3M7GA 3JUIA 4QWQA 4J8FA 2IGMA 5IOZA 1YA0A 3HOUJ 2PX9A 4Q4ZF 2TDXA 5IOYA 2Y0SA 1BIAA 2DAOA 4NRHB 1DGWY 2XGMA 3B6AA 3ULQB 4O6FA 4ABZA 3E6CC 4O1PA 4OVUA 2DODA 3ZOBA 2EA2A 1R71A 3CVUA 1TNZA 4ACLA 5EGOB 2KZGA 4L5IA 3BG0B 2VQLA 3IAS2 3WTSC 2XPVA 4E7KA 2R02A 1ZGAA 1H9TA 1XPXA 1OCPA 4NC8A 3WTZA 1P7IA 3C3WA 3FM5A 3PM1A 3OIOA 5EDNA 3NF1A 3JRCA 4ANUA 4DRXE 2BXZA 2K4BA 3M3YJ 1EA3A 5ARFA 1Z05A 1B8IB 2E0IA 3OOPA 1I5ZA 3LQRA 3PNVA 5DD4A 3OYGA 3ML9A 2VOOA 1J7KA 3MYVA 2DA1A 1D0ZA 2LYCA 3DEOA 4EZJA 3SY2A 1GT0C 1YRNA 3L09A 3GZ5A 5H6QA 5HDNA 2FQ4A 3D5SC 1ZKGA 4ESBA 1ZGWA 3BEEA 4AV7A 3VFZA 2R0QC 1BD8A 2HQRA 3HOZJ 1SFKA 2XEEA 2KCLA 4GU5A 4J8SA 3MKZA 1W7PA 1MJ9A 1FCHA 3RK6A 2XS1A 3RQIA 5HNHA 1YTYA 1JJ6C 3BQOA 4F93B 4A93J 4EQFA 2VBYA 4DJAA 3IH3A 5HLHA 1X2NA 4AYBA 3B13A 5J1YA 3LY9A 3Q7FA 3OY9A 4EZLA 1CQTA 5HDKA 3HOWJ 2WXLA 4C2UA 3IEGA 1T38A 4MLPA 4BSZB 2NOJB 3H3UA 4UQZA 3ZPLA 3IHVA 3DKYA 1J5YA 1OCCH 5J40A 1A6IA 3VEPA 3LJ3A 1IN7A 3IHUA 2QA4I 5FTPA 3TWXA 3JCUC 3T8RA 2GROB 2BY1A 2JVGA 3L54A 3TJPA 4BESA 5BT1A 3ECOA 4MBGA 2W82A 5G55A 1ZGJA 2O8KA 2K3FA 3I3LA 2JPBA 4UWKA 2XSJC 2YU3A 3HB9A 3TW7A 2K4JA 2BVMA 5EG0A 4IQJA 1UHMA 2NS8A 1IV8A 2NVYJ 3FDYA 4KDPA 5AQ7A 4HLXA 4UB6C 4FJYA 3O3KA 2VKHA 1KLXA 1XGWA 1X1BA 5ILVA 1HZ4A 5K5OA 2BZTA 2WXPA 3H9JA 2ESNA 1WH7A 3ZQCA 2QFCA 3NQPA 4JXTA 1S29A 2Y48A 4Y15A 2HPMA 1D5YA 1F5TA 1IQUA 4AIKA 1KU3A 1QZYA 5EIDA 3EUHA 3OV8A 1B1BA 4NC6A 1NK2P 2V0PA 1HX8A 4RG6A 3HSRA 3MCXA 3F6QA 2JMWA 2WQ7A 4YIIA 3MKQB 4ENKA 1WY6A 2NXPA 4HS2A 1XB4A 3AG4H 3GLXA 2E1OA 3H3VK 3AU4A 5M5XJ 4XLAA 3HL2A 1QZEA 4HBLA 5BPIA 2Y2ZA 2XQ0A 5FZSA 2E1MB 2P2CP 2MRIA 2RNGA 3H36A 3QAQA 2UZKA 3S3OA 4V3IA 3D9LA 3PVLA 1DPRA 2PNNA 1DP3A 3FTWA 3CMMA 1D8KA 4BE1A 1IN4A 4DX5D 3LA2A 4D10C 5FO5A 2O8XA 2R7FA 2VXDA 2AO9A 5H20A 3CCSI 4G7ZF 4BETA 4ABNA 2GGFA 4IHVA 2X4HA 4XKCA 1A36A 5ICGA 4Y52J 3FUIA 2LC2A 2JEKA 1T8IA 2GAUA 3OYLA 3KP6A 4RLYA 2MSYA 2STTA 3G4SI 4LLLA 3HYMB 4K5BA 2OTLI 1XNFA 3WTUC 1YFHA 5E18F 2IOLA 1A5JA 3D9IA 4DZJA 3DWLG 2JLBA 3CCLI 2B0OE 3RRNB 1SVOA 1MIJA 4WWCA 4FJZA 4I0BA 2D45A 3FTYA 5BNWA 3K1MA 3ZMZA 4GTRA 4N5CA 1RRJA 3AG4E 2PJRB 1IGNA 1N4SA 3CHOA 3JREA 1B4AA 3WTVC 2HE0A 5CVUA 4EPZA 2K7LA 3BTCA 2EIJH 1TWHJ 1BR2A 2HZDA 3MVPA 1PP7U 3E3VA 1W5SA 3APCA 3LY7A 4XBFA 5DCMA 5ENPD 3CUQB 1Q1VA 5KAFC 1MGTA 2E35A 4EEFG 4E7HA 4QPQA 5ANRA 1C0WA 5TJJA 4HNVA 1D8EA 1MX4A 3TW6A 4YFXF 3J81K 1LTXA 4A3DJ 2FULA 3WTTC 2DOFA 2QC9A 4BJ5C 5LX8A 2OQRA 3T5XA 1VQ8I 5KWDA 1V5EA 1UMQA 3TG4A 2WC2A 3DKWA 3H9QA 2LMDA 4PFPA 2LREA 1KA8A 4A6EA 3CC2I 