4K0RA

Crystal structure of mouse cryptochrome 1
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
487
structure length
463
Chain Sequence
VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPCMTPLSDDHDEKYGVPSLEELGFDTLSSAVWPGGETEALTRLERHLERKAWVANFERPRSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein
molecule keywords Cryptochrome-1
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Mus musculus
total genus 170
structure length 463
sequence length 487
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4k0rA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4k0rA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4k0rA01
2XRZA 3CR8A 1JZQA 1JZSA 2GOYA 5KCMA 3H9CA 1QNFA 1F9AA 4WNYA 4I6GA 1XNJA 2DERA 2JA2A 4MW5A 1TQ8A 2D13A 2J08A 2PXHA 3ND7A 1U3DA 1WXHA 3PNVA 4XFDA 5K0TA 4MLPA 4WSOA 1WKBA 1KQOA 3FWKA 1O97D 1YULA 1O94D 1TFUA 3ILVA 1F7VA 4ZT4A 3JXEA 4MVYA 2JAXA 1VBNA 1QJCA 4ARCA 1UFVA 3N8HA 4KPUB 1Q77A 1K4MA 5H7XA 3PNBA 1KH3A 2X3FA 1O95D 2YY5A 4PBRA 1OWPA 3IMGA 2ZUEA 4MW0A 3INNA 1YUMA 1B6TA 1JIJA 2CV0A 4U7JA 5AHWA 1XNGA 3FNRA 1NZJA 1KKUA 2QJFA 4EG7A 4DJAA 3MLAA 5LLTA 3H99A 4DE5A 3I05A 4E1AA 1QRUA 1NUUA 3HZRA 4KKVA 1J20A 4MUIA 1EJ2A 1A8HA 2ZP1A 1J1ZA 1CT9A 3HMQA 2DETA 3TS1A 3TZLA 3CLSC 3RJZA 1U7DA 5HG0A 4HPWA 3ZIUA 5JBNA 1OWMA 2Z09A 4AS1A 3MLBA 3SZ3A 2QJTA 3L93A 1GTRA 3KT8A 3SDBA 1J70A 2A88A 4I6EA 4GRIA 2GKSA 2X0KA 2QTRA 3FH0A 1PFVA 3VU8A 1JIIA 3IH5A 2OV4A 4ZT3A 5J58A 1TEZA 3ND6A 1VL2A 1KAMA 3OP1A 2RD2A 3VRHA 4ZCRA 3H9BA 4U63A 1OBHA 3IUEA 4QRDA 4YP6A 3RK0A 2A1UA 3D6UA 3CLTD 3F3MA 4CDMA 1YI8A 3AL0C 1R6TA 1TYDE 3RBAA 2XRYA 1OWLA 5FO1A 3A4IA 3CVVA 3H97A 4MWDA 3S3TA 2AKEA 1M83A 4FZJA 4MWEA 1R6UA 3M5WA 3X1KA 4EG3A 5DASA 1MC1A 1EUQA 1F7UA 1TYBE 1WQ3A 3ZXSA 2WQ6A 1EUYA 1JIKA 3SZGA 2NZ2A 3KT6A 5TEVA 3P0JA 1GLNA 1QU2A 1OBCA 4YMIA 2PZAA 4XSVA 1JEEA 1GPMA 1G8GA 5IHXA 3HL4A 1PG0A 3CVYA 2YWBA 1IQ0A 4J76A 1O0BA 1OWOA 4OUDB 3IOEA 3G5AA 3KT3A 1KAQA 1MJHA 4PY2A 4YBRA 3L92A 1J09A 4ND6A 1DNPA 1ZUNA 2HGZA 2IP1A 5KWVA 3G6KA 1N78A 4CQNA 2JANA 4EF6A 4F4HA 1ULHA 1IQRA 1FYDA 2PFSA 4RPIA 5TS2A 3RK1A 1WY5A 4EG5A 4MUKA 4MUJA 1NUTA 1GN8A 3X1MA 3MMXA 4DDMA 2DXIA 2I1LA 1GTSA 1BS2A 1GAXA 2A1TS 2A4MA 2NSYA 3FOCA 4MVWA 3UK2A 3QTBA 1MAUA 5FNZA 4JXXA 4AQ7A 1XJQA 3NBKA 3U1VA 2QJOA 1JEDA 3LCJA 3Q10A 4G5YA 2AG6A 4R2MA 1N2HA 4NAUA 3IVGA 4L2IA 4ND7A 1T6YA 1QTQA 1EFVA 1LW7A 3OTWA 3FI0A 3PRHA 3FY4A 4MAFA 4MVCA 1MB9A 1YIAA 1N3LA 1NI5A 3COVA 1IHOA 3LE8A 3ELBA 1COZA 4DDKA 1T6XA 1KORA 2Z08A 1NYLA 2PZBA 1QQTA 1P7PA 1MOPA 2X1LA 1WZ2A 4MUEA 5DEOA 5LM3A 4MUFA 2A1TR 5EKDA 1U3CA 3ZJVA 1WXEA 4ZCSA 3CA8A 1EE1A 4G5FA 1OD6A 2CSXA 1EFPA 3NBAA 1H3EA 1M8JA 4EG4A 1U0BB 4MW2A 3QE4A 1J21A 3IMCA 4MULA 3A05A 1S4MA 1KQPA 5J5AA 2E89A 1H3NA 5DK4A 3N05A 4MW7A 3CLUC 1J1UA 3AG5A 3IOBA 2YXNA 3UOWA 3SEZA 3ISJA 1N2GA 3HV0A 4MW6A 3VGJA 2CT8A 1LI7A 4DNXA 4MUHA 2CYCA 5KHAA 1ZH0A 3A04A 4GU5A 2IELA 5F23A 1KP3A 3KT0A 3CLRC 3CLSD 2VTBA 3CVXA 5IJXA 2A86A 1MB2A 1MBZA 1I6KA 2EL7A 2C5SA 1I6LA 4KR7A 4JYZA 4NDAA 1G8FA 3ZGZA 1H1TA 4PBTA 4L2IB 4MUNA 3N9IA 1WJGA 3C8ZA 4Q93A 2HMAA 3COZA 4EFKA 1EFVB 4KPUA 1M8KA 2QTNA 1K97A 5HUJA 1N2JA 2J5BA 1EXDA 4Q16A 1N77A 2E18A 4DDHA 1O5TA 2Z3VA 4CDNA 3FG9A 4CT0A 3IDFA 3UMVA 1NURA 4TS1A 1WXIA 4KR9A 3K32A 2CFOA 4OJMX 2J07A 1O97C 1D2RA 2G36A 1O94C 1JHDA 1N75A 3N2YA 5H16A 3Q4GA 2A7XA 3TNJA 1LI5A 4ZT2A 2CYAA 4ZT7A 1NP7A 1O95C 2CUZA 4UZFA 2CV1A 1EFPB 3UC5A 1ILEA 1WXFA 2A84A 4EG1A 1KH1A 4MW4A 4MWBA 4MW1A 3GUZA 1N2EA 2PZ8A 3ZJUA 1K92A 5J59A 2DPLA 1IQUA 1WOYA 2H2AA 2A1UB 4NZPA 5FO0A 4JZYA 4HJRA 4DLPA 4X0EA 1N2OA 3LOQA 1PFYA 1IVSA 2O5RA 4I6JA 1PG2A 2PIDA 1WXGA 3NV7A 1Q11A 2VTBB 3CVUA 1U7XA 4HJXA 1VLHA 3PNYA 2VXOA 3IOCA 2V0GA 1MRZA 3COYA 4RUKA 3ZUGA 4MQ6A 2GM3A 4EGAA 3MUEA 4MUGA 3K9WA 1HYBA 4K0RA 1N2IA 2R5WA 3AFHA 2DLCX 1IH8A 3HGMA 1GZUA 1WQ4A 3P0IA 4ARIA 2EJCA 1O6BA 5TEWA 3FETA 1JILA 1Y42X 1N1DA 4MW9A 3A2KA 1O0CA 4ZCPA 2J09A 4HK4A 2YWCA 1G8HA 2DEUA 4F3RA 3UY4A 3DV2A 3RHSA 1JGTA 1SURA 3SEQA 1V8FA 1O96A 1NUPA 4YP5A 2CYBA 1VBKA 3D6VA 1YUNA 3IVXA 2PG3A 1FFYA 4P2BA 3CLTC 3TQOA 1Q15A 3IMEA 1G59A 4YP7A 3SYTA 2J4DA 4ZCTA 5BNZA 1VBMA 1XNHA 2DUMA 2CV2A 3AG6A 4S1OA 1I2DA 3MXTA 1IFXA 4XFJA 2D5BA 4J75A 4KR6A 2OQ2A 1K4KA 2WSIA 2X1MA 3X1JA 3P0HA 1JMVA 3IODA 2HZ7A 1NUQA 4OUDA 3AKZA 1TYCA 1T6ZA 4U8HA 4QBTA 2ZUFA 2RE8A 1M8GA 4JFAA 4EG8A 4R0NA 2E21A 3CVWA 2H29A 1M1ZA 5HUHA 1YIDA 1M8FA 2WB2A 4K03A 1X8XA 1H3FA 1QU3A 2TS1A 1KH2A 1QRSA 4ZT6A 2QUIA 2O8VA 1IRXA 1RQGA 4QREA 5K0SA 2E0IA 1NUSA 2V0CA 2BYTA 1ZH6A 4PBSA 4ZT5A 4BWVA 3KFLA 3Q12A 4UZEA 1PFUA 4G6ZA 2B7LA 3TQIA 3G59A 3RFFA 5TGTA 3GMIA 5DB4A 1Q19A 1M8PA 1T9GS 3IUBA 3ND5A 3IVCA 3AIIA 2AZXA 3PXUA 3E27A 2D54A 1R6XA 1X6VA 1V47A 4NAHA 3GLVA 4MVXA 3DO8A 1JECA 3CLUD 2BTEA 1OWNA 4H3SA 4MWCA 1F4LA 4NATA 1O96B 4EG6A 1ZJWA 1PFWA 4JXZA 3H05A 3TZEA 2QUJA 2DR2A 3QTTA 3BL5A 3HFJA 1N2BA 1KR2A 2WQ7A 3DPIA 1KQNA 3SP1A 3CLRD 1MAWA 2QUHA 1KP2A 2IJGX 1I6MA 5LFAA 1NSYA 4A91A 3FDXA 3COWA 2QTMA 4NX2A 3ZJTA 3FHJA 3P52A 4ZCQA 3DLAA 3ZXIA 1TYAE 1QRTA 4R2LA 3FIUA 2QUKA 1T9GR
