1RZ4A

Crystal structure of human eif3k
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
213
Chain Sequence
AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADEQIFICSQEESIKPKNIVEKIDFDSVSSIMAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 3 subunit 11
publication title Crystal structure of human eIF3k, the first structure of eIF3 subunits
pubmed doi rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
total genus 69
structure length 213
sequence length 215
ec nomenclature
pdb deposition date 2003-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10075 CSN8_PSD8_EIF3K CSN8/PSMD8/EIF3K family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rz4A02
1.25.40.250 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat ARM repeat; domain 1 1rz4A01
2VC0A 1FP1D 4LLNA 4PDKA 2EFQA 3KP4A 1FBQA 1YG2A 1OPCA 3WTZA 1TLHB 1WI9A 1Y0UA 1YS6A 3MCZA 3F23A 1J59A 4M6XA 2JSCA 3QPTA 4EJUA 2ESNA 4Q47A 1ZGJA 3N97A 1IAWA 2F5FA 1LDDA 2BE5F 4KNYA 1J9IA 5BS6A 3JSOA 2MD5A 2QBYB 5DCMA 1KQ0A 3GWZA 2DI3A 1RIOH 3KZYA 2HTJA 1O3RA 2VBYA 3LA2A 5IT9K 4IPAA 2XAGA 2P7CB 3TQNA 1KGSA 2VXZA 3S2WA 3HRMA 4P55A 2COMA 1UCRA 3ECOA 2IA2A 2QZ8A 1S8NA 2CYYA 4WXHA 4QLCU 1GXPA 2CSOA 2PJPA 3TDZC 4LG0B 3BP8A 3L09A 2RC4A 3HSEA 5LBQA 2M87A 2R7FA 2J5PA 2QM3A 4P5OA 1QO0D 4CYDA 3O6BB 2PMUA 1SD4A 2EFOA 3BOQA 4YG2F 3ZP5A 1SMYF 3QOPA 1O57A 5LEKA 3GEZA 2A5YB 3KP6A 3RKWA 4JQFA 1XGMA 4EV0A 1NHAA 4HX4A 1FYKA 2VBXA 3KCCA 1BI0A 2W25A 1U5TB 4U88A 2ZKZA 4HZFA 1LNWA 1XGOA 4M9ZA 4M71A 2K7LA 3WTYC 1PP8F 4EM2A 1IN8A 1D5VA 4IRHA 2FE3A 4HA8A 2ZCWA 1KYWA 3QRFF 1T2KA 2QQBA 1HBXG 4UV8A 5L3CA 1RNLA 3RKXA 2QYOA 2AS5F 2DQRA 1U3EM 2FU4A 1QZZA 3GZ5A 4MTDA 4I2OA 2CFXA 4MTEA 4LK1F 4KFCA 3AAFA 3HTUA 1LDKB 2RQPA 3WGGA 3DKWA 5DD4A 3LAPA 1DDNA 2DW4A 3ZMSA 4RB2C 4M6YA 4A2UA 2OQRA 4WXDA 5H6RA 5L3GA 1RZ4A 3O2PE 3HRUA 1LB2A 1USTA 4TV7A 1MJAA 5LLQA 3TO6A 5BOXA 3T8TA 4UVCA 1ZG5A 4I0BA 2CQKA 5HDNA 1SAXA 1SFXA 5CLSA 3Q5FA 1YO5C 2FNPA 5FD6A 3WTTC 4FX4A 4ZYEA 4KDPA 2PG4A 2ADUA 4YFNF 4HW0A 1YIOA 3RJPA 2DQLA 2GXGA 1U6GA 3JTGA 3DQVC 5D8KB 5E8GA 4EJOA 5L3FA 3G3ZA 1B1BA 3MFKA 4U0WA 3M7GA 3JAMZ 1Z05A 5CVVA 1H0MA 3R61A 3K0LA 1ON2A 2ZMEB 3GUDA 4LLGF 2AXLA 3WE2A 2LF8A 3HRTA 5ICFA 2UWMA 3LWFA 1ZGAA 3EYYA 2D1VA 4WK8F 4LLLA 4HX8A 3L7WA 1GVJA 2QBYA 2EFPA 3RDIA 1CGPA 2C6YA 2PMHA 2O0YA 2ISZA 5FLXZ 2K86A 2D1HA 3V8LA 2UZKA 4G7ZF 1CF7B 1TW3A 2VOOA 2STWA 2KKOA 1ZREA 2QUFA 1T98A 4BHPA 1LVAA 3KFWX 4L9NA 3F3XA 3V4GA 3N4MA 3CDHA 4OIPF 2RN7A 4PCQA 3KE2A 2NAZA 2E1CA 1IF1A 4XLNF 5HS8A 1TTYA 2MLKA 3M8EA 1L3LA 3LFKA 4A6EA 2LDUA 3RKYA 3FZVA 1J2XA 4JBAA 1EV7A 1E2XA 1U2WA 4EJTA 4ESBA 1FZPB 1UFMA 4AWXB 4DNCA 2HEOA 2OZ6A 3ZMVA 5HLGA 4AIHA 2V9VA 3KP3A 5HS9A 4ETSA 4GO1A 4FX0A 5IT3A 1O3TA 4EM0B 1O3SA 3V7CA 1FOKA 1R23A 1D8JA 3FMRA 3ML6A 4EGYA 2BGCA 4ENMA 2QQAA 1IRFA 4BAYA 5DCMB 1O7FA 2K02A 5K1YA 4P9FA 4XRFA 2EK5A 1KU9A 3ELKA 2OA4A 4L0ZB 2H6BA 3Q9SA 2EJRA 3GFIA 2G7UA 2L01A 5LRRA 1R1UA 3ZPLA 1Z6RA 3WG9A 1HKTA 2VODA 3GFLA 3HSRA 2RGVA 3FM3A 4YFKF 1G3SA 3G73A 1ZN2A 2EV6A 3H92A 1RUNA 4MHGA 3BY6A 1K7AA 4L5IA 2K4BA 3MZHA 2F5DA 1FNNA 3MEXA 1EH6A 5J8CA 1WQ2A 1G3TA 3V8JA 2RNJA 1ZLJA 3U9GA 4R1HA 4WWCA 4M73A 1Z7UA 1Q1HA 1FYMA 5JHUA 5KK1A 3E97A 2MC3A 3FMQA 5CVIA 2Z5UA 3WGHA 1WSUA 4UNOA 2XAHA 3R0JA 1I27A 2LNBA 3L00A 4KA4A 3F8MA 2IRFG 3OV8A 5LRSA 1G3WA 1ZYRF 3RPQA 2FBHA 4BHCA 2DK5A 4UHTA 5J8FA 4HBLA 2FBKA 2GWRA 1XCVA 1ZAOA 4B09A 4A12A 3F6OA 2Y48A 2FNAA 1S7OA 4HOBA 1BBYA 5D6FA 4CGZA 3KP5A 1R1VA 5ED4A 1XSXA 1B9NA 3V7RA 2EV5A 2GAUA 2VT2A 5E17F 1R58A 4XSXF 1QZYA 2P5KA 4CDGA 2GZWA 1XD7A 4FHTA 5BMZA 1REPC 3B73A 1P4AA 2QVOA 3DPLC 3F8NA 2DT5A 1IXSB 3HRSA 4G6DA 3ZMTA 1TQMA 3JAMK 2G9WA 3BPXA 2Y0MA 2X0LA 3E6CC 4KICA 4I98B 4R79A 1ZH5A 2HDCA 1QBJA 1ZARA 4HLYA 3P9CA 1B6AA 3I59B 3GXOA 1U5TC 1J0RA 1I6XA 4NB5A 4OIOF 4GYIA 2QQ9A 3DV8A 5ERIA 1OYIA 5L3EA 3HHHA 2BEOA 5FLXK 4HDVA 2QWWA 5HDKA 1XGNA 1IRGA 4N9HA 4I7HA 2MA3A 4M9XA 1B4AA 1X3UA 2L4MA 5ICGA 3IL2A 2DTRA 4E70A 4YFXF 2W84A 4Y13A 5DD8A 3BWGA 3V7SA 3ISPA 3BPVA 5JI6A 4ENKA 3LA7A 1FC3A 1OYYA 2IW5A 3TKYA 3IWZA 2O6GE 1E17A 4I09A 1W7PA 2XKPA 4RAZA 3F22A 3MAJA 3CUOA 5K5OA 2OU2A 1TNSA 1YYVA 3DP7A 4YIFA 4ZZLA 2DAOA 1MZBA 2MH9A 1ON1A 5CJ9A 4HV6A 1MDMA 2IVMA 2HYGD 1KU2A 4LK0F 4M74A 4EGZA 3CUQC 2EV0A 2A3SA 1JHFA 3CJNA 4Y15A 4UXNA 3CO7C 4RGRA 2P6TA 2XIGA 2FMYA 2OQGA 2FF4A 3E5QA 5K5RA 3WODF 2K4JA 2L3DA 1PDNC 2KIUA 2OBPA 4A0ZA 2HKXA 2W85A 1TW2A 1AOYA 4U0YA 1S3JA 2XUBA 1T38A 1P4XA 3I0TA 4KMUX 1FLIA 1XMKA 2XVCA 1XN7A 1K78A 1LEAA 1RI7A 3IRRA 1I5ZA 4L9JA 1LEBA 5FGMA 3FMSA 4A6DA 5DYMA 6PAXA 5DUKA 2STTA 4EVIA 1EH7A 4G9YA 1GXQA 3TO7A 4EQQA 1Z9CA 3F72A 4G8XA 5ICCA 4IHTA 4ZH4F 1QPMA 4G7OF 3V8KA 4IXAA 2FRHA 2P5LC 3FXUA 1BM9A 1FPQA 2NNNA 4CO8A 3ROUA 4Q48A 4B8XA 2YX7A 5FFXA 2ELHA 3OOPA 3DF8A 3J81Z 2HFHA 5F6FA 5FO5A 3H3ZA 1B9MA 3QU3A 3I59A 4QWQA 3EETA 4HQMA 3GX4X 5HLHA 3R6SA 4HF1A 3HUGA 4Y17A 2BBYA 2W57A 2XROA 5JR3A 2V1UA 3ERED 1W5SA 1HKQA 5D5WB 3SFZA 4IRGA 2WV0A 3J80Z 5HLIA 1LDJA 5J6XA 4CXFA 1MGTA 5LHGA 5H6QA 3TOAA 1FYLA 2XASA 1IW7F 2OZUA 2RKHA 1YW8A 5EEHA 5CVRA 1MD0A 2ZBKA 5LGTA 3SXYA 