4K0RA

Crystal structure of mouse cryptochrome 1
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
487
structure length
463
Chain Sequence
VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPCMTPLSDDHDEKYGVPSLEELGFDTLSSAVWPGGETEALTRLERHLERKAWVANFERPRSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-1
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein
total genus 170
structure length 463
sequence length 487
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4k0rA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4k0rA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4k0rA01
1QJCA 1R6XA 3K32A 1EE1A 4DJAA 2RE8A 1GLNA 4MUJA 3CLTC 4CT0A 1QU3A 3N05A 4MUEA 1GN8A 1TYDE 3CLRC 4ND7A 3TNJA 3NBAA 3ND6A 2HMAA 4H3SA 3MUEA 1QRTA 5HG0A 4Q16A 3KT3A 4WNYA 1OWMA 2VTBB 1K97A 5AHWA 4MWBA 1QNFA 1MAUA 1Q19A 2RD2A 4NAUA 1IQ0A 1WXFA 3IODA 3LE8A 1JZSA 4DLPA 1WQ4A 5TS2A 4PBSA 1TYBE 4UZEA 1VBKA 3L92A 1F9AA 3N2YA 2WB2A 1EUQA 4ZCQA 3IMEA 3ELBA 4MW5A 1R6TA 4QRDA 1H3EA 4F4HA 3PNBA 4JXZA 1QRSA 1N2GA 1LI5A 4EG4A 3F3MA 2QJTA 3ISJA 2A7XA 3VRHA 4K0RA 1PG2A 3GMIA 3TZLA 5K0SA 1WZ2A 1G8GA 4KPUA 1JGTA 2GOYA 1NUUA 2QUIA 1F7VA 3ZXIA 4DNXA 3AL0C 3ZGZA 1ULHA 1WXGA 4I6EA 3IMGA 3UMVA 3A2KA 4CQNA 4OUDB 4ZT4A 3FI0A 1O97C 3KT6A 1F7UA 1J20A 2AG6A 1KR2A 3OTWA 5DASA 2XRZA 3E27A 3MLBA 1YULA 1OBCA 1BS2A 3ZXSA 2X0KA 4MWDA 3COYA 2YXNA 1N3LA 1N1DA 4NDAA 4OJMX 4X0EA 4JYZA 2CT8A 2IJGX 1QU2A 4XFDA 1GTSA 3A4IA 3P52A 1XNGA 1YIDA 3CR8A 1B6TA 4KR6A 1NSYA 1N78A 4MUGA 1PFVA 2C5SA 1JMVA 2HZ7A 1VLHA 3G59A 3G5AA 4G5FA 1N2BA 2NSYA 3LCJA 1KQPA 1Q77A 3PXUA 4MUIA 5LFAA 2DETA 4DDHA 1U3DA 1MB2A 3D6VA 1N2EA 1JILA 4KR9A 1KP3A 4CDNA 3IOBA 1EXDA 5H7XA 4GU5A 1NUSA 3NBKA 4NZPA 1NUTA 2BTEA 3KT0A 2A1UA 1T9GS 2E18A 3HZRA 2JAXA 5TGTA 5K0TA 2QJFA 2QTNA 1QRUA 2O5RA 5JBNA 1O96B 1XJQA 4EG5A 1M8PA 1Q11A 3AG5A 2EJCA 4UZFA 2AKEA 3PNVA 2PXHA 2R5WA 4ZT2A 5LLTA 3N8HA 1N2JA 4EF6A 4ZCTA 1G59A 1D2RA 1H3FA 2BYTA 3DLAA 3SZ3A 2YY5A 1QTQA 1T6YA 3H99A 1WY5A 2D54A 3BL5A 2DUMA 1J70A 1O0BA 3SYTA 2A4MA 1EFVB 3TQIA 1M8JA 4R0NA 3HV0A 2ZUFA 2PZ8A 3VU8A 1M8FA 4MAFA 1N2OA 4EG1A 1OWPA 1YIAA 2J5BA 2X3FA 2A1UB 3HL4A 4P2BA 1LW7A 4QBTA 1IH8A 3A04A 3H9CA 4ND6A 3MMXA 1K4KA 3FOCA 4MUKA 1JIJA 1VBMA 3UC5A 2J4DA 2V0GA 3IUBA 3HGMA 3RBAA 2E21A 5HUHA 1N77A 1Q15A 4EG8A 5HUJA 3P0IA 1JIKA 1N2HA 1S4MA 3CLUD 1SURA 5KHAA 4J75A 3ZIUA 5TEWA 1LI7A 4I6JA 4MW4A 3A05A 4HJXA 3CLSC 1MJHA 1NURA 1K92A 1IQRA 4L2IA 1MBZA 3IOEA 4ZCRA 4A91A 3FG9A 4G5YA 2DR2A 2DPLA 3LOQA 3SEQA 1VBNA 5TEVA 1NUPA 1OWNA 1U7XA 4YP5A 1O94C 2CFOA 1GAXA 3D6UA 5DK4A 2QTRA 2A84A 4NAHA 4EG7A 5DB4A 1IFXA 1P7PA 2QTMA 3P0HA 1DNPA 2A86A 3CVUA 3FDXA 4CDMA 5J59A 4U63A 1ZH0A 2I1LA 1T6XA 2DLCX 4PBRA 2JA2A 1WXEA 1ILEA 3AKZA 4ARCA 3CVWA 3UK2A 3CA8A 4YP6A 1KH2A 1MAWA 3FHJA 1M8GA 1PG0A 2V0CA 3VGJA 2IELA 1K4MA 1YI8A 3HFJA 4MW7A 2YWCA 3CVVA 3IDFA 4HK4A 2CSXA 3CVXA 1RQGA 3P0JA 4KPUB 3RK0A 4XSVA 1GPMA 4DDMA 1WJGA 4JXXA 1O0CA 5EKDA 3JXEA 3X1KA 2CV0A 1WXHA 1TYCA 2E89A 2O8VA 2Z3VA 4MW1A 1U3CA 4TS1A 3U1VA 2D13A 1OD6A 2D5BA 3QTBA 5BNZA 1U0BB 3ILVA 2A1TS 3COZA 1O95D 1J09A 4JFAA 1NI5A 1WKBA 4ZCSA 4GRIA 4MW0A 2X1MA 2QUHA 1WOYA 2DERA 1J21A 3IOCA 1YUMA 3M5WA 2DEUA 3IVXA 3G6KA 4E1AA 2ZP1A 3CLTD 2CUZA 3CLRD 3GLVA 3L93A 3IUEA 2JANA 3SEZA 2GM3A 1NYLA 4KR7A 1EFPA 3X1MA 1A8HA 1VL2A 1V8FA 2TS1A 4Q93A 3KFLA 3SZGA 4YBRA 4K03A 2H29A 4MUHA 2CYBA 3IVGA 4KKVA 1JZQA 3TS1A 3AIIA 3FNRA 4MW2A 2ZUEA 1JECA 1KH1A 1KH3A 1T9GR 2X1LA 1PFYA 4NATA 5DEOA 3ZJTA 3DV2A 5FO0A 3TZEA 3MLAA 4ZT5A 3Q4GA 1KAQA 3K9WA 1N75A 3X1JA 3ND5A 2VTBA 1UFVA 1JHDA 1KKUA 1T6ZA 4EGAA 3Q10A 1WQ3A 5KWVA 4XFJA 4R2LA 4MWEA 3SDBA 2HGZA 1EUYA 4MWCA 4EFKA 4WSOA 1I6LA 2J09A 2WQ6A 1EFPB 1NP7A 3AFHA 2QUKA 1WXIA 5IHXA 2PG3A 4YMIA 1IQUA 1IRXA 3RK1A 3I05A 4MULA 1TYAE 4NX2A 1O6BA 4MVWA 3CVYA 2B7LA 5IJXA 1O97D 3INNA 4MVXA 1PFUA 1MOPA 3PRHA 3ZUGA 4ZT7A 1TEZA 3FETA 4EG3A 1G8HA 1JEDA 4MW9A 1KORA 4MW6A 2DXIA 1V47A 1I6MA 5FO1A 1X6VA 1PFWA 4QREA 1JEEA 4MVCA 5J5AA 3SP1A 3FIUA 1FFYA 1IVSA 3MXTA 4OUDA 3UOWA 3RFFA 2QJOA 1GZUA 2WSIA 2G36A 3GUZA 3ZJVA 1I6KA 1MB9A 1H3NA 3IVCA 2VXOA 3RHSA 3QTTA 2CV2A 4BWVA 1ZUNA 4L2IB 4MVYA 3H05A 1NZJA 3KT8A 3S3TA 1COZA 1ZH6A 5H16A 1KP2A 2Z09A 5FNZA 3CLUC 1MC1A 2J08A 3FWKA 3H97A 3PNYA 3COWA 4MQ6A 2CYAA 3Q12A 1GTRA 4FZJA 4ARIA 1OWLA 2PFSA 2YWBA 4ZT3A 4MLPA 4HJRA 2Z08A 4U7JA 2PZAA 1J1UA 1Y42X 2PZBA 3RJZA 4S1OA 1OBHA 4EG6A 3TQOA 1O5TA 4RPIA 5J58A 1M1ZA 2OV4A 4G6ZA 2QUJA 5LM3A 4JZYA 1XNJA 3DPIA 2AZXA 4ZCPA 2IP1A 1M8KA 2WQ7A 2CYCA 3NV7A 1KQNA 1R6UA 4AS1A 1O96A 1XNHA 1KAMA 3IH5A 1NUQA 1H1TA 4J76A 3HMQA 4MUFA 1YUNA 2CV1A 4F3RA 1CT9A 1EJ2A 1U7DA 1F4LA 3FH0A 1N2IA 2OQ2A 3QE4A 3COVA 1M83A 2PIDA 3AG6A 1I2DA 2A1TR 1EFVA 4U8HA 4HPWA 1KQOA 2H2AA 4DDKA 2EL7A 3UY4A 4MUNA 1HYBA 5KCMA 1TFUA 3N9IA 1FYDA 1X8XA 4RUKA 1MRZA 1QQTA 2E0IA 4PBTA 3CLSD 3FY4A 3H9BA 1ZJWA 4AQ7A 4PY2A 2XRYA 1G8FA 4I6GA 2GKSA 4ZT6A 1IHOA 5F23A 4YP7A 3DO8A 3C8ZA 1O95C 2J07A 4DE5A 1TQ8A 3IMCA 1O94D 4R2MA 1JIIA 2A88A 1OWOA 2NZ2A 3ND7A 3ZJUA 3OP1A 1J1ZA
chains in the Genus database with same CATH superfamily
