4K0RA

Crystal structure of mouse cryptochrome 1
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
487
structure length
463
Chain Sequence
VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPCMTPLSDDHDEKYGVPSLEELGFDTLSSAVWPGGETEALTRLERHLERKAWVANFERPRSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein
molecule keywords Cryptochrome-1
total genus 170
structure length 463
sequence length 487
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4k0rA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4k0rA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4k0rA01
1XNHA 4MLPA 1O94D 5TEVA 3FHJA 1IHOA 1Q11A 2DLCX 1G8FA 5TS2A 4U8HA 1O5TA 1QRUA 3GLVA 1O96B 1MOPA 2X0KA 3HFJA 1OBCA 2O8VA 4KR7A 2D54A 2HMAA 1H1TA 4DDMA 3KT0A 2PG3A 4NDAA 4A91A 1QQTA 2WQ6A 3A2KA 4MWBA 3BL5A 1JZQA 4MQ6A 3NBKA 2OV4A 2DPLA 1OWMA 2Z3VA 1JILA 4MW9A 3KFLA 3CVVA 2VXOA 3GMIA 1O97D 2RD2A 3UOWA 4RUKA 5IJXA 3ZGZA 2H29A 3HL4A 2C5SA 4PBSA 4G6ZA 4NATA 3H9BA 4WSOA 1KR2A 1V47A 5BNZA 1IQUA 1NI5A 3NBAA 3FG9A 2GM3A 3VGJA 3MXTA 1IRXA 4ZT6A 4ZT5A 3CVWA 1IVSA 2PZAA 2PZBA 2WSIA 4ND6A 1OBHA 1YIDA 4MWEA 1NP7A 4QREA 3SDBA 1I6MA 3IMEA 2E0IA 4UZFA 1PFVA 4G5YA 2HGZA 2QTMA 5J5AA 2CT8A 1NYLA 1GTSA 1WY5A 1JZSA 4H3SA 4CDMA 4MAFA 4NX2A 1JEEA 1F9AA 1K97A 2PXHA 1EXDA 4R2MA 1KQPA 1LI5A 1OD6A 1NUUA 1VBMA 1KORA 3FDXA 5J59A 1O6BA 2QUIA 1XNJA 1KQOA 1Q77A 2A1TS 4NAUA 1O96A 1T9GR 1TEZA 2GKSA 4MULA 4MW5A 2DR2A 2QUKA 1K4KA 3COWA 3AL0C 4JXZA 1JGTA 2IJGX 4EG6A 4HJXA 1U3DA 3IMGA 1H3NA 3TS1A 4KPUA 3H99A 4ARIA 1ZH6A 1TYDE 1NUPA 3AFHA 3IODA 4MW2A 3RFFA 2ZUFA 4ZCPA 1WJGA 1VL2A 2WB2A 3UC5A 4ZCTA 2DETA 1PFYA 4XFDA 1N2JA 2AKEA 4JXXA 4CQNA 1MJHA 3CVYA 4ZT2A 3ND7A 4DE5A 3CLTD 3ELBA 4I6JA 3D6VA 4DJAA 5DB4A 1M8GA 1O95D 4KPUB 4GU5A 1WOYA 1IQ0A 1YUMA 2E18A 3RK0A 1R6TA 3AG6A 2CYAA 4MUHA 4WNYA 3TQOA 4I6EA 3L93A 4BWVA 3RBAA 3COZA 3HMQA 4MUJA 1OWNA 4I6GA 3X1MA 3IOEA 3Q12A 4ARCA 1EUQA 4EG7A 4ZT3A 1MAWA 3H05A 4J76A 2J08A 4MUFA 4DDHA 1O0CA 1T9GS 3ISJA 1N1DA 4F4HA 1XJQA 1V8FA 2X1LA 3HZRA 4OUDB 1J1ZA 3TNJA 3Q4GA 1U7XA 2YWCA 2GOYA 3I05A 3DPIA 3AG5A 4XFJA 3KT6A 3ILVA 1N2BA 2R5WA 2X3FA 2D5BA 2VTBA 3LOQA 3CLUC 2XRYA 1MB9A 3OP1A 3IVXA 4ZT4A 3FY4A 1N2OA 3UMVA 1R6XA 4DLPA 3FWKA 4X0EA 3CVUA 2JANA 3H97A 2RE8A 1ZJWA 1J1UA 3N8HA 2DUMA 3P0HA 2J07A 2QTRA 1KQNA 2JA2A 1O97C 3G59A 3HV0A 4UZEA 3QTBA 1Q15A 1EFPA 4ZT7A 2PZ8A 2AZXA 4MW4A 4XSVA 5F23A 1IQRA 3PNBA 3N05A 4L2IB 2NSYA 1NURA 1QRTA 1J09A 4F3RA 1WXIA 3ZJVA 1Y42X 4EF6A 4MWDA 1T6XA 1JEDA 1M8KA 1M8JA 1TYAE 1WXGA 3IVGA 1MAUA 1D2RA 4TS1A 4EG4A 2QTNA 2QJFA 1VBKA 1WXHA 3QE4A 4MW6A 4KR6A 1F7VA 4EG3A 2E89A 2JAXA 3LCJA 2DERA 3A05A 1M1ZA 1A8HA 1U3CA 4U7JA 3M5WA 1J20A 2ZUEA 3N2YA 1EFVA 2BTEA 3FETA 1KAQA 2IELA 3ZXSA 1N3LA 1GZUA 4MW1A 1N2EA 1RQGA 1TYBE 1VLHA 1TFUA 1B6TA 4ZCQA 3RJZA 1N77A 1X8XA 1N2GA 3FOCA 4MUGA 1ZH0A 1KH2A 3COVA 3CR8A 1VBNA 1Q19A 3U1VA 1M8FA 4DNXA 1QTQA 3PRHA 1JIIA 1M83A 4NAHA 5H16A 2YWBA 3D6UA 3KT8A 3RK1A 3GUZA 5KHAA 3X1JA 4HK4A 1P7PA 4G5FA 1MBZA 1NUTA 4ZCSA 4KR9A 1JIKA 4K0RA 2CYBA 5DK4A 1F7UA 2D13A 3PXUA 3DLAA 1WQ3A 3SZ3A 3MMXA 1EUYA 3G5AA 4JFAA 2EJCA 1U0BB 2CYCA 1O0BA 1WZ2A 1OWOA 4CDNA 2J5BA 1IFXA 1PG2A 4MUKA 2DEUA 2A1UA 1NUSA 3CLRD 3INNA 1XNGA 1G8GA 5HG0A 3G6KA 3IH5A 2A4MA 2HZ7A 3A4IA 2AG6A 1JECA 3ND6A 4HPWA 2CV0A 2EL7A 2NZ2A 3FH0A 1ULHA 1H3FA 5LFAA 1LW7A 2IP1A 5H7XA 5IHXA 3HGMA 1YULA 3IMCA 4Q16A 4JYZA 2CSXA 1JHDA 3MLBA 2BYTA 5J58A 5FO1A 2A86A 3C8ZA 1I6LA 2A1UB 3KT3A 2E21A 2TS1A 3UY4A 1OWLA 1COZA 5EKDA 5FNZA 4OUDA 1QNFA 1EFVB 3N9IA 1YIAA 3H9CA 2Z08A 3LE8A 3SP1A 1MRZA 1SURA 2PIDA 3L92A 4R2LA 3MLAA 4QBTA 4R0NA 4YP7A 1LI7A 1I2DA 3X1KA 1N78A 3COYA 5K0TA 4EFKA 1J70A 1N75A 1O95C 1H3EA 3E27A 1BS2A 2A84A 3IOCA 1UFVA 1T6YA 4J75A 2XRZA 4Q93A 4EG8A 3P0IA 1HYBA 1KKUA 5LLTA 5DASA 5LM3A 3TZLA 2VTBB 4OJMX 5TEWA 1GN8A 4CT0A 4QRDA 3ZJUA 1GTRA 4MUEA 2CFOA 1NSYA 4L2IA 1NZJA 5DEOA 1K4MA 1WKBA 4EG5A 2OQ2A 3A04A 1OWPA 1T6ZA 4P2BA 1ILEA 1N2HA 1QU3A 3SEQA 4GRIA 2DXIA 3IOBA 3CLRC 4MVXA 3AIIA 1R6UA 2X1MA 2CV2A 2I1LA 5K0SA 5KWVA 3CLUD 4MUIA 5KCMA 4MVCA 1QU2A 2A88A 4RPIA 1MC1A 3PNYA 3S3TA 4PBRA 4MVWA 4KKVA 3NV7A 3ZUGA 5HUHA 3SYTA 4DDKA 4ZCRA 2CV1A 3ZJTA 2QJOA 1G8HA 3VU8A 1KH3A 3IUBA 3K32A 4YP6A 1WXEA 3DV2A 3VRHA 1K92A 4ND7A 1G59A 3P0JA 4MW7A 1EJ2A 1QRSA 2WQ7A 1PG0A 3ZIUA 1MB2A 3CA8A 1NUQA 3TZEA 1YUNA 3CVXA 4U63A 4AS1A 1FFYA 1GPMA 2B7LA 1JMVA 1TQ8A 2YY5A 2J4DA 2O5RA 3MUEA 4YMIA 2J09A 3UK2A 5JBNA 5TGTA 3RHSA 4YP5A 1IH8A 1PFUA 4MUNA 1CT9A 1JIJA 2QJTA 2Z09A 3K9WA 1QJCA 1U7DA 4AQ7A 4K03A 3CLSD 3SEZA 5HUJA 2QUJA 4EGAA 3TQIA 1YI8A 1I6KA 3ND5A 4NZPA 1X6VA 1N2IA 2CUZA 3DO8A 1GAXA 2QUHA 1DNPA 1WXFA 2YXNA 1EE1A 1GLNA 5AHWA 4E1AA 1TYCA 2H2AA 1KP3A 2A7XA 1F4LA 3QTTA 3CLTC 4MW0A 2V0GA 2A1TR 1ZUNA 4MWCA 3AKZA 3SZGA 1PFWA 3F3MA 1WQ4A 4S1OA 1M8PA 1FYDA 1EFPB 3Q10A 4MVYA 3FIUA 3FNRA 2ZP1A 3ZXIA 1O94C 2G36A 2PFSA 1KP2A 2V0CA 3FI0A 3PNVA 3IUEA 4FZJA 3JXEA 4PY2A 5FO0A 4EG1A 3OTWA 4YBRA 3IVCA 3CLSC 1J21A 1KAMA 1KH1A 1S4MA 4HJRA 4JZYA 3IDFA 3P52A 4PBTA
chains in the Genus database with same CATH superfamily