4G6TB 3UM0A 2WXMA 4EHMA 2FBIA 2ACJA 1ETWA 1S63A 4HQMA 3FUEA 2EFPA 2VBXA 3CVQA 3QRFF 2H8RA 3IV0A 3F8FA 1SA4A 3D5LA 1TC3C 6PAXA 4IQ4A 3LWFA 3FDHA 2Q2EA 1AWCB 3F21A 4HBDA 5ENSD 5E3MA 2PMUA 3GZ1A 3J7AO 4KUMA 2PEXA 3OMYA 3ABUA 3G71I 4ON0A 4HOQA 4Q48A 3GYZA 4ZJZA 4Q69A 5IY5H 3G2WA 5D5UB 2KZTB 4HFGA 3W6KB 3TWRA 3FBIB 5AIPA 2WY7Q 1EJ9A 5LOZA 2WY8Q 1KU7A 3K70D 1W3BA 2EIJE 4HRMB 3M1EA 3H1CA 4F52A 1U3EM 3L9FA 3P9IA 2DYSH 5JJTA 1LB2A 5CCLA 3CO7C 1V5FA 4JD2G 1MSEC 1JUMA 4IZZA 1MBKA 5G2NA 2V6CA 2DZOA 1Y8RB 2XASA 1UOHA 3RDIA 3ZYMA 2QSFX 1Z67A 2DW4A 2DU9A 3I64A 1SFEA 3FX3A 4ACKA 4Y17A 1BOAA 1ZG1A 1RKWA 3E6DA 1FOXA 4LNGA 2KL4A 4BE0A 3S1RJ 4C2TA 3D1NI 4NQ0A 5CBOA 1RUNA 1O3QA 2WAFA 2VGXB 4B8CB 5J08A 4A3JJ 1NK3P 3Q4AB 2Y31A 3UUXA 2ZO4A 3O8GA 1D5VA 3DSSA 3A03A 5K7FA 3ULQA 2L7ZA 4AVXA 4N0BA 4LUNU 2RN7A 3LA7A 3BG1B 4CYCB 3EQLF 4NQWB 4I02A 1AKHB 3APFA 3AU5A 3KSQA 5EGOA 4U7BA 3J7ZI 5CKTA 3ZUVB 1O3SA 3FTVA 5FD5A 2BKKB 1QRYA 3I4MJ 3ZN0A 1OCOE 2CMPA 3COAC 2IO2C 2OAZA 2HVRA 4GMJA 5IY5E 4A3KJ 5TRDA 4CXFA 1OCZH 4HOSA 1B8IA 4F7AA 2R7QA 1EH6A 2BHYA 3E5QA 3QPLA 1UW4B 1USSA 4NDLA 3V8LA 2JA5J 5JA4D 1RUOA 2NNYA 2VB6A 4A63B 1KQ0A 1RZ4A 3BR3A 2FO1E 1R6RA 2IBDA 2VJJA 3W6JB 1R1TA 4XLFA 1VNDA 1IN6A 1N9AA 2E2EA 2GRQB 4WWOA 3QPSA 2KLOA 2EWNA 3DPTA 5G04J 4WXCA 2EILH 1FEXA 2QGUA 1APLC 1SMYF 2FD5A 3CQCB 1R22A 1FMVA 3V7CA 4IHXA 1N11A 2MHKA 2X6FA 5B3SE 3CSTA 3MV2B 4IN3B 5E1ZB 4LIUA 1YE9A 2EQRA 3GCMA 3K2ZA 3OYKA 2X6XA 2R7RA 3WTWC 2V9VA 2R93J 1HSTA 3ESLA 4ZYAA 4M9SA 4OIPF 3MX3A 3QOUA 5ERIA 4XE0A 1H6PA 3CHQA 2F6CA 1K3ZD 3L08A 2WQ6A 2IA2A 4QTRA 1MJBA 3OYBA 4BY1J 1LNWA 2COMA 2ZMEC 3BG7A 1KQ8A 2ETAA 1YG2A 3JQ0A 4DLOA 4XR6A 3WGHA 1ZELA 1UJ8A 2ZSHB 1QVTA 2QF7A 3RKQA 3I4NJ 4ATGA 4HNAD 1XCBA 4BKXA 3CV0A 3IXEA 3GVAA 1XX5A 4O1OA 1OCZE 2LXLA 1OYYA 4E7ZA 2TRTA 3URZA 2ZKZA 4I2OA 1FSHA 2O5RA 4BL0B 4GMLA 3DWLE 4HX7A 3FEXA 3LEWA 3FTSA 2W00A 3TWUA 5C4XJ 2R17C 2O3FA 4D9JA 1LJ9A 2OVFA 1WHUA 5AJDA 4Y3OA 1WPKA 3CK9A 3JAMZ 4ZDLA 2XHEA 1H6OA 1N52A 5F0FA 4DYQA 5D0QD 4G25A 3BJAA 4BWRA 4OMZA 2EILE 1BPOA 2A6TA 2KIFA 2L7KA 3RTRA 3MKQA 4LNUD 1HQCA 2K5CA 2X51A 5E79C 2FF4A 1ZRFA 4E7LA 2LSUA 1IRXA 3A1YA 4YG2F 2M9HA 4M73A 3S14J 1LE8B 2UV1A 2XUBA 2IEJA 4X8QA 4C9YA 4UVBA 2W84A 1K78B 2HR2A 5ENNA 4Z2YA 3UQ3A 4IKFA 2BGCA 3K10A 5FFZA 3PIOF 3TQNA 4HNUA 5BS6A 4LG0B 5DV5A 3DCFA 4CICA 2PLYA 4IRIA 5CRUA 4IOCF 4D7NA 3VLFA 2KISA 4MS6A 1DUXC 1EDUA 4Y33A 2YINA 2Y0BG 3OSGA 3GZNB 1VQ9I 5CJ9A 2V5QC 2QEXI 3FUFA 2M0CA 4UXNA 1U2VG 2CHXA 1SD5A 1MBJA 4AM3A 3FH5A 2EFOA 2LY1A 3DBSA 