4K0RA

Crystal structure of mouse cryptochrome 1
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
487
structure length
463
Chain Sequence
VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPCMTPLSDDHDEKYGVPSLEELGFDTLSSAVWPGGETEALTRLERHLERKAWVANFERPRSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein
molecule keywords Cryptochrome-1
total genus 170
structure length 463
sequence length 487
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4k0rA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4k0rA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4k0rA01
2RE8A 3QE4A 1I6MA 2R5WA 2CYBA 2OQ2A 1N1DA 4RUKA 4KR9A 4I6JA 1TEZA 3UOWA 4EF6A 1NI5A 1YI8A 4NAHA 1O0BA 4EFKA 3C8ZA 3QTTA 4MW6A 1YIAA 1M8GA 2QTNA 4QREA 1IH8A 1KH2A 4YP6A 3IUBA 3Q10A 3UC5A 4MUEA 4DJAA 4EG7A 4EG3A 1N3LA 5EKDA 2QUJA 4XFDA 4DDMA 1A8HA 1ZUNA 3IMGA 1B6TA 1WXEA 3N9IA 4OUDA 1Q77A 1U0BB 2BTEA 3N8HA 4X0EA 1GTRA 4I6GA 1KORA 1EJ2A 4ND6A 3TZEA 3A04A 1WXIA 2Z08A 1R6TA 3LE8A 3ZXSA 4G5YA 4L2IB 2PZAA 4KPUB 1J20A 1T6YA 1JZSA 1WJGA 3CLUC 4A91A 4WSOA 1VLHA 1OWOA 1O96B 4G5FA 1EFVA 4HK4A 2VTBA 2DPLA 1GPMA 1QQTA 3DO8A 4EGAA 4KKVA 2VTBB 3FH0A 1PFUA 4PBRA 3IOBA 1M1ZA 4HJXA 1KQNA 4EG1A 1WKBA 2A1UB 4E1AA 1JECA 3ILVA 1QTQA 1TFUA 4ZT4A 3PNYA 3RK1A 2A1UA 1TYBE 5KWVA 4ND7A 1JEDA 1MOPA 2QTMA 2IELA 1NUTA 2CT8A 1NZJA 4CDNA 1T9GR 3SYTA 1M8JA 2NSYA 1GZUA 1WXGA 3CLUD 4S1OA 3CVXA 2WB2A 2IJGX 1N2IA 2JA2A 1F4LA 1UFVA 1M8KA 4ARCA 2CFOA 1QRUA 1OWPA 1J09A 4Q93A 2YWBA 2O5RA 5FNZA 4AQ7A 3D6UA 2A7XA 4KPUA 1YUMA 3INNA 1IHOA 1T6XA 3SEQA 1LW7A 1YULA 3L93A 1KAMA 1XNJA 2NZ2A 1MC1A 1PFVA 4DLPA 1EE1A 3OP1A 4G6ZA 4NX2A 3IVGA 1T9GS 2V0CA 3IMCA 1QRSA 5J58A 4NATA 3RFFA 3ZGZA 3AKZA 4JXZA 1WY5A 3ZJVA 1U7DA 3X1JA 4MW5A 3RK0A 2I1LA 3TQIA 2GKSA 4MVWA 3CVUA 1JIJA 1K92A 1KH1A 2A86A 2OV4A 3CLRD 4ZT6A 2RD2A 4DNXA 2A1TR 2X0KA 1ZJWA 4ARIA 3ZUGA 3ND6A 4XFJA 1N75A 2ZP1A 3UY4A 1O96A 3CLSD 2AZXA 4MW2A 2WQ7A 5AHWA 1TQ8A 3SDBA 3HL4A 3K32A 4ZT3A 1WOYA 2QTRA 1YUNA 3H9CA 3DLAA 1G8GA 3IODA 3H05A 2E0IA 3TZLA 4JZYA 2QUKA 1EUQA 1Q19A 3A4IA 5F23A 3QTBA 2D5BA 2X3FA 1LI5A 3AG6A 4ZCTA 2AKEA 1H1TA 1JIKA 1OD6A 3TS1A 4KR6A 1VBMA 4EG6A 3KT8A 1ZH6A 1RQGA 1DNPA 5J59A 5K0TA 2J08A 1G8FA 4MUNA 4L2IA 1IQRA 4UZEA 4ZT7A 2D13A 3AG5A 2CV1A 2X1LA 1NYLA 4HJRA 1OWLA 3AIIA 5FO0A 2DERA 3AL0C 2CUZA 2CV2A 1N78A 2PG3A 3KT0A 3Q4GA 3MLAA 1NUUA 3IOCA 4MWBA 2A84A 4BWVA 1XNHA 3P52A 1IRXA 3X1MA 1NUQA 3ZXIA 1H3EA 4MW4A 1NP7A 1Y42X 2G36A 1KQPA 1ZH0A 2E18A 1NUSA 3G5AA 1X8XA 3IVCA 4JXXA 1FYDA 1Q11A 1N2HA 1JZQA 3PNBA 2V0GA 3MUEA 2CYAA 4NDAA 4MLPA 3IVXA 1O97D 3VGJA 3ISJA 3PXUA 1J70A 4Q16A 4YP5A 1JMVA 4RPIA 1Q15A 2JAXA 4YP7A 1M8FA 1EXDA 2HZ7A 4F3RA 1NURA 3MXTA 1GAXA 5HUJA 3ZJTA 4MWDA 2CSXA 4DDKA 4WNYA 1O94C 4P2BA 1MJHA 3LOQA 3GUZA 2XRZA 4OUDB 3CVVA 1OWNA 1QNFA 4MW1A 1O97C 2DLCX 3FI0A 2Z3VA 1PFWA 3DV2A 1MRZA 2DUMA 4EG5A 1I6KA 3HMQA 4MQ6A 1N2GA 2YWCA 1N77A 5TEWA 4U7JA 1N2OA 3PNVA 3GLVA 3CLTD 4MVXA 4ZT2A 4CT0A 4MW7A 1N2BA 1EUYA 3VRHA 4GU5A 1EFVB 2H2AA 4I6EA 4YBRA 4R2LA 2HGZA 1MAWA 4XSVA 1J1ZA 2A4MA 5JBNA 4NAUA 4K03A 2QJTA 2DXIA 2H29A 4CQNA 1JILA 1M83A 1MB2A 3ND5A 2WSIA 3DPIA 3D6VA 5IJXA 2J5BA 3IOEA 4MW0A 3VU8A 3FHJA 4ZCSA 1JHDA 5J5AA 2WQ6A 3TNJA 1COZA 2PXHA 3ZIUA 3HV0A 3HFJA 2IP1A 3SP1A 3NBAA 1I2DA 3AFHA 1H3NA 3KFLA 3I05A 5BNZA 2QUIA 3U1VA 1IFXA 1P7PA 2Z09A 3FIUA 3CVWA 5H16A 3UK2A 3F3MA 1WZ2A 2O8VA 1JEEA 1GN8A 1BS2A 2B7LA 4U8HA 3IUEA 3SEZA 2E89A 3ELBA 1V8FA 2QUHA 3RHSA 5DASA 1HYBA 3FY4A 4MUFA 5KHAA 3BL5A 4ZCQA 4MWCA 3CLRC 4MUJA 1VL2A 1KH3A 1R6UA 1X6VA 3COYA 5HUHA 1N2EA 4DE5A 2DEUA 1WQ4A 4J76A 1F7UA 5KCMA 3P0HA 2EJCA 5DK4A 1WQ3A 1N2JA 2EL7A 1GLNA 3P0IA 4PY2A 3COZA 4F4HA 5DB4A 2GM3A 4MAFA 4ZCPA 3M5WA 4MW9A 2PIDA 3KT3A 4R0NA 3G59A 4QRDA 3A2KA 1ULHA 3H97A 3H9BA 3CA8A 1NUPA 1O0CA 2D54A 4HPWA 1KR2A 2VXOA 2YXNA 1U3DA 1XNGA 3UMVA 4MUGA 1JIIA 3COWA 3IH5A 1WXFA 1T6ZA 2ZUEA 4GRIA 1QU3A 2PZ8A 4H3SA 1R6XA 1FFYA 1F7VA 4YMIA 3KT6A 3SZGA 3MLBA 1H3FA 1J21A 1NSYA 1IQUA 1PG2A 4PBTA 3COVA 1OBHA 3HGMA 3FETA 1LI7A 1TYCA 2BYTA 1WXHA 4MUKA 5IHXA 2A1TS 1KP2A 1J1UA 4QBTA 1YIDA 1QJCA 1PG0A 4UZFA 2TS1A 3NBKA 4CDMA 2J4DA 2PFSA 3CR8A 3S3TA 1U3CA 3ND7A 4DDHA 1O95D 1EFPA 1GTSA 3FG9A 5LLTA 3RJZA 3FWKA 3CVYA 3PRHA 2C5SA 3FDXA 5HG0A 1M8PA 2XRYA 3G6KA 3TQOA 1K4KA 1KKUA 3GMIA 4MULA 1MB9A 2PZBA 4U63A 3A05A 1OWMA 4JFAA 4MUIA 4MVYA 4PBSA 5TEVA 4R2MA 4FZJA 2GOYA 1K4MA 3MMXA 1PFYA 4JYZA 4KR7A 2DR2A 1I6LA 1TYDE 2JANA 1KP3A 2A88A 4TS1A 1IQ0A 3SZ3A 2E21A 5DEOA 3LCJA 3NV7A 1TYAE 4AS1A 3K9WA 3N2YA 1MAUA 1QRTA 1ILEA 3Q12A 3FOCA 2AG6A 5TGTA 5K0SA 1K97A 3P0JA 5LM3A 1VBKA 3X1KA 2X1MA 1MBZA 2YY5A 1O6BA 1S4MA 3N05A 1JGTA 2QJFA 2J07A 4EG8A 3RBAA 1CT9A 4OJMX 1KAQA 4K0RA 1VBNA 1G8HA 5FO1A 3FNRA 1G59A 3H99A 3E27A 1IVSA 1O94D 3CLSC 2CYCA 1U7XA 3IDFA 3L92A 2ZUFA 2HMAA 4NZPA 3JXEA 4ZCRA 4EG4A 1V47A 4MUHA 2QJOA 1O95C 5TS2A 3HZRA 5H7XA 2J09A 1O5TA 2CV0A 3ZJUA 1QU2A 4ZT5A 2DETA 4J75A 3IMEA 4MVCA 1KQOA 1OBCA 1XJQA 5LFAA 1SURA 1F9AA 4MWEA 3CLTC 1EFPB 1D2RA 3OTWA
chains in the Genus database with same CATH superfamily
