4K0RA

Crystal structure of mouse cryptochrome 1
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
487
structure length
463
Chain Sequence
b'VNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPCMTPLSDDHDEKYGVPSLEELGFDTLSSAVWPGGETEALTRLERHLERKAWVANFERPRSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-1
publication title Structures of Drosophila cryptochrome and mouse cryptochrome1 provide insight into circadian function.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein
total genus 170
structure length 463
sequence length 487
ec nomenclature
pdb deposition date 2013-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4k0rA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4k0rA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4k0rA01
3S3TA 1N2GA 4QBTA 4U8HA 3FETA 1EJ2A 2E0IA 2J09A 1U7DA 1K97A 3HL4A 1GPMA 3N05A 3AG5A 2A84A 3P0IA 2JANA 3QE4A 1U3CA 3VGJA 2EJCA 1IQUA 4OUDB 4G6ZA 1T6XA 4EG4A 3NV7A 4MULA 1Y42X 3H9BA 1ULHA 1PFWA 1JHDA 1GTSA 2BTEA 3COZA 2BYTA 4QREA 4AS1A 4MUNA 2DERA 1KH2A 4ZCQA 3QTBA 4U63A 1OD6A 4MW4A 1KH1A 2A88A 5F23A 3D6UA 2JAXA 1EXDA 4F4HA 2PXHA 5DASA 1O5TA 4F3RA 1NUTA 3ELBA 4KPUB 2X1MA 1PFVA 4PY2A 4DDKA 2X3FA 3P0HA 3C8ZA 4OJMX 4U7JA 2RD2A 4MUJA 4NZPA 4PBTA 3TZEA 3FHJA 3HFJA 4HPWA 3SZGA 4ARIA 3H9CA 5EKDA 1YIAA 4MVWA 1U0BB 4MWEA 1QRTA 4X0EA 1VBMA 5HUJA 5J59A 5H16A 1NP7A 3HV0A 2QJTA 3CA8A 2X1LA 2CV1A 2I1LA 1GAXA 2DUMA 3TQOA 1M8FA 3G59A 2ZUEA 3N9IA 1T6YA 3PNYA 1BS2A 4MW7A 1G8GA 4ZT5A 3ND7A 1S4MA 5K0SA 5KHAA 3TNJA 1I6LA 4K0RA 1R6UA 2JA2A 2QUKA 3I05A 4DDHA 3L93A 4MVXA 3ZUGA 2PG3A 1M83A 2QTMA 4NX2A 4HJRA 4AQ7A 3COWA 2AKEA 1UFVA 2OV4A 1KP2A 5IJXA 4PBSA 1J70A 3M5WA 1HYBA 2GOYA 2A4MA 3ND6A 2HMAA 5LLTA 2XRZA 4NAHA 1QU2A 4RPIA 1A8HA 1X6VA 4ZCSA 3RFFA 1OBHA 3IVCA 3KT0A 1WY5A 1N3LA 1EFPA 3LCJA 4EF6A 4YP6A 1GTRA 2E21A 3LE8A 1NYLA 1NURA 1WXIA 3N2YA 2QUJA 3N8HA 1MAWA 3IVGA 5KWVA 1N2JA 1TYAE 3Q10A 5FNZA 1H3EA 4HJXA 3GMIA 2G36A 1XNGA 4H3SA 3LOQA 3IOEA 4MWBA 1N2EA 2CYBA 2Z3VA 4MWCA 1N2HA 1SURA 3MLAA 3IOCA 3UC5A 4MWDA 1M8KA 4EG1A 1MJHA 3IUEA 2HZ7A 3RJZA 1GLNA 1V8FA 2IELA 3UMVA 1OWNA 1H3NA 2QUHA 3ISJA 1O6BA 3X1JA 3H05A 1O0BA 2XRYA 2IP1A 2D5BA 4YBRA 5TS2A 1WZ2A 1T6ZA 3X1MA 4ZT7A 3SYTA 4CT0A 4YP5A 3RHSA 4MVYA 1VBNA 1VL2A 3AL0C 3HGMA 1ZJWA 3K32A 4XFJA 1U3DA 2DEUA 3F3MA 1ILEA 1TQ8A 5HUHA 1EE1A 2QUIA 5FO1A 3P0JA 4EG7A 3ZXIA 3AKZA 2DR2A 1OBCA 1GN8A 3OTWA 1KORA 4L2IB 2PZBA 3IVXA 1U7XA 4PBRA 1WKBA 1O96B 3KT3A 3CLUC 3CLRC 3PNVA 2WB2A 1R6XA 5AHWA 4ZCTA 4KR7A 4MUKA 3FOCA 1XNJA 4I6JA 3U1VA 2ZP1A 1XJQA 4ZT4A 3NBKA 3AG6A 3A2KA 2QTRA 3RBAA 2WQ7A 1JECA 5JBNA 1EUQA 2AG6A 5J5AA 3IOBA 3CLSC 4OUDA 2PZAA 1MC1A 4MQ6A 1KKUA 3SZ3A 3CLSD 4XFDA 1DNPA 1RQGA 3PXUA 1GZUA 3MUEA 1WXHA 3IH5A 3KT6A 5J58A 5DK4A 4L2IA 4CQNA 4MW2A 2D54A 2H29A 4ND6A 5TGTA 3CR8A 4MW6A 1O96A 3DLAA 1P7PA 4UZEA 3X1KA 1QRUA 1K92A 2QJOA 1JIKA 3VU8A 3IDFA 1O0CA 2B7LA 3ND5A 1WOYA 1M1ZA 4KPUA 3HZRA 3KT8A 1KAMA 1J21A 3ZGZA 3Q12A 2E89A 5LFAA 4CDNA 1KP3A 1Q15A 2Z09A 4JXZA 1I6MA 3H99A 1NUUA 1JZSA 2H2AA 4MUFA 4ND7A 3IMEA 3CVXA 1T9GS 4P2BA 4R0NA 3CVYA 1XNHA 2J4DA 4GU5A 3FDXA 3GLVA 2V0GA 1ZH0A 1N2BA 5DEOA 1ZH6A 3ZXSA 3AIIA 1YUMA 4MVCA 4MUGA 1KQOA 2J5BA 2HGZA 1JGTA 3DV2A 2A1UB 3Q4GA 4JXXA 2YY5A 1NI5A 1I2DA 3FH0A 1R6TA 1N1DA 2QTNA 3UOWA 1IQ0A 3NBAA 4FZJA 1IHOA 4MAFA 1OWOA 4ZCRA 3RK0A 4MW5A 1TYCA 5HG0A 2ZUFA 2A1TS 2CYAA 4Q93A 4DNXA 4EG6A 4JYZA 3CLTC 3IODA 1WJGA 1J1UA 4K03A 4MUHA 1N2IA 1TFUA 5TEWA 5H7XA 2WQ6A 1WQ3A 1WXGA 4HK4A 3CVWA 2DLCX 1IRXA 4MW1A 1IH8A 2EL7A 3JXEA 1O94C 3P52A 1NUSA 1F4LA 3H97A 1IFXA 1O94D 3CVUA 2GKSA 2A1UA 1M8GA 1NUPA 3MMXA 2NZ2A 1YIDA 1WQ4A 4JFAA 3GUZA 3AFHA 3PRHA 4RUKA 1LW7A 4XSVA 3UK2A 1MBZA 3FI0A 2TS1A 4KR9A 1LI7A 4WSOA 1KQNA 3FG9A 1EUYA 1LI5A 2DPLA 1F9AA 3E27A 1KH3A 1IVSA 3TZLA 4YMIA 1YI8A 1MOPA 2PIDA 2Z08A 3FWKA 1TYBE 1G8FA 3VRHA 2YXNA 4NATA 1G8HA 1PG2A 1TEZA 4MUEA 1JMVA 1OWPA 1CT9A 3CLUD 3CLRD 1KQPA 4J75A 3FIUA 3MXTA 2C5SA 3IUBA 4DLPA 1YULA 4R2LA 4NDAA 4ZT6A 4EG5A 3ZJUA 1JEDA 3ILVA 2J07A 1F7VA 4ZCPA 3TQIA 5DB4A 1V47A 2X0KA 1G59A 4R2MA 1J20A 2AZXA 1N2OA 1H3FA 1NZJA 1JEEA 4GRIA 4Q16A 1Q77A 4J76A 4CDMA 3CVVA 1JIIA 2A7XA 1TYDE 2V0CA 1OWLA 5FO0A 4UZFA 5IHXA 2O8VA 3RK1A 3ZJTA 1T9GR 4EG8A 4MLPA 1COZA 1J1ZA 3UY4A 1MAUA 1FFYA 2CUZA 3BL5A 4DDMA 4QRDA 1VLHA 4G5FA 3G6KA 5KCMA 4ARCA 1KR2A 4I6GA 1EFVB 2CV0A 1MRZA 3FNRA 1K4MA 2DETA 4EFKA 2RE8A 1NSYA 1QJCA 1K4KA 3HMQA 3COVA 4KR6A 1O95C 3COYA 1Q11A 1O95D 4E1AA 3OP1A 1EFPB 1O97C 4BWVA 3D6VA 2CT8A 1MB2A 1O97D 3PNBA 2A1TR 4EGAA 5K0TA 1Q19A 3L92A 3G5AA 1QU3A 4ZT2A 2DXIA 2PZ8A 3A04A 1H1TA 4YP7A 4A91A 2WSIA 1JIJA 1WXEA 1OWMA 1EFVA 1YUNA 3QTTA 1D2RA 2D13A 3KFLA 2VTBB 1IQRA 4EG3A 4I6EA 3K9WA 2O5RA 1MB9A 4MUIA 1PG0A 4WNYA 1I6KA 1N77A 1QTQA 1JZQA 1X8XA 2IJGX 3A05A 1F7UA 2R5WA 1M8PA 4KKVA 1FYDA 1PFYA 3DPIA 2J08A 3SEQA 3CLTD 4DJAA 2GM3A 2QJFA 2CV2A 1VBKA 3IMGA 4G5YA 3ZIUA 1NUQA 3A4IA 4TS1A 4MW9A 2VXOA 5TEVA 1QNFA 3ZJVA 3FY4A 1PFUA 3SEZA 1N75A 1N78A 2CSXA 4ZT3A 1ZUNA 3IMCA 3TS1A 1QRSA 5BNZA 3SDBA 3DO8A 3MLBA 2NSYA 2YWBA 4JZYA 4S1OA 4MW0A 1M8JA 3INNA 4DE5A 2OQ2A 1QQTA 2VTBA 2CFOA 2CYCA 1JILA 2YWCA 1J09A 1B6TA 1KAQA 2A86A 4NAUA 2E18A 3SP1A 1WXFA 2PFSA 5LM3A
