1RZ4A

Crystal structure of human eif3k
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
215
structure length
213
Chain Sequence
b'AMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADEQIFICSQEESIKPKNIVEKIDFDSVSSIMAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Eukaryotic translation initiation factor 3 subunit 11
publication title Crystal structure of human eIF3k, the first structure of eIF3 subunits
pubmed doi rcsb
source organism Homo sapiens
molecule tags Biosynthetic protein
total genus 69
structure length 213
sequence length 215
ec nomenclature
pdb deposition date 2003-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10075 CSN8_PSD8_EIF3K CSN8/PSMD8/EIF3K family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1rz4A02
1.25.40.250 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat ARM repeat; domain 1 1rz4A01
1T98A 2ZMEA 2JRTA 4GYIA 2EB7A 4LG0B 1WQ2A 3T1BA 2XGXA 3JAMK 2MD5A 2YX7A 2HEOA 3ZN1A 1RNLA 2VC1A 1BM9A 3ABTA 4PCQA 4HDVA 3V7SA 1FYLA 1HKQA 1PDNC 4UHTA 5E8GA 4EM0B 1G3YA 1QO0D 2OD5A 3SHFA 3T5XA 2PMHA 4ZZDA 2NNYA 4NQWA 1ZGAA 1S3JA 3WTXC 3CTAA 3KFWX 2CFXA 4R79A 1H9GA 5E18F 4HF0A 2UXNA 4ENMA 3F8FA 3RI4A 1W5SA 5LHHA 3H3UA 4S04A 1FBSA 3R0JA 3WGGA 3DXJF 4G9YA 1ZARA 3HSFA 4KIFA 1IRGA 2DTRA 4WK8F 2M30A 2Z99A 2RV8A 3KP2A 1EH8A 2ESHA 3NRVA 1CGPA 2GA2A 1IXSB 1O3QA 3ZMZA 3LQQA 3L7WA 3T8TA 4RAZA 2Y0MA 5DUKA 3B73A 1P2FA 1KQ9A 4RB3C 4A5MA 3DFGA 1U5TA 5J6XA 4KIBA 1YW7A 3HSEA 5F1RA 2P4WA 4RB1A 2D45A 4G6QA 3WTYC 2EFPA 2E7WA 1FP1D 5LEJA 1I1SA 5CJ9A 3BJAA 5K5OA 2D2WA 4IPAA 2RVCA 5DCMB 1ZG3A 3PFIA 5DCFA 4EJOA 5D5VB 3BOQA 4G7OF 4A2UA 2UXXA 3K1PA 3DQVC 2G7HA 4CXFA 1XSXA 4HV5A 5DD4A 1HQCA 1SD5A 2XROA 1Q1HA 4MEYF 3KP6A 1TW3A 3O6BB 2NRAC 3KLNA 2RKHA 2IRFG 3E6CC 4Y15A 1UB9A 2HQNA 2CYYA 2OBPA 4L0YB 3QPHA 1FBQA 5AONA 2CGPA 1S29A 4EMSA 4S05A 5LRSA 1PUEE 1L0OC 3ZPLA 1FP2A 1QZYA 3O3KA 4GO1A 2NYXA 5LBQA 2W84A 1O3SA 4AWXB 4LG0A 2KRFA 3P7NA 4ESBA 1AWCA 2IT0A 2BE5F 2EFQA 4UVBA 3K9TA 1T6SA 4YFKF 3JTGA 5F6FA 1DPUA 1OMIA 3K1NA 5IT3A 3K0LA 3M8EA 2YX4A 2L01A 5IT9Z 2VBXA 1K79A 2VONA 1V4RA 1IXRC 3DPTA 3JTHA 3TOAA 1TQPA 4R8HA 3I0TA 2EV6A 3MAJA 5AIQA 4CDGA 1K7AA 5E20A 4DQ2A 3RKWA 2VXZA 4MNUA 4KMUX 3FXQA 2EA4A 2BGCA 2RQPA 2ZNZA 2HTSA 2R7FA 4B8XA 3JAMZ 3FMQA 3KE2A 3HRTA 2E1CA 1ZYRF 2VOOA 3AAFA 3EUHA 2FBIA 3GF2A 2K4JA 3WTVC 3FM5A 5L3DA 4F7ZA 1ZLKA 4BXUA 5HDGA 2HDCA 2DI3A 4AD9A 1O7FA 2XKOA 2QENA 4KDPA 1ONVA 4A0ZA 2V1DA 1FYMA 3I71A 3J81K 4HOBA 1MZBA 3T0YA 3GYHX 3HHGA 3LA7A 3WGHA 2DQLA 3MQ0A 4RGRA 1F9NA 2Z5UA 2XAQA 1FZPB 1IRFA 2QWWA 3WGIA 5KK1A 4XRFA 2TDXA 2VT2A 1XGOA 4EJWA 1J7KA 5DUIA 2A68F 3NEUA 4UV8A 3E6MA 2J5PA 1CF7A 3QAHA 5ICGA 4YIFA 2A61A 4L5JA 1J5YA 1L3LA 3WTTC 3VEPA 1XMAA 2D1VA 4M71A 4LK1F 4EVIA 3P9CA 1MDMB 2BYVE 4I0BA 2WTEA 4L0ZB 5LGUA 3FXRA 1W7PD 1ZRCA 4WXCA 2XKPA 4L9VA 2ZNYA 3C18A 3MCZA 3KP5A 1I27A 4EGYA 3V8KA 1R7JA 3G73A 5TJJA 1HW2A 1HKTA 3CUQC 1LQ1A 2ETHA 4Q5SF 1YS6A 2M1BA 3Q9VA 1ZGJA 4QLCU 4Q48A 3LAPA 3T8RA 3REOA 3F72A 4UUVA 3KEQA 4HLXA 4LGWA 4MEXF 1J9IA 2VN2A 2ZBKA 5FD6A 1BBYA 1YYVA 3F8CA 2UZKA 1E2XA 3BY6A 1YIOA 2ACJA 1USSA 3BPVA 1HKSA 2A3SA 2JSCA 4P96A 4E70A 2DFIA 4ENNA 2XUBA 3GFMA 1U8RA 1STZA 3ZMUA 1QNTA 1PP7U 2KJCA 3G3ZA 3CJNA 2VE9A 1U5TB 2L4MA 4A0XA 3FF5A 4KFCA 1KU7A 2XHKA 5CLSA 2XV4S 2ISZA 1IF1A 2X4HA 1XN7A 4ON0A 4IVNA 1U78A 3HRMA 2L3DA 4IHSA 2K86A 3V7CA 5LGNA 1IN6A 3LSTA 4CO8A 3FX3A 3TOBA 4ETSA 5FFZA 5LGTA 2XAFA 2XAGA 1YLFA 1XDUA 4BYYA 1LJ9A 1SD6A 2H6CA 1I1GA 3HIFA 5E1ZB 5LLQA 1KQ8A 4HW0A 5HS8A 3ZQ7A 2JPCA 2A5YB 1O57A 2UWMA 3NQOA 1USTA 1GXQA 1AOYA 5ILSA 3LWFA 4U7BA 1ZRDA 3V4GA 2P5VA 3E6BA 4LK0F 2G9WA 1ZAOA 3BPXA 4M9SA 3RJPA 2J5OA 3E5XA 2HYGD 2HS5A 2QVOA 2P8TA 5D5UB 3QU6A 2FQ3A 1OYWA 2OAZA 3MWMA 3F6VA 1LB2A 2STTA 2DK8A 1G3SA 4KN7X 3N97A 2KKOA 3WTSC 4Q47A 2OA4A 2LSOA 5ICEA 2A69F 1MDMA 4L9NA 4O5VA 4FX4A 4H0EA 5D6EA 2O0YA 5FD5A 4RAYA 5BQTA 2FE3A 2X0LA 4R1HA 2FEZA 1YS7A 4LD5A 1T38A 3CDHA 1UHWA 4Y13A 4LMYA 1BOAA 4U88A 5K5RA 5D8KB 3GO5A 2DAOA 1OKRA 3FMRA 2W85A 2RGVA 1REPC 4UVAA 4MHGA 1RUOA 4P9UA 1D3YA 1E17A 3R4KA 1ZN2A 5BPIA 1BI3A 4K2EA 1F5TA 3W6JB 4KIGA 2CQKA 3M7GA 3W6KB 2QZ8A 1FX7A 3H3ZA 1Z91A 4ZH4F 4CICA 2O6GE 4OIOF 2VBWA 3J80Z 4A5NA 4WCGA 2JPBA 3FMSA 1TLHB 5FFXA 4N9HA 3PQJA 3Q9SA 1JXSA 4UV9A 4M72A 5E1WA 5HLIA 4KNYA 2PI0A 1LEAA 3CLOA 3VOEA 1G6NA 2KIFA 3GXOA 5HLGA 4O6JA 4LLLA 3WG9A 1SAXA 2Z3YA 5CVIA 5L3BA 2OQGA 2EV0A 3D5LA 3KCCA 1W4MA 2QM3A 4Z2YA 5CVVA 1Z1DA 2M45A 1D8JA 4RGSA 3MEXA 5H6QA 3TDZC 3EYIA 5D4SA 1U3EM 3RPQA 4IF4A 5FB2A 5ERIA 2FNPA 1KQ0A 2P7CB 3DF8A 4ENKA 1YTYA 1Z6TA 2Y48A 4I01A 3RKYA 1JHFA 1HBXG 1U2WA 1FYKA 4NB5A 4BHBA 1CF7B 2RNJA 3EQLF 4EGZA 3S2WA 4FHTA 4BQAA 3RYPA 5BOXA 1D8KA 3E6DA 3U9GA 4D0PA 2A6EF 2P6SA 1TW2A 3RPUA 2PQ8A 4MQVA 4KUMA 3KP7A 4AIKA 2P6TA 3VODA 1SD7A 3M9AA 2VBYA 2DO7A 1H0MA 5FLXK 5HVQC 4RS8A 4YFNF 1GXPA 1ON2A 4N9IA 4IRIA 5H20A 3C7JA 1FY7A 1JE8A 1QPMA 3FM3A 1IXCA 2F5EA 4HX4A 1DUXC 1QGPA 3SZTA 3IC7A 3EETA 2EFNA 4ZYHA 1ZG1A 1HXDA 5DEQA 5EEHA 4XBFA 3U2RA 3RIRA 2H94A 5HLHA 3KZYA 4M74A 1TQIA 1KGSA 1B6AA 1XB4A 1OYIA 2W57A 2QBYB 3MZYA 4KYWA 3IHUA 4I7HA 