5D4RA 5D8LB 2DU9A 2XGXA 1G4DA 4GCVA 2E7XA 1FWZA 3FM5A 5AIQA 4O3MA 2BYVE 2RV8A 1TBXA 5A2QZ 2L02A 5ILUA 3K1PA 2PFBA 5L3BA 2HR3A 3BJAA 4ENJA 3M9AA 2DK8A 3GFJA 4G6QA 5E18F 3R0AA 4BYYA 2Q2EA 4LJZF 2LKPA 1MJBA 5E1ZB 3E3VA 1MKMA 2X4HA 1F4KA 3K1NA 3GFMA 1R5GA 1OMIA 3W6JB 2FXAA 2YX4A 4IHSA 1K79A 1R5HA 2P6SA 4KUMA 1HSJA 2V1XA 3SZPA 2XV4S 2JPBA 4PZJA 1HSTA 2DO7A 4UV9A 3T1BA 3HYIA 2VBWA 2EFNA 3HHGA 2VE8A 4OIRF 1STZA 3BJOA 1R7JA 1P4WA 3BDDA 2W24A 3WTXC 2DPUA 1D8KA 3REOA 3Q9VA 4CZZA 1BI1A 2VE9A 3KLOA 5D5VB 5CVUA 1BIBA 1W7PB 1BJAA 2HWVA 4OMYA 3WU1B 5FB2A 2ZNZA 1LJ9A 2PBIA 2L4AA 3FF5A 2YR2A 1FX7A 4OMZA 4KYWA 2ACJA 3F6VA 5L3DA 1XSDA 4AD9A 5K5QA 1K6OA 4ZYHA 4P9UA 3D0SA 3HSFA 3B02A 1KYZA 3PQJA 4DQ2A 2O61A 1HW1A 2HOEA 1MDMB 2IP2A 2LSOA 5HOOA 4L18B 4EM1A 3RYRA 2IT0A 2Z3YA 2OD5A 4RAYA 3TOBA 4BH9A 3F8FA 4LB6B 3ULQB 5LHHA 2RVCA 2HTSA 3IRQA 4KN4X 4ON0A 2IPQX 2JPCA 1TNTA 2XAQA 1BI2A 2HZTA 3QP5A 5DEQA 1F1ZA 1YTYA 5TRDA 3E6BA 2NYXA 2ISYA 3ZN1A 4XLPF 1DPRA 1BC7C 3ABTA 5D6EA 2JZYA 4L0YB 1G3YA 4RB3C 1EH8A 1OKRA 2V79A 4BNCA 2DLLA 1MJ9A 4BQAA 3I5UA 4HX7A 5CVJA 5LGNA 1K78B 4P96A 3QP6A 3C3WA 2P7VB 1W4MA 2V1DA 1P6RA 3J81K 4BXUA 2WWYA 4ASNA 2HQRA 3P7NA 3H3UA 4PGGA 2PEXA 2XHKA 3WTUC 2NS0A 3GW2A 1H9GA 1JE8A 2KIMA 3HTSB 5TJJA 4PGHA 3I71A 3E5UA 2HQNA 3GO5A 1T0FA 3M8FA 4HLXA 1GHCA 5E8IA 1SFEA 2KIFA 2QLZA 2O03A 3MQ0A 4CHUA 2OAZA 1DUXC 2FSWA 1YW9A 2YPRA 2VN2A 5DV5A 3J7AO 1VTNC 2O8XA 3ZMUA 4FT8A 4RGXA 3IC7A 5E1WA 5D5UB 5A2QK 4RB1A 1S29A 1J75A 2CO5A 2UXXA 4ESFA 2Z33A 1D3YA 1OR7A 1UHWA 2JTVA 4WXCA 4UVBA 3JW4A 2IJLA 1JGSA 1OYWA 3DEUA 3FXRA 2IA0A 3HOTA 2Z99A 1HW5A 2A6EF 3SQNA 5HVQC 3HOSA 4MEYF 1DPUA 4YIIA 3WTVC 1LQ1A 1IUYA 3QPHA 5FFZA 2JT1A 1PUEE 2FBIA 3PFIA 5JFRA 4U7DA 4L9TA 1AWCA 1PP7U 1ZHFA 3MWMA 2A07F 1R22A 4O6JA 1IXRC 1TQPA 4L5JA 2UXNA 2FOKA 1ONVA 3P9KA 1W5TA 3VEPA 3FHZA 3D5LA 5LHIA 3LQRA 4HV5A 3GYHX 4UVAA 4BHBA 3E5XA 3FWEA 4A5MA 4Q5SF 2PI0A 1SD5A 3QAHA 4MNUA 4HF2A 1JHHA 3VOEA 5E1XA 3K1MA 2EA2A 3KLNA 4NHJA 2V6CA 2H6CA 1FY7A 3LQQA 2MH2A 4U7BA 1V3FA 1O7LA 4MQVA 4KN7X 3L9FA 2H27A 4KMFA 4WX9A 2QENA 1ZRFA 2KJBA 4LB5A 2ZO4A 1IXCA 2EWNA 4I01A 3TGNA 4IVNA 4GXOA 2XKOA 2Y75A 3EYIA 1XGSA 2FA5A 1I1SA 3EUHA 1BN5A 2P8TA 1WWXA 2TDXA 4F7ZA 1JXSA 3COAC 3EQLF 1KU3A 3GVAA 4LMYA 4AVPA 4EJVA 1XB4A 2HGCA 2XAFA 2KRFA 3GLXA 3MZYA 3GF2A 5DDGA 3JTHA 5DCFA 2BV6A 3IKTA 4HDUA 1R00A 1FT9A 1KA8A 2M5WA 4I02A 1Z1DA 2HS5A 1SFUA 3VB2A 3ZMZA 2VC1A 4KIBA 4L9VA 5JVTA 1F9NA 1R1TA 2A61A 2NRAC 4GYGA 1HXDA 3RPUA 1W7PD 1SD6A 5LGUA 2RDPA 1QGPA 4XSZF 3C7JA 1ZRDA 2YSRA 4A5NA 4RS8A 3VFZA 1YFHA 4HF0A 1WKMA 1RUOA 4UUVA 1YQAA 4LD5A 5HDGA 4KT5C 3TO9A 1R36A 2R3SA 4D0PA 4U0VA 3CUQB 2NNYA 4IJAA 1J5YA 5H20A 1QNTA 2F5CA 4HAMA 4KIGA 2ZFWA 5BPDA 4LGWA 1B59A 4HYEA 2ZNYA 3CO6C 5CYVA 4I0AA 1U8RA 4G7HF 1F5TA 1O3QA 2CW0F 1HW2A 2DFIA 2B0LA 3E6MA 4ENNA 1YS7A 1SMTA 2H94A 3DPTA 3U2RA 4LFUA 4G94A 3WTSC 1BI3A 1L0OC 5F64A 1FP2A 3DFGA 5F1RA 3JSPA 5ILVA 2Z9OA 3KETA 1FSEA 4R8HA 2FMLA 3KEQA 1IN4A 2Q0OA 2M1BA 4RB0A 1H9TA 3BROA 4MGRA 1UB9A 2JRTA 2XRNA 1A04A 3QU6A 1XSVA 2A69F 2D2WA 2PQ8A 2M30A 2A68F 3ABUA 3T8RA 3LSTA 3ZMDA 3HIFA 2MLGA 3T0YA 4K2EA 4OINF 3KP2A 3I58A 1ZRCA 3ZN0A 4EMSA 2ZXJA 4A0XA 4GGGA 3K69A 4EJWA 4LG0A 3CTAA 3EDPA 5LEJA 1ZLKA 3SHFA 3F8BA 2E1NA 2G7HA 4RGUA 3GZ6A 4S05A 1XCBA 1T39A 3U1DA 4ESJA 1BC8C 2PLYA 1IN5A 3RIRA 2ETHA 3F8CA 2VT3A 5IT9Z 2MBFA 3L2CA 1S7AA 3FXQA 4MQ9F 1C0WA 4KIFA 1TQIA 1HKSA 5AONA 4H0EA 2WTEA 1U5TA 4ZZDA 3KZZA 2LF7A 4OOIA 1YLFA 3WGIA 3I53A 1KQ9A 1G6NA 2VONA 3M1EA 4JK1X 4ZYDA 5ILSA 3FX3A 1ODDA 2HYFA 2IA1A 3PQKA 3KEOA 5KVRA 4IRIA 2ESHA 1KQ8A 2DBBA 2FQ3A 3R4KA 1ZG1A 2EA4A 2EB7A 1ZG3A 2GXBA 1U78A 1P92A 1J7KA 3IWFA 4A0YA 4HQEA 4N9IA 2PN6A 3NQOA 2HKOA 3T5XA 3P9IA 3I64A 2KJCA 4XBFA 2GA1A 5ICEA 1QQIA 2CG4A 1IN6A 2M8EA 3IHUA 4AIKA 2Q8KA 2YU3A 3LAJA 1XDUA 3IKVA 2CWEA 1HQCA 2E7WA 4Z2YA 3CUQA 5E20A 2EFWA 2P5VA 2O3FA 2XAJA 1V4RA 2F5EA 3ECHA 4WF2A 2FEZA 1YW7A 3BJ6A 1IZ1A 2A6HF 3LA3A 1FBSA 4M9SA 2M45A 3C18A 4ZYGA 2R7DA 3E6DA 1FSHA 3BZ6A 3K9TA 3KP7A 3VODA 4CICA 3I4PA 1FBUA 2VBZA 4WCGA 3CLOA 3DXJF 1XDSA 3ZQ7A 1Z6TA 1IN7A 3TDUC 4AIJA 1BOAA 2L54A 2GIVA 4OIQF 2ZMEA 5EEGA 2K27A 1I1GA 5DUIA 1UHMA 3WE3A 3WTWC 3J80K 3R60A 1WRJA 2ZJ2A 4NQWA 4OU0A 5AIPA 3RYPA 2WC2A 3C1DA 1XMAA 4IF4A 1Z91A 5BQTA 4Q4ZF 2CGPA 3K2ZA 3O3KA 1USSA 1CF7A 3SZTA 2F2EA 3I54A 3WU0A 3RTRA 2GA2A 5FD5A 2VOPA 1DP7P 4MEXF 1KU7A 3NEUA 3RI4A 1SD7A 3F21A 1P2FA 4M72A 3NRVA 1T6SA 4O5VA 4RGSA 5BPIA 1ULYA 4N0BA 2GQQA 2DPDA 5D4SA 2J5OA 5D5XB 1S6LA 2D45A 1BIAA 2H09A 4S04A 3W6KB 5HS7A 2P4WA
chains in the Genus database with same CATH superfamily