5LRSA 2GQQA 4A3GJ 3JUEA 2MYSA 4A12A 2FMLA 5EJCA 4R8HA 3IKTA 2AQFA 1LUJB 4EBAA 2GRRB 3I0TA 4WXDA 4K03A 3LA3A 3QYEA 3J7AY 1WJDA 4XN0A 2DOAA 3CIAA 2VJ8A 1OWOA 3APDA 3EIQC 3JCKC 4O5VA 2V4JC 5CEAA 4GCVA 2PJRA 5HVQC 4N39A 5A23A 3CC7I 2RFAA 1BR1A 4XLHA 2L9BA 3HRMA 3VWBA 2QY7A 1UCRA 3GFJA 2W1OA 1O1TA 1FPPA 2L54A 2CG2A 5L3EA 2R7VA 4HI9A 4WNDA 3RRMB 3FM3A 1IZ1A 3CUQA 3Q79A 3AL0B 2I6HA 1W36D 3PE3A 4BGDA 1Z0XA 4XICA 3HSEA 4O60A 3E6MA 3MN2A 3IRRA 4CUGA 2XPYA 1HBXG 3HVEB 2L5QA 1JCQA 3RQ4A 1HG5A 3E0JB 2EZHA 2V79A 1GXQA 4EMSA 1LKXA 2EA4A 5EX0A 2VL8A 3NAUA 3L2UA 1V55H 5D5WB 2K40A 2RREA 3B7UX 2EIKH 2XAJA 3ZCOA 2X38A 2DT5A 2FA5A 3MKYB 2CV0A 4LJZF 3HYIA 3E33A 4TXQA 2F5EA 3DEUA 3ZQQA 5GTHC 2V1XA 1TNSA 3KYCB 2M34A 1AWCA 1K1AA 2QYJA 3BZCA 2V1NA 2QUFA 3NARA 3FXLA 3K4LA 3TWVA 1R9TJ 4ESFA 2IGNA 3GTOJ 3F0CA 4PFOA 1O57A 3WE3A 3S7DA 3ZN1A 3TOAA 2BBYA 3SGHA 4F7ZA 4U0VA 2DK8A 4GZCA 1GV5A 1ORKA 5F04A 2KZTA 4J6IA 4IULA 1U78A 3ULEG 1XGSA 3H0DA 4YDEA 4BSXA 3LSJA 5FROA 2KIUA 4N9IA 4GZ5A 5D66A 1YI2I 5ENQD 3Q3SA 2P9NG 5BXUA 2HM8A 3FTUA 1ZYRF 5KAIC 2XGSA 2XHKA 3GBGA 2KHMA 3FBNB 3ZMUA 2ZFUA 5LHGA 1WM5A 4JHJA 1X1PA 3GZ6A 5BPPA 2PL2A 1ZB1A 2QVOA 1K61A 1K7AA 4K0RA 2EFNA 2JA7J 5JFRA 4DOZA 2H6HA 2PQNA 1NZNA 3MMYB 3CMEI 3PZDA 3CF2A 4ITVA 5A2QZ 4IHYA 2A5YB 4XEIG 3V2OA 2HO1A 1MQSA 3I59B 2VXZA 1IRZA 3RKXA 4U0UA 4EGYA 3IKOB 2HQ5A 1L5JA 2V9KA 1V55E 1VQ7I 2VGXA 3OAWA 1I3QJ 2P6TA 4D7MA 4CCMA 3CCRI 4YEJA 2UXXA 2JTVA 5KNLA 5H6RA 2DA2A 1STZA 1YS7A 2HFHA 4UHTA 3TOBA 1HS6A 2KZVA 1GXPA 2N8GA 3D9HA 1PP8F 4NIKA 5ANLA 3TXMA 1JUPA 2CW7A 4NQWA 4MIMA 4CYCA 1OWLA 3SO8A 1JT6A 2M45A 1QPMA 3CMAI 4ENMA 3ZYQA 2RKHA 3KS2A 1WI9A 1L0OC 2HVQA 4EGZA 1POGA 3CCUI 4G6DA 1HF8A 3OYCA 5L3CA 5FIOA 2R5SA 2DA7A 2JN6A 4I99C 2H94A 3K2AA 5F1RA 3Q0VA 2DA5A 1RPWA 4HRIA 3GLLA 3A02A 1FJLA 1MMGA 1PVEA 2I10A 1MSFC 1ZQ3P 3HIZA 3KZYA 3J7YJ 2OCCH 2D1VA 4JX4A 4BQNA 1V5GA 1IJWC 2AXUA 2Y4TA 1EYHA 3HRUA 1TL8A 3V30A 2QLZA 2Q1ZB 4F55A 4J01A 3PO3J 3Q75A 4Y6CA 2XRZA 4DQ2A 4Q47A 4R7LA 3DSXA 4RB0A 3PZ1A 5KBAA 3G1OA 1LD7A 3L2CA 1K6OA 3PH0C 2ZGDA 3OS2A 4PS8A 2Q8KA 2IY0C 5EEAA 5LGUA 3B7RL 4KN4X 5FLXZ 4IHTA 1HE8A 2NC9A 4AIFA 2NOGA 2HR3A 5J1RA 2CO5A 5EILA 3PFIA 1PYVA 5J47A 4I9EA 4ANXA 3KEZA 3DTKA 4FE7A 4G7HF 2EPFA 2JA6J 4IRGA 2Z33A 1LF8A 2E1MC 3BCAA 3DF8A 4NC7A 4YIRX 2WXFA 1DDNA 1WJEA 2R59A 5BUZA 3CCEI 3Q49B 1S7OA 4AWXB 5KCMA 1X3WB 2GRLA 2Q0OA 5E3OA 4N4OB 1JKOC 4A5MA 2ZMEB 2I5UA 4OAZA 3JSPA 3QYFA 3CKCA 4N3BA 5K5QA 1VQPI 3ZU7B 3LVQE 5JHAA 1OYIA 5G05C 5JJ6A 3DBHB 4F3VA 1JHHA 2FO7A 3BY6A 