4ME2A

Crystal structure of tha8 protein from brachypodium distachyon
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
194
structure length
194
Chain Sequence
SLSTEAIHAVQALKRLTAADRSPPAATAAASAALGRLLRADLLAAMAELQRQGHWSLALAALHVARAEPWYRPDPELYATFVSSSPSNDPAAAAAVDALVEAFIEEKERGAAGGSSEGVWVGEDVYKLTRLVRALVAKGRARAAWRVYEAAVRKGGCEVDEYMYRVMAKGMKRLGLDEEAAEVEADLADWEARH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Uncharacterized protein
publication title Structural basis for RNA recognition by a dimeric PPR-protein complex.
pubmed doi rcsb
source organism Brachypodium distachyon
total genus 71
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2013-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4me2A00
2VSYA 5KJMA 5HQ8A 2C0LA 4GCNA 5BT1A 4BWRA 2LSVA 3Q15A 3TG4A 2GW1A 3KS2A 2VGYA 4NRHB 5HI7A 1QQEA 4BT9A 4BT8A 3QWPA 3Q4AB 4H7XA 5C1DA 2VQ2A 4RG6A 3CVLA 4GCOA 3E4BA 1NZNA 3Q49B 2JLBA 5JJTA 3QWWA 4I9CA 2HR2A 2AVPA 4N2SA 3ZHEA 4KYOB 5DBKA 3S7JA 5KJLA 4HOQA 3CEQA 4F3VA 4G24A 4ABNA 4G26A 4HOSA 2VGXA 1P5QA 4UQXA 4Y6CA 1TJCA 2UY1A 1KLXA 5D0OD 2BUGA 5KJKA 2KC7A 3KD7A 4I1AA 4YVOA 3QOUA 3N71A 5CHEE 4JL0A 3MV3B 3CK8A 2ONDA 5EX3A 5G05J 4N5CA 2I6HA 3ASGA 1ZBPA 4I2ZA 3ASFA 2FF4A 5EKQD 4XIFA 5G04C 5CCMA 4JHRA 4G23A 2HO1A 4AY5A 3CK9A 3NF1A 2YHCA 2WQHA 4A1SA 1ELWA 5M72A 4Y6WA 4GYOA 4U0ZA 2XGSA 4N3BA 4GZ6A 4GA0A 2J9QA 4U07A 2FI7A 3RKVA 2NC9A 4N2QA 5FTPA 1IHGA 3LKUA 4LEUA 2LNIA 3TAXA 3MKRA 4W9RA 5A6CA 2QFCA 3U4TA 3FP3A 1NA3A 3AS8A 4YNDA 3CK7A 4GPKA 2IFUA 3RU0A 3LYAA 4CGWA 3PE4A 4YVQC 5LCWC 3ASHA 2VSNA 2KATA 3AS4A 4HORA 3CKCA 4APOA 4HOUA 3U3WA 5FZSA 3QDNA 3AS5A 3LY8A 2Y4TA 2YQ8A 4WNGA 2XCBA 5BW8C 4UI9C 2R5SA 2OOEA 5ARGA 4GA2A 4GA1A 4GYWA 5CCLA 4G25A 2V5FA 3S7BA 3SZ7A 4U0UA 4J8DA 4RG9A 3RO3A 2E2EA 2UWJG 4WNFA 5BNWA 3LY9A 4XI9A 