chains in the Genus database with same CATH superfamily
1S3SA 1CHNA 3AHHA 1HQCA 1WB6A 2FPOA 4OFWA 1JQKA 1G7RA 4DLZA 3P45A 5C4GB 3U17A 3SBDA 1JVBA 3GLHA 2CNWA 4WLVA 4BNGA 3UWSA 1RRVA 3LKBA 1SXJB 1TD1A 1HOXA 2XHEA 5DP2A 2PM7A 1NUTA 2A0XA 2ZAGA 2AMJA 5TNXA 1AF4A 2ZG6A 4JP1A 4GWLA 4ND5A 5JEDA 4MWEA 3IPXA 1PSZA 4PNEA 5GPBA 1EM8B 3QW2A 2ZRKA 4GMXA 1FU4A 4R2HA 2XZTG 4YUAA 4EKDA 1EFTA 1B6GA 3TVYA 3B2QA 3OJXA 1TLFA 4K40A 2I71A 1SHJA 1XZGA 3R6DA 1ZITA 3H5NA 4I0WB 3SXPA 2OHJA 3O73A 2I78A 4M55A 2GZ2A 2D8AA 3EXEB 3QIVA 3UANA 4MS4B 4DLAA 2MT9A 4WI1A 1IXYA 1VE1A 4C3VA 2IXDA 1G9TA 1X7YA 3MAAC 1NXXA 1C1DA 2YL2A 1DCTA 1SMKA 1W4BA 3WP0A 3UV7A 2J9FB 1AKYA 1AHIA 2WF6A 1KO1A 3V4SA 2FFJA 3TPCA 4Z0TA 4IIJB 2G88A 1A9RA 1ZN2A 2ORVA 3G8BA 5HJ7A 3IUNA 4ARBA 4KIJA 2FN3A 3X1XA 1I51A 3ZDFA 4HQRA 3SC2A 3WLOA 1GTG1 1NI4B 1CUJA 2PZGA 3IP1A 1YCHA 2AOUA 4IEEA 3ZQ4A 4KZKA 3ULQA 3OWOA 4C7VA 3IP9A 4J0GA 2Y1OA 4XSGA 3EFOB 3A2KA 4NQRA 1LJ8A 5KJFA 4ITVA 4FA6A 4FDVA 4NYJQ 1NF9A 1X7GA 4FWTA 3LQYA 1LLDA 5FPPA 2IO3C 1PBNA 3ASVA 2XOXA 1A9XA 4RLQA 2I87A 3SS7X 1JBKA 4CODB 3GELA 3R24A 3O4RA 4TTQA 2HTFA 2X4LA 4RZ2A 3FDZA 1HFWA 1ZNYA 3RDPA 3DBRA 1FMJA 1P77A 3RTDA 5ALUA 2CBZA 3EUVA 4K6HA 1O95A 1B73A 5G1OA 2PZMA 1Y6IA 2W58A 2JGJA 5IASA 3ZCPA 1JJAA 1QCDA 1NC1A 4B73A 2E4VA 3GO4A 1DWPA 1CG6A 2WM8A 1KYZA 5LUBA 1ZJ6A 1SBTA 1OYVA 5IDQA 1JCQA 1M34E 3LF2A 1XPOA 3VQTA 3BOSA 1ZJYA 3QJYA 2H1OA 2FSGA 3KZ1E 2UZ3A 1N2OA 2O4CA 3ZE6A 5LSAA 2ZRFA 1YB4A 1YL7A 2CFSA 2ILVA 2WF7A 4HEA1 3SMQA 4NI5A 5FZSA 3MJEA 4AP2A 4G5FA 1NXOA 3DMNA 3C87A 2G4LA 3FPHA 4HMOA 1U5AA 1TUGA 1UXGA 1EWQA 4XVUA 2R8PA 3KSRA 3LBYA 5FQ6A 1TVCA 4Y6WA 5U1PA 1F3OA 2WUDA 1TJ5A 4M1WA 1M2OB 3RS5A 2BHTA 2OSBA 3V1LA 3Q1KA 3O47A 1O0SA 4P0TA 3OQIA 4HMQA 3V8BA 3PGMA 2JGKA 3EZGA 3PUWA 2VWQA 4FOTA 4C5AA 4OJNA 2A0UA 5FL7A 2VQDA 4CIDA 2AZTA 5DYYA 2CLDX 1T29A 3N2EA 2FRDC 4WBNF 1XEAA 1KMHB 2FJPA 1R3DA 1MAVA 1N2GA 5C0OE 4CDRA 4DX5D 5T8KA 5KMGB 1L2TA 1BFUA 3LDUA 1DUIA 4G6ZA 1JTFA 2ATXA 3CPSA 2H57A 2E82A 4ENQA 5GTDA 5K3FB 3ZWXA 5HKAA 2J46A 3NEYA 5A9RA 5LZ8A 1AG9A 3WK5A 5BN3B 4D8YA 1KPHA 1UBMS 1NA3A 2PKEA 1IPEA 3HDYA 2EJWA 2W9XA 4GDMA 2YZGA 5H16A 2QJTA 2FW7A 4JLDA 1FQWA 3TOSA 4AJPA 4LDJA 4GTPA 3TLKA 3KVNA 2BTOA 4DJTA 3AOGA 2HBQA 1K75A 2PUEA 2QMUA 4MVXA 4ZIRB 1XP8A 1ISMA 2F3PA 4US2R 4YRDA 4NBTA 4YDRA 5ADVA 1X1DA 2NM0A 3NTVA 4LJ7A 4GI7A 4Z51A 1ECPA 4BX3A 4BLUA 3DNFA 5A9TA 2CG3A 2ORWA 2BFWA 1V3TA 1JAZA 3H11A 1HE1C 1GTRA 2FEAA 2C3MA 2QX7A 4B4DA 3JS5A 2WZCA 3B95A 4JLOA 3ST7A 3FVVA 3EULA 1RWMA 4WESA 3AT1A 2ZSDA 2JG3A 3HVKA 4LNBA 5J2UA 1YU6A 2VSOE 3WHPA 4K5BA 3Q3JB 1TGVA 1ZYUA 4CT0A 3OZEA 1OBFO 2HA4A 4LE2A 1C7IA 4WCFB 1O8CA 1AB6A 3LFHA 2F8MA 1V43A 4J3JA 2PLRA 4RKYA 2PR2A 3CLUC 4CKYA 3D6TB 5DK6A 3THOA 3H86A 2GFHA 5ALNA 3D9LA 2C8LA 3C3BA 4RTPA 5IEJA 2QV7A 1T2UA 3O93A 1NW6A 1Q50A 5TGDA 4RQIA 1MJGM 4XCQA 3AJDA 2BKVA 3OQ6A 3ZG6A 2NU6A 4YAWA 3FAKA 2GCEA 2XNDA 1NE2A 1AK1A 4TGLA 3E48A 1SIUA 3VNUA 1U7UA 2H11A 4KI0A 2C00A 7GPBA 721PA 4DSOA 1G17A 1HLDA 4BPBA 3D02A 1JGTA 1IDN1 4PZAA 1FP4B 4ZOCA 2GHRA 2G17A 1L4LA 4QU9A 5LQNA 4AY2A 3N0XA 4BKUA 3R3WA 4MGKR 3ODPA 1TB4A 3DNPA 5J5VA 3L7LA 1PLKA 4LQ4A 3UWPA 2XUDA 3THSA 3NDRA 4NNJA 5ILGA 5JXIA 3P52A 5K3CA 4L9SA 4NEHB 3WVNA 2I54A 4B89A 1HRDA 3C3XA 3R8CA 4WXMA 2ZWAA 4ZN6A 5A5VA 1RQXA 4ALLA 5AESA 7ADHA 2JJ1A 2ID7A 1HDYA 3WXXA 1WL8A 4W6QA 5HGJA 1H4SA 2PWZA 3WGKA 4IWNA 5EJ8A 2BPOA 1GU0A 2PSEA 2C4UA 5CG2A 2UUBB 2A9OA 1H8HD 5TC4A 1Z7EA 3PF8A 3IIIA 4OGLA 4C0QC 1NAHA 3G5LA 4HNGA 2GASA 2O8VA 5K3EA 2WMOA 2ODTX 5SY9A 1AUPA 4GMJA 1KJNA 4CF3A 4M1QA 2ZIGA 4IV5A 1QH1A 4UQPA 1SN7A 4RQBA 3G85A 3PUJA 1W8IA 4JXTA 2DBZA 1OXJA 2F9LA 3SF0A 1TYZA 5SZJA 1K3UB 3E9YA 4BWVA 1FP6A 1BKSB 5DW3A 3WK8A 5B1YA 1P62B 3GXBA 4IXTA 4ARZA 1PHPA 4ILIA 1IZZA 3WK6A 3WGUA 4XGIA 3I9OA 4Y0NA 1NPDA 4KSBA 3K9GA 5BMOA 4OQ4A 1O6GA 5EWJB 1EI9A 3FUEA 1BXKA 3OPYI 1VKNA 1HT1E 3DZCA 3HQ4O 3KUCA 1KSJA 1L5GB 4NZZA 3FR8A 4WD3A 4CV1A 2X9QA 4BKQA 2RFMA 2Y92A 1DKPA 4RD0A 4QTZA 4GI1A 5LP0A 2C5FA 2FP3A 4FI3C 3DSSA 1MQ9A 5KYGA 3W6NA 4KXWA 5JBQA 3QMWA 1V5EA 1J25A 4X3OA 4FYIA 3DKVA 1WXDA 3RK4A 1UKZA 5CLFA 4OHOA 5AUQA 4PY2A 3ZOZA 1YA4A 3VR4A 1TEXA 2NGRA 5B55A 3SE7A 3ONKA 1VYUA 3ZPJA 2QZZA 4IJMA 4HMPA 2J8ZA 1M7GA 3LVBA 1OZHA 1YZGA 3MUOA 4IZOA 4RU1A 5K0SA 1B76A 3L04A 3HP4A 1BEEA 4EBAG 4WA7A 1KO7A 1UFVA 3ZI4A 4IJKA 3JYOA 2YV3A 1UWLA 5DX8A 3DWLG 1T9AA 1ONPA 2J9RA 3BEEA 2JHGA 4QUHA 2HEIA 4P58A 1I7SB 1CZHA 1DCKA 5JSHA 1H94A 3ASYA 3DL7A 4O4LF 3MCWA 4EO9A 1M2WA 1QOZA 3EIXA 2Z9BA 2WPVA 5EHZA 2DQYA 4O0LA 5JLAA 2NU9B 2XDYA 1GYRA 1XZMA 3RO7A 1E4VA 4K6CA 2QUHA 1DIGA 3I64A 1PZMA 1EH5A 3CWCA 2PWPA 3ZJ4A 4B47A 3L1JA 4KR3A 1EZZA 2LNDA 4YECA 3VI4B 1DE0A 2YXBA 2WJYA 3VKWA 1UK9A 2WWYA 1YTLA 2P90A 4JSTA 4UXJA 1DGQA 4QD3A 2O2ZA 3KRTA 2EBHX 3L82B 3TLGB 4C05A 2W2VA 2MOWA 3TCKA 5JZMA 4JKYA 4NS4A 3PH0C 2UY1B 1W9HA 1O96A 2HSWA 2XOKA 1M1XB 1NULA 3EZFA 4XJSA 1A95A 4LG1A 5AK4A 1NUUA 3CB4A 3VOTA 3NMUF 3HWRA 4IOMA 3W5VA 2I8LA 3KQQA 1QYIA 2XECA 1E7QA 