chains in the Genus database with same CATH superfamily
4IS2A 5FOVA 3C24A 5LC1A 4XFDA 2GF0A 4PS8A 2SCUB 3OQNA 3MKRA 3HDVA 4RD4A 4ZPJA 3QNKA 4HNTA 2IEGA 1N0QA 3TUJC 4EF5A 2HQSA 4YV0A 2DY1A 4E5VA 2Y3AA 1E4VA 3ZR4B 4LEUA 1HEUA 4TVKA 1NN3A 3DD5A 4APOA 2V9ZA 3DEPA 4FDLA 3RK4A 1H2EA 2C5BA 5JZVA 2A59A 4P3XA 3IAFA 4GBMA 4EHMA 3L4SO 1GLVA 4NMXB 4GI7A 4IX1A 1VE1A 2ORYA 2V5QC 3ZTWA 3GCXA 2OWEA 3I1FA 4IFIA 4PICA 2QMOA 4TMTA 2JVIA 1VKNA 2XDYA 3DZBA 4PU0A 1L5FA 1SH7A 2EBHX 4RHFA 5A03A 3L0CA 2NTNA 4P3YA 1ES9A 2QL5A 2OA0A 2UAGA 4PSKA 2IRWA 1TKBA 4B6PA 4E11A 4B40A 1FJHA 1VG9B 3ZWAA 1XGKA 2YNMA 1F2TA 1EQ2A 2IDKA 1YDEA 2XA1A 1IMJA 4YAOA 3MT7A 4HDKA 3WC4A 1MB3A 3BD8A 5JADA 2II6A 2I54A 2R6ZA 3BJIC 3V1LA 5EJ9A 4UQYA 5EDSA 1EM8A 2FEAA 5DMHA 3ZBUA 2ODWA 3ID6C 2AJDA 3SK0A 5BW4A 5C52B 2Y1FA 4QUJA 5J5CA 4CNQA 2IHJA 4BLRA 3WLLA 3ZHSA 4AJJA 2RC5A 2EGHA 1UBRS 2IOLA 3M5PA 2VF4X 3EGXA 1FCHA 5AVOA 1U0GA 2GJAA 1XRJA 4XGNA 2I55A 1WZNA 3ROTA 2ZYGA 1BO6A 2ZS7A 5KYUA 3NBNB 2PUBA 1KDRA 1YKSA 2LE0A 4MWGA 4PX2A 3QFCA 1RCUA 1T2VA 1MMFB 2B4RO 3H19A 3LLSA 3QLTA 3GPIA 3VHXB 4BQIA 2BKUA 3MWEA 1EI9A 3HDYA 3VDXA 4IIUA 3L7LA 2GO7A 4YP1A 4Q12A 5B1YA 4GCNA 3Q5GA 1J5EB 1K6XA 5JS1A 2I7TA 1BWSA 2XZTG 1KR5A 1O94C 4B85A 3PFBA 1OU0A 5EHZA 1Z4KA 4A16A 2IVFA 2Q6IA 4U7TB 3OU2A 5JWOA 1WMFA 4HDAA 2DUWA 4GUAA 5JC1A 4X8QA 4C9BB 4BUJA 1DKNA 2ZYDA 3QXCA 2XMZA 5I9MA 2FXVA 3HKBA 5LP1A 3ZK8A 3UA4A 2VH2A 3CZ5A 1N2CB 4G9BA 4YECA 5AVXA 5A5VA 3BMCB 2TMYA 1KPHA 4ECEA 2QQFA 4I66A 3MJ4A 3P0IA 4H77A 3MTQA 1FLDA 2AE2A 4EFDA 2W2QA 3LHFA 3BWBA 1AGRA 3OCXA 4BRUA 1XZHA 1JWGA 5HPYB 4HXFB 2EKPA 4K6GA 3KSZO 4LZOA 5I5EA 3N8GA 4KIUA 3L40A 2UZAA 4M55A 1SUFA 1EFCA 1QK5A 2IU1A 4NFYA 1JPLA 1XTPA 1A27A 5IWCA 5TARA 4RTMA 2TS1A 2AFHA 1JVBA 3D6HA 1ORHA 1EXVA 2NMVA 1A8QA 2HPZA 1D8DA 2LPMA 1AURA 3B7GA 5LU9A 1JPJA 1VCOA 2O5CA 1FRZA 4O4HA 4G41A 1MQ8B 3WLEA 4EYEA 1JNXX 1AMOA 1YE5A 2JBAB 2CWWA 4UZSA 1E1LA 1FSZA 1MO2A 4XWAA 1P3JA 2YVKA 4Z1OA 4DHWA 1QAMA 3UHOA 2I6QA 2F6RA 3S1AA 4KUEA 4MKZA 1T9GR 3IDQA 1AMUA 3BQ9A 1IU9A 1NRIA 1P74A 3R5FA 4K5QA 2ZAGA 5KNCD 4DV1B 4N6NA 4GKKB 4BVAA 3RT7A 5FQ8A 3FPLA 3EF1A 5CLJA 4D9NA 4DC9A 2LCIA 1IBKB 3TQHA 5KC9A 2ZU6B 2FTKE 1U2VG 3AW9A 1UKBA 4AY4A 5AI6A 3PX3A 4FZ5A 4DRXB 2Z2YA 1VZ2A 3JASB 4N0MA 4R40A 5ESRA 3VJLA 4QO7A 4KBFA 5JBIA 4CM5A 3IKTA 1OXTA 2CLMB 2FLKA 3AI1A 2GZHA 2FWAA 4O2LA 4XD7A 1ND5A 3V2OA 2PBRA 3HDJA 1H93A 1Y8CA 3ND6A 3SJBA 3DMFA 4PR0A 2HW8A 2IV2X 3C45A 2ORVA 1WW3A 1PNOA 1GG2A 2OILA 2BI4A 3OLCX 1CLUA 4IH1A 1N9AA 3AINA 4EKNB 4FX2A 3TQQA 4PIPA 3DAYA 4IEFB 4Q82A 5EKUA 2RMKA 1RBMA 1W0KD 3N1UA 5BW8A 5BMVF 4QUAA 3YASA 2AOXA 1SELA 3G8CA 2A0XA 4BKMA 3D8UA 1GA6A 3BICA 7ABPA 1K27A 4DQVA 4RESA 4A1FA 5JAUA 3MPUA 4XYLA 4ZCMA 121PA 4F12A 5ALUA 3PEWA 3CPEA 4C4ZA 3O8CA 4QG3A 4RPIA 5LBTA 3NHLA 2W2TA 4CWAA 3ASHA 4EHLA 3L04A 4WNAB 3ZE7A 2DFLA 4LNHA 3JSAA 1VCIA 4BNNA 3KD2A 3MGAA 2BZSA 2AX4A 3B12A 3GPCA 4GX0A 4LCJA 3VUEA 3L6BA 2EZ8A 3P9IA 1FNDA 4M22A 3PC4A 3T6KA 3TAXA 2C9CA 1WDWB 4IQGA 2HJRA 5UKDA 2VNAA 3E53A 1N4AA 3R0JA 3T5MA 1W36B 2MYNA 3RYIA 3N87A 1VL0A 1KJ8A 4X60A 1SM4A 2AXEA 3LQ1A 3G1WA 2MYUA 2PEZA 2O2ZA 1OYVA 2G9ZA 3ROKA 5K8IA 3SE7A 4EPYA 5FL3A 2QM0A 4IBOA 3RM3A 3ZWNA 1YJCA 4OGGA 2JFOA 3AG5A 1Z35A 4I2ZA 3HKCB 3WK8A 2FGJA 4CMEA 4FR0A 1MB2A 4UHFA 1R5JA 5H83A 3ZN2A 5H9WA 3SHTA 4Q93A 5AVWA 2QX6A 1NLYA 3CXUA 2ZUDA 1F38A 3ODPA 3QMVA 8ATCA 1ZVQA 1Q7TA 4NJMB 7REQA 3BH6A 2EOAA 3HXBA 1OGIA 1XDGA 3AIMA 3R0QA 4LTDA 4M9ZA 4DJJA 5HVNA 3RTEA 1Z06A 3F73A 3NT5A 2A7XA 3PG5A 4FXPA 4JX9A 3QRWA 5CYPA 4QFDA 2A84A 4MW4A 1C2TA 4JBYA 4INZA 2NU9B 2L69A 1TAQA 4US0R 3UG7A 4U39A 1P2SA 5IJ9B 1SUCA 4MAAA 4QATA 3ORFA 2X42A 1YASA 4EY8A 1FVXA 3FTNA 2BFWA 3GVHA 4ZI5A 4C7VA 3IVXA 4OBBA 1HDEA 2CV2A 4QDOA 4U7FA 3KVNA 3PR2B 4GF5A 1EVEA 1WE2A 2PMBA 3WE7A 2O8CB 4F84A 3U4QB 4I4TF 2QI9F 1XKXA 4H4CA 4O0LA 3Q7RA 5DHPA 2REXB 1Y3IA 1HO8A 5JLAA 3ASNE 2GEDA 5I7UA 4RJLA 1DEAA 5TNXA 3EEQA 3ZE1B 1NM5A 1R6XA 2FNAA 4NAHA 4L08A 4QOIA 3R7WB 3EVEA 3J80A 1GUAA 2RGNA 4TTSA 1KMHA 2B4TO 1FYVA 1Y9JA 4J9VA 1N2BA 3FVTA 3TRDA 4TKVA 4L9WA 3WL6A 4KPYA 1ZCAA 5G4LA 4KVAA 1JT9A 4Z3OA 4HO1X 4Y18A 3USZA 2R1VA 3U7FB 1JCRA 3QYFA 6PFKA 1TLLA 5FZRA 1M1YA 3PNVA 4JR1A 4FP7A 3OF2A 5AM2A 4WLUA 3PTAA 4RHUA 1JA0A 4LE0A 1V6AA 1N95A 2H1FA 3RU3A 5CCXA 4MPPA 4BNDA 621PA 4X62B 2VSOA 1X87A 1I94B 3OTIA 4MW0A 4YMUA 3KKLA 2JPDA 2XB9A 4U7JA 1QFJA 3KYDB 4KGDA 2MSNA 2PM7A 2D3TA 1U3VA 5F2OA 4AKIA 4R2XA 2I0FA 1W5FA 4I6EA 1TLTA 1KYQA 2IUUA 4DOMA 1FC0A 4BFWA 4XGRA 2WMYA 4OU5A 3B7BA 4IIHA 4YMVA 1FJXA 1S3SA 1QV7A 1QPBA 2NQTA 5E4TA 3V55A 4EYGA 5CFOA 5I48A 4O1HA 5LBIA 4AJ4A 4AZ3B 4AS2A 3OE5A 3MRTA 4BFCA 2GA9A 1JDJA 4MS4B 2GN6A 3DSSA 1BG6A 3ZQKA 1F3LA 5CEFA 1S8FA 2R25B 4JT9A 3OQBA 1Z2PX 1UXKA 1XXHA 1UC9A 3QUCA 4WECA 1R8SA 2QD2A 4TTQA 2HSGA 1JYEA 4MVJD 5MGNA 4Y6LA 2R97A 1DNPA 2L0XA 1PGPA 4HBGA 4LE2A 4OAVB 2ZBFA 2ZAOA 4EG5A 3E30A 1OXKB 4YCSA 1Z8NA 3Q9NC 3NBKA 1VIDA 3BZUA 2ZB3A 3ZWBA 4WH0A 3WMRA 1KYZA 1FP2A 1EGQA 3FY4A 1GNSA 2GCEA 4CMKA 1X2EA 3LWDA 2EX1A 4DDKA 4GZ5A 5LDGA 4YRQA 3MJFA 2IYVA 4M7OA 1R50A 4GA2A 3DBIA 1GAQA 