1X1QA 2JJ2A 2VGXB 3RBVA 1BHO1 4W9NA 3MGBA 2AG1A 4G1VA 3QV2A 4M60A 1GNSA 4WCFC 3ZZUA 2CXHA 3DZHA 2VK4A 4JYBA 5TS2A 3ORSA 5IJZA 1NVBA 2I2OA 1ODJA 4OP3A 2VJNA 5LP6A 2AKYA 1OIWA 2CUTA 3A1EA 3Q6NA 3REGA 4OQXA 1OBCA 2UYCA 4UMVA 4ZU1X 3ZR4B 2BKEA 1KA9H 4L6AA 5H8WA 5G3YA 3HYRA 3RS0A 1RM3A 4ZK2A 1KR5A 3BXHA 4WVFA 5EEGA 4YMGA 1M66A 4C4YA 4DLWA 4U0ZA 2QP9X 4IIEA 1EWVA 1X13A 2Q5IA 2WQ6A 1FTWA 3FNQA 3OFSA 4BPRA 4EA8A 2E9SA 1R3DA 2ATXA 2OLEA 3GRZA 4MIYA 3HU3A 4CUJA 3SZ7A 1DEOA 1QLJA 4F6RB 4EDFA 1ISFA 1SJ9A 1Y3DE 5KJKA 2M9MA 3K8OE 3WV5A 5JASA 3ZPXA 1UKVY 4JHJA 5JJBA 1BD3A 1JHUA 1N3YA 1U8UA 3BIJA 1BDIA 3EPHA 2G6TA 1M2OB 1BMDA 1FP1D 2A1IA 3H87A 3HDVA 1QHSA 1VJRA 4UHEA 1N2ZA 3HR8A 4XGNA 1C3OB 4O2LA 4LF6B 1UDRA 3JQ1A 3D9IA 3IPCA 3ENVA 3I9V6 3KEFA 3MCAA 1SG9A 4XQEA 1GEEA 1GG5A 1F3OA 3OOEA 4G6ZA 3KBBA 2WJ3A 2H3HA 4KR2A 4WBNB 3W05A 1XYGA 2I4IA 5H70A 3UW1A 1V95A 5KIAA 2Z98A 4ABNA 4K86A 3T9EA 2RKWA 4B8YA 1L3CA 5HS4A 1JCSA 4JL6A 3OE4A 3J7TA 2IOLA 3LPNA 1DG1G 3IBGA 4KO2S 4R31A 1ZSVA 5C8DA 3NOXA 1T2VA 2DPHA 2DR3A 2AVNA 2VRNA 2OBLA 3GMDA 1VL5A 2IGBA 3K1ZA 4R7ZA 1YS9A 3OCVA 3OZSA 3W5SA 3P2YA 1OZFA 3UN1A 1R6VA 3P2KA 1B93A 1T6BY 3F6EX 3KLMX 3KSAC 2XKKA 2AOTB 2W48A 4M9RA 4YJGA 3T5CA 1JSRA 3WL4A 3UFXB 2VUSA 4GM1A 5JZVA 4ZV9A 2UZ1B 1GEGA 3KSUA 4M1WA 1Q0SA 3L82B 1YL5A 5E9JA 2WZCA 5ANRB 4H16A 4B80A 2FI1A 2B21A 4Q1CA 3U4QA 4TTTS 2OM2A 1FQWA 4DLVA 1JSZA 1K86A 3ZHVA 1TTPB 3OOWA 4QWMA 4R69A 4RK0A 5AMXA 4D3XA 3NETA 4Q1BA 5FB3A 5KYXB 4LSZE 4G8DA 2GHTA 4PX9A 3PDUA 2NP7A 1AU9A 2LCIA 3KUCA 5AVSA 2OENG 4GEGA 4XVHA 3B48A 4F5YA 2VAXA 4ML3A 2O9JA 4L08A 1Q44A 3DR3A 5L8VA 4Z4FA 4OHVA 3ZW8A 4HATA 4TXNA 4M0FA 3EMVA 1JGTA 2C88A 5LP6F 3ZGOA 2MMGA 3L7BA 1P9OA 4EMBA 3DEKA 2Z6AA 1AKQA 1VKHA 4MQMA 2CDBA 2J0EA 3EDYA 1J0BA 1ZH6A 3M6FA 5AI5A 3SGLA 2YCLA 3GR6A 1O58A 4KE8A 1NUPA 1Y34E 4Q37A 2TMDA 3I04M 4W1QA 1US8B 4X1KB 3RFFA 3STTA 1Q50A 3UAVA 3DUFB 1WJGA 4YCLA 2FWNA 4KI0A 4G5SA 4F8EA 5HVNA 3U5ZB 4MXDA 4UUNA 2JGMA 4IJVA 1EAYA 1QR2A 3AXSA 3GVIA 3K1YA 3RIHA 3FOZA 5JU6A 3R9XA 4UOQA 1W88A 1W0KD 3DZFA 2CC2A 3WLJA 4UM7A 1GCOA 1DBWA 4QBIA 4QUDA 4DE5A 3RHZA 3LTNC 2PT6A 4EZJA 4OMUA 5B53A 3DP7A 1IZYA 5DB4A 1QLWA 3WHKA 1MNAA 3W1VA 2N42A 2F1HA 5CLQA 5EGSA 2AUNA 3PHBE 4WECA 3IL2A 2EJUA 1RR6A 3C74A 3D3QA 1C0PA 2OQRA 2H1SA 1G2QA 1TUIA 1HZZA 2XSZD 5ALYA 3O4JA 5B3JC 1MF7A 1HEUA 2VT3A 1ELWA 1JYFA 2PPVA 4TMFA 2OC4A 4IG9A 5E6UB 4LDQA 1X8KA 4O59O 1GGVA 2YINA 1XZCA 1IONA 1DT3A 3RRMA 2D06A 3RS8A 1T0BA 1UIRA 5FPPA 2IPLA 5IH3A 3UENA 3KZOA 2BW0A 2DC1A 2ZTSA 1ZYUA 4CQLA 4YCSA 5KNDA 1WSWA 4LY0A 2XAAA 1AQIA 1SPBS 2Z9CA 3G68A 2B92A 3I8XA 4HTFA 4DS3A 3EX7C 5I4CA 1YAHA 4EF5A 1BA3A 2VSNA 1DTEA 1CUVA 1N1EA 3HCCA 3KALA 5H4HA 4BASA 3FZNA 4DA4A 2QR2A 2QVYX 4O4HA 3RBXA 1UJ4A 1KDOA 5HA5A 4DJTA 5JYDA 2XUDA 4Z8YA 2V4LA 1KFKB 2P2GA 4ZI7F 1B2LA 3KJQA 3C3WA 4CKBB 2BKKB 2BSAA 2W2OA 2AXEA 5LOVF 4FLEA 3IAFA 3IOYA 3RC2A 4GLJA 4GWGA 3VI4B 4ZQGA 3UAXA 3QPWA 4QOEA 4UNPA 4DM7A 3FGPA 3CPJB 2H6FA 5H59A 2DG2A 1O2DA 3R6LA 4DNQA 4H4CA 1WL8A 4NV1A 4ZT4A 5AENA 5DXJA 4BLOA 3AVXA 4S35A 2DT5A 5HKKA 5ALFA 3UWKA 1S7GA 4IH1A 1W34A 4ZVMA 3THWB 2RE8A 2LXNA 3UJ7A 3YASA 4WK0B 3NXSA 2ST1A 4K2HA 3MS4A 4G2VA 4YAGA 1X42A 2BFBB 3WRXC 5DTQA 4BNNA 3ESKA 1YOBA 2IHYA 2AFHA 2JRLA 1NHGA 3K2IA 4L3VA 3WC4A 4X5OA 3UT5A 2AOUA 2G09A 5DGXA 2Q8QA 3BH7A 2VYCA 4C7JA 1J09A 2QRGA 1UJMA 3DO5A 1GG9A 3T7KA 5TF4A 1FMTA 1DQZA 4I3FA 4HWSA 5ENPD 4MVJP 1ZSYA 1HEIA 2BKXA 4EF6A 1X9IA 4MCHA 3O8CA 1DC3A 1J97A 4YAWA 1JFLA 1ZRNA 4GHWA 1JEDA 1P2GA 4IHJF 4LYFA 4TGLA 1OHHA 4IILA 4C30A 1TW3A 1CUAA 2OFWA 3H3JA 4HDRB 4JCOA 4P6VF 3D5QA 5B7NA 3QRWA 3ACCA 4F1JA 1DZIA 3FTYA 4K5BA 4G2NA 3VQTA 4AAYA 2QD5A 1OI3A 1QVVA 2RGBA 2CSUA 2JAXA 2LKCA 2RGYA 1HDYA 3OTOB 4MOWA 4WXPA 4OXKA 2YIMA 1EDUA 4WQMA 4AXXA 5H7PA 1LD7A 2WVAA 3RSQA 5BURA 4O33A 4PIVA 4QQFA 2P35A 2PS3A 5CCMA 1ILWA 1KBQA 4KMSA 3EISA 4UAUA 3SYRA 2GF0A 4JVLA 1KZHA 4DOMA 1CULC 4KPYA 4BV8A 2YTZA 1XPRA 2RC5A 4URXR 3HKDA 5JXJA 4QNRA 3CIAA 2ZFUA 3VDNB 3TGLA 2IELA 3I2HA 4PYNA 3RIEA 1NNEA 1KFBB 4YGYA 1HT0A 9ATCA 1D5WA 2F9MA 4EYQA 4YRZA 5D5QA 3DW1X 4YI5A 3NDBB 1U98A 3ZV4A 1O3YA 3J80A 3G1WA 2IXBA 2O8EA 1SKBA 4CMKA 3DMPA 5J2TB 3KM0A 3H8JA 3O0TA 3MZ0A 3CINA 5EIBE 4EOGA 4WOPA 3RS3A 3V2UA 4GTOA 4ZEXA 3ESXA 3FAKA 1HMYA 2WLTA 3FWPA 3GJ5A 5DMHA 3VMFA 2H48A 5FUWA 3GEHA 2HE0A 1MO3A 5JAHA 2VJCA 4FEYA 1RE0A 1VYVA 3B6IA 1NXQA 1EPUA 2DJ5A 2IIPA 3MFYA 1NM5A 4CN9A 4AOFA 3JARB 5CLGA 3H5AA 2ACVA 1QYMA 2WT4A 2C7GA 5DGTA 1JB1A 5J1TB 1LPBB 3PRZA 2Y76A 1ENOA 1TJCA 1YSCA 2EG5A 3GFBA 3HJAA 5FUXA 1U2RA 3FSJX 5D87A 5HCUA 5TS3A 4EVRA 5JCJD 1E2NA 2DR0A 2H9YA 3KUUA 1WQ3A 3FZEA 4JSYA 4LSZA 4MKRA 1C3EA 4MV5A 1W44A 4AMBA 3QBJA 4BRSA 4E70A 3RF7A 1EUYA 2YRXA 1UN9A 2XWPA 1W6RA 1O0BA 5MHTA 4DR5B 4B82A 2JGDA 5A7FA 2IOHA 1T15A 4C5AA 3RK6A 2V7TA 1SM4A 2FLVA 2QTZA 1D2AA 2XUKA 4UPVA 2CJWA 1X1AA 2H1HA 4FS8A 5GP1A 1FJXA 3N07A 1B6GA 2IOYA 4BFXA 2PSHA 4O5OA 2A4MA 2HZ7A 2P9CA 3E81A 2PL3A 1L5NA 1LS6A 3PEWA 1NBAA 4OBXA 3RC7A 4DXDA 1AS0A 1FF9A 3JQ8B 2SKDA 5FRDA 5SY9A 421PA 3FM9A 4EKYA 5GMOA 5AAOA 5B58T 2JJMA 3VKHA 