5FZRA 3OXGA 1E96B 1ZU2A 4H7YA 4IN3B 3LCAA 4N3CA 3PDNA 4U04A 3K9IA 3OXLA 3Q5MA 3FFLA 1NA0A 4J8FA 1WM5A 4AY6A 1A17A 2HYZA 3UUXA 2XGMA 4CDRA 3ASDA 4UI9K 3VTXA 2FBNA 3FWVA 5JJ7A 2KCLA 2PQNA 2XCCA 1YA0A 4JA7A 3GZ1A 4I17A 1W3BA 2DBAA 3HYMB 2Q7FA 3CVPA 3O48A 3ZFWA 3CVQA 3OXFA 5G05C 2PQRA 4XI0A 3ZHEB 2FEZA 3LPZA 3TGOA 4WNEA 4KXKB 1Y8MA 1HZ4A 4GYYA 2VGXB 4JA9A 3PE3A 5FT9A 5KJNA 2UY1B 3CKBA 4AM9A 3MV2B 4O6FA 3ULQA 3URZA 5AYWD 4ME2A 4J0UA 2KCVA 4HOTA 3JYSA 2IF4A 3CVNA 3RJVA 2MHKA 2FO7A 3Q47B 4G1TA 1KT0A 4AIFA 3S7FA 5A7DB 1QZ2A 4G2VA 2XPIA 3ZN3A 2XGOA 1OUVA 4WUYA 3ZGQA 4I2WA 5G04J 1HH8A 4J8EA 3SF4A 5ARFA 4BTAA 5DIZA 4KBQA 1XNFA 2KCKA 4CGVA 3ESKA 4EQFA 1KT1A 3CV0A 3GYZA 4UQYA 3WXXA 3TG5A 4N39A 3MEKA 2C0MA 4NQ0A 3BEEA 2PZIA 4GZ5A 4B94A 3GZ2A 5JJ6A 2L6JA 3QKYA 5FJYA 2XEVA 3GW4A 3MA5A 1WAO1 2PL2A 4U0SA 4UQZA 3EDTB 4WNDA 5FZQA 5D0QD 3RIBA 1PC2A 1ELRA 3UPVA 5EX0A 1B89A 3S7DA 1IYGA 4N3AA 5LCWJ 2P58C 1HXIA 3VTYA 3RO2A 3R9AB 4I9EA 3KAEA 4BTBA 3ZPJA 2LSUA 3LY7A 4GZ3A 2C2LA 3QWVA 4UI9J 3UQ3A 2VYIA 3IEGA 1FCHA 2Y4UA 2WPVA
chains in the Genus database with same CATH superfamily
2VSYA 5KJMA 1E7VA 3FTXA 2XS8A 2OV8A 5AAOA 4XE0A 1Z5SC 3LVRE 3TG4A 2VGYA 3FY4A 5HI7A 1HG5A 4GZDA 4YDYA 4RG6A 4HB5A 4ACLA 3CVLA 4EHMA 1NZNA 3FU6A 4UWFA 3Q49B 5CBNA 3MKQB 5JJTA 3QWWA 1ELKA 2LUHA 1K1AA 2P9SG 1N9AA 2ZISA 4E6HA 4N2SA 5ANRA 4L23A 4KYOB 3EIJA 3ASNE 3CEQA 4F3VA 4G24A 1N0RA 3PZ3A 4HOSA 1LTXA 3FU5A 1P5QA 4UQXA 3TXMA 4Y6CA 3L6AA 2X3MA 2DYSE 4GB9A 4PS8A 1NI1A 2KC7A 5CRUA 4I1AA 4KVMA 3L54A 5CHEE 4WWOA 4GAAA 2X6HA 2XPZA 2RD0A 3AJIA 3CK8A 1OWLA 2BKKB 5EX3A 3UT4A 5G05J 2CG2A 1ZBPA 2FF4A 4L9PA 1A5EA 3D9NA 4G23A 3UIOC 2VGEA 4BETA 2WQHA 4ATGA 4I43A 4Q94A 3CVUA 1ELWA 4HLLA 2BF0X 3L82A 4K5CA 3FTZA 2XENA 2ETBA 4K0RA 2AXVA 4IYPA 3TL5A 4MBGA 1IHGA 3TAXA 2RFAA 1U2VG 