1YDFA 1NQVA 3H2YA 3ETLA 4RTRA 4TUMA 4A0RA 4E5SA 4TYWA 4AW9A 1HXIA 3TDNA 2PNNA 3OEEA 3QMPA 3CKMA 4MUHA 3CN9A 1DQRA 3CVXA 1SB8A 2V4HC 4XLLA 4XI0A 4PSDA 1ZKDA 2HXGA 5AVYA 4AFNA 1BSVA 1UIRA 4DTCA 1CQWA 2JGFA 2QT1A 2AW6A 5IAKA 1GUYA 2Z4TA 2AG0A 4YS6A 1D0SA 5G0VA 5FPHA 5L4NA 2LWIA 3N71A 1N1MA 2VHEA 2CDRA 4Y2XA 3IAHA 1T35A 2H2GA 4B71A 3NM6B 4NDZA 4PTLA 3GZTB 2XCSB 3GG9A 4CIXA 5AKZA 4J0QA 4ARVA 2I2FA 1LTXA 2HU7A 3LVFO 2WABA 1E1YA 2C42A 3PGKA 3I3NA 5LOVB 2EJVA 3PUIA 4O5OA 1EWTA 1TPYA 5SYNA 4ZYUA 1VMAA 2ZPTX 3KPWA 1VLMA 1Q1EA 2RB4A 3SYTA 4JK3A 1SA0B 4YEDA 3LPNA 2D5BA 2H8GA 3IULA 4K5CA 2WAMA 4WXPA 4MB2A 1IQPA 3D81A 3T0GA 5I51A 4LBZA 3VO8A 1Z22A 1Y8MA 4L02A 4YDOA 2AMLA 3RKSA 1PQUA 5D01A 5EJIA 2XYQA 1QBGA 4FQ8A 4H7HA 1W6RA 3V8EA 3G1UA 4G0MA 3I6IA 4NJEB 4P9NA 2W4MA 4ONEA 1PJAA 1Z6GA 1FTGA 4CEJA 1W30A 4GTOA 3K73O 1U6JA 2P90A 3DB2A 3BL5A 3CBGA 3APFA 2PJZA 1M7BA 2PGAA 4QQIA 1KP2A 5FJJA 3ZY6A 4OX9B 3FUVA 4HB2A 4F5EA 1WPRA 3MAAC 4B8WA 4N41A 2VPWA 3AJ9A 2Q21A 4LXGA 3ZYMA 1E9SA 2G9UA 3PHHA 4UAJA 1O97D 1ZOPA 1X80B 5K01A 3F5DA 5LD2B 2FSHA 1IJFA 4RIFA 1DQYA 1DTEA 3QNMA 5IN4A 4OHWA 2RD0A 4P38A 4BLQA 3F47A 4DJAA 1PEAA 3ZVVA 2JGMA 3A7DA 1KBQA 3BG1B 3EMVA 4KKVA 5BMVA 3VNRA 4PRKA 4B44A 3TWUA 4MUMA 3D6MA 3D7LA 4ANWA 1JAXA 3SQLA 4JUDX 4NOJA 1C5KA 4QTUB 3UMFA 1J70A 3NKFA 3D5QA 2NNWB 1R0XA 3K72B 4UVEA 3RF6A 1SCBA 1Y1KE 3KQWA 4EA8A 1ULTA 1MVLA 3CV3A 3A0UA 1SNYA 3J81A 2VAWA 1WAMA 4DX2A 3RK0A 1NASA 2XB6A 1E63A 4FHDA 4Z4FA 4CV2A 3DCIA 4JBLA 2AUTA 4DBZA 1M2NA 2PGXA 2C7VA 5D7BA 2AVPA 2GCOA 3K4PA 3CF4G 2LAIA 3WIEA 4R2KA 3VYTB 4MDEA 3OFNA 4BVFA 2WIBA 4B3RB 2D2VA 2PY6A 2PQ6A 2QZ4A 3DBLA 4O59O 4PHTA 4C4TA 4HH0A 1X74A 1ACMA 5IAAA 4Q39A 1BCRB 1HE4A 3F6YA 4TXLA 4J7WA 2QYJA 4DJ5X 3HXKA 4E4RA 2FI7A 4P7FA 4IIJF 5L7YA 1NWHA 5G04C 4B73A 1HG2A 2F1HA 1AA6A 5JISA 4JOCA 1B8OA 4R9RA 3W2EA 2V03A 3T7KA 1JI3A 3IPLA 1O95A 4KGVA 4R0VA 1UMBA 2DPHA 2ZJ4A 4V1CB 1N1EA 2I3AA 5ITWA 2L6JA 4PHCA 3LJNA 4NNPA 2CLHB 2ZIXA 4KNWA 4E15A 4KIFA 4DB4A 4O3MA 3W05A 4OAPA 3D7MA 2PT6A 4RDCA 4P5DA 2FZLA 2H7XA 3F6QA 3R7DA 3C1UA 5KMGB 4UUNA 1W6UA 4AZ0B 1QIEA 3VDRA 3KZMA 3QC1A 2IYAA 4U95D 3LCAA 1ND6A 2QTHA 1K8ZB 3KIPA 1USWA 3MOGA 1NYTA 1G1MA 1TEVA 2CW5A 4OH1A 3FMOB 1HX7A 3K9HA 2XECA 3RYHB 4ZOCA 4HI9A 3O90A 3CIFA 2ID7A 4IDOA 4U2DA 2R96A 5BQFA 4HMPA 4I9NA 4D42A 2G0TA 4H7JA 3HHMA 2FPGB 1XL1A 3NTUA 5AR1A 2VDWB 3EQ9A 1RFLA 1K92A 4BUCA 2D74A 1QS0B 5CERB 3H0KA 3JWEA 4I4TA 4A15A 4OMCA 3SNHA 2BBTA 2WMOA 2J0QA 3P9QA 1TNYA 1Q11A 3EDQA 4R1MA 4YWHA 3TG5A 2JH8A 3EXAA 2AYZA 4U8VD 4HDRA 2EGUA 2Q3EA 1A9XA 3OJLA 1YDHA 4CU2A 5EZ5A 3VDMA 2DBVO 1VLJA 2VF2A 4HB4A 1DBWA 3R5HA 2P0AA 4BT8A 3KSDO 1G21A 2AJLI 1YC2A 1CYEA 1RXSA 4BB9A 1Z15A 2ADFA 2JCGA 3NMUF 1H4VB 4TTVA 2HZ7A 3I5MA 1BI7B 2IXTA 4X41A 1TYCA 4JVLA 4XCXA 1C4WA 3R0VA 4D0GA 4YUWA 1QFSA 5IKMA 4BBJA 3C6ZA 5B6IA 1SK8A 1F2UB 2JRLA 4KYUA 5BQOA 2FUG6 3AVYA 3X0DA 1P1KA 3PLNA 1JH8A 1JWLA 3W9SA 4CLXA 4C0EA 2XMCA 4UNRA 3PREA 5HKKD 5CM8B 3DO8A 4QVGA 3FHLA 1Y1QA 4MS3B 4HLEA 2XDQA 1VRCA 5B1BE 2C84A 3AC0A 5JSFA 1AK2A 3FDXA 2QTMA 3OCYA 4HEA1 4QPZA 4FGLA 1TA4A 4Q1EA 1W59A 5A3JA 1OLXA 4PGAA 4YJ2F 2XXAB 4P58A 1QP0A 3X2QE 3KTOA 4DCMA 2I1KA 2Z6UA 2GPJA 3J7TA 2A5YB 1P77A 2ETXA 3PFCA 2JI6A 1KH3A 1QR2A 5DV9A 4UBIA 3VTYA 1CF4A 3GD7A 2QL6A 1FFXB 1PVVA 3C3RA 5B12A 2XZDA 1SULA 5DYTA 2C1EA 2QMQA 2AI3A 4JA2A 1KYIA 1KAEA 3HCRA 4RGBA 1REQB 4RY0A 2AB0A 2ZIFA 5JAQA 2A78A 3HXCA 1G1AA 1ZIXA 3DE4X 3O8LA 1HNWB 3EDCA 1TQ2A 2QLBA 3GJZA 4UTZA 2R11A 1R9GA 1O0SA 3RS7A 4NR0A 4BX2A 1O4WA 3UFXB 3OP4A 1BLXB 3UTMA 1SCIA 4AEZC 2O23A 2FBNA 4U07A 2G8LA 1OA1A 3D54D 5H82A 3CRMA 4UQOA 3NRJA 4FYKA 1C4XA 2I78A 3HL0A 1PZXA 2Z5GA 4YMSA 2C4TA 3FA2A 1ZQ9A 3BQMB 2XCIA 1I8TA 4B47A 4PN7A 3QH4A 3K16A 3A31A 1N25A 2HO1A 2Z5FA 2UZ1B 1UKCA 4JLBA 3ASDA 3TLGB 4LN1A 3B7PA 1P4SA 4IS3A 3SMVA 1WY5A 4A4DA 1S9DA 3VC2A 3ADCA 2WIDA 4GO1A 4V0SA 2JGDA 4ESEA 5B3JC 3ZCSA 3L7IA 3RC7A 4AM9A 2JVKA 1XJQA 3WB1A 1W19A 2W11A 1T13A 3EE6A 4CEHB 2UVDA 3DW1X 3EQ2A 1YIAA 1GQYA 1I33A 1TF2A 2JFGA 4B9AA 3R7AA 4DSTA 4MKGA 4LRXA 4YCBA 2FPLA 3BEEA 4B3GA 3WQRA 1Q2XA 4AVYA 2CSXA 2AIRA 6GPBA 2Q9BA 3R6WA 1E2JA 1N8SA 3AEQA 3MA0A 1XDWA 1IHDA 2HK8A 1BN6A 4MK4A 3RS3A 1B15A 3KOUA 4ZI2A 4JY7A 5JXJA 1BHJA 2QRLA 3EZFA 1JA1A 3V48A 4EFKA 1ZCZA 4EMSA 3BCUA 5HUJA 1PGOA 4KOAA 1XZKA 3OHSX 4C4XA 4UNSA 2A67A 2OZKA 3QWAA 4H1UA 3QEAZ 3JQBA 1V2HE 3HWSA 2WYUA 1IOLA 1C14A 3HCOA 5KZMB 2IYYA 3CT4A 3AUKA 1CZHA 5FL7A 1ILEA 4HQDA 2EJUA 1JEJA 2RKKA 4LW8A 3HB1A 1N2EA 1INZA 1Y8QA 3TCNA 4IJKA 3E0XA 1NR7A 3L9WA 2R1TB 2QTAA 3VVCA 5LCWJ 2XPIA 4OM8A 1DCTA 1B8VA 2O8BA 4NURA 3U7GA 1AF7A 1V43A 4DLLA 5AESA 5AVQA 2DQZA 3D6JA 2XGOA 4L3WA 2RHBA 2C00A 4BQFA 1WXDA 4R83A 5JU6A 3IUMA 3KM0A 3K15A 4X3CA 2QN3A 3SEQA 1CE8B 2RKOA 3KPUA 3D4OA 1RVV1 2OFPA 4S1OA 3SKVA 1ISSA 3FPEA 4JYAB 3E5HA 1BGWA 3X1JA 3U16A 3JQ8A 2XXBA 5KO2A 5EPEA 1JP7A 1TU4A 2VT2A 3U37A 4FHCA 1L9KA 3EIEA 2O8EA 1XTKA 1ZNXA 2HSDA 1SVUA 4F1PA 2H85A 1L0BA 3U81A 1DC4A 5EJAA 3BDVA 3WICA 4Q9HA 1ZK1A 4LRZA 3O4JA 5TGTA 3ZCRA 1FJGB 4D1YA 4C89A 4MGKR 5AOCA 4B3IA 2CJWA 3S5JA 2I6FA 