4FNAA 2IOQA 2Q4EA 4LV5B 5ALMA 2XTMA 4BO2A 2R47A 2P30A 1GPDG 1PLJA 4BVGA 4C01A 1OB2A 3GP8A 1C3VA 1LFAA 2O20A 2YY7A 3LT0A 4KQWA 1X3LA 4RA9B 5FO1A 4BX3A 2Q3EA 4CHGA 4XWYA 4Z9YA 3R3HA 3VR6A 4LX0A 1P7VA 2WJPA 4JEUA 2SCUA 4PSUA 3HJNA 4LWOA 2XQKA 5FNZA 1UEXC 2HKIA 1FFGA 1YQDA 2XTJA 4F06A 4LJYA 2WAXA 3PEVA 5L3SA 3MIIA 5TGDA 3V8NA 3HN2A 4PICA 3KS9A 3OE7A 4MI3A 2D00A 1OY1A 3L92A 4RDCA 1FIUA 4F6RD 4DMLA 4IGFA 4C4SA 3HDJA 3P8ZA 5K1ZA 5EUMA 5IM5A 2P6PA 5KYYA 4J2OA 3OT5A 3Q2OA 3VYVA 1GA6A 4TVSA 1T3TA 3A9SA 1N75A 2WYHA 2XNDD 1PR5A 2VDMB 3HYNA 4RZSA 5KC9A 4TMKA 5DCYA 3VZPA 4CPDA 4G11A 1T6YA 2OPBA 2QVGA 1OOEA 2ECPA 1A7KA 2L9BA 5BMVF 3IEGA 3FWNA 5DASA 5JAPA 3AEKB 4XR9A 2GJAA 3SE7A 2NO9A 4TROA 1AS2A 1WPXA 2P0EA 2A3RA 5EJGA 1OA1A 4QG7A 3H2JA 3HJUA 3MAAC 4JXJA 5F21A 4DUPA 2FPIA 3WWZA 3PWSA 3CPSA 4I5GA 3AU4A 5D86A 3BH0A 4CIXA 4URWR 4DCPA 4UU0A 1AKTA 2QOEA 3DOOA 3E5HA 4QHYA 4DA8A 2GPSA 3NIBA 3U49A 1ILEA 5CB4F 3SC2A 1CUJA 5AIJA 1I2MA 2J4CA 5K0CA 5L40A 4IRUA 2WI8A 2DY1A 1EGAA 1TN7A 1PSZA 2H63A 2QE6A 1D0SA 3GRCA 3PR1A 3TLZA 1RQ7A 4HO1X 5KYNA 4MQ4A 2X1MA 2DFLA 4OYSA 3CZPA 3WKEA 3RS2A 1NM5C 4A63B 2B3DA 5M5BA 5KOJB 4BNDA 2GBGA 4NY1A 4H7YA 1K3ZD 1HFWA 1PU2A 1S8OA 2F67A 2Q4TA 1K0FA 3ETNA 3MQ4A 4L51A 4R4JA 4YV0A 1QU2A 3QSYA 4Q9IA 5SZIA 3FWVA 1PR4A 5EP1A 1JR2A 3NV7A 3LRTA 2JJ1D 4C48B 3IVMA 1U7HA 2CLCX 4BCBA 3K32A 2NXEA 1E79A 3IMKA 3UF0A 5DDIP 1IUOA 2KS6A 5CMWA 1BZYA 4ND7A 3ROMA 1NI1A 4M0LA 2XMZA 2VT6A 4K5CA 1F0PA 1EMDA 2XYPA 5A5EA 1KMNA 2ZRMA 3GZ4A 4E14A 5GVSA 4B3GA 4LWPA 2A0KA 2DRIA 3C48A 1QUFA 3OETA 4PM4A 4ZQIA 4BNLA 1K7SN 1PT8A 3PC4A 3TZEA 3U16A 4S1WA 3FVWA 3K0AA 2ZUSA 3KXIA 3NU1A 3OQPA 1P60A 2H85A 1JQEA 1P75A 1UJ6A 2HCJB 2OCIA 2ODNA 2OWEA 1SEVA 4NARA 3FFXA 5CJ2A 3T94A 4G0QA 2YY5A 4EIWA 2JFPA 1RM4A 4S12A 3GLFE 1UK7A 1FX0A 4O2BF 2D7CA 3HCAA 2YMPA 4UE3S 3UUEA 4NZ9A 3RHSA 1A9XA 2I22A 1XN1A 4I3HA 3ZEAA 4OYLA 5GQSA 3CNBA 2HQOA 4MVJD 3RFCA 3ZGYA 4B7CA 3NHSA 4LIPD 1PUXA 1C0EA 2GK7A 3P97A 3PPXA 4H7IA 4LRYA 5LQAA 4F11A 3MOIA 2NVUB 5ELXA 3CLSD 3FUCA 4IX1A 1QO9A 3AFIA 3RGWS 1LZKA 4G37A 2C57A 3G5UA 5CXXA 4M1QA 1RJGA 1RYEA 3PHLA 2NADA 2V9ZA 3L6AA 3AVWA 3ZJYA 1OB5A 5HQ8A 4CZ2D 3P4UA 1N0IA 1U2DC 3E37A 2QL7A 2G4VA 1VYUA 4G0PA 2ZYVX 1NONA 1Z3CA 1NBMD 2AS0A 2DFNA 1V2GA 1LBSA 1ORTA 2IT1A 5BR1A 1HZZC 2CXSA 3B82A 5CMLA 4AX8A 1K89A 4RHUA 3ZY6A 4F8JA 3QVWA 1P1IA 5FUQA 2CCJA 3CLTC 5BV2P 3IUSA 1CRPA 2R2GA 1F2VA 4X64B 2QM3A 4OGGA 1YBHA 3EVTA 1E9RA 1BJRE 2JD0A 2Z6VA 1CB0A 3IDAA 3WS7A 2WSYB 3V1NA 4BEJA 4EHNA 4GIBA 3W8RA 2X22A 3IPXA 4J4TA 4LBZA 3SS9X 1APBA 1PR1A 1NPTO 4J7XA 1EK2A 4ZOQI 3AJ8A 3UJAA 2B1QA 4O4HF 3U2QA 5KMGB 4OL0A 3EY9A 1T3ZA 1R9NA 3LY9A 1D6JA 1H8HD 3ZNOA 3ZXIA 2V0CA 3ANNA 1JQAA 3ZHYA 1FVOA 4AMVA 4BVFA 2W2NA 1MHTA 1R15A 2ZI9A 2HHLA 1PP4A 1U7UA 1W96A 2H0RA 4IW3B 1QGED 3KXLA 3L41A 4RABA 4V0MA 3I76A 1AKRA 4C08A 3DYVA 2ENWA 5I01A 1I30A 2P9BA 1YOVB 1F6BA 2QGZA 2QLMA 1OLOA 2B5OA 2O1EA 4CM1A 4AYWA 4MLPA 3L49A 5FJIA 5AFSA 1SXJD 3K0CA 3D4LA 1PJRA 2OZLB 2CMDA 3C7KA 5DX8A 5KX5B 2YQ8A 1UZAA 3JQFC 1QIFA 3O83A 2IV2X 2ZWAA 3PFCA 6GPBA 3IT3A 3SHTA 3TSAA 9GPBA 2WD7B 3KETA 4NFHA 4D02A 1H1TA 2WTNA 4TWIA 1UOOA 1V8ZA 4OH1A 2RI0A 4BFSA 2XD9A 3VH3A 1PW5A 5JQWA 3UK6A 5JD5A 4Q6BA 3KHKA 3GC6A 1EK6A 3VYRB 3WB1A 2BI8A 2E4XA 3C4JA 3RSLA 2HGSA 3A2KA 4LZAA 4BFWA 2O1SA 2FMHA 4EO4A 2XMRA 1F9EA 3PGKA 1TZKA 1IXVA 4HYQA 3QFCA 4KH1A 4B6FA 1FNNA 4YDSA 2UAGA 1JFVA 1QRAA 2WP0A 1P9LA 2NP6A 3R3YA 1OXTA 3FVRA 4IVRA 2WMOB 4FNOA 4PZUA 3GLFA 2FSVC 3GLIB 4QZVA 1O1TA 1EVIA 3CSTA 2Z1DA 3GNTA 2B1RA 4EB6A 2XYVA 1MDFA 4AMUA 1N2SA 1O87A 4X7RA 3HNRA 4D79A 1E7UA 3H9BA 4Q47A 4TS9A 4BQNA 1L3IA 1G3QA 3M6MD 2DP4E 1D8AA 4MIEA 2I0FA 5CH3A 1VRCA 3KYJB 1C3OA 1EIZA 2A5LA 3PE3A 2ATVA 2BF4A 1LDMA 2R11A 5ERXA 3WE7A 2FVYA 5EWJA 2OCXA 4O1HA 2JVJA 2F43A 1L6IA 4B85A 4O4JF 3BCSA 4YT4A 3AUKA 1VE7A 3GJXC 5E7MA 3V6MA 2EWWA 1YRLA 2PSDA 1V7QA 1CQIB 3SY2A 3SYLA 5EIDA 4E4RA 2CT8A 1PFVA 1MQAA 4EHMA 4KL8S 3SQLA 3LTEA 2VK2A 3V9AA 2PR2A 2GRPB 2AJ8A 4NOKA 3ZWDA 2R96A 1KQPA 1WU8A 2JI7A 1YCFA 2A0XA 1SULA 3MGAA 1Q0LA 3D0OA 4HDKA 2YMMA 2ZUBA 2XZOA 3I6MA 1OE0A 1PNRA 5LPNA 3NDJA 2HYDA 2QUIA 3A3OA 4ZI7B 1P2VA 4HRNA 3DVQX 1O57A 1Z7YA 1U2ZA 4LDPA 2RK6A 2HLPA 1KKLA 4TLDA 4ZVVA 4JPSA 2FI7A 3ADDA 4YRGA 3LJ3A 1E8DA 4B46A 3GFRA 3Q9SA 1O96A 1T9GR 4IDPA 2VYVD 2IWRA 3IMFA 1M2VA 1M10A 1O08A 4QOIA 1R0WA 4IVNA 4J7WA 1A2KC 4BQSA 4D43A 4N3CA 2PKYX 4OD0A 4BX8A 2WVHA 2GASA 2H18A 4AECA 3H3XA 2G1AA 3GEPA 1GPWB 3RAEC 1B41A 3TTTA 3TS1A 2A14A 1WXQA 1K2VN 5KINB 1ID1A 1OH5A 3P9ZA 1IATA 1Z74A 3LK7A 5SYAA 3FTQA 2W6PA 1EB8A 2JPDA 3QOUA 2A9RA 2YN2A 2PMFA 4J90A 3BF7A 3V6LA 5JSFA 2AA3A 3FZGA 4JP1A 2G9QA 3W5DA 4M6WB 4CM3A 1D2NA 1NKTA 1M9NA 2IYXA 2NM0A 3MT7A 2FUNB 1J9GA 4PS7A 3C14C 1RRMA 2ONJA 1N2JA 3EASA 4MMZB 1U2EA 5D0OD 1SCAA 4ZHQA 2DUJA 3GA7A 4GRDA 4WAUA 4RNCA 4M0PA 2LNIA 2YBEA 3BWMA 5DEIA 4EZLA 3BRWA 4I6JA 1E1NA 2DLDA 2Y1CA 1RI1A 3D6VA 3JQQA 4L0DA 4MJLA 4AO7A 3GW4A 5JMND 1NYRA 4QU5A 4GLBA 1XKTA 4OHUA 2PL9A 2W71A 9ABPA 2F3QA 1UOHA 2R6HA 4HVLA 1QHFA 2PSEA 2ZPTX 4N8DA 4D4MA 3VTXA 1FFAA 3F2IA 