1KPSB 3P9XA 3G88A 2RE8A 1E9DA 4H6WA 2OV8A 4M55A 1BMQA 2CYBA 2PZGA 1JUDA 1XELA 3LTEA 2GPYA 3T5VA 4GNKA 1YQXA 1N54A 3I5AA 4I4TB 1PJCA 1YCDA 3N59A 2DRIA 2Y1FA 3QUAA 1TLFA 4QE3A 4TVOA 5LA6B 1NSFA 2PLWA 3UOWA 2I2DA 2JNWA 3HPRA 1CJTC 4HN2A 2HU2A 5ED4A 3PR2B 2XOKA 2ZGDA 2V5VA 5CX1A 3K09A 5CH3A 2OQVA 1WTCA 4ADSG 2C2WA 1BU5A 3D2CA 3ESBA 1MB0A 3W1VA 1P2SA 4PS8A 1DXQA 4IZ6A 2ZT7A 4LCJA 3LQRA 1UKAA 4OHXA 2HNAA 1EBUA 5GMOA 3TE7A 1ZW6A 4UBNA 1L1QA 3KU4A 3BMCA 3LC0A 4CODB 3OVMA 2HI0A 4C21A 3ZTTA 3I5MA 3IV0A 1MX9A 1QK4A 4L6CA 1N0UA 3MIIA 4XEIG 4WBNB 4NG4A 1N8NA 1ZXXA 5ES3A 1K6MA 2XJ9A 3EX7C 5DU2A 7YASA 1U0BB 1UBCA 2HH9A 5ANRB 4FX2A 1N4PA 4ZVKA 4L6IA 4MWOA 2EJBA 3E33A 2X0JA 2YY6A 1C4KA 4BLOA 1GT6A 1J8VA 2WHQA 1Q12A 4G11A 5ADHA 2OD2A 2DHCA 4DUGA 1DX6A 2GQ0A 1F0YA 4WZBA 3C7DB 2VHEA 4ENUA 4QATA 1UPAA 3VOSA 3AUSA 2FEMA 3PNLA 1UDRA 2IOFK 2BGWA 5WRFA 4EGAA 1HNZB 1ZAYA 5EA2A 1SXIA 3BWBA 3BZWA 1AKMA 1PFUA 3CVOA 1FDOA 3UMJA 2PJRA 4LKRA 2GBPA 4MYTA 4BNJA 5KVSA 1LPMA 1JXMA 2ZT8A 3F2IA 3R9WA 3CN7A 1HYQA 2Y3IA 2FFBA 4JK3A 3WRYA 1H6DA 3A1EA 3FR8A 4GMGA 2BSXA 3T1QA 2EKDA 4EBFA 2IELA 2SNIE 4WBNF 3LI2A 5T4HA 1PDVA 5B7PA 2X5KO 1V6SA 4EWLA 1P4AA 2WPDD 3T7SA 2FZLA 1IM5A 2NP7A 1GZUA 1B0UA 1GKYA 1PEAA 3ONVA 5DSXA 3RUIA 3B9RA 1DZ3A 3F5DA 2HY7A 4L3WA 4C05A 2H92A 4Q3OA 1FP2A 2XZDG 3OTOB 3NTLA 3NLLA 2EINE 1U63A 1UT8A 4BLPA 3OKPA 1QE0A 4CLDA 5FCDA 1HNWB 3MXOA 1F4LA 1DFGA 3OT4A 3CG0A 5AI8A 2JCYA 1RC8A 1Y37A 2A8YA 3Q8WA 2Q4TA 3UBTA 1X42A 1H65A 2EDAA 2POCA 4AJIA 4FMBB 2XEEA 3DTVA 1E77A 2X3YA 4AX4A 1P5ZB 2MR5A 3R7LA 3ESLA 4XE5A 5LA6F 4DCGA 4DQLA 2A0UA 4EY6A 2WXMA 3K8ZA 1YUMA 3TG4A 1S2IA 3FPCA 4RLHA 3RYFB 4ARZA 4YRIA 4KZ0A 3TX2A 4FHGA 1I3LA 3RT7A 3QVMA 4KLRA 1NW7A 3C4JA 5EWLA 2NUAB 3WOHA 4MV6A 2P5YA 1T5HX 4FLBA 4QU5A 5EIWA 3VU3A 2NUAA 2VSQA 1WG8A 3BOSA 4RCYA 3AHCA 3QU2A 4S1NA 2EILE 3A1TA 2GKOA 1D1QA 1UXKA 4PIMA 5KKNB 1AD2A 5BQXA 1KI7A 1U1CA 3D6TB 1VHLA 3MUFA 2JCBA 5EMMA 2LGJA 4DUPA 3A1CA 4IFEA 3O1IC 2A14A 2FMFA 4M1MA 4UWKA 4QPNA 1LU9A 3GNLA 4AURA 2FW9A 4PQEA 1XF9A 1VPLA 4QYSA 2F67A 2O8NA 1FQWA 2R84A 3DP9A 2W8ZA 4OG2A 4WUVA 1K1BA 1V1MB 3KUUA 4KFSA 4M1ZA 2NYAA 1ADYA 1Z2AA 4CLOB 3FDJA 3U49A 4FYYA 2GXAA 2O8EB 2BGNA 2OBBA 3F47A 4B43A 5KDLA 4XQ9A 4GOJA 4JZKA 5AUOB 1T0HB 2MWMA 4IYJA 3QLJA 2VTDA 4U7GA 4CLOA 4KPGA 1W47A 2GCOA 1L5WA 1H1LB 4QBFA 5LOVB 4LC1A 2C2MA 3QXGA 4OHUA 1YS6A 1P2GA 2GCOB 4OAPA 1VMIA 4Q4LA 5FL7D 3ZHOA 1PD1A 2NACA 2X77A 4C4AA 4L16A 1QVZA 3ACBA 3K2BA 5MN5A 1U2SA 3NHYA 4LZPA 1PV4A 5CA1F 1QQAA 3JAWB 1AGPA 4Q66C 4E1BA 1XTRA 2PANA 2CC2A 4BNHA 1IEWA 2ZJBA 3EEYA 3HL4A 1CF2O 2WNHA 3JAWA 2H1LA 3AW8A 3G2HA 1RWNA 2GHIA 1UMKA 4FYWA 4LGVA 5T3UA 4IXTA 3UOAB 4J16A 4TLBA 4YRTA 5LQKA 5KOHB 3T3GA 5CBPA 2BMWA 4BWRA 2B8WA 4GPTA 2XNKA 2XBMA 3FP3A 3DXZA 2O2SA 4BRUA 5BSEA 2Q5CA 3BQMB 3EUFA 4F53A 4IHQA 4F5DA 2PZIA 2C4TA 1I24A 1OV4A 5HOQA 4JX8A 3O8RA 3TS1A 3VPGA 1XCBA 1G7RA 2ZSAA 4AAYA 4JX9A 3LX8A 3U4GA 2VWGA 4IIGA 1WDLA 1CRWG 1P4SA 5DYIA 4GTPA 1T8RA 4MR9B 2O6LA 2I8CA 3L84A 3A1DA 2OEWA 2WP8J 4CEJA 4CCYA 4DA8A 3E34A 2K5UA 2QYJA 1IK4A 2IYLD 2WHXA 1G38A 4JLKA 5AW1A 3M6LA 3NH6A 1AF7A 4ID3A 1P73A 5D6NA 5EKTA 1N78A 2AFRA 2IA5A 5EJAA 5BYBA 1UDWA 2IYEA 4KVFA 4YAFA 1XA0A 3FTDA 3HLKA 1LDEA 3OLCX 4LMAA 1NUUA 4E12A 3LSYA 1LA2A 1O9HA 3DSWA 3K8YA 4ERXA 3SVLA 2ZUSA 4Z4GA 1H3EA 4REQA 3ZWYA 4J2TA 1RTKA 2VF5X 1BN6A 3G5AA 3HKCB 1KFCB 1JP7A 3U6KA 4GSKA 4ONEA 4RHCA 4W6QA 1BFUA 2VA9A 3HKCA 4AZVA 2IEZA 3HMKA 3VHRA 4EP1A 3PC6A 3PX3A 1ZMRA 3HR8A 5IPFA 2QQGA 3DBLA 2GBCA 3DKKA 2XT6A 4ZI2A 2R05A 2IVZA 4RPIA 1RAHA 2IXTA 4WCVA 1N0RA 2WVHA 3H2BA 1PJTA 2BFFA 2GX6A 3VVBA 3L7AA 5B1AE 2VPIA 4GH5A 1Y8RB 4BO9A 1OIWA 4HEQA 4F45A 4F8EA 4ZHBA 3Q85A 4YT4A 1UN9A 4TS4A 1FVHA 4G0VA 2GAOA 2W42A 1XYVA 5JXWA 2QTGA 1WSWA 2VDVE 4V0LA 2EGGA 3H0KA 4L9PA 2EVWX 2AT1A 2QG6A 4CUZA 3Q3VA 1UBHS 3ADKA 4PGMA 4MV5A 2FPUA 4EJMA 6ADHA 1QDUA 1G3NB 1R4AA 2CBGA 1RZVA 1A9TA 2W2LD 4GKVA 4HN4B 4P3NA 4TM7A 4LZWA 3GOQA 3LOQA 1V0JA 3QSGA 4LGCA 2HNBA 3HVJA 3CXRA 4LSMA 5IM4F 4WD3A 5A4FS 2QRQA 3GVIA 3GA5A 4RV4A 4LYEA 3SVZA 4HEA6 3GRVA 2YZNA 3DV2A 4EG5A 1U7HA 3DVRX 3AHGA 2G82A 3QSYA 2PMKA 2CLFB 5KYNA 3WGNA 3DMRA 1XEXB 3NB2A 4GCNA 5C80A 1MW8X 2NUPB 4KPYA 2O8FA 1E62A 1H22A 2DH5A 3TECE 3OJOA 1C3EA 2OR3A 3V7FA 4X5OA 2AJ8A 3GVHA 2AS0A 3IE1A 4I9FA 5B1HA 2H2AA 3IOMA 5ALMA 2FTKE 2X4IA 2B5WA 2YN0A 2F3UA 3VR1A 4M0EA 3GJQA 1MGPA 1WF3A 1ODTC 4OH7A 4A6EA 1HV8A 1QF7A 5LP6F 4I1OB 2RHOA 1SW6A 1XXHA 3OOYA 4K03A 4FCTA 4JLOA 4QOFA 4XSVA 3UJAA 2PUEA 1L7NA 3G8BA 1QGUA 4JLUA 4RVFA 3AP3A 2QMQA 3D8RA 3WWDA 3DLBA 2DU8A 4C0SA 1M34B 4D4KA 2Y0CA 4ZEMA 4KK3A 4LHVA 3F6QA 1QOZA 4GM4A 3A6GA 4Z8XA 2VYCA 3OLVA 2QW0X 3TRDA 1TM5E 1UCFA 2GN6A 4QODA 5UKDA 3CSUA 2GD2A 3DF9A 2PT5A 3A1SA 4XQEA 2PNNA 1JWBB 3C6KA 1X7XA 4Q96A 2FO7A 3AG3E 3MYRA 3WWYA 4B4KA 5IT0A 3R0VA 2B0CA 5E9QA 2UYHA 4IRUB 4JI7B 4S1WA 3NEYA 3VDXA 3QV2A 1UPFA 1X80A 4GTSA 1ZD9A 2GGFA 3DTVD 2TMYA 3NBAA 5DSZA 4IRUA 4E14A 1O03A 1N6PA 1Z2EA 3NAQA 2Z8YA 1ZVJA 5BNZA 3AVXA 2X1HA 2GRPB 5B2FA 4TXNA 4CEIA 4JAVC 4M0PA 3U1VA 5I7OA 1YB6A 3PEYA 4OKSA 4F46A 2PAAA 