2HPIA 2OCCE 2XPUA 1Z77A 4M3BA 1IUFA 2J4DA 5HNFA 5EZGA 4XRSG 4NBQA 2R5ZB 1CF7B 4EVIA 5BMZA 3QB2A 1YS6A 4P9FA 3ZIMA 4BACA 1X19A 2IEKA 2LF8A 5DBKA 4KT5C 2F48A 1BC7C 2ZIRA 3BR1A 4E6HA 3LSPA 5F27A 1WJAA 3JRBA 2P5VA 3FISA 2IO3C 1ETYA 3HIFA 1XMAA 3IWZA 1QVUA 3CZ6A 4PJMA 1LE8A 1U5TB 4IF4A 3IHYA 4A0YA 4FHTA 3SZ7A 2O7OA 3V8KA 1K78A 3HBLA 1IXCA 1TQIA 3AJIA 2GXGA 4HAMA 2HI3A 4CSWA 1N0RA 4S04A 5FGMA 2A05A 4LG0A 4B8XA 5JR3A 3CUQC 2MW8A 4GA0A 4XLNF 3SD5A 3UX4A 2XAQA 3HRSA 2V6EA 1BJZA 2L9VA 3KEQA 1ZRDA 1Z7UA 3FULA 5FQ4A 3ABTA 3KZIC 1G2HA 4EM0B 3OL3A 3HM5A 1FYMA 4MO7A 5KVRA 3UIOC 2J8SD 4A1GA 4GTSA 1ULYA 3BZKA 3EHNA 4GDFA 5HOOA 3PNLB 4FADA 3P5JA 1QBQA 2OEVA 1XN7A 3D9KA 3LQQA 3ZGQA 2F2EA 2X6WA 1B72B 3HRAA 1YJNI 5T3RA 2G7UA 2LY9A 4U0ZA 2RGVA 2R3SA 2V7FA 4AIDA 3C1DA 1OWMA 4MKTA 2PBIA 1UB9A 3RPUD 3LSHA 5ILSA 1FOWA 3K4MA 4ZZDA 4HNTA 1U8RA 1XC5A 2HDCA 1QZ2A 2M30A 2CQQA 2R4GA 3GUDA 4QLCU 4BX8A 3LFUA 4A5NA 4PDXA 2ME6A 4HF1A 3CCQI 1DNPA 4GXOA 4DZPA 4HLYA 3K9IA 3OIPA 3S16J 1TQMA 3TP3A 1TBXA 2A69F 2E5ZA 2B0LA 3BTJA 3S3MA 1FVHA 1XSXA 2EH3A 2FI7A 3OXFA 4I6GA 2OOEA 3AG1E 4BT9A 5ENTD 2XPZA 2WQHA 1D3YA 4IXAA 4W97A 1WQ2A 2CJJA 3KEYA 1Y39A 1O3RA 4RAFA 1KU2A 1WKMA 2NS0A 3BPXA 4CDNA 4BERA 2XCBA 4UI9C 5KNGA 4B48A 4KMUX 1K1BA 3CP8A 1VQMI 3CSFA 5E8IA 3HOXJ 3CQGB 1ETKA 1IHBA 2PQ8A 2HTJA 4HDUA 3HVEA 5BV0A 1IQRA 2MABA 2UWJG 1PAQA 3X2QE 1G3SA 1SAXA 4HRLA 2IGKA 3KP5A 4DX1A 2LK2A 3A01B 1HKQA 2MYOA 1AA7A 1KT0A 2NAZA 1VQ6I 3C2BA 1OKRA 1PC2A 3FFLA 4W9RA 2CQNA 3GFLA 1JGSA 2L9NA 1RR8C 2L6JA 4BY7J 2KIQA 1FSEA 2WAQN 4BY6A 1NG7A 1R7JA 4KN7X 2E1NA 2GIVA 5DUIA 2J5PA 1VQLI 4UUTA 4ILHB 3OYDA 2CYYA 1HG2A 1MJ0A 1WVRA 4RGSA 2OV8A 1QGPA 2H09A 4QQIA 1G4DA 3RYPA 3BTIA 3KE2A 4DBRA 1P2FA 3LS8A 2DT6A 4E7JA 2BV6A 2DFEA 1UN9A 3NOGD 1JUSA 2IP2A 3LSMA 3OTNA 3S7FA 1BU9A 1FWZA 2KATA 4QIWN 5JHUA 3TBIA 3D9JA 3CDLA 2MGQA 4XKBA 3DEWA 4PSWA 3REOA 2YU9J 3HDXA 2D1HA 3NQOA 1ON1A 2VQCA 3VB2A 3EU9A 5GADJ 3R0AA 1UZCA 2R03A 4L18B 1SVLA 2PM6A 1S6LA 3QPHA 3SFZA 3CD6I 1I39A 1HLVA 1B89A 1MMNA 5DUKA 1MNDA 1KT1A 1LD8A 4HOBA 4CO8A 2HQAA 2Y9YA 4HSRA 2QZ8A 3LSIA 2IVMA 3DLLF 3CVPA 1YCSB 4CGWA 3PQJA 4X1EA 1TWCJ 3I59A 4AU7A 5M5YJ 4OIOF 4PCQA 3ZQHA 3FZVA 4MFDA 3F8BA 2ECBA 4ESJA 3KP4A 1KYWA 2GOMA 3FHEA 1XCVA 3BT9A 1OCRH 3CGHA 3GW4A 2G0EA 3Q9UC 1ACIA 4FETA 4G26A 1NA3A 3BG3A 1P4XA 2LSOA 2PG4A 3S1MJ 1Z3XA 4KZ0A 3PUFA 2Y75A 4MHGA 3CJNA 3LSGA 5B1BH 2CG3A 1BM9A 3KEAA 1VQ5I 2FOWA 3FH8A 1X1AA 1QO0D 4GTMA 1H19A 2MC3A 2ZJ2A 1TNBA 2K9QA 1NFIE 2A6HF 1ELWA 4FA6A 3GFIA 3FK7A 3CJRB 1HXIA 