4QBFA 1VHQA 2ATIA 1XDSA 3BE4A 5TQ0B 3DVSX 2FPGB 4JD2G 3W5UA 4RHFA 5KU1A 5DBEX 1KJJA 4NU0A 1TKBA 2FW0A 1J2TA 5ECWA 4Z0NA 2SKCA 4A5SA 3MWJA 5ICFA 3BZUA 1Q1GA 1E7MA 2A9PA 1JB1A 2L69A 1OVGA 2CMHA 3D7SA 1Q7EA 3LC0A 1TRKA 1JAHA 1Q0RA 2QJRA 3QKIA 3REQA 3BD7A 3L40A 1ACLA 3CLUD 1M67A 2QXTA 4CF7A 1Q0HA 1T5BA 2ZETA 3Q5GA 2IPAB 3USES 1E60A 4TMXA 4LXQA 3HYRA 2ZSIA 4LJ9A 5LXTB 3Q47B 4KQ9A 5MDHA 1C7FA 3NC4A 4NENA 4ZWNA 4BWRA 1PNOA 1M1NA 3OE7D 3A3NA 3EY9A 4IUDS 1POXA 1KIFA 2W6NA 4RIEA 2VTKA 5KJ6A 1L8XA 5FBQB 3D3WB 2A30A 3NUQA 2AFIA 2F8XK 2JEZA 3LHIA 2IEBA 4ARVA 5MHTA 1F12A 2RMKA 1GN9A 1W46A 4TWIA 3KZOA 1ORDA 2K2WA 1XCOA 3G49A 5BOSB 2G40A 5KNDA 3RHTA 4V02A 3OJ0A 4MEBA 4JHLA 4P7KA 4CQLA 3N28A 5CFQA 3E4CA 3ZWAA 4M9CA 1QAMA 3C3OA 4W82A 1C7ZA 1WCV1 2YJ3A 4BGDA 4NV3A 2ZXWE 5ED0A 3E1GA 4O4LA 4DABA 1AMOA 3IGFA 1DEHA 3QEMB 2X4IA 2VZ9A 1IJKA 2VJQA 1MRNA 4Q4CA 1ACJA 2NUTA 4D9IA 1SUSA 4K9LA 3KEZA 1Q92A 5KNGA 2GZAA 3AK4A 3S3TA 4E88A 4DNQA 2G0NA 4U5XA 2GUGA 4F1WA 3DXKG 2P6UA 1BIFA 2IBMA 1KYVA 5DNEA 3HBNA 2E5FA 4F5ZA 1PWEA 5F12A 4DLXA 2ZB7A 4M98A 1ISSA 1WV0A 3G2JA 1KI2A 3NI2A 1UOEA 3C8ZA 1FJ2A 1S2NA 1B0PA 4G1EB 1HORA 3SZGA 4TRRA 1UWVA 3A27A 4DPMA 3TECE 3P9XA 1RLUA 1OIWA 4QGFA 3HGTA 2GNPA 2J30A 3D9QX 2OWDA 1MZPA 1JR4A 5KBAA 2IH5A 4C87A 5FNVA 1UN9A 4HCJA 3TCNA 4M1TA 3TTXA 5DX0A 4UNQA 5IJZA 4DR6B 3TEJA 4RTMA 5DO9A 4HQ6A 5B7NA 1EIZA 2IKQA 2DVMA 3ZW9A 4I2VA 1ABBA 2OCBA 1AMUA 3N2KB 4N6OA 3N6RA 2AD5A 4ZTUB 1JR6A 4JOQA 3SLKA 5LD2C 1EINA 3UMVA 4H2DA 3NHFA 4A15A 4P29A 2VL7A 1SEVA 4V1CA 4X24A 5CD9A 3GUCA 1OOEA 3E3OA 4AKGA 2DBQA 1K7YA 5EJ9A 3X3HA 3S2GA 5ADHA 1DO2A 1N4RA 4BGVA 1JW9B 5M2QA 1WKBA 2YZNA 2BGIA 4C7BA 2HF8A 4WNAA 3BORA 3SQOA 2VF2A 2ZP1A 5HI7A 3Q79A 1ML4A 4TVOA 3NWOA 2H1IA 5HUQA 2BSAA 1D0VA 3CLSD 4O6FA 3W6OA 1G8SA 3DP7A 4F85A 1W25A 2JGNA 2JH9A 1MNAA 4RZ3A 4G26A 3UT6A 1N4PA 2VTEA 4KPUA 3HB1A 1QGYA 1S7CA 8MHTA 1ELWA 4C7KA 2VPPA 3CZRA 3QVVA 4X90A 1T1EA 4TV9F 4L15A 3B3JA 4BMXA 4EHAA 3LM8A 4HNSA 2FDRA 1RLMA 2OQRA 1T8RA 1X2EA 1CW2B 3MCZA 2Z2ZA 4XH9B 1E2DA 2F6RA 2IHJA 2AJBA 2BMFA 5FR2A 3U80A 4HX9A 1NPTO 3MKRA 5FHQA 3SYRA 2CHEA 3MRSA 2CL7X 1PDWA 1N0RA 4G65A 5DISB 3IVAA 4C7OB 2V9CA 5CJ2A 2ROQA 1U2EA 3EPJA 1WUJS 1E62A 3UJHA 2HA7A 2L42A 3OEED 1ISFA 1N0IA 5J1SB 1N4DA 5FD8A 1E2IA 4W6ZA 4CTMA 2A0KA 3G1UA 3KKZA 2PKQP 4RQAA 2HCJB 4IJ6A 1ODCA 4RIHA 1VPLA 2B8NA 2YASA 4F11A 3A36A 3IHLA 2OMKA 4QJ5A 4NZ9A 1COZA 2JARA 3BL5A 4W7HA 1YA0A 2HMTA 4CIXA 5BOVA 3QY0A 3KSMA 3T9EA 4YEDA 3LT4A 4LXIA 2ZE8A 2O3UA 3TIXB 3N0RA 3U5ZB 4CIAA 2EKQA 1ZM4A 2HQOA 2PE5A 1WEKA 5EI5A 8ADHA 2NO1A 2B4KA 1R8QA 4UHCA 5B1AE 2ADFA 1JLLB 4I1OB 5EN5D 2B1QA 1Z47A 1JZQA 4A1SA 2YC2C 1DIBA 3WZ2A 3QHPA 4W1RA 3AHCA 1ZVJA 3NOXA 4URVR 3TINA 2VAWA 4FCCA 2OFWA 5HQ3B 2CD9A 2YWCA 3WGZA 4CMJA 2Y67A 1KY3A 1GO2A 5JRDS 3PP8A 5HRCA 3C72A 2MR5A 1QV9A 2XHZA 5A3SA 4IY1A 1U3CA 1OXSC 3HYSA 1Y3IA 5CYFA 5E3HA 4M1MA 4WKPA 1PTJA 4AS1A 4OXIA 4B3XA 4WK0B 1RT9A 2DFKB 3NT2A 4B71A 1AUXA 4DL9A 5DASA 3HB4X 2WTBA 1SUEA 4DPRA 3THXA 2J3HA 5JY6A 1FZTA 2CFZA 3ANLA 2WM3A 3G8CA 1T9DA 4XGKA 2O7SA 4GOXA 4K8RB 3GBVA 3P94A 1TZKA 2VRWA 3U9WA 3C5HA 3FKJA 4OLHA 1L8AA 4BCBA 1CETA 2Y05A 5EE9A 3JQQA 3BWBA 1S63A 1UBTS 2H8GA 1XA4A 3RVQA 1X2BA 5CLGA 1LTQA 3TUZC 5I48A 4TWAA 4RESA 3A1UA 4RLYA 4JLUA 4IUBS 3GPCA 5GY7A 3R1IA 3QPDA 3STUA 1YZ3A 3F96A 1UINA 1KFEB 4HRMB 4W9NA 1RM4A 3F49S 1HKHA 5E3IA 4X7MA 1XTPA 1SKUA 3EF1A 1T10A 2Z30A 3RNLA 4NH4A 1Q0TA 1R6AA 1E3MA 3KKEA 3FYHA 4GZCA 4DLVA 1W2WB 3T95A 1WTCA 4FFOA 1ECGA 1Y3CE 1GUYA 4FFMA 1EK5A 3KBOA 4YUZA 4RTNA 1ZHFA 5KJEA 2AFHE 5FZRA 4Q6WA 1EG2A 4IJ5A 5D84A 4GBGA 1XDDA 1T2CA 1QQ6A 4YH1A 2R8OA 1GNQA 4H7HA 5CIWA 5CT5A 1JALA 2GJ4A 4LMPA 4OX9Y 2XEVA 4RV5A 1PV2A 5ENOD 2CL0X 2Y9PB 5JOQA 2GCOB 5HS6A 4H3KB 4OLAA 1Q2XA 4JR1A 4NBKA 1L4HA 2CXHA 2JBHA 1KI6A 2IXGA 4OYRA 1P2VA 2OZVA 1NUHA 5JMPA 2ZIXB 1HFKA 5ARGA 4UOQA 1YA8A 3G23A 5KYXA 5JD6A 1XE3A 1PJ4A 2CZCA 3R6WA 3C1AA 5EESA 2OBXA 2IHUA 3DR5A 1G21E 3GVPA 3C85A 3K5WA 3GOHA 3SX2A 5CVUA 4BN0A 1KVRA 3D8RA 3ASZA 1DBSA 4DJDC 4W5HA 4BNTA 1U8TA 2ZAIA 1RTTA 1P39A 4YCSA 1U0SY 3B6JA 1IH8A 5LZ4A 2GK7A 5AARA 2M9MA 4HXGA 3E37A 5TR9A 4TTRA 2ZRDA 1YJCA 4YLEA 1G3UA 4MV7A 4QQ8A 4DIBA 1OFUX 5IWAB 1E7UA 4P0PB 3ANTA 3L6CA 4OI0A 1UOPA 4I1YA 3RTAA 2A5FA 1E3QA 3ABSB 2X6QA 2ZU6B 3Q9NC 2ANCA 4GIBA 3EMDA 4Q3BA 3OTIA 3T3NA 1QS0A 2AN1A 4LHEA 5E6UA 3G5MA 4V0LA 2VSYA 3IEKA 3PEYA 2VZLA 4KVZA 4D9GA 5LWHA 2GTHA 4FEYA 3V3KA 1QB8A 3NKVA 2IF2A 4QXRA 1DELA 4YDYA 4E30A 4ENRA 3GJXC 2GM5A 3NWBA 3MMNA 4MYSA 4M7WA 1NHGA 2G1AA 2Y66A 2WFMA 4HVCA 2CW5A 3DXFA 4F72A 4PS7A 3SEQA 1SGWA 4HH0A 3PNOA 1ZCFA 3ZJVA 4EHHA 2DLDA 1XPJA 4TVBA 4RTQA 3OUTA 2GLTA 2E18A 2WXJA 2WT8A 1M34B 5CT8A 3T8KA 2B78A 1IU9A 3KSBC 1CYEA 5JDIA 3QW4B 4GOJA 2Z2XA 1SELA 1XLWA 2CSUA 4H1HA 5B58C 2YVLA 5EP3A 4QBGB 3ZHXA 5ALFA 3V32A 1EXDA 1Y80A 2V7TA 2WD9A 4G8JA 1LW6E 3OOHA 2DHEA 4CKXA 1D03A 2Y6VA 2F3SA 4YJDA 2C7PA 3I1FA 1NP7A 4WNFA 1T4CA 1JPVA 1GPYA 2PKQO 4RDCA 6GPBA 4NHOA 3TQOA 5K4GA 3PQCA 2BEUA 2AH5A 5CA1A 1UBGA 2YHAA 3L8HA 2JJ8A 1GAEO 2V0PA 1FE8A 3COWA 4R6XA 5BR7A 3WA7A 4E21A 2DECA 2IP4A 