2ADMA 1KKMA 5AUOB 2PV0A 2GZSA 2H7CA 4ANUA 3HO6A 1OZHA 3DPUA 1V8BA 1DC8A 2OCGA 1IM8A 4QT4A 2Z8YM 3PRJA 5IAGA 4UUBA 3ESCA 4IYPA 5KYKA 3U60B 2UKDA 4I99A 5IW8A 1KE1A 3LF2A 3GC6A 3BXXA 1EWRA 4L8LA 1FPMA 1YXMA 5J4YA 3E0QA 5IKXA 3RSQA 1GSOA 3C4QA 2J9FB 1QHNA 3MINA 1I1OA 4EELA 1FYXA 2A9VA 1W36C 1IDOA 3ZXYA 4UJ3A 4CGWA 4I0WB 2ZUTA 1IJKA 1PL0A 3C5WP 4Z0NA 1JUQA 3I8SA 2H48A 1RAAA 5DBOA 2DU8A 3M1AA 4X8MA 4Z86A 3FPHA 2LV8A 2Q9CA 1W1UA 3I2KA 3VNBA 5IMSA 4M9XA 4HADA 1YTLA 1UZAA 2I5PO 3F47A 2R11A 1ODTC 2BGNA 4UNRA 1V3TA 3MTEA 2WF6A 5DP1A 3MCZA 5AYWD 4X6LA 4KQGA 4J1QA 4ZREA 3I32A 4HNHA 4GTRA 4PGHA 3OQPA 3TVTA 5U1PA 4R1QA 1AS2A 1UJ2A 4B6GA 2JRLA 1TA0A 1GYRA 1C0IA 4UVHA 2OC9A 2R66A 2QFCA 3V4PB 2Y4OA 1B0UA 2Y68A 3A1EA 5KB3A 4A1FA 1JMYA 1RJGA 1Y34E 3KZCA 3DXFA 5C8YB 2IPNA 4NHOA 2IZ6A 1V4NA 4BKRA 2RONA 1W581 1E3TA 5LZ5A 3RIXA 4GH5A 3WLLA 4IWXA 5FB3A 1SY7A 2TSYB 3UMBA 2FJ0A 2X3MA 1ILWA 1EX1A 4D9EA 1OIWA 2H08A 1E6UA 1EWTA 1WB5A 1PG0A 1DTWA 2OCYC 4QTZA 1KPIA 1DJNA 1YI8A 4W1RA 2ZKLA 4MDFA 4IINA 2F1RA 4QSHA 2PRSA 2ZYIA 5IJ0B 1GDHA 5EKDA 4KE7A 2LW7A 3IBEA 2XKBA 2KZTA 2WMNA 5ECWA 4GLFA 1CR0A 5CHYA 5IC6A 4BLVA 5TXGA 4DRYA 5EG5A 1MOQA 2XXJA 3O9VA 5A5VA 1OXXK 4W5TA 2AK2A 3DO5A 2QYHA 5I9TA 1CIVA 4IFTA 3K20A 1W85B 3MILA 1Y7TA 1PS9A 3PKIA 1MX4A 3BMQB 1BYIA 1ZM3A 5ENNA 2FZKA 4CMAA 4AWAA 1VM6A 4JN6B 3KOXA 1YYHA 1K3FA 1N9KA 2ZANA 1VXOA 4MUXA 2CDBA 2IHYA 1F6WA 1GCIA 1UBHS 3D8HA 3RAFC 1T3TA 2Q5JA 5EC8A 2FJPA 5G41A 1PJAA 1L4EA 1QAQA 2OBLA 5GV7A 3N5KA 4LTMA 1RYNA 4UTVA 4MVJA 5ELMA 4DRZA 4V3IA 2I6QA 4GSKA 1GLGA 3T7AA 1Z75A 1ZRMA 4Q7LA 1KSHA 2POCA 3KKLA 3RUCA 4MVJH 3G82C 4OQYA 1LSUA 2EHJA 5ALSA 3ZQKA 3C5CA 4UWLA 3HXLA 3DZCA 1ZCAA 4KE9A 1QTNA 5H3HA 4F4UA 1FS5A 2ZTUA 5ICMA 3FULA 2WTBA 2PWZA 3FROA 3ZLJA 1LLCA 2VDJA 1VSVA 4C7XA 2GPSA 2ZCVA 4UFOA 4ZC1A 2ZDHA 4C21A 4DCUA 3IURA 4LYGA 3M2PA 3BFPA 3M7IA 3AUJB 4QUAA 2A1TR 4AO8A 4GDFA 1OIVA 2D8MA 1Z33A 1DWUA 5ITSA 3BTSA 4A3VA 4CEMA 2HI0A 3RV4A 4EB3A 4AQ7A 4QC2A 1HDCA 2AKAB 2A6PA 2Q2NA 2KCKA 3Q78A 3PXAA 5HGJA 3RODA 1WY7A 1M2OB 5HWSA 4AJPA 3TEJA 2V7UA 3WZMA 1T4MA 4BECA 1MENA 2I1WA 1OFGA 4MWSA 1I4TD 1ZJYA 3VNSA 4LF9B 4ER5A 1S2NA 5AKEA 1M2GA 4BHTA 3C48A 5IK2A 1BQ3A 3A25A 4RSRA 3JYPA 3BIFA 3SS9X 1CUDA 4HB4A 2O8FA 3MSXA 3ZEFA 3KB1A 3QI2A 4MVJP 3WQHA 4NPAA 1MV5A 4ZK6A 4CPDA 1N4DA 1PQPA 2RGRA 2AOTA 1FP7A 4ZYTA 5K09A 2XE7A 4C7KA 5F9FA 4ND2A 5UKDA 2EARA 1SVLA 2IEBA 3E15A 3EGDA 4D42A 1RWPA 2G71A 3ZWXA 1LTHR 2O2SA 4F5ZA 3OVMA 4JD5A 1M2EA 1WXXA 2CHFA 1H93A 2PV7A 1Q50A 3DLAA 4UJ5A 4R71A 3S70A 3U2QA 3TTSA 3QFHA 4QPZA 3UUEA 2V7BA 1UMKA 2XDQA 4KG7A 4TMYA 1USKA 3FYTA 3E4CA 5TQVA 4ZDKA 3P97A 2FPGA 2QG4A 3FWNA 1P2BA 1DO8A 2HEGA 2P40A 3VYUB 3AVUA 3FUHA 1T91A 1XKQA 2XIQA 3TJRA 5BSFA 3EQ7A 1VPTA 1Q83A 3C6ZA 4XRGA 3QKIA 3M9XA 4EMTA 4PRLA 2E3JA 2EW2A 3MPUA 4LXHA 1YA6A 3M6MD 3HCDA 3WRXA 5JS1A 2C77A 4CHGA 2VWGA 4CM9D 2FKAA 5D3MA 3UK7A 1JFFB 1QXSA 3ZDAA 5JJ6A 1KFJB 1CW2B 1IB6A 2VJCA 2Q3JA 4XR9A 1H2VC 3IILA 2IY0C 3N58A 5JNTA 5CNMA 5KWEA 2I3AA 2WKSA 2NVUA 2WUWE 1BE8A 3T3OA 2QRQA 1C7IA 4HQNA 2HR1A 4L7QA 4PXSA 2VAXA 2HRRA 3KSDO 1B14A 2CL6X 4KWIA 3LVFO 4J0HA 2GK3A 5D85A 4FHCA 1QMGA 3DBOB 3TR5A 4C0HA 3PS6A 1T4CB 3BGVA 5G1PA 4N7RA 3NM5A 5CBNA 3HS3A 3CGGA 2NU8B 1CUVA 4JJFA 3JZFA 3N8NA 2DZDA 4S04A 1DBPA 3FMIA 1BYUA 1KKUA 5K3AA 3SCZA 3PHLA 2OO7A 3UINC 3IO3A 1X7XA 1BXRA 2B37A 4PYQA 3SWWA 3MELA 5I7UA 1E5QA 3OEED 5D66A 5CT4A 3RU2A 1RRVA 2GD2A 4I1SA 3ZR4B 3PRHA 1IZYA 2AN4A 2PA0A 1XQ1A 1Z5SC 4YCDA 1Z06A 3EQ2A 4MDYA 3Q3GE 4CRWA 2VJAA 4E30A 2G36A 4HS2A 3UHJA 1WS6A 3SXUB 3KDPA 3E9MA 2TYSB 1KVTA 1TXGA 2QR5A 4MB0A 2B9VA 2OR3A 9MHTA 4FW8A 4JC5A 2A1IA 3FSRA 1V7ZA 2YJ6A 2Y2VA 1EA7A 2QIOA 1PUJA 1KDYA 3Q3CA 3FWYA 1P2GA 4LYJA 3PEFA 4QAJA 5J9FA 2Q2VA 4G6ZA 4HNQA 4BNFA 3RJMA 4ZCPA 3OZTA 2IP1A 3SJZA 2AG1A 4B2PA 5IANA 3AHEA 1GZ3A 1K88A 4JC0A 2BGKA 3WMFA 5KNHD 1YUNA 3WNDA 3CR3C 3L0CA 5KWJA 2OQVA 3R9KA 2PRJA 1R88A 3F98A 4DDKA 4M8LA 5I9LA 1PGOA 4ZU6X 4PHTA 2LWIA 1TKAA 1UP7A 1LBIA 1L5WA 5AWFC 1TOAA 1PDWA 4D4KA 2CNWD 3C7TA 2IXFA 3CWCA 1MP0A 5JD6A 1Z4KA 2WT4A 3FUUA 3THXA 1QU3A 2Q6VA 1U99A 4X1YA 1MEOA 4D9HA 2OOEA 2NAPA 3APCA 2C07A 1U1IA 5DNCA 4TWJA 1VJ5A 4PQGA 4F86A 2OEVA 3GLTA 2Q6TA 5ARBA 3JAWA 4MK4A 4PX9A 1WP4A 1JG3A 5K0SA 1LBTA 4RF3A 4EYKA 1N4RA 5DM70 2JCBA 4HOYA 1X0XA 2KCVA 1B6GA 1ZD1A 3CIAA 1N3LA 1GTSA 5I51A 2E4WA 3N2NA 4ZO8A 1AOXA 3MJFA 5TRTA 3IHVA 5G02A 4HBGA 1XMXA 5E6SA 5FKJA 2NUTB 3NPAA 2JI4A 5FADA 3VFDA 2W2TA 3VZDA 4OAQA 1D2HA 1WDYA 2JIQA 4J0KA 4URYR 2BKKB 3KDSE 5HILA 1N4SA 3FLBA 5IXJA 4RF4A 4BO2A 3BCRA 5BN5A 3IS3A 3TTTA 1NYRA 4NACA 4ZICA 2Z3ZA 2AX3A 5J47A 4ZN6A 3IP5A 2PQ6A 2W93A 4P35A 4ZJUA 2DUUA 4FLMA 4K88A 5I45A 3DT8A 2LD4A 4ZVPA 1HT0A 1H94A 4LDRA 4RAOA 5AO9A 4R9SA 3BKWA 4DCSA 4BCDA 1J8VA 2P67A 2E1RA 3E23A 3LY8A 2ZU6B 1FNMA 3AB8A 2F64A 3LD9A 1DNPA 1HT1E 3G0CA 3AIKA 1FXWA 3KKPA 1FUIA 5FWXB 4FHZA 3CN7A 1NXQA 2JEZA 3OQVA 4J6EA 3KQPA 1PJ4A 4B7CA 4YAIA 5BP7A 1UJ5A 1GPYA 1PTJC 2GKOA 1DWPA 4PO3X 1P31A 3X1KA 1AKNA 1FP6A 3DW1X 4L3OA 1YZ3A 2D8AA 1XEAA 2P9UG 4P83A 2L0IA 2Y27A 3A2LA 