1D1AA 1X58A 5EEHA 4LMYA 4XQFA 1HFAA 2KMUA 5B66C 3J5QB 4GMRA 3AAAC 3ZXPA 4CDMA 4ANJA 4RM2A 1TW2A 5EYPF 4OINF 5CCMA 3JW4A 4ZYDA 1D0YA 4RVBA 4U7EB 1SVXA 2RQQA 3UKGA 2WADA 3JAMK 5J8CA 4ZDOA 2XGCA 2ETBA 2GRPB 2XS8A 2DOEA 4XX5A 3S7BA 1N77A 3SFYA 2A4ZA 1S7EA 3ZNGA 3U1KA 4XI0A 1IUYA 3PS6A 2FMYA 2VT3A 2OA4A 1BW5A 2DPUA 5K5RA 4U95D 2BW3B 4P29A 1S8NA 3MKWB 1JI8A 4EV0A 4BEPA 3HG9A 3FEYA 2WVIA 2EQXA 3DSTA 2LOOA 1KYZA 2E2IJ 2OC6A 3IWFA 1T6SA 4BHPA 5B1BE 3ML8A 3B02A 1VFCA 1O3TA 2DA3A 1T39A 2HYZA 1QHGA 4WNEA 4TXRA 4U7DA 3EDTB 1JKPC 1OCCE 3FY4A 2K9MA 1D1CA 3ZQGA 1FX7A 1WCMJ 2X1EA 3W6VA 3J5PA 4CCAA 5M72A 2ZMEA 3ABMH 2K9SA 4JP0A 4XKVA 4H7YA 3EPZA 2YS9A 2NVQJ 1FP2A 2IAIA 5HLGA 2OPTA 2OUMA 3BOQA 2RKKA 2V26A 5DYMA 5FZQA 2DK5A 3CHMA 1O7FA 4A3EJ 4G94A 3S1QJ 4RB2C 3SHFA 3HOVJ 3L2VA 4GTVA 4YVOA 2F4IA 5LBQA 4OIQF 3Q78A 1OWNA 3FUKA 5IP9J 1OPCA 2R5ZA 1CF7A 2X48A 3ISMC 4RQIA 4IEJA 4LLGF 3ZRGA 3ZRHA 2XPWA 4CCJA 2LO6A 1U0JA 3LOCA 1H2VC 2JABA 3ASOH 2DDBA 2HEOA 5ENOD 2BKGA 1HXDA 4I9CA 3RJVA 2XAGA 2J4BA 1J0RA 1R36A 1U5TA 5KNHD 3EYIA 1BR4A 1VZ0A 2M2EA 2FOKA 2WAQA 3SDGA 3K4KA 4FLBA 4O3MA 5AN8A 3UT4A 3BP8A 1DC2A 5FKKA 2R5YB 2KXPC 2XGXA 3AG3H 4BQQA 4WNGA 2HYJA 5C44J 4WF2A 1JTYA 3AL0C 2VPLA 2BHZA 1JUQA 3AG2H 4E7IA 4AIHA 1T98A 2WAEA 3UKUG 1FOKA 2Z1DA 5AAOA 2V8SE 1T08B 1U9NA 3ABME 2E5NA 3CVNA 2P58C 1E8YA 3EHRA 4CYDA 2WMNA 3L00A 5KJMA 4GO1A 3UM3A 2X6OA 3SFXA 2IONA 3DXJF 3V79K 2BUGA 2LAIA 1SD7A 2LY2A 2XB0X 1B72A 5CERB 3GMEA 4A55A 5FB2A 1IDZA 5LP0A 1SMTA 2VSNA 4LRZA 1U3CA 5G05J 2HKXA 3RCOA 3CMYA 3WU1B 1M1EB 2COBA 4XORA 1UJJA 1UFMA 1R58A 1PUFB 4I6EA 4YRVA 2I2OA 4GCOA 4BBSJ 2QM3A 5KJNA 4N2QA 3ECHA 3ASOE 3AFHA 4LSZE 5CVRA 1TR4A 3B7BA 4OAUC 4GPKA 5EYRA 4AEZC 3UMVA 3ZXSA 4Z68A 3A2KA 2MC4A 1EKEA 5FLMJ 5BOXA 3FUDA 5C4JJ 2OTJI 1Y8QB 5KHDA 3CCJI 3U21A 3T5VA 2IPQX 2MFZA 2DTZA 3BC8A 1Q1HA 4PJ0C 1QZZA 3PIPF 1ZREA 2ISZA 3AG3E 5KJKA 3FMSA 1BI2A 3OR2C 4KT6A 3H3ZA 3CLOA 4G8XA 2WXOA 3AG2E 1WI3A 3OSFA 5ED4A 3SI5A 5A2QK 2F5VA 2K85A 4C2MJ 2KM4A 1MDMB 4LFUA 4LGWA 2R7ZJ 1F9NA 3T0YA 3ELKA 4I7HA 3U4TA 2IT0A 3NB2A 2OZ6A 3A01A 3DV8A 1JXSA 2C0MA 4JZYA 3RO3A 3DEEA 3HJEA 1WJBA 4U88A 1NH3A 4TUMA 3BR6A 4HEA2 3RKWA 4L0YB 1Y0NA 3Q9SA 4B4CA 2DIWA 3LY8A 1JCRA 3L7WA 3QAHA 1JT0A 1MZCA 3HG0D 1TN6A 5JHBA 2UWMA 1YIOA 3D9MA 4JW1A 3PZ3A 1DVPA 4P5OA 3JRGA 1OISA 2RG8A 2CW0F 4B43A 1H2UA 1QBJA 1D8DA 4MRUA 1BBYA 4S0HB 4L9VA 3FU3A 3F6VA 3U9GA 5L3DA 1E0EA 2XAHA 2GXAA 2IS6A 3ERMA 3H5RA 1JKQC 5TGTA 3S2WA 3S1NJ 1NL4A 4CRWA 2ZB9A 4DX6D 3H92A 1X3ZB 1WJCA 3S15J 3SQVA 4GZ6A 