1KU2A 3DP7A 3EDPA 3HRUA 1TNSA 1WWXA 2DU9A 3R61A 1KU9A 2R3SA 2VOPA 2MH9A 1T0FA 3ECHA 5FGMA 5BPDA 2NAZA 2PG4A 2CG4A 2DBBA 1B59A 1YW9A 1T39A 2GA1A 4CHUA 4ENJA 4BH9A 1FPQA 2OZUA 3GLXA 3TO9A 2AS5F 2BV6A 4GXOA 1SFUA 4WWCA 5L3GA 4A6EA 4HQEA 5JR3A 3HTSB 2GAUA 2JZYA 3FWEA 3HOSA 1R5GA 4LB6B 1LDDA 5ICFA 1J75A 3F3XA 4B09A 3GFIA 2NS0A 3TO6A 2IP2A 5LEKA 2CO5A 2MH2A 4OU0A 4HZFA 4L9JA 2Q2EA 3V8LA 2QLZA 5F64A 2GXGA 1ZH5A 5HDKA 3IRQA 3K2ZA 1ZREA 4PGGA 3JW4A 4M73A 1XGSA 1BI1A 2CWEA 2XIGA 1MD0A 1DDNA 4DNCA 5ILVA 2IA1A 4LFUA 2EK5A 4WXDA 4WXHA 1KYZA 3QP5A 4HX8A 4HBLA 3FHZA 3COAC 2B0LA 1R1UA 1P4AA 4XLPF 4M6YA 3K69A 3L00A 4HX7A 2LF7A 1ON1A 2L4AA 1QQIA 4L9TA 4BNCA 2F5DA 1GHCA 3WE3A 2DPUA 3IWFA 2LKPA 3ZMTA 2IVMA 1P6RA 3SQNA 4JK1X 2H09A 1R23A 3OOPA 3GFJA 2FXAA 3JSPA 1O7LA 2Y75A 2KJBA 4LJZF 1W5TA 3FZVA 1FNNA 1P4XA 3RKXA 4OINF 2LDUA 2EA2A 2O3FA 2PN6A 3FXUA 4I02A 3ZMVA 2K27A 4CYDA 4LLGF 3C3WA 1U6GA 2QYOA 3BZ6A 1V3FA 2ZXJA 1MJBA 3TO7A 2QBYA 1HW5A 3TGNA 2HKOA 5HS9A 5L3FA 2IA0A 4XSXF 3BJOA 4BHPA 3LA3A 3GWZA 2CW0F 3CUQA 4OIQF 1R58A 1XMKA 4GGGA 1IN8A 2EFOA 4Q4ZF 4NHJA 3WTZA 4ZYGA 1R5HA 4PDKA 1BC8C 2Z33A 3GUDA 5FLXZ 3HRSA 3TDUC 2XVCA 3BP8A 2QUFA 4EJVA 5A2QK 2ESNA 5D8LB 4PGHA 2RDPA 1LDKB 1Z7UA 3I54A 1LDJA 2HR3A 4I2OA 5DD8A 2W25A 3H92A 2BBYA 2STWA 2O8XA 4U0YA 1NHAA 2Q8KA 3GX4X 1LNWA 2M87A 1GVJA 2HWVA 1X3UA 4KMFA 3CO7C 1R1TA 5K5QA 2ELHA 4EJTA 1XSVA 1ZHFA 1R36A 3ZMSA 3WU1B 4G6DA 2GIVA 3VB2A 4ZZLA 5FO5A 1P4WA 2ZJ2A 1SMTA 1R00A 2HGCA 2PFBA 1W7PA 3SZPA 2XRNA 3F8NA 1Z6RA 1LVAA 3F23A 3F21A 4IRHA 4I98B 4P5OA 2GZWA 5IT9K 2IPQX 1ZLJA 4RB2C 5ICCA 5HDNA 3D0SA 2FSWA 2DLLA 1FC3A 2DPDA 1P92A 3ELKA 6PAXA 4OMZA 1QZZA 1WRJA 1XGNA 4U7DA 2F5FA 3L2CA 2VBZA 2DQRA 1J59A 3IWZA 4AIJA 3E5QA 2D1HA 2YSRA 1JHHA 4IXAA 3J81Z 1TTYA 4M9ZA 1RZ4A 1FSEA 2F5CA 2ZKZA 3ZN0A 4RGXA 1MGTA 3LFKA 4CZZA 3V7RA 3HOTA 4OMYA 4EM2A 1S6LA 2Q0OA 2Z9OA 1JGSA 1G4DA 1K6OA 1BIBA 3GW2A 4ZYDA 5CVJA 3I59B 1HSJA 1I6XA 3WE2A 4XSZF 1FT9A 3TQNA 1FWZA 2OZ6A 2FMYA 4N0BA 2XASA 2JTVA 5D6FA 5JFRA 1DPRA 5J8FA 4TV7A 5HS7A 2EFWA 3L9FA 1U5TC 1S7OA 4OOIA 3RTRA 1WI9A 1B9MA 5ILUA 5JI6A 1BC7C 4L5IA 2IJLA 3EYYA 3GFLA 2HYFA 2IW5A 3HSRA 2EV5A 1G3WA 1BIAA 4AIHA 2R7DA 4JQFA 4RB0A 4LB5A 3KZZA 2P5LC 5AIPA 4L18B 3F8BA 3KEOA 1TQMA 3DPLC 2YPRA 1ODDA 2AXLA 3HUGA 4MTDA 1A04A 5JVTA 1S8NA 4U0WA 2FOKA 3BJ6A 4MQ9F 3L09A 1K78A 3GZ5A 1WSUA 5EEGA 3HHHA 3O2PE 3P9IA 1S7AA 3BDDA 3GVAA 4ZYEA 4M6XA 5TRDA 5E1XA 2P5KA 1BJAA 2ADUA 4IRGA 1G3TA 3RYRA 3PQKA 2RN7A 2PBIA 4U0VA 2M8EA 3R60A 1R1VA 5HOOA 1BN5A 5D4RA 1HSTA 2WV0A 2ISYA 4G94A 4A0YA 1O3TA 1F1ZA 5A2QZ 2GQQA 4G8XA 1O3RA 2HOEA 1MJ9A 1HW1A 3U1DA 1ZG5A 5JHUA 2FBHA 4WX9A 2RC4A 3CUOA 3TKYA 3ZP5A 2ZO4A 4YFXF 3C1DA 2VC0A 3QPTA 5D5WB 2FF4A 2L54A 4ESJA 3RDIA 1IN5A 2OU2A 5BMZA 2QQ9A 4A6DA 1SFEA 1BI0A 2HQRA 1TBXA 2O03A 1RIOH 3LA2A 2V9VA 4HQMA 2VT3A 4HF2A 4KT5C 3I59A 1IAWA 2FRHA 3F8MA 4HV6A 4QWQA 3HYIA 4KA4A 4UXNA 1ULYA 1PP8F 2L02A 3IL2A 2COMA 3CUQB 3GEZA 2BEOA 3MZHA 1B1BA 3KLOA 4EJUA 1J0RA 4RGUA 4ASNA 2VODA 4UVCA 2MA3A 4M9XA 1XGMA 3V8JA 2PJPA 3IKVA 1FLIA 1EH6A 4BHCA 4P55A 3QP6A 2FNAA 4FX0A 5LRRA 3ABUA 4G7HF 5ED4A 3OV8A 1KU3A 2K02A 5KVRA 5K1YA 4HYEA 3QU3A 5LHGA 1IUYA 2PLYA 3ECOA 4UNOA 3BROA 4IHTA 3VFZA 4MTEA 2E7XA 4PZJA 2E1NA 3IRRA 2WWYA 1UHMA 2LF8A 1XCBA 2FBKA 1YG2A 4EQQA 4OIPF 1W7PB 2GWRA 5E17F 2CSOA 2FU4A 3IKTA 4LLNA 3ISPA 5L3CA 1B9NA 2ZCWA 2OQRA 3I58A 4YG2F 3KETA 2XAJA 2YU3A 5CYVA 5DCMA 1YFHA 2QQAA 1OPCA 3M8FA 3SFZA 3I4PA 4I0AA 1WKMA 2MBFA 4JBAA 3SXYA 3R6SA 5H6RA 3WTUC 4O3MA 1C0WA 1YQAA 1R22A 2MLGA 1MKMA 1DP7P 3Q5FA 5D5XB 2MC3A 1KA8A 3JSOA 2YR2A 2DW4A 2G7UA 1UCRA 3J80K 2MLKA 3LQRA 2ZFWA 2DT5A 2ZMEB 3I5UA 4HLYA 3P9KA 1H9TA 1T2KA 3KP3A 2KIUA 4GYGA 3E3VA 1YW8A 1IN4A 3CO6C 1XSDA 3I64A 3ROUA 1BI2A 4EM1A 5CVUA 3ML6A 3WU0A 3BWGA 3F6OA 2DK5A 1J2XA 2V6CA 4HDUA 1IZ1A 3E5UA 2KIMA 4MGRA 2EJRA 3QRFF 2LNBA 3M1EA 2NNNA 4EV0A 3N4MA 4G7ZF 5DYMA 5BS6A 1VTNC 1RI7A 1TNTA 4HA8A 1EH7A 5E8IA 2C6YA 1F4KA 3WODF 1FBUA 2PMUA 3B02A 4I09A 4AVPA 1KYWA 1OR7A 2JT1A 1IN7A 3QOPA 1OYYA 2HKXA 4ESFA 2FA5A 2FMLA 3ERED 2K7LA 4OIRF 4HF1A 2V1XA 1ZRFA 3DEUA 2O61A 2W24A 1YO5C 4KN4X 1Y0UA 4P9FA 4YIIA 5LHIA 1FOKA 1SFXA 4CGZA 1EV7A 3F22A 2HFHA 1MJAA 5L3EA 1K78B 3LAJA 1I5ZA 2H6BA 4XLNF 2A6HF 2PEXA 3DKWA 4IJAA 4Y17A 3E97A 2H27A 4FT8A 4KICA 2K4BA 4GCVA 2WC2A 1LEBA 3ZMDA 2HZTA 1Z05A 3MFKA 1D5VA 3I53A 2QQBA 2XAHA 2F2EA 1RUNA 3WTWC 1SD4A 2P7VB 2HTJA 3HTUA 3DV8A 1SMYF 4A12A 1XCVA 1XDSA 3GZ6A 1XD7A 2M5WA 2V1UA 1B4AA 5J8CA 4HAMA 5CVRA 4WF2A 2EWNA 5DDGA 1Z9CA 1UFMA 2VE8A 2A07F 3J7AO 3R0AA 4BAYA 2IA2A 2GXBA 1FSHA 5DV5A 1IW7F 1QBJA 3K1MA 3KP4A 3ULQB 2V79A
chains in the Genus database with same CATH superfamily