3CVWA 1UZMA 1V1RB 4EHJA 3F3MA 4W99A 3W6OA 1GN8A 3GFFA 1N4AA 5KTSA 4F04A 3DEKA 2B7LA 5FUQA 1T0IA 3SD7A 2IUFA 2BFCA 3U5ZB 2ATVA 1Y7TA 1DTWA 2ZI5A 1W36D 2WV9A 2LUOA 4AY3A 2VAVA 1WSAA 3MGKA 3CNQS 1J2UA 2J59A 1II0A 2QGFA 2QMEA 4HG2A 4O4JB 2JLQA 1ABBA 1GT91 2R1TA 2O14A 4QGGA 2FR0A 1XQVA 4NOLA 3KOUA 4B2PA 1YZTA 5LC1A 3KAPA 1V25A 2JDID 3O4JA 2GMWA 3CISA 4N0DA 5ADWA 2NZJA 2X6QA 3HUFA 5E2IA 3EVCA 5HRAA 2ZRMA 4BN0A 1XQWA 3WK6A 3GQBA 3B78A 2QX9A 2W5UA 2DEUA 3SM9A 2VWHA 3OZEA 1Z2CA 3VU9B 1WQ3A 4EY7A 3ILHA 1IL0A 3B5EA 4L7QA 3W9UA 4BU0A 2XMQA 3H4VA 1O95A 2OYSA 4QYWA 3COPA 3FRIA 3U4CA 3ZU2A 3RSGA 4PO1A 4C6SA 5LNK1 5F7XA 3DVAB 3ZLUA 1VE3A 4BC0A 1UBLS 5F3RA 1IBRA 2XPYA 2PU7A 3GT4A 4YJHA 4GMLA 2ZCVA 5AI5A 4NDZA 1SA4A 1E9VA 1Q0UA 1RYZA 1XQ1A 2I3ZA 1ZGBA 4W1RA 4Z4HA 1JZTA 3ZHXA 1EP9A 1E89A 3HCFA 3NG1A 1XLUA 4WXRA 3OIYA 4W5RA 4E85A 3PVCA 1MB3A 3W04A 5FZRA 1UODA 1LBSA 4AMYA 5FT9A 1GPWB 1TTTA 1QKKA 3STYA 2CFIA 3BAZA 4GRIA 5IF3A 4RW0A 5LQNA 1K8KG 1ZL0A 3I1JA 2EYUA 2JRLA 2ZJ6A 3FYSA 4F7DA 3SJZA 4GLJA 4BGUA 1PP4A 2Y8EA 4IOMA 1VCHA 2DBAA 4GP7A 1WMEA 5CFPA 3SJBA 3AO0B 1F8GA 3MLBA 3HK2A 1LGYA 3WZLA 4DI4A 1EM8A 2IUTA 4QXOA 1ORVA 3Q3EA 5JLJA 1DBPA 1IN1A 3MWEA 1U0RA 2QENA 3WKBA 1WMSA 3UANA 1KK1A 3W6UA 5C51B 4MUKA 1YR6A 4HOTA 1CKEA 1Y3IA 1PR6A 2O0JA 2A1TS 1KP2A 3BEEA 2ZRGA 5EQJB 1DGQA 5JD3A 2Z9CA 1N6LA 3ZQKA 1MXHA 4L75A 2XNHA 1W44A 5LDGA 1W4RA 3K6JA 4OUKX 3RBZA 4O1PA 2DLDA 2GPNA 2WJ3A 3DBOB 1AUPA 2EWVA 2O1SA 4EW6A 2C2LA 3JZAA 1O1SA 2NAPA 2OOKA 3OC0A 4UHCA 5SY6A 2ZBDA 3C6YA 1TMOA 3CCBA 3DCNA 2ADMA 4KV7A 2FETA 4FGUA 2PZBA 1GY8A 4LDNA 3OCYA 1DV1A 4MS1B 1JAHA 3R3UA 3I3SR 4PNPA 3GZ4A 4EYQA 4LXHA 1T0BA 3GXBA 4JVSA 2VF8A 4L5IA 2FJUA 5I9IA 1VDYA 3MMXA 3P0EA 2PJZA 2GPBA 4UQXA 3KALA 3C45A 3LX4A 4P84A 3NHPA 5KZMB 2HYIC 3MK31 3PUHA 4LXXA 1JMKC 4OLFA 2X1VA 4FKBA 4OO3A 4EGQA 5CVUA 4BMYA 3JYQA 2EEZA 5EY5B 1Q0TA 5LB4A 3AVVA 1XAJA 1BMFD 3B3AA 1JXOA 1YUBA 3NHWA 1ZK4A 1I4DD 3CZPA 3Q7SA 5KI6A 3PC4A 2ZTSA 5K4AA 2M63A 4LNAA 4U2FA 3WLEA 3KVYA 1H6OA 2BEVB 2HRRA 2IEBA 5FBRB 2DWZA 1A97A 3RIGA 2M6KA 2QTCA 2VK4A 3P0JA 5JAUA 5JQGF 4D0NA 1SAYA 4HFNA 1VP9A 4C7BA 2AZMA 3B6MA 1MOQA 3WLPA 3CSTA 1LDYA 4J3NA 4DV3B 1W6RA 1I3CA 3NALA 3WGVA 1RHQA 5FQOA 4J1NA 2OUIA 3BD6A 1UADA 1E3DA 2ZG6A 4D9JA 4BX0A 4CM6A 4YONB 4RPCA 5GPBA 4EI8A 1KZ7B 1UFOA 2LCQA 3IDOA 3K4PA 4O5AA 2QGNA 2PLNA 3K05A 4LC9A 4B46A 4C7JA 2OO7A 1IVSA 4IJ6A 5DNAA 4EYKA 2J5QA 1THMA 1RWMA 2JFFA 1GTJ1 2P3SA 2WD8A 3BGVA 3I2YX 4QJIA 4TMYA 3E37A 1KZPA 4WFQA 2G06A 3VR4A 4C3OB 5JNUA 1E7VA 3CQCB 2VT6A 1I2MA 3DE3X 2ZTHA 2ZDGA 3O8QB 1NW4A 4OHOA 1QM5A 5BNWA 3UT4A 2EC5A 4HF7A 1ADGA 1ZI8A 2C8LA 3CFYA 2I9KA 5GOTA 3VNBA 3G5LA 1SUFA 2RHMA 3IUQA 3C5CA 2EZ4A 3SM3A 1I1NA 3LCMA 1S2MA 1T3SA 2QIOA 3W4JA 1S0PA 4LHYA 3QWBA 1MOZA 1U7ZA 4RPGA 4NI5A 3ONLA 1SURA 1F9AA 4KYTA 3WJ2A 4A16A 4EO4A 3PHHA 4DVGA 3LJ3A 2H52A 3QOUA 1EFPB 1Z47A 3KJFA 3KJNA 1NXVA 1V35A 3QJ5A 2YH2A 1D2RA 3IHYA 1US8A 4MQFB 5ISMA 1EB9A 2CVZA 1IWOA 1BOFA 4UQYA 1EUCA 2ID8A 3FKQA 3I73A 3NPMA 2QYUA 1C0LA 3ORFA 3HRAA 3R6DA 1X9GA 3AF2A 2Q28A 4XJXA 5LP6C 4A2QA 3H9QA 5BWOA 4OQMA 2XB4A 3DO5A 4PG5A 1E96B 4A3TA 3CZ5A 1YI8A 4UTXA 3HP1A 3F49S 4RMJA 1ORWA 5TS3A 3JYSA 3N6XA 3QTTA 5KHLB 3U7GA 3FU3A 4HOSA 4A3VA 4I50A 2ZUDA 4K9PA 3KV1A 1FT2A 5CLHA 1QFSA 4DQXA 3NUQA 2BF0X 1ST3A 4X63A 4H7FA 1XZDA 3ERCA 5BXUA 2NQ2C 1QV9A 3TQQA 3ZD7A 1Z2NX 4HNAB 1N3YA 1CG6A 4O60A 4N5LA 3W2GA 5DW3A 1ZUNA 3JQRA 1WXEA 1QIIA 3FVTA 4ZOBA 1FDUA 1EF1C 4DDUA 3H2JA 5JH7A 1N7IA 3IXQA 1TQDA 2N42A 4FX5A 4Z5XA 5CVEA 2Y1LE 2NPOA 4MV4A 5LOVF 1POWA 3BJIC 3DYBA 3FKJA 1TF2A 2DT8A 1ECJA 1U8TA 1G9TA 1TJCA 1O4WA 2XKAA 3CF6R 3LS2A 2HSJA 4PYOA 1FK8A 2NO5A 3RVKA 5IF9A 4Z51A 3QPDA 5I3ZA 2CMHA 2ZYRA 3OFJA 5CA0F 1TKCA 5DRYA 2R7NA 1WJGA 3HU2A 5ENOD 3DEYX 4HXEB 4MKFA 2GRMA 2GM5A 1Z16A 2PRZA 3KVOA 3LBHA 1JQKA 2NLOA 3HUEA 4UE6A 4HK4A 4BVBA 4C48B 1P2FA 2BCGY 2BD0A 1BE1A 3GZ1A 2J3JA 2QA5A 2VIIA 4RXUA 2QAGB 1E99A 4RD2A 5DKFA 5FI1B 4CKEA 3O91A 1JE0A 1JQBA 4F1JA 1W46A 5JDIC 5AOCA 1IK6A 3H1BA 1WKBA 4HRMB 3HCBA 1E2KA 4R3UC 4CL0A 1YXMA 2BH9A 3M2TA 4ER7A 3BXPA 2XB9A 3L8FA 4NEQA 4PLGA 3UK7A 1KQFA 3H42B 4HRLA 4II7A 4W5HA 4DR6B 2GPSA 2PWPA 2Q6VA 4AO7A 4DV6B 3OKAA 1ODLA 1DBRA 4CCWA 4DX1A 4ZHSA 3D4PA 3M6MD 1KK0A 2YICA 4FONA 1RKUA 4HI0E 2P6RA 2GPTA 3QMVA 2CLSA 1V11B 2NSYA 3HVIA 4S1OA 3PTAA 3UTMA 3E3MA 1UK8A 2ZBPA 1NQTA 1YA6A 1ZIPA 3JTMA 4RHXA 4R71A 3I9V1 2FCAA 3L77A 2VATA 1NM5A 4HLNA 1H8HD 3J5PA 3H8JA 3WLTA 1U02A 5EXEA 3EGCA 1HQCA 5IVDA 1ZOOA 2QXTA 1QYCA 1K4YA 3M4JA 3QEBZ 1X77A 3O2NA 3BRWA 3R6TA 1YJ8A 2FK8A 1LLCA 3IRUA 1Y4ZA 2ZB7A 5EEGA 5HKBA 3G2WA 1P1IA 1UBSB 3GWZA 3I30X 5KNBH 2B0OE 1OSNA 5ENNA 3GBSA 1BFDA 2R5FA 3SKYA 4KO8A 1AX9A 2I2WA 3G2UA 3UJ8A 5A3QA 1D6JA 3R7RA 5AW4A 1REQA 3IB3A 2W2OA 1ZCBA 2X6JA 2AI2A 1HOTA 3BXGA 3GAAA 3MT9A 4RK7A 1F3LA 4U5XA 2V0CA 4XLLA 3ROXA 2IODA 2ZBVA 4IYPA 1KTVA 1XZAA 2BEKA 2C9MA 2JFVA 3GLUA 3PXDA 4Z0TA 3ZCRA 3A3YA 1JBEA 3E9NA 3OICA 4RVOA 1E2DA 3A9RA 3ZJVA 1U7DA 3BD9A 3A6LA 3WSWA 5CDUA 2IXGA 3KEMA 4GLOA 1NJ6A 1YFKA 4E5SA 1GZSA 4RGQA 3OURA 2QX8A 5E8JA 1GQOA 