3QARA 3SNXA 4DRXE 2QUJA 4ZRDA 3DFZA 3D7RA 1SC6A 3LQ4A 3Q79A 1H6PA 3FPHA 4Y6PA 5M72A 3CNEA 3VAAA 1EA7A 1Q1AA 3DV0B 3WGUA 1II8B 4UQZA 2VBGA 1E1CA 1RRPA 1RACA 3JATA 2QVGA 4CG1A 4DUGA 1VCHA 1EUZA 4EDHA 4BGEA 1KO8A 4ZTUB 1EGVB 2SICE 4JGGA 3EX7C 1T1GA 2VS1A 1Q0PA 1PK8A 1D8TA 2PRYA 4KNYA 3H0EA 3TXAA 2Q2OA 1B6TA 2FG5A 4LC1A 4EG7A 3EVCA 2VIIA 2C88A 3GZSA 3LGSA 1PHPA 5CFZA 4V24A 4XD7D 5LD2C 5JRZA 2PS1A 4AJ9A 2ZGDA 1U8FO 5JHGB 1AHPA 2IYNA 4J3JA 2UUOA 1EXMA 1SXHA 3G2UA 4W1PA 3LHSA 3NQPA 3HTXA 4C7OB 3EWAA 3HH8A 3DDSA 1O57A 5D86A 1D7AA 3PGVA 3R1IA 4LF6B 4IIJA 2OAEA 3UAWA 3MWYW 2LAHA 2VJKA 3VBEA 4XQ9A 2X6FA 2NGRA 4O1MA 2W83A 3QVJA 3PD7A 3U4IA 4BE9A 2IIBA 5ILGA 1I36A 1DEHA 3WNQA 1EUYA 1T2AA 2P1DA 3KR2A 1QSGA 4QJ3A 3KQMA 2QZAA 5LKAA 1OWOA 4U0UA 3OH8A 2GPNA 4Q01A 4F3VA 4EJMA 2IV7A 3U4AA 8MHTA 1C41A 4A0FA 2NM0A 1QUEA 3BN3A 3TFOA 2NPIA 4HN2A 4C1BA 2HI0A 1KAHA 2BMVA 3EHMA 4HS2A 1HFKA 1KETA 3PYMA 3U9WA 5BOVA 4OXQA 1T6BY 3KYJB 4CKEB 1BC5A 4LV5B 2VSFA 5CT6A 4K3VA 2G7MC 3WB2A 4MAFA 1GRRA 4AKTA 1WABA 2P2LA 5YASA 1EK6A 3ZEAA 2JASA 5E3HA 3ML8A 4MYRA 4RVOA 4WGFA 1FDSA 4DVJA 4ILEA 4KDCA 3SEZA 3ISJA 2C77A 2J3LA 4FOOA 5F23A 3IAS1 5AK0A 1Q44A 5E6RA 5J9FA 4R71A 2EZUA 5LQRA 2ZDGA 2IHKA 2D4HA 2C7PA 3U9SA 4BLWA 3KSBC 4KXKB 5B3KA 4GL2A 2C2XA 2PR2A 4NBUA 4XUEA 3PFHA 3ICWA 3WWPA 3QU7A 2OZVA 5JPIA 3IUPA 2W2KA 2P7IA 2G7ZA 4A8HA 4ZD6A 2UUPA 2LKCA 4MO2A 3QKSA 4KX5A 2TECE 4U2EA 4XQGA 3I30X 2V8OA 2O7SA 4OQMA 2A1UB 4BMVA 3FFXA 3WMEA 4FJ0A 1RTKA 4EZEA 1ZH2A 4FFVA 3SR4A 3AHEA 4B7XA 2ATCA 2Y9PB 1EB9A 1Y42X 1WV1A 1EVIA 4PGHA 2XZOA 1UJNA 4YV2A 4MQ4A 6LDHA 2YJ4A 1H2UA 2B36A 1SBIA 4NMMA 4QU5A 4ZMRA 1KS9A 3MK31 5CVDA 2FRXA 1ZLXA 4BY6A 4HVCA 2V7QA 3VXKA 4DA6A 1XVUA 4AVXA 4RK0A 3M33A 4OLFA 1J2YA 3GZNB 3QHQA 3RVSA 2IDMA 1SCJA 1STOA 1V6CA 4JI3B 5F78A 3IV0A 4BZXA 1JLMA 3PKZA 4LE1A 4GMRA 3RJ5A 4FDTA 3M7IA 3FBTA 2BGMA 4RO0A 3GVCA 1FXSA 5GP1A 1T2UA 1VG0B 3MLEA 3LBIA 3INYA 2J59A 2VGYA 2H51A 2X0EA 3NWBA 4PHFA 4YRIA 3ETDA 4E2FA 4UM5A 4I3HA 1QNFA 2J0EA 1KWGA 3NIDB 5EVJA 1C3VA 1U1EA 3KQYA 3FAZA 3JVVA 1XJ0A 2XEXA 4NBKA 4L9RA 4EFLA 4OD0A 1OIWA 4ZI7B 4GR9A 3JXEA 1XAJA 2QD5A 3WP0A 2FFJA 3FFWA 1FCJA 3JQGA 5LXTF 4DIOA 3ZE0B 5T8KC 3QOFA 4AJEA 4UAVA 4JA0A 1B0AA 2H63A 1OY1A 1ZXLA 5FTNA 1RLTA 3GLHA 4GUDA 1ZESA 2YOFA 5G0SA 4U5QA 1XN4A 3TFQA 2PH1A 1N0VC 4AY2A 2QPOA 2BY4A 4DDTA 4G1BA 4O2BF 2FG7C 2Q46A 1ZG3A 4HY3A 3A1FA 3LI2A 3T4UA 2HH9A 1T29A 4NV1A 4BGVA 3KETA 3GJXC 4Q9IA 3O8NA 1SB9A 5CLLA 4FEGA 3H97A 4XASA 3WNCA 3A14A 5DSXA 5EAIA 3WY9A 1Q92A 1Q20A 4DLWA 3R9XA 1Z45A 1F7UA 5ALLA 1OTHA 2W0SA 3IQXA 5IJZA 4JLKA 1JIKA 4RVSA 2JEOA 3WQHA 1VBFA 2X6JA 3W5BA 1J5XA 4Y7DA 3UWOA 3AT1A 4UWHA 2ZSAA 1E2GA 3FCSB 4N7JA 3Q9UC 3F3KA 5BVGB 2O5EA 4YQFA 3PHGA 3BMNB 1LRLA 3GCZA 2VJOA 5BRNA 5FV4A 1QQ7A 3OTNA 2XYVA 5LIRA 1E98A 4EA7A 3WBKA 3JARA 1JQLB 2ZUSA 4RDIA 1QYWA 4MARA 3CUEF 1L7AA 5BN4B 1YZTA 1SCAA 4CZ2A 1Y1SA 3NHPA 3CF0A 4PSVA 2ZRAA 3Q0IA 5MGBA 2CNOA 4GE3A 3GNTA 5BOSA 3I04A 3U6BA 3LVBA 2RGEA 3OEED 3V8NA 4RTQA 3FP3A 5K0CA 4UTOA 3PJGA 1WPQA 1V37A 2WDZA 1ZGBA 3CLUC 4KB5A 2PAAA 2FXIA 2B2NA 3FZEA 3OFVA 5K99A 4V38A 5DI3A 3KSAC 2VP4A 4LQCA 1E7QA 1RXVA 1KOLA 2ACEA 4CCAA 1YZVA 3TDMA 2P4UA 3WLQA 1VHQA 5A3RA 3W7AA 3NHMA 1PWZA 3UAXA 2QF7A 4AQYB 2K4MA 5FEUA 4MMXB 2W70A 4JLVA 3NWOA 2J85A 3TNJA 3CRVA 1LNZA 4Q9DA 1TW3A 3ZU5A 1Z3YA 3U5TA 4KRYA 3W5HA 2B1IA 3BWMA 1OPRA 4KG7A 4WESB 3I39X 4FYVA 3E3LA 3CEJA 5C5CA 1GZ3A 2W6ZA 3CBQA 2HJGA 1YCHA 3GPLA 3DMTA 1ADBA 5KVVA 1WXGA 1VJDA 2XIJA 2W93A 2ZJ3A 4V0OA 4TVBA 3LCUA 3OPYB 1QVVA 3IJRA 3SJZA 4FSXA 4YHHB 2GQ0A 3G9UA 3M4XA 3I64A 2DE0X 3L0YA 3DWLG 4BRSA 2CLOB 5HDBB 4M9QA 3R20A 2F0YA 5T64A 1EUDB 3GGGA 4JLSA 4YJFB 4P2BA 4CGZA 4K8OA 1U7TA 1RRFA 3BGDA 4ZIRA 4KPFC 4WAFA 2W6MA 1SZCA 4P35A 1L7DA 2XCRB 4D81A 3BK1A 4YP0A 1RRGA 4XX0A 1H6BA 4FEEA 1EDZA 3ASGA 4GXRA 3PE3A 5MDHA 1SCUA 1P2FA 1H65A 1HZ4A 5FQOA 4JT2A 4PBSA 1CC1S 3C43A 1ADFA 1WSDA 4KFUA 3X1DA 4JL8A 3SFTA 1OZFA 3SXUA 1UAAA 3A0RB 1USVA 1LRKA 4I2WA 3QK0A 5FCDA 3ADOA 4G5XA 3VFDA 2F8LA 2WIJA 1FDRA 1YE3A 5CRVA 1Q6ZA 1QG4A 1JX6A 2BGUA 3GL9A 3UMCA 1OXBB 1KPSB 1ZC3A 4YCJA 1UPUA 2BKKB 3ESKA 4WI1A 2JAXA 3HR4A 1CS4C 3IPXA 3LDFA 4TM7A 2YN2A 4QYIB 3LDZA 3U61B 1AZLA 3LHKA 1YJ5A 3HKEB 2QX8A 1N94A 1OTYA 4XPZA 1QH0A 1PFKA 3QELB 5EKXA 5JSYA 3CG4A 3OTQA 2J49A 1G2OA 2BEUB 3R7QA 4R69A 1N6PA 2PFKA 3KEGA 4IMJB 3CF2A 3AHIA 4IHAA 3HZZA 5CJ2A 3Q6MA 2NUPB 2W42A 1PZHA 5EEGA 4HOSA 2WXPA 1KNXA 1KO1A 4CR7A 4LF8B 1VL2A 3TW6A 3TXNA 3R8CA 4ARZA 3DTNA 3IT2A 1XU9A 4P82A 1PUJA 4KIWA 1GPUA 2KS6A 4KV9A 2AXNA 3FOFC 2X22A 5JNVA 1JN0A 2WZBA 3DZIA 1RRVA 2TMKA 3AG1E 5E2BA 4A0GA 4MROA 1WQ3A 3EGOA 4OK5A 4HEQA 5KBAA 2O7RA 2XXJA 1R9JA 5ADHA 3DZGA 5BQPA 4LNBA 2WTMA 3ZDRA 1FX0B 3G6WA 3FLBA 2BFDA 2ACKA 4RORA 1MZCA 1L7RA 5LQUA 1X7DA 4CM1A 1X94A 1KYWA 3SDSA 4MUKA 4JI6B 1PJBA 3R6DA 5DNDA 2EXXA 4D45A 4DLRA 1TCUA 3NNDA 4MVWA 3PC3A 2CFTA 2WHYA 2WZDA 2NU6A 4JJ4A 2GZMA 2QTVA 5K3CA 2BJWA 1LKZA 2VYQA 3MN1A 2Y99A 5CEJA 3ZKWB 3E3OA 1YZQA 3D9QX 1A5ZA 5E9QA 1IHOA 4D2IA 3V1MA 5H59A 5FPYA 4JS0A 4BMCA 1X1AA 4BVGA 3W6UA 2WEKA 3U9TA 