2R5YA 4U95D 5J90A 1Y56A 1H19A 3P5JA 3NWSA 1T98A 2ZMEA 2JRTA 4GYIA 2QFCA 1SEUA 4PJJA 2IBDA 2EB7A 4LG0B 3W9FA 3GTOJ 1WQ2A 3T1BA 1OFCX 2XGXA 3JAMK 4F1PA 3A2KA 3KZIC 4AJWA 2MD5A 1WAO1 2YX7A 2HEOA 3ZN1A 5E3NA 4U8HA 2BZTA 1AWCB 1RNLA 2VC1A 2K9SA 1BM9A 3ABTA 4XI9A 5FKNA 4ACKA 4PCQA 4HDVA 2Y69E 5H2FC 4ILIA 3V7SA 3AG2H 3I9V2 1FYLA 3I55I 1HKQA 4EATA 5F08A 2R0QC 1PDNC 1H0AA 2I2OA 2FX0A 4DYRA 3HOZJ 3S14J 4MLPA 1SAUA 3ASNE 1QU3A 4DI3A 5JJ7A 2MRIA 3S2AA 2KISA 2VSYA 3PO2J 4UHTA 5E8GA 1A5JA 1W1WE 3PRZA 4EM0B 2WAQN 1ZR2A 1G3YA 3ONQA 1QO0D 3X2QH 3MN2A 3JRBA 2OD5A 1P9QC 1FEXA 1BI7B 4AEZC 4RBOA 3CCMI 3SHFA 3T5XA 2PMHA 4ZZDA 2NNYA 4IKFA 3CCJI 4NQWA 2E0IA 4OVUA 3ULYA 3BR2A 1WPKA 3RPUD 3BU8A 1ZGAA 5J3LA 1S3JA 3WTXC 2XSDC 3PREA 4D5FA 3CTAA 3FTVA 3KFWX 2F37A 3Q7FA 1X1PA 3EU9A 1RESA 1MBGA 2JUGA 1N25A 1WI3A 3M3YJ 2CFXA 4R79A 3LCAA 4TUUA 3ZXPA 1H9GA 2BY0A 1FMWA 5E18F 3CHOA 3HVEA 4GA0A 4XRSG 4HF0A 4GPKA 3ZHEA 2UXNA 4ENMA 3F8FA 2VASA 1D9SA 3RI4A 1W5SA 5LHHA 1MNMC 4XRMA 4R7LA 3W6VA 3SBSA 1Z5SC 2F0YA 2F8YA 3FXKA 2RD0A 3H3UA 2M2EA 4S04A 2PMZN 1FBSA 2HR2A 3SNXA 1OCCE 3PE3A 4PS3A 3R0JA 3WGGA 3DXJF 2M0MA 2QYUA 3L54A 1O5MA 4CGVA 1S64A 4G9YA 4CEMA 1E7UA 1H6OA 1ZARA 3HSFA 4KIFA 1IRGA 2DTRA 4WK8F 5GAHJ 2M30A 2Z99A 2RV8A 5FT9A 3A02A 1X2MA 2EZLA 4EZLA 3KP2A 1EH8A 2ESHA 3NRVA 1CGPA 2GA2A 2CUJA 1LKXA 1IXSB 4NUBA 1O3QA 2WAFA 3ZMZA 2V5QC 2X6FA 4CSWA 2XC7A 1HG2A 3KIOA 2GIZA 2UV1A 3LQQA 1JWFA 3L7WA 3T8TA 2DWZA 2PQRA 1VNDA 5G05C 4RAZA 2LP0A 2Y0MA 5DUKA 4XOTA 2Y31A 4GTSA 3B73A 1LD7A 1P2FA 2V4JC 3HBLA 1KQ9A 4RB3C 4A5MA 4YDEA 3DFGA 1U5TA 2DOEA 2HXOA 1Z77A 5FKMA 5J6XA 4KIBA 4BERA 5ENRD 1YW7A 2LFBA 1SZ9A 2I10A 3FTSA 3Q9UC 4HRIA 2VGYA 3GZ1A 2MGQA 1N94A 1SVMA 2WY7Q 3LSRA 3RO3A 3HSEA 5F1RA 4K03A 1N75A 2P4WA 4RSYA 2GXAA 2KZTA 4IYPA 4RB1A 2D45A 4G6QA 3TBIA 3TXMA 3WTYC 2R93J 2BXZA 2EFPA 2E7WA 1FP1D 4HOQA 2KMUA 4I17A 1M1EB 2BW3A 3CCUI 5LEJA 1TYQG 4K5AB 4ATZD 2X6IA 1I1SA 4BSXA 1JKRC 5KJNA 5CJ9A 1Y1WJ 2L7ZA 3BJAA 5DTDA 5K5OA 2HOSA 3SFXA 2D2WA 4KVOA 3JRDA 2VYIA 5ARFA 4IPAA 5AQBA 2RVCA 1K83J 2X48A 3CVUA 3MX3A 1K6YA 3RZDJ 3BQYA 3OYLA 4BXXJ 5DCMB 1ZG3A 1ORKA 2NOGA 3IH4A 3QC1A 4PUCA 1VQKI 3PFIA 3MVPA 4GZ3A 4TXQA 1TJFA 3VTXA 2K85A 4OAUC 5DCFA 4MS6A 4EJOA 5D5VB 3AU5A 4HOSA 3DEOA 4N4OB 2CHXA 3BOQA 4G7OF 3L2WA 3M4OJ 2W82A 3LSJA 4A2UA 4C48B 2I8DA 2UXXA 3ZW3A 4MRUA 3K1PA 5KBAA 4V3IA 3DQVC 1Y39A 2G7HA 5CMYA 4XIFA 4CXFA 3HHMA 3TP3A 3RQIA 1XSXA 5G05J 4BFRA 4HV5A 5DD4A 3G4SI 1Y1VJ 2FD5A 1HQCA 2ELJA 1SD5A 5J4YA 3K4JA 5EDNA 4CDNA 4F92B 4QTRA 3CMYA 3AFHA 2XROA 1Q1HA 4AY6A 4MEYF 5E76A 5AENA 3ASDA 3KP6A 2F4IA 3Q75A 5IOYA 4GYOA 4GZ5A 2LSVA 4A3JJ 3TWVA 3HOXJ 3SBTB 2NVYJ 1IG7A 1TW3A 3OS2A 3O6BB 2NRAC 3KLNA 3CDIA 2CUZA 2RKHA 2VJJA 3E6CC 2IRFG 3FH5A 4EBAA 4Y15A 1UB9A 2HQNA 1VQOI 3GMEA 1D1BA 4OAYA 4I6GA 2CYYA 2OBPA 4L0YB 2P9NG 2KIQA 4UB6C 2E60A 2B7EA 4FJYA 1E3PA 4GCNA 1YYHA 5EYRA 1E8XA 2GRQB 3IHVA 3MJWA 3QPHA 4C9BB 3A0HC 1FBQA 3LDZA 1X3WB 5AONA 2CGPA 3FH8A 1TT5B 4FHJA 3ZCOA 1S29A 2L9VA 4V2FA 4OVVA 1SANA 2KDOA 2R4GA 4EMSA 2E2IJ 5ARGA 1NG7A 1N0QA 2HM8A 2X1EA 5GAEJ 4S05A 1E8ZA 2JA2A 5LRSA 2V0PA 2VB6A 1PUEE 5KAIC 3ULQA 1L0OC 2LTPA 4HG2A 4S0HB 4NIKA 3ZPLA 1TWFJ 2EILH 2B0OE 1FP2A 1OCZH 1QZYA 3O3KA 4RM2A 4JXTA 4LNUD 4GO1A 5IYBJ 2DOFA 2NYXA 3HKZN 3DPDA 2A5WA 5LBQA 1U9NA 2H6IA 4WNEA 2W84A 1O3SA 1IHGA 4AWXB 2CW7A 2EIJH 4LG0A 1LUJB 2KRFA 2H8RA 4I2ZA 3P7NA 4ESBA 1T0FC 5CEAA 3ENEA 3D9MA 4MIMA 2V1NA 1AWCA 3MKQB 3U21A 2IT0A 2ZU6B 1INZA 2BE5F 3HB9A 2EFQA 3BR6A 3F0CA 4UVBA 3K9TA 4C3HJ 1T6SA 2OV8A 4G11A 1O1RA 2JSPA 3DTIA 4YFKF 3JTGA 1V5EA 2L7MP 4BT9A 5F6FA 1DPUA 1OMIA 1TC3C 3K1NA 2F8XK 2XF7A 1U3CA 5FRNA 5IT3A 3K0LA 4XNFA 5FLMJ 1PUFB 4GTMA 2OC6A 1B72B 3M8EA 2YX4A 2L01A 5IT9Z 1IQUA 2KLOA 3C3OA 2AXZA 2VBXA 3BZKA 2MSYA 2DMQA 4HSRA 3FXOA 1K79A 1PY1A 2G0EA 2VONA 4RVBA 1V4RA 4K5CA 3D3MA 4BGDA 3OY9A 2R7VA 1N11A 1ETOA 1IXRC 3QPSA 3LY8A 2JMWA 3DPTA 4LITA 4YEJA 2IOLA 1BOBA 3T8KA 3O8GA 3JTHA 4NNJA 1TQPA 4R8HA 3TOAA 3I0TA 3ZXSA 1MH4A 2EV6A 3FUMA 3MAJA 5IY5E 5AIQA 3ZOBA 1D0YA 3QODA 4CDGA 4F6RD 3KYLA 3ZNGA 1K7AA 3JXIA 5E20A 3RRNB 3CMMA 2H1LA 4XKCA 5C4JJ 2YHEA 1VF9A 2F48A 3RKWA 4DQ2A 3CDLA 5KNHD 2TCTA 4F53A 2VXZA 1NA3A 2QY7A 1YOVB 2X1DA 1T56A 4MNUA 2AQFA 4KMUX 4CCJA 1E8WA 3FXQA 2EA4A 3C98A 1FIAA 3EPZA 2BGCA 1HFAA 3NB2A 2WXIA 3D5SC 4GTOA 4BT8A 2RQPA 2ZNZA 2VSXE 2HTSA 2R7FA 4B8XA 3JAMZ 2XRYA 3FMQA 3KE2A 3HRTA 2L9SA 1LPQA 2E1CA 1BJZA 1MYOA 5CCMA 5IP7J 4X8QA 1GV2A 3DXMG 3N05A 2FJ1A 2RKKA 3H5NA 2H6FA 4DIQA 4A3TA 1WJDA 1ZYRF 3FUIA 2J49A 1YRNB 2O9LA 3GZNB 3OYEA 2KZVA 2LXMA 1KZOA 2VOOA 3AAFA 1N52A 1FMVA 3EUHA 1TNYA 1VQ6I 2IS4A 2FBIA 4HPQA 3KX2A 4JEUA 3GF2A 2K4JA 4HI8A 2IS6A 3WTVC 3FP3A 4ZDPA 3CHQA 3FM5A 5L3DA 5D2MC 2WB2A 3AG2E 3IH3A 4D7NA 4F7ZA 1ZLKA 2DA3A 4BXUA 5HDGA 3L08A 3UUXA 2HDCA 2DI3A 2LYCA 3SJMA 4M3DA 4CYCA 5LX8A 1PAQA 2IGNA 4AD9A 1A17A 3E4BA 2NXPA 1O7FA 3JRCA 3H9QA 3S2DJ 2XKOA 2QENA 4KDPA 1ONVA 3PEUB 3DRAA 2Y4TA 3X2QE 4A0ZA 2H8WA 4NC8A 3S1RJ 3APCA 2V1DA 3K4KA 3GTJJ 1FYMA 3I71A 2ZXHA 5FJ8J 3UIPC 4DRXE 3J81K 1WCMJ 1UZCA 4HOBA 2L9BA 1MZBA 5FZQA 1F43A 3PL8A 5FJYA 4WUYA 1MZCA 5FTPA 3NZSA 2DT6A 3H5RA 3T0YA 3GYHX 4DOZA 3OXLA 3HHGA 4FADA 4B3XA 4BWRA 4AUXA 2X6XA 4DUIA 3LA7A 3WGHA 3CCVI 2DQLA 5F27A 3CHSA 1ETYA 2NOJB 5KNLA 1KT0A 3HIZA 3MV2B 2JEKA 2QGUA 1HDDC 5KJMA 4JL0A 3MQ0A 2LO6A 3PZ1A 2WXJA 4RGRA 4PFPA 2HYJA 1F9NA 2Z5UA 1WVRA 1UHSA 4C2MJ 2DA1A 2XAQA 1IRFA 1FZPB 1ENHA 2QWWA 3WGIA 1I39A 5KK1A 2CW8A 1OUVA 4AVZA 4XLFA 4XRFA 2P2CP 4WWNA 3R9AB 4AYBN 2TDXA 4F52A 4BTAA 2VT2A 1N77A 4JC8A 1ETQA 1XGOA 2Y0SA 4EJWA 2JA8J 