3LEWA 4W9RA 4GMRA 5A6CA 3C72A 4HS2A 3UX4A 2LXLA 3SNXA 3D9IA 3RU0A 3LYAA 1AWCB 3AG1E 4HI8A 2DWZA 4A63B 4GTSA 4UWKA 4HBDA 1LD7A 3UXGA 4APOA 3U3WA 3Q79A 1FVHA 2X6IA 1OCCE 1X5BA 3IHYA 3DSVA 1Z3YA 5BW8C 3J5PA 3TJPA 4CCAA 4FADA 2Y1LE 3T8KA 3EJNA 4NACA 3S7BA 3CHMA 3KSQA 3SZ7A 3FUJA 2CFZA 4OAUC 2X6JA 3DSUA 3NB2A 2L0TB 4CDMA 3SQVA 1S70B 4H7YA 4IN3B 3C98A 2KXPC 3ZVVA 3PDNA 3Q5MA 2H6IA 1TYQG 5JHBA 5JA4D 1N94A 2OVBA 2DZOA 3D3MA 4CDRA 3FUKA 4HQDA 1TEZA 2J8SD 3MKQA 4N5QA 3ABLE 4ILGA 3PNLB 3FWVA 3ZYLA 3QAQA 2KCLA 3SGHA 3GZ1A 4FP7A 1V55E 1HX8A 4B89A 3CLJA 3FU3A 2R2LA 1S63A 3MZLB 3UM1A 5G05C 1UW4B 1EF1C 3T8MA 3WG7E 3DSTA 4V3IA 1Y8MA 4GYYA 4JA9A 4FLBA 4F6RD 2DIWA 3DPDA 5BUZA 2UY1B 3ONKA 3UIPC 3ZXPA 1TNOA 3CKBA 5EIDA 4AM9A 3SHFA 5AYWD 3U64A 4NIKA 5JMND 3R7RA 5JHAA 4JEUA 1OWMA 1MHQA 3JYSA 2IF4A 2IONA 2FO7A 2WXFA 3DRAA 3V2OA 5CMYA 4AIFA 5A7DB 3FTUA 2BEDA 1QZ2A 3FEYA 3S2AA 4G2VA 2XPIA 3L22A 2WVIA 3G2UA 4U8HA 5BPPA 2EIKE 5ENPD 2ZGDA 3ZGQA 2P9LG 3MCXA 4J8EA 1YMPA 3QK0A 1INZA 4E85A 2IO2C 1TN6A 3ESKA 4TV3A 2KBXA 5FQ8A 3CR3A 1E8WA 3G2WA 1HS6A 4UQYA 3MYVA 3PS6A 4A3TA 3RRUA 3FULA 2E0IA 4PUCA 4DRXE 5EYPF 2AJAA 4GZ5A 4XKCA 3GZ2A 1OT8A 4JB8P 5JJ6A 2L6JA 1QNFA 2XEVA 3TWQA 1BI7B 1E8YA 1WAO1 4UQZA 5FZQA 2XZTG 2QYJA 1DVPA 1PC2A 1ELRA 5EX0A 2J4BA 2FO1E 4M3OA 1IXVA 4BEPA 4I9EA 3KAEA 3ZPJA 2R59A 3HHMA 2F8YA 3ULEG 3QWVA 2J49A 1L5JA 3UQ3A 2VYIA 3IEGA 1FCHA 3C3OA 2A4ZA 2P9KG 1FVFA 2YHEA 3R9MA 3KSLA 2LO6A 3QNKA 5BT1A 4P29A 4EECA 3CVXA 1K8KG 1TNUA 1Z6TA 2GROB 4GMLA 2GW1A 5HKPA 1QQEA 4BT9A 3QB2A 4H7XA 2WXMA 3Q7FA 4L2YA 4QQIA 2KZTB 3ZYMA 4EZKA 3T5XA 4I9CA 2HR2A 2EIJE 5AQ9A 3RSEG 3CSFA 4HXIA 2DVWA 4I6JA 2B0OE 4GTOA 3HXCA 5KJLA 1LD8A 3OTNA 1XGWA 4GTMA 3TWSA 4MLPA 3NQPA 5CERB 4C0EA 2MYOA 2UY1A 5D0OD 3D9HA 3PREA 2LAHA 4AVXA 3QOUA 3ZIMA 4HRNA 3MV3B 5AQBA 2P9IG 