2Z3WA 1XI2A 3VR6D 1MX4A 2KM1A 3GPDG 4K9SA 4RGVA 4ZCLA 1I7DA 2BZ1A 4LWQA 4DA4A 3APCA 2FUEA 3ZVVA 1TK3A 2PWAA 3ADOA 4LNUD 3ICCA 3LUFA 4NULA 4WK6A 3EG5A 2I6QA 4OBEA 1TC2A 4UBLA 3ZNNA 4JEUA 3QUQA 4K6MA 1H2RS 2CEKA 3RQIA 4LRXA 2R4UA 2I6HA 4W7SA 4EGCB 1PW5A 1PG5A 5B3JA 3UWOA 2IHNA 4CKCB 3ZUGA 1T0JB 4B9AA 1G41A 1JPNA 4FC7A 5E9AA 4B17A 1XU4A 1W5TA 4D26A 1H5UA 1MFZA 4EKGA 2ZP1A 4WKBA 5JADA 2BGTA 3RWBA 4XD2A 3KQQA 1IZ9A 3AFIA 3B53X 1G60A 5AVOA 1SHKA 3DXXA 4Z99A 1EVYA 3SKXA 1QBQA 4OLJA 3HN6A 3GRAA 4L23A 4LHSA 3IHTA 4ILGA 1F2TA 4NONA 4PN3A 4DR4B 1EWQA 5JS1A 1U9ZA 5EGSA 5K8JB 3BXFA 1IOVA 3S1LA 1MV8A 5IM5A 3S81A 3VU0A 5F23A 3I37X 4FLMA 3W9SA 1GILA 4JXKA 5F2KA 3HXDA 2C7PA 2GBLA 1MIOB 3FSRA 3KTOA 1IB6A 3SLKA 1L7QA 1IHUA 3N76A 2DLNA 1TA0A 4P80A 2AKEA 1ODFA 2J3MA 3DTVB 2B1RA 3FMPB 2VBIA 4EHHA 1ZN7A 3ZHEA 4YCCA 1PS9A 2HWKA 2EFCB 1E18A 4PLFA 1ZGCA 4MKXA 3NYRA 1MG5A 3CEMA 2GEBA 3EY9A 4TQAA 4W8GA 2JFBA 3QF4B 4G63A 2XADA 3L4KA 1DNPA 1O94A 1I13A 2YFKA 2ZI4A 3DFFA 5DNDA 3VC2A 1FYVA 3LGAA 5A4AA 2O57A 1TF7A 4TV9B 3RHFA 1P4HA 4H08A 4DSUA 4NAVA 1ECBA 5KS2A 4O4LB 4YY3B 3KAQA 1M0SA 3SJCA 2O1XA 1WDWB 2ONYA 4KT6B 2VEOA 3I83A 4Y1RA 4HJRA 2Y69E 4GCOA 3BUAA 1N0QA 1A7JA 1L4MA 4Y2HA 5DCYA 4JDUA 1NHWA 5GJVC 3KT0A 1GL6A 2V3WA 5FD8A 3Q4GA 4IPTA 4JD2G 5DO9A 4ZFHA 2ACVA 1GHTA 3WNQA 1HF8A 1WWKA 2NU7B 3DEHA 5JMPA 3UJ3X 5A23A 4G07A 2OG1A 1HFAA 1KMNA 3FOWA 3F1LA 4V0RA 2NU7A 5JJCA 4FWTA 4JXXA 1IY1A 1X8XA 2OO5C 3GEEA 4M0UA 3SQVA 1OY1A 2VSXE 2V0GA 1I0LA 3KB1A 2YS7A 4R4JA 2PSEA 4KQKA 5BT9A 2OZLB 1Y6GA 3HH8A 5FIUA 2XODA 4UBMA 2P9KG 3PXUA 2HKIA 1T3HA 1QTNA 1Y7LA 5AO9A 4TZ0A 4WZBE 1YONA 2JBAA 2XUAA 1XBTA 3I3NA 4C03A 3I6QA 3OQJA 3OWHA 1K8QA 2AF3C 2RG1A 4F85A 4BJ6A 4EQFA 5CTAA 1YBAA 5FL7A 4D6XA 3KLBA 4BE7B 1Y4SA 5BWLA 4GSYA 1NRWA 1OHHA 1PN3A 2WUDA 4RTRA 1XAGA 3SF4A 5C8DA 2IH2A 5JZMA 1GAXA 2NUTA 1AHIA 1SZ9A 5CBPB 2CSXA 3RYFA 2FRXA 5AJVB 4M9XA 2BRUC 2AW3A 2FH5B 1RLUA 4BMOB 1KVRA 1A04A 2C9ZA 1DCMA 4FMCF 3T5TA 2MRIA 1UJ5A 3GEPA 2KCKA 3I2GA 5HM8A 1EBFA 1X1DA 1O8CA 1QNFA 5C1IA 3FU0A 3ZYCA 2GH1A 4L8FA 5H7PA 3W9YA 2Q29A 4L9SA 3I28A 3GGJA 5KNLA 3G7UA 1K5DA 2HK8A 4C2UA 2J5RA 2PGLA 3X2SA 2OFPA 2OO3A 3EIQA 1W34A 4HMPA 4RZ2A 1TO1E 4U7JA 1A4IA 4G1EB 4UPDA 2ZWMA 3L8ZA 5C31A 2G6BA 4B7CA 5JA4D 1SQ6A 3HB4X 3KB2A 4G89A 4K81B 4WVFA 3T5PA 3LQYA 4ZEVA 4B4OA 3TNYA 4FI3F 2DBZA 3KP1A 1GFZA 2WTUA 3E1KA 1DIBA 1YQQA 2IONA 1JR3D 3I53A 4PRZA 2RFMA 3KXPA 5EESA 1E8DA 5KYVA 4APFA 4XKBA 3NFYA 4HNUA 2WNIA 4TKUA 5DE3A 3WL6A 5JCXA 5CIYA 2FMTA 4O6FA 3ML8A 5JG7A 3AI1A 3HEBA 1IVYA 1TVKB 3ONKA 1UFRA 4QJBA 1LCIA 4Z4FA 4HX5A 2LE0A 1VLMA 5JZBA 3D6VA 3RO7A 2E4YA 4DGSA 1KVQA 4Y2TA 5SZIA 4DBZA 4REQB 4XKCA 1DUSA 1FJ2A 3EVAA 4RIIA 2JCSA 5LB2A 2G72A 4Q47A 4QC2A 3UKRG 3HCWA 4PNZA 5JO0A 2WKQA 3ROKA 4IDDA 4EDFA 4Z49A 3OM1A 3QKRA 1VZ3A 1NMSA 1R1DA 2WBLC 2ZYTX 3ROFA 5DTJA 5A04A 2XZTG 4WWNA 1C1XA 3MCWA 3UNXA 5KJ6A 3CPEA 3QI7A 1NLFA 3ROZA 2EP5A 1E59A 1GN9A 1WABA 1WETA 5IC5A 2IBSA 2JAOA 4EELA 2J3EA 1DQYA 1RM4A 1C0EA 2NIPA 2DR2A 4V1CA 1RYFA 5FOQA 5B37A 5CYPA 2IPLA 3TRIA 4YMLA 2OORC 2W0SA 4E3ZA 3H3XA 1NN5A 3B2QA 1ISMA 4PLHA 4RF2A 1YS2X 4HS9A 1Y82A 5ENSD 3IQEA 5ERXA 4BWGA 5BW5A 3HVEA 1FTYA 4RJTA 4ND3A 1TNZA 4GTRA 5H83A 4DC0A 1YK0A 3TRHA 2I0FA 5HFJA 3HVEB 3P8ZA 1KY3A 1TXGA 2R25B 5AP9A 5F9FA 2C9OA 4INJA 5EERA 4MWCA 3THSA 3UC9A 1NC1A 3KB8A 5FR1A 4ALNA 4AG6A 1Z5NA 1AUQA 2HT1A 1ZN8A 5FUWA 1OX4B 3FAKA 3FYTA 4H4EA 5AI4A 3PHGA 3A4MA 1QRAA 5CLJA 4FFRA 4WA7A 2G70A 3DAGA 3KHSA 1L9XA 5ALDA 4KODA 3ABME 2W70A 2A59A 4B3FX 4RMNA 1E79A 3QELB 5AVZA 2YRWA 5KVVA 1LNSA 3ASVA 1IBLB 5TLSA 2GM3A 1J2YA 2YV5A 1U1FA 1MV5A 1GRQA 1QQ7A 3IHLA 3ABKE 4RJLA 4MW9A 5KTMA 1G2IA 5DNWA 2PIDA 2LSUA 1VSQA 1GPLA 4L2YA 4ROTA 3Q41A 1QGUB 1IMOA 4M37A 5A6VA 1Z5VA 2BGJA 3PI7A 3QE3A 3AB7A 4MTLA 1M34A 2JGJA 5CRIA 3HXBA 3MGGA 5AENA 3BMOA 2YXNA 1YRYE 2WUWE 5IDVA 1BC5A 4A73A 1DIAA 3AI7A 3BWXA 1NMQA 2BAGA 3P26A 4XVQA 3RTBA 4X60A 5KWIA 2FRDA 5D0OD 5JYEA 4ODIA 3BJRA 4FADA 3R7NA 2XAUA 2QXYA 3PL5A 3ABLE 3C3PA 3WY9A 4V1CI 1SOVA 5K5EA 3IVMA 2HA7A 3FTEA 3TFOA 3WADA 3SZUA 3ITKA 4QWMA 4J2HA 4E5YA 1YS7A 5FWYB 1FLDA 4KSBA 3A6DA 2PUBA 3GJRA 1S8FA 1G3QA 2IIBA 3DM9B 4PCLA 3K9GA 3VR3D 3JQFA 1TYCA 2YQ5A 3HEAA 5BSWA 1G5PA 3QIAA 4PU0A 5AVKA 1KZHA 4NR0A 4GBED 5GZ3A 3KQKA 3NHRA 5ALSA 5CU7A 2G7ZA 5TMEA 4UREA 2VTVA 5TQ2A 1S70B 1QGOA 2RGNA 4CCAA 4ZVTA 4BETA 2J3LA 4EKDA 2ZGVA 4B85A 1E1CA 2YJNA 3CR8A 3H1TA 2BFCB 3NU1A 5AM4A 2J4CA 3SS8A 2YXBA 3KS2A 5KAMA 2P2GA 3MLEA 2E37A 1SG0A 1ZK0A 4PIPA 3F5FA 5J90A 1K4KA 4K5CA 3I9FA 3WK5A 3L82A 1UM8A 2Q45A 2V5QC 4HQNA 1QHEA 1YMQA 4MULA 3CO5A 3RSQA 5BSGA 1ZGHA 4JFAA 1OWMA 3FMOB 4LVOA 3D8HA 1JB1A 4JYPA 4E30A 1JWGA 3NVDA 4QQKA 1OH5A 4O2RA 2I7VA 1YMVA 4GQIA 2HIGA 4QYXA 2X8BA 4P4SB 2E6UX 3HXPA 3D7KA 1Z2DA 2DGDA 1P3Y1 2HUNA 4Y6LA 4MS4B 1I6LA 3FFAA 5A4MS 3MV2B 3B3QA 1GW6A 1TYDE 4QVKA 3B7SA 3ASFA 1B0ZA 1SELA 2JL1A 1ZK3A 3N75A 4FOLA 2WT4A 1V4BA 121PA 1Y81A 4HDNA 5EFOA 2VH1A 4EVQA 3NXKA 1KMCA 1ZLYA 3UINC 1GG8A 1NI3A 1VBFA 2M98A 1NQ5A 4R0VA 1KT1A 1RKQA 3H13A 2IYAA 4RVUA 4FGWA 3T5XA 2AG6A 3KDAA 