3C6MA 2I6SA 2PLFA 2NACA 3OJOA 1CQIB 1T2UA 1L1FA 3ZIMA 2FO7A 1RFGE 1KMHB 4BC1A 4WGFA 1FVHA 2YINA 1V8FA 4MMXB 5EJFA 2KSQA 2EXXA 4TKVB 2RB5A 2EFHB 3AIIA 1JECA 3P7MA 3SBDA 5DFAA 1HQKA 5BWBA 2W6IA 1PL8A 1U3UA 1QH9A 1AURA 4JLUA 2R6GA 1ECCA 5CAEB 3R7DA 1O6BA 1AX9A 2UYQA 3F78A 3G0OA 4FCVA 3WHIA 2XR1A 5C5IA 5AP9A 1UPTA 1NDUA 1S3GA 4PIMA 2D5CA 5K0FA 3D9JA 5KQMA 1XRJA 3VR3D 1XDWA 4QREA 3NAZA 2FMUA 5LZ7A 4JVSA 1YCHA 5IH3A 4D3ZA 5F5XA 4JA0A 3T3HA 2AJCA 2C57A 2MT9A 4UEOA 4WFJA 2ZYHA 2H6GA 2FQ1A 2YY7A 1VPWA 2QPOA 5LQUA 3KQNA 4F04A 3COWA 4Q4JA 1OWLA 5G1NA 3DAYA 1WDMA 1MYOA 5I7VA 1V55E 1XNJA 2HQRA 2R25B 5LP1A 2XTMA 1HZJA 3OZXA 5D3KA 3ELUA 1Z7BA 3AVQA 4IHKA 5BV0A 5HKBA 1MB0A 3QE4A 2YV3A 2HRQA 1D0VA 2LR0A 1LSOA 5KHLB 2RGEA 3QQPA 3S2FA 1E1RA 4U7FA 2LPMA 5A3QA 4URHA 3U17A 5KDLA 3TRIA 1XDBA 4FEGA 4B7UA 1ST3A 4CIDA 2W6ZA 4YRNA 2C00A 2L9BA 1VQ1A 3GLHA 3CJRA 2B5VA 3PQ7A 2BC9A 4MS3A 4B3GA 1QGDA 3ND7A 5KIAA 3OXGA 4ZRNA 5M34A 4Y6CA 1VI5A 4I46A 4DIDA 3FA2A 2G9ZA 1U3GA 1LDGA 3NUQA 2C3UA 4G8KA 2B9EA 3QE0A 1BEEA 3LT4A 1F12A 4M1SA 5A3RA 4GMJA 3OCZA 1SXJB 3Q87B 2CXTA 3V1UA 3GLGE 1OZGA 3GAMA 3FCOA 2X8JA 3F3KA 2Q5FA 4BFSA 4QYMA 4UDXX 4KX3A 2HR2A 1Z82A 2GNAA 2PL9A 4HDKB 4TS9A 2FXIA 1N0IA 1JGTA 3D7RA 1Z15A 1KP9A 3AM3A 2Y0BG 5A4MS 2EP5A 2WXMA 5BW8A 3K8ZA 4OP3A 2XTNA 4LOKA 5IYZF 3E1SA 2WJHA 4WBNB 4AWBA 3IYLW 4PO8A 1JQAA 2WB4A 5C8YF 3FFWA 1XRRA 2ZSUA 3BGSA 1E2FA 4UREA 4C07A 2CW5A 3I1JA 4KFUA 3GJZA 1JH8A 3T61A 4QXMA 4FEEA 3QIAA 2XMDA 1TIBA 4CKBB 1I01A 1W7AA 5CCLA 1L4NA 4DUZB 4F06A 1MQ8B 3I1FA 4I4CA 2ZTSA 3F6RA 4EG5A 3EX7C 2ZGDA 1JEQB 3ANTA 4TSFA 4HDOB 2UVPA 5D3QA 1TD9A 4DG8A 3D6AA 2J6IA 3QE9Y 4ND6A 1I4LD 3OLZA 2P2LA 2YVLA 1P9OA 1VG1A 3I4RB 2MRIA 1N2HA 4R6WA 2FSPA 2EJUA 2FW8A 2Y6VA 1YJCA 1BMFD 2C2KA 1PWHA 2G70A 1JFRA 2WWTA 1A50B 1YHNA 4CHTA 3RTAA 2ZU0C 1TVKB 1YWGO 1KY3A 2JG3A 4ZTZB 1SOVA 4FB5A 5CFOA 2VTVA 4GLLA 3MQ2A 4KIUA 1YS9A 2F9FA 1BJKA 1AS0A 4HTFB 4O59O 1RFLA 2AZMA 3FM9A 1ZMTA 1GRNA 1NLMA 5HJ5A 1NONA 2K87A 2OKGA 4DR6B 3LJ3A 2GVNA 2GM9A 3LLSA 3LT5A 1UXHA 3DTYA 4OP1A 1SFRA 4NENA 4EARA 1GAJA 1VG0B 4JT8A 4KZKA 4U3JA 1HFKA 3IL2A 3KKMA 3NFRA 3AOEA 1SZJG 2DH5A 1OY1A 4Q3NA 5KNCA 4OHXA 1WM5A 3GT0A 4J1NA 2EP8A 4QSMA 1ISPA 3JR3A 1JDUA 1PBNA 6NULA 2Z8ZA 5IX8A 1UBSB 1OYYA 4IAOA 1JU9A 4QGFA 1IK4A 4RDIA 2G4LA 2WABA 3UJ6A 3P9YA 5DGCA 4LBWA 1H8ED 3UT8A 3ZYLA 3R9AB 3LU1A 3GQVA 3OKCA 3INNA 4BBJA 1SU7A 1MOPA 2WIAA 5DLEA 5C31A 1PYDA 4EG3A 4EBAA 1Q3KA 4BGUA 4B3SB 5DTIA 1OGYA 4OXRA 4WKOA 1QQAA 4KO3S 3MRVA 4PZ9A 2FFHA 4AKEA 4ID3A 1OU4A 4JLMA 1ABBA 2HN9A 5L95A 4OLAA 3RAPR 4R2XA 3ZLBA 3GLFA 5CMLA 3FNBA 4W6ZA 2ZJ0A 4G8LA 2GEFA 4RTMA 5JDCA 1KMCA 2R00A 1KI2A 3S55A 4DCCA 1L5VA 3TEMA 3M6UA 3HXDA 4UWGA 1RTKA 5EIEA 5TS3A 2QX8A 3M0EA 3ZH2A 5T67A 1T5TA 4HDRA 3E9DA 3HB0A 4AMUA 3G8BA 4Z3DA 2DR3A 1X7YA 2HUNA 4AZTA 1TIKA 1GFZA 3A31A 3WJAA 1EU1A 4JLWA 1DE0A 1D7AA 2N9UA 3IAUA 4TZ0A 4QGSA 3MYVA 1WVGA 4TPKA 4TLMB 4M3NA 3E9YA 3UMCA 4ZKEA 3F73A 2NO0A 5G05J 5EJ4A 1X14A 3C8ZA 3C97A 2H3HA 3ZCSA 1EHYA 2JI8A 4B8YA 4QOEA 4YJFA 2JATA 3WSTA 3R0IA 5T6MA 3F97A 1PVOA 2KE5A 4E88A 2EW8A 2IX9A 2NV6A 2BHSA 3UWPA 2D0DA 3TW0A 5JR3A 2AJDA 3U7JA 1VMKA 1K66A 5H81A 4LN1A 2JFNA 2FWPA 4POAA 5EXXA 5CH3A 4KTVE 3U3WA 2PNJA 3T4PA 4M9UA 3TGWA 3FUEA 2C84A 3R9MA 1J90A 3A4LA 2AOWA 1JBKA 3DFFA 3G7SA 2I66A 4I8IA 1UN8A 4ED9A 2GEBA 3GGDA 3WL6A 1NF9A 3NORA 1U4SA 3U3ZA 1Y6QA 2J7PA 2PL1A 1XRPA 3C3BA 4WBSA 3FMVA 3D3WB 1NOIA 4E6PA 4H31A 3EA5A 5ICCA 1ZIOA 3WJ7A 2WKPA 1RHMA 5ICFA 4BS9A 3ICOA 3DZBA 2QTCA 2PDAA 2IYAA 4V24A 2ZIEA 4FNMA 2YJTD 1Y48E 3FCAA 4DLYA 2PEZA 1V6CA 4QT0A 1XE3A 3AQ4A 2WM9A 1LPNA 2VBGA 1VYVA 4HDSA 1JALA 3QPUA 1GR1A 1H23A 1HORA 7REQB 2FY8A 2H5EA 4CF7A 1EVKA 4HFMA 2YV4A 5FQ8A 2W2KA 2V1XA 4BO3A 3O8OA 1LFDB 2Y3IA 3C43A 2A57A 2D00A 5HKLA 4L74A 1NURA 4LG6A 2D2EA 2O3RA 4U0SA 3IUPA 2LNIA 4IOMA 1F2VA 2XCRB 4A0SA 3W5UA 1T5BA 1I10A 1QV9A 5C8XA 4OL0A 2Q49A 1O9GA 1WXEA 3E5NA 4JWTA 3TLBA 1IL0A 3HCPA 4ZVOA 3EMKA 2ECQA 2IWRA 2X2FA 2CBGA 1U02A 4N41A 5JXJA 3FVQA 1NVMB 3R23A 1ONSA 2FRDA 3IQXA 4QXPA 2GN2A 4IICA 4DDMA 1Y6JA 2JGJA 3L8MA 3QVVA 4KNVA 1T2NA 1P29A 4XVUA 3KJEA 3A6DA 2PUDA 4F0JA 1XZAA 4X6YA 3PYLA 2DERA 4HXFB 4CKXA 3QE2A 3CLTD 5H9WA 1PR3A 3W04A 1ZK1A 1SUFA 3DT6A 1SUBA 1YQWA 1UBFA 5BR7A 3DKPA 3EZLA 4L0CA 5LMCA 3IP7A 3OUZA 4JI3B 3A4YA 5CJJA 1E2MA 1WIWA 2Y77A 1SHTX 3Q3HA 3L7NA 1CP2A 3K0FB 1Y9AA 3G79A 3JCZA 1Y4DE 1TGYA 2ZE7A 5JNLA 5C4IA 1UOOA 2G9RA 4RTJA 2NTJA 3BJIC 1TC2A 4XPZA 1N57A 3ZUGA 4KGXA 1VSBA 1EGQA 2EG5A 4G84A 2GBIA 3ZD9A 1DGQA 2PS9A 3FWZA 3MXTA 4ROTA 1WRBA 5J3JA 2GTIA 5L3ZA 3NG1A 2IPXA 2Y93A 4L2IB 5L6LB 4FHGA 2I78A 2JLWA 4RF5A 2J08A 1GGKA 1I3MA 4MHTA 4XIGS 2W6ID 2GCOA 4OM7A 4UU8A 3RKSA 4J7XA 3PFIA 3LO5A 4NECA 3KAKA 3RJTA 3ZZTA 5ITZA 2HXYA 2WYOA 3N0WA 4GXQA 5JPIA 2WV7A 1C0KA 1S0UA 4RTLA 1OGIA 3D9HA 1N0QA 2NIPA 4GTMA 1TIPA 4DLTA 5KYNA 4I9UA 4RZXA 2H51A 4YRBA 1GCUA 4HRAA 1X8XA 1KOFA 3ZY2A 3P0RA 2JAUA 1XU9A 3DH0A 1NC1A 4XOUA 5T3RA 4O5AA 2AUTA 2O3TA 2CVQA 4H7DA 4RYDA 3UOGA 4NZNA 3BERA 1P3DA 4R6XA 1EZ1A 3DE6X 1T2EA 2V6IA 3P2IA 4K28A 4MGKR 1G3QA 1Q19A 