3HOUJ 4F1SA 3EU5A 3NOGD 4L9PA 3BR5A 1J7KA 5DUIA 5DS9A 5HLTA 2A68F 2QKMB 3NEUA 4UV8A 3E6MA 2IJGX 3B7SA 4UWFA 3MZLB 1SVOA 2J5PA 3I4MJ 1EPUA 4AP2A 4DI4A 2QCOA 2KCLA 1CF7A 3NARA 4XE0A 3QAHA 1H2VC 5ICGA 4YIFA 2A61A 5IP6A 2XCCA 3FKIJ 1G59A 1TJCA 4L5JA 2E2JJ 1N4RA 1LFBA 3CC7I 1J5YA 2ETCA 1AP7A 1ZKGA 1L3LA 1UN8A 2N8GA 4L1BA 4TRQA 3WTTC 3UX4A 2DA4A 3VEPA 1A36A 1XMAA 4PDXA 4UWGA 3B6AA 4BE2A 4XI0A 2D1VA 1LF8A 4Y6WA 4Y4RA 4M71A 3RCOA 3HZJA 2IOSA 2ZXIA 4LK1F 4EVIA 1FVHA 2GW1A 4CCOA 3EUVA 3P9CA 1MDMB 1W5CC 4BQNA 3VDXA 2BYVE 4I0BA 3RKQA 3JQ0A 2CS3A 4L7TA 2WTEA 4KJZA 2QEXI 4L0ZB 3B7TA 5LGUA 4I76A 3FXRA 1W7PD 1NZNA 2IXSA 4XOPA 4WXCA 1T95A 2XKPA 1ZRCA 1JCSA 4CCAA 4APFA 3H9JA 3UR3C 4L9VA 2R5ZA 2ZNYA 3C18A 3MCZA 3PJRA 3KP5A 1I27A 2CV1A 2J09A 4EGYA 3QYEA 5GTIC 3V8KA 1R7JA 3G73A 5TJJA 1ACIA 5M3MJ 3RRMB 4DX5D 3CMAI 1DU0A 2JN6A 1HW2A 1HKTA 3ZFWA 3CUQC 1LQ1A 2ETHA 3DSSA 2VTBA 2HPIA 2XEVA 3MKLA 4NQWB 3ZQHA 4RG6A 4WNFA 4Q5SF 1MMDA 2R05A 1YS6A 5AAOA 2M1BA 3Q9VA 1ZGJA 3IAS2 4Q48A 3WHBA 4QLCU 3S1NJ 4G8KA 3LAPA 4J8DA 5T4YA 4EZKA 2WXGA 3S7FA 3CJTB 2VKVA 4XKBA 3T8RA 4A3MJ 1LE8A 3TGOA 1DC2A 2E1OA 3REOA 2WXFA 3LS8A 3CVXA 4A3EJ 3VPRA 2VQ2A 4BJ6C 4CCNA 3F72A 4JA7A 1HO8A 5KCMA 4UUVA 1D1CA 2ETBA 3HVEB 3KEQA 4HLXA 1B72A 5CKTA 4LGWA 4MEXF 2LRDA 1J9IA 2PM6A 4GTRA 4CH7A 3GZSA 5IOZA 3ZHEB 2EQXA 4E7SA 2K9MA 2VN2A 2ZBKA 1K4TA 2LD5A 5FD6A 2MW8A 4UI9K 1BBYA 3QOUA 1YYVA 2A5UA 1R5ID 3MKWB 2XEHA 3Q78A 5G2NA 3T9KA 3ZGKA 1TT0A 3F8CA 1YCSB 2OVFA 2UZKA 1E2XA 4CZCA 3BY6A 3DWLG 4IHWA 3NQPA 3G2WA 1YIOA 2ACJA 4XRSA 1Y8MA 4BX9A 1USSA 4GDFA 2Y2ZA 1TZLA 4G25A 3BPVA 4ILGA 4Y3OA 3PUKA 1HKSA 3L2QA 1UJKA 3OAWA 2W1OA 4RMNA 2A3SA 2MABA 2JSCA 2WM9A 4P96A 3Q7AA 3K4MA 5EIDA 4B0ZA 3HDXA 3PH0C 1V55H 4E70A 1AHDP 4YIRX 4PSXA 3FUDA 2DFIA 4ENNA 3UKGA 3PVLA 2K3PA 2Y1LE 1NG6A 3LY7A 2XUBA 3RJVA 1MMNA 2YHCA 2ME6A 1FT1A 4PH4B 5CRVA 3GFMA 1SA4A 1WJ5A 1U8RA 1STZA 4BDYA 3ZMUA 1QNTA 1D8DA 2BTDA 1PP7U 5T8IA 2KJCA 3J7YJ 3OYAA 2VGXA 3L6AA 3G3ZA 3CSTA 3CJNA 4IHVA 3FWVA 4XKVA 4X0GA 2M4KA 2VE9A 1O4XA 4KISA 2NVQJ 4G12A 1U5TB 3QOEA 1BA5A 4ME2A 1K1BA 4LSZE 1N4PA 2L4MA 4A0XA 4CCLA 2RFAA 2QYJA 4D5CA 3FF5A 4O60A 3VYUB 4KFCA 1KU7A 2XHKA 2BHYA 2XV4S 5CLSA 2CFUA 3BTJA 2EILE 4RAGA 2GOMA 2ISZA 1IF1A 1OCZE 2X4HA 3RIBA 3TG4A 4AY5A 3IUOA 1XN7A 4XQFA 5C3EJ 4ON0A 1RPWA 4IVNA 1U78A 3HRMA 2L3DA 3FUJA 1TWHJ 4B44A 4IHSA 2K86A 3V7CA 5LGNA 2EIJE 4U87A 2IS2A 1QVUA 1IN6A 1X5BA 2XS8A 2BW3B 3LSTA 4V2GA 2V6EA 4B1RA 1VQ7I 3ASFA 3MA5A 2KL4A 4CO8A 2CUEA 5JHFA 3FX3A 4AIFA 4I99C 4C30A 5GTHC 4F3VA 4Z68A 2RNGA 3TOBA 4ETSA 1E3OC 5FFZA 1HA8A 5LGTA 4JD2G 1QRYA 3W2VA 4V19K 2XAFA 3PNTA 2LKSA 1R4NB 2XAGA 3MKZA 4GB9A 1YLFA 1IJWC 2COBA 5EKQD 2RG8A 1XDUA 4ZDLA 4E6HA 4YRVA 1BR2A 4BYYA 1NP7A 4YVQC 5JJ6A 1LJ9A 1SD6A 3GLLA 4G8LA 4UWKA 4CDMA 3I4NJ 1OQYA 4OWRB 3FHEA 2H6CA 4D9JA 4A3KJ 1N4SA 4HVBA 1R9TJ 3HRAA 1FOYA 1I1GA 3TXNA 3HIFA 5E1ZB 4B94A 1E7VA 5LLQA 1D0XA 1KQ8A 2MOWA 2XPIA 5EJCA 4HW0A 4G23A 4YNDA 5HS8A 3HXCA 3ZQ7A 2JPCA 2J4BA 2YNQA 2A5YB 1S63A 1O57A 2UWMA 1SVXA 2X6OA 1P5QA 2J08A 3BR3A 3D5RC 4YVOA 3NQOA 1G3NB 1USTA 2UUZA 1X1BA 1GXQA 2V9KA 1RKWA 4UUTA 3KEYA 4A3IJ 1AOYA 2ZSIB 2XCBA 3L1PA 5ILSA 3LWFA 5HQ8A 4UB8C 1R4MB 4HS2A 4U7BA 1ZRDA 2KP6A 1O1TA 4HNVA 3V4GA 1ZU2A 2P5VA 2ILRA 3ONLA 3E6BA 4F93B 4LK0F 4BEPA 2BKGA 2L9NA 3Q0WA 1EF4A 4I6JA 1V54H 2G9WA 1ZAOA 3BPXA 4M9SA 1W3BA 3GZ2A 3RJPA 4I6EA 2HQ5A 2J5OA 3E5XA 3AL0B 1S0PA 2HYGD 4DZPA 3UKUG 1X19A 2HS5A 2QVOA 4I9EA 3RSEG 1UAAA 3APDA 1BR1A 2P8TA 2M0CA 5D5UB 4E7HA 2XPZA 2KBXA 3S7BA 3QU6A 3CVLA 2FQ3A 4N5QA 1OYWA 1OCOH 2E71A 3OYDA 2OAZA 3LL7A 3MWMA 3F6VA 2B63J 1OCRE 1LB2A 2STTA 3AG4H 1WG0A 3R7QA 3IP4B 1S9HA 3TEDA 2WXLA 3ZKJA 4DYCA 3LSPA 2DK8A 1G3SA 3CJQB 2YU9J 2E35A 4FCYA 4CCMA 4J7WA 1TP4A 4KN7X 3B95A 3N97A 1RETA 2M4GA 3I4GA 2KKOA 5TISC 1BR4A 3WTSC 1TN6A 4Q47A 2OA4A 2LSOA 5ICEA 4MFDA 4C2UA 4ATGA 4BJTA 2CUFA 2Y0BG 3DBHB 2A69F 1MDMA 5FQ8A 1RR7A 4L9NA 2ETAA 4O5VA 2MD0A 3ABKH 4FX4A 1ELRA 2IY0C 4H0EA 5D6EA 2O0YA 3CK8A 5FD5A 4RAYA 3PEVB 4NQ0A 5CECB 5BQTA 1R49A 2XGDA 5FIOA 1JT0A 4A3GJ 3UXGA 2VI6A 3M8JA 3SFYA 3B6CA 2Z2SB 2FE3A 3SQVA 2X0LA 2EIMH 2P9IG 1FCHA 5IYDJ 4R1HA 2ZXWH 4XLCA 3TWTA 1XC5A 2FEZA 4B3AA 1YS7A 4LD5A 1VQ4I 2OCCH 3NZUA 4KVMA 4RG9A 1T38A 1P7JA 1UHWA 2E36A 3CDHA 4LMYA 4Y13A 3AS4A 5JLXA 4I9CA 1PYVA 3PM1A 3GYZA 3SDGA 1BOAA 3ZQGA 4U88A 5K5RA 5D8KB 4RDUA 3GO5A 4G24A 2DAOA 4LCTA 1OKRA 1ZB1A 4N3CA 2W7NA 2DFEA 2K9NA 2W85A 3FMRA 2RGVA 1REPC 4UVAA 4MHGA 1RUOA 3ZYLA 3I3LA 2DDAA 4P9UA 3GW4A 3QWWA 4KT6A 1D3YA 2K5CA 2V8SE 1E17A 2I6HA 5FZRA 1UN9A 3DU5A 1ZN2A 3R4KA 3OYBA 5BPIA 1YJ9I 1BI3A 3K4CA 1A35A 1YJNI 3TL5A 4K2EA 4QQIA 5IPAA 2HDWA 3W6JB 1F5TA 4KIGA 2CQKA 5K7ZA 3M7GA 3W6KB 2QZ8A 1FX7A 1HF0A 2WB1A 3LNQA 3SI5A 2VQCA 2KXPC 3H3ZA 4A3VA 1Z91A 4ZH4F 4CICA 3FBIB 2R5SA 2O6GE 4OIOF 2VBWA 4XLHA 2AWIA 4C0MA 4EZJA 3J80Z 4A5NA 1OWNA 2XZTG 4GTQA 2WAEA 4WCGA 1HE8A 3K4LA 2JPBA 3FMSA 1TLHB 3A0BC 5FFXA 1KZHA 3CCLI 2QSGX 4ZDOA 3FDHA 4N9HA 2HOTA 4GMRA 1JGGA 4WNGA 3PQJA 3Q9SA 2P58C 4UQXA 1TN7A 2W00A 3VYSB 1D0ZA 1JXSA 2BEDA 2VSNA 2QKLB 4M3BA 3LSHA 3W2AA 4UV9A 3U3WA 3LJ3A 5CRUA 4M72A 5E1WA 3FIWA 3LYAA 