3FUMA 2QY7A 2ONDA 3RK6A 5E75A 5T4YA 4N5CA 2I6HA 3DWLG 1FPPA 3O4ZA 2MOWA 3U66A 3FUNA 5CCMA 3CK9A 4AY5A 2YHCA 5AQAA 4A1SA 4OAVB 3HXDA 3Q9UC 5M72A 3X2QE 4PS3A 3FTWA 3ML8A 3ABKE 2WQ6A 2J9QA 2OVFA 4U07A 2WXGA 3RKVA 3UT7A 2NC9A 4N2QA 5G2NA 2XS1A 4CYMD 2LNIA 2AWIA 1KPSB 1U3CA 3E30A 2CHZA 4DX5D 2QFCA 3FH8A 3FP3A 4F1SA 1NA3A 4TXPA 3DPYA 2IOLA 1E7UA 2V0PA 4FHKA 3CQCB 1HF8A 4HNAD 3PRZA 3L08A 3UINC 5C2YA 4MKTA 1JCQA 5FZSA 1IKND 2XQ0A 2WXQA 3AS5A 4ZFHA 3UT8A 2GRRB 2YQ8A 4AEZC 2XCBA 3EIQC 2P2CP 2R5SA 2OOEA 4GA1A 2F8XK 4G25A 2AXZA 3TWTA 3ZEFA 1LF8A 4U0UA 4J8DA 4J8YA 3ZKJA 1HE8A 2IQCA 3D9KA 4LCTA 3ZNGA 3LY9A 5EDSA 1YYHA 1TNZA 3UM0A 1E96B 1ZU2A 2VJ8A 2WXLA 3FEXA 3SO8A 4XZ4A 4U04A 4Q69A 2LXMA 4EPZA 3FFLA 3ASOE 1JWFA 5B3SE 5A23A 1WM5A 1A17A 3AG2E 4G8LA 3UUXA 4AP2A 2EINE 1TN8A 2L9BA 3RAUA 4TXRA 2WXNA 4JD2G 1S64A 5D66A 3PH0C 3HVEB 2PQNA 1YA0A 4JA7A 3Q7AA 4I17A 2YNQA 3ZW3A 1JCRA 3RRNB 1W3BA 4B8CB 3BUAA 5EIBE 3MX3A 4L2LA 3PVLA 1V54E 2Q7FA 3QC1A 3CVPA 4O1OA 4I1OB 3ZHEB 4BSXA 1OXJA 2BKGA 3JUIA 3E37A 3TGOA 5AIJA 3EHRA 2HE0A 2LAIA 1HZ4A 3PUKA 4EBAA 5FQ6A 3G2TA 3B7UX 5J08A 4FULA 5FT9A 5FIOA 3MV2B 3TWWA 4M7CA 1SA4A 2P9PG 3ZUVB 4QFVA 4MS6A 3LDZA 4J0UA 2KCVA 4LSZE 2IU1A 4GTRA 4B0ZA 1OWNA 2WXIA 4BY6A 1D8DA 1AP7A 4PDXA 2IJGX 3ZU7B 3FUHA 3E32A 4YDWA 4YDOA 2PM6A 2WMOA 1DCEA 4LNUD 3TWUA 4K5BA 3TWXA 3B7TA 1OUVA 4WUYA 1EDUA 3EHQA 5G04J 1FT2A 3AG4E 5FQ7A 3QJZA 4KBQA 3TWVA 3CQGB 2KCKA 3V2XA 4DX7D 3ISMC 3TG5A 3I4RB 2XHEA 2R05A 2P9NG 3D9OA 4J8SA 4Q96A 3NOCD 3SFXA 2J08A 3W9FA 1KZOA 3FTSA 2WXHA 4U8VD 1TR4A 4ANWA 2V5QC 1PY1A 3CHPA 3EDTB 2DZNA 3RIBA 1H6OA 3PNTB 1MX4A 4ATZD 3S7DA 4N3AA 3ZXSA 1VDYA 4JPSA 1HXIA 5AJDA 2XPYA 2XEHA 5B1AE 1N54A 3LY7A 2NSZA 4DI3A 4GZ3A 2B6CA 2WXJA 1IHBA 4ILIA 4TXQA 1MZCA 1N52A 4UI9J 2A5UA 4C9BB 3J5QB 5ENSD 5HQ8A 3JQ0A 4Z68A 