3IQGX 5I7FA 2DZOA 1PWEA 3I62A 1OXJA 2CYAA 3AG6A 3EG9A 2C54A 1XWWA 3NOCD 3SZMA 1MGPA 4UDXX 3ZKJA 1Z83A 1ETUA 4DBZA 4J0UA 1MV8A 5FI3A 3LL7A 2GN0A 4K40A 1U4NA 3QFHA 4BBJA 3A6LA 1UZLA 3WGHA 5CDFE 1N5KA 1TR4A 4PCUA 5JCOC 5MN4A 2ZYHA 2HLDA 4N3AA 3HCWA 2AJDA 4AN0A 1JE0A 1M5TA 1XDUA 2WG1A 3AZPA 3PPWA 1CQZA 4TLEA 4W7SA 5FFFA 4H15A 3ZFWA 3VPXA 2QTGA 4QE3A 6ADHA 5FWQA 3CS3A 1OA0A 2VVTA 1XZMA 2DLNA 1T9GS 3IHWA 5CFNA 1BE8A 3ISJA 4HF7A 3S1AB 1WDYA 1PGOA 1ATZA 2AZMA 2PGJA 3DMRA 4M99A 2QRVB 4HEJA 2HPZA 2BGTA 2HSZA 5DX1A 2DAPA 4OJKA 3TMKA 4BFLA 2C4MA 5L6MB 1J06A 3KX2A 3S29A 4BFYA 5B1IA 2WDZA 2X0JA 1MFZA 1QU3A 4ZC8A 1KYXA 4I2ZA 4R9NA 1DWPA 2IH5A 5A0VA 2IYRA 1JEQB 4IRUB 1XKQA 1Z36A 3MTBA 3OE1A 3VXKA 1M1NB 4JLWA 4NDNE 4E51A 5D3KA 1QK4A 1XRJA 5JLAA 4B17A 2OCKA 5LZ2A 4OQDA 5AJTA 2XOKD 1WS6A 3PBKA 5JT1A 1VJCA 4PQFA 2KBFA 2P41A 2PX4A 4R2XA 3TLKA 4ZTUB 3URMA 3P0HA 4XKJA 3ZZ0A 3D3MA 4DL9A 4HEA1 3R5TA 1LRJA 4EG8A 4UZEA 2ZIUB 3G5MA 1E69A 4TRNA 1JAXA 1NP3A 1XD8A 2G04A 1NE2A 4I4NA 4CGVA 1O8CA 3FHCB 1V11A 4F91B 2IC5A 4TSKA 3KTDA 1GUZA 3FOWA 1YB4A 3OHPA 4MS4A 1K8YB 1LLDA 4U95D 3PNBA 5AOAA 3HPQA 1B1CA 1CUGA 1L4YA 3E7XA 4S24A 1WXIA 2CK3A 4YUAA 1G98A 4M7PA 3QUBA 4WFQA 2E2WA 3L0DA 3O4HA 1O1RA 4HLUC 3HEAA 4JUBA 3CVPA 1Y6QA 2AG8A 3JRNA 4GS5A 5EE9A 3RVSA 5BT1A 1WAMA 2CLLB 1VHQA 3JQGB 3E33A 3AF3A 5C1IA 3DM5A 2GZ1A 4FVTA 4D9JA 4EI2A 1SWVA 1IXSB 3RADC 1ENYA 5H9VA 2PHZA 4OBEA 1RPNA 3LU1A 5L53A 1DEXA 3GAFA 2REOA 4AUMA 2DQKA 4EG3A 1V16B 2G9NA 5DM60 1M1ZA 5E1OA 4DAEA 1MN6A 1GRRA 4ZMRA 1FX1A 3NASA 2ORWA 3DL4A 4FKBA 2CXRA 3AV0B 3NB2A 5KYWB 3HL0A 3N2YA 5CH5A 2ZJOA 1Y1QA 3ZYMA 4U0JA 3V4SA 2WXKA 2V6IA 3A9TA 5JJCA 2BTEA 1JEAA 2NSJA 1I4TD 1QRDA 3Q3GE 4RKEA 1VLZA 4R7TA 1KDRA 1AGPA 3K1TA 5AKGA 2EIHA 2RGAA 4ZJPA 3VSEA 5CDYA 4MR8B 3AF5A 5B1HA 4G1EB 2XXBA 5C7LO 2Y1OA 1VYTA 1NVXQ 3BXFA 4RMGA 4MWOA 3HYLA 2LV8A 5HKKD 3PD0A 1KQFA 3K71B 3RYTC 1E3WB 2CCKA 4G0XA 2SICE 4UHDA 4HDKB 3IAS6 2A9VA 5HNKA 5LMCA 4UXJA 5JCZA 2WIJA 1JX6A 2CW5A 2GM5A 3DT9A 4PN3A 1WKCA 3F0TA 1SGWA 4OGLA 1SUIA 3QFTA 1C7FA 5J47A 2HUPA 4DPMA 4FJYA 1LF5A 3BJIC 5HJ5A 4OHYA 3RK1A 3CR3A 2YS6A 4CCSA 1UH5A 3GYGA 1DXYA 1WW3A 5GV7A 3AF2A 4DARA 5SY4A 1GWNA 4BVHA 5HOQA 1FMCA 4BLUA 2WIGA 1SXJE 3C6QA 5BXYA 1TUBB 3LWDA 3AKCA 1GPUA 3KKEA 1W9HA 1WCWA 5AK5A 3RAJA 1Y7HA 2GH1A 3SFZA 2V54A 1K5DA 3NCTA 4RVDA 5BWCA 3ETHA 5LZ9A 3U26A 3SQVA 4B79A 4I5EA 2CVHA 1OY3D 2WSBA 1EX6A 1P3DA 3KWMA 2WW8A 1EH5A 2RGUA 4KXXA 4O2AA 3ZHTA 4N3NA 4W1RA 3P5SA 1JE1A 1FRZA 1ZNWA 2VI5A 4Z0PA 1UPTA 1RIIA 5B12A 3DHYA 3OQHA 4GD3Q 1Z62A 3BE8A 1QV9A 3B7UX 3PJEA 4WNCA 3U5TA 4PO9A 4EAAA 4RSMA 1KK2A 1ZD8A 2JEOA 3WRXA 2AG6A 5JYBA 2CV0A 2I9KA 5CW1A 4TPKA 3ZLJA 3B3JA 5AVOA 1T26A 3FHLA 4PYRA 3FH0A 5FWDA 2VYND 3WKAA 4EW1A 5BQFA 4QYMA 5KVVA 3V1MA 3AX6A 1H94A 2B35A 2P68A 4G0VA 5T8KC 4TWBA 1OYYA 2IY7A 4KSBA 4E5PA 3DMYA 2FLKA 4JYZA 3KPJA 3Q0IA 2CEKA 3K0AB 4DLNA 5MFPA 1A5ZA 8AT1A 2J3DA 4J6EA 1DPFA 2DM6A 5AJUA 1R4ZA 1DMSA 4FMPA 4H6VA 4N03A 4EP1A 5TX7A 3G0HA 4BUZA 3LX4A 4WH0A 2PFKA 1ECBA 2O8DB 3EF0A 4C76A 4G5XA 1BMTA 3G13A 5K20A 4EQ6A 1HPLA 4KXUA 2VQFB 3T9DA 1LEHA 4AJ9A 2B94A 4D7AA 1AZWA 2X4GA 5EI5A 1EE9A 3JX9A 1BQEA 3A58B 3E35A 1T9HA 4BO4A 2WU0A 1DXQA 4RZ2A 4L02A 4RL6A 3LCUA 5K9ZA 4K6FA 5JVDF 3C6MA 1O95C 1Z7BA 3ELWA 5G1NA 3RWMB 1GUFA 2Q46A 1RZRA 5AHKA 3AZQA 1E6MA 2WV7A 4AZVA 2PUJA 4AJOA 4XE5A 2ASVA 1RTTA 4DILA 3O2QB 2PEZA 4BEBA 3TIXB 5EWLB 5JAMA 2J9FA 2DBZA 2W6ID 2ZYAA 4RZQA 1IBLB 5TEWA 1RLMA 3FIJA 1GN8A 3K09A 3P7MA 2O7NA 5BVGB 1BXRB 2BGKA 4R8MA 3WYFA 2Y8EA 5BPFA 5IT0A 1V0JA 1P4HA 3QVTA 3PXGA 1MABB 3W4KA 3QJZA 1NZJA 3AI2A 3LGSA 2CCGA 4GMHA 4UVIA 1I3OA 4BFVA 4OEHA 3L22A 4E5VA 4EG5A 2NSDA 4IKOA 4PNHA 1JKXA 2C2GA 1VSTA 3I4LA 1KXZA 1GR0A 1PX0A 3FJYA 4RLQA 4YCCA 1IK6A 3MJRA 4TL9A 3MT0A 5BQ5A 3U9TA 1QZUA 3MOSA 2BVNA 4BQOA 3WMRA 3HLTA 1EX7A 3ONEA 4AP6A 2H52A 3CLRC 3GZSA 2APJA 2KSQA 4BUCA 1XKLA 3TX6A 5E7IA 4UUMA 2I2BA 5CJJA 1K8XB 1Z5PA 4MR9B 2GK3A 4BMZA 2JIPA 1RBYA 1ZONA 4Q9KA 3WMFA 4YJHA 1QB8A 3NEJA 2GJSA 4O6VA 2HA3A 1BEEA 3VVBA 5GPBA 1IUNA 1Z3YA 3MVEA 2P8JA 3ZYLA 1PUJA 1FU4A 2QSUA 1THTA 2VP3A 3KQOA 3KSZO 3M89A 4MVCA 4EMTA 5B5SA 4AIRA 5JPDA 1KOFA 1VGQA 4NBVA 1VL0A 3H6HA 1MA0A 3MINB 1NRIA 2IU4A 1JDVA 2M1XA 4LUCA 5DYYA 4DDKA 5HM8A 1NAIA 2CV1A 4E3WA 1FUYB 3FOFC 4GOMD 3VJRA 3NHJA 2WWWA 2WNHA 2OFXA 4DSOA 1JEYA 4H1UA 1E90A 2BM0A 2WG0A 1XU9A 3H18A 1BX3A 1OGJA 1UFOA 2WF7A 4KFSA 3T12A 1T8RA 3FYTA 2ZRNA 4M1OA 4R3WA 3L1KA 1ZR2A 4ZV7A 3I2JA 2VN8A 4LNUD 3PTZA 1EJ2A 1UPUA 2EOAA 1MEEA 1XLUA 3PHJA 1H0KA 4RD3A 1G3RA 2ATIA 4B34A 4GT1A 4D6YA 1A8IA 2QG4A 2OP1A 2YDYA 3PC7A 1CDOA 2IEAA 4K2AA 1LDNA 3M5CA 4XQ0A 4EKDA 5FTLA 5I6DA 2D0DA 5JWOA 2J45A 4MV0A 5TQJA 3KPWA 4NMHA 3QOXA 1CY4A 5AN8A 4FC8A 2EFHB 3E9MA 4N4AA 1N6PA 2PTGA 1WG8A 1KYIA 3BMQA 3EVAA 1RFLA 4QOSA 1ONNA 2CXQA 5GINE 3AR6A 3CIOA 4NJMA 3O95A 3EWAA 3CN9A 4FFVA 1F2TA 1V4NA 1VIVA 3EDOA 5ILOA 1XZGA 2BH9A 3KKNA 3AU9A 3L18A 4EUEA 1Z6AA 4JT8A 3VO1A 3IBEA 3T1HB 2VWGA 3EAQA 2H7YA 4M9CA 3TDKA 3ZTTA 4EGAA 5AUPB 1C50A 2FCRA 1NJ1A 2Q3FA 1X7DA 4F3KA 2C9DA 5A5GA 3H0KA 4TYMA 