2VC0A 1N11A 2MG4A 4RM3A 2LG4A 4C0MA 4GA1A 1FP1D 2EPFA 1POGA 2XAUA 4LLNA 1X1DA 2DA2A 3QYFA 1N0QA 2DMTA 4PDKA 3L54A 4BT9A 1FT2A 2EFQA 3KP4A 1FBQA 1YG2A 1U9OA 5M3MJ 1BI7B 4JD2G 1V5EA 1OPCA 1R4MB 1X3ZB 4UWHA 3WTZA 2CFUA 1SAUA 1TLHB 1WI9A 1Y0UA 1MBHA 1YS6A 3MCZA 3F23A 1J59A 4M6XA 1FJLA 2GRLA 1WH7A 4F7AA 3DTIA 5IPAA 1VQ9I 1TR4A 4ZTJA 4I6ZA 2W1OA 2K9NA 2JSCA 4BDZA 3S1QJ 2RREA 3QPTA 4EJUA 3VYUB 4YVOA 1E96B 4I43A 2ETCA 3PNVA 4KT6B 1B8IB 2ESNA 4PH4B 2VKDA 1UJ8A 1HLVA 4Q47A 3UM2A 1ZGJA 3N97A 5IYDJ 1IAWA 4A3VA 4ANUA 2F5FA 2HDWA 3NWSA 1LDDA 4CCLA 2BE5F 1FTZA 1BJZA 1TWAJ 3GZNB 4A3IJ 4KNYA 1E8ZA 1Z0XA 1J9IA 4YELA 5CCLA 1E8XA 5BS6A 2VSYA 3FXLA 4DYRA 3JSOA 1VQ4I 2MD5A 1YRNA 3PZ4A 3FUFA 2QBYB 5DCMA 5EG0B 2M3AA 4XLAA 2L6JA 4A55A 1KQ0A 3ESWB 3GWZA 3PM1A 3Q47B 1A6IA 2DI3A 1RIOH 3KZYA 2HTJA 1O3RA 2VBYA 4RG6A 3LA2A 5IT9K 4IPAA 3QB2A 2DFHA 3ASGA 2XAGA 2P7CB 4HOUA 3JRCA 4XQFA 2GXAA 1SZ9A 2H8RA 3TQNA 1S0PA 3R9MA 3CVWA 1KGSA 2RD0A 5ARGA 2VXZA 3S2WA 4LEUA 1DCQA 3HRMA 3IAM2 4B47A 2P9UG 2ZISA 1JUQA 2V5QC 4P55A 3LKUA 2COMA 1TC3C 1ZQ3P 1UCRA 3ECOA 1X4OA 2HVSA 2IA2A 2QZ8A 1GV5A 5F0FA 3WG7H 4AUXA 1V54H 1MZCA 1UOHA 4BEPA 5FLVA 1S8NA 2X85A 3KZIC 1JCSA 4UQZA 2CYYA 3IV0A 1GLNA 1EPUA 4WXHA 4QLCU 3ULEG 3DBHB 3OSGA 2YU9J 2HR2A 2I9CA 3UUXA 1GXPA 2CSOA 1EKEA 2PJPA 2X1DA 3Q9UC 5CERB 3HB9A 1SA5A 3TDZC 4LG0B 4UWFA 3TWXA 1RR8C 3BP8A 3LJ3A 4FU3A 5CCMA 1YX3A 3L09A 2E1MC 2RC4A 3MN2A 3L22A 1NG7A 5FRMA 1X1AA 3HSEA 2M4GA 1MQSA 4EBAG 3PSIA 1A17A 4G2VA 4F91B 3ASOH 5LBQA 4KXKB 5B3SH 5AN8A 2M87A 2ILRA 2JN6A 2R7FA 2B7EA 2J5PA 2QM3A 4AYBA 1BA5A 4PDXA 4P5OA 1W36D 1QO0D 3U3WA 3HGYA 4CYDA 3IEGA 5LOZA 5G04C 3O6BB 4CUGA 2PMUA 2CMPA 3AG4H 2ETAA 5FQ7A 4KITB 1SD4A 3HYMB 2EFOA 4E7KA 3D5RC 2WB1N 3K6GA 4C30A 3BOQA 4YG2F 4BX9A 1P7JA 3ZRGA 3ZP5A 1KT0A 3FHNA 1VI0A 3HJEA 4GZ6A 1SMYF 2E2JJ 2MW8A 3QOPA 2Y69E 2DA5A 2G0EA 1O57A 4BS9A 2E2IJ 3AL0C 2ME6A 1E8YA 2OCCH 4BQOA 5LEKA 3MKYB 1YIJI 1W36C 2ZGGA 4KVMA 3T5VA 3GEZA 4EZKA 3JUIA 2A5YB 3MZLB 3KP6A 3RKWA 4JQFA 1XGMA 2M7AA 2V9KA 4EV0A 1NHAA 3GZ2A 3LDZA 4HX4A 3LVRE 1FYKA 2VBXA 1OJLA 3KCCA 4M6VA 5JJ6A 1BI0A 2W25A 1U5TB 4J01A 5DM7F 4U88A 4AIFA 3GTGJ 1WM5A 2ZKZA 3RSEG 4HZFA 4F52A 1LNWA 1XGOA 4M9ZA 5KNLA 4M71A 2K7LA 4BE1A 1HG2A 3WTYC 1PP8F 5BUZA 4EM2A 3QWWA 1IN8A 1GW6A 2HQ5A 2B0OE 2M0MA 1D5VA 4IRHA 1OWOA 2FE3A 3CK8A 4HA8A 2ZCWA 3EHMA 4DBRA 2DYSE 3K4KA 3EU5A 3FUMA 4LG6A 4TXQA 1KYWA 2M2EA 3QRFF 1T2KA 2IS4A 3CMYA 1FOYA 2HDDA 1S63A 3EHQA 2QQBA 3NAWA 5FZQA 1HBXG 4XRSG 3BEEA 4UV8A 1BLXB 4B0ZA 5L3CA 3ABKH 3G2UA 3I5PA 3ZHEB 1RNLA 2YUSA 3RKXA 3E7LA 3IH4A 2QYOA 1SA4A 2AS5F 2DQRA 2Z1DA 3E1SA 1DU0A 2XRZA 4ZC3A 1U3EM 4LNGA 2FU4A 4MRUA 1QZZA 4GCNA 3GZ5A 4MTDA 2CW8A 4I2OA 2CFXA 2W82A 3E33A 3EU9A 4MTEA 1NK3P 4J8FA 5CMWA 4LK1F 4BQNA 1WJFA 4JXTA 3H0DA 1WG0A 1KZHA 1F36A 4KFCA 3RO2A 3AAFA 3HTUA 1OR7C 5M3FJ 3IP4B 3MGBA 4GTPA 4BEHB 4OAYA 1LDKB 2P58C 2RQPA 3WGGA 2CG3A 5H7PA 3DKWA 3ISMC 4FJZA 4ILGA 3BU8A 3OSFA 1KPSB 5G05C 5DD4A 3LAPA 1DDNA 5KJLA 2DW4A 5FQ6A 3ZMSA 3DTKA 3Q75A 3DU5A 4JX6A 4RB2C 2XENA 3DPDA 2DMPA 4R7LA 4UQYA 2DA4A 4M6YA 1NL4A 4A2UA 4DX6D 2OQRA 4WXDA 1K3ZD 4A69C 3S14J 5H6RA 4NACA 4YDYA 1JJ6C 3T9KA 2JQ7A 3TWRA 5L3GA 4Y33A 1RZ4A 2B63J 4JPSA 3JRAA 3V31A 3EHNA 3ZEFA 3K4MA 2VXDA 3O2PE 3UT8A 2VGXA 2YHEA 1WJDA 4IO9F 3G1OA 3HRUA 4XONA 3FHEA 4XZ4A 3A0HC 3S1RJ 5KHDA 1N4QA 1PUFA 1LB2A 5AJDA 1USTA 4TV7A 1MJAA 3CC4I 4LNBA 1IQUA 4ATGA 1B72B 3DLLF 1BW5A 5LLQA 3HIZA 4QQIA 3O8HA 4MFDA 3TXNA 1PY1A 4ZTFA 3TO6A 3UQ3A 1T56A 1QZEA 2XB5A 3OYNA 5BOXA 3T8TA 1TYQG 2MYSA 2M4KA 4UVCA 1ZG5A 2Y9ZA 3RIBA 3CLQA 3C72A 3S2AA 4I0BA 2CQKA 5HDNA 3BQYA 2UV1A 2NS7A 4IX7A 5ENPD 5EZHA 3AG3E 1SAXA 1I3AA 2JA2A 1WAO1 1SFXA 3CLJA 2K85A 5CLSA 3Q5FA 2EZHA 3CC2I 1YO5C 2QC9A 2FNPA 2LMDA 2ZXHA 5CKTA 5FD6A 2P0WA 3WTTC 3HXLA 1HF8A 2MOWA 4FX4A 4J0UA 4ZYEA 4UUCA 4U87A 3A2KA 4KDPA 3Q3SA 2E19A 1I3QJ 4LRZA 2ZJRF 2PG4A 3W9FA 1VF9A 2BHYA 2ADUA 4YFNF 2XRYA 4ANWA 3KYCB 4HW0A 3ZQLA 1NK2P 3EJNA 1YIOA 3RJPA 2DQLA 3HXBA 2HOSA 2GXGA 1U6GA 5FKMA 3CSFA 2R7ZJ 3JTGA 3DQVC 2ID3A 2A05A 3JR9A 1MHQA 3LYAA 5D8KB 3C3RA 2TCTA 1VQ7I 5E8GA 4EJOA 3DXMG 3JCKC 3QK0A 5L3FA 3G3ZA 3MCXA 1B1BA 1XPXA 1PYVA 3MFKA 4U0WA 3QWLA 4AP2A 3M7GA 2CH0A 3JAMZ 1Z05A 4EEFG 3CD6I 3CP8A 5CVVA 1H0MA 3BR0A 2DN0A 3R61A 1K4SA 1SW6A 3K0LA 1I39A 3LY9A 4HOQA 3SD5A 1VQMI 4Y7NJ 4RVBA 4AVXA 4DPRA 2X6WA 3HOUJ 3TWQA 3FWVA 1DGRM 3F9KA 3AS4A 2MC4A 1ON2A 3AG2E 1LF8A 5E76A 3CV0A 2ZMEB 3GUDA 2R4GA 3B6CA 4LLGF 4N3CA 2AXLA 2NOGA 2X6XA 3FXOA 3WE2A 2LF8A 2KM4A 2XSJC 3HRTA 3FBNB 5ICFA 2UWMA 3QAQA 3LWFA 1ZGAA 2F4IA 4BKXA 4CYCB 2DBAA 4CCAA 2AXUA 3EYYA 3HM5A 4W9RA 4OAVB 2D1VA 4WK8F 1YMPA 3EPZA 3E34A 3NQPA 2R17C 4HI9A 4LLLA 4HX8A 4QPOA 5G55A 1ZKGA 3L7WA 4NQWB 2P9SG 3BQOA 1GVJA 2QBYA 2EFPA 3RDIA 1CGPA 2GIZA 4W1UA 2C6YA 2CQXA 4XL9A 5IY5H 2YQ8A 2PMHA 2OPTA 2EINH 2O0YA 2ISZA 5B1AE 3IH3A 3C2BA 3TW7A 3GZSA 3R9AB 1W5CC 2KQRA 4OWRB 1IC8A 4N3AA 2LR8A 1O1RA 2R5SA 5FLXZ 2K86A 4G24A 2D1HA 3V8LA 2BZTA 3PNTA 2UZKA 4G7ZF 3TL4X 2E60A 2K9QA 3H5NA 2DWZA 1CF7B 2J07A 1TW3A 2XGDA 4GTTA 1TP4A 2VOOA 5AJLA 2STWA 1FT1A 3DSWA 3G2VA 2KKOA 3KX2A 1KZOA 2CS3A 1N9AA 1ZREA 4WAFA 1P5QA 5EIDA 1UZCA 1MMNA 3BG5A 2QUFA 5EX3A 3IV5A 3MVPA 1T98A 4BHPA 2Y3AA 1LVAA 3KFWX 4L9NA 3PJRA 3F3XA 3CVNA 3V4GA 1HZ4A 2AVPA 2YHCA 1RKWA 1N25A 3N4MA 1FTTA 3CDHA 3CK7A 3DSTA 4XRMA 4OIPF 2RN7A 3ML8A 4PCQA 1H0AA 3KE2A 1LVKA 1TT0A 4XIFA 2NAZA 2E1CA 5FQ8A 2EIKH 5M72A 1N75A 3D9PA 3VYTB 1IF1A 2HXOA 4XLNF 5HS8A 1TTYA 5D2MC 5ENOD 4E7JA 3VYSB 5K7FA 2MLKA 3M8EA 1L3LA 4XKVA 3LFKA 4A6EA 3EUHC 2LDUA 3RKYA 5M5XJ 3FZVA 4LIUA 1J2XA 3PEUB 3EUVA 3PVLA 4JBAA 2CJJA 3ULYA 3FH5A 4FTHA 