4N5LA 3L13A 1MB3A 2YUIA 2ZI7A 3R7AA 3HZZA 3GPBA 5IEBA 5JSZB 5H9VA 3HLYA 4G1FA 4KPUA 3PDIA 4Q5IA 3O95A 4I6EA 4D6YA 3RK4A 5CXSA 1FBTA 3DDHA 1SOMA 2ONCA 4B7XA 4WV3A 2OT3B 4YMWA 1X92A 1V41E 821PA 1H2ZA 1N1DA 4JLSA 2Y8EA 1HMYA 4D4HA 3ZY5A 3MA0A 3RSGA 1I5RA 4HPJB 4WW0A 1AP7A 3UENA 5C52B 2WAOA 4HNAA 2UVQA 3QXXA 3JYOA 4DR4B 4UQYA 2XJ4A 3HU5A 4M49A 1XPRA 1QQ5A 1DJOA 3O3NB 3VSBA 3PQ3A 1J7KA 2FG7C 2PUGA 2AFHB 3B13A 3KVNA 4D9KA 3FNQA 4JJ6A 2IYOA 4UD6A 1TPYA 3Q1LA 3VZSA 2RG7A 4Z1OA 2TRSB 5DTRA 1Q44A 2Q4RA 2X3FA 1H2AS 5AVSA 3DBHB 2O3JA 4UI9C 3CRQA 2DYSE 4D82A 3BM5A 2J45A 4OVUA 1H1DA 2C42A 4XX0B 5AJHA 4PNHA 4GOKA 1UIMA 4NJOA 3WAJA 2O59A 2XCSB 4RMJA 4IS2A 3I5MA 5A3JA 4RTSA 2JVJA 1GR0A 2BFEB 2YWXA 3Q8KA 3KV1A 4DEVA 1L7VC 1E7VA 1YL7A 5TDHA 5CEDB 3QEKA 4HH3C 3MJ4A 4Q01A 2HD4A 1EIZA 3ZXPA 4ZHQA 3UK2A 3TSAA 1OV4A 2KHZA 3P4UA 2W90A 3LQFA 4A26A 4B6JA 4DNFA 1VHQA 4Y6LA 2SECE 5EHXA 4OKSA 1CU1A 1OTYA 3ZEAA 3LFTA 5E9JA 1L5QA 1IU9A 4MITA 4Z1MD 1EM8B 4ESOA 4XQCA 4EATA 2OGWA 4EHJA 3R5XA 4CKCB 3SBOA 3QLUC 2HAEA 1TNBA 4WX2B 3C3KA 2I7CA 4LEUA 1FNDA 3LW8A 2FWJA 4C78A 2EZ8A 1A5BB 1W19A 3AF1A 1JZQA 4IWYA 3O3OB 4DLVA 1GUDA 4H35A 3OESA 1PNQA 5HS4A 4RVDA 2OCXA 5HCNA 1V11A 3M6VA 4NU6A 2A9JA 4IMJB 4GE3A 2QP4A 1XEWX 1VHLA 3ZE2B 3KAJA 5FLYA 1VTKA 1CUGA 1D2EA 3UTCA 1P1CA 2FPPA 1KYVA 3WL4A 1XF9A 4P86A 5KNCD 1DLIA 1QX3A 1JEEA 1JKJA 1KZ1A 1FFYA 3L7KA 1ZK0A 3ML9A 3HL0A 5HF8A 3A8TA 4D74A 2RIPA 2D3WA 3TUJC 1Q5PA 1KI8A 4XD2A 2VBCA 2YIMA 1HT2E 2ZI5A 4ND8A 4RTNA 5KMGB 4O4IA 1OAAA 2EC5A 1GFWA 2ZGGA 3HHPA 3RLIA 2ONZA 4IIHA 4X8LA 3ZKWB 4KPYA 1TZKA 1EAYA 2EQAA 4AC9A 3QWFA 5FUWA 1JFLA 1K5PA 3OY2A 2HSWA 1HOXA 3O1JC 1H0KA 3ICCA 1QVVA 2IFUA 3FDFA 1BW9A 5BO5A 3CF4G 3KWMA 2F8MA 1EFVA 1K9VF 1FFXB 2F1OA 5DDIP 2CWDA 3HUTA 1YDHA 3DDUA 2JHCA 4KQJA 1OZFA 3LLCA 4WBNF 3MAAC 2QX7A 2V5VA 4DMGA 3NHAA 1E7MA 1W4LA 2NV0A 1ZM4A 3EIHA 3G17A 1XR3A 2EGHA 3TWRA 3IO5A 2O4CA 3MUEA 4KHPB 4Q16A 2FTKE 4N65A 1YMQA 3A6ZA 3DEAA 2H3EA 1MPXA 2EQBA 1ZSVA 4EW6A 5FWYA 2DYKA 4CKWA 2OD9A 4HGQA 4Z0TA 1HI9A 1EVZA 1HX7A 3JQ1A 4BV9A 5CFQA 4MJ7A 3ZHCA 3FE2A 2Y1KA 2AQKA 4K6OA 2QD1A 2QKYA 4XB1A 1W75A 4LZWA 4BFRA 3EMDA 1R0SA 1D1SA 3BTVA 3RVOA 1KNXA 5AUNB 3IDZA 4RXMA 4F38A 3KUUA 3B5IA 2GNOA 4FFOA 4KV7A 4UHHA 4X0EA 1DBVO 2BIFA 4CQMD 4IJKA 2RBEA 1TN7A 2EATA 3W79A 4D8UA 3CEJA 2WT9A 1X42A 1YR1A 4G63A 3PFHA 2AQIA 3P96A 5JADA 1DCEA 1QGOA 3DEIA 3SFTA 1UKZA 3W2EA 5E1MA 3H7IA 2B3TA 3V7UA 2WR8A 1F06A 2AW5A 3DJFA 1UZNA 4Z0HO 3L82A 4D5EA 1Z4LA 1ZM2A 2ZR7A 2IYWA 2QW1A 1WY5A 2FPXA 5DHTA 4RADA 1LPPA 2NYAA 3CNHA 1CY2A 4C76A 4D1YA 4A55A 4BBAA 3DBLB 1Y33E 3EDQA 2KJQA 1F20A 1G20B 2XEXA 3IV7A 2B20A 2FH5B 3NTLA 4QFBA 3GA7A 3FTDA 1J99A 2HJSA 3QOFA 4ENTA 3MT7A 2COKA 3IDSA 4FFWA 4PLPA 1TW2A 4RV9A 4YR9A 1P73A 2FZEA 5CB0A 4B74A 3SHWA 4OBWA 3AKEA 3C3DA 1QE0A 3CVUA 1BGXT 4KGZA 5BOSA 1ILEA 2AXZA 3UXGA 3LY7A 4M7RA 4KI7A 2QS9A 4AURA 3AI3A 4NQRA 3ESXA 3SHFA 1EX7A 1ZVJA 1US8B 1Y9EA 2PAAA 3KZOA 2ZATA 1PL7A 2CNWA 3T0IA 3CUKA 3QTBA 2BMWA 1N1MA 4FGSA 1NT2A 1YDGA 1KJNA 3JUIA 4UWKA 1PT5A 1LTKA 3L0DA 1HGXA 1AKYA 2X6RA 4JUFA 3ZV4A 4X3CA 2XMSA 4NG5A 1V25A 4U0JA 4E7PA 1SC4A 3CPHA 3EUAA 4F1JA 4KWHA 4MQEA 3ZN2A 3DLTA 4KPGA 1TAHA 4G4IA 3P27A 3PSAA 3PFGA 5LOZA 1XA3A 2ATIA 3OQIB 4UQXA 1M1YB 1U9IC 4GL2A 4OYSA 4IQ4A 1MX3A 3V32A 3QVSA 3P9QA 3VSEA 2IO3C 1RQXA 3ETDA 3ME5A 4QLBA 1PFWA 3ESQA 1FTSA 5J1TB 3DMGA 3QUQA 4I1OB 1SKMA 3AU9A 3U6KA 3PFKA 3G2JA 3PU6A 3TSYA 2XGOA 3ENEA 1FRFS 1GNRA 4ND1A 5LU9A 3PQCA 5KSPA 4KREA 2EU8A 3HN7A 4RM2A 3TW8B 2NTNA 2R62A 3Q3VA 4J1TC 1YDWA 3WNBA 3GRAA 2ZIXB 3TL6A 2JJ2D 3F96A 2HADA 5BY2A 2F8TA 5I9BA 2GYYA 2X2EA 4PFKA 2IKSA 1A88A 1KYZA 1S3FA 4ACLA 1NG1A 4KJXA 3TIXB 3UKRG 3EEOA 2RGAA 1R6UA 3MWFA 4DA4A 3ET4A 3FSGD 4YDYA 2W22A 4IGIA 1S9DA 2J5KA 3UMGA 4WESA 3QF4A 1FTYA 4BX2A 1PWXA 3M83A 5A7FA 4DSZA 4FM9A 4EB8A 1S1MA 4DGSA 2O23A 2AYXA 1ID8A 5FBWB 2QBYB 2VEDA 4OK3A 1Z68A 3S7ZA 2C54A 4HXIA 2NPOA 1DMSA 2FK7A 1VLZA 3DLBA 1H9BA 1SQSA 1XKLA 2GRLA 1HDXA 1U0LA 3IJEB 5FZRA 1JMKC 1ACLA 2AZTA 3G5LA 1MQ9A 1VA4A 2ECOA 5EZSA 1ZI9A 4D56A 2C7PA 4DLPA 5J5VA 2H9YA 3UEOA 2GEJA 4MS4B 3M4NA 2XB8A 4Q19A 4S05A 4NCHA 2JC3A 5EYPA 4KLZA 4YNBA 1KR5A 2F2TA 3QOYA 4DLBA 2G28A 4LRQA 5T4BA 1IBMB 3CH7A 2RMKA 2GN6A 3ABZA 4JP1A 3AL0C 5AOBA 4DKJA 3QMWA 4E03A 4FX5A 4PNPA 3QYFA 3Q6IA 4ALKA 2GLXA 4BNKA 2FEOA 2OMKA 3I1IA 3A4IA 1SBHA 4A6XA 4NE7A 1UR5A 4O2AA 2XNJA 2FR8A 1P2UA 2PGLA 2BW0A 5FUMA 2OE2A 4Z7QB 6GPBA 3CINA 4Z6KA 2PCLA 2F43A 4BY6A 2PMBA 4ZJZA 4BSZB 3VR3A 4OI4A 1YJXA 3KYDA 4LJSA 4H27A 1YJQA 5JROA 2OBMA 5HRAA 1QQ6A 4TMKA 4UVEA 1KVQA 1XN1A 4NK4A 1QHIA 1RAGA 3MEKA 4PG4A 3G1UA 2EFYA 2PZLA 3W5AA 3ORYA 4HNAD 3PC8A 1KY4A 5CTJA 1A27A 4F2HA 2AOUA 3PNLA 1Z7EA 3I04A 1QUEA 1TK9A 1V4VA 1XL1A 5DN6D 1XTBA 3GJXC 1KJIA 1CS0A 2GXSA 2PX4A 3T1HB 2YIDA 1C4OA 1NJFA 4PNZA 3OT5A 4K8OA 3ZYMA 4E1VA 3T4XA 1S2LA 3K9GA 2AMJA 3EBPA 4L6IA 3S40A 4ACKA 4JEIA 5CM8B 3VNQA 3QA3E 3B1YA 4XUEA 3NV9A 4BFZA 1H1LA 3UUGA 4PLFA 4UBLA 3GFVA 3TMYA 1A5EA 1GRRA 4ME2A 4DY4A 4M86A 3WZLA 3Q88A 2ORIA 4XW2A 4ZQBA 3QNWA 3B51X 2C8KA 2Z4RA 5ALOA 4E1AA 