3OEHD 2N46A 4JKIA 2GRLA 1YKFA 3DE0X 4Q3EA 4DWVA 1UPUA 2K7ZA 4TKZA 4BQOA 2CXTA 4ENSA 3AFOA 1X7YA 3DCIA 3IAEA 1BS9A 1SG9A 3GVPA 3JZIA 4OGWA 1UH5A 2HBRA 4JSYA 4BKQA 5CM2Z 4DWWA 4F56A 5TY0A 1Z0SA 1WBDA 2RB4A 3WGLA 3KJXA 1Z7BA 4IHKA 2VJMB 5J1TB 3KZXA 4EJSC 3CLHA 2VYND 4IDGA 4GWLA 3FNRA 3Q47B 1C9MA 5FFFA 3F7TA 3H0EA 2ZYVX 1O94D 2GRNB 2CYCA 1Y9EA 1WPRA 1GAEO 3IRVA 3OOEA 2VXCA 3HJUA 1DDGA 4ND8B 4XGNA 3VPFA 2CF6A 4FP7A 4EG4A 2B4KA 5AH0A 1U0HC 3BMXA 1II9A 1X3SA 3ESDA 4OHBA 4X1OA 5JYBA 1U5BB 2Y4TA 2OM6A 4HTFA 2XEHA 4V2IA 1M5RA 4CG3A 1N3IA 2VP9A 3MKRA 1TL7C 3LKVA 3BWEA 4D96A 3PQ4A 2DETA 2I7TA 3I6MA 4EPRA 4RPJA 3ECAA 4G56A 1GKUB 5FNVF 5SYAA 3FAZA 2FPGA 3V7NA 1GG5A 2AK3A 1D2EA 4EF4A 5ANLA 5T64A 5KWEA 3S8YA 1RJDA 2JCGA 2I6UA 4PGHA 3MT8A 3GQBB 4G9GA 1PGOA 4BLUA 2RGAA 2VK8A 4RD0A 5JNLA 4BRSA 3IUPA 3V31A 1VLLA 4FJZA 1Z0KA 3N28A 1DDOA 1E6UA 1GSOA 1V2GA 2Q3EA 4JLMA 1Z2OX 1L5YA 1PL7A 1V5IA 4J0CA 4ZWNA 3URMA 2OFFA 4YRSA 5LL6P 2HL6A 4GKAA 4UUCA 2ZYHA 5K0CA 4OP1A 4MCJA 4J0JA 1DXOA 1CR6A 1SC4A 2CHWA 2V7QD 2J46A 2W37A 1HE1C 5TB5A 3ZDRA 3LQFA 5PNTA 1V39A 1JDJA 1SCUB 1U9IA 1TZMA 2PAFA 3W8FA 2B5VA 4HDCA 3T3DA 4BVKA 3S7JA 5CECB 2J6IA 3PR1A 4M3NA 3C7AA 1NBMD 2ERXA 1VJGA 2H2FA 3JAKA 4IICA 4WLVA 3FGOA 1FOEB 3AESB 5EUQB 3UWDA 2GYUA 3G0CA 3HY3A 4KXLA 5INTA 1Z7WA 3DGFC 3ZU4A 4P4TA 3PEVA 4OJYA 1L3BA 4U0JA 4PQYA 4CQJA 3FCXA 2UZ3A 1FTNA 2I54A 3LKZA 3VSDA 5LQJA 5DP1A 3PYXA 2ZYGA 1EJ2A 1QZXA 1M2NA 3TWSA 4YJ2B 5FQ8A 2DT5A 1BVRA 2D7JA 2Z6VA 4ROSA 1OXKB 2P0EA 2Q50A 1TO6A 3QPWA 4L3OA 4L3VA 2W2TA 4F06A 1Y3HA 1NV8A 4HUQB 3RSEG 1C3OB 5HX7A 3KKNA 2B1GA 5IVPA 3R5KA 3GA0A 4TQUS 4UM5A 2ZJ5A 1DBIA 3V5NA 2QPTA 1J97A 3ZHQA 4Z6KA 5EQDA 5JCJA 2IYTA 4LK3A 3AOEA 2WHEA 1U8YA 4QUGA 5CLGA 3WWZA 1WB9A 2RBEA 1N32B 4YI5A 4R0MA 1FA9A 3PX2A 4Q3BA 3LVFO 1C41A 4YUXA 2A9JA 3JVDA 3H75A 1NUTA 3FH5A 1YVEI 4PYNA 3AU4A 1NZJA 1Y5MA 2ZU6B 3QMPA 4CMIA 1M7BA 2ZRNA 2PKWA 1W94A 4J49A 5DOZA 1TM3E 5AXBA 4N7BA 5LLDA 1VXRA 2XSZD 4OHYA 3DB2A 1I32A 3M5CA 2JA2A 4EHLA 1GEEA 5CAEB 3EPPA 4RM2A 3E03A 1UXJA 1UFVA 3ZKAA 4YCMA 1ZOPA 3PGJA 4J0UA 4LRZA 4WOKA 1K88A 4IX9A 2UU9B 2J8SD 5LDHA 5JNRA 3AI3A 3OKCA 2CLLB 3OCVA 3NEJA 1XKTA 3FBGA 4L9RA 4PIVA 2FSFA 2EV9A 4KMMA 1BPOA 3U64A 4JELA 5CB4A 2JIQA 4IS2A 1A4RA 3FUDA 4CM4B 3V8MA 1HG1A 2ZSHA 3RYTC 3OQMA 1Z75A 2E7ZA 4E94A 4ZHQA 1TAHA 2OHJA 2RKKA 5BQPA 3OP1A 4G6ZA 4PPGA 1QIJA 3TIXB 4IHJF 4EA9A 1D8DA 4PC2A 5CMLA 2OQRA 4B3SB 2WSYB 3NHAA 3B8EA 3B8HA 4HDRB 4XWYA 3VR6H 1JWLA 1XCOA 3C3DA 4FFNA 3QLVA 3U0BA 4RY8A 3OJXA 4CRWB 2J41A 2GN1A 1TYEB 2NOAA 4NFHA 4EYGA 1YHNA 2GSDA 2W6PA 3LDAA 1YB4A 3GOHA 2R96A 4BUCA 4YH1A 4R7LA 1JHOA 2VQFB 4H9GA 3LPLA 1AK2A 2P9HA 3AR2A 3EGIA 3EODA 3CK7A 3H5AA 3BXOA 4OBBA 5AW8A 1IZ8A 1K92A 4MDHA 5A62A 2OV4A 2JI4A 4AO6A 5DGXA 3NO4A 4GMHA 4LJRA 2PM8A 4DPKA 1C30B 4O08A 2NPFA 3UUFA 3NYWA 1X7WA 1Z56C 4L4XA 4M60A 2DQZA 1JR2A 4LISA 3GZNB 5D5QA 2Q1WA 4XFJA 1PNTA 3BCHA 4JJ4A 4X92A 2BKLA 3C3KA 4BAZA 5IW8A 1E96A 1P2BA 1Y9AA 3IE0A 5CVDA 4E2WA 1O96A 1G5IA 3CR7A 4GLBA 4LNUA 2QU8A 1PIWA 3EH1A 3F6YA 3E1GA 4H27A 4J8DA 3CIAA 3N2GB 3DKPA 2O0LA 5AAOA 4U3JA 4KFCA 4MMXB 2A57A 1YUNA 4O59O 4U0UA 3KZMA 2JLZA 4MINA 3VJRA 2R00A 1FFGA 2QUKA 1G8JA 2V0PA 1Q19A 4GEKA 1H8ED 1FQOA 4QM7A 1QCDA 1OROA 2CMFA 2HNKA 1TW3A 2W43A 2X3FA 4BKMA 4URZR 1H1TA 3UEOA 5I8PA 4QL3A 2PYZA 2AKAB 4G4GA 3BEDA 3K0CA 3O1JC 3V4PB 2BEUB 2R8OA 1ZXBA 3VR4D 2C7QA 2OMEA 4MIKA 4WFJA 4XUGB 2A78A 4YDHB 5CT8A 1SU6A 5JW6A 4FYKA 4X8QA 3WLLA 2JH9A 3RRJA 2TMDA 4RSMA 1PQPA 4YNBA 2MYOA 3L6OO 5JEDA 2XF8A 4C89A 1BMFA 3G2NA 3KJQA 4FGKA 5KYUA 3PGXA 1HS6A 1OCOE 1QHHA 3B51X 4Z4CA 2OXFA 4NBWA 1FCHA 3MMZA 4C0XA 2JH8A 1R5JA 2YFQA 4QICA 4WZ6A 1A9SA 1QIDA 3DOCA 2XVAA 5HRCA 3QG5A 2XH8A 4HUTA 3I45A 4OSPA 2B94A 1U0JA 2QRZA 2XHZA 5IDYA 5B5SA 3JQ7A 4C7OB 3WHPA 4XGIA 1F5NA 2BJHA 3L46A 4B44A 1ECCA 1PR5A 3TLBA 1M2OA 3LKDA 4B47A 3OPYB 3AINA 4RE5A 1YZFA 3K0AA 1P31A 3EAQA 4M7RA 1NUSA 4MV7A 2CNKA 4BNXA 1TECE 5AQ9A 1KAHA 1V71A 2AQHA 2Y1LA 4J8SA 2F3SA 3JASB 3LWNA 3MWKA 1K9SA 3K6RA 2YTZA 1W5AA 3T7KA 5FV4A 1CIPA 1V11A 3G13A 3BFKA 2EIJE 1HA3A 4L15A 1RXYA 4LJ5A 5EIFA 1I2AA 4BFVA 4R5HA 3GVXA 2VJQA 4GEGA 1C9JA 1XYYA 1Q50A 5H68A 3AEUB 3G1TA 3L6CA 1MAAA 2A0KA 4P1ZA 3K96A 3UZUA 1YRQA 3GLFA 3CURA 4MWGA 4BJ3A 2Z1MA 1J0EA 1V7QA 2HXSA 2R9VA 3IAS6 3ECCA 4G5XA 2VQSA 5HZHA 4F3RA 2XVZA 4C4RA 2PH1A 2WJGA 4LOLA 1QAOA 4MKTA 2P9IG 1PQUA 2ADOA 2ICAA 1V6AA 4PONA 4XWGA 1J24A 3THWA 4IIXA 1KYQA 1L7VC 3HS3A 4HGNA 1O94C 4BVLA 3GELA 1NG1A 3NHMA 1MJHA 4JBYA 1Y6ZA 2BZGA 3K70B 2D1RA 3CVVA 2W2MA 3WQSB 4CL3A 4ZYXA 4BVEA 4JXTA 1TCBA 1K6XA 2Z3VA 3NM5A 1MRZA 1QQEA 1A5SB 2HF9A 2NSDA 2WM2A 1LZKA 3HVRA 1FVFA 3QKIA 1INLA 2OHFA 1HL7A 2CMGA 3Q7IA 1OF1A 3PNPA 1CQPA 4GBMA 2J6CA 4L50A 4A3SA 5FWAA 4ABYA 1B16A 5I4KA 3NNDA 2ETVA 4DJDC 4JUDX 9LDTA 3AKEA 1AZSC 2BFEA 4O4LF 4TV9A 3UF0A 2Y27A 4LCBA 4DMGA 4B73A 4WACA 1GG9A 2OCIA 2J9XB 1EX6A 3GX1A 4KYVA 3QPCA 2W48A 5E4JA 3TI7A 4BX8A 3AS5A 3S68A 3EDMA 1R12A 2J0EA 3IEMA 2XKKA 5JC8A 3E82A 3WYDA 2QVBA 3T9BA 3H5NA 3UATA 4NLLA 4FYMA 3TSWA 2VDRB 1R6AA 1RWXA 1GCOA 4NCHA 3UWKA 