5EIFA 1HDCA 2X8JA 3GT4A 2OGUA 1T1SA 3TBHA 3OSZA 3ROZA 4XVUA 2IXGA 3DZCA 2OXCA 3DD1A 4XWWA 2MYOA 3EC2A 5KWDA 4DWOA 4UMDA 1DNPA 3WL7A 4HMQA 1WP9A 1Z33A 2GD0A 1EUDB 1KY4A 2UYHA 1X1TA 1KAEA 4KC0A 4LGYA 3BH6A 3WLFA 1DCEA 2QTCA 2YHUA 3B70A 2HK8A 3BQOA 3O31A 1ICIA 3FCYA 1PRYA 3S7BA 3U13A 1WCV1 4FN5A 4CV3A 1E60A 2QRQA 4DJJA 4HNUA 4AC9A 5K99A 3K2BA 1QG6A 3NBXX 4YWHA 3ZH2A 1TNDA 4NHOA 3TTSA 1F1BA 4MDFA 2QT1A 1T3SA 2IU1A 2X8WA 1Y33E 3ETJA 3FIUA 3FKQA 3BILA 3GGGA 4EJ2A 4LKRA 1K8KG 3ELYA 4BJ3A 3KEOA 1NJ5A 2Q2WA 4DRZA 3DL2A 4S2EA 3ULKA 3W8FA 4GC5A 2QX4A 5FO0A 3WOVA 2ZZNA 2HCTA 3ROQA 4S05A 3UBMA 3OJFA 1W87A 4MP6A 1BCRB 4C4XA 3DVAB 4UHJA 2KCVA 1ORVA 5EIAA 2PNJA 2Q6IA 1RJFA 1N9GA 3P52A 1UMCB 2J4FA 3IAM1 3Q8XB 4OHXA 5TJHA 3UWDA 4JVNA 1IVNA 3ZU3A 5IJWA 4P54A 1LC3A 1R8XA 3PIIA 3NKVA 4NJMB 1JQKA 4X8MA 3VO2A 3EVEA 1EBFA 2W0SA 3D02A 4J0KA 4BJHB 4EHLA 5CCLA 3CUVA 2E49A 1UKCA 4C14A 1MV5A 1MJFA 3LYHA 1SUBA 5ALIA 4WKPA 3A27A 2Q5EA 3ZHXA 2H57A 1A4UA 3TLAA 1XHEA 2A59A 3OPQA 4FHCA 4H7FA 1DAOA 1U63A 4QG3A 1W2WB 5C35A 3LVBA 1A71A 4NH4A 2E4VA 5LJIA 3QEBZ 4MWBA 5EJ4A 5AHOA 3FGZA 1Z7EA 4OXYA 5KO2A 2EQAA 5F2KA 3AUAA 5ULLA 2Z3VA 4EQFA 1CJVC 2PGIA 2QAGC 1WEKA 2VEOA 4MWTA 4R2HA 4ZOEA 5JPIA 4QOGA 4G1TA 1UT5A 3M5PA 1J4AA 3MEQA 3HXFA 2NSLA 4F93B 4H3HB 1XC7A 1GIAA 2YXPX 1M34B 3EW9A 1IEWA 1GKUB 2AD1A 4JL0A 2IPAB 4IDNA 5BP7A 2Y3AA 2PBRA 3LKBA 3WLMA 1DS6A 1N11A 1NG1A 5JDIC 2WU1A 8LDHA 1XU7A 1A9YA 2KB0A 1NXWA 3EXEA 2WXGA 2V6GA 1T4DA 3CWZA 5BO5A 5HDBB 5CXQA 4ZRDA 2BFBA 5F52A 2P5UA 1NVUQ 1WXXA 3R7LA 1NHWA 3E4DA 1V37A 3NGMA 1EVKA 4EW6A 2OHJA 2I3DA 3MILA 3Q72A 3NAWA 2XUQA 4U2DA 1OJ7A 3EZ2A 4ND1A 2V9PA 2OV3A 3NRBA 2OO3A 3GZTB 1I3LA 5FUBA 2UWJG 2EW2A 2QAGB 2QTMA 3H5OA 3PIDA 2KLBA 1XZLA 4Q03A 5DK6A 5FPQA 3Q15A 4IJQA 3UIOC 4A26A 4C7OB 3HY3A 2ZJYA 1XZFA 2A5JA 4L15A 4JOBA 5TARA 3PR3A 4FFDA 2XYQA 1GW6A 3QMWA 4ESEA 5JLJA 3AOEC 1NX6A 1Y8ZA 1RTKA 3UAZA 2CGEA 1RC1A 1E1KA 1G2PA 3SBXA 2H0QA 2X58A 4CM6A 2PX6A 4HBDA 1FDWA 3FYHA 3D2AA 4KPGA 3BRCA 5A4AA 1FRVA 1ZRMA 3FDXA 4I19A 2OV2A 1IZ0A 2ZB3A 4ITUA 5CX1B 4EI7A 4LPSA 1VOTA 3BAFA 4RY8A 1P45A 1KQOA 4N0EA 1LBEA 5LQJA 2XPZA 3ZHQA 1A1SA 3RVRA 3IIMA 2GKSA 4MW5A 1U8AA 1XTSA 1WB5A 3HKDB 3WYAA 1EWRA 5BPHA 5G0TA 2I3AA 1RRKA 4TL8A 1JUDA 3A0RB 3F67A 2ZBRA 5F78A 5AXCA 3WNVA 3CUKA 1G3IA 1GVHA 3I32A 4TVBA 2Q9UA 1NLZA 4KXLA 5D1HA 1EJBA 4JVMA 1T8SA 4KIFA 4BVJA 4F1PA 1HA3A 2BBWA 3U3OA 1KRHA 2D2EA 3JR3A 1Y6IA 1XZBA 2H65A 2LTAA 5FUMA 2HYIC 1NA5A 4U5QA 1HLFA 2RGEA 1VI6A 3A1FA 4YA6A 2P6RA 4NONA 2J87A 2FQYA 4INPA 3RTEA 4G1CA 1CD5A 2QNBA 4K1XA 5FQNA 5EJAA 3DWIA 3IO3A 2PS0A 4XFDA 1GFIA 2XHZA 2GWRA 1CP2A 3CRQA 5B3LA 4KXYA 1PKEA 4R8VA 5DP1A 2H4WA 3BDAA 3D0QA 1QBGA 3GLQA 1IBCA 2YJ5A 4OX9Y 1Z12A 3C16C 1XEAA 4ARZA 4TWJA 4L0MA 4G84A 3EQ8A 2R65A 1LSJA 1LBTA 3KNZA 2FN7A 1E9FA 3AYXB 3HJBA 7GPBA 1RPAA 2O7RA 4I55B 2X40A 3R8CA 3QNWA 2F8LA 4YO7A 3F8SA 3RK0A 3TXNA 1DKLA 5DSZA 2GF2A 3FU3A 2J0VA 4EKEA 1WEHA 4PYQA 3FUNA 3VU9B 4YAIA 2FMUA 3NEPX 2F9FA 2A0FA 2FMKA 3H2BA 2H3EA 3PZ1A 3DEJA 4YDEA 4FYHA 3CKBA 4M49A 4RFVA 1OFTA 5G1PA 1ADYA 3IESA 3M4JA 3OJCA 4PGMA 3VPHA 1KSGA 2XGGA 4ANUA 4IXWA 5HF6A 4LFBB 1S01A 2NLOA 4GM4A 3O94A 4LYJA 3VR4D 4C1BA 4TTVA 3OOSA 3A1CA 4W4TA 4B8CB 2C2OA 5F9HA 3TUIC 1N8NA 4URHA 3WISA 5E0KB 4RA9A 3D8BA 4G86A 2BP7B 1JJAA 4U7FA 5E38A 5CFZA 3ROPA 1C81A 3L6DA 5ECDA 5CA1F 3KQHA 4XQCA 3PVZA 3MCVA 4OKSA 5FF9A 2C94A 2V03A 1L4KA 4JY7A 2Q2QA 1J5PA 1C7JA 4M54A 4Y6SA 5DLEA 4ARUA 2HMUA 2PQMA 3F7OA 4IMJB 4NJEA 1USVA 4J49A 2WA2A 2L6BA 2DBAA 4AY4A 4D80A 1E4VA 3Q73A 3QKYA 3Q7IA 5F5XA 1NLYA 2ZJ8A 2ZETA 3MBKA 1VMDA 4A2WA 2KW5A 1GJRA 2R8BA 2V7BA 4RIEA 3BIXA 2XD4A 4D45A 1CK4A 2XH8A 1YL6A 2H16A 1QCDA 3O3OB 3G8YA 2QZJA 3WK6A 3AIOA 1XXHE 3LLMA 1TUGA 2OZPA 3IEIA 3PNQA 4FYPA 4RESA 3BGIA 5UKDA 5KYYB 1RW4A 4FW8A 2HV8A 2O3JA 2Z5LA 3H1EA 3KQWA 1BKYA 4JWKA 4L4XA 4QAJA 2R84A 4QJ5A 1E0SA 2Y4NA 3QUTA 3FFTA 2WWGA 1IBRA 3EBPA 1J25A 2ZSEA 4A1FA 1J5XA 3GL9A 5U1PA 1VKZA 3WDLA 3ZK9A 4MW4A 5FP0A 1W85A 2IDZA 1L5FA 4ECAA 1TPYA 1IQRA 1NF3A 4KAFA 2QRNA 3F1KA 3ZV7A 3O4FA 3OX1A 3TWWA 4RJTA 5CM9C 1YI0A 2FK7A 5HXAA 1BGWA 1EGHA 2FWPA 1QIJA 1A04A 4IDBA 5PGMA 5CB4B 7ABPA 4C6TA 5EINA 5G3ZA 1T6XA 2MHKA 1E1QD 5AR1A 2FFBA 4AKSA 3E2MA 4ETNA 5JNTA 3TZQA 4JLBA 1A2OA 5JANA 3GLHE 4CL8A 3FUKA 1M33A 1CRQA 3N0TA 2IEIA 5EKUA 1SCUA 4HRAA 1K7YA 1PV4A 1DWOA 3DB1A 5A4FS 3T5XA 3IR6A 2FG5A 4P34A 3P27A 2RCYA 2ZBQA 4JGBA 4YHHB 3KFXA 4Q3OA 4D3SA 1BD8A 1ZCFA 4WFJA 1YZ3A 5CLJA 1E8NA 2H9IA 3OF5A 4DLSA 2Q1WA 2VFAA 4II7A 3JD3A 3BWXA 4YRBA 3LV8A 2A94A 5IXYA 3EEFA 2BONA 1DIHA 2RH9B 1NC1A 1RAFA 3Q3HA 5AWFC 3T7TA 3WLTA 3T4EA 3KE9A 1E8ZA 3TG4A 3E5MA 2COUA 4BLPA 5CCEA 4M55A 2G28A 3N0VA 3O1IC 4FMCF 5DV9A 2GKOA 2PQ2A 3WHIA 1CERA 4DLAA 2FEXA 1N77A 1ZZEA 4MUGA 2CFUA 4Y9RA 4WJLA 3OIUA 1NTOA 3TUZC 3OQNA 3MAGA 5CMYA 3Q0EA 3CRMA 1ORWA 1URPA 5DHAA 2VJ8A 2UUBB 1LLCA 3V3TA 4HPJB 1RC0A 1LQ2A 2HEGA 4C04A 1CNEA 3R9AB 2ZITA 1M83A 5CDTA 1RBZA 5IG2A 1JEJA 3PQFA 1XPUA 2VPTA 2ZVDA 4ZGGA 1DKPA 3HABA 4R7LA 5EYLA 3Q87B 1MBZA 2X0EA 4GMDA 4YMVA 5FOXA 4WDRA 4XPIA 4H1TA 3RAFC 