4NRHB 3MT0A 3BIXA 3THWB 1AK9A 3LIPA 3F5FA 4XGNA 2B83A 1GG8A 3PFGA 5BY2A 2B25A 1VLQA 3DLBA 4N6NA 1YB6A 3L6UA 2FR1A 1DQSA 3SU8A 4AJEA 1REQB 3FU3A 4WN9B 2V9PA 4LXGA 1S9HA 1V1MA 2WD7A 1L5NA 3DF9A 5I7VA 2XVZA 3KOMA 4BNXA 2BGNA 3O31A 3UK0A 4MPJA 3ONDA 1GZ5A 5L3QB 3TQCA 4EELA 3L84A 5LCWC 4BMCA 2FI7A 2WWGA 1EE1A 4C76A 5F9HA 5ALRA 3NX4A 4RAOA 3I76A 2RH5A 1L5QA 3CLRC 4HC4A 3ZE2B 1HA3A 3WYNA 2VF5X 3BFVA 4DLNA 2OMEA 3TB6A 1Y9JA 3I9NA 2IEJA 1VKOA 2B0CA 3IP5A 2QK4A 3ZKJA 3AU4A 1U0RA 2ZXUA 3EODA 2YWRA 2JCBA 1H8HA 1BN7A 1FNBA 3K16A 2B7LA 2EP8A 3QFHA 4UMFA 3FVQA 4URZR 2A5LA 2Z5LA 1A7KA 1U1GA 1LF5A 1QFYA 3FUVA 1T8YA 4M7CA 5AI5A 1QE0A 1AB5A 4MVCA 3BRWD 2I7TA 2WTXA 4JJKA 3HCRA 3DHWC 2OK8A 1KFJB 3LC2O 1SB9A 5GJCA 4WWPA 3EC2A 1EFRD 1RBYA 1E99A 3I04A 2HM8A 5AUPB 3SZ7A 4AURA 4R2WA 3MOSA 1QK5A 4AT1A 1QUEA 1AKEA 2Y69E 4QUKA 1USIA 2P68A 4CT5A 2CEKA 1XGKA 3L5KA 3HO1A 3A4VA 3EDMA 3CURA 3R9XB 4EB6B 4CEHA 3BJEA 4ITUA 1MX9A 4LA4A 1EDZA 1Z2EA 3KL4A 4BGEA 2UKDA 1U4SA 3CQ9A 3EBOA 2J9GA 5AI0A 2IXEA 5AJTA 2HMVA 2M6KA 4B43A 5C8DA 3UB3A 5JO0A 2ZIAA 2QI9C 2FXIA 1ENZA 2I1WA 4PC6A 2EKPA 1BHJA 5IHXA 4MEJA 3DCIA 3VYRB 2F1IA 2XITA 3C5EA 1PJAA 4FHFA 1PX0A 3FM9A 4BFVA 3LRTA 3IQFA 4AKIA 3ZYMA 2IVFA 4JJAA 4UVGA 3X0DA 4JBXA 3ASGA 2W5UA 5L9AA 1GZVA 3AR2A 3I01M 2IY7A 1OXMA 1IRIA 1ZN7A 1RI4A 1P4RA 1KI3A 2O6HA 2Z9CA 3VH4A 5EIWA 3L9WA 5FAXA 1CY2A 3JPYA 2BDEA 4G0WA 4OXYA 4K9SA 3JCZA 4B35A 2WHXA 3DB2A 4BZZA 4X7BA 1TUBB 3DPIA 8LDHA 4P34A 2VN8A 4LN1A 4H7PA 5DZSA 5CH8A 4IDBA 1LV7A 3EDRA 4M86A 3R7FA 3TWXA 3OX2A 1P60A 4E94A 1CUIA 1ZWLA 4KQWA 2EYQA 2FK7A 2E0IA 3TAXA 2QBYB 2DQZA 2YOGA 1EHYA 3T06B 4FYPA 4UDNA 2I8CA 4ZOLF 3SFVA 4PG8A 5J3JA 5KOYA 3WYFA 4Q1CA 4OBBA 3RVBA 1MV8A 4ND1A 4QXPA 4YCNA 5A3QA 5IARA 2W43A 5DYWA 3OJLA 5AKEA 3NG1A 1F38A 5D2MC 3OAWA 3VV3A 4S24A 1PVVA 2OFOA 1LSUA 4GAAA 1HGXA 1M8FA 2C7RA 4O1OA 2AK2A 3BFJA 3OQJA 2WV7A 1LWOA 5HF9A 1S89A 5G4KA 1NY6A 3VC2A 4QFDA 3KIPA 1CRPA 2ZTLA 3DDSA 4EYGA 4L8WB 2IEYA 2GEUA 5LB4A 3KR2A 4L3VA 3WJAA 1KY2A 1FSSA 1EF1C 3K1AB 4P3OA 1S1MA 4WCDA 2XAAA 3R7LA 2PNFA 3V7NA 3RC7A 4ZVRA 4EUFA 4BTVA 4E7OA 2A58A 2G36A 1XNGA 4TLMB 3B5IA 5FQOA 4ZAVA 2ZVQX 3E0XA 5KTTA 3B3QA 1FX0B 1UBUS 2VCYA 3G2NA 2PYDA 1C3LA 3HDVA 1JE1A 1H3NA 4CU5A 4XQCA 3WL4A 4DBLE 3E7DA 3ZU4A 3NBZC 2FLKA 4RJLA 3KLPX 4HLLA 4CHTA 5JPDA 2JFWA 1OSNA 2QR5A 4FHJA 3G8DA 3F7MA 3RU2A 4MYDA 3HVIA 5EJ5A 4ZU1X 5IKMA 4L4YA 1KEEA 5L95A 1M5RA 4OB7A 1LLQA 4PAOA 3AVTA 1A4IA 2VK4A 4OK5A 3FTUA 3NBKA 2QRHA 5KREA 5I7FA 1V3QE 5EXPA 4HFRA 1YB7A 3PQ7A 5AKJA 3DVRX 1M5TA 2ST1A 1ISHA 1YF3A 3ELWA 3UAGA 4L8GA 2B8TA 4IPTA 5LU9A 3B1ZA 1K92A 4I43A 1TM3E 3C1OA 1QFSA 4UQYA 4H59A 5AQBA 3OE7A 4CG1A 3LT0A 3HVEA 1K2VN 1HNWB 1T9GS 5AVRA 1VHJA 4ZA2A 5HIMA 2D6FA 2WXQA 2DSNA 1YR3A 3WGQA 3FCCA 3A3KA 2QAGB 5I7UA 3E3LA 3IHTA 3ZLBA 3W8DA 1U8FO 4M1YA 1U1EA 4FZJA 4E70A 3D6FA 1PT6A 5L3SB 1FU7A 2YNMC 2CWWA 1QPZA 1NR7A 3CVWA 3OLWA 2OK7A 4H35A 2GK4A 3G6WA 3CLJA 2VYCA 4RCZA 4JIMA 3OD1A 4MVJP 1IJBA 4TYYA 4BP1A 3DV9A 3AF2A 2QPLA 2G8NA 3CC8A 1LI5A 1Z12A 1OH5A 2GWHA 3I34X 2QN2A 3NHBA 4BO5A 2C3YA 5GM2A 1PDVA 3K96A 4YQEA 4FJZA 3CLRD 2JH3A 2V96A 4ZOLA 2OBLA 4MLDA 1XCBA 2V5UA 2PUVA 4RK6A 2V1UA 3AYZB 4WK2B 5B7GA 2AZXA 1PX2A 4GC5A 3FCAA 3WLMA 1PZNA 1QP8A 4NBSA 2PWYA 3SR3A 3JAKB 4EG8A 2K7ZA 4J2HA 5CDUA 3TNLA 1SBHA 1VCHA 3TR6A 3UV6A 3D4BA 3Q0IA 2ZYHA 4Q3EA 2A3RA 4LRXA 2BN4A 5KI6A 3HA2A 3UBMA 3FUWA 1RHRA 4HG2A 3KV3O 2ANBA 3ZS8A 2XNKA 1M7BA 1QX4A 1SOVA 2IV7A 2GEDA 3V46A 2QTVA 4YP7A 4MI3A 3MYYA 3FTNA 1PNRA 2ZRJA 2RGDA 1IB0A 3A6JA 2Y68A 3LW8A 3EVGA 3TW8B 4E33A 1NM5C 1XZNA 2GJKA 1IAVA 4E15A 2J6BA 3H9UA 3W0LB 4KTTE 3NYRA 1AZSC 4TS9A 3TBFA 4YX9A 3FUTA 2PNNA 3BG1B 3T61A 1HZJA 1Y5NA 5BNTA 3QLVA 3W3AD 1OVMA 3WIUA 1NJ1A 1UXHA 2NN3C 2EEPA 4QO8A 1CZKA 4UDXX 3I8OA 2G1PA 3E3NA 2HSZA 1A4RA 4IQ4A 4RZIA 4CFYA 5DOVA 1BXGA 4DX6D 1AQIA 1KFBB 1CUGA 2CVPA 4MX8A 2GCNA 2W2NA 3VLDA 2CNKA 1XZQA 4JP3A 3FVWA 1HH8A 3A3YA 1DKQA 3EGIA 1XRPA 3TF5A 4C2AA 3OSUA 5JZOA 4RX1A 5DBOA 1KBQA 5JSKA 5H4GA 1UBCA 3SX0A 1Y4DE 1UFQA 3PDUA 1JKJB 1E8WA 1E77A 4RMGA 3HYNA 1OZ0A 5FL3A 4NV1A 2JGIA 4D02A 2G82A 1QP7A 4ALNA 3JY6A 3FTEA 1OV6A 3AFOA 3BREA 2CLMB 2GRUA 2HJRA 1OBHA 3O84A 3EXHC 1CZUA 1ZLXA 1ULSA 1UC9A 4UVIA 4TXMA 1LRJA 1D5CA 5HDBB 3QPUA 1NN3A 5DHUA 1SCUB 1MH1A 1YTUA 3HCDA 3U7QA 1GGVA 4IHAA 1QO7A 1N2ZA 3SXUA 2VDPB 3NS7A 4NTZA 4K9PA 1X70A 1EP3B 5J2UF 1SZDA 1EXVA 2R5SA 3AL0C 4JT8A 4G0YA 4LMRA 1VYVA 2XXJA 2BCGY 1K2WA 1QE3A 1JH8A 4P82A 1AQNA 4C06A 1YONA 1JQ3A 4M0UA 1GLGA 2IYYA 1J5PA 1ZJ5A 4M9UA 2OCPA 3SHWA 3OEEA 1CR0A 4U0ZA 1H23A 1JDTA 1TCVA 3DDWA 4QPDA 4L5YA 4UE2A 1Y5RA 1LD3A 2EZ8A 4Q9NA 1GFSA 1ZIDA 1Y4AE 1L4BA 1MW9X 3CNOA 4R7LA 2VK8A 3T5GA 2VJMB 1T9BA 1ORHA 3BRQA 2IPLA 8GPBA 2PMEA 1ECCA 4AKEA 1F2UA 2WMNB 1ZS9A 1XKTA 4OHZA 3L7OA 1DTWB 4X1KA 1QGUA 1TDJA 4L6IA 3RGGA 3IOYA 3RIEA 2C3PA 1KRWA 2DCUA 1L4UA 4A8HA 4R7ZA 2I6SA 5KWSA 1IHPA 1HH4A 1S8AA 3CVPA 4A6EA 2JD1A 1TNZA 4C0EA 1FUEA 4DAEA 3LRXA 1QHSA 4GO1A 1JLSA 1SU4A 3L0SA 4HK4A 4N41A 2C2HA 1U2GC 1E8DA 4U6SA 4JU8A 2QRZA 2NZ2A 3HCFA 2YRXA 1M6VA 4FMDF 2OHOA 3R6TA 4MJLA 4CKZA 3GLHE 3JQ6A 