4U96D 4GCNA 4KT6B 2LSVA 3DSWA 5CECB 4BX8A 4HLEA 4BT8A 4RSYA 4K03A 5C1DA 5T3RA 2VQ2A 5ENOD 4GCOA 3L13A 3JXJA 2EILE 4HRLA 4I6GA 4JEHA 3AU4A 2I9CA 4AV7A 1WY6A 3BG0B 2A5EA 5KWDA 4ACKA 3ZHEA 3Q75A 4IRUA 3S7JA 5CEDB 3FH7A 3G2VA 4EZJA 1TJCA 4ZHBA 1BPOA 4JVSA 1MYOA 3KD7A 4F1PA 5B1BE 2WXPA 1H2TC 3IBEA 3APFA 4CT4A 4X8QA 3ESLA 4I2ZA 5ENRD 4GPMA 4XIFA 2JABA 5G04C 4KVOA 4DUIA 3UKRG 3EHNA 1G3NB 3AU5A 3HIZA 4OYSA 4Y6WA 4U0ZA 1MQSA 2J07A 3QARA 4GZ6A 4MRUA 5KNHD 2XZDG 3T5VA 4TRQA 2FI7A 1D8EA 3NOGD 4G11A 4DLOA 5FTPA 1N4PA 2EQXA 2CHWA 3UMVA 3MKRA 1SW6A 5ITZF 2GRQB 3UM2A 1QYMA 1UN9A 2ETCA 3U4TA 4YNDA 3SY2A 4GPKA 1DNPA 2IFUA 3PE4A 4DPRA 2DCPA 1OWOA 3ASHA 4LNGA 3TWRA 3P1UA 5CEAA 2CHXA 2H6FA 3KEZA 4D10C 2BTDA 1OCRE 4OVVA 2X6KA 2Y4TA 2ZIRA 4WNGA 4UI9C 3FUIA 3PZDA 5ARGA 4GA2A 5CRVA 2ZXWE 4GYWA 5D2MC 4A3VA 3NAWA 2V5FA 4RVBA 3IXEA 5KBAA 4U95D 2IEJA 2QYUA 2I2OA 3CHQA 3D9MA 4LRZA 4WWPA 4RG9A 5AQ7A 3RO3A 2E2EA 2UWJG 4BFRA 4WNFA 3FUEA 1UN8A 5ENNA 4XI9A 5AENA 1TJFA 3LCAA 3FHEA 3RRMB 4N3CA 2KM4A 3K9IA 3E33A 3OXLA 4GTPA 5T8IA 4AOFA 1NFIE 4AY6A 1BI8B 2VTBB 2RKKA 2WM9A 4FLHA 4LNBA 3FH5A 5LOZA 3CIAA 3ASDA 1H0AA 3AAAC 4LG6A 3I3NA 4R7LA 4YDEA 1H19A 2MRIA 2YINA 3JQ1A 2IO3C 3LXUX 3APCA 2GRMA 2OCCE 2J4DA 3T9KA 4CDNA 4PH4B 3C3QA 3ZFWA 3CVQA 1NP7A 2PQRA 4XI0A 4ANUA 3SFYA 4KXKB 2VGXB 3PE3A 3HXBA 5FINA 4B93B 3SBTB 3URZA 3JXIA 1JPLA 4U63A 2L0IA 2WXOA 4GZCA 2HM8A 1FT1A 3VLEA 1JUQA 3LJNA 3CVNA 3ZYQA 2MHKA 3G2SA 3Q47B 3HDXA 1HFAA 1KT0A 3S7FA 4CZ2D 3L16A 3LJ3A 3ML9A 1D9SA 2H6HA 5FWQA 3HXEA 3I5PA 3ZN3A 1BU9A 5ENQD 3MGBA 3JUEA 2XGOA 5KCMA 2GRLA 4HRMB 5LFAA 2I1JA 1N4QA 5CMWA 1N11A 1DC2A 3SF4A 3Q78A 4LUNU 4BTAA 3FUDA 1XNFA 4UWLA 4CGVA 4U8YD 4EQFA 1KT1A 5FQ4A 3NZUA 2X38A 3CV0A 1E8ZA 1ZB1A 4JW1A 3B13A 4N39A 3DBSA 3V30A 3MEKA 2C0MA 4NQ0A 2Y0BG 4PS7A 4O1PA 3BEEA 3HG0D 