4OMYA 2LNIA 3ASFA 4CZCA 3QOPA 4M7CA 3FUJA 3P2BA 4DUIA 2CU7A 1IRFA 3JRAA 3P7NA 2FJ1A 1LQ1A 2O9LA 3LVRE 3K0LA 4L9NA 4A3FJ 2VN2A 2DYSE 3MQ0A 4JBAA 3BWGA 4QPOA 2YR2A 3NEUA 4U0WA 5FLXK 3F23A 4XNFA 1TEZA 3FKJA 3L1PA 2HOSA 3MZYA 4OAYA 4FCYA 2D5VA 3R7RA 2IGOA 1QNFA 1O4XA 2XZTG 3RU0A 2E60A 1RKTA 2EBIA 2DMUA 2WWYA 1ETOA 1H88C 3UM1A 5LEJA 4PJJA 2DVWA 2JWTA 2VJIA 3FUMA 2ZXIA 2XVCA 2AXTC 3SEZA 3C2GA 4OWRB 1S3JA 3CCMI 4EJTA 1HW1A 3GTKJ 1T0FA 3CK7A 4C3JJ 3ZP5A 3G2SA 2JSCA 5DIZA 3RZOJ 5LD2C 5ILUA 3JTHA 4UVCA 3L82A 4YVQC 5C2YA 1QHHD 1S9HA 4BNCA 2H6GA 4LD5A 3E37A 3Q73A 5LRRA 3WXXA 4BT8A 3TP0A 3RI4A 3IKVA 4AJWA 5JJ7A 1SVMA 2YPRA 3ML6A 4M3GA 1TT5B 2EFQA 2OU2A 2E2HJ 1VDYA 4C0EA 2CWEA 2X85A 3IAM2 3KFWX 4MTDA 2W4SA 2C6YA 1ZRCA 3HPHA 3JRIA 2ICWG 2AXVA 2CGPA 1ETXA 2DYRH 2WXQA 3KIOA 2WV0A 2ECCA 3HTUA 2L6BA 4Z6YA 3OYAA 5A7DB 1IDYA 3MCZA 4BAYA 2O6GE 2MBFA 1EF1C 3FWVA 1J09A 1J9IA 1P9QC 3ZR8X 2WXJA 2WXIA 3T8KA 2BTDA 4KITB 1DPUA 1H8AC 3WG7H 2CUJA 3LJNA 3FU6A 3VPRA 3ZMTA 1E8XA 4AY6A 2CG4A 1FVFA 2BW3A 2L0IA 4K5AB 1T95A 2BY3A 1U5TC 1AP7A 3HGGA 3IC7A 1X4OA 2P7VB 3C7JA 3E7LA 3FHNA 4XONA 1I6HJ 4AC0A 3P9CA 3N97A 2KCKA 3JQ1A 4GPMA 3ROUA 2DJIA 2BY0A 2CRGA 4BQAA 5IYBJ 1KU9A 1MMSA 4II3A 5LGNA 3M1CA 4FQGA 2JK3A 1ZHFA 2P4WA 2M1BA 1WG0A 3NAWA 2DMPA 2LKPA 3R0JA 3QWLA 1FT1A 3KLNA 2Q7FA 5FJYA 3BJ6A 1P4AA 2VJ5A 2F5DA 2P9PG 3UIPC 2EZIA 2GBYA 3IL2A 2KRFA 1H89C 1W5CC 3HUGB 2CQKA 4DGWB 5T8IA 3CO6C 2WB2A 2WXGA 2E71A 2M7BA 1H0AA 2A68F 1TNUA 4I6ZA 1FIAA 2QYUA 2EV0A 4R79A 3J80K 4YDYA 2AS5F 2DYRE 2ZSIB 3LYAA 1MYOA 2NNNA 2XC7A 2J09A 3GTMJ 4Q94A 3CP2A 2LFBA 2Z2SB 2QKMB 2QQBA 3MZLB 1Z3YA 3U64A 1N4RA 1MH4A 4CCLA 4G1TA 4C48B 2FSWA 1TW3A 3Q0WA 1TWFJ 4EQQA 3K6GA 1E3HA 2JT1A 3JTGA 2QZAA 3UKRG 3OXGA 2MD0A 5AIQA 1W7PD 1Y6IA 1RNLA 1T2KA 5EZHA 1LEBA 2STWA 5FWQA 4E4HA 1NTCA 2P9SG 3VYRB 2VE9A 2R5YA 1I6XA 3PZ2A 3BU8A 2XCCA 4XN3A 5J6XA 3QOEA 3FMRA 1JKRC 3DEPA 1R4MB 2VGEA 3NWSA 3D3MA 3V8JA 1N0QA 1MX2A 3ULYA 5E76A 1VI0A 1IC8A 1XG1A 1OMIA 1MZBA 2IA1A 5J90A 3HSFA 5ICEA 2F5FA 2ZU6B 5C1DA 4E70A 4A3BJ 4XK4A 3SBSA 4UUVA 3QNKA 1LDJA 3BG5A 4HYEA 2AXLA 4M6XA 1ZR2A 2J5OA 3IRQA 3O2PE 4JQFA 4N3CA 3E6BA 3OYFA 3H9GA 2BXYA 2XAFA 2A5EA 3G1MA 4U87A 1ONVA 1WAO1 2VSYA 4GAAA 4G6QA 2E7WA 4DIQA 4L2YA 3BJOA 1SFUA 4WK8F 3QP6A 1IO2A 3CR3A 2XRYA 4KVMA 3K4BA 4BX9A 3IH4A 3GTPJ 3I71A 1PUFA 4NHJA 3KLOA 4KVOA 4PJNA 4UQXA 2DI3A 1FOYA 3H5NA 4GA1A 1TLHB 2XSDC 4IHSA 2P81A 1H2TC 2B6CA 3OYMA 2DQRA 1E8ZA 3X2QH 4ME2A 1QQEA 4QFVA 3BZ6A 5HLTA 2XEVA 2MD5A 3F3XA 3HOYJ 2LSVA 2P9KG 3DPDA 1IYGA 