3KSQA 3K9IA 4ATZD 2ECCA 3NBNB 3SJMA 3DSUA 2MGQA 2HVQA 1EV7A 3OYMA 1E2XA 2L9VA 3ONQA 1U2WA 3I56I 2WXHA 4EJTA 2XGOA 3LMMA 3FP3A 3SFIA 5FINA 3BR5A 3ZGKA 3X2QE 3OYJA 1O1SA 5KBAA 4ESBA 4Z6YA 1NFIE 2KRCA 4K5BA 2JK3A 4XLEA 4AU7A 1FZPB 4LOCA 1UFMA 3K4CA 1MX4A 4AVZA 1R6RA 4AWXB 2WVIA 2KP6A 4DNCA 1U3DA 3JREA 3K2AA 4U63A 3DRAA 2HEOA 1Y8QB 5LCWC 3AFHA 1NTCA 4WNDA 2OZ6A 4CDNA 3ZMVA 2EZKA 1R71A 1JKQC 3QODA 4LITA 2JEKA 5HLGA 4AIHA 3S1NJ 2V9VA 3RPUD 3KP3A 5HS9A 4ETSA 1MH4A 3FKIJ 4K0RA 4AC0A 4GO1A 1RRJA 1Q2ZA 1IDYA 2LYCA 4FX0A 4MLPA 1HCRA 2KDZA 1N0RA 5IT3A 1JTXA 3G4SI 1O3TA 4U96D 4J6IA 4EM0B 2IEKA 1O3SA 2EQRA 2IU1A 2WQHA 3V7CA 2DVWA 1FOKA 1R23A 3GBGA 1D8JA 3FMRA 3ML6A 5GTIC 2BGCA 4EGYA 3PDNA 4ENMA 2QQAA 1IRFA 4RAGA 5TISC 5J1YA 3HOXJ 2Y4UA 2IO2C 1X1BA 4V19K 4BAYA 5E75A 2XEEA 2LXMA 4DX2A 1YRNB 1RKTA 4GTVA 5DCMB 1O7FA 2W7NA 2K02A 1A35A 5K1YA 5JA4D 4P9FA 1HA8A 2FX0A 4XRFA 3NWTA 2EK5A 1KU9A 4HNTA 4MBGA 3B7TA 5GADJ 2Y30A 2LKXA 2AQEA 3ELKA 3FTUA 2FO1E 4XNFA 2KCLA 2OA4A 4L0ZB 3TG5A 1OCOE 1D0ZA 4ACLA 1AP7A 3LCAA 2H6BA 2LOOA 2EJRA 3BG7A 3Q9SA 1Y39A 3GFIA 2G7UA 2L01A 4LIVA 2QA4I 2X6JA 4CGWA 5LRRA 1R1UA 4E7LA 1WJEA 3ZPLA 1Z6RA 5GPAA 3WG9A 4CCJA 3HXDA 3L17A 4XN3A 1HKTA 4GA2A 1A31A 3OYGA 2VODA 5M5YJ 2IAIA 5EGOA 1JT0A 3AU5A 3GFLA 3HSRA 5M5WJ 2RGVA 2BY2A 3FM3A 4YFKF 1G3SA 1VQ6I 3G73A 5IYCJ 4IHXA 1ZN2A 4BL0B 3Q9NC 2J08A 4RG9A 4JVSA 2EV6A 2ZU6B 3H92A 3PS6A 4GB9A 4BBRJ 2JVGA 4GPMA 2QYJA 1RUNA 2W00A 4MHGA 1UJKA 3M4OJ 3PH0C 3BY6A 1YJWI 3SBSA 1K7AA 4L5IA 2K4BA 2KT0A 3SNXA 2K9MA 3MZHA 1O4XA 3BZCA 3CHQA 3S1MJ 3TWTA 3QOUA 3UKGA 5T8IA 2F5DA 4FADA 4PS7A 1FNNA 2VJ4A 4F3VA 3KYLA 3MEXA 2NSZA 1EH6A 5J8CA 1WQ2A 1G3TA 3Q0VA 2A5WA 2V4JC 3V8JA 5HODA 3RU0A 2RNJA 1ZLJA 2LREA 2IOLA 3U9GA 4R1HA 4WWCA 4M73A 3D9HA 4JZYA 1Z7UA 1SC7A 3VPRA 3ZPJA 1Q1HA 1FYMA 2H6HA 4IKFA 5JHUA 4A3GJ 5KK1A 1G2HA 4E4HA 3E97A 4Y3OA 2CU7A 2MC3A 2DYRH 2LH9A 4C3IJ 3FMQA 2CG2A 5CVIA 2Z5UA 3WGHA 2VUMJ 2XGSA 1WSUA 4UNOA 4F1PA 2XAHA 4GA0A 3Q4AB 3R0JA 1I27A 3HBLA 2LNBA 3ZR8X 5JHBA 3L00A 1H2TC 5AAOA 1X5BA 3OIOA 3BZKA 4KA4A 1TL8A 3F8MA 4J8YA 3A02A 5AYWD 2IRFG 4B3XA 3OV8A 5LRSA 1UHSA 2VKEA 1G3WA 1ZYRF 1TNYA 1MX6A 4IQ4A 3LY8A 4Y6CA 1UAAA 3UM0A 2BVLA 2W4SA 3FDYA 2DA1A 1XGWA 3RPQA 2FBHA 4BHCA 4UUSA 2HQAA 3VWBA 1IKND 2DK5A 4UHTA 5J8FA 4HBLA 3NZUA 4DI4A 4GFBA 4GZCA 3L2UA 3OL4A 2FBKA 4ZYAA 5C1DA 2GWRA 1XCVA 2ZFUA 3OS1A 3M8JA 1LD8A 1ZAOA 2R5ZB 3OTNA 4B09A 3K4LA 4A12A 2DXIA 3F6OA 3HOWJ 4BERA 2Y48A 2FNAA 2FULA 4D5CA 3CSTA 1S7OA 4HOBA 2L7FP 4K5AB 5D66A 1BBYA 3IHYA 5D6FA 2OCEA 3IXEA 4NC7A 4CGZA 3KP5A 1LTXA 2M9HA 4CSWA 3SZ7A 2LC2A 3DSSA 2X38A 2IS1A 1R1VA 5ED4A 3PNLB 1XSXA 5JHFA 4B94A 2QCOA 1B9NA 3V7RA 2EV5A 2GAUA 5FLMJ 3HKZA 2VSXE 4GYWA 3F6QA 2KMUA 2VT2A 4HG2A 3HG9A 2QEXI 5AQ9A 2WADA 1N4SA 5E17F 4HSRA 2E0IA 4EZLA 1R58A 4PK4A 4XSXF 2D5VA 1QZYA 2PL2A 2P5KA 4E85A 4CDGA 1IHGA 4XMYA 4KMOA 2Z2SB 3DEEA 2GZWA 1XD7A 4FHTA 4UB6C 2A5EA 4CH7A 2H1KA 3FUNA 3RAUA 4J19A 5FRNA 5BMZA 1REPC 2X6FA 3B73A 4RA2A 2JVHA 4BQQA 1YJ9I 1YCSB 1P4AA 2HYJA 2QVOA 2R7OA 2DA7A 3DPLC 3F8NA 2DT5A 3ABMH 1OUVA 1IXSB 2VQHA 3HRSA 3LSJA 4G6DA 3OY9A 3OYFA 1JJ8C 1EJ9A 1OWMA 4F55A 2VGXB 2R02A 3ZMTA 5C44J 1TQMA 3JAMK 4A3EJ 3GYZA 2G9WA 3BPXA 5LP0A 3OR1C 2KATA 1PUFB 4L1BA 2Y0MA 2X0LA 3E6CC 2VQGA 5ENQD 4KICA 1DP3A 2XZDG 1Z67A 3CHSA 3SFYA 2HYZA 3V42A 3DWLE 4I98B 2P9NG 1O1TA 2ONDA 4R79A 1ZH5A 4GTSA 2NC9A 2HDCA 3PZDA 2L6BA 1QBJA 3NF1A 1ZARA 4JX4A 4HLYA 3H5AA 1SFOJ 1Y8RB 4FASD 3P9CA 1B6AA 4D7MA 3I59B 3LSKA 2JJ7A 3GXOA 1M1EB 1K61A 3PNYA 3HHMA 3UT7A 1U5TC 3PIOF 1J0RA 1I6XA 2BVMA 3G2BA 4NB5A 3GTJJ 4OIOF 5BW8C 1H8AC 1V54E 2DCEA 4GYIA 1HXIA 2QQ9A 3DV8A 1MSEC 1JWGA 5ERIA 5FKKA 3HC7A 4A3JJ 1VQ8I 1MBJA 3CF2A 5F1JA 3K70D 1OYIA 5L3EA 2DJNA 2VPRA 3HHHA 3FIWA 3U9WA 2BEOA 5KAIC 4C3JJ 5FLXK 4HDVA 2QWWA 3DU6A 3NARA 2KL4A 5HDKA 3GTOJ 2XS1A 1XGNA 1IRGA 2XEHA 4N9HA 3IBEA 4KBQA 2MABA 1A6QA 5B1BE 1AKHA 4I7HA 2MA3A 1DC2A 4M9XA 1OWLA 4M3FA 3LSMA 1B4AA 2VYIA 1X3UA 2L4MA 5ICGA 3IL2A 5E3NA 3Q79A 2DTRA 3OWTA 4E70A 3J5QB 4YFXF 3K70C 1RPWA 2W84A 2ZXWH 2QZAA 4Y13A 4LERA 4E7SA 5DD8A 3BWGA 3ENEA 3V7SA 3ISPA 2WXOA 1V55H 3BPVA 4CCMA 5JI6A 2CV1A 1KLXA 3MKRA 4ENKA 3LA7A 1FC3A 1OYYA 3UIOC 2IW5A 4RLQA 4XKWA 3UINC 3IHVA 3TKYA 3ZVVA 3IWZA 2O6GE 2WY8Q 4C48B 5J08A 3KEAA 1E17A 3QOEA 4I09A 1HC8A 3PZ1A 1W7PA 2WXFA 1Y56A 2XKPA 4RAZA 5TGTA 3F22A 3S16J 1OCRH 3MAJA 3CUOA 2WMOA 4UB8C 3CVQA 3ZN3A 1FOWA 1IRZA 5K5OA 2OU2A 1TNSA 3MZ8A 2L9NA 4GYOA 3LJNA 4PS8A 5D0QD 3RO3A 1YYVA 3LOCA 3DP7A 4GCOA 3I4MJ 4HXIA 3OYAA 4YIFA 4ZZLA 2MYOA 2F5VA 4I6GA 1U0JA 2DAOA 3J7YJ 2JMWA 3KEYA 4CCNA 4HVBA 1MZBA 1SANA 1ON1A 2CUFA 2MH9A 4HV6A 5CJ9A 2O5RA 4BY7J 4S0HB 3MKZA 3C3QA 1Y0NA 3L08A 4FC8A 3HEFA 5FT9A 5GAEJ 4CEMA 3U21A 3DWLG 5KAFC 2H6IA 3PNTB 2HOTA 3A01A 1MDMA 5JLWA 2IVMA 2HYGD 3Q73A 1KU2A 4LK0F 4CT4A 2RNGA 4M74A 4EGZA 3CUQC 1IQRA 2EV0A 5ENNA 2VB6A 2A3SA 1JHFA 1QYMA 3TXMA 2F6CA 3QPLA 1TJFA 3ABKE 3N05A 3RZOJ 3CJNA 4Y15A 3EHRA 4A1GA 3OYIA 2BXZA 4UXNA 1MBFA 4FJYA 1MJ0A 1ZBPA 1UELB 5FROA 3AS5A 4FE4A 4APOA 4U0SA 3CO7C 1ENHA 2IFUA 3ULQA 1DVPA 4DZPA 3PUJA 2Q2EB 4U0ZA 4RGRA 4PUCA 2P6TA 4GMJA 