2EBFX 3NR2A 3QFRA 4P80A 1BRMA 4MI9A 5KUTA 2BLNA 2FZKA 1DBQA 2WSSD 3F98A 2XEHA 4Q34A 4ATZD 1G2OA 2IPMA 2JBAA 3TZ6A 4EDFA 5I8WA 3NUGA 2H4YA 2Z6UA 2GN6A 4J7WA 3B9PA 2AQ8A 5CECB 4RVUA 2H0QA 5AW3A 4J0IA 4S1NA 4G8KA 2ZUWA 1THGA 5IDYA 2Q3DA 3A11A 1AQJA 3A32A 4TM8A 1T5LA 1UPTA 3B6IA 3LBHA 5SYNA 5K0GA 3RRZA 3GZNA 2NWQA 2XB9A 5EP4A 3TW0A 4IGEA 1XRSB 3ZNOA 3PXCX 5CT6A 3WB2A 2ZLBA 1V11A 2VTBB 4D1YA 1KMNA 1OTHA 3MOIA 1XI2A 1XZBA 3CB2A 4S1WA 2IJGX 1NIJA 3TG8A 1Z16A 4N12A 4URYR 3OPVA 4GTMA 5CFZA 4URHA 1RPJA 3DA8A 2V7GA 5I01A 3ZVNA 1IY0A 4LF6B 2ISCA 3V48A 1GGNA 1VA4A 2DMRA 2W2KB 2VC2B 1UOQA 4BBZA 3SYKA 3VAZA 4U3JA 1R0CA 2NQTA 5KJMA 2DR3A 5CBKA 4OQYA 4ZCLA 1OXVA 3I6IA 1CIJA 4K9QA 1E2JA 5TQ2A 2WIDA 4Y6SA 2GSDA 2YRFA 1YRQA 1PT9A 4MULA 4BVEA 1GFZA 4K88A 4EZJA 1NYQA 4QPPA 5F33A 5JQGF 4D4KA 3LFTA 5HS0A 3JR3A 4QVIA 4YVOA 3WDLA 4LWZA 4REQB 2HRCA 4Y8VA 1QLHA 3ZLVA 1L9KA 1VHWA 1L0BA 1WZEA 3EPLA 2GERA 2COKA 1C3XA 1L8QA 2PTGA 1NFFA 2J5RA 2C5AA 3O8LA 1BHO1 3V1TC 3B1YA 1DC7A 3EFEA 1I6LA 4JXKA 1CR4A 3GFBA 2L0IA 4L57A 2SECE 4N8EA 2AKEA 2AUNA 2GZDA 4HADA 4PO3X 3WGGA 5IJXA 1T3TA 1DPGA 1HZZC 4AG5A 4PLPA 1T3HA 5SZHB 4GA1A 1N9ZA 3B52X 4P4LA 5E75A 4AXBA 3RFFA 3N70A 3D2LA 5GJBA 4RFSA 1L3CA 1E3TA 1U0TA 3A9WA 4HXEB 4M99A 1N3LA 1EFPA 1VRWA 2XUZA 3DBIA 3WQRA 3EVTA 4U7GA 1VCIA 1FIUA 3CHRA 4ECEA 3HB5X 3APCA 4JOSA 1VMIA 3QUSA 1ZKMA 1R2QA 4DARA 3KZVA 1WSBA 4EY4A 4WEQA 1EHIA 4WNGA 3HP1A 5ADWA 4JOCA 2PGXA 4ZQHA 4DA6A 1FNMA 1LC3A 3UA4A 5I7OA 5B4TA 2OUIA 4O1IA 4XEIG 4UMDA 1A82A 3LUFA 4K7JA 3AINA 3CBQA 2QQFA 3TJPA 1Z37A 4I5EA 2Z57A 4ZI7B 1LUAA 1IXVA 3AG6A 3T5BA 3UJ8A 1KYXA 2FO7A 5EYPB 5K2MA 3ZZ1A 5CVJA 3T7IA 3WRYA 4GZLA 4PC3A 1QZUA 4OATA 3GEGA 2O8CB 3Q3IA 4BFZA 1DTEA 2EL9A 1GNRA 5A4JA 3HJHA 1YIOA 4DMUB 4ZDJA 1DPFA 1DFGA 1U2DC 1A17A 3LY5A 2EW2A 4HPXB 4MRRA 4FQ8A 4KT6B 3E2IA 2HX1A 3PB3A 2WAAA 1MHQA 5F2EA 2HGSA 4JQCA 2R48A 3JQ9A 2JLAA 2X6KA 4PYLA 4EHNA 3WMFA 5DHQA 1N54A 1K6JA 3V9AA 3B6ZA 4UU0A 3ZH2A 1C4XA 3ESBA 3KKPA 4YRSA 3U9SA 4GXQA 2BJWA 4LEIA 4CL0A 1CK4A 2AFHB 1UWCA 1UMDB 2CEAA 5E6RB 3R3SA 1YOVB 5F5XA 2F1KA 4X9XA 1EA7A 1Q7TA 3HEBA 3PHHA 3K1ZA 3FHTA 2AXPA 1ZM2A 5EUBA 4AJOA 3IKOB 4OV6B 3MHPA 1NVXQ 5JQGA 5BWMA 1D8TA 4DC1A 1RYDA 3RREA 2FUEA 5CR9A 2X6RA 4JMLA 2UYOA 3I37X 5AJLA 3V8PA 3K5PA 1P2BA 2ET6A 3EGXA 1MVNA 4X63A 4QRDA 2ACWA 1CX9B 3W5SA 1A1SA 2VOEA 3PEVB 1H2YA 5ADUS 2JVKA 4XQEA 2GB4A 2XDQB 3UAWA 1GUBA 1GWNA 4ZQEA 2H92A 4N5HX 1D4FA 1G21B 1I5OA 1OFHA 2P9GA 4AJNA 5FUXA 3KTOA 4Q1AA 4A91A 2BKUA 4J07A 1WP4A 4GR4A 4Y98A 5CNIA 4MS1A 1RXWA 3EGWA 3KSAC 3M0EA 3DAOA 4FHGA 1R5BA 2C92A 1UN8A 1E2KA 3BGOS 4EFDA 1E1MA 2H1FA 4L16A 3H4VA 5DI3B 2FWJA 3BWDD 4EVQA 4ZHQA 3ASDA 1WHTA 1YXMA 1JA9A 4UEKA 3LWNA 4QBTA 5BN5A 1SZCA 3FETA 2W0MA 4PSKA 2J0SA 2RGYA 2XGGA 4IS2A 1JKMA 3P0IA 1PR6A 1OLXA 4LXUA 1T1GA 2XB4A 4ZHSA 4D9JA 1ZOLA 3R3VA 2PIAA 2NO6A 3VOAA 3G1TA 4P4NA 4EJSB 2N1MA 5EJAA 5T3YA 1AGNA 3ZHTA 4ACLA 4C6TB 5HM6A 2NXJA 3JD0A 3BTVA 1H4TA 4E12A 5GVSA 5CJPA 4TQ9A 3W2IA 5HE8A 5JSZA 5MFZA 2ZGVA 4MITA 1Y9EA 3HCOA 1KK0A 3M5CA 2I1LA 2IUUA 2DT5A 3P26A 2ZR8A 4RWZA 1A50B 5HMLA 1EVZA 3LP5A 3V8RA 1V45E 1VCOA 1LQ2A 5C52B 4MMYB 3QWFA 2ZBGA 2YJ4A 5FNVF 4V3BA 1K7SN 3GVCA 3IA2A 5BQFA 4B3RB 3MJ4A 2J85A 3IAUA 4XQ9A 5CERB 3JQPA 1VJGA 2LD4A 4QQIA 1AWCB 3HKEA 4KCGA 4LJYA 4P4SB 2GDJA 3DRAA 3L9TA 3EW9A 4JI0B 4KXXA 3OE5A 3BRWA 3RYFA 2O8NA 1XAJA 2C58A 4OFZA 4UEJA 3RPEA 2FI1A 4L07A 3QPBA 1EFRA 2BR4A 4M89A 3WSVA 4JNKA 1BKDR 5ES3A 5BW6B 1XTBA 1HDCA 3JALB 1XRRA 1V54E 3PL1A 1R6XA 1X8LA 1J8FA 4A4DA 5KTYA 2BFMA 3VBEA 1XHFA 5B30A 1YB5A 4X8OA 5G0WA 3P9QA 1MOZA 2Z5GA 1M72A 4BVGA 1HWYA 1CUXA 2Y4OA 1R9GA 4BNVA 3QBEA 2W71A 4KLNA 1KLXA 3IMFA 1W36B 1CB7A 1HEYA 2G80A 3WK9A 3TXMA 2V03A 1GRNA 2BKAA 3ZY2A 3T3GA 2O0HA 1AA6A 4XWOA 3KALA 3DMFA 2XZOA 5K09A 1DAFA 1KRXA 1M0TA 4IBOA 4KSCA 2YX1A 3LPZA 2OHXA 3B20A 3UJ9A 4OHMA 3AILA 2BCEA 3PCXA 1L3IA 1MPXA 3GV0A 1G60A 2B4RO 2CKDA 5EJ7A 3OKCA 2C2LA 4K5QA 3KOWA 1OPXA 3SE0A 4QWWA 2QN3A 2ZWIA 3TVDA 4ZYUA 2GKSA 3WKDA 3T5VA 1VE3A 1NXTA 5KKNB 2VGEA 1YSCA 1XMOB 1NGSA 1HF8A 1MDBA 3OP4A 3ZS9A 2H06A 1UP4A 3NJRA 1NU8A 5ITVA 1KZGB 3WQHA 4D4LA 2OTCA 2PH7A 4OB6A 4YN3A 5LOZA 2C5GA 2FCAA 4YVQC 2C96A 1ABEA 3TTWA 4UNRA 3ECSA 4Q1FA 4FEAA 3ZW8A 2LXLA 5B2EA 2W0SA 2WXIA 1KSGA 4JI7B 4CDMA 5FTWA 1VGQA 5EQJB 1YE8A 2WU4A 2O06A 4FFPA 1J1ZA 2TMGA 3G9XA 2HCTA 3QNWA 4N40A 1XNQB 3K0BA 1FPPA 2NXWA 5EMJA 3TG5A 2IF4A 1ZGZA 2P9ZA 1JLRA 4FYKA 2FP4A 3V2GA 1DWUA 3N8GA 2ZTVA 5CAEA 3Q7EA 1CUUA 1GKYA 1L7AA 1QMGA 2JFQA 2DXIA 1QUFA 4N9QA 3KFLA 3AM1A 4I6EA 2V5QC 3NIWA 1HRKA 3AVXA 1FYDA 2PU5A 3O8OB 1QFZA 1CQJB 2PUGA 1QK4A 2L0XA 3E34A 4G09A 3KLNA 4CTKA 3V4VB 4HYTA 1X8JA 3ZH9B 2BEKA 4RQTA 2DLNA 2VSNA 3BMOA 1QQTA 4LGYA 4R6WA 5ICGA 4FGZA 3MUNA 2OV6A 1VG1A 2PNJA 3FKQA 5KJ1A 1VBFA 2PO5A 4HH4A 4OBEA 1TR4A 4K9KA 2OQIA 1G4AE 4BQNA 5H70A 1WBDA 4I36A 2J4BA 1R10A 2OGWA 2ZJFA 4PZEA 1N1EA 1X7HA 4CWAA 1NP3A 2H2GA 3ZK9A 2JI4A 2BUBA 4XASA 4Q39A 1SOUA 2R11A 3TIGA 3RGWS 5KC9A 2W11A 4I4IA 1DV1A 3FSEA 3N2GB 3LUCA 2Q3LA 3QVJA 5F1OA 3KBBA 1TVKA 4HV4A 2J0UB 3OHPA 3IBYA 4Q02A 5DHPA 3WL6A 5JCPA 4KFRA 