1R1VA 1R00A 1RESA 2DJNA 2GWRA 4XOTA 3RIRA 2Y4UA 2ZGGA 4FTHA 1A04A 2UXNA 1MHQA 5K1YA 3HXDA 4EZKA 4HVBA 3I55I 3ESKA 4JC8A 3SXYA 3HZJA 1CGPA 2HOTA 3EHQA 3IH2A 3O48A 1QU3A 4EJUA 2HS5A 1AOYA 2LUHA 2HTSA 1SEUA 3GTLJ 2O03A 3JRHA 2KJBA 1UHWA 3QYBA 4HX8A 1MDMA 3VOEA 4YELA 2P9IG 3CJTB 3DQVC 1B9MA 4TV3A 5F64A 2M87A 3CLJA 2I8DA 2UUZA 1UELB 1VQNI 4UWHA 1GW6A 2CQXA 5AIJA 1QQIA 3M8EA 2E1CA 4HPQA 3PEVB 2X6IA 2ZNYA 4XSXF 4ZYEA 3T8MA 2L9RA 3VODA 5D8KB 4BXXJ 4MEYF 4ENNA 3CK8A 2G7HA 4PH4B 1N78A 2EIKE 3PSIA 3B95A 3V31A 2KQRA 4LG3A 4S05A 3OYHA 1KZOA 4A3MJ 2ETHA 3I4GA 3RSEG 1ZG5A 3OWTA 2XGOA 1JTXA 3FHZA 4JL0A 1T0FC 1AKHA 4IHWA 1GVDA 3DFGA 2JRTA 3CDHA 1LVAA 4M9XA 4V2GA 3FP3A 3QU3A 4JX5A 2DMNA 3KP7A 3N05A 5FKNA 4CCKA 4XKWA 2DLLA 3OYJA 2Y9ZA 1UAAA 1BLXB 4MGRA 4GFBA 1IHGA 2FEZA 4GA2A 4F6RD 2VONA 3LDZA 4GTTA 3PNYA 1K6YA 3B7TA 5D2MC 2HOEA 3FXQA 2P5KA 2ZC2A 1U2WA 2VT2A 2L4MA 2YUSA 3F72A 2FBKA 2CSOA 2E19A 2HKOA 3S2HJ 4APOA 3TL4X 4ANWA 2HDDA 2P9UG 3WHCA 2H6IA 1ITYA 3T1BA 4XRSA 4FLHA 2DTRA 4XZ4A 4OOIA 4CCOA 1R23A 5ENRD 5J8FA 1VQKI 2DCPA 3TGOA 2IA0A 2VC1A 2DQLA 4G12A 3SQNA 3DXKG 5GAEJ 2CV1A 5DS9A 2L7FP 2F8YA 3VDXA 2L0TB 2H1LA 1OR7A 1F1ZA 1BJAA 3FXJA 3LFKA 5L3GA 2VQ2A 1IN8A 4A3CJ 3U2RA 3HXFA 3CC4I 2I1JA 4XRFA 1BN5A 3G1LA 2VSOE 1MBHA 1OQYA 3ZMDA 4UWLA 3DPUA 2GW1A 3C18A 2RDPA 4M3DA 2L7MP 4YNDA 4U07A 1N25A 2IS1A 4I1OB 2PQRA 5HODA 3CTAA 3SEQA 1FYLA 3UR3C 1WFXA 3GW2A 2XKOA 2P6SA 3OR1C 2ZNZA 4II2A 5EF6A 1MBGA 3BPVA 3M9AA 3DU5A 3RRUA 5KJLA 4F3QA 3CDIA 4TV7A 2MH9A 5IYCJ 2DWZA 4U8HA 2LTPA 1E96B 3A4CA 1OUVA 2A61A 3Q9VA 3GYHX 4OYSA 3PNTB 1P7JA 4XL9A 3I56I 4G8LA 3CQZJ
chains in the Genus database with same CATH topology
1Y0UA 4JK1X 3I58A 4EJWA 2A07F 2M8EA 2FU4A 1ON2A 4LLNA 3HHHA 3KETA 4EJOA 3KCCA 3HUGA 1IRGA 2KIMA 4LK0F 1LDKB 5CLSA 2NRAC 4ZZLA 4CGZA 3J80Z 5HS7A 1FT9A 1ZN2A 2JZYA 1V4RA 1FBQA 2FNAA 1XSVA 2QQ9A 1K79A 3R6SA 2L02A 1F4KA 3F8CA 2BYVE 3F8NA 2CFXA 3DPLC 4MQVA 2FBHA 1R1UA 3QP5A 2O61A 3TKYA 1BI3A 2HYGD 3QU6A 5E17F 3AAFA 3LAJA 3TDZC 2V1UA 1MD0A 2OQGA 1P92A 4M6YA 3RKYA 4ZH4F 4M72A 4IJAA 4RAYA 2QYOA 2DFIA 2DBBA 3G73A 3NRVA 1J75A 1I1SA 2GZWA 4UV9A 3HRTA 2RVCA 1U6GA 4ETSA 3FF5A 4I0AA 4BYYA 5L3FA 2GA2A 3F22A 4A6DA 2W24A 3TO7A 2Z9OA 1HKSA 1ZG3A 2ESHA 3WGIA 5KK1A 3TO6A 4EM1A 5HS9A 2NYXA 3KZZA 5BPDA 2BE5F 5FD6A 2LNBA 4KIBA 1WRJA 5CYVA 1IAWA 1E2XA 4KMFA 4L9TA 3K69A 5E1WA 4WX9A 2W25A 2RV8A 2EFWA 2ZCWA 4MTEA 5D5XB 2X0LA 3RYRA 5E8GA 1HW2A 3ZMVA 1YO5C 4RB3C 4M9ZA 1LEAA 3MZHA 4LK1F 5HLIA 2A3SA 1Z91A 3WG9A 3MEXA 3RJPA 4N9HA 5IT9K 1G3YA 