3CLKA 1EGQA 3JWJA 5CP8A 3RU7A 1AK1A 1L4BA 2E82A 2FPLA 2W0MA 4IDGA 4KR9A 2EDCA 2FO7A 3CO5A 3DLAA 4XE0A 2FVXA 5EXSA 4CJXA 1EA5A 3DBSA 2OCDA 3ZD9A 4OFXA 2R1TB 2XNJA 4RSYA 2HJHA 2BZGA 1WMAA 3TQSA 4DIEA 3SICE 1BVYF 3HXDA 3GARA 1REQA 3V2HA 3RVQA 4M86A 4G0NA 5AIAA 3ZXXA 2QVZX 4W6QA 4F9EA 2CNBA 3FOEC 1MX3A 4UQXA 2HFJA 2ZE8A 3MM4A 3ICWA 1QYCA 2RJOA 3EBOA 4CWAA 3FF1A 3P9YA 4MMXB 3ND8A 1ULBA 1JECA 3FVQA 3ESZA 4BKMA 2ZROA 1PS8A 2FCAA 5FA5A 2O2DA 3C5VA 2VBIA 3H86A 1XF9A 1EDOA 1X1DA 2DCPA 3CSSA 3EA5A 3QY0A 4H3KB 4I1IA 3OXFA 4B0OA 5HW0A 4AQYB 2PKQP 3WKDA 2R4UA 2ILRA 1LW7A 3R5JA 4KEAA 4EPWA 2VP9A 4DA7A 4I55A 3LPMA 3OHMA 3UGTA 4YRMA 1Y48E 5EXXA 3SVZA 2FUCA 1ZHHA 4KXQA 5J58A 2BYTA 3ZHZA 2QUAA 4HSEA 2D5IA 3LP5A 4YC7A 4ZEMA 1NVEA 1HT3A 1AM4D 1C2TA 1H2AS 2IDMA 3ETCA 4N7BA 4QIHA 5FLKA 1OWLA 1KAHA 3LUAA 5EMJA 1LD3A 1Z0UA 2I62A 3EC1A 4GI5A 4OUDA 1M6VA 2NWQA 3G9UA 5K4HA 1I51A 1FW6A 1L2TA 1DCTA 1M0EA 4GFDA 5T64A 1LK7A 2QORA 4UTNA 1BKSB 3NDPA 1N4AA 4BNKA 3IILA 1AB5A 2MJLA 2WLSA 1E7SA 2WKRA 3FNHA 1AVTA 3NJRA 2LO6A 2QGFA 3OIVA 3PT5A 3R3JA 4ASUD 1P2UA 3CCFA 3OTQA 2JC3A 2HFKA 2QMHA 5KJ6A 1NYQA 3RWOA 2PLFA 3QLVC 5H80A 1V3VA 1KZ6A 2HPVA 4QEDA 1KEEB 1P2BA 5ENRD 1CUZA 1SCJA 2GJKA 2HCFA 2GGFA 3NHWA 3S2GA 2GPYA 3DZ8A 1PT6A 1WAO1 3ECSA 3VR4H 3ZV3A 3RYIA 4TZTA 3FA2A 5F33A 3EJ6A 3ZD7A 4C0KA 1U1EA 3O4GA 5LM3A 3FMGA 4TMYA 2HJVA 2H6HA 2VT2A 2V7PA 4U7HA 3JRWA 5D66A 4RLFA 4L7QA 1WD5A 4MWZA 1PX2A 4RM3A 3BHJA 4RZIA 3UGQA 1R6DA 3CX8A 4QGAA 5FPTA 1X7YB 1EQ2A 3G9XA 1P3JA 1SBIA 5TRTA 1WKBA 4R0MA 5T67A 1PW7A 5FNVA 1BCSB 1I8TA 4WZAA 4WTOA 5KWIA 5C53B 4J1TA 1HX7A 2WU8A 3KOOA 5E8JA 4V0OA 5DTEA 3KEGA 4ZHQB 4M9QA 2V5AA 3RU3A 1QP8A 4YDHB 1HF3A 4LY9A 2W9XA 2YJGA 4R2IA 1SQ6A 1TM2A 3O3NB 2DSTA 4L8VA 1XRSB 1KI9A 5E75A 1IOLA 1QC5A 2HQRA 3ZDYB 3ZYQA 4P8RA 4UM9D 4BTVA 4QQRA 2MCFA 3ZV6A 1LNQA 1Y8MA 3DONA 4BRUA 1QBQA 2HSEA 3QUSA 4RJLA 5EQTA 2WE7A 5KWVA 3F6CA 3FLAA 3OCUA 1MG5A 3B89A 4G0ZA 3FTEA 4BKPA 4CTMA 4L57A 3WLKX 4BNDB 3HUDA 1T1RA 1QGUA 5KQLA 4LYAA 2V8SE 4PGFA 1WULS 2KX7A 3HU1A 1GQOA 2CXXA 5KAPA 4RTOA 2JIMA 3GVXA 4M3OA 1KH3A 3DVLA 4BTLA 1RJEA 4JT9A 2OO5A 1FYXA 3EPPA 3K94A 3ZVVA 4KW7A 3AFNA 4PTLA 3Q85A 1PQUA 4RVUA 4FHJA 1TW2A 1WXWA 1ADGA 2AV6A 2CUNA 3BA6A 3CT4A 3OOHA 3P0JA 2NNWB 5LWQA 1G59A 2PBFA 1W88B 4B43A 1CUSA 3HUTA 2AMVA 4ZHBA 1JLKA 4ZI5A 1E2GA 3JYOA 4AZ0A 1WBBA 3UJBA 1A2QA 1L4NA 4YUZA 2JI8A 5K6RA 4HWRA 1KNQA 4GTMA 4WLEA 1P9NA 1EQUA 2G7ZA 5JRZA 1Z17A 4D25A 5AP9A 2Y67A 3VR4A 1YFJA 3G6WA 1H93A 1OT5A 3UK2A 4DF3A 1MYOA 4N9WA 5EP4A 3REOA 2Z09A 2FEPA 5HI7A 1I3CA 3N0WA 4ER7A 4EBFA 3T4UA 1NLMA 5LZ5A 1JDUA 1FSSA 1B8OA 2C96A 4N6OA 2A9FA 5LR6A 5AW6A 3OXGA 4UTXA 2OKCA 1ZGAA 3HXBA 2OG1A 2QUJA 3HZHA 4LCBA 2QG9A 3Q3JB 4CG0A 4HX2A 2ZGGA 3R09A 4AZ0B 3OLWA 4BX0A 1M2OA 2FU5C 2XMQA 1TM4E 4QOHA 1NU6A 2IHVA 2ZJZA 1L7XA 3G3EA 5GM2A 4V24A 2AN3A 4N82A 4L95C 3I2FA 3D8TA 2PM7A 1SXIA 1UBTS 5HKLA 5I9BA 3SSOA 3H4MA 2GNPA 2JH9A 1XUOA 1KP3A 4EBAA 3QTTA 1Q7BA 4R5HA 2TMKA 1C9EA 3RC9A 4AVXA 2ZQ5A 3QLVA 4U2KA 4YR7A 1YCHA 4ZC1A 5G2NA 3E0QA 2B83A 3WGZA 5CA0B 4RIGA 3SZGA 4F84A 3O74A 3NVDA 3D81A 1W52X 2IUYA 3WIEA 1DUSA 4LVCA 1ULTA 2AMFA 5TQ2B 5MGNA 3KZCA 3DSXA 2NZYA 4MWSA 2WF8A 4LOHA 3QYAA 3L08A 1OQAA 1RADA 1X14A 1F8YA 1KP2A 1CUHA 1RWXA 3PICA 4JITA 4Q19A 3URKA 5HF5A 4EZEA 1T1EA 1QOPB 2BM9A 4BNMA 1QF6A 3EYAA 2Q7DA 4XEHA 5DWVA 4KTVE 1H2UA 4ALNA 2PUDA 3ITEA 821PA 1P9WA 5JH7B 1NN5A 2Y1FA 4GR4A 1E92A 2ZSIA 2W2KA 4NI5A 4I8IA 2TYSB 1TT5B 3IP6A 4A5OA 1P7ZA 3K35A 5A4IS 1WRBA 2J0QA 1EINA 4GCNA 1ZIXA 4G36A 4ZOBA 3EVCA 1IHOA 1D2GA 4W9NC 4US1R 1ADFA 1RLIA 1W85B 3DTYA 3E3MA 3E9NA 2HV9A 4P0TA 2DFDA 1RWVA 4MJ7A 1XMIA 3BXOA 2X0KA 5LQSA 2FZVA 5FWAA 3I1IA 4C0HA 4C43A 2O8VA 4RLHA 2JAHA 3HFGA 3IUQA 3OCZA 1I5EA 4IDQA 1IG3A 4A91A 3GLHB 4Q48A 1KJQA 2WM9A 4QUBA 4OVUA 3EXAA 2JZOA 2YV2A 2I1JA 3UM9A 2I66A 3IIIA 1VBFA 3LPDA 2Y92A 4L1KA 1XDZA 2ZJ2A 3QW4B 2ZVQX 4DMCA 4DTCA 4DX1A 2G8NA 3RCBA 1CY0A 1E98A 2FSSA 2ODPA 3P9SA 4TQAA 4NDZA 5BT8A 2AJTA 3T52A 1OAOA 2HDHA 2O54A 2FPRA 2IZZA 2E37A 2NZVG 4KAXA 4UNIA 1A9RA 4NSNA 2G5GX 1DKOA 4CM5A 4MP8A 2HL6A 1DDGA 3R8XA 5F2NA 1DX6A 3E9RA 3K53A 2Q9CA 3GCDA 3K4HA 3ZHOA 3SHVA 4IQFA 2IYSA 3MPUA 2QTWB 4X60A 3EDTB 4CIVA 2C2BA 5EHXA 3LXMA 4WZAB 5B1AE 1IVSA 3PGXA 3W9BA 2PGDA 4K46A 2C9CA 3KHSA 2UYQA 3SBSA 2F1OA 3HH8A 3INRA 1Z39A 3HYSA 4U96D 5KJMA 2YWFA 5JJTA 4UZFA 2EV9A 3AI7A 4G5YA 4JASB 5J5AA 2LCQA 1QMPA 3VFDA 3Q8KA 4KVOA 3LD9A 3RUAA 3NHZA 1TGYA 4HD8A 4CDMA 4IH4A 2O5CA 1JEEA 2OC9A 1QYVA 2D1FA 3D3WB 2IF4A 4IEIA 3KQTA 4Q3DA 1B3RA 1VBMA 5LB2A 1C1DB 3T6KA 4XM2A 2CB9A 3NM6B 5D5PA 1IQPA 3OUTA 4PAQA 4RAQA 1IN5A 5KYKA 3IQEA 4DM3A 1MOZA 4UI9J 1K9SA 2EL9A 2FQ1A 3ASNE 1UKBA 2EDAA 2FSHA 3BL6A 1E3QA 2FWIA 2IZOA 3CXRA 3EMKA 2COKA 1HOXA 5C5CA 16PKA 3VZSA 4HOYA 1SC3A 1IY0A 1E3SA 1J23A 1R0KA 2CUKA 4D3DA 1TEZA 1ESMA 3TZ6A 3IAUA 2HMWA 4KV7A 1USIA 4PC2A 4TV9A 3UHJA 1GPYA 2K7ZA 3V42A 1J2YA 4C4PA 4AUKA 1B6RA 4FJZA 4V2IA 5LQUA 1ECCA 1JDTA 3K0SA 2IJGX 4GAAA 4YWJA 1SQFA 3DSSA 1YQQA 2QT9A 4BATA 2XTZA 3THSA 2SHKA 4HX9A 4UHCA 4JDUA 1H2TC 1TE2A 1GV0A 