3DKYA 3DXKG 4XIDA 2WM9A 3MV2B 5A7DB 1N77A 1LFBA 1FVFA 2VL8A 3LNQA 3C5RA 4Q69A 3TWUA 3L2QA 2XIGA 3SEZA 4L2LA 4G25A 5BT1A 1EA3A 3B7BA 2XHEA 3VTYA 4PSXA 2FMYA 2OQGA 4GTQA 2FF4A 2WMNA 3LSIA 2EIME 2Y31A 2LUHA 2X3MA 3E5QA 2BW3A 5K5RA 2IGOA 1OCPA 3PZ2A 2DZOA 1YOVB 3QQAA 3WODF 4DX5D 3SDBA 1UJJA 4D5FA 2I10A 3ONLA 4XOTA 2P9PG 2K4JA 4PJLA 3BC8A 2UUZA 5AQAA 5HI7A 2L3DA 4B93B 3W2VA 4PJNA 1PDNC 1OXJA 2H8WA 2KIUA 2GOMA 5FKOA 4BBSJ 1S5LC 2ICWG 2OBPA 4A0ZA 3NOCD 4J8DA 2ZMEC 3S17J 5JLXA 4XKCA 2HKXA 2PJRA 2W85A 3I4NJ 1MMAA 1TW2A 1AOYA 2VLAA 2XPYA 4HNAD 4A1SA 4U0YA 1N78A 3E37A 1JTYA 1S3JA 4DLOA 1T08B 2XUBA 1OCCE 2AO9A 5ITZF 1T38A 4CZCA 4WNEA 3MD2A 3GTPJ 1P4XA 4N4OB 3N71A 3FTZA 1IDZA 1JUMA 3I0TA 4KMUX 3S7FA 2XPIA 1X2NA 1FLIA 1XMKA 3UMVA 2L0TB 2XVCA 1XN7A 1K78A 2AHQA 2F4OB 3FEXA 1LEAA 1RI7A 1QZ2A 3IRRA 1I5ZA 2R5ZA 3WHCA 1FCHA 2YS9A 4L9JA 2DOAA 2V7FA 1H2UA 2GROB 1LEBA 3ZXSA 3MKLA 2HXIA 5FGMA 4M7CA 3FMSA 4XKBA 4MFEA 3CIAA 3MV3B 4A6DA 3DSXA 4EQFA 4IOAF 5DYMA 6PAXA 5BNWA 5DUKA 2STTA 3DSVA 1TN8A 3OYKA 2PZIA 2ZIRA 4G6TB 4EVIA 5E79C 1EH7A 4G9YA 1WCMJ 1NA0A 4NIKA 1GXQA 1BL0A 3QYEA 3F0CA 2O7OA 2HE0A 3ASNE 3TO7A 3C2GA 4EQQA 4HOSA 2CQ7A 5KNGA 1ZELA 4NC6A 5GAHJ 1Z9CA 3F72A 4G8XA 5ICCA 2ELJA 2V1NA 4ZH4F 5J4YA 4IHTA 2NVQJ 4UQXA 2IY0C 1D9SA 1DNPA 3UT4A 5D0OD 3OS2A 1D0XA 1U8BA 4B43A 3PZ3A 4GZ3A 1QPMA 3OYBA 2X9DA 5EGOB 4CRWA 2IS6A 2VIXA 4G7OF 4IULA 2KPMA 3OYEA 1XG1A 3JRHA 3V8KA 4IXAA 5CQGA 2FRHA 1N4RA 1OISA 2V5FA 2P5LC 3CCEI 3B7SA 3SEQA 3HOZJ 3GCMA 1P9QC 3ASDA 3RK6A 3FXUA 1WZ2A 1VFCA 1D0YA 3IUOA 1BM9A 2WAQN 4EBAA 2KHMA 3M1CA 1FPQA 5F08A 4YRVA 1ZU2A 2NNNA 3VLEA 1W0TA 2ID6A 4CO8A 3ROUA 1S72I 4HRMB 2QKMB 2E34A 3D9MA 4N5CA 4Q48A 2L9RA 5C2YA 2WAFA 4CCKA 2M8GX 3TMOA 4B8XA 2YX7A 4F93B 3IH2A 3CZ6A 5FFXA 1QU3A 3UKRG 2ELHA 2PMZN 3OOPA 3DF8A 3TP3A 3J81Z 1D5YA 2FD5A 2HFHA 2GLOA 5F6FA 5FO5A 4A3DJ 3CGHA 3H3ZA 3L9TA 4XI0A 1B9MA 3D3MA 4YEJA 3QU3A 3RZDJ 4DRXE 2NOJB 3I59A 3C98A 4QWQA 2Q7FA 1WDYA 3D9OA 1ZGWA 3ML9A 3K7AJ 3CDIA 2Y69H 2DDAA 1S7EA 2DFFA 5E3MA 1XC5A 3EETA 4HQMA 2BUGA 2QYUA 3DPUA 1BPOA 3QWPA 2HOAA 4YVQC 3APDA 2NYJA 2LY9A 1VZ0A 3GX4X 3MJWA 4U07A 2XQ0A 2LNIA 5HLHA 3AKZA 1TWGJ 3R6SA 4DYCA 4BY1J 4HF1A 3HUGA 4Y17A 3BCAA 4CDMA 2BBYA 4WWOA 1BI8B 2W57A 2XROA 2R7SA 5JR3A 1D8DA 1E7VA 1ZR2A 4UI9J 3CMMA 2V1UA 3JRIA 3ERED 4UUSB 1BU9A 1G3NB 3OYCA 3PE3A 1W5SA 2VSNA 1HKQA 3S32A 4BJ5C 5J1RA 4WWPA 1UG0A 5IP7J 1E8WA 3E4BA 3PUBA 1HO8A 5D5WB 4O1PA 3SFZA 5BNGA 5J40A 4IRGA 1VQKI 2WV0A 3J80Z 5HLIA 3JRBA 4KVOA 1LDJA 2DYSH 5J6XA 4CXFA 1K83J 1MGTA 5LFAA 4XRSA 4YIRX 3CCRI 4BDYA 3HGGA 3CHPA 3FTXA 5LHGA 1SVMA 1WY6A 2IJGX 5H6QA 3G2SA 4KZ0A 1H2VC 1DU6A 5AENA 3L1PA 1QPIA 2PQNA 3TOAA 1FYLA 2XASA 4QSHA 1IW7F 3BCBA 2OZUA 1ZTRA 2RKHA 4PJJA 4PFOA 3Q49B 1YW8A 2XCCA 3SBTB 4AOFA 2X6KA 5EEHA 5HNFA 3H3VK 4B8CB 4C0EA 3CCUI 3FDHA 5IY5E 5CVRA 2J09A 1MD0A 2LLKA 5HRYA 2ZBKA 3CQZJ 2R5YA 5LGTA 5EYPF 3SXYA 2COBA 4M3OA 5D4RA 1S9HA 3DEWA 3QYBA 5D8LB 2DU9A 4U8YD 2XGXA 1G4DA 4GCVA 2E7XA 1FWZA 3FM5A 5AIQA 4O3MA 2BYVE 2RV8A 2GGFA 1TBXA 4U8VD 3UI2A 5A2QZ 2L02A 3PL8A 5ILUA 3K1PA 1ETVA 2WXPA 2PFBA 3LFUA 5L3BA 2E2HJ 4P29A 4XX5A 1LD7A 3ZIMA 2HR3A 3BJAA 3SDGA 4OAUC 4ENJA 3KPHA 5K7ZA 5T4YA 1V5FA 4JW1A 3LSHA 1AHDP 3M9AA 2EILE 2F8YA 3EIJA 1JKRC 2DK8A 2M0CA 2ZSIB 3ABLE 4OVVA 3GFJA 2K9SA 4BETA 3VSLA 5JMND 4G6QA 1IV8A 3RKQA 2ZJPF 2LTPA 1JCRA 4B44A 2CFOA 5E18F 3ZYKA 4BSXA 3R0AA 5BPPA 4BYYA 2LO6A 3ZUVB 3APCA 1N54A 3GTLJ 3AAAC 2Q2EA 1OQYA 1QVTA 2KRHA 4LJZF 2LKPA 1MJBA 2DA3A 5E1ZB 3E3VA 1MKMA 4B3AA 2X4HA 3G1MA 1F4KA 3K1NA 2E36A 3GFMA 1R5GA 1ERDA 4B89A 1OMIA 3W6JB 4BACA 2FXAA 2YX4A 2GBYA 4IHSA 2KISA 1K79A 4OYSA 1ZR4A 4KISA 5CBNA 3ZW3A 3G71I 5J90A 5CECB 1R5HA 2P6SA 3L2VA 4KUMA 1WI3A 3UR3C 4G1TA 1HSJA 1Z7LA 2V1XA 2KDOA 3RSNA 2XV4S 3SZPA 3FUKA 1YYHA 2JPBA 3AG1E 1KZPA 4PZJA 3S7JA 1HSTA 2VTBA 2HVRA 2K5CA 2DO7A 2BEDA 4UV9A 1ZK8A 2I5UA 3HPGA 3HYIA 3T1BA 2WXQA 4XORA 2VBWA 2WQ7A 2R7XA 3LEWA 2EFNA 4AYBN 1AKHB 4U95D 2ME0A 3UTMA 1IUFA 4NQ0A 3HHGA 3I55I 2L7MP 1N94A 2VE8A 3HXFA 1T8IA 1E3HA 4OIRF 1BR1A 1HS6A 1STZA 2DOFA 4HNUA 3TP0A 4IZZA 3BJOA 4V3IA 3S7DA 1R7JA 1IHBA 1P4WA 3FBIB 4M3EA 3BDDA 3H36A 2W24A 3LSRA 3TG4A 5H2FC 4A3KJ 3WTXC 3J5PA 2MFZA 3W2WA 2DPUA 2OC6A 3JXIA 3MEKA 4GPKA 1D8KA 5J4VA 3REOA 1YJNI 4HNVA 5J3LA 5AQBA 3BTIA 3B95A 3Q9VA 2BOLA 2IEJA 3H35A 2OVFA 3I4RB 3TJPA 4CZZA 4IHVA 2E35A 5KWDA 2Y0BG 1BI1A 2VE9A 4V2GA 3KLOA 5CRVA 4XLFA 1PVEA 5D5VB 2L2OA 5CVUA 3AU4A 5FTPA 3HVEB 1BIBA 1W7PB 3CCYA 2RG8A 3SQVA 2VJJA 4N5QA 1BJAA 2HWVA 4OMYA 2DCPA 2XB0X 5FB2A 3WU1B 2ZNZA 1LJ9A 2PBIA 4RDUA 2L4AA 3FF5A 1WVRA 1SEUA 2YR2A 4G8KA 4IYPA 3KYDB 3SI5A 2QKLB 2J49A 2IGNA 1FX7A 2XF6A 2X51A 4OMZA 3GTKJ 4GTMA 1AWCB 4KYWA 2ACJA 3A4CA 3F6VA 2BY1A 3CHRA 3KD7A 3BR6A 1XMXA 5L3DA 2R7WA 1XSDA 4AD9A 4LNUD 4J00A 5K5QA 5B1AH 3OIQA 3DEOA 1K6OA 2P81A 4ZYHA 4P9UA 4GDFA 3D0SA 4GAAA 4YNDA 4JB8P 3HSFA 3B02A 3JCUC 3FUDA 4HS2A 1KYZA 1TT5B 3PQJA 5HLTA 2I2OA 4DQ2A 2O61A 3AS8A 1HW1A 5CQEA 2HOEA 3W6VA 3BG1B 3K4NA 4AV7A 3A01B 2IP2A 2WY7Q 1MDMB 3U4TA 2LSOA 2JABA 5GTHC 5HOOA 2IS2A 5A6CA 4L18B 3TEDA 3S3MA 4EM1A 3RYRA 2WXKA 2IT0A 1X4PA 2Q1ZB 