1V11A 1OU4A 1XO1A 5AI0A 1UEJA 1M2VA 2ZWIA 4XLZA 3GXOA 1N2GA 3EGWA 5KHAA 5T7BA 3RS0A 4QUGA 1YK1A 1ADJA 4JDPA 1T3GA 1UWKA 5MFZA 1THMA 1AHHA 1P4AA 3AUFA 4GTTA 4IMIB 1U9IA 2QTNA 4UTNA 1EXDA 5K05A 3H17A 4X64B 2KC7A 4GS5A 4MIYA 1VKZA 4P98A 2IZZA 4UQLA 3NBUA 2FEMA 1ENZA 2HKIA 2E6UX 1I5EA 1LI5A 1FYEA 3GMTA 1MJ0A 3WLPA 3VH3A 2DQSA 4XZ3A 4F6RA 3ETHA 4NTZA 3QMWA 1MC4A 1GYRA 1VRVA 4IMPA 4N3AA 1G5TA 5TQ2A 2G1PA 5AOBA 1CV2A 2IQ5A 1E4EB 3R2JA 1E9VA 4I1SA 2VYFA 3DOOA 4HDSA 4G1MB 4RA9B 4CMGA 5IRCD 1YZNA 3QY9A 4KLCA 3HCAA 3G68A 1YRWA 2YS6A 1K7FB 4UE6A 3VHRA 5BY2A 2GSDA 4X7MA 4FEAA 4WJKB 1QRDA 3JD3A 1RKQA 1D5CA 2BCEA 5EYPB 5EWJA 1VM6A 1XE3A 2O4UX 4EOGA 1C0KA 1CIJA 2ETVA 4S1VA 2ODBA 4EH1A 4F2GA 1PEKE 8GPBA 4TMYA 5TQ0A 3DOUA 3KLOA 3U44A 3I62A 1T8SA 4P4GA 5D6NA 4DPLA 3OJOA 1YRYE 2X0FA 3EXIA 4MQFA 1UFQA 2QWXA 3T5TA 3ABLE 4RF2A 3D4IA 1DVPA 2E4AA 4OX9Y 4Y2RA 1Y4DE 1WW8A 2V0CA 3AS4A 1JWFA 2I7XA 5LXTA 3ZY3A 5IBQA 1B26A 3N59A 1FA9A 1M6HA 4ABYA 4MHOA 4GT1A 1RWVA 4BS9A 1K7EB 1OYYA 1ZVKA 2Q3HA 4DBVO 2FR0A 4LYDA 3PVZA 2NVUA 5KNHD 2G72A 3PNSA 5AARA 1EZ4A 4O2BA 3CUYA 4TYPA 2VATA 4G07A 4QXMA 2PS3A 4M1MA 2P2CP 4IXDA 3L6RA 2I22A 3UHPA 3GI1A 1PAUA 3W5SA 5HSGA 5AKKA 4MGYR 1HFWA 2O3JA 1W49A 4MS6A 2IE8A 2VYCA 4JX8A 3G2SA 1BKDR 4Q15A 5DBFA 3MINA 1ST2A 5ALXA 1RJ9A 2XYGA 5JXGA 4EL0A 1VP9A 2OAGA 3OFSA 4X54A 3PWZA 4M88A 2HR1A 1CY8A 2O0LA 4B34A 4UU0A 1J49A 4KQCA 2FF5A 2DVWA 5JHHB 2RGBA 4DPRA 3SI7A 4JITA 5J58A 1WB9A 3O3CA 2PQRA 3BZBA 3UJAA 3LL7A 2QMHA 1UJJA 3N2IA 2QPAA 5DHAA 2D0IA 4ND4A 4HN4B 4BNFA 1G3MA 5FWXB 1Z0IA 4BX3A 3KR1A 3BC1A 2FLWA 2I6HA 3SS7X 3DMHA 3ZWKA 5A4IS 5G1OA 4Y6RA 4OYSA 4MZDA 2PUVA 1WZIA 5FA8A 1QYCA 2GPYA 2GEBA 2W5UA 4JVOA 1K75A 1GTZA 1V1RA 1K8RA 2DKNA 4J16C 1U6KA 4XWTA 4DNPA 4US2R 1DAKA 4LVUA 1CIVA 5CB8A 2VDVE 1HNNA 4G8DA 3UPDA 4MINA 4JVNA 4EY6A 1FJ2A 5IH3A 1W5TA 3LZ6A 5FNZA 2HCFA 3EU9A 1GFWA 3M70A 3EXG1 1K6MA 1O94A 2AQ8A 1CY4A 1QBQA 2WXRA 1XTQA 2X6RA 1XDZA 5K1ZA 2OTCA 1YFZA 1F4PA 1KOGA 1OI7A 5DTMA 4QGGA 1MJGM 4GBED 4XQEA 4JJFA 4H08A 1R27A 5E3JA 5HP4A 1YTUA 3TZBA 2CLIB 4RK6A 2YXDA 3BULA 3HV0A 4N5QA 3JAKA 2IOFK 1JEQA 4QXOA 4HDNA 4ZJZA 3KE9A 3CLRC 3A6EA 4DR4B 3N6XA 3V4RA 3QE0A 1WG8A 3BFKA 1VTKA 2IEIA 1OILA 3DMNA 3QF4A 2F3QA 3MGBA 3M6FA 4CDNA 1XRSB 1PUXA 3EGIA 3IVAA 3EXFB 4FHJA 4UXJA 1IN1A 1EX1A 2W6JA 2HSWA 2KCKA 2W2XA 4UW9A 3PDIB 1TUBA 2RHDA 2TYSB 1CRZA 4QARA 3JD1A 1AGNA 5EIEA 1IN4A 4EFNA 3AY0A 2F9LA 1IQUA 2UU9B 5TGZA 2BUGA 4I6JA 4RA6B 3PFWO 2FF7A 1EJ0A 3LWBA 3VC1A 4PYRA 1I30A 5JZ9A 5SY4A 4Y2YA 4MUGA 4JB2A 1SUPA 5FTLA 3D8HA 2RJOA 3LYUA 1C0IA 3M83A 4DXDA 4G25A 1G8HA 3HXEA 3W8RA 3RHSA 3HG0D 3LGXA 5JSKA 1H6DA 3BIWA 5CVEA 3VPGA 4ZVPA 5D5HA 4QHTA 3K2QA 4FD2A 4MCIA 1AC5A 4J75A 4QZVA 1Q84A 3EPHA 1JLLB 3UJ7A 2Y05A 4DMHA 1X9HA 4KI7A 2Q1SA 2GHQA 4X20A 5AJWA 4ZDKA 1CQJA 3ZU6A 3IQWA 4F4FA 3T9EA 2OXCA 3M6LA 2YIMA 4PPNA 4TWIA 2Y1LE 2VT7A 3L46A 1AKWA 3WLJA 5C8XA 2H4FA 3THYA 5TIIA 3TQIA 1UODA 1U2GC 4AKHA 1RWPA 3F6SA 2CDCA 1EK1A 2R68A 3KLNA 2VDPB 3E15A 1BROA 2AN9A 2AXQA 1RRKA 5JCOC 3HB0A 3ZV5A 5JXIA 5LP0A 4DUGD 4CL0A 2EDAA 1U65A 1VIMA 4NU5A 1H4TA 3GJ6A 2XF2A 2C07A 1Z4OA 3RQIA 2X9QA 4ENQA 1WZEA 5ANLA 5K3EA 1N9GB 3AUTA 4HQFA 3ZQ6A 2ATXA 3AEKA 3PZBA 4EPTA 2QP4A 4FFRA 5FXMA 3L84A 2GKGA 4MKTA 4FGZA 3U3MA 1P60A 3KLBA 1XAHA 2Z56A 4HH3C 3OOHA 4GLBA 3WISA 1YA6A 3ZIUA 3SLGA 4YDWA 1B1AA 1HRKA 1AH2A 4U2CA 4D92A 2OVFA 2RARA 3WK6A 1OFHA 3KDPA 4AZVA 3OLWA 5CLFA 1LLDA 1JFFB 1PLKA 4ZCLA 4WRRA 3EDOA 2B1JA 1WKVA 3EGEA 3SAJA 3NGXA 1HYEA 1EZ1A 1QOQB 1UMCA 1DBQA 2VTVA 3S3TA 4E22A 5L3QB 3TH5A 4DV6B 4G24A 2QMUA 4I8IA 3TTUA 2J32A 4K81B 3OZFA 1TYQG 2JI4A 1NJ1A 4FFOA 4GA0A 2HZBA 2J4FA 5CCLA 4L95C 1XF9A 3KYIB 1V7PC 4P4NA 3VVMA 1B4DA 2B99A 3FTPA 2FFAA 1FBNA 4O29A 2HGZA 5B1AE 1K06A 3UXEA 1A7AA 3F8SA 4Q4JA 4JA9A 5BRJA 1B89A 1N4RA 1GPH1 1SN7A 1BS2A 4CGYA 3LCMA 2ARKA 2DWQA 5D87A 2VSXE 3LPMA 5B37A 1MC5A 2DH6A 2RGCA 3HACA 4TKUA 1MPTA 3VR0A 1Y98A 2ETCA 2GEFA 3C6YA 2ZJ5A 3EZ7A 1SK9A 4LJ5A 2EEPA 4JYPA 1RI4A 4HNUA 4MGZR 4ERXA 1XRQA 1C1HA 3RUDA 3LKVA 4NZOA 5LL6P 4TMXA 2DFKB 2XQVA 5CG2A 2P9TA 3HA2A 2BJVA 5J2UB 1T0PA 1N7JA 1PZMA 2VJCA 5IKXA 3MIZA 3RH0A 2YV5A 1YB5A 4X1YB 1QZ2A 4Q37A 1KJWA 3HCEA 1JJFA 4N0QA 4L4UA 3P20A 2OZPA 2O6HA 4ZN6A 2O9JA 2FQXA 3K6SB 2JGJA 3FSGA 3A1CA 1L1FA 1WNTA 3CLVA 5AO9A 1EFVB 1NLUA 2X2EA 4U6NA 3K4HA 4BUZA 2YUTA 1ULBA 1J0EA 1P4RA 1R10A 3TUZC 4ZWNA 1NW9B 3OD1A 5FINA 2DCPA 3IPAA 1V45E 1K8YB 4Z4IA 3O74A 1E2UA 4OP3A 5M3BA 3K1YA 1P1HA 3DF9A 1AU9A 5JEDA 4MQBA 5ENTD 1QK3A 1J24A 2EW8A 4QC2A 4HJXA 3JVEA 1TCVA 5IKEA 3AFNA 2K87A 5BUSA 3CUSA 3AFHA 2V6GA 1WQ4A 3FRHA 3FH5A 4LYFA 5EXSA 1U80A 4RD3A 1WU8A 1JWAB 3ONVA 1G3UA 1M2GA 2NTEA 3IAM6 4WWPA 1Q0HA 1WDMA 1JJBA 1F0PA 3Q2KA 4JBWA 1Q15A 4PAGA 3ZHEB 1PDOA 2J9FB 3L6AA 1RLUA 4L4SA 2P79A 1GV0A 3L7OA 5IEJA 1JAZA 3ED1A 3AU4A 4HYYA 4DWVA 3CMCO 2H9AA 1WXWA 2A0YA 3GK3A 3USCS 4CCSA 1DG3A 3CVWA 4GI3A 1T2EA 4LERA 5FUBA 3H83A 2FUEA 4HYEA 3PXDA 2SCUA 5DN6A 1GGKA 3WDLA 4NQ0A 4MOWA 1NF3A 5DF1A 2B7LA 2OM2A 4BC0A 1H1LB 3ZBPA 4YRMA 3MUOA 3N2GB 2GAFA 3X1WA 2PUDA 4ITUA 2YQ4A 3T9KA 2GN9A 