4RLYA 3CVYA 2KZTA 3QKYA 5FJYA 5BV1A 3SFZA 3MA5A 3B95A 2PL2A 2AXUA 4U0SA 4WNDA 3CVWA 5D0QD 3ABME 3UPVA 2CFUA 1B89A 1IYGA 1K3ZD 4JZYA 5LCWJ 4EBAG 3LS8A 5ANLA 3VTYA 2ZU6B 4FHJA 3R9AB 1DCQA 1QBQA 3BG1B 1SZ9A 2C2LA 2JEKA 2P9UG 5EN5D 2RFMA 2F37A 5J90A 4CEMA 1O1SA 4JHJA 4I1MA 4FJZA 3D9LA 3C5RA 3V31A 2WPVA 4DLQA 3VLFA 4JXTA 3DSXA 2C0LA 2VTBA 3MJWA 2ZGGA 4BWRA 3Q15A 1E8XA 3BQOA 3CHSA 4KZCA 2QZAA 3KS2A 4AJWA 4JC8A 4NRHB 3ZRHA 4BESA 3V79K 3UI2A 3QWPA 3Q4AB 5LX8A 2V4LA 5EYLA 4CRWA 3EHMA 3U9WA 4XEIG 3E4BA 2WB2A 3JCKC 3PEVB 3SBSA 4WWNA 2JLBA 1RW2A 3IHVA 2CG3A 3VLDA 1MJ0A 4DI4A 3CSTA 3B7SA 2AW6A 1WDYA 2AVPA 2ETAA 3B7RL 1OWPA 2R17C 5HRYA 1PAQA 5DBKA 4TUMA 4ANVA 1SQMA 4HOQA 4ABNA 4G26A 3PZ2A 2VGXA 1IQRA 1EPUA 5EILA 1KLXA 2BUGA 5KJKA 4HI9A 1RZ4A 1N95A 4YVOA 4O60A 1SZAA 3GZSA 5ENTD 4NURA 4G8KA 3N71A 4JL0A 5LP0A 2J09A 3DSSA 4AXHA 4HVBA 3ASGA 3ASFA 1OCOE 2OEWA 5EKQD 2EIME 3DXKG 4UUCA 1N4SA 5AJLA 4JHRA 4ILHB 2HO1A 3NF1A 3FTYA 1UOHA 1TNYA 3TXNA 2L6BA 2VSXE 5G55A 3CHOA 4JHKA 4FU3A 4GYOA 3OAWA 5BXOA 1MX2A 2XGSA 4N3BA 4GA0A 4U7EB 3ULYA 1HG2A 5CBOA 2FULA 1UG3A 2IY0C 4FJYA 3DEOA 3PZ1A 1H2VC 3LKUA 4LEUA 4DX1A 1HU3A 4XX5A 3IKOB 3ZYKA 3ONLA 2ILRA 4L7TA 1Z3XA 2NYJA 2WXKA 3AS8A 3Q73A 3UM3A 3CVVA 3CK7A 3AG3E 1BD8A 2X6FA 4CGWA 4YVQC 5LCWC 3PEUB 3HVEA 2VSNA 4A1GA 4CT0A 3L17A 2KATA 4APFA 3AS4A 4XKBA 3PUJA 4HORA 3Q9NC 3CKCA 4L1BA 2QC9A 2F0YA 4HOUA 3QDNA 3NBNB 3LY8A 2IOSA 4DK5A 1TN7A 2XEEA 4WAFA 1H2UA 5CCLA 3L9TA 1N4RA 1Q2ZA 1OY3D 1E90A 4UWHA 1N0QA 3APDA 4K5AB 1MX6A 5BNWA 4B8AA 5FZRA 3OXGA 4J7WA 1SVXA 1O5MA 3P2BA 2WXRA 3D9PA 4EZLA 4KZ0A 3SD5A 4GTQA 1O1RA 4J6IA 1EYHA 1SA5A 1WG0A 1NA0A 4J8FA 3FUFA 2HYZA 1S0PA 3F6QA 2XGMA 2V4HC 1Y6IA 1K1BA 1BLXB 4F7AA 3HRAA 4UI9K 3VTXA 2I1KA 4F53A 2FBNA 1H6KA 3CHRA 3B7BA 5JJ7A 3UTMA 2XCCA 3LVQE 1X81A 2H6GA 4A55A 