3E34A 2QF7A 5HLIA 2BXYA 3VLEA 2CFZA 2BKKB 4DX2A 3A4CA 4KNYA 5BW8C 3MEKA 5EG0A 1JKPC 3FU6A 3SDBA 4XMYA 2WMNA 2PI0A 2Y3AA 3JQ1A 3GTPJ 4LEUA 1DGWY 3KYCB 1LEAA 3CLOA 3VOEA 2CHZA 2X1CA 1G6NA 2KIFA 3GXOA 3TW7A 2E34A 3IAM2 4Y33A 4Y7NJ 3Q3SA 5HLGA 1MX2A 4CYMD 4O6JA 5LOZA 2P9SG 5GP9A 4LLLA 2VJ8A 3WG9A 2XPYA 3CVVA 3L16A 1T33A 4IOCF 2AXTC 1SAXA 1MX4A 3K9IA 4U04A 2Z3YA 1GT0C 1MSEC 4L2LA 4CYCB 5FZSA 1Z3XA 1E96B 2NC9A 3OTNA 5CVIA 2QC9A 5L3BA 2EIKH 4LIUA 2OQGA 2EV0A 3OOUA 1U8BA 2IONA 3EIQC 1JUMA 2LUHA 3DLLF 3UM2A 5FQ7A 4OYSA 3D5LA 3KCCA 3IV0A 1W4MA 4RLQA 3JCUC 4MFEA 4KMOA 2QM3A 4Z2YA 4AU7A 2ZGDA 4BDZA 2L5QA 3QWVA 4Y6CA 2VXDA 1Z1DA 2M45A 3H1CA 5CVVA 1D8JA 3LY9A 3FK7A 3DPYA 3PZDA 1ERDA 4RGSA 1RC9A 2R7SA 5J1YA 1YITI 2OTLI 4JPSA 1ETVA 5JHAA 1GUUA 3MEXA 5E3MA 3ZR8X 1JTXA 1VQMI 3OYMA 1O1SA 2GROB 3FU3A 5H6QA 3TDZC 3WG7H 3EYIA 2Z1DA 2VQHA 5AQ7A 5D4SA 5FKOA 1U3EM 3JUEA 3ISMC 3N71A 4RLFA 2ELKA 3RPQA 1K4SA 4IF4A 4WWPA 3EHNA 4C9YA 4OAVB 1JI8A 2XGMA 1X4PA 3DBLB 5FB2A 4A3FJ 2WPVA 5BV0A 3KSQA 5ERIA 2L9RA 4BESA 2FNPA 1XS9A 1KQ0A 4U7EB 4H7YA 2P7CB 4DJAA 3DF8A 3QYFA 4ENKA 1YTYA 2WXMA 1FJLA 1Z6TA 2Y48A 3APFA 4I01A 2RAEA 3RKYA 3ULEG 1JHFA 4EPZA 1HBXG 2DMUA 1TWGJ 4E6KG 1V55E 1U2WA 5B3SH 2DYSH 1FYKA 4LOCA 1X1AA 4NB5A 4BHBA 1CF7B 2RNJA 1T08B 3KPHA 3LFUA 3OWTA 3CSFA 3EQLF 1OT8A 3CR3A 2E1MB 4H4KC 4EGZA 3S2WA 4FHTA 1H2TC 1WDYA 4AVXA 4BQAA 3MCXA 3RYPA 5BOXA 3VTYA 2O5RA 5B66C 1D8KA 3FK6A 3SYTA 3E6DA 2HNHA 4F91B 3U9GA 3OYHA 1I6HJ 2IO2C 2NS7A 3LXUX 3TAXA 2XGOA 4D0PA 4N2QA 2A6EF 2P6SA 1TW2A 3RPUA 5KWDA 4FLHA 1D5YA 2PQ8A 1X1CA 2Y0SN 3IBEA 4MQVA 4KUMA 4HOTA 4FE4A 3LEWA 3CCQI 4U0SA 2HU9A 4PSWA 3KP7A 3LSIA 5EF6A 3I3NA 5CCLA 5KJLA 4AIKA 2P6TA 3DEWA 3VODA 1SD7A 2KRCA 2KHMA 3UT7A 1U0JA 2JVGA 2O8KA 2JJ7A 3M9AA 2VBYA 3SEZA 1L5JA 1WJCA 2CRGA 2DO7A 2WADA 3OIPA 2R5ZB 1H0MA 1HC8A 5FLXK 1MSFC 1DCEA 5HVQC 3FU0A 4RS8A 5H7PA 4YFNF 1GXPA 4N3BA 1ON2A 3ESWB 4I1MA 3DKXA 3RRUA 3U64A 4ACLA 4N9IA 4IRIA 5JJTA 3H0GJ 3G1LA 5H20A 4B4CA 2VUMJ 3PO3J 2VTBB 3C7JA 4ZFHA 1UG0A 1FY7A 5LCWC 3UMVA 1YA0A 1JE8A 1QPMA 3PS6A 2P9PG 2XGCA 3FM3A 1GVDA 3PZ3A 1IXCA 5A23A 2F4MB 2F5EA 4HX4A 1DUXC 1QGPA 1UOHA 5ENSD 4CGWA 2R7UA 1LE8B 3SZTA 3FFLA 5J08A 2WAQA 1S72I 5EN5D 3IC7A 5BPPA 2ZIRA 3EETA 5HODA 4H7XA 2FO1E 2EFNA 4ZYHA 5KHDA 3DXKG 1ZG1A 1JTYA 1UW4B 1HXDA 2ZB9A 5BNWA 5DEQA 5EEHA 1KONA 3L22A 5CQEA 4XBFA 3BT9A 3MMYB 3S32A 5M3FJ 3QK0A 2FBNA 3UTMA 3HOVJ 4LUNU 3U2RA 2X6JA 3RIRA 2H94A 4B47A 5HLHA 3KZYA 3H5AA 4M74A 4RLYA 3P2BA 1TQIA 3P1UA 1KGSA 1Z67A 1ZK8A 1B6AA 1XB4A 2WVIA 1OYIA 3IKOB 4TXRA 4M3OA 3L13A 2W57A 3Q0UA 3C3QA 3CC2I 3TW6A 3S16J 2QBYB 3MZYA 4KYWA 5AQAA 3IHUA 4I7HA 1KU2A 3DP7A 3EDPA 3HRUA 2A6TA 3EHQA 4NDLA 4UUCA 2KT0A 1TNSA 1WWXA 2DU9A 4QIWN 3OIOA 3HJEA 3W3CA 3R61A 3OYJA 4IZZA 1HXIA 1N4QA 1KU9A 3BG0B 4FP7A 4JEHA 1HX8A 5BV1A 4HNAD 2R3SA 2VOPA 2MH9A 4LG6A 1T0FA 3OYKA 2NVXJ 3ECHA 4XLEA 5FGMA 5BPDA 3FTZA 3PSIA 1JKOC 3HGGA 5F0FA 1H2UA 2WXPA 3AG1E 2C0LA 4PS8A 2I1JA 3CZ6A 1V54E 1VDYA 2VGXB 4U96D 4ANUA 3J5QB 2NAZA 1BI8B 3ESKA 2PG4A 4G6TB 2CG4A 2DBBA 3S8PA 1B59A 1YW9A 3AKZA 2IQCA 2VGEA 2J07A 3E30A 4HRLA 5ENOD 5F0CA 1T39A 2DT7B 1R71A 2GA1A 4CRWA 1HLVA 3QNKA 2F6CA 4CHUA 1HF8A 1OCOE 5LCWJ 4ENJA 4BH9A 3S93A 1FPQA 2QA4I 2OZUA 1A6IA 2FO7A 3BQOA 1UMQA 3AG4E 3BCAA 3PSFA 3GLXA 3CVWA 4BXFA 4B8CB 3TO9A 2AS5F 1FOWA 2OV7A 1POGA 2BV6A 3C2GA 4GXOA 4CUGA 1SFUA 4WWCA 5L3GA 4A6EA 1TL8A 4DX7D 2HDDA 4HQEA 1UJ8A 4DW6A 5JR3A 3SEQA 1RR8C 3HTSB 2GAUA 2R7OA 1QZEA 3IEGA 2JZYA 1BW5A 5EX0A 3FEXA 1Y8RB 3FWEA 4UQZA 3HOSA 3TJPA 4DZJA 1R5GA 4LB6B 5GPCA 5EEAA 3TWQA 1LDDA 5ICFA 2LC2A 1J75A 2L0IA 3BZCA 4JHJA 3F3XA 3BR1A 3ABKE 3ZU7B 4B09A 3GFIA 4OAZA 3UPVA 3NOCD 4QSHA 1VQ8I 2NS0A 3QYBA 1B89A 1VZ0A 3TO6A 2DA7A 3PNTB 2GRNB 1IV8A 2IP2A 1K61A 3DBRB 2DZNA 5LEKA 2CO5A 4GU5A 1IC8A 2HQAA 3UT4A 2MH2A 3BR0A 3L82A 3ZVVA 2ZXWE 4OU0A 4HZFA 4L9JA 5TGTA 1WFXA 2OCCE 4LG3A 5AJDA 2AVPA 4XIDA 3GTMJ 2Q2EA 2MHKA 1F36A 2CQXA 3V8LA 1TEZA 5AN8A 2QLZA 5F64A 4A3CJ 3DU6A 2DZOA 4YDYA 2GXGA 1ZH5A 3MYVA 1OWOA 1K3ZD 5HDKA 3IRQA 1GDTA 5AJLA 3K2ZA 3ASGA 1IV6A 1ZREA 5JHBA 1MBKA 2XPUA 4PGGA 4L2YA 4K0RA 3JW4A 2DFFA 5GAGJ 3OS1A 2KM4A 5AARA 4Q69A 4M73A 1XGSA 3ZGQA 1VQ9I 1BI1A 2CWEA 3S3NA 1IDZA 3HXFA 4D1QA 2IGKA 3HOWJ 2XIGA 3ML9A 4NRHB 2ZISA 4ANJA 3KSLA 1XGWA 2ZJQF 1MD0A 5F04A 2R92J 2E2HJ 3S1QJ 2M3AA 4AM9A 2R7QA 4RAFA 3FTYA 5D0OD 2GBYA 2Y9YA 2M7BA 3CLQA 1DDNA 2R7TA 1D8EA 2VSOE 3FUKA 5ENQD 4U0ZA 4DNCA 3V2OA 4ZJZA 3MZ8A 3LKUA 3GTLJ 4G26A 1Z0XA 5ILVA 2IA1A 3URZA 4CT4A 4U0UA 4ANWA 5LD2C 1CQTA 2E5ZA 4LFUA 2EK5A 1NH3A 1U3DA 2HO1A 4WXDA 3VSLA 4I43A 1HZ4A 4WXHA 5HS0A 5CEDB 1KYZA 3QP5A 3DTKA 4HX8A 4HBLA 3FHZA 3COAC 3IHYA 2B0LA 1R1UA 4CCKA 1P4AA 1S5LC 2HVRA 4XLPF 2KFDA 4M6YA 5K7HA 3ZQFA 5BNGA 3HG0D 3W9GA 3H9GA 4I2WA 3K69A 3L00A 1JUPA 5C44J 3IH2A 4HX7A 5EZHA 1V5FA 2LF7A 4DLQA 1ON1A 2DMPA 2EINH 2ICWG 2CHWA 3NAWA 3OS0A 2VL8A 1K8KG 3QJZA 2L4AA 1BPOA 4CA0A 1QQIA 4L9TA 4M6VA 2IF4A 4PS7A 5AIJA 4BNCA 4IULA 2X51A 2F5DA 4X6AJ 2BF0X 5FQ4A 4W9RA 3PNLB 1GHCA 2W48A 3WE3A 2DPUA 3IWFA 4LERA 2JWTA 1NTCA 2LKPA 3A1YA 1WY6A 3ZMTA 3U1KA 2IVMA 1A31A 2HE0A 1XPXA 2V5FA 2EBIA 