2A5UA 2Z3YA 4M3GA 2OD5A 1I50J 3L2WA 3TAXA 4CGVA 3D9IA 4RAYA 3TOBA 1JWFA 1OFCX 1QRYA 4L23A 5K7HA 1VQOI 2XGMA 4M3DA 4BH9A 3K4BA 3F8FA 1VQ5I 2J4BA 2GRNB 4LB6B 3ULQB 1W0UA 5T3RA 4I1OB 5LHHA 2RVCA 3ZQHA 1N52A 2HTSA 2M7BA 3RCOA 4ZJZA 3IRQA 3ZCOA 4ILIA 4KN4X 4ON0A 5DIZA 2CQQA 2IPQX 3T8MA 2JPCA 4HLEA 1RESA 4MKTA 5EIBE 2KFDA 1TNTA 2LVSA 2XAQA 3ZFWA 1BI2A 2HZTA 4XICA 3QP5A 5DEQA 1IRXA 3BTJA 1YA0A 3CVYA 1F1ZA 1RR7A 3KS2A 3I4GA 1YTYA 5BV0A 2PM7A 3HL2A 5IYBJ 5TRDA 1F43A 4LUNU 2KZGA 2R7QA 2Y4TA 5JHAA 2BW3B 3E6BA 3MKWB 1ETWA 3X2QH 2NYXA 2ISYA 1MIJA 3ZN1A 3LY7A 4XLPF 1GT0C 4UY8I 1OCZH 1NI1A 5EJCA 3G2WA 2X6IA 4UUTA 1DPRA 3UX4A 2VPLA 5EILA 4ZDPA 1BC7C 3ABTA 5D6EA 4FA6A 2JZYA 4L0YB 3MKQA 1G3YA 4RB3C 2EIJE 2PJRB 3D9KA 2K3FA 3J7AY 1EH8A 3H5RA 4C3HJ 1YI2I 1OKRA 2JUGA 2V79A 4N4NB 3D9LA 1U2VG 4BNCA 1E90A 2IF4A 4D10C 2DLLA 4D9JA 2LAIA 3C3OA 1MJ9A 1SZAA 4BQAA 4HB5A 3I5UA 4I2ZA 2LK2A 2QFCA 2KCKA 3R7QA 3CCMI 3U64A 4HX7A 5CVJA 3CF5F 5LD2C 1WFXA 5LGNA 3I3LA 3EDTB 4GZ5A 3D9JA 3FTVA 1K78B 4P96A 1TWHJ 3NOGD 2LSUA 4O6FA 3QP6A 2QGUA 3C3WA 4F3QA 2P7VB 4GRIA 3CCLI 1W4MA 3FISA 1ELRA 2V1DA 1APLC 4XOPA 1N4PA 3Q78A 1P6RA 3FK6A 3J81K 4BXUA 2WWYA 5IP9J 1JUSA 2HQRA 4ASNA 1JI8A 3P7NA 3H3UA 1Z21A 2Y0SA 4PGGA 2PEXA 2XHKA 4E7IA 2XRLA 3GMEA 4RMNA 3WTUC 1PC2A 2NS0A 2BHZA 5C4XJ 4QIWN 2DZNA 2P9IG 3JQ1A 3GW2A 1OLTA 1YE9A 4AM3A 1H9GA 1JE8A 2KIMA 2XPUA 3CDLA 3AJIA 5ARFA 3U66A 3MMYB 2CV0A 1UMQA 2HPIA 5CRUA 5HS0A 2FOWA 2WAEA 3HTSB 3FU6A 2WPVA 5TJJA 3FUEA 2X1EA 4PGHA 2FI7A 4FP7A 3I71A 3E5UA 1U3CA 4XEIG 4DK5A 3GW4A 2HQNA 4HRLA 3GO5A 4HSTA 1T0FA 3FXJA 3JRFA 2V4HC 1UN8A 3M8FA 3MYVA 4HLXA 5FZSA 5IOYA 3FH8A 2IGMA 1LFUP 1GHCA 3BLYA 1D1AA 5E3OA 1RW2A 5E8IA 4JA9A 1MBEA 1SFEA 2KIFA 2LY1A 3TBIA 2GM4A 2QLZA 3CCQI 4B4CA 2O03A 3MQ0A 4RM2A 4CHUA 5FJ8J 2OAZA 2H6FA 4GMLA 4TUUA 2DMUA 2PX9A 4Z68A 3EUKL 1Y1VJ 1DUXC 2HPMA 3CCJI 3QDNA 2FSWA 2JSPA 1YW9A 1Y8MA 2YPRA 2VKVA 1H6PA 2R05A 3IAS2 2GRPB 2VN2A 2HO1A 2J4DA 3RQ4A 2PNNA 1IYGA 3CJQB 5E3LA 5DV5A 3J7AO 1VTNC 3KSLA 2O8XA 3ZMUA 1QHHD 4FT8A 5CMYA 3VLDA 4AJWA 2BXYA 4BT8A 1MNEA 4MLOA 3G2TA 2WXMA 3OAWA 1ETKA 4C9BB 4RGXA 2BKGA 2L0KA 3LSGA 1GVDA 2CRGA 3SYTA 3WG7E 3IC7A 5E1WA 5KJKA 5D5UB 1OCTC 2MRIA 5A2QK 4RB1A 4BTBA 4L5EA 3NB2A 1S29A 3CVVA 1J75A 2CO5A 2UXXA 4ESFA 2Z33A 5IOZA 3PEVB 1D3YA 4PS3A 4FE7A 3CEQA 3VYRB 1OR7A 1UHWA 1XTAA 3HUGB 3KAEA 2JTVA 4WXCA 3P1UA 4HPQA 4UVBA 4D7NA 2OV7A 3DPYA 3PE4A 2BF0X 1TNUA 4I6EA 3JW4A 1BOBA 1HF0A 2R7TA 2IJLA 3A1YA 1OWPA 4G12A 4CA0A 1LE8A 1JGSA 3FKJA 1OYWA 2ZSHB 4GYYA 2XPVA 3DEUA 1X19A 2X6YA 4MO7A 3FXRA 3HXEA 3ASOE 5FIOA 2R59A 5B3SE 2IA0A 2VASA 3HOTA 4CZ2D 1WJBA 2NVTJ 2OTJI 1MBGA 1NZNA 2Z99A 1HW5A 2A6EF 1K8KG 3FXMA 3SQNA 5HVQC 3CCVI 1ITYA 3HOSA 2OVBA 4MEYF 2LAHA 1JKOC 3CP2A 3VTXA 5EDSA 1XX5A 3AG4E 3ZYMA 3L82A 1QA6A 1DPUA 1K1BA 3E32A 2IO3C 1BD8A 4Y6WA 4YIIA 5IP6A 4XR6A 3WTVC 3VDXA 1LQ1A 2JUCA 4K03A 1IGNA 2F8XK 1IUYA 1MBKA 1X3WB 4EECA 2JRMA 3QPHA 2DT6A 2CW7A 5EZGA 4EATA 3HVEA 3OS0A 4DX7D 3J7ZI 3S2DJ 3FU0A 5FFZA 2K40A 4L7TA 2JT1A 2R5YB 2OCCE 1PUEE 2FBIA 4BGDA 1ELKA 3LXUX 3PFIA 4E7ZA 5JFRA 1D8EA 4U7DA 3B6AA 4L9TA 3H9QA 1AWCA 2FJ1A 1PP7U 3MX3A 1ZHFA 3MWMA 2J8SD 1JT6A 2L9BA 2A07F 3BR2A 3FK7A 1R22A 4O6JA 1IV6A 1IXRC 3L6AA 1TQPA 4J7WA 4BY6A 2LFBA 4U8HA 4L5JA 2UXNA 2XEVA 2NVXJ 3SF4A 3Q5MA 5KJNA 4Y52J 5FKNA 1R49A 5JJ7A 2FOKA 2ZB9A 5EF6A 2E2EA 3CHOA 3BR1A 3PRZA 1ONVA 2KZVA 3P9KA 5JJTA 5FWQA 1W5TA 3VEPA 3FHZA 3DBSA 1Q1VA 3D5LA 5LHIA 3ESKA 4NRHB 3TGOA 3S7BA 1QNFA 4G11A 1X2MA 3EUAA 4P1WA 1CQTA 4O1OA 3LQRA 4HV5A 2DMNA 3GYHX 4HQDA 3VLFA 2ECBA 4UVAA 3KIOA 2XS8A 1ETQA 1Z3YA 2Y9YA 4BHBA 3E5XA 2I1KA 3HDXA 4EPZA 2XPWA 2KXPC 3FWEA 4A5MA 1TNOA 3O48A 3CVPA 2KZTA 4Q5SF 2V26A 4BWRA 2A6TA 3T8KA 2PI0A 2CHWA 5G04J 1IO2A 1SD5A 2OJED 3QAHA 5AQ7A 2XZTG 3BTLA 3OMYA 4MNUA 4BE0A 4HF2A 3GZ1A 2B9SA 1KT1A 5F0HA 4DBQA 4AY6A 2F0YA 2NS8A 1JHHA 3VOEA 3BT9A 2PQRA 3RRUA 1LFPA 4UWGA 5E1XA 2E5NA 2WA0A 1FPPA 3K1MA 2EA2A 1FIAA 3P2BA 3UNGC 3KLNA 3BUAA 2E71A 4XI9A 3DCFA 3BTCA 4NHJA 2DJIA 4J8SA 3RRMB 2ETBA 3CKCA 3DTEA 1E7UA 3QARA 2V6CA 4BXXJ 2H6CA 1FY7A 2VTBB 1UN9A 3LQQA 1VNDA 2MH2A 4JYKA 5C4JJ 5B1BH 3R7RA 2WB2A 4U7BA 1V3FA 3O8GA 1H89C 1AU7A 1O7LA 4MQVA 1IXVA 1H6KA 3L2RA 2Y1LE 1QQEA 3B7UX 2L0IA 2XSDC 1LPQA 1I6HJ 1QHGA 4FQGA 4G8LA 1J09A 4KN7X 3L9FA 3LPZA 3W9GA 1OY3D 5HKPA 2H27A 1NH3A 3BR3A 2IBDA 3ZOBA 2EQXA 1G8XA 4JOMA 5KNHD 4KMFA 3ZYLA 1SVXA 4IN3B 2XC7A 3GTMJ 2P2CP 4H7YA 2IONA 1MMDA 3FTWA 4U0UA 4WX9A 3RQIA 3CVXA 3S3NA 2LBFA 2QENA 1ZRFA 2KJBA 5DTDA 4LB5A 4QFVA 4U04A 2R2LA 3UPVA 1LKXA 1FOXA 1T0FC 2ZO4A 1GDTA 2K3PA 4TV3A 1W1WE 4RBOA 2R7VA 2B6CA 4I9EA 1IXCA 2OUMA 2OEVA 2QF7A 2PM6A 2V9PA 1DCEA 5F04A 2CHXA 3BG9A 2XF5A 1KONA 2EWNA 2WBMA 4I01A 1K4TA 3TGNA 4IVNA 1YHQI 4IEJA 3FXKA 2HZDA 4GXOA 2A4ZA 2OEWA 2FBNA 3ZRHA 2XKOA 2Y75A 3EYIA 1XGSA 3V2XA 2FA5A 1GV2A 1WHUA 3I9V2 1I1SA 3EUHA 1BN5A 1S64A 3I3NA 5G05J 5CHEE 3UIPC 2N8GA 2L7KA 4Y4RA 2P8TA 3QPSA 3ZKJA 3H0GJ 2CUZA 2AXTC 1WWXA 2QQ8A 3BQZA 3CR3A 4I2WA 4UI9K 4AIDA 2TDXA 4F7ZA 4BU2A 3WU2C 2EZIA 2VJIA 1JXSA 4L2YA 3OYDA 3COAC 1X81A 3EQLF 2I8DA 2Y0SN 1INZA 4C9YA 3OXFA 1KU3A 1X58A 