2AG8A 1T10A 3ND9A 3PCTA 1E9RA 3RRJA 4EYQA 3KPJA 2XSZA 4BTEA 5C3UA 1P8JA 5KNGA 1D9XA 2VRNA 2MSEB 2VJYA 1DV1A 3D3WA 5A0VA 2P9YA 4IF4A 4NJOA 3JXIA 2XQJA 3K05A 2J9YB 3LO8A 1Q77A 1HDGO 4PO3X 1WB5A 3ASOE 1T4CB 4PFQA 3JWHA 3CVLA 3RC9A 1XDUA 4KITB 2Z3ZA 4HWTA 3P7MA 3LCRA 2WT8A 1GDTA 4NACA 1U7DA 4KR2A 2W90A 4NYJQ 5H9VA 2QMYA 1MABB 4OU4A 4IQ0A 3UMRA 1TT5B 1XT6A 3S5UA 5IVHA 4R54A 5DDIP 3EQ6A 3N76A 4FQ5A 1RP1A 3E9CA 1OBHA 2HMVA 4O2RA 3NHKA 1KPIA 4UUPA 2IU4A 1R00A 1M83A 2RH8A 3TBKA 1JG3A 5FH9A 2P4EA 1POXA 1QFXA 4XH9B 2H17A 3JCKC 4OSPA 1PL0A 4PNZA 4WJLA 4J7CA 1G291 3TGWA 3MWKA 2WM2A 3DTVB 4RS4A 1T1RA 3P0FA 1R9MA 4KU4A 2C3UA 4WVLA 2AR7A 1DWUA 1ZOLA 4DR2B 3G2MA 4WHMA 4HX5A 1NYQA 4NZ9A 2YV2A 3DRAA 1F9EA 4KQGA 1WTAA 3OA0A 1IN6A 5DKFA 3INTA 3LX5A 2IZ0A 2R6CA 4CZ2D 2FW9A 1NVGA 1FOEB 4G26A 3DPYA 3VHXA 1JG6A 4BQOA 5TXGA 2IFTA 2MIIA 1RLIA 3JPYA 1BX3A 4FT2A 4XDHA 1S8NA 4BMDA 1GG8A 1BQ4A 5AJTA 3IA2A 5HFJA 2O3TA 2Q8NA 2VCYA 2ZKLA 1LBEA 4NQRA 3I0NA 5M2QA 4DADA 3MJHA 1PQYA 5BXUA 3ODGA 1E79A 1VA5A 2VHVA 1OD6A 4UE3S 5CT4A 2E5FA 4IKOA 4UBOA 1XD2A 2GH1A 4C9BA 4CUZA 4RZIA 4KR3A 1R88A 1GG5A 3UWMA 4MLCA 5ES4B 2PVPA 5EUBA 4PGMA 3ZNNA 1N2CA 2P4QA 1NG1A 1USKA 4X93A 5EUMA 2VYVA 3BMCA 4EUHA 3C8ZA 1JSCA 3EIXA 4KPUA 1DARA 1SOVA 3LCCA 4PQEA 1HF8A 3PWSA 4XPIA 3PP8A 1E6KA 4HRLA 1SG0A 4GX5A 4JOQA 5DISB 3BL8A 2E85A 2AEMA 3BH0A 1IJKA 4A7PA 3K35A 3AL2A 3SU8A 3RVQA 5JI2E 1KH1A 3ITDA 4OTZA 1EHCA 3BS4A 3THWA 5JC8A 4WADA 1KZ6A 2YZKA 2JGLA 3C3KA 4DZZA 5AQAA 3H9QA 2DRIA 5B5SA 1KQFA 3TRFA 3E35A 3DV9A 2H65A 5SY6A 5LOVF 5BUQA 2P9JA 3IIJA 3JWJA 1YS6A 2ECPA 1VXRA 1SVXA 4F3RA 2GZSA 1ZDMA 2WICA 2WT9A 2FP4A 1BGVA 3PKJA 2CKDA 3Q5DA 1DC8A 1WCIB 1D5WA 4F38A 5BNZA 1BE0A 5IDWA 1U2QA 1CR4A 4XOUA 4F7DA 3AW8A 4J43A 4L7TA 4F9FA 1FUUA 1ZICA 2JJMA 2ZUFA 3NDBB 3SBTB 4JJAA 4R0NA 2IBTA 3IT0A 1ZZGA 4D56A 1O1YA 1T1JA 3AF5A 3VOSA 2LW7A 2WLTA 3OC6A 1ZY2A 2JCYA 4ZT5A 2W2LA 5BXOA 3TMYA 2ZU6A 3BA6A 3AHJA 1N6NA 5AVSA 2COKA 2O19A 2YNMD 5BSGA 1T2CA 3LF2A 5JWHA 1A96A 5B3SE 4DSAA 3OQMA 4P80A 1ZJWA 3CXRA 4KO4S 1UDBA 1LSSA 3HADA 2V96A 1NTRA 3AESB 3MWDA 1SOAA 4JU9A 1KQNA 2HA4A 3CPHA 4J49A 2C2HA 3FZYA 2V3CC 2HT1A 3ILSA 4KZCA 4UEOA 2EQAA 3FUKA 4ZVMA 3WMFA 2E37A 3C3EA 4G1FA 1GVHA 4W5RA 1NPYA 2QNRA 3LOUA 2IXGA 1A98A 4D4KA 2UYGA 3OOJA 1NJ2A 4OM7A 2OHIA 2FSFA 3JS5A 3N8HA 4NZZA 1B16A 4IULA 1QHEA 5T4YA 3WX0A 2XVYA 2B6HA 4DV2B 2ZPUA 3M4YA 1U31A 3TEMA 4RTJA 3PWTA 3L7MA 4HAVA 4FFSA 4V3BA 3TS1A 3A1EA 1BE6A 4EB8A 9LDTA 3SZ3A 2C7QA 3HNRA 4ZOBA 4Y2GA 1SIOA 3ANSA 5TQJA 1G8JA 1TEZA 1Z08A 3IHTA 3MTDA 4WNAA 2N75A 3HHPA 4PX5A 3PZRA 2CFCA 4FM9A 4FFBA 1N8TA 2C57A 1J2JA 5JNLA 4NPHA 2AJBA 3FR8A 4IR7A 1U0TA 3NM4A 5I7SA 1GLNA 2OHVA 3B48A 2WLSA 4EIWA 2HDHA 3ZV4A 5DNEA 1PG0A 1QPGA 3DYBA 3C4JA 1A7KA 1ODCA 1W4CA 4GZ6A 5FOUA 1S0PA 4QGBA 3NZUA 1TZCA 2F3PA 2XUAA 3ZGYA 5JS6A 4R9UC 1BMQA 3FOBA 3HKCA 2NAFA 3O1HB 2VO1A 2YKGA 3AEUA 4JHKA 2ZRGA 3BSYA 1NW6A 1PF7E 1KTVA 3QOXA 4F11A 1QOZA 1PFGA 1S8OA 3T5XA 1QYVA 4V0QA 2G82A 2DX7A 2AQHA 1HYGA 4Y2VA 4LKOA 2YIJA 4JCCA 1VHJA 1NATA 4WX2B 4H0CA 2Y92A 4AJ1A 1H2ZA 4INOA 2F1RA 4B7ZA 3AV3A 5EQDA 1M8JA 3RASA 2DPMA 2PZLA 2PJRA 4OO3A 5C8DA 4GU5A 1QYRA 1PCXA 3NM5A 5IJ9A 2P41A 1ZI9A 2PMCA 3LLMA 3PEYA 3ZDYB 1E96B 4CHGA 3WG7E 2GVDC 3GVPA 1T3LA 3S40A 2X0RA 4F6RD 2M2IA 3KFXA 2Y1XA 3EG5A 1R0SA 1WW2A 2I4NA 3KD3A 3M49A 3CEQA 4PPYA 2DZDA 3CQ9A 3PEUB 4PEVA 2H2WA 4BFVA 3PLAE 5KVSA 4PC6A 1BEZA 5D2CA 4G5SA 4WOPA 1SVNA 4RVHA 1V41E 2RFAA 2O8CA 4US1R 1ZRMA 3U4QA 4XEUA 4O2AB 4MP3A 1L7QA 4R7GA 2OGWA 3FJOA 4FE4A 2ZXWE 4MCAA 1X1BA 4MRNA 3TR5A 5D85A 4BQNA 3TG4A 5MFPA 3C7CB 2AZTA 3HYNA 4RFSA 3DZCA 3IXEA 1IOZA 5LQNA 4J2HA 3CZ4A 5ALJA 5A1JA 1T1SA 3KQNA 1R64A 1HFJA 3KQPA 2IYOA 4UQXA 1CUAA 3IB3A 5L51A 2I3ZA 3CR3A 2VPXA 5D84A 1WRBA 4G2TA 2H29A 4RSRA 4RH1A 5K20A 4HFGA 3ZVMA 2XNKA 1RD4A 3LBNA 2L2QA 4B7UA 4M49A 3E33A 1R0YA 4F2WA 4J03A 1VMEA 1QAQA 2ZB2A 3TLBA 2J9GA 4QT4A 3GGPA 3B82A 1NDQA 5ENDA 3RYCB 3FYSA 1TMYA 3NO4A 5AKJA 5ALTA 3UW1A 5EE0A 5K6AC 3KYDA 5FJIA 4C3VA 1AK9A 3THXB 1JKFA 1N34B 1YKFA 2UVPB 4MQEB 4A1SA 5FA6A 4E4YA 3AQ4A 3S7JA 4D0LB 4D79A 2EFJA 1Z75A 2JLVA 1NSYA 2DLNA 2A5LA 2PWYA 4DIEA 4OHPA 3NORA 1KERA 5L4SA 2PWZA 1WUIS 3RWOA 3LAWA 3B20A 4RZHA 1DTSA 1QK4A 3ZZTA 2AW5A 2GVNA 1DCEA 3AR8A 3CPSA 2M6KA 3OZIA 3WK9A 4L50A 1I7QB 1GGNA 1X1QA 2VAMA 3E9EA 4CQJA 3HJBA 4AZ3A 3LTNC 4N9QA 3NYIA 2BD0A 4MS4A 2PL3A 2CXHA 4RWEA 4PS7A 4YVQC 2WWVD 2VPYA 2KBFA 3VH2A 1BW9B 4B31A 2CUKA 2X5KO 4IIVA 2FWRA 4B5KA 3GUUA 3HO6A 3VC3A 4BC1A 3TNYA 5EESA 2JFHA 3VR4H 1TZKA 2JH9A 2E4ZA 1UJKA 2XCOA 1O9BA 3OM1A 2VJMB 1PFVA 4WNCA 4OVUA 1KMNA 1XCBA 4M7WA 1GGEA 1UPBA 3ZWXA 2PSDA 2O52A 4MV0A 4CBVA 3PDHA 2L6BA 5KWJA 4R2JA 1RRMA 3IKMB 1LPPA 2ZS9A 1R6AA 2P3LA 4L4ZA 4DLXA 3ANXA 2OEVA 5CDUA 4B94A 5DCYA 2ROQA 2ZRCA 4RVCA 4JT8A 2P2SA 2WMNA 4KXWA 4QYSA 1SUWA 4RTSA 3KSQA 4YXWA 1ADCA 4ZV4A 3G5AA 4E5DA 1MJHA 5ALFA 4AJNA 5LZ4A 1IHBA 3IQFA 4QG7A 3F49S 3HYLA 3T7TA 4UD6A 5AW6A 5G2OA 2CJXA 4FINA 2PBFA 3B70A 2QZPA 3SKXA 1H0AA 2C4KA 2DKOA 3MIIA 2A4ZA 3LCJA 5L3ZA 3QW4B 2B20A 1VL6A 2NO5A 4BNMA 4DXHA 3Q8XB 1ITZA 