1P6RA 2K3FA 5EGOA 3SQNA 3CMEI 3UNGC 4JK1X 2H09A 1R23A 3HKZA 3AAAC 2K40A 3OOPA 4BE0A 3U9WA 2LAIA 3C2BA 2B9SA 3J7AY 3CEQA 5G55A 3F9KA 5DIZA 2L7FP 3GFJA 5HNHA 2FXAA 1HH8A 3E0JB 3JSPA 3Q15A 1O7LA 2EIKE 2Y75A 3C3RA 1P7IA 2KJBA 4LJZF 3DWLE 5B5EC 5EILA 3FISA 1W5TA 1XX5A 3VYRB 5IYCJ 3C72A 3DBSA 4W97A 3FZVA 2IFUA 1OR7C 2D5VA 1FT2A 3ZYMA 1FNNA 1P4XA 4GCOA 1RKTA 3RKXA 3TWSA 2YUSA 2LR8A 5AQ9A 2LSUA 1MBEA 5D66A 4PFOA 4OINF 2XHEA 2LDUA 4KT6B 2EA2A 2O3FA 2PN6A 3FXUA 3HXLA 4I02A 3PUFA 3ZMVA 2I5UA 2K27A 1HS6A 2H6HA 4CYDA 1SFOJ 3S1MJ 2EZHA 2HPMA 4BBSJ 3EJNA 3MGBA 4J8YA 2F5VA 4C2TA 3WG7E 2AXUA 2AQEA 3JRIA 4LLGF 3TMOA 4HI9A 3FY4A 3R9MA 4F55A 3C3WA 4GTVA 1U6GA 3E1SA 3FTUA 4KBQA 2QYOA 3BZ6A 1KT1A 3KEAA 1V3FA 2ZXJA 2IGOA 1MJBA 1MQSA 1MNDA 3PNVA 3TO7A 2AJAA 3ZRHA 2QBYA 1HW5A 2XF6A 2HKOA 2VJ4A 3TGNA 1FTTA 5HS9A 5L3FA 5CPRB 2IA0A 2XENA 1HDPA 4XSXF 3BJOA 5B1BH 5B3SE 2JLBA 2DYSE 4BHPA 2VJ5A 3GWZA 3LA3A 2NS8A 1SW6A 4KZ0A 2CW0F 3BCBA 2EZIA 2NYJA 4E85A 2VQGA 5LFAA 4N4NB 1S7EA 3CUQA 4OIQF 4QFVA 3A01A 4NC7A 1R58A 1XMKA 4GGGA 1IN8A 3DSWA 2EFOA 5FWQA 4Q4ZF 4NHJA 2CQQA 3WTZA 4ZYGA 5EG0B 5M5XJ 4WNDA 2WB1N 3TG5A 4EECA 2GRMA 9ANTA 3V31A 1R5HA 4PDKA 1BC8C 3SY2A 2OVBA 3ZUVB 4QPOA 3RK6A 2Z33A 3GUDA 5FLXZ 2Y4UA 3EHMA 4AXHA 3HRSA 2LBFA 4HRMB 4HSTA 4A3BJ 3VLFA 3CVNA 2XB0X 2V4HC 3TDUC 2XVCA 2UY1A 2LOOA 1NI1A 3BP8A 3UINC 2QUFA 4EJVA 5A2QK 2ESNA 3G1MA 3EUAA 2XZDG 4XK4A 4XKWA 5D8LB 1OISA 4PGHA 1EYHA 2RDPA 1J09A 2QSHX 4WAFA 2X9DA 1LDKB 4JX6A 1Z7UA 3I54A 1LDJA 2HR3A 3FXJA 4I2OA 4UY8I 1ELKA 4FASD 3ESLA 5DD8A 2KRHA 2W25A 4I1AA 3H92A 2BBYA 3LOCA 4P1WA 2GM4A 2STWA 2DA5A 3FEYA 2W4SA 2O8XA 3G2UA 4UI9C 3EUKL 4U0YA 3QKYA 1WHUA 2DN0A 3I4RB 1R6RA 2TRTA 4BL0B 1NHAA 2BVLA 2Q8KA 3GX4X 1DVPA 4GA1A 4BJ5C 1H8AC 1LNWA 2LY2A 4Y52J 2M87A 3E32A 4EHMA 1GVJA 2HWVA 4XM3A 4JX5A 4FQGA 4BBRJ 1X3UA 4KMFA 1IUFA 3NBNB 4FISA 3WXXA 3RKVA 3K4NA 4A55A 2DVWA 4NBQA 3CO7C 3QARA 3GBGA 1R1TA 1N78A 2GGFA 4HLLA 2DCPA 5A6CA 3HG9A 5K5QA 3CVPA 1I50J 2ELHA 3BG1B 2V26A 3M1CA 4APOA 4HEA2 4EJTA 1XSVA 2QQ8A 3CF5F 1AKHA 4FJZA 3AG3H 1VQNI 1ZHFA 1R36A 3ZMSA 3WU1B 4BS9A 4G6DA 2OCEA 2GIVA 3M07A 2IEJA 3VB2A 4JYKA 3PE4A 4ZZLA 2NVTJ 2DTZA 5FO5A 1P4WA 3G2SA 2ZJ2A 1SMTA 3PIOF 4LNBA 2R7XA 1R00A 2HGCA 2PFBA 1W7PA 3SZPA 5EYLA 2KPMA 1SA5A 4ITVA 2XRNA 1YIJI 1WGXA 4IQJA 3F8NA 1Z6RA 4IN3B 1LVAA 2L2OA 3F23A 2LREA 4II3A 1H89C 1FVFA 3F21A 2ZMEC 4A63B 4IRHA 3C2HA 4JB8P 4RQIA 3OL4A 2XAUA 1WJEA 4I98B 4P5OA 3G71I 3CQGB 2WV1A 3BQZA 5M5WJ 2Q7FA 2GZWA 1KZPA 1W36D 4DYQA 3KAEA 1SVLA 5IT9K 5AYWD 2XDVA 4MKTA 2IPQX 1ZLJA 4RB2C 5ICCA 4J0UA 4O1PA 5HDNA 3ZN3A 2JRMA 3FU5A 3D0SA 1ZELA 2FSWA 3ABLH 2DLLA 1FC3A 4DGWB 1SZAA 1SFKA 1TWAJ 2DPDA 4UI9J 3H0DA 4LIVA 3HGYA 3HPGA 1IQRA 2CG2A 3LVRE 1VI0A 3QAQA 2X38A 4ABZA 4GMLA 4Q96A 1P92A 2VLAA 2R02A 3ELKA 6PAXA 2H6GA 4OMZA 2R59A 3G1OA 3Q79A 1QZZA 1WRJA 1XGNA 4U7DA 2F5FA 1EKEA 1JPLA 3L2CA 1VQ5I 1WJBA 5J1RA 2DYRH 1PC2A 2VBZA 5EZGA 2DQRA 1J59A 4E7LA 2L0KA 3IWZA 4AIJA 3E5QA 3K2AA 2D1HA 1OJLA 2ME0A 4IL6C 4UUSA 2KC7A 3HXDA 1YI2I 2YSRA 4J8FA 1JHHA 3RU0A 4IXAA 3BG7A 2K9LA 3J81Z 1LD8A 1TTYA 4M9ZA 1RZ4A 4IQ4A 1FSEA 1TNBA 3FUEA 3UQ3A 3OR2C 2F5CA 2ZKZA 3PUBA 4ANVA 1GV5A 2XQ0A 3S3OA 1GLNA 5DM7F 4HRNA 3ZN0A 1NK2P 3CF2A 3ERMA 4RGXA 3D9HA 5KJKA 1MGTA 2WXHA 3LFKA 3L2UA 4D7MA 4CZZA 1A6QA 3V7RA 3HOTA 2RREA 4OMYA 4B89A 4EM2A 1S6LA 2Q0OA 5C4XJ 1MMAA 3HM5A 4DPRA 2Z9OA 2J4DA 1JGSA 2LY1A 1JJ8C 1G4DA 4BUPA 5M72A 1VQPI 4FETA 1K6OA 1MMSA 3OSFA 2VQLA 1BIBA 3OXGA 2O7OA 3GW2A 5K7FA 4ZYDA 5CVJA 1JCRA 3I59B 2R2LA 1HSJA 4AM3A 1I6XA 3WE2A 2QZAA 1EJ9A 4XSZF 3W2WA 2DODA 1I3QJ 1FT9A 1ZTRA 3TQNA 2M9HA 1YE9A 1FWZA 2DMNA 2OZ6A 1X58A 4N2SA 2FMYA 4N0BA 3OXFA 3TP0A 3TWRA 4GRIA 2R7ZJ 2XASA 2X6WA 5DM6F 5J47A 3RAUA 2JTVA 5D6FA 5JFRA 1H88C 2X6KA 1LTXA 1DPRA 1YHQI 2GRLA 3S3MA 3CQZJ 4BQOA 5M5YJ 4GZ6A 5J8FA 2CJJA 4TV7A 1YX5A 3NWTA 4PJMA 5HS7A 1FIPA 4YELA 2EFWA 3QPLA 4JP0A 1GW6A 3L9FA 1U5TC 1S7OA 2M7AA 1EA3A 3LSKA 4OOIA 4E7ZA 2CH0A 2ID3A 2PL2A 3RTRA 1W36C 1BL0A 3J5PA 2WY8Q 4NC6A 3TWWA 5BXUA 4BU2A 4UWHA 1I3AA 1QHGA 5FROA 1OY3D 1WI9A 4XONA 3C5RA 3VSKA 5CMWA 3PUJA 4TUMA 5GADJ 1B9MA 4E4HA 3BTLA 5ILUA 2XF5A 5JI6A 1OXJA 1BC7C 3TWXA 4M3GA 2EINE 2WQ7A 4ZYAA 4MO7A 4L5IA 2FULA 2ZGGA 3FULA 4F7AA 4HB5A 1Q1VA 2BVMA 3CGHA 5EIBE 2JA6J 4J8SA 4ANXA 2IJLA 3EYYA 3GFLA 2E2EA 5A7DB 5BXOA 2HYFA 4BY7J 2IW5A 3HSRA 3ABMH 5JLWA 1QQEA 2EV5A 1G3WA 1UG2A 3H3VK 1BIAA 1VQLI 3U66A 1UJJA 4AIHA 2E5NA 3HXBA 2R7DA 1TWCJ 1H6PA 4JQFA 4RB0A 3K6GA 2JA5J 3VWBA 2OF7A 4LB5A 1BLXB 2FQ4A 5ENPD 2E19A 3KZZA 2P5LC 5AIPA 4FA6A 4L18B 1ZQ3P 3F8BA 2KDZA 4U8YD 3KEOA 1TQMA 3DPLC 2YPRA 2PJRA 1ODDA 3FTXA 2AXLA 5ENTD 3R7RA 2R17C 3LJNA 2R03A 3CP8A 3HUGA 2JQ7A 1YMPA 2I1KA 1JWGA 5HKPA 4MTDA 2WQHA 1A04A 1Z21A 2Q2EB 1UELB 3RSNA 4A69C 3HC7A 5JVTA 2PQNA 2CFOA 3D9JA 3SF4A 3QWLA 1S8NA 3FXMA 4U0WA 4B43A 2BY1A 2FOKA 2YQ8A 3SZ7A 1X4OA 3BJ6A 2XPWA 4MQ9F 2DJIA 3DEEA 3L09A 3OR1C 3JRGA 3GZ5A 1K78A 4BKXA 1WSUA 5EEGA 3ZQQA 3CP2A 3HHHA 5D0QD 3O2PE 3UM0A 4A3LJ 3P9IA 1S7AA 3BDDA 3EIJA 3GVAA 4QPQA 4ZYEA 4M6XA 1W0UA 5TRDA 3AU4A 2JUCA 1Z3YA 3MKYB 4Q94A 5E1XA 1HOMA 3HDDA 1NL4A 2P5KA 1BJAA 2ADUA 