4CKCA 4MZXA 3PD1A 1Z4LA 1JN0A 4MKGA 3NIDB 2SKCA 3OMWA 4O6VA 2UUOA 4LSGA 1MENA 4D4MA 5CG1A 1T36B 2GNAA 4JC8A 3NS7A 4NZNA 2ZVDA 4I3HA 3X44A 1QO0A 3K53A 1EXWA 2Q4DA 1T1GA 2QHXA 4L07A 2C77A 4L5CA 4UHHA 3LUPA 5J5AA 3H9EO 3TNJA 1RXVA 2ZU0C 5LIRA 2I2OA 3PXAA 3MTJA 4LZNA 4CYMA 1RRMA 3L43A 2J0VA 5EJ7A 1LS6A 3QFSA 2WIFA 4JLPA 5ALXA 1XCJA 2VEDA 4HT3B 1E8MA 3VR5H 4MV8A 5CVVA 4CEHA 5LUBA 4DT1B 1U98A 2DYKA 2D1SA 4Y2PA 4I2ZA 4J6FA 4ZPXA 1P7PA 3KSMA 2GCEA 5H16A 4FDTA 2VP4A 1N6KA 4Y1EA 4X66B 3VZBA 3ZHEB 1BS2A 2RMKA 1XQ9A 1G42A 2GNPA 4POAA 5FAKA 1TVMA 1CRQA 1YCSB 3BRSA 2QUHA 4CU2A 3KXDA 4UBJA 3ONEA 4DLRA 4LCEA 1RP7A 1N6IA 2FW1A 3AHIA 3L8DA 2WWYA 5JNWA 3OQ6A 3D2BA 4AF6A 4B8ZA 1XVVA 2X4GA 3EXG1 5DBHX 3UAOA 4A1OA 3PIIA 1B3BA 2ACEA 4UJ5A 5KWSA 4GA1A 1A9QA 3M4NA 4BQPA 4GL4A 2P1DA 4R1OA 4W8OA 4LJAA 1X6VA 3GPBA 4JC4A 2LWIA 3F7OA 4YFYA 5DN6D 3WWPA 1SCQA 1ADFA 2A9RA 4WCFC 2YMLA 1BE8A 3I04M 1FJHA 5KCMA 4A1GA 1AKYA 1HE8B 1C0KA 1Q22A 4DLUA 4ZZIA 1N95A 1T10A 1F6WA 3EXEB 3TE6A 2H2IA 1P5RA 5LQRA 1YJXA 1KOGA 2R00C 2P9UG 2XCQA 3EXEA 1WNFA 3VLFA 4TRRA 1WU7A 4L5JA 1TRKA 3KTFA 1F9EA 3PIDA 4L5AA 2VAMA 4RKWA 3I4CA 2V8SE 3ZOZA 3A1FA 3B9PA 4BNTA 4QTYA 2X4LA 1H2VC 4HLUA 4PAQA 3HNRA 3PD0A 4X95A 1TT5B 3H97A 3OD5A 2W93A 4EW2A 3E9ZA 3LV8A 3L6UA 1T0UA 1ORIA 1GR0A 3FD8A 4AZWA 5C5CA 5FOTA 1RWBA 4NMLA 1TNDA 4L73A 3C3JA 5JS7A 4NKRA 4MUGA 5EOVA 5KJMA 4C08A 5KDDA 1Z39A 4NBUA 1T6ZA 2BEDA 1L3CA 1MCZA 2GRQB 4N0PA 2ZUEA 1QU3A 1EIZA 2DVMA 2OZKA 2VAXA 3RJ5A 3JQ0A 2BBTA 3A9VA 4B3BA 1GKIA 1K3ZD 2ZOSA 2Y68A 1F7VA 1CUIA 2FPLA 1YZGA 2I1QA 1Q0ZA 3LZDA 2R1ZA 1S02A 2QPLA 2RHBA 4LOIA 5BT8A 5JECA 3KD2A 5GIOE 1A7UA 4QECA 1T9DA 1NSYA 3H65A 3OLZA 4Y2RA 4GM0A 4UASA 1IRIA 1POXA 2MYUA 2D3TA 2CE7A 2D1TA 4HRVA 3JYPA 4PFJA 1DIGA 5IBQA 1IDN1 1UPTA 1YIDA 2WINI 4TSFD 1OXTA 1C5KA 1Z82A 3C6BA 4F0JA 1HFWA 2OK7A 4BNZA 5IANA 1L5QA 1RJEA 3CEQA 1ULSA 1KKMA 1H69A 3FSEA 1YS9A 1O95D 3ZY6A 1SCBA 1XAHA 1SUWA 2NO9A 4H3HB 3RJZA 4Q02A 2E49A 2ACKA 5B6PA 4HWTA 1BQ3A 1ORHA 1SXPA 1LLQA 3M49A 4RSRA 4LBYA 3RVPA 1EWRA 2O3JA 5BN1A 5GV7A 3U4AA 3KL4A 4NG5A 4ATGA 3K31A 3PK0A 4JBNA 1DELA 3PT9A 1SB8A 2I76A 3BX1A 3C6QA 2ZRHA 3JZMA 4D3XA 4BY6A 1U28C 2Y67A 3PWSA 4TVKA 3ML9A 4FR0A 5DSTA 5DTIA 4CG2A 4ABNA 4F5WA 1RQPA 2IYZA 1ZXLA 2B34A 3GJ5A 4JHXA 3INTA 2O5VA 5KYGA 1JFVA 1ONNA 4MDEA 4E31A 1DEAA 3K9IA 2WE8A 1UFKA 1OYYA 2ON6A 5T41A 2D1QA 1GTMA 3WIOA 3G3EA 1E6EA 3EJ6A 4EVIA 2HJVA 2VH2A 1MO4A 5LWQA 1GRNA 5JALA 2BM9A 2HLPA 3OC6A 1JDTA 1MAUA 4BO0A 3LY5A 3K20A 3P0FA 4JGIA 4ATNA 2XGSA 2JDIA 5KYWA 1ZD1A 3GCGA 3K73O 4J1TA 3U4HA 4LF7B 1UT6A 1TJ5A 3I4LA 2RC5A 1C80A 3NYIA 3UG6A 5LM3A 5JTUA 1HMYA 4HFGA 1RE1A 4XEUA 4EPVA 1M6NA 4UUAA 4OFBA 2HMVA 4KBYA 2HQBA 2Q3BA 1L5OA 2O2XA 3OSZA 4MUYA 1GPDG 1DIHA 4F3KA 5B30A 2P9BA 4C07A 4CHGA 1EUZA 5KB3A 1ZR2A 4INAA 1CUUA 3UT8A 3MILA 2D0PB 3TSYA 2GS9A 2PWBA 2AYZA 3LKUA 4AUMA 4Z3DA 4BESA 1YS1X 4PXSA 3PKJA 3L7NA 5F2OA 1E4EB 5DYTA 1ACMA 1FSGA 1A8IA 2F55A 1BA3A 2ZS8A 4K1XA 4EK9A 4ON9A 4C0AC 1WZUA 4CIVA 1C4WA 4P58A 1AKNA 1TA9A 4HB5A 3U5TA 3L1KA 1C50A 1UXOA 4C3VA 3IQFA 3W7VA 4LJ8A 5AJWA 4J0GA 5BWBA 3A1VA 4B40A 1CNMA 4K9MA 3JSXA 2ANCA 3ZTWA 1L5VA 3ITNA 1G21A 1NIPA 1JLSA 1XTPA 1Z45A 1XEXA 2WSSD 4PQRA 3S2GA 1RMYA 1ZNZA 1QHFA 5LFAA 2NUPA 2BF7A 2PGDA 3FF4A 3KQWA 4LA4A 4MWEA 4XA8A 1USUA 3BJEA 4BNKA 5C52B 3ASDA 3UAGA 3KPVA 3UQZA 4UWLA 1MDBA 2QRUA 4TLLB 2YJTD 1I6MA 1IATA 4UWFA 1UK9A 3DM5A 2JI8A 3GUHA 2QOEA 4PLWA 1GRRA 4ZYTA 3NVKI 5HM6A 4ENRA 3VHXA 2ZEJA 3KLMX 3KEZA 2CG2A 1SKYB 2MSDB 3D9OA 1USVA 4I6JA 3DV9A 1YL7A 4LV5B 4TTTS 3ML1A 3T12A 3LDFA 4Q4HB 3PE4A 3GLRA 4QNMA 2WJZB 2GBFA 2ORWA 2AVPA 1E3JA 4YEDA 4GD3Q 5AJDA 5E38A 3WLAA 3CRZA 4YQYA 1HNXB 1HURA 1K06A 5T4FA 1NFFA 1EG2A 1NP3A 3Q2KA 2AJTA 2HSDA 3I09A 4PCUA 1ZISA 3ZDYB 1P4RA 2RSLA 4MUEA 3WRVA 4AMZA 1N5IA 3QU5A 4EG3A 3E9CA 4E1VA 1WM5A 4OGGA 4G41A 1QFZA 1XKXA 3QVVA 4DDMA 3OO0A 4ZCMA 3TIIA 2XYRA 5F3DA 2ZPTX 3LQ2A 3DHEA 3SFYA 1A77A 3LLMA 3OETA 4ZVMA 4KSCA 4A6PA 5AW9A 1WBJB 2WM9B 3N9IA 5HKOA 1QPGA 3GO4A 3F9RA 4O25A 1GTRA 1GV0A 3A6FA 4LF5B 2A0YA 4EBAA 1CNEA 4QTUB 3DDOA 3VC1A 3HKEB 2I8AA 4EA8A 2MIIA 4X0EA 4YHHB 2QP3A 4I6GA 1X7ZB 1L5JA 4PR3A 5KEIA 3VLDA 1FX0B 3N74A 3GPLA 1JJFA 3JCKC 1M2WA 4KKXB 2FOIA 1CJVC 1E2MA 1L5RA 3C14C 1NU8A 4ZKEA 4N5QA 5CPBA 4GYOA 1UR5A 3QC1A 3QKTA 1J20A 1YB2A 2C5HA 2IYQA 2QLBA 2XMPA 3ABSB 1ZWKA 4MNTA 1AZWA 1J9EA 1FP4B 3KEQA 1Y3DE 4B7XA 5M34A 1BXRB 4G1FA 3QHAA 2PYDA 4HL6A 5FTNA 1M72A 4R9NA 5GJBA 4HXIA 1JR3E 4LK2A 2R1TB 1YJBA 1DT5A 5AM2A 1D6NA 2AA3A 1ANKA 1XVIA 5L3SA 4FBGA 4J43A 2O05A 2GXSA 3LYAA 3NWBA 5DZSA 1U99A 2C54A 3ENNA 3HZHA 1TUGA 1BLXB 3VLEA 3P4UA 4NIMA 5ESRA 4L1KA 3PTLA 4P4SA 1D4ZA 4UHDA 2CT8A 5TGZA 2HU5A 3Q87B 4EHBA 1TCVA 2ZT6A 3NIFB 1BU9A 4C0HA 3OUTA 4OXYA 1M8JA 2C4UA 2XDWA 4Q3AA 5JPIA 5CXUA 5HSGA 1OB2A 3GK3A 2I91A 1UC9A 2IJGX 4BAUA 5FDFA 5HI7A 5JO9A 3VBEA 3OXFA 1ZL2A 2BISA 3EA5A 3GFTA 2R2AA 3IO5A 3DQQA 3WIDA 5K09A 2WYHA 3ABQB 3TINA 2YXEA 2VK2A 5DULA 2MSWA 3PNSA 3VOAA 3GNSA 2FHPA 2NO1A 3P2MA 5AKZA 3WIUA 5TE9A 4D8YA 5EJ2A 2FEAA 2YWBA 1P9RA 4JI3B 1TW2A 4EG0A 