4C0MA 2DYRE 2DBAA 3HYMB 1IQUA 3D9JA 1TNBA 1YCSB 2XRZA 3O48A 3OXFA 2RG8A 3CGHA 4GU5A 5H7PA 1H6PA 2FEZA 3LPZA 4WNEA 1NL4A 2Y3AA 5HS0A 3FU0A 2GRPB 3I4GA 4BERA 5KJNA 4BX9A 3PZ4A 1O1TA 4O6FA 3ULQA 4ME2A 4BSZB 4ANXA 4HOTA 2R03A 3RJVA 5KNGA 4DX6D 2NXPA 4GTVA 4G1TA 1U3DA 2XRYA 3IV0A 3EU9A 3DXMG 4TUUA 4GTTA 2WQ7A 2Y69E 4DX2A 4RQIA 3UKUG 5BXUA 3C3RA 4I2WA 5IY5E 1HH8A 4FA6A 4UWGA 5AARA 5BV0A 5ARFA 4I6EA 5DIZA 2OEVA 3GYZA 5AN8A 3WXXA 1JCSA 4IULA 1UJKA 4DJAA 4OVUA 2V8SE 1KZPA 2PZIA 4B94A 2VSOE 1OCZE 2GGFA 3ENEA 4FC8A 2PM7A 2WMNA 1HO8A 3GW4A 3R7QA 3DEPA 4GMJA 3BU8A 3EU5A 4HFGA 4URKA 4KMOA 3HXFA 3NZSA 2R02A 2PNNA 2P58C 3EUVA 2GRNB 1GW6A 1JWGA 3RO2A 3W9GA 4BTBA 4C48B 2LSUA 3FDHA 3SI5A 3KEAA 2M63A 1UJJA 5E76A 2Y4UA 3FTVA 3E34A 4LERA
chains in the Genus database with same CATH topology
2VSYA 5KJMA 4DLQA 1E7VA 2A4ZA 3VLFA 4JXTA 1FVFA 3FTXA 5HQ8A 3JQ0A 2YHEA 2C0LA 4GCNA 2VTBA 2LO6A 4KT6B 3MJWA 3QNKA 5BT1A 2OV8A 4XE0A 4P29A 4EECA 4BWRA 2LSVA 3Q15A 3CVXA 1E8XA 3LVRE 3TG4A 3CHSA 1Z6TA 4KZCA 4GMLA 2GW1A 3KS2A 4AJWA 2VGYA 3FY4A 4JC8A 4NRHB 5HI7A 3ZRHA 4BX8A 1QQEA 4BT9A 4HLEA 1HG5A 4GZDA 4BT8A 4RSYA 3QWPA 3QB2A 3Q4AB 4H7XA 2V4LA 4K03A 5T3RA 5C1DA 4CRWA 2VQ2A 5LX8A 4RG6A 3EHMA 4ACLA 3U9WA 2WXMA 3CVLA 4GCOA 3L13A 3E4BA 4L2YA 1NZNA 2WB2A 4I6GA 4JEHA 3FU6A 3JCKC 2KZTB 4UWFA 3AU4A 2I9CA 3Q49B 3ZYMA 4EZKA 3PEVB 3SBSA 4AV7A 4WWNA 1WY6A 3MKQB 2JLBA 3T5XA 5JJTA 3QWWA 4I9CA 3BG0B 3IHVA 1ELKA 2CG3A 2HR2A 3VLDA 4DI4A 3CSTA 3B7SA 2AW6A 4ACKA 2AVPA 3B7RL 1OWPA 4E6HA 4N2SA 2R17C 5ANRA 4L23A 3ZHEA 4KYOB 3CSFA 4HXIA 1PAQA 5DBKA 4I6JA 3EIJA 4IRUA 4ANVA 3S7JA 5KJLA 1SQMA 3OTNA 4HOQA 3CEQA 4F3VA 1XGWA 4G24A 4ABNA 4G26A 4HOSA 3FH7A 3G2VA 3FU5A 4MLPA 2VGXA 1P5QA 3NQPA 4UQXA 3TXMA 4Y6CA 1TJCA 1IQRA 3L6AA 1EPUA 2X3MA 4EZJA 1BPOA 4C0EA 4GB9A 4PS8A 2UY1A 