4O6FA 3V2XA 2DBAA 4IRGA 2V4LA 3TWUA 1G3TA 3FXLA 4DBRA 2A5EA 2CU7A 4J6IA 4MLOA 4XR6A 3RYRA 3PQKA 3AL0C 1MBHA 2RN7A 4YDWA 1ZR4A 5EYPF 2PBIA 4U0VA 1A5EA 3UI2A 3ASHA 2M8EA 3R60A 1R1VA 3IXEA 1XTAA 5HOOA 1W0TA 1BN5A 3DKYA 4TV3A 3Q5MA 5B1BE 5D4RA 3O48A 4IO9F 1HSTA 1MMGA 2WV0A 2DFHA 2ISYA 4G94A 3L2VA 4J00A 1B8IB 2P9LG 5CBOA 4XORA 4A0YA 1O3TA 3PZ2A 4U07A 3CQCB 1JUSA 2VJIA 3G2TA 1F1ZA 5A2QZ 3SFIA 2WQ6A 3CHPA 2GQQA 4G8XA 1AA7A 2DA2A 2MFZA 2IGMA 2HOEA 1O3RA 2BUGA 3DCFA 1G2HA 2F4OB 3FHNA 2WA0A 1MJ9A 3BG3A 1HW1A 3ZYQA 3IV5A 3BG6A 2ZFUA 4M3FA 3JUIA 2LVSA 4HBDA 3U1DA 1NFIE 2X85A 2DCEA 2LXLA 1ZG5A 5JHUA 5EGOB 1X81A 3PZ4A 2FBHA 3LMMA 2ZJRF 4GZCA 3V30A 4WX9A 3OSGA 4JOMA 5JMND 4CT0A 5CERB 3HXEA 3KEZA 1MJ0A 2RC4A 3CUOA 3TKYA 4GA2A 5IP9J 5J1UA 4KYOB 5LP0A 5E79C 4KZCA 3SGHA 3ZP5A 2ZO4A 2OJED 1QPIA 2GRPB 4KITB 4YFXF 3C1DA 3BTCA 1Z7LA 2VC0A 2M34A 3QPTA 2VPLA 2WXOA 3CVYA 5D5WB 2FF4A 3D9NA 5ANLA 2L54A 1E8YA 2MYSA 3E37A 3QB2A 2J8SD 4J19A 2WXKA 1IRZA 3ZYKA 1XMXA 2EPFA 3Q0VA 4ESJA 3RDIA 4UQYA 1IN5A 2OU2A 3OL3A 2AW6A 1PJRA 1FOXA 5BMZA 2PNNA 2QQ9A 4A6DA 1DP3A 2DXIA 1SFEA 2LG4A 4D10C 3HOYJ 4FC8A 3UT8A 1BI0A 2HQRA 2CMPA 1TBXA 1LFUP 2O03A 4RA2A 1Y0NA 4L23A 3CK9A 5JA4D 5E3LA 4BACA 4YDOA 1LVKA 4M3EA 1DU6A 1RIOH 3LA2A 2V9VA 1EF1C 3DSTA 5DBKA 4HORA 4HQMA 4DBQA 3AG3E 4RM3A 2LNIA 4JA9A 1KLXA 3SD5A 1OLTA 2VT3A 2CG3A 4HLEA 2CV0A 4HF2A 2OEWA 4J8EA 2K9QA 4KT5C 1ZGWA 1DNPA 3HPHA 3I59A 1IAWA 2FRHA 3F8MA 2HVQA 4HV6A 4TXPA 3PIPF 4QWQA 3FDYA 3HYIA 1MH3A 4KA4A 4C3IJ 5B1AH 4UXNA 1ULYA 1PP8F 1HU3A 2IU1A 3CIAA 2L02A 5KAFC 2P81A 3JR9A 3IL2A 2PMZA 2XRZA 2COMA 5G04C 3CUQB 3GEZA 3A01B 1WJAA 3OYGA 3ASOH 3U4TA 5EX3A 3OYIA 2BEOA 3MZHA 4GTPA 4PK4A 1B1BA 2WXQA 1IDYA 3KLOA 1QNFA 3EUHC 3QQAA 4U63A 1APLC 2KQRA 4EJUA 3B13A 3JXJA 1J0RA 4RGUA 4GZDA 4ASNA 2VODA 2L6JA 2LBFB 1VFCA 2AHQA 4GYWA 2OOEA 1ETKA 4IHXA 2ZC2A 4UVCA 2UY1B 3ABLE 1QHHD 5F0HA 2MA3A 4M9XA 3CVQA 2IEKA 4XZ4A 1XGMA 3BTIA 3HYMB 3V8JA 4BQQA 2PJPA 2BHZA 2WMOA 2A4ZA 2C2LA 3IKVA 3PNYA 2XSJC 4LRZA 3EDTB 1WJFA 3CCEI 1FLIA 1IYGA 3FUNA 1SQMA 1EH6A 4BY6A 4BHCA 5BUZA 3ZRGA 4P55A 4HNTA 1QZ2A 3QP6A 2FNAA 4XICA 2DYRE 3G2VA 4FX0A 1IKND 2EZKA 5LRRA 3ABUA 4G7HF 5ED4A 1N95A 3OV8A 4MBGA 1KU3A 2K02A 4X1EA 5J40A 2DJNA 5KVRA 1E0EA 5K1YA 3VLDA 1QA6A 1OCRH 1ETWA 3QU3A 4HYEA 5FKKA 2HI3A 5LHGA 1IUYA 3LVQE 2LAHA 2MC4A 2KATA 5E3OA 1V5GA 2AO9A 2PLYA 5KNGA 4AOFA 1TNUA 1E3HA 2ZSHB 1LFPA 2EIME 4URKA 5JVGF 1FTZA 1QBQA 3AS5A 3ECOA 3MKRA 3S7DA 2XEEA 4UNOA 3BROA 3OYCA 3DPUA 4IHTA 5CHEE 4JZYA 1MW7A 2BY2A 3VFZA 1H6KA 4MTEA 1AKHB 3LSMA 4EEFG 4PJNA 2E7XA 1MBJA 2BY3A 5G04J 2ECCA 2E1NA 2Y69H 4PZJA 3UKRG 3IRRA 2CQNA 2XB5A 2WWYA 3TL4X 1UHMA 4II2A 2LF8A 2NXNB 1XCBA 2FBKA 3ASNH 2L0TB 3Q4AB 1YG2A 4EQQA 2OUMA 2UWJG 1JT6A 2QSFX 3B7BA 4IEJA 2DOAA 4OIPF 4M7CA 1W7PB 2V9PA 2FI7A 3DLAA 5FLVA 4C0EA 2GWRA 4WWOA 3DSXA 3L9TA 5E17F 2CSOA 2FU4A 3IKTA 5T3RA 3D9PA 4LLNA 3ISPA 5L3CA 3K7AJ 1B9NA 2E1MC 2JK3A 4JW1A 2ZCWA 2MG4A 2OQRA 4IOAF 3F6QA 3I58A 2M63A 4YG2F 3GTKJ 4B48A 2LLKA 3ML8A 3KETA 2XAJA 2YU3A 3CHMA 1Y6IA 4HXIA 3MV3B 5CYVA 3A03A 4IRUA 2VKHA 3DTEA 5DCMA 4E7JA 1YFHA 2QQAA 3WHCA 3PDNA 4N5CA 1OPCA 4A1GA 1YJWI 2EQRA 1MX6A 2L7KA 3M8FA 3SFZA 4XN0A 3O4ZA 3I4PA 4I0AA 1K1AA 2DIWA 1WKMA 2MBFA 4BEHB 4ZTFA 2DDBA 4JBAA 1B8IA 2LK2A 3SXYA 2ID6A 1X2NA 2KZGA 3R6SA 3OYNA 3J7ZI 1IGNA 1OCPA 5H6RA 3WTUC 4CZ2D 1N54A 5HNFA 2IO3C 4O3MA 4GMJA 4CDRA 1HCRA 1C0WA 1YQAA 1R22A 2MLGA 1MKMA 3L2RA 1DP7P 1OWMA 1OCCH 3D9LA 3QDNA 2BOLA 3Q5FA 1WM5A 2JABA 3D1NI 5D5XB 5C2YA 4EBAG 2MC3A 2XS1A 4L5EA 1KA8A 2A05A 4JHKA 2GRRB 3JSOA 3ABME 2YR2A 2DW4A 4UUSB 1JCQA 3FTWA 1X1DA 5FRMA 3L17A 2WBMA 2G7UA 4LNGA 3NAUA 3JRAA 1Q2ZA 5E75A 4XN3A 3ZPJA 4IX7A 4BX8A 2R5YB 1UCRA 2XGEA 3J80K 5ITZF 2MLKA 4DK5A 3LQRA 2ZFWA 4HFGA 1IHBA 2DT5A 2ZMEB 1QYMA 2J9QA 3D9KA 3BC8A 3I5UA 4GYYA 4NACA 4HLYA 2VKEA 1NK3P 3E7LA 4J01A 3CD6I 3BUAA 4PJLA 3JCKC 4BSZB 2VIXA 3P9KA 1H9TA 1T2KA 2MYOA 3KP3A 2OTJI 2KIUA 4GYGA 3E3VA 3NF1A 1YW8A 4BE1A 4BY1J 5HI7A 4F3QA 1IN4A 2VKDA 3CO6C 5J4VA 1XSDA 2IS1A 3SZGA 1MBFA 2ONDA 2P0WA 3CCYA 3I64A 1BI2A 2JVHA 2NVUB 3ROUA 4DLOA 1OWLA 3VYTB 3ZQLA 1EDUA 4EM1A 3GCMA 5CVUA 3E33A 3ML6A 1BD8A 3ZEFA 4AIDA 3I5PA 4HQDA 4PUSA 3FBNB 3KS2A 3S7JA 3WU0A 3K10A 2ECBA 1Y8QB 3H36A 3BWGA 3F6OA 3DSVA 5FINA 3RO2A 2DK5A 1J2XA 1X3ZB 2LMDA 2V6CA 3RQ4A 4HDUA 2L6BA 2Q1ZB 3Q9NC 1IZ1A 2PZIA 3E5UA 2CV2A 3MKQA 3T8MA 2KIMA 4MGRA 2EJRA 3QRFF 2LNBA 2AXVA 1MHQA 4N39A 1TNOA 1RRJA 2YINA 4DX1A 2LY9A 1T8IA 1TNZA 3M1EA 4G1TA 4I1OB 2GLOA 2NNNA 4EV0A 2Z16A 3ZQCA 3N4MA 1YX3A 4G7ZF 4A3DJ 5DYMA 5BS6A 1VTNC 2C0MA 1RI7A 4XLAA 1XNFA 3UM1A 1TNTA 2DA6A 1SC7A 5F1JA 4HA8A 1EH7A 5E8IA 2ZJPF 2C6YA 3OYFA 1PUFA 1F4KA 3WODF 1JJ6C 1FBUA 3KYDB 2FOWA 3O8HA 1WH5A 2PMUA 4C3JJ 3B02A 3BG5A 4I09A 4E7IA 2EH3A 4I6ZA 1WZ2A 4FLBA 3SO8A 3K70D 3RZOJ 3Q73A 2V7FA 1DGRM 2GOXB 4AVPA 3JRFA 5BT1A 2VPRA 4XEIG 3Q49B 1KYWA 1OR7A 2JT1A 1QVTA 3FUHA 1TR4A 4P29A 1IN7A 3QOPA 4U8VD 2X6HA 3H35A 2HOAA 3MD2A 1OYYA 2HKXA 4ESFA 2P9UG 2FA5A 2FMLA 4XL9A 2I9CA 2KCKA 3ERED 2K7LA 4GTTA 4OIRF 4A93J 2HYZA 2M8GX 3QWPA 4W1UA 3LSGA 1ETXA 4HF1A 2V1XA 1D1AA 1TN8A 1ZRFA 3OMYA 3DEUA 