3GVAA 3WHBA 1EDUA 3HG0D 4LMYA 3V30A 4AVPA 2QSFX 4EJVA 4TRQA 4QPQA 3HKZN 2AXVA 1XB4A 2HGCA 2VJ5A 2XAFA 4URKA 2KRFA 3GLXA 3MZYA 3CJTB 3JRDA 4I17A 3GF2A 1RC9A 3M07A 5DDGA 3JTHA 3FH7A 4IL6C 5DCFA 2BV6A 2RAEA 2OV8A 3LSPA 3IKTA 2NXPA 4HLLA 1XNFA 1SVLA 2V6EA 3L16A 4HDUA 3ZQQA 1R00A 1FT9A 2UY1A 4LG3A 1BW6A 1KA8A 4I99C 3HRAA 4KZCA 4DX1A 2M5WA 4I02A 1QBQA 1Z1DA 4ABZA 3CESA 3FUIA 2HS5A 3Q15A 1JCQA 1SFUA 3VB2A 3ZMZA 2R0QC 5CBOA 4RLFA 1UG2A 3HPHA 4WUYA 4CDRA 2VC1A 2DTZA 2XDVA 4KIBA 1TWFJ 4L9VA 3LVQE 3O4ZA 5JVTA 5BXUA 1F9NA 3ESLA 1JUPA 1R1TA 2EINE 2A61A 2NRAC 4GYGA 2ZXIA 5ANLA 2F48A 2WXNA 1HXDA 2JLBA 5CPRB 2EIMH 3RPUA 4FHKA 1W7PD 3PUFA 5F0CA 1SD6A 5LGUA 1X1CA 1H19A 3S93A 2RDPA 3U1KA 2K9LA 2IQCA 2VQLA 3OXGA 1QGPA 3JRGA 1FMVA 4XSZF 3W3CA 3TL5A 2QSGX 2BY3A 3C7JA 4I6JA 5HQ8A 1ZRDA 2YSRA 2VI6A 4A5NA 4CCOA 2WXGA 3CVLA 1Z5SC 4RS8A 3LL7A 3VFZA 1YFHA 3S15J 3BG0B 3MKQB 4HF0A 1WKMA 1SQMA 4JHJA 1RUOA 4C2MJ 1E3PA 3RKVA 1V5GA 4UUVA 1YQAA 2V8SE 4I1AA 4LD5A 5HDGA 2C0MA 1OCCH 4KT5C 3TO9A 3PIPF 1R36A 2R3SA 2MD0A 5FKLA 4D0PA 2QY7A 3ASHA 2WV1A 1HH8A 4U0VA 3CUQB 1Z77A 3PFYA 4X6AJ 2EIKE 3SGHA 4UWKA 2NNYA 4AM9A 3HOVJ 1TEZA 4IJAA 2OTLI 1TWCJ 4RSYA 4TXPA 5AIJA 2KIQA 1J5YA 4XLCA 5H20A 1QNTA 2NVYJ 2F5CA 3CVUA 4HAMA 4KIGA 2ZFWA 2EH3A 5BPDA 5EYRA 3V79K 4MIMA 1MNDA 4V2FA 4DLQA 2CV2A 4LGWA 2AQFA 1B59A 4HYEA 4NC8A 1H88C 2E1MB 3VSKA 2ZNYA 1XS9A 3CO6C 4N2SA 4MS6A 5CYVA 5EKQD 4I0AA 1U8RA 3KEZA 2X6OA 3FTSA 2DODA 4F53A 4G7HF 3E0JB 1ETOA 1F5TA 1TNZA 1ACIA 2AXZA 2HM8A 3ASNH 4KYOB 5C3EJ 2H6GA 1O3QA 2CW0F 2R92J 4JEUA 4PSWA 1HW2A 3FEYA 2MHKA 2DFIA 2B0LA 1NP7A 4HRNA 4LSZE 3E6MA 2JWTA 4BXFA 4ENNA 1VQNI 1YS7A 4E6HA 2NXNB 1SMTA 4NDLA 2JA7J 3CCSI 2H94A 1R9TJ 3DPTA 1DGWY 2ZGDA 5GAGJ 3U2RA 4IQJA 2I6HA 4LFUA 2R03A 4G94A 2WXJA 3WTSC 4UI9C 1BI3A 5G2NA 1L0OC 5F64A 4KT6A 1B8IA 4X0GA 4PUSA 3AL0B 1K1AA 2LSVA 1FP2A 3DFGA 2CUJA 2UWJG 2IGKA 3TWWA 1X1PA 1MSFC 5F1RA 1HFAA 3DBLB 5EN5D 2IXSA 3JSPA 5ILVA 2GRQB 3C2HA 3KETA 2Z9OA 1T33A 2CHZA 4BTAA 1FSEA 2R93J 1NG6A 3UM1A 4R8HA 4DOZA 4FHJA 4NBQA 3RJVA 2OF7A 4AEZC 2FMLA 3S8PA 4AXHA 3KEQA 1ORKA 1IN4A 2Q0OA 2O9LA 3PO2J 2GRRB 2DDBA 1Z3XA 2M1BA 4RB0A 3JYSA 3ZGQA 1WH5A 2RKKA 5EG0A 1H9TA 3B13A 2R7UA 3BROA 4FULA 4JP0A 3DEPA 4MGRA 2J9QA 2XPZA 1UB9A 2JRTA 4GMRA 2XRNA 1Y1WJ 4OVUA 1A04A 3QU6A 3OOUA 5EYLA 4IHWA 2AWIA 1XSVA 2A69F 2D2WA 1VDYA 2RFAA 2PQ8A 1TZLA 4E6KG 2M30A 3P5JA 2A68F 3ABUA 3T8RA 2AW6A 3LSTA 3ZMDA 3NZSA 2L7ZA 2C2LA 3AG3H 3D5SC 1AA7A 4H7XA 2F37A 4GTRA 3HIFA 2GRMA 3PUKA 3SZGA 2MLGA 3T0YA 4K2EA 4F1SA 3ERMA 2NVUB 2YNQA 4OINF 1TJCA 3KP2A 4DI3A 4ZFHA 3I58A 1HOMA 5CEDB 1ZRCA 3ZN0A 3QNKA 3K4JA 1TN7A 4C2TA 4EMSA 2VQ2A 2ZXJA 5LCWJ 2L5QA 2MSYA 4A0XA 3RRNB 2C0LA 4GGGA 5JVGF 1K6YA 3K69A 4EJWA 4ANXA 4LG0A 3CTAA 5EDNA 3EDPA 2GOXB 5LEJA 4J8EA 4ME2A 4JC8A 5KJMA 3GLLA 2CUEA 3TW6A 1ZLKA 3SHFA 2E1OA 1D1CA 3F8BA 4QTRA 1LE8B 2E1NA 4IHYA 3A0BC 1D1BA 2G7HA 2KCVA 4G23A 4O60A 4X8QA 1GUUA 2FUG2 4RGUA 3GZ6A 4PFPA 1B89A 1SVOA 4DJAA 4S05A 4A3MJ 1XCBA 5B66C 3TWVA 4I9CA 1T39A 2AJAA 3CQGB 3U1DA 4ESJA 1BC8C 4YDOA 2DA6A 4II2A 3CMAI 4A3TA 4XN0A 2PLYA 1IN5A 4BJ6C 3RIRA 3AG2H 3D1NI 1OCZE 2ETHA 3F8CA 2VT3A 2KBXA 5IT9Z 3FTYA 4F6RD 2MBFA 2DYRE 4UWLA 3OYLA 4HI8A 3L2CA 4BX8A 1S7AA 4G26A 4JHRA 3UM3A 1WJCA 3FXQA 3ZQGA 4OAZA 5KCMA 1MNMC 4D1QA 1HG5A 3Q0WA 2Y2ZA 1BR2A 5FZRA 4MQ9F 1C0WA 3CHMA 4KIFA 4BUPA 2GW1A 4BFRA 3JXJA 1TQIA 4ZDLA 3SO8A 1HKSA 5AONA 4H0EA 2F4MB 1YX5A 2WTEA 3CC7I 1U5TA 2KC7A 4ZZDA 3KZZA 2HI3A 2LF7A 4TXRA 1MYOA 3Q7AA 4OOIA 3JUEA 4C2UA 1YLFA 3WGIA 1TN6A 3I53A 1OT8A 4IRUA 4YDEA 1KQ9A 2LXLA 1G6NA 4ANJA 2WXLA 2VONA 3M1EA 2BKKB 4NURA 2EILH 4JL0A 4RQIA 4JK1X 4ZYDA 1O5MA 5ILSA 3FX3A 1ODDA 5DS9A 2HYFA 2IA1A 4CT0A 1VQLI 3ABLH 3PQKA 4XLHA 2XF7A 3DBRB 4I76A 1A5JA 4Q96A 3WXXA 1N95A 3Q7FA 1ZB1A 3KEOA 5DBKA 3ZHEA 5KVRA 4IRIA 3ZU7B 4M3BA 2LY2A 2VJ8A 4NUBA 4GZDA 3MA5A 4A3BJ 5LX8A 4PJMA 4EZJA 3OR2C 2ESHA 1S70B 1KQ8A 5B5EC 1G59A 2VGYA 2DBBA 2KZTB 4BE2A 2V0PA 2FQ3A 4JA7A 4BESA 4E7HA 2JA5J 1MH3A 2L9SA 3R4KA 1ZG1A 1WGXA 3D9NA 2EA4A 2EB7A 4XE0A 2DOEA 1ZG3A 4BEHA 2GXBA 2EBIA 1U78A 3E30A 4ILHB 1P92A 4ZHBA 9ANTA 4NNJA 1J7KA 3JQ0A 1OWNA 3IWFA 4A0YA 2DIWA 3CJRB 4HQEA 2RFMA 2VKHA 1E3OC 2M63A 4N9IA 3ZQIA 3FU5A 1NA3A 2WQ6A 2PN6A 3NQOA 3S2HJ 3ASFA 4F92B 4A3CJ 2YINA 2X1CA 3NAUA 2HKOA 3T5XA 1JPLA 3P9IA 3AG1H 3I64A 2KJCA 4U7EB 1ETYA 3ABME 5EX0A 2XGEA 2I1JA 5GPCA 2QSHX 1WJAA 4DGWB 4XBFA 5GP9A 2GA1A 1FVHA 1U9NA 5CEAA 5ICEA 5ENSD 1IJWC 1QQIA 4WNGA 4W97A 4DIQA 2HU9A 4ITVA 2XCBA 1B72A 2CG4A 3FUHA 1IN6A 2M8EA 4K5CA 3PO3J 3IHUA 4AIKA 3HZJA 2Q8KA 3FU3A 3OXLA 2WB1A 2YU3A 4BJTA 3CKBA 3QKYA 3LAJA 2W48A 4GTOA 1XDUA 3IKVA 2CWEA 4FETA 3DLAA 1HQCA 2E7WA 4HRIA 4YDWA 4Z2YA 2LBFB 3CUQA 4N2QA 5E20A 2EFWA 2P5VA 2ELKA 2O3FA 1VQPI 4L9PA 5A23A 2XAJA 2EZLA 2DMQA 1V4RA 4XK4A 2F5EA 3ECHA 4WF2A 4FCYA 4EHMA 2FEZA 1YW7A 3M3YJ 2LP0A 3BJ6A 1IZ1A 2A6HF 2X48A 1A36A 3V2OA 4ANVA 3OYHA 3PREA 3LA3A 1YITI 4LCTA 1FBSA 2CFZA 1FEXA 1ELWA 2IOSA 4M9SA 2M45A 2TRTA 3C18A 3PSFA 2E5ZA 4ZYGA 1EYHA 2R7DA 5HNHA 2ZC2A 3HOYJ 1MMGA 1P7IA 2V4LA 1R4NB 3E6DA 2WXRA 1FSHA 3BZ6A 3K9TA 5J47A 1PAQA 3KP7A 3Q0UA 4KJZA 