1RM5A 4Q7JB 2C78A 2P68A 5KOHA 5C5CA 4KACA 3U62A 4MKFA 3CZPA 4GAEA 4BVGA 4QYIB 1ZN9A 1KH1A 4HTAA 4MWZA 4KRGA 5EX3A 2FN4A 1WABA 3GF4A 1RU3A 3FTQA 2E85A 1XHLA 5JO0A 5LB4A 3K8YA 5BN3B 4DWJA 3VH2A 4I19A 4P82A 4M60A 4EI9A 3DTTA 3UJPA 3L9WA 4PSDA 1K98A 2PEYA 1TEZA 1BJTA 2Q1SA 4UNSA 2WINI 4URZR 2CUNA 1K7YA 1ATZA 3UMYA 1ZL2A 4M1WA 2JIMA 5EGNA 2Q9BA 2PWAA 1WXDA 3TAHA 2QVBA 1CUZA 4ABYA 1SCKA 3V4LA 4IPTA 4JMLA 2Z6UA 2ST1A 1MG5A 3OQOA 3DW3X 2BKVA 2CLOB 1KBOA 1XP5A 2XCOA 3NIBA 4RIIA 4HDNB 5I7OA 2XUAA 4JZYA 1Z45A 1VIMA 3D3MA 3Q9LA 1BIFA 3KPWA 2G17A 3TFWA 4YCMA 2QY7A 3D7LA 4B3DA 3NVAA 4D79A 1BMFA 2VGXB 1IZ0A 1BU8A 5HQJA 4PYIA 4LY6A 5ALIA 4WXRA 1SWWA 4ETWA 3N28A 1TUGA 1BHO1 4IRXA 3LYAA 2YXBA 1M54A 4Q7EA 2CLHB 4Y1EA 4TXPA 3EXFA 3TF5A 3LPLA 2OPHA 1JPNA 3UXHA 5CDFE 3INRA 1UPBA 2WFMA 1PWYE 3GLIE 4A1GA 3RIGA 4F1WA 3OZAA 5AUPB 1NAHA 1Z6QA 1X8JA 1T8TA 3GJ4A 2XUFA 5ALVA 1WXFA 3ONEA 1DKRA 3B6ZA 1TYBE 5AHXA 1XTTA 1JN0A 5ENZA 3ONNA 1F1BA 5EP4A 4N0QA 1NVVQ 2O50A 2JW5A 1GZ5A 1NW9B 1XGKA 2QPLA 2GYWA 5FI1B 1H6KA 5KTRA 3U5TA 1JUDA 4C2AA 1OILA 3F3YA 5K9ZA 4IFBA 3DMDA 2VFAA 4X7BA 2GZ2A 3NP9A 4PZDA 1L3IA 1X1AA 1E9SA 4KXNA 3U13A 5KYTA 1KMMA 2WU0A 2YVUA 5JLJA 3CR8A 3GXBA 4OB8A 1TPZA 3EY4A 1H8EA 1L7QA 2B1QA 4G5FA 1DHTA 3MYRA 3PXUA 5LFAA 3UXYA 4QDKA 1G66A 1XJ0A 2VHZA 2BFMA 3R9WA 1XDDA 3FPBA 2HNKA 3G89A 5CERB 4AN1A 3QYJA 5GVSA 2G1KA 3RO2A 1D2RA 1RRMA 3Q5DA 4LGVA 2B34A 4I7EA 1UDWA 2W8ZA 2QMOA 2FQWA 1JSRA 3SQMA 1K06A 2WNSA 1XDSA 5B7NA 4FI3F 2FX5A 3QG1A 3U64A 1E9DA 4LHZA 2B83A 1N7GA 4CU2A 4CR8A 2C29D 3KDAA 4F3NA 3VOTA 5TQJA 4HJXA 2H59A 5AVOA 4EEZA 3E81A 2AR9A 4XZ3A 5JAHA 2L42A 3C8UA 4F4JA 5EQFA 5FFNA 2PUFA 4GBJA 3PKZA 5CM2Z 2BFBA 3L8EA 4GZMA 2QM0A 5B12A 4Q9DA 4F9EA 3HJCA 5K99A 1FIUA 1N0VC 1Y8MA 2CFUA 2NO1A 1M6HA 1V3VA 3PEVA 3OMXA 2WICA 1IXKA 4RD0A 4A1SA 1EEHA 2IYZA 4W9NC 2VSXE 4F92B 1GG5A 4QLOA 1BOOA 3EG5A 4XZ4A 5LQRA 1TM5E 3S7FA 2XW6A 3UYKA 5I9SA 3QU9A 1H8HD 4WY8A 1G8PA 2LXLA 3VO9A 5FWAA 4AROA 4P92A 1R4MA 4URUR 1S89A 1Y82A 2LE0A 4DIFA 4E09A 1MKYA 4MPRA 2DKFA 4R01A 2C0PA 1TM3E 2YUTA 3U4TA 3RUHA 2PNNA 1TZJA 1XYGA 5TVKA 3CKLA 3B7RL 4P34A 5COAA 1HDZA 5JCXA 3D7SA 4FE3A 1UBJS 5B37A 1YB2A 3BSSA 3VDXA 1R27A 3REFA 3FPKA 4A6EA 1SVIA 3ZZ0A 4X63A 4ZV7A 3OZRA 1DHRA 4ISCA 3L18A 3NQPA 1L3BA 2NLOA 1IMJA 5F3DA 2UUOA 5LQNA 3NBMA 4ARSA 5F2NA 1UC8A 3E53A 4Q3DA 4EITA 1RCUA 4LC9A 4FDLA 1NDQA 3OECA 1NJGA 4BLUA 1T5HX 3L6RA 4ZYXA 3H5VA 1H05A 5I7AA 2YHUA 3SIXA 1BI7B 5M04A 3EGCA 4YRIA 3ACCA 1T1EA 1Q2XA 3TTXA 1A9YA 1NQOA 3B5JA 2ROQA 3JSAA 3PNYA 2OQIA 4ZJPA 1W8DA 3TRKA 2H7XA 1QHSA 4XSGA 5ALTA 2OCIA 3R3WA 2GHQA 4CKEA 2HK8A 3QVGB 4RGYA 4WNAB 1HY3A 3HYLA 3LUAA 3AT1A 4N7BA 1N8SA 1E1DA 4M87A 4OJQA 2OZKA 4LVUA 1LRLA 1D4AA 3R7RA 4JD2G 4FA6A 1SUAA 3F71A 3GP3A 1I2DA 1XPUA 1ZISA 3RC3A 3DRAA 4FADA 1JAIA 1KWGA 3TSCA 2QYTA 2ONKA 5JAMA 4TM8A 3I8OA 3CX4A 3GJ3A 1NHWA 1SXQA 3EJWA 3T12A 1OWOA 3HA7A 2YC2C 3K9QO 2JI7A 2ZUUA 2NO9A 3EXEB 2XTJA 3GH3A 4LJ7A 2AFIA 3HACA 1MZVA 3REQA 2W98A 2RD2A 1HDEA 4KGVA 1I7LA 2JB9A 1VBFA 1H2XA 2Y76A 4QQNA 3GBPA 2Y92A 1W5FA 4I1PA 2P6RA 4ILHB 3QM1A 4EG4A 4LWOA 3OJ0A 4L9PA 4MV8A 1JT2A 1KE2A 3UWMA 4GPD1 4WJLA 4Y6WA 2XE4A 3A6EA 4K86A 1XEXA 1OAOC 1D9SA 4EDHA 5KTMA 2QRJA 3AY7A 3PS9A 3EIXA 4W1QA 1JEYB 3MAGA 3KU1A 2WVHA 2WFZA 2ZE5A 4JBHA 4DPKA 5JJLA 3EGEA 4TMVA 4MKXA 3STYA 2I3DA 3UANA 4DDWA 2DX7A 2ECKA 5EJMA 2E6KA 3T06B 1AH2A 1UJKA 1RLMA 1PHRA 1DLJA 3H04A 4OHMA 2J31A 1GQYA 3FZQA 2XKAA 3NHYA 1U0TA 1N5OX 2V0PA 1YB5A 1RZRA 3FR8A 2NX2A 1QE3A 1T8UA 2C0CA 4CT4A 1XZJA 2XHEA 2UUCB 1EDEA 1NW3A 2PMDA 3NM6B 1C30B 2J3DA 2FCRA 5EY5B 4OFXA 1U2VG 4L8GA 1Z0SA 3ZVRA 3I62A 2FG5A 5LZ8A 1UXOA 1DRKA 4NBTA 1U7OA 4M88A 3ONKA 2LDBA 3AVWA 2GLTA 2QDXA 2WTAA 4YCAA 3ZCRA 2ZAMA 3H3FA 1K2WA 2CLIB 5AI4A 1J0XO 4AV7A 1CY0A 4FSXA 4JB3A 1P7PA 4AWXA 2ERXA 1R0CA 4R16A 2M9MA 3L7AA 1GSAA 4LCTA 4ARCA 4I9FA 3K0CC 3GELA 2R02A 4N5CA 5D3ZA 3C7DB 3SEAA 4ZQCB 1V8PA 4KLCA 5JRJA 5FOSA 2A2ZA 5K05A 4G23A 4GUDA 3QJYA 2HWUA 3PCRB 4YQEA 1F2TB 4L5CA 4D4JA 5AW8A 3PENA 4C4PA 2CNDA 1E4YA 2IZOA 3KLNA 4L8FA 3Q2IA 1INZA 2QB5A 1HYQA 3QPWA 4MR7A 3N2LA 3IJ5A 2PKRA 1HYEA 3PYMA 5AJYA 1ZEJA 3PCXA 4EDFA 3ZTWA 1VL2A 5J2UA 1DVRA 1T43A 3NWOA 4XLZA 1W94A 2XPZA 3BKXA 3LC1O 4ZEVA 4TSKA 1AKEA 3R7FA 5B3SE 3GJSA 3WTBA 3HRIA 4ATNA 5BV2P 3HU2A 2I7TA 1MIOA 4LNBA 5JRDS 5A7HA 4R2LA 3CNLA 1E32A 1JJAA 4X1IA 2VJQA 3DZKA 3DE1X 1XZIA 4LUNU 4MULA 3EJ6A 3UXMA 2BEJA 3RE1A 1Z47A 1EZ4A 1II8A 1Y8ZA 4DX1A 5JW6A 3OZVA 4DZZA 1W52X 5B1IA 1X6VA 1KERA 4DQXA 2JA1A 1N3YA 4RK6A 2QTWB 3H4TA 2F17A 2Z3WA 4C5CA 2CXXA 4RSYA 3FTZA 2WIDA 3QTLA 4KFCA 5DK6A 5A2GA 4DB4A 4JIGA 4XVHA 2R2LA 2UZ4A 3MBOA 4OP2A 1K89A 3H97A 4QIHA 5EFZA 1PUXA 2P11A 4V0LA 4C4XA 3QEOA 3CZ4A 2BKGA 4UFNA 4Y30A 1DELA 4NL4H 4CIXA 5F73A 4WOPA 1P0FA 5CCXA 5I4CA 3NEPX 5AFSA 2VSNA 3AEYA 1NL3A 2Q3LA 3SYNA 2C5EA 4TUYA 5JD3A 3BMOB 1C1YA 4PZEA 1ZJZA 3BRSA 4PYOA 5FNVA 3VH3A 2XV1A 3LUFA 3E2PA 1ESEA 4RTPA 2PUTA 3RVJA 1R50A 4BDSA 4XIIA 2Q0XA 2HWXA 5CT8A 1U9ZA 3WO1A 2V7TA 5F1YA 4QPCA 2FVXA 1LLUA 4YMSA 3C16C 4K0KB 3WDSA 2BJVA 3NAQA 3ECSA 1GJRA 4JJEA 