4Z9FA 1YB1A 4X20A 2P5TB 4EHFA 2QRGA 3PDWA 5E9WA 4B2IA 3HU3A 1DO0A 4G36A 1D8DA 2IVZA 4H7KA 2ETBA 2KHZA 1I14A 2ZJ0A 4KOEC 1KP9A 4ALMA 3ORHA 3G13A 2JKYA 3HSKA 5LMZA 3LT1A 4MWBA 1ZD3A 2EG5A 3HN2A 3D64A 3L6RA 5CX1A 4U00A 2YCBA 1Z9BA 2HMWA 1BZYA 1RJ9A 4I1PA 4M3OA 1UKYA 1Z2AA 4YJ3B 4O4HB 1H6AA 3Q5MA 2Q27A 3OY2A 2BLLA 4WNDA 1FFDA 1N5RA 4EG7A 3CLVA 3FCOA 5JTTA 1GN8A 2I91A 4R5HA 1LLFA 3S2FA 1XKLA 3VU1A 3PQ3A 3T41A 4LF4B 4LDRA 3G2PA 2O2JA 5JG7A 4EZEA 3OTNA 1E61A 3WTBA 2AFIE 2NQ8A 4MIKA 4HDMA 3AU9A 4AKSA 3AJAA 4HLEA 2OPHA 2CLKB 3ZHEB 4IWXA 4YASA 2P8JA 2HFKA 3ASHA 4LBVA 3ZK7A 1BWSA 1TE2A 3RC2A 1E3DA 3HLTA 3AAAC 4NESA 2FZWA 5ES4B 3ZZNA 2AOVA 1VLVA 5C7YA 3IA7A 4ND4A 3DPSA 5E9QA 2FZ5A 1WXXA 4MI6A 3VYWA 1EK2A 3SYNA 3B60A 2DZDA 2II6A 1KK2A 5A03A 1FFGA 3H3JA 1SR8A 1XHEA 4KN9S 4CKWB 4XVQA 2AT1A 5FA8A 5G3ZA 5C4MA 1AS0A 1B6RA 4NHEA 4JUDX 1I4EB 3HNPA 2AI3A 3B13B 3L77A 4HH1A 1YKSA 3H0EA 2BIFA 3IQGX 1MDFA 4XIGS 5L7WA 4CLXA 1NG9A 2J31A 4JN6B 3O9VA 5JU6A 4UTPA 4KP7A 4OQXA 3V1KA 3L1UA 1UW4B 2PX0A 2Q5FA 3BQ9A 3QKWA 4GT1A 4YT2A 4H7JA 3ZJUA 3IDSA 3PTZA 3UMCA 3W3AA 4AMYA 2R8ZA 3M6IA 5DCUA 5FOQA 4I5IA 4PTZA 3JQFC 5EC8A 3DLIA 3H5VA 2RHGB 4UZFA 4CRWB 3COJA 1ZD1A 1HDOA 1A8UA 1EX9A 2A35A 2O2HA 4HSEA 1KQ3A 4BB5A 3KQNA 3GPIA 3RUAA 2GEJA 2ZRMA 3SICE 3RYIB 3PYMA 1L1FA 1PS9A 4ZJYA 3O4JA 5I4IA 1L5FA 4JR2A 4KWIA 4NZYA 3MIIA 1GSOA 4Z7QB 4LHSA 2EHDA 3JZIA 2PS1A 3GBSA 3AJIA 4E7PA 2XT9A 2CXNA 3E7XA 1KTVA 2ERCA 4ZRMA 3IEPA 1N0UA 1L7XA 3FYUC 4C9BB 4RVHA 3O82A 1LQUA 2EFDB 2O2YA 2ZBVA 3DLPX 3ZIUA 5A62A 4M1ZA 1E4YA 1XZDA 2PGAA 4JWKA 1ODJA 2ZUCA 4YT4A 4JDPA 2ZAOA 3OKPA 1V1RA 2AJ8A 4JK3A 2C83A 1Z15A 2FMTA 4MV1A 3BMXA 4OAPA 4OHUA 5LM3A 3S8EA 1E58A 4U8HA 5NLLA 4RULA 3QM1A 1IE3A 1Z6GA 2C57A 3EQZA 2FE1A 2PUWA 2D2IA 3ZWWA 3NONA 4C20A 2I5PO 4RF4A 2CC2A 3IHKA 1CUVA 2HPAA 2VBCA 4A2WA 3I52A 1MEEA 2X5JO 4U9UA 4DIMA 2B69A 4U1RA 2RD2A 2YWXA 3FUIA 3E7WA 2O07A 1E9AA 1RLTA 5IMSA 1P44A 3LUKA 3CA8A 4MS6A 1MG5A 5JWHA 2PDAA 2CXXA 2XRFA 1T6YA 3JATB 1WCIA 2EFJA 2VT3A 2X2PA 5C3MA 5EKSA 1U7PA 2D1RA 2VDWA 1I3LA 5CA1F 3RS3A 3WIDA 3UAVA 1VIMA 3JQAB 4XIFA 5KNBH 3ZCRA 2P9IG 1SG6A 3VISA 2VP3A 4JSYA 3A1VA 2J3JA 1UK6A 1H6CA 1JYFA 2QUJA 1TU4A 2Q3JA 3FUMA 4ECAA 4O59O 5C1PA 2A57A 2HF7A 4Z2AA 1M6NA 4LHZA 1MXFA 3REOA 4RZUA 1QTNA 2PSSA 2IELA 2B4AA 4LX0A 2EQ5A 3ON5A 1W4ZA 4CHGA 1N4AA 3U7RA 3G0DA 4DJFC 1AMNA 2EARA 2RAFA 3CZCA 4ANWA 1U8ZA 4Z0HO 3IDOA 3TDKA 1LD7A 3D4LA 1M6EX 2DTXA 4EY8A 4UUQA 1OTYA 3W2FA 1XIVA 2QV0A 4IFIA 4AIIA 1QIMA 4L74A 1K7XB 1Y1KE 1GPJA 1SBQA 4TRJA 4FSHA 1C3EA 4NECA 1DADA 3AG4E 4BFXA 2VLBA 4X64B 1ADBA 5E9AA 4KO2S 5KOJA 3ILHA 1G38A 2WSSA 4RK0A 5ELMA 4DUYB 5GAJA 2TMYA 4QHYA 3AIKA 2YNQA 1WDKA 5CB6A 3DULA 3S5UA 1NQXA 4XUGB 2R25B 2VJLA 4NONA 4PEVA 4QYIA 3DMHA 2WYOA 1L4YA 3TSYA 1F17A 4IDDA 1IB6A 3BMNB 3ZWQA 1DRUA 1Z08A 1L7OA 3NTLA 2WHRA 3D3NA 3Q41A 3SS8A 1WVGA 2DAPA 1BNCA 1BMFD 3INRA 3ZJYA 2C2WA 1TYCA 3W77A 1OX5A 4D0LB 1FTYA 5HIKA 1XTZA 4Q00A 1S4QA 2OT3B 1P9LA 4RAQA 5K20A 3R3XA 1QC5A 3BMQA 3RT1A 3ZUVB 2IIPA 4JGBA 3U56A 4RA9A 1T6BY 1MBZA 4D5EA 5BV8A 3FJ1A 5KTMA 4HX5A 3ZXYA 1FFHA 2GBPA 4BBJA 2ZI3A 2I0FA 5C35A 1A2KC 5C53B 1Y1PA 1YQGA 4H4DA 4DQDA 5EIBE 1YHYA 1ADCA 1V47A 5DRTA 4KO4S 2B6CA 4K9MA 1EB8A 1JDSA 4LJ5A 2B61A 3B7WA 4J49A 3IRUA 5B58T 4LVNA 4U96D 4UULA 5D87A 3OOSA 3TZHA 3SEFA 3VBCA 2LIVA 1FDOA 2FN7A 2M6RA 4V0SA 4RLFA 2C20A 1QVRA 3DZ8A 1IHXA 5LMNB 3BWXA 3SZOA 5LQAA 5DN6D 3FUFA 1XYVA 1BWRA 1OLUB 1UK7A 2BW0A 1BCSB 1JDBB 1YZQA 4RO0A 3PVCA 3E5RA 5AQ9A 1DTSA 2H85A 2ZB3A 4GW3A 4JLPA 2XOEA 3QF4B 4I14A 1B42A 4WUYA 4D8TA 5B7PA 1OZFA 5DT9A 3SLGA 5JALA 2Q46A 4FEEA 2ODNA 3ZCQA 4Q7KA 4CIBA 3WS7A 5FBKA 3B51X 4KYIB 3GLHB 4KACA 4DE5A 1ESNA 2ZUBA 3BX1A 4Z6KA 1DFIA 1PJLA 2HPVA 3H6HA 3ZHSA 3FOAA 3BHNA 2MMCA 4P84A 3TWUA 3NORA 1KDZA 1HXHA 1TXGA 4TXPA 3M49A 1DRWA 3VOBA 4DOMA 1GUDA 3STXA 1C9KA 1L1RA 2OG1A 3QUBA 4DB2A 1NTOA 4QUIA 3ETGA 2V7WA 2LPMA 4WXYB 4EY3A 4YWHA 5JFOA 4IXMA 2VP0A 2DPGA 1AZTA 1WX1A 2CF6A 4IO0A 3Q2OA 2C2OA 5HGXA 4JY7A 4B3TB 1IEWA 5SYAA 1I2MA 4R9SA 1XZKA 3OM0A 3AEQA 5FWXB 3PHGA 1LJLA 1N92A 3HMKA 2ZE6A 5DYNA 1SW6A 3C41J 3DVAB 3FZEA 5D51S 3OF2A 4H6VA 4FC7A 1TNBA 3IILA 3QH4A 3KJNA 3QC1A 4UM7A 1X7YB 2MINA 3DMPA 1R64A 5A6SB 4Y9DA 1BCRA 1GRQA 3ZE0B 3GJRA 3HABA 2BFDA 3Q6MA 4F6LA 1FDTA 2B3TA 1AXEA 4HY3A 2ID9A 1YDEA 2P41A 1CQZA 2YMMA 4OYSA 2XGJA 3OG9A 1TECE 4DZZA 3DTVD 3H1PA 5DM60 3EXHA 2WZDA 2J0EA 2AOUB 2OD2A 1HQKA 3H8VA 3FVRA 2IP1A 1QBKC 3CRQA 2AR7A 4DMLA 2PL3A 4UFOA 3OPNA 4MQ5A 3JXIA 4JLKA 3C6BA 3K35A 3N7TA 2ORIA 3FTXA 1D7OA 1A9XB 1TADA 4QOEA 2D7CA 3TRHA 2CMDA 4DRXE 4E31A 4OM8A 1V2HE 4MRMB 1GL9B 5FDFA 2ZT5A 4DR3B 1ZK1A 2R59A 3FDZB 1VDZA 2OO7A 1N4QA 3C6ZA 3AVOA 4LGCA 2JLQA 1R0SA 4HAZA 4QJ4A 1YFJA 2NUAB 1B74A 1R0KA 4RD3A 2PJZA 2NADA 3WL3A 4RVCA 2IZZA 2Z04A 3OJCA 3QYJA 4U7WA 1QKIA 1Z88A 4KJZA 4L9AA 4X5OA 3HH8A 1SIBE 3KL2A 4LJKA 4UWFA 3HZHA 2EEZA 3TXYA 1E7WA 4F4CA 5AVYA 1Q74A 3OM9A 2L6JA 4N48A 3EEOA 2V5FA 3BC1A 2KSQA 1LTXA 2FEMA 4MAAA 2Q3EA 1Z3CA 5IJAA 1DG1G 3GGGA 1WMEA 1OCOE 3K2QA 5F76A 3JZMA 3WG9A 1YQXA 3IQXA 3ITKA 1YKGA 2V7QD 4QQRA 2C4WA 