1G7TA 3ABLE 3O4IA 4H60A 2ZSFA 3OZRA 3NVMB 4QICA 5THKA 4DZTA 2HHHB 1KJWA 4HN4B 4CW7A 1MT3A 3CRZA 2A0WA 3H9JA 3MCTA 4I4IA 4HFMA 3T1NA 5HIAA 4AY5A 1HF8A 4DA0A 1T5SA 4YUXA 1YVPA 1FUIA 3LW7A 4O1IA 2EFJA 4EAQA 1RYYA 1R10A 2R8PA 2ZR0A 3V8VA 3BEOA 5LQKA 5TT1A 1YR2A 2C8VA 2XPCA 2J30A 3EHQA 4JROA 1ODTC 5WRFA 5EYPA 1AKEA 4KPUB 4RIIA 1II0A 2J85A 4O1OA 1E64A 2PGOA 5KQSA 2WUEA 3OPYA 4DUGD 3PKIA 1EVYA 2IHKA 2FPPB 4YMTA 1RWQA 3OZEA 3F3KA 3M34A 1JAZA 3UB2A 3GDHA 4ME6A 1ODKA 4BQPA 3IURA 1PT9A 4QODA 4AG6A 4BWVA 5CBOA 2FF7A 4IDFA 3COZA 4TYPA 1IPFA 3F71A 3QKRB 3HBNA 1GQFA 3BJRA 1D03A 2FPOA 5AI6A 3DGFC 4EG7A 1CPYA 4V02A 5JC8A 1MAWA 2WXRA 3NRJA 3AMVA 4HQRA 1Z5VA 3M49A 2GPJA 4KNVA 3R9KA 2X6JA 3L82A 2HRQA 3KOYA 3EPRA 4XARA 1TMOA 1IOZA 1O4WA 1PQYA 3A6HA 3HR4A 4HUJA 1WQ1R 2P58C 2AW3A 3B52X 3RS5A 2CHUA 4UBLA 5ITZB 5L3SB 2HWYA 4NYJR 2FW7A 4NZNA 5GJCA 1AKNA 2ZE5A 3JATB 2FFQA 5ALXA 2VRWA 3KT6A 3NAMA 1Y82A 2XZLA 2H5IA 1B42A 3MQFA 1DCQA 2ZE6A 3D3JA 2B0CA 2IFTA 5CEDB 1IZ8A 4HQDA 1F0NA 1XHFA 3IKLA 3TL6A 4CQMA 4CVNA 3QVLA 4AICA 1K06A 1NNI1 2JATA 3SHOA 5FBLB 3L8DA 3UV3A 2YVKA 4ARVA 5I9NA 3O8BA 3ZWPA 2QZSA 3P19A 5CFRA 4XLLA 3PNLB 1E1QA 2F1IA 3HBMA 3HDQA 4HEA6 1Y3FE 3TAUA 3IP7A 3VV2A 5EJ5A 3PQ4A 1EU1A 4O4IB 2CNNA 4GUAA 5SICE 1KQNA 4DZZA 2ONZA 1SZCA 1YB6A 3TNFA 3NYQA 5KTOA 1ZM2A 3VSCA 2ZRQA 4MS3A 1YB2A 5COAA 1OH7A 4UD2A 2C2LA 5H1YA 2AZXA 3KZVA 3KVRA 2LDBA 1SU4A 1OVMA 4R8KA 1KI6B 5BUQA 2QKYA 4CMJA 1PTJC 1OTXA 2F3UA 3W5JA 3HWSA 4RMHA 3O48A 2V5VA 3EEIA 1SUAA 3ZTWA 5ES4B 1FVFA 3B6MA 4FM9A 2XKBA 1BCRA 2B4RO 3ABZA 4PS3A 1M8KA 3AEXA 2X8LA 1F48A 3E9ZA 2VTEA 4HXFB 4RPCA 1TQHA 4TTPA 3VOSA 2ESRA 4QPNA 1EFDN 1K7CA 1LH0A 4QPCA 1GLGA 3TJRA 4IJ6A 2HT6A 4DLKA 2SKEA 1CHDA 3MNFA 1SUWA 1IN6A 2XQGA 2R79A 4OB6A 4ZQCB 2A92A 4J7CA 5IKPA 2GHRA 5DM70 2IEZA 3R0ZA 2F8YA 2F43B 4R9VA 2JD1A 1AQNA 3UT8A 3INTA 1SC1A 3L4BC 3UOGA 1O5IA 1FU7A 3A26A 3JQ9C 3LUPA 2OMEA 1WDLA 3L1UA 1Y37A 4FMCB 1N54A 1DKRA 2G72A 4LJ5A 2R00C 4S1TA 2P67A 4ZU6X 4GBJA 3UQ3A 1UBOS 1PR9A 3ZRHA 2OAP1 1SVNA 3PGJA 3WGKA 3CHQA 1EP1B 5LCXA 1EX9A 3NM4A 3FU5A 4QU0A 1S70B 3AKEA 2CLKB 4O6FA 1HE3A 5CECB 2Q6VA 2QW1A 5TPWB 2C97A 2CE2X 2W93A 2JLYA 2H9AA 3NZUA 3QWWA 2ZG6A 1Z4IA 3VR5H 2ISQA 3IDSA 5D6NA 1J49A 2ODBA 2WTAA 3B7WA 1R5BA 3COVA 5G05J 4KN6A 4MV9A 2QC9A 4HGRA 4F96A 4QOFA 2C7PA 1ZD9A 4BLQA 1HNWB 1C3LA 3FNBA 4L8WB 1KE2A 4PIMA 5I51A 5IWAB 4LEIA 3TEMA 4BT9A 4NAHA 4KQHA 5DNVA 2PEYA 3ZYCA 5IHPA 2WAYA 1JKJB 4RVOA 3FTUA 3T99A 3IE2A 3V7YA 3EE6A 3KEMA 3C1UA 1NBMA 4R1NA 5K0BA 1GAEO 1U7PA 2WBLC 5EJEA 4QGBA 2PNFA 3JRXA 3V8RA 1XU4A 5JXGA 3AJIA 2XF2A 4X95A 2J6BA 4WDQA 2HX1A 1XFAA 2XOXA 4N2QA 5F1KA 4F7AA 2YYYA 2EBFX 3MJEA 4OSPA 3SZ3A 5KTPA 2OSBA 4LEUA 3JSAA 4AKEA 5C8ZA 2WWRA 2J6HA 3GUHA 5KJ1A 5B1SA 4PLYA 1T29A 4X90A 1WM1A 4WWPA 4G26A 4Q24A 4EM6A 3DPSA 1H1DA 1EWTA 4FGSA 3PTAA 4LCEA 4EPZA 2A1UA 3EVFA 3GH1A 2CHZA 4YVQC 1FXWA 2J1LA 3A4VA 3JCZA 2JFFA 4TUYF 5LXTF 3QUQA 2X41A 4ZOLF 4A73A 2AE1A 2BMVA 1G4UR 1RVDA 3MA0A 3QVJA 3SBEA 3ZY3A 2QUZA 4MUBA 1G6Q1 4BMOB 5EE5B 3TL5A 2MSEB 4Z4HA 4GI2A 1E7WA 2J3MA 1QWOA 2JDID 4FGWA 3BMQB 5KMGA 3CKMA 3ZKWB 4FDUA 3DNMA 3V46A 2VHXA 1KJJA 1XL1A 2EP8A 3GROA 2OVFA 2AOWA 4TXPA 1YULA 2VS1A 1P5QA 1DO2A 3RH0A 5REQB 4IZ6A 1ELOA 1JHDA 1KDVA 4IDAA 1H6AA 3ZHRA 2FPPA 3L06A 3TYXA 1A9OA 3UFBA 3PWTA 4QM6A 2A1UB 2PQRA 3NC4A 3MKQA 1M1YB 5I7UA 1Z5WA 3P0RA 4FD2A 5DW3A 3B53X 3PL5A 4IOJA 2BIFA 2VAPA 4JU8A 4LJKA 2J9FB 1SBYA 4MB6A 3DHVA 4OAQA 3AU5A 3R77A 3AEYA 3QM1A 2GVZC 3B1WA 5FJJA 3WHPA 2A0UA 1W0JA 2P77A 4PIPA 4CCWA 4ZGWA 1COWA 1S2OA 2ORVA 2Z8YM 3BA1A 1FPMA 3WLIA 1CVLA 1ZOIA 4E3ZA 5JBIA 4EVSA 3GZ2A 3BN3A 1HFEL 3I58A 1ORDA 1GU1A 3KTOA 1TZJA 4IIUA 1ORRA 1TCBA 4RY0A 3EUAA 4M9UA 2PRZA 4G24A 3NP7A 5CFMA 2P62A 4MBGA 3B1VA 3JZIA 1BS2A 2B8TA 1QR6A 3MYVA 5EE3A 2Z4RA 3NOQA 4WVLA 2PZIA 5F1OA 3BUSA 1KO8A 2ZUWA 3AJRA 4C0QC 2C2MA 2V4MA 1P1HA 3HEBA 3TZLA 1OUVA 2FV8A 2Z58A 1U8CB 4G9BA 1KJYA 4H6WA 3DFKA 4R8LA 2DKFA 2J9XB 2OHGA 2PU7A 2WF5A 1JFFA 2ZI3A 4Y18A 4A16A 4F2GA 5ENSD 1LB1B 5DEOA 2FN3A 4J07A 1PZXA 4BGUA 5FEUA 1G9TA 4OJNA 2XE6A 3VR3D 4DIKA 4PLTA 1AHNA 3TSYA 1SVMA 4MARA 5EFOA 1P6XA 2BKAA 3WQBA 2HCBA 4OSEA 3UI2A 2GK4A 4KQFA 4UUAA 3UJ8A 2XNDA 1RRVA 4UBKA 4LSWA 3EXG2 3ZS9A 2FOXA 1SIBE 4A2PA 3UWPA 5ADVA 1ECLA 4DA6A 1GKKA 2WUFA 4Y2XA 3FRHA 4LRQA 2JNWA 1WWKA 2QM0A 1NWHA 3JVEA 3H2GA 2QWXA 3AHDA 2OWDA 3CLUD 3M7IA 4JIMA 5DRYA 2BCEA 2E2EA 1ENPA 4G8LA 5AKLA 3A1DA 4CG2A 1L5OA 2PSSA 2EX4A 3A4NA 1IZZA 3R5SA 3I6YA 3ZDFA 5HUHA 4EHFA 3R23A 1D6MA 1IPHA 3TDNA 3VU8A 5DIZA 3BK7A 1ZOLA 1KU0A 2BD0A 3U48A 2P2LA 3L7YA 5AQ7A 1QYIA 3BORA 3H75A 3DFMA 4IFIA 4BP1A 1R27A 2IU3A 2TECE 4GWKA 2F2TA 4NPCA 3QXXA 1NQVA 4PSDA 4XVCA 2GUGA 3B1KA 2EJWA 2IO2C 2XDQA 2ZWPA 3BFKA 3VPCA 5A0TA 2ZT8A 4CM8B 5BY2A 3AY0A 1H8ED 2JIBA 3E7DA 2HBYA 3B8HA 3U3DA 4C4ZA 4QL3A 5IU6A 2G77B 4MA4A 3UT0A 1P5HA 2YJ6A 4UM8B 4BGVA 4BNVA 2NTNA 2FDXA 3GLSA 1SKYB 1JMVA 4X61A 4B0PA 3THYA 4ZTZB 1VSVA 4TSFA 4DKXA 3IEVA 1E9SA 3RO3A 5JBNA 4BO7A 2AN9A 2CFTA 1OZHA 4ERXA 3KR0A 3JARA 2PX0A 5CLHA 2CFZA 1PEYA 4TTJA 1QJCA 4W82A 4EW3A 3QK7A 