1G17A 1QORA 4JDPA 4K86A 3IBCA 3HXFA 4YNDA 2FPMA 3CV0A 1VGQA 4N0QA 4CKBB 3L40A 4MGYR 4A6DA 2FWMX 3CWCA 3N70A 4UTOA 1YULA 1VRWA 4KACA 2WMOA 4KAFA 4A7PA 2WJ4A 3FFLA 3NBNB 4GVXA 3HJGA 4NX2A 3L9XA 1A9XA 1W36C 2YHIB 3KOOA 4WXHA 2GM9A 3DR3A 1BRTA 1EM8B 5P8WA 4ZJYA 3RD5A 2WLSA 3ZGZA 3UCEA 3NBXX 1YBVA 4FOTA 1NBAA 4CZ2D 2EU8A 1IMJA 3FPKA 3TFWA 3B20A 3HKDA 4KJXA 3MJSA 2OQIA 1R8YA 3SC4A 1AHNA 2WXOA 5AI9A 1SXGA 1T9KA 2QJWA 3GH1A 4RA6A 1X86B 2WUEA 4EW3A 1NVTA 1XCMA 2NT4A 2QVYX 2CK3A 4RD6A 2H4JA 5G05C 3FDFA 1PSWA 1V54E 4RA6B 3IPRA 4G8CA 3UB2A 4D4LA 2VHJA 1EZZA 2QB5A 2LIPA 4ZO8A 4FEAA 1FUEA 3AKYA 4ZARA 4QGSA 4QLBA 2WFLB 5HOEA 4TTAA 4HQ6A 2V55B 3ZQ4A 1NL3A 1K86A 2POQX 1XB2A 3FFBA 5JAIA 4CDRA 5HKKA 4GMFA 1IHGA 4HAVA 2PCLA 2QRHA 3I4GA 4EMTA 4JI2B 1CHNA 1NM5C 4YJGA 1VE9A 4UPEA 4EJ2A 2PL2A 3LFHA 4DY6A 5CFQA 4MQBA 1E7SA 3K6KA 4AWAA 1AN0A 1U0LA 1P72A 4BB6A 2R751 4P36A 4WJZA 1QIKA 5SY4A 4FWIB 3UGJA 3FOBA 4J0QA 3GLFB 1E9FA 1CQXA 2JEYA 2V6MA 1PHPA 2ZJ2A 3OEED 2Y4OA 2F8MA 1LK7A 3AU8A 1XFDA 1Q74A 3VAYA 3DLAA 3VH4A 1Y89A 3IIMA 4FB4A 1DG1G 1Z73A 2QN9A 4X65B 3RH0A 3KQLA 2P1ZA 2RGUA 1UZAA 3LO5A 3TUJC 3RIMA 3DOIA 4G37A 3B52X 1S2LA 4UNIA 5ALYA 3MEKA 3O9VA 4Y9DA 4FYHA 2R4QA 3T1HB 1XVAA 3W9GA 1KEWA 4ITUA 4J03A 5C1BA 3D4IA 3EIFA 1QV6A 5DHRA 2E4XA 1Z4KA 5BN3A 1DEKA 4AJJA 1JIKA 2IPXA 3APFA 1OZHA 1DXYA 3D4BA 3RS7A 2HQSA 5BN3B 1AE1A 2AN4A 2WD7B 5KJLA 1FPPA 4NPHA 4PLVA 4WKPA 3HABA 5EIBC 4N8DA 5T4EA 1HF3A 1T2NA 2SBTA 3BB3A 1VCIA 1R74A 4BCCA 1EE9A 2BI7A 3RS2A 4F9GA 4QDJA 5DLQC 3SSNA 3O31A 5I7AA 4A2CA 4PH4B 4URKA 4RCVA 1GTL1 1YDEA 3H9UA 2WOJA 3O8QA 4BWFB 4D8VA 4PX5A 2R03A 3AL0C 3KZ1E 1MH1A 1F6BA 3GFRA 1JEQA 3KJHA 4O3FA 4QUIA 4UEKA 1MU0A 1DVPA 3MLAA 5BV8A 2ZFUA 1DINA 2EQAA 2FE1A 2FR8A 2O23A 2AW5A 4DJ5X 4Z86A 5HGJA 3ZXIA 1TN7A 3QK0A 1Y42X 1Y8AA 4NIKA 4MQFA 3Q73A 2HIAA 2DJ5A 4CZ2A 1TKAA 1MC5A 5EZQA 3RAEC 3K16A 1A95A 1EUCB 5M29A 3MHTA 3PREA 3IMFA 2HO1A 3FJ1A 3KSQA 1C30A 3W34A 2G9VA 3E7XA 2O59A 4BQIA 1J90A 1CJUC 5L45A 3RIYA 1M2HA 2D8MA 3FYHA 2WHRA 2YXDA 4M0FA 3RANA 4YP5A 4OIMA 3THRA 4BO5A 4F96A 3U16A 2H6FA 3J7AC 1I5RA 1ZRSA 1TYZA 2AZTA 3AONB 4KXWA 4WBSA 5HS6A 5T5QA 4I1UA 4B3DA 4Y8VA 4LG1A 1DUVG 4HR7A 3WGKA 3EHRA 3DOFA 3O0DA 3PI6A 4HDSA 2DQKA 1JHXA 1ZOIA 2IHZA 4U3JB 3S2IA 2BGLA 3S1SA 5A9SB 4LQLA 3ZYLA 4RQIA 1DX4A 3S7BA 1J0BA 1QKIA 1Y3CE 2XOEA 3M4ZA 4M86A 4AKSA 4X8LA 3JARB 2NU9B 1PBTA 1BI8B 4H7YA 2RI6A 1TR4A 2E55A 4HYQA 4AJ1A 2G9UA 4IQ8A 1Z5GA 2WILA 2C95A 1PJ3A 2NXNA 4YMUA 3OX3A 1OWNA 1WP9A 3SS9X 1IXZA 4TV3A 4RM3A 3DZ8A 2WYUA 3PKZA 2C5BA 3ROGA 4NPCA 3DKRA 3L7JA 3FA2A 4CFSA 3K5IA 2DUMA 4RO0A 1G2QA 3DHWC 3V4ZA 4UNRA 2CZGA 3H4MA 3MRSA 1JVSA 1N2GA 4JP5A 5BV7A 3OA0A 3TH5A 4AIFA 3Q40A 1G5HA 4KQFA 3R0JA 1EKXA 1V3QE 1JLMA 2A9FA 1I3KA 3DDWA 5CHEE 2NYJA 3RJTA 3O3OB 1AMUA 1TADA 1G20E 1PKEA 3T3EA 3DEPA 2H9IA 4GTOA 3K0BA 2ZQ5A 3N6VA 4PG8A 2FPIB 2YL2A 3NAZA 2Z5LA 5JLAA 3AZPA 5BV2P 1NIJA 4E13A 1WKVA 2OAQ1 4DX2A 2VJ8A 1ZCJA 2W11A 1DCEA 1P5QA 3CC8A 4TWAA 5JCOA 2A3NA 2GFQA 2NU6A 1L4EA 2GZAA 2Z4SA 3BULA 3C97A 3DZJA 2LKDA 3MAAC 3PU6A 1KOJA 3QVJA 5I7HA 1HM5A 1NDQA 1LPPA 2DKOA 4EFLA 2WJHA 4C20A 5AKHA 5BSKA 1X7WB 3CVJA 1GUYA 3SJAA 3GZNA 2WFZA 3W7AA 4PQGA 3ZIAA 1J7JA 1DKPA 7AT1A 4GUAA 3WTCA 1WMFA 1WPQA 2IYYA 2Z2IA 1XZJA 2Y93A 4GB9A 1LJ8A 1QVWA 2YVUA 4MW0A 4NYMR 4YLGA 5AUPB 3W3AA 4ND2A 3U66A 3H5OA 3RRMA 1BD3A 4JP8A 2OFWA 5HJ7A 4BBJA 3FUUA 3O93A 4JJFA 2GD1O 3UKJA 3DBSA 4MP8A 3MPOA 2I87A 4P4LA 2PM7A 4H1WA 3HFJA 1PW7A 2IQCA 1WSBA 4BKPA 3QNWA 3KM0A 1DTEA 4US1R 4E6PA 2YJZA 2CV1A 4I9EA 1RP1A 3AEQA 4TLDA 4ZI5A 3U7HB 3GD5A 1RAAA 2QUIA 1T1EA 2GARA 3B7WA 3MWJA 2ZJAA 3TR6A 4CT5A 3AEQB 4MEJA 1ND6A 5ICGA 2B8TA 4J1QA 1CS0A 1XR3A 5ERYA 2KMLA 4OQYA 4LRWA 1ENPA 4PC1A 4A8JC 4EMSA 1L0BA 1N5KA 4GYJA 4MR8B 4P35A 1GTG1 4X3CA 1BWQA 3RTGA 2W2NA 4TOIA 4B6FA 3G85A 3V8EA 1EDEA 1REQB 5K8CA 4E5PA 2FPOA 4R01A 4URFA 5FUXA 5JNTA 1B41A 3LPNA 1RHRA 3IILA 3EFOB 1N1GA 2EJVA 4LECA 2MSKA 2C84A 2UVPB 1KSJA 3CLRC 4MUJA 1W2WB 4UQPA 5AK6A 1A7KA 2GETA 2REBA 2WIAA 4JJKA 1KH3A 5D86A 1E5DA 1ESMA 2R4TA 3EIUA 1DQSA 4DE5A 3CY6A 3QE0A 4H77A 5F98A 3UXHA 3T5DA 5JSUA 2R85A 2FLVA 1NI4B 4U7HA 1PC2A 1AZLA 5DK4A 3KSAC 3U48A 4BWYA 1BH2A 2YHAA 3PE6A 2PS0A 4BO6A 4JL8A 1ONBA 4J3JA 1I5OA 1E98A 3ZXXA 1L7PA 3EQ7A 3LF2A 4GZ5A 1E6KA 4UVIA 1JIQA 4ZV9A 1NVAA 4FFVA 5HXAA 1J2EA 2XD9A 4PZDA 4DNQA 4BCDA 4WJLA 2NTJA 3ESKA 2X41A 4R0NA 2P90A 4UUBA 1B0AA 3D8UA 4GPBA 4C5CA 2N9UA 3CYFA 2QN7A 3GW4A 2D5AA 1JQLB 1SCDA 4LXUA 5AM0A 5A5EA 1VA5A 3MRXA 2WJYA 2QTTA 1OBVA 2XUOA 3AUKA 5CHEA 1WUJS 3RB8A 1BKSB 3TW8B 2HWUA 4GOOD 1GWNA 1YVUA 3OF5A 2PZ8A 2ZRAA 3CBGA 3IE2A 4XIGS 5AKLA 1ZCZA 1W52X 1W9HA 3EXIA 3L0YA 1FNBA 1QG2A 4D8UA 4V2UA 2OD9A 3EEOA 2B4TO 1AUOA 4WAFA 2GI4A 1MEOA 3DOOA 2KYRA 3DBHA 1E2IA 1S1MA 3EXIB 3NRJA 2IIVA 3D9IA 2R6JA 2WAYA 3DT8A 2JLXA 2EIHA 3UM9A 5CYFA 2FPKA 1WCYA 1E8XA 3WGTA 3TTSA 5B3LA 4IJVA 2HMSA 5GM2A 5CD1A 5A9TA 4DNFA 4Y6QA 3LHFA 3HN2A 5BQ3A 1U8UA 1DRKA 1SVOA 3N2KA 1CUSA 1NZDA 1J7KA 2A5GA 4QO8A 3L1JA 1MB4A 1HZ4A 4RA9B 5J5CA 5TRTA 3Q7EA 4S04A 4ZU1X 5ANRA 2TS1A 3TL5A 1X19A 