4TKLA 2GR9A 1F9AA 1UDBA 3ESLA 4H15A 3RRNA 1V5IA 4BASA 4NNOA 1A7JA 1V6SA 1GL7A 1DXYA 3MXTA 2Z4TA 4AY6A 5B5SA 2FRDA 2UXDB 3EZYA 1DZIA 4RL4A 1E1NA 3A1WA 4GZ6A 3AG1E 1VL5A 5CYPA 2IQCA 5DNAA 5AIJA 2C29D 4L8VA 3UMJA 4Q3CA 5EQDA 4Y6PA 1P5JA 2JIPA 5FT9A 1UDAA 2BZ1A 5CNMA 4GAEA 1NVVR 1LGYA 2ZR0A 1C0IA 2CHGA 1MC8A 3DEAA 1VLJA 1EFVA 3GARA 2BFAA 2QMZA 3DFMA 3QSGA 3TW4A 4X60A 1IOWA 4FXPA 1QGAA 2JKZA 1K9VF 2HRZA 2I22A 3NYIA 3R3UA 3LOUA 1QNFA 1LRKA 2ZRIA 1BYIA 1JHUA 5BNZA 3F74A 5J08A 1EXMA 1XZIA 4XKCA 2O8BA 1ZSYA 1ULZA 1P2TA 3T12A 1KEPA 1QANA 2J0QA 3DD1A 2NAPA 1H2WA 2CHFA 2FR0A 2MYTA 4HD8A 4DQ0A 1AHNA 2PCLA 1H22A 2V97A 2EZTA 2P4QA 3IJEB 1D2GA 3L4EA 3SNKA 5ICCA 5ERGB 1AZWA 4DYHA 1G7SA 3ENEA 1QGOA 3X2QE 3P4XA 1NT4A 5LN1A 1LZKA 1Y8RA 4FI3F 4JX9A 4FBLA 3OE1A 2BHSA 2WQZA 4QDJA 3H11B 3VM6A 3U66A 5DTRA 4LJRA 1QFJA 1QH9A 3I12A 1KF0A 4L72A 1GVNB 5C3UA 3RU0A 1FCHA 2JA2A 4B75A 2ZZNA 2HDNB 1M83A 3L46A 5BN4A 1UBKS 1D6MA 4WESB 2PUCA 2A9JA 4FJ0A 4HBGA 4WADA 2I1JA 2XRZA 1JRLA 4ZDKA 5E7IA 2HL6A 2FDCA 2J3QA 2O3SA 3HCCA 3I9KA 5THXA 2FGJA 4Z3OA 1UJ4A 3GF4A 3IJRA 1EQ2A 1USVA 1DIAA 1OT3A 1XDUA 1C30B 1NXPA 3O91A 4M7RA 2JAPA 3AUKA 1XA0A 2AMFA 2Q8PA 1LBSA 1VSVA 5HZMA 3OZGA 5FEUA 3MRVA 1SCAA 1BOOA 4YP0A 4I08A 3WWCA 5DNDA 3ZZUA 1PV1A 4DTIA 2CHWA 1HEUA 4HNQA 1PAUA 1MN6A 1UQRA 4R84A 3UW3A 4FFSA 2HB6A 2HWYA 1ZQ1A 2EQXA 4AY5A 4HGYA 3AESA 2BM1A 2DR2A 4DBVO 3KXKA 4ZODA 2FHPA 1GPNA 2QNRA 4J2OA 2HMSA 3DZGA 3HI6A 4NXMB 5F1KA 1WPXA 1K6IA 4XM2A 3LLSA 4MVJI 2NU6B 1W88B 1FW8A 1NVBA 3Q3EA 5ALYA 2WXRA 1N5KA 3WYDA 2JGAA 1UAAA 3U7HB 3W1EA 3RBAA 3ASNE 1K86A 4F06A 1X0VA 1OI7A 3UGQA 3QOFA 1GGEA 4EFLA 4YCDA 3N58A 4C4AA 2ZJOA 2ZUVA 2RG1A 2QJOA 4KXNA 4R51A 4E14A 1N0HA 4WUVA 1JQBA 3K6SB 1Y3HA 1J21A 1U94A 1UBHS 1QRRA 5CA0F 3WV4A 1A97A 5AVZA 1F6DA 3F7OA 3HUTA 2OYSA 4OI1A 2WBLC 3NKLA 1FF9A 1RKVA 3FCSB 3UBTA 2VIIA 3CJTA 4WBNB 5LZ7A 5TT1A 5KNHD 3C45A 3GWGA 2J8SD 1L4KA 1YH3A 2OGSA 4BERA 5K99A 3ZHUA 2IYAA 2OHGA 1W59A 2FWAA 1MHTA 3ZIMA 4R31A 2F4NA 1EEXB 1V39A 4B4VA 2AXUA 3E27A 3L06A 1MQAA 4G0NA 2WMOB 3M5DA 1G8HA 3GFRA 1LPSA 3AHGA 1OWPA 1QH1B 2NG1A 2OHVA 4PWYA 4KNWA 2I6QA 1EEHA 5A0TA 3PKIA 1SD2A 3HU5A 1R4ZA 4YB8A 4NYMQ 5LNK6 3HVRA 1IIRA 3KLMX 4M21A 1V16A 1IBLB 3OQBA 1B8UA 1G5QA 1KO5A 2XYVA 1XALA 1K6MA 4IRXA 2QW1A 4BC1A 4PAGA 2WSYB 5KAPA 2I66A 2C3UA 4MQFA 1DBPA 4F8JA 4KPEC 2CT8A 4QDUA 1WLSA 3K70B 3H65A 4LRWA 5LIRA 1BVHA 1MLDA 3P4UA 4U0SA 1CBUA 3UUXA 1RAEA 3JVIA 4PLFA 4KV7A 3ZKAA 1CUZA 2NC9A 1XJCA 4O1MA 4D5GA 4FN5A 4YRKA 1QHIA 6NULA 1F8UA 1NBHA 1GXSA 2KPOA 1L4EA 2CV2A 3RARA 1GV0A 4D57A 1U28C 3SXJA 3E03A 5K8TA 4QPNA 2IV3A 2FN4A 4E4TA 2CHVA 2B30A 3HHPA 4E85A 2X41A 4P5PA 2IFUA 5GZ1A 1DX9A 5FULA 4OUDB 5CB4A 2A0FA 5BURA 2RDMA 3H9BA 5ECGC 3GZJA 4NQZA 3U7JA 3BWCA 2F43A 3HDGA 4OG2A 4DADA 4YALA 2IQ5A 3EXG2 4PX2A 5MN6A 4N7RA 3X1WA 1RYZA 3SHTA 4NK4A 5LCXA 3TL5A 3VDQA 4DMMA 2NSHA 2E1RA 2BE9A 3QELB 2D7JA 3IXLA 2WAYA 5CT9A 3E22A 3CH4B 1E92A 5CA0A 2VRBA 4BVBA 1R6UA 2REQA 1IJFA 4IUYA 1QAQA 1O6FA 3WMXA 4C48B 4EJFA 4QVGA 3FEYA 4Q9JA 3CUYA 4F7DA 5BWLA 2HLHA 2R4UA 2J6CA 5KYYA 5DSTA 1PJ3A 3LCJA 4HHEA 4JI2B 3TG4A 3DR3A 3PGKA 5H3LA 4YMUA 2NAFA 3LX8A 3K9HA 1ULAA 3SC4A 4MP8A 1TJFA 3LBIA 5P8WA 4HTFA 4R8KA 3F6BX 1SWWA 4N5DA 2I4NA 2WAOA 4QO7A 4WZAA 3VVMA 2A78A 4IIEA 2CHXA 1H85A 4MVYA 4DIEA 1EGMB 4R41A 4W1QA 5HA5A 1NW3A 1NBEA 2OO3A 4LWOA 5EHXA 1THMA 5FFNA 1V9CA 3UQYS 3VVLA 1GKKA 1O96B 3DZDA 2FSSA 3ONWA 3OQOA 1BTOA 1SB8A 3MS7A 1PKXA 5IUKC 2LO6A 4N39A 3K71B 3AR8A 3DDHA 1FYEA 1U04A 5A7DB 2R6DA 2C1ZA 2VNKA 5DF1A 5K2OA 1Z75A 1S1CA 1JTEA 4CXMA 4UEOA 3BJIC 1M3SA 1HU3A 1O0CA 2C7QA 4GX0A 1SD1A 2V6IA 3LX4A 3QWWA 3GHYA 3U3WA 1RJWA 3CE6A 4F60A 4YI5A 4HUQA 2BBWA 1WCYA 2GPTA 3TB4A 2Y1EA 3S2UA 3DV2A 2BM9A 4DT1A 3M8KA 3GIWA 4LMBA 5FLYA 5HRUA 4RHEA 1QR6A 5DLYA 5KKAA 3TL2A 2ETXA 2YNMD 2C03A 1A5AB 3JXEA 3REQB 2RI1A 2A9FA 4NLLA 3UM2A 2P1RA 3E1KA 2IHTA 3AHDA 1PTKA 4HBZA 5LJIA 3ETNA 3CX3A 1M1NB 5FYQA 2UVPA 2H2FA 4PG5A 2XZPA 1IN7A 2AFIB 2C5SA 4AMBA 6REQB 3QMVA 2OOKA 2QVXX 1XMQB 3P1JA 3BBPA 2AUTA 1GHTA 3R3YA 5TQJA 1HO3A 3ESXA 1FNDA 4EBAA 4HVBA 2OESA 1RAIA 1DAEA 5ENPD 1SUAA 3B36A 4CLOB 5FIOA 3CX7A 4OKNA 3EG5A 5ED4A 3HR7A 3JTMA 4O4LB 4OFBA 5KNCD 2FPLA 3DLHA 4OYYA 3IKLA 1TW3A 1J07A 1QU3A 4FYMA 5AI4A 4OHKA 1QHHA 5CCMA 1NKVA 1QV7A 2REBA 4HLUC 2FJUA 1UPUA 4DIDA 2H00A 1G2QA 4DCUA 1O7JA 4C88A 3NDBB 1R00A 4RTLA 3JRXA 1MO2A 2GRAA 1VE6A 3Q4AB 1CJSA 1SG9A 2EKZA 2HNAA 2WXLA 3WFIA 1QHYA 4M6WB 4ZT3A 1R9MA 1D2NA 1RLIA 1OXTA 3EDOA 3DKPA 4ENPA 3M4ZA 3UOAB 1PQWA 1DQZA 3V1UA 1B6SA 1LC0A 2I2OA 1WMSA 4ZHQF 3QXCA 3P9NA 3OT4A 2WNIA 1R0XA 2LBPA 5DM2A 4DIOA 1M76A 2GYYA 1Y6QA 2CE7A 1FBNA 3AKEA 3DHNA 4NYIQ 4CM8A 4ASUD 1WETA 4RKFA 4I9GA 4QOSA 1ULHA 3K5IA 1KKMA 2JCVA 1C14A 4PN7A 2VF7A 3SLRA 4LGMA 3ZE9A 3ZW3A 2HBRA 1WRBA 3RWBA 1Z62A 2IUFA 2H1WA 3EWIA 4ARIA 4B5KA 2C95A 1RVV1 2X1LA 2AWIA 3H18A 4AICA 4WLOA 3UHJA 5KEIA 2NO9A 1Q95A 4PO8A 2CCKA 1UC4B 2QRQA 2VR1A 4UDYX 3ZDQA 3VI3B 3KUXA 5E7MA 1CUAA 4L76A 5FWYB 2P40A 4FC8A 3H75A 3OZWA 1PGJA 5IKXA 4KGZA 3G5TA 2RH8A 5DM0A 3JTEA 1ZUIA 4NYJR 2ECPA 2BDUA 4E5KA 3FVTA 3HZZA 