4E09A 3EYAA 1DUVG 3CINA 3AKYA 1LTKA 4NHOA 3OQPA 1JSXA 2LKDA 4QNNA 4WN9A 1E1DA 1YS1X 1P5JA 4MLDA 1F0YA 2IYZA 4U9UA 2EV9A 4EEKA 1G8MA 3M6MD 4PFKA 2PYZA 3TOCA 1I51A 3LYHA 2YVQA 2CT8A 1G0NA 1XU7A 2QVZX 1CFJA 4YJ2A 2VAPA 5DULA 4FGJA 3DPUA 3CT6A 4WLEA 4RJJA 1NVXQ 2W6JD 3OZTA 2VHUA 2YRFA 3ANYB 5LOVA 1M8KA 2I1QA 1Q0ZA 3PFGA 1J99A 1NT4A 1GQRA 3H1FA 1OF1A 2HLHA 2BFOA 3ZI0A 2UV8A 2DBQA 1C50A 2GPBA 4JUFA 5ISMA 3EDRA 1JR2A 1SA0A 4TROA 2WVHA 2YXLA 1C3EA 2V55B 3N2NA 1WM5A 3I6ZA 5BWCA 4NCBA 5T4EA 4F21A 4GNKA 2H2AA 4HL6A 5HX7A 3SIPA 3B53X 1P0CA 4DCPA 4CI9A 5I4KA 4IIXA 1YOVB 1RLMA 3UV7A 4URYR 4YUXA 1GAWA 4Y1GA 2HU8A 4ANXA 4NJEA 1M73E 1UWCA 4X1KB 1GR1A 1JFLA 1FSGA 1KZYC 2WV9A 1EGMB 2CDBA 4ZPXA 2OKGA 4Q9AA 5EEHA 3CSTA 1NC1A 4QHYA 4FDMA 3OJ0A 2VZEA 2O3SA 3HFRA 3L4KA 4R6WA 5C34B 3O21A 3PXCX 1M8GA 1YBFA 1I4EB 5A7GA 3LQQA 2PKWA 2P9UG 4EY5A 2HQBA 1B6SA 1X80A 2BOVA 1H8HA 1MTOA 1WKCA 1UT6A 4BV9A 1V5WA 1E7WA 3TGOA 4P22A 2NACA 2XITA 1TD1A 4L9SA 3X2SA 1X7XA 2IYLD 3WKBA 3GH1A 1Z0KA 3STYA 4H60A 4ZRNA 1HDYA 2ZT7A 2PO5A 4AAYA 2NZ8A 3SHWA 1N3IA 4HNSA 2IEZA 4CKBB 1U0HC 3G02A 2NSZA 2P4HX 4WWNA 3HB4X 2PQ2A 4P1ZA 4WNDA 1PR2A 1R8JA 3ZVRA 2Z0MA 4RMIA 1OB5A 3B9RA 1D6MA 4U7WA 4BTBA 3AR6A 5KJEA 5HIKA 4JT4A 1R9NA 1QJCA 1UFVA 4I9CA 3OA2A 4PLHA 1G5FA 4UBJA 2PSHA 1VPEA 3K09C 4BSXA 2IK8A 4CV1A 4C4AA 2XCTB 2EJBA 3PC8C 2XQFA 4RLSA 3K1JA 3T95A 1U5BA 5L53A 1VPWA 3HUDA 2PMWB 2B0OE 3GFGA 4EA6A 3CLSC 5AQ7A 4O8ZA 4W6ZA 1JALA 3TRJA 3LWZA 2BIFA 1OI3A 3UVEA 2B21A 3GC6A 1XRRA 5I8ZA 3FJYA 3R7LA 3T8YA 2HNKA 1BXRB 4JB3A 5DHSA 2MYOA 4ZT3A 3DEHA 3PA6A 4B3HA 3VRHA 2RI0A 3GVXA 3D5TA 3ONFA 4TZTA 1D2AA 4UVIA 3MCZA 5B1SA 3WVNA 4JJ6A 5G02A 1ORTA 2OORC 4MPJA 2JFFA 3L8ZA 5JE8A 1EBBA 4D3FA 1W85B 2XI4A 5L8VA 4U5XA 4Q3NA 3PNQA 2PZAA 2IXDA 3Q8KA 4V1CA 5JQGB 1AS0A 4WBSA 5ALEA 4S2UA 1GEGA 1TMOA 2E1RA 4RD6A 2VG8A 4CIWA 4MH0R 1FUIA 3KUKA 1JBKA 1U6IA 4F4HA 1BOFA 3Q8WA 5KMGA 5J08A 4G2VA 4EPZA 4AZ0A 2NU8B 2F4VB 3IILA 4KQJA 4TTTS 4Y30A 1SWVA 1WPXA 5GZ3A 3O5AA 1TO6A 5JG7A 3FWZA 4ZK2A 4YRBA 1UL1X 3Q10A 2XS8A 4ZOLB 2Z43A 3RIBA 4ME2A 3IIEA 1CHDA 1CUGA 4FB5A 4KK3A 2DM6A 2QYUA 2DU8A 2Q4TA 3RYHA 2VT3A 4GAAA 4J0CA 1WOMA 3ZCUA 1IHUA 4QQNA 2FPGA 2VDWA 5FI5A 4U04A 3FSGD 3NBZC 4LRYA 1QS0A 4LJ8A 1LTHR 1FTQA 4QNMA 3TXXA 3ZK9A 4IEEA 3WRXC 2HD4A 1J8YF 1HRDA 4BPRA 5ICEA 2G0NA 4DR6B 1IMOA 3BK2A 1PTKA 1YSCA 3TECE 3HMKA 3C6BA 1G41A 2HRBA 4M0LA 1A3CA 5A04A 4TWAA 4LZAA 4QU0A 2X3UA 4MYTA 3C3WA 1OXVA 2C9OA 2G5PA 3H5TA 2C8KA 2ZYAA 1RE0A 5LQJA 4XARA 2V6BA 4ASUA 1GNPA 3TIVA 1L5SA 2H4HA 3TIIA 2H1VA 2EEZA 4UEJA 1NI3A 4OHMA 1IHYA 4WDQA 3EPKA 2YXBA 4A6EA 1OJ7A 3I3OA 4P4LA 1F2UA 2YY7A 3GUYA 4KO8A 2GETA 3NALA 1Z2OX 3DEFA 3AUJB 2H8KA 1V4BA 4M8NE 2GBLC 2Z2XA 4HK4A 4IUYA 4P84A 2PX6A 2H6GA 4KQEA 1T3ZA 4OVKA 3RO2A 1P80A 3DCJA 2CLEB 1GTG1 1G7CA 2GXAA 1SIWA 1JHQA 3GFTA 4ZAWA 4HLUC 1Y3AA 5DN6D 2W6QA 2HFKA 2ZZNA 2HU2A 2Q5LA 4CG0A 3OCWA 4I17A 2XRFA 2XXAA 4AQDA 3FIJA 4AU1A 4C30A 3HSYA 5HF6A 2I4RA 5AXCA 3DDNA 5JA4D 3RRUA 1ZH6A 1PJSA 3OFND 1WCYA 2CB0A 3LY8A 5C2JB 3OHPA 7YASA 1QH1A 3EVFA 1FFXA 5MHTA 1BA2A 2XSZD 4HNGA 3KUDA 2FKNA 1VJ1A 4J0KA 4JP1A 5K0NA 4H6XA 4N8DA 2XEDA 4H3SA 2A7QA 1EFTA 3T9FA 4KKXB 2PX8A 1REQA 1FFEA 3SP1A 5EE3A 2V74B 3B6IA 4DUIA 4PZ9A 3DVSX 1EYZA 3WNDA 3P2MA 5IBCA 3FGPA 1TYAE 4HCJA 1TTPB 5CM9C 4IWXA 4IOJA 3UT5B 1D09A 3IBGA 3WLOA 5ICSA 1MEEA 2YDYA 3I37X 5BPFA 3UFXA 4L23A 5JJBA 1WXHA 2ZSEA 4F2PA 2OO5A 4ZI7F 4LBVA 3CGGA 1VBNA 3SBDA 4ITRC 1MP0A 1XZMA 3EH2A 1O95D 1DI0A 2WP8J 5SYAA 1PJZA 3OIFA 2AZMA 4DMCA 3CEPB 3W5JA 2BHNA 1GRCA 3ZHTA 3TL5A 2C78A 2JJ2A 2XCBA 4GVLA 4IGIA 4EGJA 4TLLB 3P0EA 4BFTA 1BX1A 2C7GA 4BV3A 5I01A 4PYIA 5HGXA 4B8CB 1E2HA 1GPLA 2XH8A 3TWQA 3RHZA 1OBVA 1DBIA 3O1JC 4RPGA 5LN1A 4QQRA 1XZ8A 4ZJYA 1Q0TA 3OJXA 4IUDS 5HIJA 4RZXA 2H3HA 4CEHA 1JU9A 3VPDA 2WXMA 5CFNA 1C0EA 5ALNA 3QVKA 1V3VA 2FUCA 2P2DA 3B8HA 4PCUA 2A0WA 3DE6X 4OBWA 3UHJA 1XPRA 3MXOA 1MFZA 3PIIA 2WZQA 1GNTA 2CMGA 2BGLA 3K8YA 2A57A 1PHRA 4DSUA 2BP7A 2BHRA 4PQFA 4DEXA 4ZYWA 1IQRA 4LNUB 5JMWA 4MP6A 2V6MA 2NVWA 2JIPA 5AW3A 2VN8A 1HFEL 5C5IA 2DXIA 4GOJA 1XALA 2O8DB 4R3UC 4BVHA 3DYIA 2B8TA 1GZDA 2HV9A 1K4YA 4UMVA 5DWDA 4NV3A 4NAUA 3DB1A 1ECCA 3KEOA 1E7SA 3GQBB 4Q4AB 2Q6OA 3QGMA 1E79D 1G55A 4KQ6A 5JMND 3QITA 3QI2A 3JPWA 4R6XA 2R5NA 1XROA 1N7GA 5EIBD 3JALB 3E7WA 1WSBA 1J7KA 1N5DA 3ONEA 3S7DA 1E62A 4RD1A 4WNEA 2VAVA 2D7CA 1DX9A 4F53A 3ZXUB 2G9QA 4R68A 1IN5A 4RPKA 3O1LA 3K8QA 2R1TA 2YVAA 3T38A 4AJLA 1ZH0A 2XD4A 2X19A 3RAGA 4XR9A 1EQAA 5IJXA 3DZ8A 2DQKA 2QN2A 2EWMA 4IVPA 4ZAVA 4Z1MA 4Q3EA 1J2UA 4DZTA 4I9GA 3B1XA 5B57C 2ZSIA 1Q7CA 4NBVA 4E88A 4MJ3A 3K32A 2AN5A 2ZI9A 1CE8A 1FX1A 3VPFA 3TKLA 1IBMB 3IJPA 4BAUA 5DBIA 4L6AA 3BD6A 3OTHA 2H5EA 3FU6A 4EI2A 4KO1S 3ZU2A 1Z4JA 5CR9A 1XMOB 3ZDDA 5LNK1 5LPNA 3DSWA 1JDNA 4DQ0A 4XIYA 1X7YA 2NO9A 4R2IA 4ZOLF 2PM8A 5JSHA 3I5AA 3GYBA 3HYSA 1JQ3A 1XZEA 5T4BA 2DEUA 1T0IA 3T3EA 3EHDA 3CV0A 3CEHA 3TKYA 3U7RA 3ZE2B 1KE2A 4C0KA 4ZCTA 3BJRA 3EMKA 1G6HA 1PN3A 2QVLA 2BZ0A 2DWZA 4LBYA 3ISMC 1ZM7A 3DV0A 2FK7A 1II8A 5BV7A 1V2GA 3OCZA 3R4VA 5F1KA 2Q8PA 4JKYA 1OAOC 2W2LD 