3LDGA 4RA9A 4UHBA 2HO5A 1PYDA 1NOKA 2HLDA 1GTSA 1O4VA 4EHDA 1B2LA 4RLFA 1CUJA 3A1WA 1N4QA 3PE3A 1PQYA 4I1SA 1KKUA 3CX3A 5B1BE 5JANA 3M82A 1JLRA 4IW3B 1YDWA 3UIOC 1SU8A 3MQFA 3WL4A 1YH3A 4D9IA 2C4HA 4Q9AA 3F7NA 3OLQA 4OAUC 1V96A 5KUTA 2IZ1A 4LPKA 1H5QA 3K15A 3RE1A 4QTTB 4N3NA 3AJEA 1UAAA 1KMIY 5BN4A 1K5GA 4NXMB 2YXPX 5F35A 2ISSD 3UM0A 5LU9A 3IUSA 3PGVA 1KZ9A 3EEFA 4MWTA 2ANBA 4IIVA 4B5LA 5JFOA 3IL2A 3RFUA 3MHPA 3ETDA 2DE0X 5ALVA 1RC1A 2XSZA 3P32A 4XCXA 3WLHA 4IYRA 1JKMA 1M1NB 3AZQA 4HQDA 4NZZA 1XDDA 3GEGA 2QPOA 3QVXA 4H1UA 3B6IA 3ISMC 3LCJA 5DM0A 3RVRA 1ELOA 3CUVA 1N8TA 5AVVA 1UBOS 4AS1A 3EIXA 4QYMA 1BVYF 4TXMA 3OT1B 3FWHA 4ZPJA 3FOCA 1O8BA 1V37A 2GCGA 4GXRA 4CF7A 5MDHA 5JJIA 2GZ3A 1MX5A 5ENZA 5F73A 3EZFA 1ODSA 4EYEA 1EFKA 4HQFA 5LZ5A 5FTLA 4LXQA 2ADFA 3UB4A 3TZ6A 4C2TA 4FCWA 4XAQA 5EGNA 1CRZA 3SMQA 5A0VA 2VS1A 1EK1A 1GPH1 3R77A 3F46A 4RVCA 1XMVA 4X20B 3O3MB 1PJ4A 4F92B 3GDWA 4YO7A 4EITA 1VECA 2DBYA 1BXZA 2G9ZA 4HOYA 4K6HA 1SHJA 5ULLA 2D6FA 3I01A 3DR5A 2ZIXB 1NV9A 2Z6UA 4UVGA 3UT5A 4BEWA 4IQ4A 4DIUA 1CUDA 1D2NA 2YNQA 3ELUA 4BZPA 3VBCA 1T25A 2W6JA 1KEVA 1SQ0A 2DSNA 3LP6A 4YR7A 2AFHE 1VYUA 1O95C 1GQRA 3IQXA 1KEEB 4R7ZA 3PEEA 4P81A 4IIBA 1KI6A 2OILA 4RADA 5LWHA 1QB8A 3D81A 2CV0A 1TUBA 2JK1A 2GN4A 1KIMA 3IIJA 1R0KA 1U3WA 3H16A 5CCDA 5LZ8A 5HZMA 4J75A 3H2SA 1ZR4A 4KGXA 4WY5A 5C37A 4F8YA 3K1ZA 4B84A 4CIAA 2YHBA 3WL8A 4GNRA 5HDBB 3OZBA 4EB3A 4FULA 3IUMA 3U9TA 1Y34E 4P8RA 1NMXA 2PRYA 5LUAA 4KH0A 3QE4A 4HYYA 3F5SA 3OQHA 4B45A 4EI2A 4NJEA 3DTYA 3HEMA 4KR9A 3ZNGA 3FXAA 3SF0A 2IEIA 2AE2A 3L1HA 4KRXA 5TPZA 3WA6A 3N0XA 4B76A 4DCVA 1XK6A 3AM1A 4J1TC 5G3ZA 2YOHA 1KJNA 2BEWB 3JQPA 3QG1A 4WKOA 1EU1A 1H1LA 4JBXA 1TT5A 3D7RA 2GD0A 2VDUE 4IIYA 1VKZA 5KJFA 5LOVA 5LZ9A 4Q4AA 3THXA 4ETIA 3EZNA 2EKZA 3UC5A 3EARA 4DJAA 3DE4X 4Z3OA 5EKQD 1MT0A 3F7MA 4BC1A 2KC7A 3LJKA 3ONDA 2QUJA 3BC1A 1CY2A 4I4CA 4AVYA 4EI7A 3ICVA 4AN1A 1NE7A 5B58C 3CQGB 3QKRB 3WL5A 2CK3D 4YP1A 2IDJA 1P9WA 3H6HA 4Q94A 2GVZC 3AHHA 1EDOA 3IP8A 4RHTA 1E1NA 3A9TA 4N9QA 4RTLA 2UWJG 1SR8A 2J9QA 2H3HA 2Z2JA 1C3XA 5HKLA 1T3GA 3A8TA 1I3MA 3QKWA 1B00A 5DNCA 5LQDA 2BFMA 2XD4A 2G3YA 5DGHA 4MJXA 5T8KC 3U81A 4LJ4A 3H86A 3QX7A 4IH9A 2B35A 3AR6A 4V3IA 3E5MA 1CIJA 3DTTA 3PL1A 4OQEA 1AURA 4PG7A 3BHMA 3O7MA 3KAKA 5FI5A 1D6SA 3BQNB 3Q79A 2RBKA 4GKJB 3IBEA 3EGDA 3TGPA 1HETA 1YZYA 5ICMA 3QEAZ 1A72A 4FE3A 4TMZA 4OI1A 1OFUX 3SO8A 2AD5A 2HA0A 1PLKA 3TAXA 2WPNA 3CLUC 5DWQA 3OQIA 1EYHA 1JLHA 1UUFA 1VLHA 4XIJA 1SQMA 2Q6KA 1N2ZA 4N2QA 1U9CA 2EZTA 3IIIA 1GPMA 3S7TA 5MHTA 3EEQA 2PQNA 3DPDA 4R8SA 3ONWA 4C78A 3CE9A 1KF0A 2P0YA 5TVKA 3ER9A 3ZLTA 4JBLA 3G0BA 3IOBA 2Y3AA 1M1ZA 3D6MA 1J4AA 1R6BX 1KQNA 3I9V6 4JKOA 4DQVA 5HS0A 1R6DA 1JECA 8LDHA 1J56A 2CEAA 3IEPA 5DX0A 3SHOA 1G21B 2L82A 2J4FA 3LCVB 2OGTA 4KN8A 3T3IA 4JJ6A 1PJBA 4LOAA 4P98A 3WC4A 4PM4A 5K99A 2IS2A 2V9CA 4XWTA 1PT7A 5BUQA 3MBOA 3OJFA 3ECSA 3RAUA 3OMLA 3GP3A 5EJFA 3HYTA 1PL6A 1SCJA 3QELA 5C5DA 4IY1A 1WXGA 4FE7A 4TMTA 3GUYA 5DHFA 2WFMA 1ZHHA 3H2GA 3KVNA 1EFUA 4LHWA 3VUEA 3E7FA 4URUR 5AW6A 3NR2A 2ZYWX 4ZQHA 4KE9A 3Q4AB 2X6KA 4MOWA 1XZHA 2IZ0A 1M8KA 3G2QA 2F0YA 1U0EA 3W79A 2V65A 3I61A 4R84A 1B93A 5AKYA 2ZE6A 1OE0A 4TKMA 3BMOB 3HZOA 4GPKA 3MD0A 1T0PA 4J16C 1V3VA 5EYPF 3RS8A 1QR2A 4PS7A 2DHDA 4IMPA 5KOYA 3SC3A 1TN8A 1RHMA 1TMYA 5EKXA 3U26A 2QPAA 4CNBA 2OXTA 3L16A 2BFFB 3LA6A 2IITA 3LBNA 4X3OA 3KOZA 4QPJC 1LRJA 3LVRE 1ETUA 4MJLA 1JPVA 1P7CA 4CR7A 2NC9A 2GXQA 5JJ6A 1FYXA 1YE8A 1K5HA 2NQTA 2OB1A 4EPZA 2QZ4A 3C0KA 3QKSA 1RAFA 1B1CA 1S6YA 1T4MA 4GWGA 1D4AA 4KQIA 2QXUA 5DT9A 3VR2D 2D7DA 2I67A 1HTWA 3GRKA 4AY4A 2WC1A 2SKDA 1QWSA 2EHJA 2CL6X 1RRFA 2J9FB 2VT2A 2LCFA 2I1LA 2QYHA 2Q49A 2EIKE 4HDAA 1ZEJA 4UEQA 4Y0NA 3AVTA 3LRXA 1ZBQA 2OGZA 4NY1A 3AX6A 4TX1A 1C81A 4FYPA 3O4IA 4H7JA 3OZGA 4QLOA 9ATCA 4B9EA 3OAWA 4PG6A 1WW3A 2H2DA 4TMFA 2A2ZA 2VUTA 1C1YA 2ZDQA 3PUVA 4G1VA 5E7MA 2MSNA 3K4HA 3E4CA 4EJSB 3HJFA 3CLRD 4ZJPA 3FZYA 1F8YA 3LKBA 5GOZA 2BKXA 4EHMA 5DRTA 3T6KA 4BX2A 3D2LA 3OECA 5I7SA 1J6UA 4DZZA 3N8KA 4C6HA 3PZBA 4NENB 3AR7A 3LZ6A 1MD9A 1AHPA 1SRQA 1E4OA 1YVRA 4HRNA 4BV9A 5KNDD 6AT1A 4MBGA 1GSAA 1RWPA 2JGDB 2YIDA 5AUQA 4B8YA 4JIGA 3L41A 3P9ZA 1F51E 3IBYA 4RKRA 3UKDA 1Z4NA 1JDPA 4ITVA 2FO1E 1DAPA 3S1AA 3OZVA 2OCDA 2BGUA 2VLBA 2PT6A 2ZRPA 3MBIA 2J7PD 4Z1MA 1OFTA 1I10A 1P91A 1XZPA 2CMKA 2OY0A 3PEWA 2RIRA 2D2VA 5DOVA 5CCMA 4WXMA 1CZKA 3VO1A 3QTBA 4X7PA 3CCFA 5K1ZA 4CM8A 1KBZA 4KBGA 2DFNA 2D5BA 2IU4A 2JJMA 2HFKA 3LOPA 1ZFNA 4QPCA 1CW2B 4RY9A 3PQ7A 1LI5A 3F3YA 1A1VA 1DADA 2WM9A 5JT1A 2GF9A 2VJPA 4KR6A 3U7RA 2LP4Y 1U3VA 2FAXA 1IBCA 1MA0A 1OD6A 1SPBS 2SCUB 4BQEA 1KJ8A 1SKAA 2H1VA 3H2ZA 3QUSA 4GR4A 4DM7A 3BIJA 5F33A 4K7JA 3LOUA 5C8YA 3SS7X 3NMUF 1ZH6A 4OL9A 5BOVA 4QQRA 1Z12A 5C5EA 1BGVA 1MTZA 1WW2A 2X7HA 4MYSA 4PEVA 4CEIB 1C7IA 4ND8A 2WQZA 5M04A 1E1DA 3WKEA 4JHJA 1XL1A 4NP6A 3LP5A 4M76B 3KWLA 2FN3A 1V1RA 5GONF 4LYGA 4DUZB 5JWOA 1G9SA 1DO8A 2XLCA 1N6HA 2FWPA 3AMVA 2H1SA 1KJZA 4YMGA 2OSBA 3VZDA 3DD5A 2PG3A 1Z0FA 3E7PA 3AS8A 1PZMA 1WU8A 4O63O 1OXVA 2P2LA 5K51A 4JVLA 3LIPA 1ZRMA 2R6CA 3BG5A