3JYSA 1U2VG 2P9KG 3V42A 2O61A 3BEEA 2W24A 1YO5C 4KN4X 1RW2A 1Y0UA 3D9IA 4XX5A 4B93B 3I56I 2CQ7A 4BTBA 3CCRI 2PJRB 4P9FA 4UWLA 4YIIA 5LHIA 2HXIA 1FOKA 3ONKA 2Y9ZA 3FKJA 1SFXA 3HUGB 3DSUA 4CGZA 3CHRA 2LKXA 3UM3A 3T5VA 3JRHA 1OWPA 4B8AA 3HEFA 1EV7A 4FU3A 5HRYA 4FTHA 1KPSB 4ZTJA 1U9OA 1E90A 1S70B 3F22A 3HL2A 3EHRA 3KD7A 3V79K 2B6CA 2HFHA 4FULA 2IAIA 3CLJA 1ITYA 1MJAA 5L3EA 3D9OA 4PJ0C 1K78B 3CKBA 2YS9A 4ABNA 3LAJA 2H1KA 2RQQA 5ANRA 1I5ZA 1BW6A 2H6BA 4XLNF 4DX6D 2A6HF 2PEXA 3DKWA 4IJAA 2KZTB 2PM7A 3WU2C 2HVSA 3AJIA 4Y17A 3BLYA 1YRNA 2R7WA 5C1DA 3E97A 1JUQA 2H27A 4FT8A 1N0RA 4KICA 1MIJA 3G2BA 2JA7J 2K4BA 4GPMA 1IXVA 1BU9A 5CQGA 4AV7A 4Z6YA 4GCVA 4K5BA 2WC2A 1LEBA 1XG1A 3CV0A 1IO2A 2KCVA 3CC4I 3ZMDA 1G8XA 2HZTA 3GTGJ 5FQ6A 1Z05A 3MFKA 4KXKB 5GPAA 4A1SA 3K4BA 1DCQA 4BETA 2Y30A 1D5VA 3UIOC 1ELWA 3I53A 3JREA 3S17J 5B1AE 2QQBA 3CCSI 2XAHA 2F2EA 1JKQC 1RUNA 4AYBA 3WTWC 4AC0A 1SD4A 2WXNA 2P7VB 3ASOE 2HTJA 2OPTA 4JHRA 3HTUA 2NSZA 1ZBPA 3K70C 3Q47B 3DV8A 1MNEA 1SMYF 4A12A 3B7RL 1XCVA 1AU7A 1NA0A 1XDSA 3GZ6A 3CESA 3BG9A 4ZC3A 2R7RA 3DEPA 4N3AA 5CBNA 4JVSA 5EDSA 1OCTC 3ZQIA 1XD7A 3G6EI 4FE7A 2M5WA 5IY5H 3FUFA 3GTQJ 2PX9A 4ZHBA 2X6YA 4JX4A 4E7KA 1B4AA 4BEHA 5J8CA 2V1UA 4HAMA 3S2HJ 5CVRA 4WF2A 3ZIMA 3FH7A 1HG5A 4NURA 2EWNA 2XRLA 2LH9A 4O1OA 4EQFA 5DDGA 1Z9CA 1UFMA 3LPZA 2VE8A 4FHKA 3AG1H 2WXRA 2A07F 3J7AO 4GFBA 4G2VA 3R0AA 4HOUA 4BAYA 1IRXA 1WH7A 2IA2A 2GXBA 3AS8A 1FSHA 4ILHB 4HNUA 3S15J 2FUG2 5DV5A 1PVEA 1IW7F 1DQUA 2OEVA 1N9AA 4IHYA 2X3MA 2XPVA 1QBJA 1UG3A 2XGSA 2DMTA 3CJRB 2HZDA 5ENNA 1FPPA 3K1MA 5FKLA 3PFYA 3B7UX 3CKCA 3KP4A 3CK7A 3ULQB 3OIQA 4GAAA 2V79A 2RFMA
chains in the Genus database with same CATH topology
1T98A 2ZMEA 2JRTA 4GYIA 2EB7A 4LG0B 1WQ2A 3T1BA 2XGXA 3JAMK 2MD5A 2YX7A 2HEOA 3ZN1A 1RNLA 2VC1A 1BM9A 3ABTA 4PCQA 4HDVA 3V7SA 1FYLA 1HKQA 1PDNC 4UHTA 5E8GA 4EM0B 1G3YA 1QO0D 2OD5A 3SHFA 3T5XA 2PMHA 4ZZDA 2NNYA 4NQWA 1ZGAA 1S3JA 3WTXC 3CTAA 3KFWX 2CFXA 4R79A 1H9GA 5E18F 4HF0A 2UXNA 4ENMA 3F8FA 3RI4A 1W5SA 5LHHA 3H3UA 4S04A 1FBSA 3R0JA 3WGGA 3DXJF 4G9YA 1ZARA 3HSFA 4KIFA 1IRGA 2DTRA 4WK8F 2M30A 2Z99A 2RV8A 3KP2A 1EH8A 2ESHA 3NRVA 1CGPA 2GA2A 1IXSB 1O3QA 3ZMZA 3LQQA 3L7WA 3T8TA 4RAZA 2Y0MA 5DUKA 3B73A 1P2FA 1KQ9A 4RB3C 4A5MA 3DFGA 1U5TA 5J6XA 4KIBA 1YW7A 3HSEA 5F1RA 2P4WA 4RB1A 2D45A 4G6QA 3WTYC 2EFPA 2E7WA 1FP1D 5LEJA 1I1SA 5CJ9A 3BJAA 5K5OA 2D2WA 4IPAA 2RVCA 5DCMB 1ZG3A 3PFIA 5DCFA 4EJOA 5D5VB 3BOQA 4G7OF 4A2UA 2UXXA 3K1PA 3DQVC 2G7HA 4CXFA 1XSXA 4HV5A 5DD4A 1HQCA 1SD5A 2XROA 1Q1HA 4MEYF 3KP6A 1TW3A 3O6BB 2NRAC 3KLNA 2RKHA 2IRFG 3E6CC 4Y15A 1UB9A 2HQNA 2CYYA 2OBPA 4L0YB 3QPHA 1FBQA 5AONA 2CGPA 1S29A 4EMSA 4S05A 5LRSA 1PUEE 1L0OC 3ZPLA 1FP2A 1QZYA 3O3KA 4GO1A 2NYXA 5LBQA 2W84A 1O3SA 4AWXB 4LG0A 2KRFA 3P7NA 4ESBA 1AWCA 2IT0A 2BE5F 2EFQA 4UVBA 3K9TA 1T6SA 4YFKF 3JTGA 5F6FA 1DPUA 1OMIA 3K1NA 5IT3A 3K0LA 3M8EA 2YX4A 2L01A 5IT9Z 2VBXA 1K79A 2VONA 1V4RA 1IXRC 3DPTA 3JTHA 3TOAA 1TQPA 4R8HA 3I0TA 2EV6A 3MAJA 5AIQA 4CDGA 1K7AA 5E20A 4DQ2A 3RKWA 2VXZA 4MNUA 4KMUX 3FXQA 2EA4A 2BGCA 2RQPA 2ZNZA 2HTSA 2R7FA 4B8XA 3JAMZ 3FMQA 3KE2A 3HRTA 2E1CA 1ZYRF 2VOOA 3AAFA 3EUHA 2FBIA 3GF2A 2K4JA 3WTVC 3FM5A 5L3DA 4F7ZA 1ZLKA 4BXUA 5HDGA 2HDCA 2DI3A 4AD9A 1O7FA 2XKOA 2QENA 4KDPA 1ONVA 4A0ZA 2V1DA 1FYMA 3I71A 3J81K 4HOBA 1MZBA 3T0YA 3GYHX 3HHGA 3LA7A 3WGHA 2DQLA 3MQ0A 4RGRA 1F9NA 2Z5UA 2XAQA 1FZPB 1IRFA 2QWWA 3WGIA 5KK1A 4XRFA 2TDXA 2VT2A 1XGOA 4EJWA 1J7KA 5DUIA 2A68F 3NEUA 4UV8A 3E6MA 2J5PA 1CF7A 3QAHA 5ICGA 4YIFA 2A61A 4L5JA 1J5YA 1L3LA 3WTTC 3VEPA 1XMAA 2D1VA 4M71A 4LK1F 4EVIA 3P9CA 1MDMB 2BYVE 4I0BA 2WTEA 4L0ZB 5LGUA 3FXRA 1W7PD 1ZRCA 4WXCA 2XKPA 4L9VA 2ZNYA 3C18A 3MCZA 3KP5A 1I27A 4EGYA 3V8KA 1R7JA 3G73A 5TJJA 1HW2A 1HKTA 3CUQC 1LQ1A 2ETHA 4Q5SF 1YS6A 2M1BA 3Q9VA 1ZGJA 4QLCU 4Q48A 3LAPA 3T8RA 3REOA 3F72A 4UUVA 3KEQA 4HLXA 4LGWA 4MEXF 1J9IA 2VN2A 2ZBKA 5FD6A 1BBYA 1YYVA 3F8CA 2UZKA 1E2XA 3BY6A 1YIOA 2ACJA 1USSA 3BPVA 1HKSA 2A3SA 2JSCA 4P96A 4E70A 2DFIA 4ENNA 2XUBA 3GFMA 1U8RA 1STZA 3ZMUA 1QNTA 1PP7U 2KJCA 3G3ZA 3CJNA 2VE9A 1U5TB 2L4MA 4A0XA 3FF5A 4KFCA 1KU7A 2XHKA 5CLSA 2XV4S 2ISZA 1IF1A 2X4HA 1XN7A 4ON0A 4IVNA 1U78A 3HRMA 2L3DA 4IHSA 2K86A 3V7CA 5LGNA 1IN6A 3LSTA 4CO8A 3FX3A 3TOBA 4ETSA 5FFZA 5LGTA 2XAFA 2XAGA 1YLFA 1XDUA 4BYYA 1LJ9A 1SD6A 2H6CA 1I1GA 3HIFA 5E1ZB 5LLQA 1KQ8A 4HW0A 5HS8A 3ZQ7A 2JPCA 2A5YB 1O57A 2UWMA 3NQOA 1USTA 1GXQA 1AOYA 5ILSA 3LWFA 4U7BA 1ZRDA 3V4GA 2P5VA 3E6BA 4LK0F 2G9WA 1ZAOA 3BPXA 4M9SA 3RJPA 2J5OA 3E5XA 2HYGD 2HS5A 2QVOA 2P8TA 5D5UB 3QU6A 2FQ3A 1OYWA 2OAZA 3MWMA 3F6VA 1LB2A 2STTA 2DK8A 1G3SA 4KN7X 3N97A 2KKOA 3WTSC 4Q47A 2OA4A 2LSOA 5ICEA 2A69F 1MDMA 4L9NA 4O5VA 4FX4A 4H0EA 5D6EA 2O0YA 5FD5A 4RAYA 5BQTA 2FE3A 2X0LA 4R1HA 2FEZA 1YS7A 4LD5A 1T38A 3CDHA 1UHWA 4Y13A 4LMYA 1BOAA 4U88A 5K5RA 5D8KB 3GO5A 2DAOA 1OKRA 3FMRA 2W85A 2RGVA 1REPC 4UVAA 4MHGA 1RUOA 4P9UA 1D3YA 1E17A 3R4KA 1ZN2A 5BPIA 1BI3A 4K2EA 1F5TA 3W6JB 4KIGA 2CQKA 3M7GA 3W6KB 2QZ8A 1FX7A 3H3ZA 1Z91A 4ZH4F 4CICA 2O6GE 4OIOF 2VBWA 3J80Z 4A5NA 4WCGA 2JPBA 3FMSA 1TLHB 5FFXA 4N9HA 3PQJA 3Q9SA 1JXSA 4UV9A 4M72A 5E1WA 5HLIA 4KNYA