3VODA 4CICA 1JGGA 3CQCB 4N39A 3UKUG 4A3LJ 4JHKA 1OCOH 2ZJQF 3FULA 3H9GA 3I4PA 3FUJA 5AARA 1FBUA 2VBZA 3LS8A 4WCGA 3BG6A 5ENRD 3ZXPA 3CLOA 3ONKA 3HXCA 2R7RA 3DXJF 1XDSA 4A93J 4ACKA 4JX5A 4DZJA 3ZQ7A 2ZXWE 4RAFA 4RLYA 1Z6TA 4Q94A 1IN7A 3ZNGA 5J1UA 5F27A 3TDUC 4AIJA 2FO7A 2P9LG 1Y6IA 1V55E 1HX8A 3EIQC 5BV1A 1BOAA 4DW6A 3BG3A 2L54A 2WXIA 2GIVA 4DYQA 3CMEI 1MX2A 4XM3A 2H1LA 1R5ID 2ZMEA 4OIQF 5EEGA 1TNBA 2K27A 3CK9A 3QC1A 4FLHA 1HDDC 5BXOA 3GTQJ 1I1GA 5DUIA 1UHMA 2BY0A 4I1MA 3H9JA 4H4KC 1T95A 1EF1C 1H6OA 4CYCA 4TUMA 3WE3A 4PJ0C 4WWNA 1RETA 1E0EA 3WTWC 3FFLA 2UY1B 1OCRE 3J80K 4CYMD 3L13A 3B7RL 3R60A 3OIPA 1WRJA 2XGCA 4II3A 1JKPC 2P9KG 2ZJ2A 1FMWA 4NQWA 4OU0A 5AIPA 3SFXA 3RYPA 4X1EA 3QWVA 3UXGA 2WC2A 4HORA 1UG3A 3C1DA 4GU5A 1XMAA 4BSZB 1HDPA 4IF4A 4AY5A 1Z91A 4HFGA 1WPKA 5BQTA 4Q4ZF 2CGPA 3K2ZA 2OOEA 2RQQA 4APFA 4B8AA 1PJRA 2WAQA 3ZQCA 3OL3A 2FQ4A 3O3KA 3HDDA 1WJ5A 1USSA 1CF7A 2O8KA 3SZTA 2F2EA 3URZA 3I54A 3SY2A 3W2AA 1L5JA 3WU0A 4B1RA 3RTRA 1EF4A 4ABNA 2GA2A 1FIPA 5FD5A 3IKOB 2PMZA 2VOPA 3K10A 1DP7P 2Z16A 1UW4B 2EIJH 3ZYQA 4MEXF 2VGEA 1KU7A 3NEUA 5ENTD 3RI4A 4WNFA 1IG7A 1HU3A 1SD7A 2LRDA 3F21A 2HNHA 4A63B 3DKXA 5EEAA 1W3BA 4HOTA 3ZQFA 1P2FA 2VSOE 1SFKA 4M72A 1MW7A 1T6SA 3NRVA 4O5VA 2JA8J 3APFA 4DUIA 1BR4A 4RGSA 3S3OA 1ETXA 4B48A 4IOCF 1QVUA 5BPIA 1HE8A 2KLOA 2LD5A 4JEHA 1ULYA 3G1LA 4N0BA 2GQQA 5FJYA 3G6EI 1DQUA 4FLBA 2DFEA 2DPDA 3QJZA 2DT7B 4HEA2 5D4SA 2J5OA 1A5EA 2LKSA 3TWSA 2CQNA 3A03A 4A3FJ 5D5XB 1S6LA 2BTDA 3FY4A 4FISA 1MMSA 3H1CA 5FQ4A 2JA6J 4N3BA 4HBDA 2D45A 5ANRA 1LUJB 5DM6F 1BIAA 2X6HA 2M34A 2H09A 4S04A 3W6KB 4ZDOA 5HS7A 2P4WA 2VQCA
chains in the Genus database with same CATH topology
2VC0A 1FP1D 4LLNA 4PDKA 2EFQA 3KP4A 1FBQA 1YG2A 1OPCA 3WTZA 1TLHB 1WI9A 1Y0UA 1YS6A 3MCZA 3F23A 1J59A 4M6XA 2JSCA 3QPTA 4EJUA 2ESNA 4Q47A 1ZGJA 3N97A 1IAWA 2F5FA 1LDDA 2BE5F 4KNYA 1J9IA 5BS6A 3JSOA 2MD5A 2QBYB 5DCMA 1KQ0A 3GWZA 2DI3A 1RIOH 3KZYA 2HTJA 1O3RA 2VBYA 3LA2A 5IT9K 4IPAA 2XAGA 2P7CB 3TQNA 1KGSA 2VXZA 3S2WA 3HRMA 4P55A 2COMA 1UCRA 3ECOA 2IA2A 2QZ8A 1S8NA 2CYYA 4WXHA 4QLCU 1GXPA 2CSOA 2PJPA 3TDZC 4LG0B 3BP8A 3L09A 2RC4A 3HSEA 5LBQA 2M87A 2R7FA 2J5PA 2QM3A 4P5OA 1QO0D 4CYDA 3O6BB 2PMUA 1SD4A 2EFOA 3BOQA 4YG2F 3ZP5A 1SMYF 3QOPA 1O57A 5LEKA 3GEZA 2A5YB 3KP6A 3RKWA 4JQFA 1XGMA 4EV0A 1NHAA 4HX4A 1FYKA 2VBXA 3KCCA 1BI0A 2W25A 1U5TB 4U88A 2ZKZA 4HZFA 1LNWA 1XGOA 4M9ZA 4M71A 2K7LA 3WTYC 1PP8F 4EM2A 1IN8A 1D5VA 4IRHA 2FE3A 4HA8A 2ZCWA 1KYWA 3QRFF 1T2KA 2QQBA 1HBXG 4UV8A 5L3CA 1RNLA 3RKXA 2QYOA 2AS5F 2DQRA 1U3EM 2FU4A 1QZZA 3GZ5A 4MTDA 4I2OA 2CFXA 4MTEA 4LK1F 4KFCA 3AAFA 3HTUA 1LDKB 2RQPA 3WGGA 3DKWA 5DD4A 3LAPA 1DDNA 2DW4A 3ZMSA 4RB2C 4M6YA 4A2UA 2OQRA 4WXDA 5H6RA 5L3GA 1RZ4A 3O2PE 3HRUA 1LB2A 1USTA 4TV7A 1MJAA 5LLQA 3TO6A 5BOXA 3T8TA 4UVCA 1ZG5A 4I0BA 2CQKA 5HDNA 1SAXA 1SFXA 5CLSA 3Q5FA 1YO5C 2FNPA 5FD6A 3WTTC 4FX4A 4ZYEA 4KDPA 2PG4A 2ADUA 4YFNF 4HW0A 1YIOA 3RJPA 2DQLA 2GXGA 1U6GA 3JTGA 3DQVC 5D8KB 5E8GA 4EJOA 5L3FA 3G3ZA 1B1BA 3MFKA 4U0WA 3M7GA 3JAMZ 1Z05A 5CVVA 1H0MA 3R61A 3K0LA 1ON2A 2ZMEB 3GUDA 4LLGF 2AXLA 3WE2A 2LF8A 3HRTA 5ICFA 2UWMA 3LWFA 1ZGAA 3EYYA 2D1VA 4WK8F 4LLLA 4HX8A 3L7WA 1GVJA 2QBYA 2EFPA 3RDIA 1CGPA 2C6YA 2PMHA 2O0YA 2ISZA 5FLXZ 2K86A 2D1HA 3V8LA 2UZKA 4G7ZF 1CF7B 1TW3A 2VOOA 2STWA 2KKOA 1ZREA 2QUFA 1T98A 4BHPA 1LVAA 3KFWX 4L9NA 3F3XA 3V4GA 3N4MA 3CDHA 4OIPF 2RN7A 4PCQA 3KE2A 2NAZA 2E1CA 1IF1A 4XLNF 5HS8A 1TTYA 2MLKA 3M8EA 1L3LA 3LFKA 4A6EA 2LDUA 3RKYA 3FZVA 1J2XA 4JBAA 1EV7A 1E2XA 1U2WA 4EJTA 4ESBA 1FZPB 1UFMA 4AWXB 4DNCA 2HEOA 2OZ6A 3ZMVA 5HLGA 4AIHA 2V9VA 3KP3A 5HS9A 4ETSA 4GO1A 4FX0A 5IT3A 1O3TA 4EM0B 1O3SA 3V7CA 1FOKA 1R23A 1D8JA 3FMRA 3ML6A 4EGYA 2BGCA 4ENMA 2QQAA 1IRFA 4BAYA 5DCMB 1O7FA 2K02A 5K1YA 4P9FA 4XRFA 2EK5A 1KU9A 3ELKA 2OA4A 4L0ZB 2H6BA 3Q9SA 2EJRA 3GFIA 2G7UA 2L01A 5LRRA 1R1UA 3ZPLA 1Z6RA 3WG9A 1HKTA 2VODA 3GFLA 3HSRA 2RGVA 3FM3A 4YFKF 1G3SA 3G73A 1ZN2A 2EV6A 3H92A 1RUNA 4MHGA 3BY6A 1K7AA 4L5IA 2K4BA 3MZHA 2F5DA 1FNNA 3MEXA 1EH6A 5J8CA 1WQ2A 1G3TA 3V8JA 2RNJA 1ZLJA 3U9GA 4R1HA 4WWCA 4M73A 1Z7UA 1Q1HA 1FYMA 5JHUA 5KK1A 3E97A 2MC3A 3FMQA 5CVIA 2Z5UA 3WGHA 1WSUA 4UNOA 2XAHA 3R0JA 1I27A 2LNBA 3L00A 4KA4A 3F8MA 2IRFG 3OV8A 5LRSA 1G3WA 1ZYRF 3RPQA 2FBHA 4BHCA 2DK5A 4UHTA 5J8FA 4HBLA 2FBKA 2GWRA 1XCVA 1ZAOA 4B09A 4A12A 3F6OA 2Y48A 2FNAA 1S7OA 4HOBA 1BBYA 5D6FA 4CGZA 3KP5A 1R1VA 5ED4A 1XSXA 1B9NA 3V7RA 2EV5A 2GAUA 2VT2A 5E17F 1R58A 4XSXF 1QZYA 2P5KA 4CDGA 2GZWA 1XD7A 4FHTA 5BMZA 1REPC 3B73A 1P4AA 2QVOA 3DPLC 3F8NA 2DT5A 1IXSB 3HRSA 4G6DA 3ZMTA 1TQMA 3JAMK 2G9WA 3BPXA 2Y0MA 2X0LA 3E6CC 4KICA 4I98B 4R79A 1ZH5A 2HDCA 1QBJA 1ZARA 4HLYA 3P9CA 1B6AA 3I59B 3GXOA 1U5TC 1J0RA 1I6XA 4NB5A 4OIOF 4GYIA 2QQ9A 3DV8A 5ERIA 1OYIA 5L3EA 3HHHA 2BEOA 5FLXK 4HDVA 2QWWA 5HDKA 1XGNA 1IRGA 4N9HA 4I7HA 2MA3A 4M9XA 1B4AA 1X3UA 2L4MA 5ICGA 3IL2A 2DTRA 4E70A 4YFXF 2W84A 4Y13A 5DD8A 3BWGA 3V7SA 3ISPA 3BPVA 5JI6A 4ENKA 3LA7A 1FC3A 1OYYA 2IW5A 3TKYA 3IWZA 2O6GE 1E17A 4I09A 1W7PA 2XKPA 4RAZA 3F22A 3MAJA 3CUOA 5K5OA 2OU2A 1TNSA 1YYVA 3DP7A 4YIFA 4ZZLA 2DAOA 1MZBA 2MH9A 1ON1A 5CJ9A 4HV6A