4RD4A 2R6HA 5IFLA 2GGFA 4D9MA 1NVEA 1Y7HA 2V4ZA 3MAJA 3L1VA 4DRXA 4FU0A 3FYUB 4PCUA 5M72A 2P2GA 3V46A 4E08A 4ZALA 2XB6A 4Q03A 4FP7A 2PO5A 3H17A 3W5HA 3FTVA 1SIWA 2MSCB 4Z1MA 1QP0A 2XVXA 3HDVA 3ZDEA 5THQA 5L8VA 5YASA 3PBKA 2C2OA 1FCJA 4UTRA 1B16A 1FX0A 5JUWA 4U7TB 3NOCD 4IUYA 2SHKA 4L4YA 5H59A 3PX3A 4KLNA 4A8JB 2E48A 1VCMA 5EE5B 5GPBA 2R84A 2X0KA 2JGDB 3K1JA 3BD8A 3RR2A 1DRVA 1KSJA 4Q4HB 5CDGA 2VJBA 5AM2A 1KS2A 2IA5A 3A10A 1Z7WA 4CM8B 1DAHA 4L4SA 1Y3IA 1N2BA 1ZGGA 1P6XA 4CYMD 3ROZA 4DBZA 2Z9CA 1MB2A 4JYPA 2JAHA 4RZ3A 3WLEA 3EOZA 1FDWA 1HWYA 4CN8A 4GLJA 3LT0A 2D5AA 3LGXA 4WZBE 1RKVA 3JQGA 3I30X 9LDTA 3ZCUA 1QK5A 4BZWA 4I4IA 3A9RA 2XUPA 2HV9A 5KNCH 2C9DA 1Y5NA 3WYCA 3C8MA 2PJRA 5DW3A 3HNRA 4O4HB 4PGMA 3RARA 3EK2A 5JARA 1K8XB 2GXAA 4GPKA 3NBUA 4UMEA 4TXMA 2WJJA 3NJRA 3E70C 1JKMA 4ER0A 4NMXB 4PSCA 3X1XA 5AJUA 3UJ7A 2B36A 4F60A 4H7XA 1NATA 4GMHA 4OQDA 2X77A 3AKZA 2ORVA 5DHPA 3OPYA 1FTNA 5CVVA 3NTVA 3LECA 3VGJA 3LGAA 1RT9A 4CM5A 2CHGA 2AA3A 3L8FA 3DCIA 3KFVA 4HGZA 1WXHA 2J4FA 4CV1A 3KX2A 1USGA 3K4HA 1XHFA 2V58A 3QHAA 4XPIB 4U8VD 1RP7A 3H2GA 1Y4UA 3ZV7A 3IOCA 3W8EA 3F6YA 2VEOA 3PQ6A 4PC1A 1C4XA 4RZIA 2X4IA 4UDOA 2IL1A 5J2TA 3QUCA 3HVRA 1EP1B 4XGQA 5FBVB 3HFSA 2ZI6A 3QVLA 2CXUA 4IXNA 3B7TA 3FPGA 3DVQX 1DCFA 3ES9A 2VUIB 2G5GX 4DTIA 2HQBA 2IYSA 3H2KA 1TECE 4DX7D 4JR2A 2FOIA 1NP7A 3NUZA 1GQSA 1P77A 4JBGA 2GUGA 4XVRA 3P2KA 3PHIA 2MYUA 4EYEA 2WIKA 1YR3A 1M0EA 3RJ9A 5AOVA 4WZZA 4Z4QA 1Q1NA 4BRZA 4G2VA 5EPEA 3VTFA 4CQMA 2DQZA 1COWD 3OBBA 4Y9RA 4LXQA 4YIHA 2PU7A 3O03A 1LNQA 2VNSA 1T1JA 5CRIA 2QY9A 3DDSA 1WDTA 2HKIA 4YRKA 1SOWA 3EPRA 2PQMA 1EG7A 1YRQA 3L1KA 2BP7A 5H5JA 2VQSA 3VX3A 5LA6B 2CMDA 1NWHA 1KJQA 3QFRA 4TMXA 4KV9A 4HQFA 3RJZA 2COUA 3ISVA 4L23A 4QUEA 1X38A 3D8SA 1JHOA 1EE2A 2ZROA 4IIEA 3GJ7A 1YCGA 1V1RA 5L3RA 5LIPA 2GARA 4R51A 4U5XA 2FP3A 2X58A 2C1EA 2IU4A 4MMZB 2ENUA 3OOWA 3SNHA 2C5FA 1GZSA 1U0GA 4CT5A 1REQB 1PZNA 3TI9A 2J07A 3M4ZA 2YYYA 3U16A 4BP1A 4B8ZA 4TTRA 3TDMA 3DSWA 3HJTA 5IDYA 1EE1A 3IMFA 4HVLA 3TBHA 1EYHA 3DEZA 2RC6A 3NBAA 5C1PA 4DIBA 4J9VA 5BPFA 3OQBA 3P1JA 3I8XA 4ZVRA 4DQLA 2OK7A 4BOYA 5B53A 2W6OA 4X3OA 4LRUA 1KOGA 2R6CA 1OXJA 2WXLA 5GZ6A 1C9NA 3SYRA 2AMFA 2N46A 1NVVR 1DKOA 1YQEA 5LYYA 4RLFA 3QARA 3VPDA 2M6LA 3KR2A 3M3PA 4KPFC 5C2YA 1F7UA 2AG6A 4KLAA 4X93A 5DNDA 5AR1A 1KTVA 4N76A 5DJ5A 3D4BA 1G2IA 2D0PB 2I4TA 2WIFA 4TYPA 3K53A 5FXMA 3F1LA 5LR6A 1XCOA 2HPVA 3B3JA 3QJZA 4NFHA 2ES4A 2ZSEA 1RWXA 4PTLA 4QM6A 1TJCA 1QHGA 4TTSA 4QUDA 1UXJA 5K0TA 5EKUA 1WW2A 3OMWA 3FKQA 5BMOA 3NZEA 1A3CA 3V80A 2ID4A 2IU3A 1XZ8A 2H31A 2X9VA 5ES4B 4TV9A 1MA3A 3IBSA 1MORA 4YMVA 5LYJB 4R98A 4NBWA 2P6UA 2FX2A 1QO0D 2JLUA 5E3JA 1ZONA 2QTAA 2PT9A 2BFDB 3AVPA 3TR0A 1OW3B 4C87A 4U07A 5FBZA 2QJWA 5TGDA 4QOSA 1PKXA 2JJ2A 3CLUD 2X40A 2KBXA 3ZD8A 5K7SA 4L75A 1X7ZB 4LRTB 4JBIA 3TK1A 1KZ9A 4II3A 5KYVA 4A91A 1UT6A 5JS2A 2P9EA 1N36B 5ALPA 1RMYA 4YRZA 3FSGA 4BAUA 3WIDA 3CH5A 4PC6A 2R6R1 1RZRD 3TQTA 1CP3A 4L27A 2Y1CA 3GVIA 1UWLA 4FTWA 2YH2A 5DCYA 4L72A 4DLZA 4N8EA 3QXJA 2IELA 3SYLA 1APBA 5CLIA 1TRKA 3AB7A 1KDVA 4ZO6A 1R18A 3RS5A 1WJGA 4LF5B 1E92A 4LYHA 1G1MA 2GF2A 2XF8A 1U0BB 1JLLA 1HEIA 3L0BA 1DFGA 2QVGA 3VLEA 2GZDA 2H54A 3LDHA 5I5EA 5CR9A 3IPRA 5T8KA 4Z3KA 5DM2A 3TD2A 4JSTA 4XUGB 5F7OA 2B3DA 1DZ3A 2B78A 5KOIA 4BXOA 3PC2A 4NOKA 2A59A 5EP3A 4PG7A 3ERCA 1DINA 3TOZA 3CY6A 1L4FA 4BO9A 4DIOA 9GPBA 3ZWPA 4L73A 4EG0A 3Q3EA 3Q11A 1XMJA 5DLYA 4EVSA 4MRSA 4BNYA 3BSYA 1C3EA 2G7MC 3T9KA 3E7WA 3QWAA 5HBGA 1QOZA 3NBFA 4V3CA 4UI9J 3ZLVA 4CMIB 5H0IA 3WNVA 1QTRA 3JQCA 3ROMA 3KP1A 3OFNA 3HXKA 3DVLA 3CX6A 2I0FA 3G2TA 4Q4AB 2PTGA 2XWSA 5HSGA 2A5EA 3K70C 1CZUA 1FFAA 3DDNA 4Z5XA 4ER7A 4GKBA 3VO2A 4U7JA 3ENNA 2PL3A 3DZDA 2EKBA 3PQ5A 1NN5A 4DIKA 2BE7A 3UYLA 5H3LA 1PT6A 2WF9A 3JPYA 4IMIB 3CRMA 4OLJA 1ULAA 2PTHA 1AN0A 4HPWA 5DN6A 1S2DA 5LP6B 5AXBA 2V97A 2YXDA 2IITA 3WLQA 4KYOB 1BCSA 4ZPJA 1SA0A 1HE5A 1MHQA 4NVRA 3HWX1 1VG9B 4WIAA 1ULBA 5CIYA 2GPNA 1XTVA 1NVXQ 4Q48A 3GOQA 3Q0IA 4HB5A 4XKJA 3C4VA 2O2JA 3OZ7A 3MOIA 1CUSA 2JD2A 2G9VA 4MV1A 3KT3A 3H11A 3HB5X 4Q05A 2QNRA 4JUBA 1DQZA 2C61A 2IH2A 1RZVA 3NI2A 1NYTA 1Z5ZA 2B92A 4JQYA 2VZ0A 4H6PA 4YDOA 3GDWA 3ICPA 4IJVA 3PVZA 3RFVA 4JUIA 2GOYA 2CWWA 3ANLA 1BXKA 2NNLD 7GPBA 3BVPA 3TECE 2HNAA 5FA5A 1O97C 3RTEA 2KATA 1SVWA 3F4KA 2O8BA 2ZDGA 3GUVA 4X91A 1NVTA 4N0PA 3H6HA 5KTYA 3A26A 2PMEA 1H9AA 2R9VA 5KC8A 2VF4X 3BD9A 4C0EA 4I55A 1NRJB 4G5XA 3EUFA 4GR5A 5DF1A 5JNSA 3NEYA 1ZOSA 4FDAA 2H7VA 3AF4A 5CG2A 1G60A 3G2MA 4Q9IA 5JIBA 2XRFA 2B25A 3P32A 5KWIA 3DMYA 5HTKA 1TAQA 3RUIA 2ZS8A 2ZTMA 2JGLA 2VQ3A 1RRCA 1HTTA 3V97A 3SYTA 2IVFA 1ODCA 3IDQA 3IAM1 4JX8A 1C29B 3G9UA 1RWOA 3ZZ1A 3L0OA 4HS9A 2JCGA 2FFBA 2H52A 3PXBA 1F14A 2XEDA 1XTZA 4U96D 2AVDA 1JIKA 4EQ6B 4RQUA 2NXEA 4FD2A 5JASA 1H19A 2ZRBA 6REQB 2WOOA 3JD2A 3W6UA 1V5FA 1V54E 4LF7B 1GEGA 3SJ7A 4V0MA 1D6MA 4BATA 3UM1A 1AE1A 1RHKA 5HIMA 3PH0C 5EIBD 4TLEA 5EIOA 2VYVD 4BVBA 3PXXA 3DSTA 3IA2A 4MQ4A 4CL8A 2Z98A 3N8DA 5EFOA 5LQCA 2RHRA 4F3CA 3CVVA 3JSXA 1WE2A 5INTA 1PDOA 4EPXA 3DS8A 1PTKA 3I45A 3QFSA 1VOTA 4ANVA 1LSSA 3AR2A 