1UF9A 4RTRA 4UQLA 1VG8A 1GZ5A 3FWHA 2BMDA 1TVMA 1YJAA 2PTHA 5F7JA 3K0HA 3TQIA 4B5LA 4IGIA 3IOMA 3GJSA 5EMNA 4JBHA 1UKYA 4KP7A 4FJ2A 2AI3A 1TC2A 3CONA 3VC3A 1P2FA 2VATA 5D3MB 2NSZA 5KHLB 1G5HA 4GYKA 2PL2A 4WI1A 2QN8A 2VKTA 3FSRA 5EKXA 1J2TA 3QVXA 1TAUA 2VP5A 3RD5A 1ZVMA 2FP3A 1ZJYA 4YCMA 1QH9A 1RCUA 2OGZA 3IP3A 2Q3JA 4P4UA 2YXLA 2XPYA 1BDBA 4IAOA 4KQCA 4NKRA 4PZ9A 1WBDA 3RG8A 3VO9A 4PLPA 4B48A 1JA1A 3PFGA 4S1OA 5EJIA 2A4ZA 1A9TA 1E1CB 1FYDA 2O6HA 3D6JA 4UZSA 1Y1SA 1F06A 1YZUA 3MOGA 4UFPA 5BWMA 2HSGA 3WWCA 3O8OA 4WK4B 2PWPA 1N6OA 1GCGA 4HX5A 3JZDA 1TK2A 3OPVA 2HIMA 4HLCA 2QW8A 3GFOA 4OBBA 5DYIA 1OCZE 3PZRA 1FDOA 1Q17A 3O73A 1J0AA 2C0PA 1FPQA 4Y0AA 5BWBA 1WETA 4V3IA 1QCZA 1ISIA 5A3QA 1S4MA 2IONA 3ZGLA 4AVYA 2EIKE 5E4JA 1U7OA 3FTXA 3AEUA 4XGRA 4QBHA 1X74A 4OY3A 2EP5A 3EF3A 2ZYTX 1QIDA 3RU0A 5ITZF 2QJWA 3CYFA 4PC1A 5JV5A 1E6EA 2H8GA 3EGDB 3ZCTA 3M1LA 3WRYC 4J91A 1DVPA 2Q5CA 3NEAA 4QFCA 2BT4A 1E59A 4GOOD 4TV9F 1Q84A 3U3RA 2D0PB 1S02A 3ETEA 2WJWA 3HFJA 1P5ZB 1XE3A 4KR7A 4E5MA 4DCOA 3D3EA 3BQ9A 2RFLA 2JK0A 2PG3A 2IPMA 3SPXA 3O3CA 1M2JA 4B75A 1Z5GA 5HFAA 2OTCA 3PXCX 1SWWA 4KYVA 2ZSHA 2G82A 1QZTA 1R5OA 2V0PA 1UWCA 5AM2A 2FWBA 2XTNA 1OUMA 3RJVA 3OEED 2FMTA 3OE5A 3VOTA 3LDUA 5C5IA 4MLZA 4J29A 3TRDA 5LVAA 1PSDA 1WB9A 1I2CA 1IJFA 1G8MA 2BFEA 1X7GA 4X20A 4C4TA 1K6XA 1ZCZA 4GLLA 4L4ZA 1UDWA 5DHRA 5FHQA 1INZA 4CKZA 3TIGA 3GLGE 3UOWA 1OLXB 2WMYA 3CW2A 1YIOA 3IVRA 3K3PA 1UQRA 4EJMA 5CB0A 5EXTA 3ZGZA 1ZCBA 3EVGA 3SMQA 4CKXA 1U0HC 2ID9A 4TXMA 4EG4A 3WGJA 4REQB 4U2EA 1GZDA 3AERB 3JQRA 2RGWA 3I04A 3LXXA 4IJWA 4WSOA 2FFHA 1L7PA 1MTOA 1WPQA 2XA1A 3CW9A 3ZXYA 5JNSA 5AVUA 1HYQA 2XT0A 2P0YA 5DNUA 3VA7A 2QRLA 1KFJB 4JW1A 1P4GA 1RM5A 3MXTA 2G88A 2I67A 4LBVA 1WPRA 3MS7A 4MR8A 3I34X 3B3QA 4FK8A 1ZD2P 2BUBA 2FZEA 2RB5A 2ERCA 3X44A 3VBEA 2JK1A 1QH0A 3LBAA 1DXOA 4Y6PA 3WBFA 1BS1A 1OBHA 5GGXA 1GT6A 3A1NA 1KVRA 1H2XA 3D9MA 5KJLA 4GNRA 4CQLB 1U7TA 1EE2A 3DHNA 2P9PG 1EKXA 1NT4A 1T35A 2HAEA 1EP2B 5L3ZA 4CTKA 4ER3A 4QVKA 5TR9A 5CB8A 4R7GA 4CMAA 2ACKA 3IAS1 3OFKA 3TZBA 1VSQA 4TMVA 1RAHA 2ODAA 2J9QA 3CRNA 3DZKA 5MF6A 3LWZA 1BJKA 2FHSA 3CUEF 4L72A 4QRIA 1MEJA 5DULA 4HZUB 3SM3A 1ZW1A 4MV8A 4UDOA 2WY2D 4WAFA 1QXSA 2GN1A 3I73A 5DHUA 5TPZD 2H1RA 3EC7A 1O6BA 4RORA 4Y2JA 5DTIA 5CD1A 1SZPA 1Z2PX 4AJEA 3QBVA 2Q4RA 3IEXA 3WYCA 4ECEA 3HXCA 1VJTA 2WFAA 3MINA 5FBHA 3UT5B 5CX1A 2NSHA 1YASA 1JKMA 4JELA 1SXJC 3F6SA 3K8QA 1YR1A 5K4AA 4CL0A 3C8HA 1BWPA 4UU7A 5H02A 4HI8A 2GO7A 1OFIA 1X7YA 1YJXA 1KEWA 3M3PA 3PWKA 3VISA 1JRLA 2R6CA 4IV0A 4YROA 3ZHCA 2FMIA 4HLUA 2XXAB 4BP8A 5B4VA 1XALA 4JMPA 4QFMA 2R3SA 5AW7A 4EG6A 1XCOA 3OP4A 3EPJA 1PTJA 1XELA 2ZRKA 4WINA 1QVZA 2GKGA 3H5WA 2BFDA 1UC9A 3EVNA 1A2BA 3EZ6A 1LQTA 3QKSA 3WBBA 4OU5A 5K8TA 1O6CA 1ZVKA 1V2HE 4DG9A 1IUPA 1MVOA 3OUUA 1T4MA 4KWIA 3TSCA 1JDNA 5ITVA 3ZDAA 4OV6B 3AEKA 1PFYA 3DVRX 3DV0A 3ICCA 4JLNA 3TTVA 3ZDRA 1SC6A 4M1SA 2WPVA 1O95A 2XOKA 4WXEA 4AW9A 4BQIA 4AJHA 2WJAA 4N5DA 3QX8A 4QXRA 2GPWA 3IP1A 3CLTD 1NMQA 2D62A 3P5BA 4R1PA 3REQA 4CMEC 1CQXA 2ZIAA 3VC1A 5ILGA 2LAIA 3T1TA 3O03A 2VHUA 2GZRA 4FE3A 4IDCA 2ADFA 4Q4JA 4DB2A 1TO1E 3P4XA 3V34A 1W0KA 1X80A 4KFCA 2ZANA 2R03A 4NU5A 1WTAA 2NU6A 2BM1A 1SFRA 2XNKA 1E62A 3S2ZA 3C4QA 5M29A 3FVVA 1CG6A 2P65A 1NIPA 4P33A 5IAAA 2RHRA 1OKKD 4DCJA 2JGKA 2Q2VA 1A7AA 3A32A 1KBOA 4IQ4A 2YHEA 4RVBA 5FOWA 2XADA 3EIWA 3L93A 4AYTA 1FRNA 1RYHA 4N0MA 1WHTA 4XIYA 5A7HA 4BESA 3K5IA 4I1VA 5CH8A 1R9JA 2YWGA 1RI2A 2BR3A 2EGUA 4LTMA 1X94A 4LQ4A 1N5RA 4FXPA 4LYEA 2YZMA 4YS6A 2WU3A 4BU0A 2ERXA 4UDNA 4ZQBA 4DLXA 4YCAA 3N28A 5IJ9A 4B3TB 3MSXA 4BX2A 4W7HA 2OYSA 4ON9A 2H4HA 2GLXA 1N5IA 3CEPB 4EKIA 3M2PA 4LYYA 4B4KA 3RNOA 3R3XA 3T7DA 1Q0UA 3CRVA 2A67A 3E05A 3IP9A 2GROB 1MOQA 3O93A 3IHVA 1TECE 1Z4KA 2ZAMA 2NXCA 3WFJA 4BNXA 2P9FA 2VSYA 5HEKA 1J1ZA 1QDEA 4CFSA 3JQCA 4UHBA 1V5WA 2JS7A 1PY1A 4B8AA 4M98A 2Q4BA 3DPIA 2HNAA 3DCJA 5HG0A 3NAGA 5C1OA 3W06A 2C7OA 3KE8A 3ZD8A 3NB0A 3MT9A 4O0MA 1TYZA 3OCCA 3PCTA 1TIPA 5HKOA 1PWXA 5FORA 2EC5A 2R85A 3VAAA 2I6QA 5CYPA 2IQ5A 1Z0FA 1N2OA 2C31A 3CNNA 1C4OA 1JDJA 1KY2A 3H7IA 4O8CA 4BO1A 1IJEA 1GR1A 3TFWA 3VDMA 3FWKA 5EG5A 3R0JA 4DDTA 2C9MA 1E8MA 1CIVA 2JANA 3CNEA 5BW6B 3GFGA 4IHJA 5LZ7A 1VZ3A 1E3JA 5K3OA 4GX1A 3LLCA 3M6VA 1UBNA 4E2ZA 13PKA 2P4UA 2QTRA 2WZQA 4MPJA 6NULA 2NW6A 5P21A 1V5GA 3HV0A 4H0FA 4YRRA 5CNJA 2QY9A 1MG0A 1R66A 1TNYA 2OESA 2R5FA 1JKJA 1NPYA 4YRPA 1CRZA 3AI3A 1THZA 3LGXA 2QX9A 4DMMA 1E1RA 3VSAA 1U90A 4QLOA 4Q4CA 4EB6B 1ETHA 4DR3B 1VJ1A 1YTLA 4GECA 2UU9B 2VQEB 4L4UA 1QRTA 2VHYA 4FEEA 2OAQ1 1N25A 3ADKA 4LS3A 2UUCB 3IUNA 1R64A 3E1KA 1Q1ZA 4GA2A 4MWDA 5FV4A 3G85A 2ARKA 3FWZA 2QYSA 5DHTA 3M4ZA 2VPYA 4MKZA 1M8JA 1RLJA 3QUCA 7ADHA 4IHAA 4CM4B 3BD9A 3K2QA 4D8YA 3TNDA 2PMEA 3LIPA 2IPNA 1UP7A 2FHPA 5DRTA 5SYMA 1M54A 4IDHA 3WGNA 1JXAA 4IIDA 1XV5A 4RWZA 5AJXA 3AV3A 3IUJA 4J4BA 1CZHA 1P5JA 5JW6A 1U6IA 5LP1A 5KHOC 2JIDA 3DJYA 2BAGA 3C24A 4QPDA 4D0GA 4QDKA 2IZ7A 2XJ4A 4CN8A 3Q79A 2NU7A 4II2A 2REXB 1VXOA 4L75A 5KYUA 2WQHA 1J20A 5AJVB 5GWXA 4B6JA 3EZXA 3LDFA 1XLWA 3LC1O 4WK2B 3PK0A 1L1RA 2GZ3A 2OE2A