2H4WA 5JTUA 2E2WA 4RWEA 4WNAB 2QD4A 1BMFA 4TL9A 4APOA 1F5SA 3KYDA 1HBJA 1J2JA 4X84A 1UC5B 2EP5A 1T3SA 4OBXA 3OECA 4EW6A 3IE2A 4QBIA 3S28A 4FUQA 4QE3A 5DHTA 3SZMA 2VJDA 3OF5A 1DC3A 1EKXA 1TAQA 3BGDA 2P0YA 3HEMA 1FBTA 1ETUA 3NHLA 3X1DA 4E1BA 5JEEA 1ELKA 5FV7A 4OLBA 3ZVLA 1QDUA 3L8EA 4WIAA 5CRVA 2RHCA 2D2VA 4ER7A 3ZU6A 3QENA 2GGSA 5A7FA 1R7RA 2WPNA 3C1TA 2BFBA 3DBLA 1FYVA 2QTLA 4UREA 5TB5A 2V3CC 2HXSA 3QITA 1RI3A 2KMLA 2ODEA 4IQGA 3KO8A 3CVYA 4QAQA 1OLSA 1PU2A 5AW0A 5DEOA 3RG2A 3FTWA 3R75A 2ZULA 4EUEA 3F9RA 1BX3A 2AYXA 1ZUNB 3SO8A 1WPRA 5LPNA 2RGAA 4P33A 3PX7A 2WKRA 1NATA 5DN6A 2HA3A 4B85A 5LR6A 2OEPA 2QGNA 2EL7A 4RPGA 2Z4SA 4KXQA 5JFGA 3UJPA 1SVOA 4RIFA 4WOPA 4PFKA 1TC2A 3C5WP 4MR9B 3TGWA 5EIEA 3DT9A 4RUKA 3DOJA 4UE6A 2RBKA 4JKOA 3I4GA 1UT6A 3DC7A 4I9FA 3G2WA 3TX6A 1WDWB 2VP6A 3BF8A 2O9JA 4TLCA 1TEZA 3LT2A 3AR7A 3ZEIA 3H6GA 3UINC 4CIVA 1ECLA 4R2MA 2QLNA 1DOZA 1G20A 2AEEA 2OB2A 1W3BA 3HEAA 4GMLA 3F4BA 5ERXA 5KPDA 5JZBA 5F7JA 1N32B 4G0XA 1VPWA 4RXMA 1QO9A 1ZBDA 2HJWA 3NYWA 3LA8A 3IB6A 1ZX1A 4KR6A 4AXHA 2PXAA 4IGAA 4GZ5A 2VDLB 4M1OA 1KMQA 3EZXA 1K7CA 4KREA 4C2TA 1TT7A 2H48A 4CN9A 2I65A 3QTTA 2XB2A 1RYMA 4BNNA 4RHXA 1JEAA 3A4IA 4YO8A 2GD0A 2UZAA 1OMOA 1D1TA 4QFVA 2IOHA 1JJ7A 2JCYA 3NT4A 4TROA 5MN5A 5KHLB 1E2MA 1Q83A 1KAQA 1W4CA 2EFCB 3R5FA 4BYGA 3DF7A 3LGSA 1NX9A 1FXWA 5EMLA 1UUFA 1KNQA 2NV6A 3NJ4A 4HDRA 2R85A 3I6ZA 4KH1A 2YBDA 2H18A 3THXB 2P91A 3NHJA 3PJGA 3DTVA 2FQWA 3QNKA 2YYAA 1UXOA 2AG0A 5ALOA 1T9KA 4O4IA 2DERA 4UW9A 1ZMXA 2Y9MB 3JQRA 3CRVA 2EILE 1K8YB 5BRJA 3LBAA 1KAHA 3KZNA 3LYLA 3CCCA 1JG7A 4TV9B 2ZZMA 4DWOA 4HAWA 3WXMA 2YY7A 5FJIA 3KVYA 4GA0A 2C5HA 5DHSA 4OJTA 4HB5A 1ICIA 2R86A 3JQBC 3HI4A 4CMBA 3URMA 4C21A 3PWKA 4GOOD 1ORRA 2UXCB 3ZUGA 4PVDA 2ZJ4A 3E9EA 3AXTA 4DQXA 4QU5A 4GMRA 1I6WA 1KK1A 3REFA 3G9ZA 1UFRA 3GGOA 3L7KA 3UOGA 5FTKA 4DPKA 4TMFA 2ZU0C 5F7OA 5JY1A 5MGBA 4ZJUA 3ET4A 2AG5A 3FFAA 3OD5A 4HEHA 3ZEAA 3RHSA 2YHIB 4BFTA 1ZN8A 1GCIA 3RVNA 5F35A 1E2NA 4GKVA 1YWGO 4PC2A 1DAIA 3F6SA 3WNDA 5K0EA 2X0IA 2NVUA 4UUOA 1SHKA 1NW8A 1KI6B 1QF6A 3SFZA 1GAQA 4XZ3A 4IDHA 1IYGA 2A5GA 1J8VA 4LJ6A 1WG0A 2V7QA 4ND8A 4ENSA 2ZJ3A 3N86A 1PR1A 4ZALA 2GARA 1L4FA 1GQFA 4P3YA 2VH1A 2VQ2A 4HRNA 3SZ3A 5EFOA 1JU4A 5KYXB 1UPFA 3URZA 1CJTC 3LXXA 5G1PA 2EKDA 2Q1TA 5LC1A 4H4CA 4RK7A 5FQ7A 5T3RA 2W2TA 1Y8CA 5EJIA 3K3PA 2PQMA 3ACDA 1F3LA 3Q9NA 1OXUA 3ZGZA 1LV8A 1NW9B 1SC1A 3PFIA 1KI7A 1T26A 3TXNA 4GE0A 4AJLA 1T2EA 3NBMA 1F4VA 3T5TA 3IMEA 5D00A 2BDTA 3VVCA 1L5WA 5J23A 3L7IA 4GTVA 3IBCA 1M66A 1Z5ZA 3P0RA 3AVYA 1EG7A 4L7QA 1J0CA 4DLBA 3FNGA 3VTXA 3ABIA 3GNTA 2WWXA 2PH5A 3M3HA 1YR6A 1ONNA 5DIFA 2WKPA 2QU7A 1C9DB 1KJYA 2O2EA 5I7RA 1KZ7B 4ZC1A 2WTEA 4U6NA 1T9HA 5HWSA 1JMYA 5FOXA 3E4DA 4F1KA 4OVUA 1K6EA 3QLJA 2HJGA 4HVLA 1IULA 4G63A 3USCS 1U31A 4M8LA 1K3TA 1Z6YA 2QSJA 3S5JA 1EX7A 4CV3A 3TZKA 3RRUA 4DRXB 4BUZA 5FX2A 2VYVD 3MCAA 3RBXA 5E6UB 5IT0A 4ONEA 4HATA 3EMKA 4K2HA 4DV4B 4QSHA 2KATA 5D6NA 2YQZA 2ILRA 4GLLA 3SVTA 1RQRA 3DBOB 4X1IB 3VPXA 1UIMA 2QN7A 1OFTA 2ZJAA 4L2LA 4AYTA 3HLKA 2XCCA 4UUCA 2QX4A 2HK9A 5EQTA 2HA6A 2JVJA 4M87A 2Z5VA 5KS2A 2DETA 5KVVA 5CCDA 4MVJG 2FY8A 2WSMA 3CNLA 5CVEA 3W6UA 1TZJA 3TQSA 3ISTA 2QI9F 2WYVA 4AUMA 5LL6P 3LK6A 2IIQA 4W8GA 4ZOQI 5L51A 4OSPA 1Y81A 2RKWA 1P7ZA 1E7RA 1NKTA 3PT9A 3DXXA 3KJEA 3ND8A 3WA6A 2AE1A 4KRYA 1TCBA 1ZOSA 4MUIA 3QAQA 1XLUA 4GSLA 1C7RA 4FP9A 2P3QA 3OQVA 1DWQA 5EYLA 3ZDCA 1NF2A 1RBMA 3AZQA 4ZKEA 1ZVQA 2AUMA 3NWJA 5G4LA 4E3WA 3WY9A 4N3NA 3INNA 4DNPA 2RHDA 3RS7A 4NMMA 2OC9A 1UMBA 2J09A 3PQ2A 5ITWA 2CGEA 2CDRA 1D6SA 3UGKA 3BXFA 2JFPA 2BTEA 1US8A 4DG5A 3QTBA 2BEUB 2CFIA 1OD6A 2C31A 2AW3A 3PZ4A 4LYAA 2H17A 4BO9A 3SQWA 3ZIDA 3R7WA 1F8YA 1JQJC 2C84A 3RYCA 2P6PA 1XUOA 4Y2UA 2Q2VA 1CSEE 2YWJA 1T3ZA 2JA1A 1UQUA 1UZUA 3CIOA 2OENG 2PT5A 4J8DA 1CR1A 2IHKA 4B74A 3I2YX 3Q8LA 5KHAA 4OL9A 4H7FA 4MGYR 2MWMA 2QTMA 3T3DA 1HYBA 2WD7B 4RPHA 5DN9A 4KRGA 3MINA 5ENSD 4ZCSA 2XRMA 5NULA 2OVBA 5EQFA 3ZHZA 3IKJA 3O1JC 5TGZA 4L27A 4X8QA 3QU9A 1P0QA 4V0QA 3GMIA 3MWKA 1KZHA 1J99A 1UEIA 4TLBA 1IZYA 4IIVA 4S1VA 5A71A 3IERA 2BE7A 2B2XA 4P36A 4AG6A 1YL5A 3KLOA 1OH7A 1USGA 1N0QA 3F1LA 1KSFX 3PDIA 1NV9A 2DM6A 2H08A 4AZWA 2C0LA 3HHEA 3KTAA 3QUTA 4IYRA 4F6RD 2HBZA 4Q03A 4C4YA 1FPQA 1TQ2A 2ZUUA 3KT3A 3CEMA 3ZHCA 3SWWA 4UZSA 4OHPA 1GRRA 3BXPA 2HPHA 1K63A 2MYOA 5H3HA 2EJTA 5HF8A 2B2CA 5A6VA 4H3HB 1UBSB 4QUEA 2P9UG 5I7WA 3E84A 2WTNA 5AHOA 3U37A 5EFZA 4BU0A 1UKCA 1FTGA 2RHHA 4BMYA 4J7CA 3M89A 1YVEI 4A8JC 4A8PA 3V6LA 4Y1RA 1GCGA 4MB2A 4QATA 2B98A 3KNZA 3FOEC 1Z3YA 4HNAD 3LW7A 4HGRA 3PC6A 1RWPA 1WCXA 4CEHB 4FOOA 3SMVA 5LDHA 2QVCA 1QP4A 3QARA 2DBYA 2OXTA 3NOQA 1E2HA 1DKUA 4CEJA 1YI0A 5JS2A 2PH1A 4S1TA 2CZQA 4J0QA 2V7EA 2IU4A 1X9HA 3MJCA 1JMKC 5C2JB 1Y7HA 5LWQA 4G81A 2QG9A 4HZUA 4YMIA 3VTKA 3PG5A 3G79A 3VDXA 3U5TA 3DXMG 1A2BA 4J0KA 1RZUA 2Q28A 1H2EA 3F67A 3T4PA 1R4MA 4JJFA 4LTDA 3JQ8A 4BAGA 5DB4A 5BT9A 1UBRS 5BPHA 1XLTC 4O60A 3HY4A 2Z4RA 2IXBA 2CLLB 1Z8DA 1RWXA 1GVHA 4MLPA 1TNOA 5ALXA 4LRSB 4H1WA 4AJWA 1OAAA 1ZSVA 2RBEA 3PGXA 4GL2A 1MX6A 3B7PA 1ARZA 4HWSA 2XCOA 3GMTA 3TOZA 4A6DA 3GEEA 5IM4<