1ZU2A 1L5GB 5GIOE 5BVGB 2DLNA 3K5PA 3KSMA 5LPNA 2MJLA 1KZ7B 3RAEC 4TT3D 1ZY2A 5CA0B 1JF8A 2ASEA 2B4KA 3WMRA 5JTUA 5AARA 2CVPA 2VK1A 2CZQA 3CUVA 3WRWA 3X0DA 1Z22A 2E7ZA 2B4YA 4HLCA 2V7EA 2VP6A 1XK7A 1R8XA 1BEUB 2B7CA 3HH8A 3EWNA 3BWCA 2VDWA 3VAYA 5KSZA 1BDHA 1VJRA 4YPFA 4Z9YA 1OLXA 3QELB 3V7YA 2V1UA 1N5MA 1EGAA 1Q0ZA 3F67A 1X7DA 3DAFA 4M8SA 1ZJ5A 3ESKA 2I2BA 4U9IS 5HQ8A 3BEOA 5FHRA 3N2KB 4MRVA 2TMGA 3BFXA 1W9MA 2CXNA 1RWWA 3O2NA 3ML1A 3ASOE 1W4RA 3KTAA 1KVSA 3UK1A 3DTVB 3AESB 1GPLA 4Y6SA 1A9XA 5CVJA 2O9JA 4HRXA 1ZI6A 4FFBA 2ODBA 1R15A 4FHEA 1SA4A 1VGQA 4PLTA 1OA0A 2WNHA 4V0RA 4DUIA 4H1TA 4AS1A 1O96A 1KAMA 3PF8A 1KK2A 1R5OA 3HTXA 2LIVA 1UC5B 3UMRA 3KZ1E 2QV7A 3TKYA 1S01A 4NBLA 3OZWA 2WA2A 2YS7A 5B36A 4AZ0A 4HFNA 3VVLA 3OPMA 1UXGA 2Q8QA 3MMNA 5JSUA 2XRYA 3AG3E 5F23A 5A4AA 4ZHBA 5CDHA 3ED1A 3PLAE 2H4ZA 2J48A 2A4KA 3DWFA 3Q15C 4MUJA 2DCUA 3ZN3A 2QNBA 1PGNA 3AC0A 4M1TA 2C7BA 2G9UA 1MN6A 1DRWA 5KUTA 3I83A 3ER8A 1VLVA 3CZ9A 2OZLA 3IBYA 3DXKG 2OCDA 1H8HA 5EWJA 2ALJA 2AN3A 3BWEA 1DQYA 5J4HA 5ALFA 5KCZA 3CU5A 3U48A 4K0RA 1SRRA 5E4FA 3QW4B 3GB9A 1SD5A 4O4HF 2JLSA 3THRA 4MAMA 2GETA 1T0IA 1EG2A 4G41A 4JI1B 5C2JB 1E2UA 5CJPA 2PS1A 2FWMX 1XDGA 4QUBA 4JELA 3DKIA 2R1VB 1XLVA 5L45A 3THWA 2OORC 1IVNA 3KQWA 4NMHA 1J9ZA 1JR4A 5GONA 1KDRA 1IZ7A 1RMTA 1OYWA 2VOEA 4OAVB 2ZPAA 2RCNA 3IQZA 2IHVA 1AN9A 4Z7JA 5KX5B 3FSEA 3U19A 4BMNA 2PA3A 1XZLA 1KK0A 1RJWA 4A5SA 3VHQA 4M7CA 3JWGA 1XALA 2Z6QA 1QGZA 3VOSA 5AVXA 3C3EA 3RNOA 3NIGB 4M6WA 1G19A 1LDNA 1IN4A 1CUWA 2EQ5A 5FQ4A 3DOUA 3STUA 1CVIA 1BX1A 5EOVA 3D1LA 3FF4A 1V96A 4X92A 3HWSA 2REQB 1UZMA 2F0YA 3QY0A 1BD3A 4YP0A 3BC1A 2A84A 1IXSB 4JODA 4GF5A 1RWQA 4F1SA 2I1LA 2TMDA 4EQFA 2ZJYA 3GPLA 1DTSA 1F4VA 5JI3E 1GKYA 2GJ8A 2I6TA 3RIMA 3S8YA 2G5TA 4X90A 3UJBA 3HBFA 3GT7A 5JH7B 5F64A 2C9OA 1S7CA 3QNMA 1EYZA 1RXVA 3IQHX 4B0ZA 1Z0AA 5GQSA 3GZNA 4C7VA 1U0EA 1E98A 3NFYA 1U0JA 1MGPA 3ZCPA 1U5BA 3GLVA 3PZ3A 5BW4A 1V9LA 1USWA 4HZIA 4PYNA 5LA6F 2H4XA 4KOAA 2ZSDA 5HM6A 2E55A 2Q6LA 1M34A 4PWYA 4L07A 1G4HA 1E96B 2X1LA 3KSQA 4WCDA 5WRFA 5ALKA 2G82A 4M2LA 3KSAC 2FOLA 1IQUA 5FT9A 1SJ9A 4OA5A 3WYGA 1JP7A 1TCUA 3I42A 4BEVA 2R1TA 2F8YA 3PL5A 4MARA 1Q84A 1HC7A 1CZOA 4U2CA 3VVCA 4LECA 4MV4A 3II6X 4G36A 1B8NA 4PLWA 4DYVA 2KC7A 1J5PA 1AG9A 3NOGD 4OXKA 2V98A 3HN2A 4I9EA 3AAAC 1RJ9B 3NTXA 3IEXA 1OAKA 4PTYA 1G21E 3FH7A 3RJ5A 1HNZB 2PFSA 5LQSA 3V4ZA 3EZGA 1WLYA 5JPCA 1SUSA 1UDXA 4GT1A 4ZCLA 1Z8FA 4KE6A 4FYIA 2FPIA 2BUAA 5CNJA 2XCBA 4JL5A 3TNFA 5K0ZA 4BJ1A 3QSGA 1R12A 2WIGA 1MXFA 4ENRA 4QU0A 1U2GC 1XAHA 1KQOA 2PRYA 1NQTA 1KLXA 3E22B 1MVOA 1GCOA 2ANCA 4PZAA 3OFND 3AEKB 4H7PA 2BEWB 3FPEA 5H80A 2FJUA 4MDHA 4BUCA 2G88A 2H6IA 1ZJWA 5JJKA 1PWZA 4Q1EA 5L3SB 1TTTA 4HVTA 1WSAA 2O7QA 1HURA 2P41A 4F6RD 1A69A 3JAKA 4MEAA 1KZYC 1Z0ZA 1XCLA 2HT1A 1T29A 3AYXB 2ZCUA 5ALQA 1M76A 1U0HC 4H18A 4BIMA 4O5OA 2QZZA 1KWKA 1R4NA 1GG8A 2ZR0A 3NIDB 1Q1QA 3UG7A 2PJDA 1ZIDA 4N0EA 1RXCA 1GGNA 2V74B 4YMTA 5LYJF 3K6SA 3K92A 1EH5A 2G4VA 3V3TA 2ZQ5A 4AY5A 3A7DA 3D9QX 1J00A 3LUHA 3WHLA 3PXDA 2OA0A 4EPRA 3K09A 4GDMA 3KNZA 2QK4A 3D6MA 4KEAA 2NO6A 5FHQA 3GRZA 3TYXA 1KVRA 3IA7A 2YNQA 5TVGA 4EW1A 5CX1B 3A6FA 5DLDA 2DFKB 1O8CA 2M1XA 3WK4A 2L6BA 3DKKA 5LZ9A 4OK5A 3D2AA 3WBJA 2NG1A 5IAJA 1EXDA 1Y5IA 1UPCA 1AV6A 3VDRA 4QJBA 2WZDA 5KREA 4OQZA 4RHFA 1K7XB 1L5HB 4MLCA 4RK1A 3D59A 3TLGB 1S02A 3ZE0B 4HN4B 2CMFA 1KAOA 4XM1A 3GRPA 3LTNC 1DIGA 2VDVE 4WUVA 1V1MA 2P5UA 1FU7A 4MCJA 5HX7A 1SZCA 4FT4A 1JFTA 4WT7A 1GM5A 4WLUA 3QOUA 4IVNA 1CF9A 3HXEA 1IC6A 3ZOKA 2GPTA 4RG9A 4JASB 2EFCB 2AFRA 4BRSA 3I4LA 3E8SA 4XA8A 1U04A 5I7WA 2QXTA 1GNPA 1IHGA 1U65A 1NF8A 1E6LA 4AQDA 4NHEA 3K7EA 3GPDG 1X77A 2H2HA 3IUNA 4HGRA 3D3EA 2XNDD 2R8ZA 5HXAA 3LVBA 3DBRB 3GP8A 3L0YA 5F5NA 4IULA 5KYWA 3VC3A 5BPHA 1ZSNA 1IXRC 1SHLA 4NFSA 2LZ0A 2DSTA 4MW1A 3T5AA 1FW6A 4KE8A 2YZNA 4I2WA 2KBEA 2XZTG 4HWSA 4NF2A 3CXRA 2P35A 4PX3A 3X3HA 4QX6A 2XUJA 4KI0A 1T9AA 3LLVA 4FKBA 2MSLA 3HVKA 3N76A 1HG1A 4DLUA 4UHCA 3MTGA 1QC5A 3U0BA 1L4BA 1RACA 4FYMA 4QRHA 1U6IA 1MFZA 3EFOB 5KNDD 3U9TA 4YC7A 4CM4B 1K08A 3SZ7A 3AR5A 2HSZA 4L02A 4J16A 4AP9A 5JVDB 3JXJA 3JATA 3PDCA 3W2GA 4Z49A 5LP6F 3ZE6A 3JASA 3OCCA 1K3UB 4E13A 5LQJA 4L5YA 1NQVA 2OFOA 3UUXA 3MJTA 4OUDA 4CYMA 2WSIA 4UM8B 1WPQA 4X1OA 3DVRX 7ADHA 1IIBA 4MV6A 3UJDA 2YV1A 3JQ6A 3RVLA 4X62B 1FJHA 5I7FA 1C3OB 5JZSA 4KSCA 3PFCA 1Q7CA 3KOMA 2KLBA 1NHGA 2NW6A 1I3NA 4RHCA 2BTDA 4EJSA 1H42A 1Z26A 4OGFA 2DT8A 2P9JA 2J0SA 1HO8A 4NZOA 3T4EA 5FR1A 4LTNA 4DNPA 3FDHA 3NRBA 4ZYUA 3HMQA 4LJ8A 3E2IA 3CVLA 3VKHA 3VV2A 5FZQA 2YHBA 3TN7A 4QFVA 4OYYA 4MHSA 2FSVC 1PVVA 4GVXA 3OT1B 4I3HA 4QHTA 1WPXA 2Q27A 3TRDA 1R5BA 3WWCA 1ORRA 2AOXA 4F1KA 3NWPA 3PPWA 1ZZGA 4DMLA 4C20A 1XI2A 3ORQA 2ZBGA 2WAAA 2WW8A 4WKCA 2WHPB 2GFHA 2NNWB 4ND7A 2HXSA 3C70A 2IHBA 2OHFA 3LXMA 4WFQA 5ERGB 4UULA 4WEOA 1Y81A 2CFIA 2WG2A 5C34B 2O0MA 2HIGA 1E1CB 3SF8A 5DI3B 1PYOA 4ZVKA 4MRRA 4A0FA 1BFDA 3U9SA 1JDSA 1GUAA 5E8JA 4Z9FA 2Y4TA 2OYCA 1QH1A 4WXYB 3F7NA 1ESCA 4EEKA 3NAMA 3K8QA 3JQFA 2ONYA 3E7PA 3P9NA 4YMLA 4A5OA 3A06A 1JCQA 2ILVA 1QHHB 4GPAA 3UGTA 1ULHA 3AJ8A 