2H27A 4BHBA 5HS8A 3K1PA 3O6BB 1Z9CA 1FY7A 2QENA 2QQAA 2VE8A 4WCGA 1HKTA 4AIJA 2QWWA 3F8MA 4BXUA 4WXHA 2A6EF 1H9GA 1SFXA 2HQNA 2BEOA 5EEGA 1Z6TA 1YQAA 1ZARA 5ICCA 1J59A 4I01A 3WE2A 4OU0A 2H6BA 3G3ZA 2P5LC 1XGNA 2L3DA 1HSJA 2O0YA 4UVAA 2EK5A 1ZH5A 1FNNA 2EV6A 1GVJA 4RGRA 5CVVA 2W57A 2HYFA 2YSRA 1B9NA 2FNPA 1XSDA 1RIOH 2H6CA 5HDGA 4NB5A 3ZMSA 2DO7A 4A2UA 3HOSA 1L3LA 1BI0A 3FXUA 4RAZA 4BHCA 4MEXF 2IW5A 1XGMA 4KICA 4P55A 4K2EA 3TGNA 4HZFA 3I54A 1G3WA 1HW5A 2PN6A 1WSUA 1OYWA 2YX4A 2L4AA 4YFKF 2VBZA 3HTSB 1XDUA 5D4SA 1WWXA 4MNUA 1BI1A 4CZZA 2IRFG 5AONA 3B73A 3ERED 4A0ZA 4HX4A 2QBYB 4HDVA 2XRNA 4YFNF 3LSTA 1I1GA 1XGOA 1FBUA 3I53A 4DNCA 5JI6A 4UV8A 1W5TA 3RPUA 4P96A 2VOPA 4A0XA 3V7SA 4HV6A 5E1XA 1SD6A 1TNTA 3QPTA 2RNJA 4RGXA 3GF2A 3GEZA 3V7RA 3WTXC 3TO9A 2XKPA 2Y0MA 2VBWA 3MAJA 3P9KA 5L3BA 1KGSA 2FE3A 2RQPA 3I5UA 1GHCA 4FX0A 1IXRC 2HGCA 1R5GA 3ZQ7A 1O7LA 2Z99A 2LDUA 5LHHA 1FYKA 3R60A 2WTEA 2DPDA 4P9UA 2FRHA 1KQ9A 2KKOA 3JSOA 2XROA 2HWVA 2PFBA 4RS8A 2FXAA 1IF1A 1Z1DA 5D6FA 5IT9Z 1G3TA 3N4MA 1H0MA 4IPAA 5D8LB 1YLFA 4RGUA 5JVTA 4GGGA 2OBPA 2ISYA 4L9JA 2PJPA 3GXOA 4D0PA 1PUEE 4CDGA 1FLIA 4G7OF 4ZYGA 3HOTA 2RC4A 1PDNC 5DCFA 4HA8A 3K1NA 4KIGA 4ENJA 3E5UA 3V4GA 3GX4X 1YW7A 1YW9A 5FFXA 4PGGA 2ZXJA 4PZJA 5D4RA 3MWMA 3SZPA 3M8FA 5CVIA 1FZPB 2ZFWA 4G9YA 4MQ9F 4EJVA 3K9TA 1ODDA 2L01A 1REPC 2F5CA 4H0EA 4L0ZB 3E5XA 5D6EA 3FMQA 1FBSA 2E7XA 2YX7A 1TQPA 5LEKA 1P4WA 1G6NA 4M74A 3J81Z 4YIFA 3KP2A 2OZUA 4CHUA 1IXSB 4KA4A 5DEQA 1R5HA 3F6OA 2M5WA 3MFKA 1MKMA 1EV7A 4RB1A 3D0SA 3R61A 3TDUC 4IVNA 4ZYHA 5F6FA 2ZBKA 1RI7A 4AVPA 1D8JA 2EB7A 4Q5SF 3EETA 2K02A 2MLGA 3EDPA 2IJLA 3R4KA 3GFMA 4EM2A 3RPQA 3WGGA 1XD7A 2W85A 4OIRF 1W7PB 1XDSA 2P8TA 4LB5A 4M71A 2GXBA 2ELHA 2QBYA 4B09A 3PQKA 4GYGA 1XMKA 1NHAA 3GO5A 2FQ3A 4HQEA 4I98B 5BQTA 5LGTA 1FP1D 5IT3A 1YW8A 4O6JA 2JPCA 2D2WA 1FC3A 2GA1A 1S7AA 1BC8C 4KFCA 1EH7A 5ICFA 1J2XA 1B6AA 3I4PA 4KNYA 1DP7P 4FT8A 3EYYA 3E97A 2HZTA 4HF2A 4I09A 4IRHA 2OD5A 1B59A 3WODF 1EH8A 2VODA 4L5JA 2XV4S 3LAPA 1ZLJA 3T8TA 1ZLKA 4KYWA 4LB6B 4XLPF 4U0YA 1VTNC 2EV5A 1V3FA 2LF7A 1BIBA 3U1DA 3Q5FA 3BROA 5LLQA 1Z6RA 3GWZA 4AD9A 4HF0A 3KP3A 2EJRA 1ZAOA 3ISPA 2R7DA 5DDGA 2Z3YA 4PDKA 2K27A 2ADUA 3SZTA 4GYIA 5D5VB 2P7CB 1YYVA 5LHIA 4HV5A 2PI0A 4XSZF 2K86A 4Y13A 3FWEA 1P6RA 3HHGA 2Z5UA 4UNOA 4ASNA 4PGHA 2MA3A 5DCMB 5E20A 1IW7F 1I27A 5DD8A 2MLKA 4FX4A 3FXRA 1USTA 1MJAA 5CVJA 3DP7A 1QNTA 2V1DA 3WU0A 2PMHA 2KJCA 4HW0A 4BH9A 3BDDA 3WTYC 4KIFA 1X3UA 3KEOA 1FPQA 1JHFA 1TTYA 1JE8A 4R1HA 2VC0A 3CUOA 1LDDA 2XIGA