3D8NA 5DBHX 1XZDA 3IR7A 1Y6GA 3TWXA 1OCEA 2A30A 2PD4A 3LUCA 2VDKB 3RGGA 1RKBA 3H5OA 3UOGA 3MTEA 1ZJYA 4L4YA 2DZOA 5ESXA 4XYBA 3EPPA 4AO7A 1Q0UA 1JECA 1U8CB 4C05A 4ILKA 2A5EA 3VYWA 5CGQB 4RGQA 4DX5D 2OUIA 2WQ7A 5ER6A 2WJAA 4YRJA 3QVLA 3O8RA 1SD1A 1P9LA 2GW1A 3O93A 2UDPA 4KX3A 4KSCA 1MA3A 5C80A 4RG6A 3OOEA 3UBTA 1NRJB 1CKEA 2YIDA 5D1HA 2H52A 1YONA 3ILVA 1SUBA 1TU3A 2OY0A 3GFQA 3WGOA 5HRCA 4NXMB 3PR3A 4YJGB 2IYRA 2G4CA 2XE7A 2WUEA 1YC5A 1P19A 5IVIA 3EQ7A 3CZCA 4DANA 3FNRA 3ND8A 4ML3A 1JAIA 4AZWA 1N5LA 1TGVA 3FUCA 3RJZA 4ZQIA 2KX7A 4HORA 2BKGA 2NYUA 5CVJA 2BELA 2V7GA 1OT3A 3OX3A 1OZAA 3HP1A 4FHZA 1E3DA 1GAJA 1GHTA 3ZPXA 3N0RA 3WNBA 4O60A 5C7IO 5JJCA 4JBNA 1XA0A 2FEZA 1PD0A 4LOIA 3H1TA 3WGLA 3S2UA 4U9HS 3QU5A 3TR6A 1T1EA 1SHLA 4X3PA 4NK5A 3VPXA 1V48A 1W36D 3HN7A 1E66A 3DVAB 3N3BC 1CQZA 3SZGA 2C31A 3X44A 1OBCA 3VNQA 3S7FA 1NW3A 5FL7D 3ISTA 1GCAA 2WPNA 2HWXA 2Z58A 4TLMB 4ALMA 4EX6A 3A1VA 3L8CA 4OKNA 1X1SA 3Q78A 1YS4A 4QJ5A 3S6JA 1CRLA 3LBAA 3KWLA 2VF7A 1FDUA 1N6KA 3CHQA 1WUHS 2VNIA 5KKCA 1ZRHA 2Y76A 5AJDA 2ABWA 1QGED 3Q5EA 4BJ1A 1XHLA 3G9QA 2WE8A 1EP9A 1L8OA 4UUCA 1GCIA 3GJ0A 5IDQA 4NULA 1ZN2A 3TMAA 1L1RA 3TMKA 2C2KA 1KSHA 2YL2A 4MUEA 4BNVA 4BNZA 1P45A 4B82A 1UJ4A 1XFAA 3OZVA 4Y9SA 5P21A 5J43A 2DULA 2Q27A 1J8FA 3LWNA 4BP8A 3KZCA 4XQCA 1UBUS 1SC3A 4CMBA 5ALQA 1ZCFA 2A86A 4GI2A 4HVAA 1I6LA 2Y0DA 4ZO4A 4FJ1A 3WIUA 2G63A 1JU3A 2J41A 4QPCA 2ZJ6A 3EA0A 5F21A 4E3ZA 4Q7KA 1OCOE 5U4QA 4D3YA 4UUAA 1WX1A 1D2RA 5B55A 3O4IA 2CNBA 1VSTA 4PHGA 2Z8XA 2D1FA 1UKYA 1ZWKA 4XQ0A 3QE3A 2RK3A 3QXXA 4EZJA 3GROA 2VP6A 5IJWA 4X71A 1OE0A 4UBLA 1THGA 3A6DA 4LWOA 5IUJC 3DHVA 2EFHB 1XAGA 5HJEA 3TIFA 5FRDA 2AX3A 3GYZA 3VU0A 4BIIA 5K9ZA 4AP2A 4QU8A 4GD3Q 2RG7A 4B2IA 3B3GA 4RADA 4KBYA 2KATA 2YJ6A 5A5GA 1P5ZB 2I8AA 3RARA 1DFIA 1UBOS 2H1IA 3NIWA 4QT0A 3F3SA 5C0OE 4O3FA 3L08A 3DL4A 1BMFA 2HNBA 3C15C 4ZFHA 5EYPF 3I83A 3L0ZA 2C5EA 5E7QA 4HS4A 4Q7QA 4PAWA 5ENRD 1YZFA 4J1SA 5LDHA 1SUAA 2E48A 5KX5B 4MPRA 3WHKA 2MSDB 5CMLA 4DIUA 1AE1A 1XZNA 2VUIB 1ZXXA 4E07A 2I2CA 5ICFA 5KSZA 3RSEG 5IBRA 1E1KA 2NYAA 1E8WA 1KSGA 2VA8A 4I1YA 3ZX5A 3FTXA 4N48A 4TQ9A 2GCIA 4HDMB 1ZHOA 1P2BA 3GLVA 4M9XA 3OWOA 3KKMA 1ENOA 2UYYA 3HC7A 4Y67A 3H05A 1AUXA 3VSBA 1PSDA 2JAQA 4M86A 4CKXA 3COWA 5JD4A 2OD2A 1TQDA 4ZAYA 3GJQA 4ER6A 2WNHA 3ZXIA 4EA9A 2GPWA 4RKWA 2B8EA 2R00C 1SEVA 1SVWA 5DLEA 3NHAA 2ZCVA 2E4YA 3A9RA 2PGIA 4RYLA 2ST1A 1YULA 1ODJA 2QM3A 5JNUA 5E7MA 5BSMA 4HOQA 1QCCA 3JQAB 3TLMA 4WKBA 4YPOA 3ULKA 3PSAA 1OR8A 1EFHA 4O0MA 1BD8A 3QPAA 3R9KA 4Z54A 1ZHFA 4GLOA 3Q7AA 5AK3A 3PC7A 3M8KA 3JRWA 3QFHA 1HTTA 2J9RA 4B6FA 1ECGA 5CB6A 3V4PB 5BVGA 4FK8A 2WFLA 7ADHA 3WIDA 4CN9A 1UQUA 3C7AA 4N0EA 3GBPA 3D5EA 3T1OA 2IYEA 1XHEA 4MR9B 2G67A 1IWOA 5BN4A 3RI3A 1G38A 3E5NA 2XMQA 4OFZA 3S2EA 3ENNA 3OUZA 3T3DA 1KNQA 2Z8YM 1DPGA 3GN2A 5GPBA 3DAPA 1XLVA 3L4BC 4N3NA 2FO7A 2JLQA 5ARDA 3ESQA 2ENUA 4JOBA 1E5TA 4FFMA 1Z0JA 4TVOA 4YBRA 3B5IA 1NTOA 4ND6A 2IP1A 3OJEA 1MUUA 2AT1A 4HXYA 5B1DA 2GESA 4BX8A 5IKPA 5CU7A 4F85A 1XRMA 1ECPA 3O94A 1R5NA 3VTAA 1MV8A 2QN1A 2WNSA 2D8AA 4U02A 4FJZA 2D0DA 5U9CA 4L57A 4DT1B 1VDZA 2QTFA 5LZ7A 5T3YA 5B58T 1I2MA 2CHZA 3L0SA 3JW8A 4OI1A 1D04A 5LM3A 3BXEA 3PDCA 1Q1BA 3ACDA 1GTJ1 4GR5A 5JD3A 2V7QD 4HNHA 3AJDA 1HSOA 3SM3A 4AULA 5CYGA 2ZVPX 4F9GA 4WESA 1NF8A 2CG2A 2PH3A 5BN5B 3IP3A 4G8LA 3BHJA 4ER5A 1CF9A 2IOFA 1YVDA 2OGUA 1DAFA 2OK7A 1SQ6A 1TO2E 2AOUB 5HTKA 2XWSA 5AOAA 3NWEA 4LI0A 3EH1A 2A3RA 3A4TA 3L17A 2QJWA 4EGSA 3OPYA 1X7ZB 2VYIA 4CLRB 1D2EA 4X94A 1T43A 1U4OA 4WK0B 4FU0A 1EUDA 1G6OA 1GGMA 1YK0A 2I71A 4O8CA 2C3YA 4YJFA 4CMCA 4FSHA 5J90A 3OG9A 3MD0A 3E1KA 3EWNA 4ZT7A 1NP7A 3W5UA 1RMQA 1E0KA 2XUJA 3ZY2A 3AR3A 5ERXA 3W1EA 4PYQA 3ELYA 4NEQA 3RC8A 3BDIA 1FSPA 2GYVA 1UBGA 2P27A 2V7EA 4DCOA 3OO0A 4W5HA 2R8ZA 2XB4A 4L5IA 5JTUA 2NU7B 4QAJA 2JFUA 1GSIA 3FVVA 2R5WA 3C0KA 4ARIA 3D7NA 5TEWA 1JILA 4P3PA 2H1HA 2VUHB 4LHVA 5DWQA 1QO0A 2QTWB 1XZJA 1FFYA 1L3IA 3WR5A 1MTZA 1CNMA 3BBLA 3ESZA 1FTSA 1HZJA 3ETJA 4CPDA 3AR2A 4IQ8A 3HXOA 2XPCA 1G9XA 1ZPDA 4D8TA 3IELA 2E21A 3Q9NA 4C4OA 2NT3A 5DNWA 1AQJA 1VE6A 3N5CA 2BUCA 2B30A 2YHCA 4N01A 4UMDA 4YWJA 3Q12A 2JCSA 1DAPA 3AS8A 1NX9A 1NJGA 2TRSB 3E70C 4WXEA 1Z6QA 3QELA 3EVDA 2E2WA 2V58A 5HCIA 3ORRA 2BEUA 4YO7A 3SS8A 3ITNA 4IPTA 4MR8B 1MN6A 3P5BA 4LI3X 4CIAA 5EMLA 1JQEA 2NUPA 4LG6A 3P4UA 4OHBA 4C4PA 2G17A 4ACKA 2ZI6A 1LXCA 1SZJG 2GFHA 2HNAA 4YP9A 3JUIA 2AVDA 3GMSA 4DKXA 5IJ0B 2DHRA 4CCYB 2ONYA 4KWIA 4C6RA 1DZIA 1YMPA 4PCLA 1V9SA 1IZ0A 1JHYA 1OQAA 1RU3A 4YQEA 5CD9A 1KEEB 1P33A 2WD7B 1FQKA 1K8XB 1N52A 1Z38A 3FPBA 1KVRA 3U7IA 4NL4H 1U0JA 1A2QA 4A6XA 2ISCA 5JYEA 5LCWC 1RYMA 4RVGA 5K2MA 2YS7A 1UT8A 2IYFA 5A7HA 1LBIA 4Y9DA 4BE4A 3PTZA 4NG5A 5D3MB 3G9ZA 3RV3A 1DMSA 5BN1A 1JW9B 3QA9A 5CEEA 4UWLA 3FCCA 5FO1A 1M6YA 1PX0A 3AJEA 3FPJA 3ZKWA 3R09A 1GR0A 3TWTA 5AHXA 1R6VA 5KVQA 1U8TA 1CFZA 2R86A 4EJ2A 4EUNA 4OKIA 3DS8A 1FVHA 2ZUUA 1O0BA 1N0RA 3QYPA 4GMHA 5SZIA 3ZNPA 1GXSB 3HB5X 1Y1TA 1KHHA 4BNKA 4RANA 3X1MA 5AKYA 3Q9SA 2G0AA 4YAEA 5THQA 4A82A 4NS1A 4JH0A 4CL2A 2PMFA 3U3JA 1QNLA 3O6VA 4YAKA 3SYMA 5U1PA