5LLDA 3FFBA 4ZT4A 1WSWA 3NWJA 4JX9A 4R8KA 2C8LA 4G1BA 1G18A 2PUEA 4KVAA 3WJ2A 1EA5A 2QZ4A 4XM2A 2JBAB 5KKNB 1ZD8A 1RXSA 2EIHA 2WU3A 2FDRA 2L0TB 3OZSA 4PZZA 3A27A 2ZXUA 3PHHA 2ORWA 3UQYS 1H85A 5H7XA 5D6NA 5AXAA 5DNEA 3ZZNA 3KT0A 4GQIA 1COWA 1R9MA 4KXQA 1TKCA 1QB8A 2YWEA 4ZDWA 1EUDB 1JB1A 3QEMB 2WLTA 2XVZA 5D5QA 3C3XA 3GQBA 5JQGB 3VZBA 4DYDA 2D54A 2PRZA 2E82A 1HOTA 3R5TA 3TAUA 4X7RA 3MFYA 3K9CA 4UI9K 4EYQA 2B8EA 4XWWA 3MMXA 3Q1KA 4WWPA 4PRZA 4C30A 2IDKA 1N77A 4EIWA 5FPKA 1GNLA 2N1BA 2WBLC 3L6EA 3GZSA 4P3NA 4WACA 5BW5A 3A4VA 4F8JA 3SEQA 4JI2B 1U7XA 4AJHA 3EXHB 2QX6A 3PZ4A 1BCRA 1H2RS 5JE8A 1N0HA 2NU7A 1J1IA 3JR7A 4MAAA 3T3GA 5EMHA 1X70A 1MIHA 1K7EB 3IAS1 2G40A 2Y1LA 3TW4A 2AV6A 1NJ1A 1TTQB 4ZVNA 3MCTA 2X0IA 2P6MA 2ZRGA 4ZOCA 3DUWA 3T7CA 3IEIA 1PD0A 3GW4A 2BGGA 2OG1A 1PW7A 4WA7A 1N6HA 1Z7YA 2DKOA 2X7JA 3H13A 2B6HA 2QSUA 2X23A 3T1NA 3R3VA 4XXHA 1WMSA 5ER9A 5HFAA 3UB4A 1SCDA 4FX2A 3C39A 5D1NA 2CCKA 2GM3A 1BDMA 2QLJA 2IRWA 3IP1A 5KOJB 3DE7X 2J9QA 4MCHA 2ZREA 5A4KA 2IV2X 1XTSA 2B4QA 3SDBA 1G7CA 3S7DA 5AENA 3FOFC 1J2EA 1HFAA 3ZWWA 3DHVA 1C1XA 2HHLA 4A36A 2XDYA 1A7AA 2WF7A 1A5SB 4OQLA 5BV1A 4PS8A 4WOKA 2MSDB 2P65A 4DSOA 1DKUA 3TJMA 1LNSA 5CRVA 2BFCA 4CCYB 4Q66C 3TQRA 4BQNA 2QPAA 1Z0IA 2IOSA 5K03A 2HLHA 1TM2A 4PPFA 4LQ4A 5AOCA 3U5ZB 3IAHA 4ITRC 5GVRA 1V9CA 1Q0SA 5DTEA 2XZDA 1L6IA 2A67A 2FPUA 5BMVA 3CSDA 3TUZC 2GFIA 4NPHA 2A0KA 1TTHA 1QO0A 3I39X 4UZSA 3G6WA 1E9FA 3EEBA 3Q9UC 3AUFA 2DPGA 2H8GA 4WCFB 5LD2B 4F91B 4IG4A 4HXYA 4E22A 4GAAA 4YQYA 8MHTA 4WL0A 3AEQA 4W6QA 2B82A 4Q82A 1BE6A 2DAPA 3W77A 5KJ6A 3DMRA 2R5NA 2XYRA 4KO2S 2YL2A 1ZLXA 2WYHA 1R0ZA 4UDYX 4AIIA 4B3FX 2HTFA 2DVWA 4UBMA 4MR9B 3WFZA 5T8IA 8ADHA 5AKIA 5EEHA 3QXGA 1AQNA 1MRZA 1EE9A 1ODJA 4MB2A 4IGEA 3AUSA 4M99A 4PY2A 2Y69E 1RJFA 4EEXA 3LH5A 4J4TA 5CBPB 4PRKA 3OP1A 4UVIA 1YZYA 1CEEA 4EPZA 4DJAA 4INAA 4P81A 3RH0A 3MB8A 3WGIA 1QS0B 4NICA 2HMAA 5NULA 1PNTA 1QRTA 4TWBA 5KX5F 2H2IA 3S2UA 2PBRA 2ZRMA 5AI0A 1OCEA 3KE8A 3C5VA 2MYPA 3OWXA 4AJWA 1JWAB 1EUQA 3M3DA 5G40A 5IC4A 4W5QA 5TF4A 4MV9A 1KEEB 3I52A 3AJRA 3AH8A 3EVNA 3U7GA 3ZU2A 3B1KA 1X7HA 3OSZA 5H4HA 3KS2A 3EGVA 2DBQA 1QZTA 3TLMA 4R81A 2IJGX 3IVAA 4YRJA 1GKUB 1QYIA 1HG0A 1SXIA 4RIHA 5DV9A 2Z6AA 4V3BA 3ZGNA 4TRJA 4D9BA 4G81A 3I01A 2J85A 3V55A 1KZ6A 4ZKDA 4IV5A 3C14C 3FNEA 5E8RA 3HSKA 1HE4A 4Y9UA 3Q7PA 5BVHB 1VKOA 3F6CA 5AW2A 1NC3A 1ADYA 4R8SA 2O5RA 1EM6A 4D25A 2I71A 4ZYVA 2JASA 2CHEA 4DEXA 5JH7F 2IXAA 4D0SA 3ZDXB 2NYRA 4I9NA 3RC2A 3AUYA 2WJWA 4B94A 3WGKA 5JYEA 4KRFA 2ATXA 2CXOA 3NOVA 1WB6A 1KPGA 1ZD5A 3BGOS 1F51E 5IM5A 3U7QA 3ZNNA 2BDTA 2P2SA 4KITB 4AULA 1UP6A 2FF7A 4MPTA 1N2CA 3U7HB 1OWNA 2XENA 2YHCA 4LYFA 4FK8A 4OFZA 3N74A 3RAJA 1G5HA 4EHNA 1X9HA 1E1LA 2WMOB 3OEWA 3SZLA 2P0YA 3UIEA 1H0RA 1SHJA 4XQGA 2HWKA 1QZZA 2X3UA 1U8AA 3G0HA 4IIDA 3LOUA 3DE3X 4BIIA 3G68A 1NW7A 1CPYA 3VU9A 3J81k 2DGDA 1SCNE 3AETB 3P19A 1Q16A 2KX7A 4O2BB 5DIZA 2NUAA 1SCQA 2SCUA 1KS9A 5CX4A 1E99A 1G8YA 2FI1A 3SQXA 4MB6A 5H83A 2P91A 5FIUA 4ZT5A 1XXHE 5DHQA 4ARZA 1U0FA 1T1GA 4INOA 5A3SA 1AK2A 2YHIA 5FYDA 4CFSA 4ZC8A 3A6KA 5C7IO 3WK5A 3AR9A 1XDZA 4JGIA 2WXOA 3W7AA 2B2NA 3ZIAA 4MRAA 5CTAA 2XNKA 2AZ4A 3WL3A 1SVOA 4GR4A 1LLQA 4H7KA 5IH7A 3UGJA 2Y05A 4NJMB 2IDJA 2Z2XA 1FJ2A 3QKWA 3MJVA 1M0WA 3UOWA 5I7HA 5IT4A 3N2IA 3SSMA 3WWEA 4MRMA 3G1TA 1JSCA 4MVYA 4MVJI 4RANA 5DHRA 4EENA 4S1PA 3ZY4A 2FPMA 3ADOA 3JWPA 1ZA2A 2DTDA 1L5FA 2LSVA 3RFXA 4YT4A 2OOKA 3NLLA 5EWMA 2X4DA 4DLXA 5EQJB 1ULUA 2BGJA 2PVCA 1GRVA 2LUHA 4JJAA 3EPHA 3NV7A 3ZYQA 4JHJA 1NI4A 1JR3A 3IP3A 1DC3A 4UBKA 4E5PA 4H2DA 3PEUB 3O4JA 1YRBA 5CGQB 3UY4A 4RVGA 5AHRA 1KU0A 4G0XA 1DIAA 2IZ5A 2J32A 5JD4A 4TLAA 1M2VA 3RRZA 2VYVA 3DEFA 4LZNA 1XCJA 3ICQB 1BN6A 3B60A 3TKAA 1L8OA 3VBCA 2KB0A 3EUWA 5ALZA 2DVMA 3AV0B 3MS4A 5EZYB 4B4UA 1NXTA 2VF5X 1VIAA 4TT3A 3RADC 4JI4B 1IBLB 1QGUA 3HNOA 2F8SA 1ECBA 4R1PA 2A5JA 2IU1A 5FZSA 1E18A 3IDOA 3F2IA 5EJ2A 2AGVA 2EERA 5AXCA 1DCTA 3HXTA 3ZS8A 1XCGB 2QNIA 3C1TA 2I8LA 1U28C 3GUHA 3E9QA 4RA6B 5EMNA 2D5IA 1SOAA 4D9CA 4YLEA 4FJ0A 3FB1A 5TQ0A 1LF8A 2F8XK 4NDAA 1AZSC 5BYBA 4GEKA 2QAGB 2FW0A 2VNHA 3L9TA 2KW5A 2H7YA 3B70A 3K9NA 3R9XA 2PSSA 3V2OA 1PK7A 3A28A 1GZHB 2GJKA 4NZMA 3B1WA 2GAIA 4U8YD 3IFSA 1IMOA 4Y1GA 3PUXA 4A63B 4HORA 2ZR8A 3NTOA 3U4CA 3AHJA 1IHXA 5EHIA 4K9QA 4EGQA 1N5IA 1HPLA 1J70A 3G7UA 1T4DA 1S9HA 4WADA 3O26A 4LRXA 4JVMA 3VNVA 2QTVB 4OLFA 5ICSA 1ZB1A 1DUVG 3AQIA 1C7JA 1M74A 3DP9A 2YKGA 2ON6A 1GGMA 4R2JA 2V6GA 5LDHA 3T8YA 1NT4A 2PX3A 1Q20A 4D26A 3N07A 2JKVA 2WSLA 3Q7AA 3K5WA 2DFPA 4O2RA 1TKRA 5JS7A 5HKPA 2X86A 1VBNA 3BS4A 2OCCE 2PZEA 1IXYA 3ZE9A 1GUBA 3SKVA 2QTBA 2ZTVA 3IQWA 4U9HS 3ZNOA 2R8PA 3STVA 4ZEOA 1QYDA 5JVDF 1YC5A 4F4FA 1IHUA 1JJ7A 3D9OA 3FU6A 2BUGA 1QH8B 5SICE 1SELA 5AHKA 2CV0A 1J2UA 1WTCA 3DZ8A 4RVHA 2B61A 4O63O 2FZ4A 1ISIA 2J3IA 4M1ZA 4G2NA 3IAXA 1MJGA 2Q4EA 3EEQA 2V7QD 1DKPA 5KQSA 1L7OA 1TQDA 1XLTC 3HK2A 2RHHA 3QHQA 2I8CA 3AUAA 2BKAA 3T5GA 1U1GA 3SC3A 2H9IA 2C20A 3HXMA 1P33A 3SYKA 1UL1X 2FW1A 3FR7A 1VHTA 1PFYA 4I5GA 4RDHA 3OA2A 4WZAA 5LNK1 3Q4GA 2VTBA 4PPNA 1T6ZA 3AFOA 4GMGA 1RXIA