1KLXA 5D0OD 2BUGA 4JVSA 2KC7A 5KJKA 3PREA 3KD7A 4I1AA 4YVOA 1SZAA 2LAHA 3GZSA 4KVMA 4NURA 4AVXA 3L54A 3QOUA 3N71A 3ZIMA 5CHEE 4WWOA 4JL0A 4GAAA 2X6HA 2XPZA 2WXPA 3MV3B 5LP0A 1H2TC 2RD0A 3FUMA 3IBEA 2J09A 2QY7A 3CK8A 1OWLA 2ONDA 3RK6A 5EX3A 3UT4A 5E75A 5G05J 4AXHA 2CG2A 3APFA 5T4YA 4HVBA 4N5CA 2I6HA 3ASGA 4CT4A 1ZBPA 3ESLA 4I2ZA 3ASFA 2FF4A 5EKQD 3O4ZA 2MOWA 5AJLA 3U66A 3FUNA 4XIFA 5G04C 5CCMA 3D9NA 4G23A 4ILHB 2HO1A 3CK9A 4JHRA 4AY5A 3NF1A 4KVOA 2YHCA 2WQHA 4A1SA 4ATGA 4I43A 4Q94A 3FTYA 3TXNA 3CVUA 1ELWA 2VSXE 5G55A 3EHNA 2BF0X 3CHOA 5M72A 3AU5A 4PS3A 3HIZA 4OYSA 4JHKA 4Y6WA 4FU3A 4GYOA 3FTWA 3ML8A 3OAWA 4U0ZA 1MQSA 2J07A 2XGSA 3FTZA 4N3BA 3QARA 4GZ6A 4GA0A 4MRUA 2WQ6A 2J9QA 4K0RA 2OVFA 4U07A 3T5VA 1HG2A 2WXGA 2FULA 1UG3A 2AXVA 2FI7A 2NC9A 4TRQA 3RKVA 4G11A 3UT7A 4DLOA 4N2QA 5FTPA 5G2NA 2EQXA 4FJYA 4IYPA 3TL5A 1H2VC 1IHGA 3LKUA 4LEUA 1HU3A 2LNIA 2CHWA 2AWIA 3TAXA 4XX5A 1U3CA 2CHZA 3IKOB 3UMVA 3LEWA 3MKRA 4W9RA 3ZYKA 5A6CA 3ONLA 2ILRA 2QFCA 1UN9A 4HS2A 3FH8A 3UX4A 3U4TA 3FP3A 4L7TA 4F1SA 1Z3XA 1NA3A 2WXKA 3AS8A 3SNXA 4YNDA 3CVVA 3CK7A 4GPKA 1DNPA 3D9IA 2IOLA 2IFUA 3RU0A 2X6FA 3LYAA 1E7UA 2V0PA 4FHKA 3CQCB 3PE4A 2DCPA 1HF8A 4DPRA 4YVQC 4CGWA 1OWOA 5LCWC 3PEUB 3ASHA 3HVEA 2VSNA 4A1GA 3P1UA 3PRZA 4CT0A 2CHXA 2KATA 3L17A 3L08A 4APFA 3AS4A 4XKBA 3PUJA 3KEZA 4UWKA 4HORA 3CKCA 4D10C 4L1BA 2BTDA 5C2YA 4MKTA 4APOA 4HOUA 3U3WA 5FZSA 3QDNA 1FVHA 2XQ0A 2WXQA 3AS5A 4OVVA 2X6KA 3LY8A 3UT8A 2X6IA 2Y4TA 1X5BA 2YQ8A 3IHYA 4AEZC 2IOSA 4WNGA 2XCBA 1Z3YA 4DK5A 5BW8C 3EIQC 4UI9C 3TJPA 3FUIA 2R5SA 2OOEA 3PZDA 5ARGA 4CCAA 4GA2A 4GA1A 4WAFA 4FADA 1H2UA 3EJNA 4GYWA 5CCLA 4A3VA 4G25A 4NACA 2AXZA 2V5FA 4RVBA 3S7BA 3CHMA 3ZEFA 1LF8A 3SZ7A 3FUJA 2CFZA 4U0UA 2I2OA 3CHQA 1E90A 2X6JA 4J8DA 3D9MA 4LRZA 4WWPA 4UWHA 3APDA 1HE8A 4RG9A 2IQCA 3RO3A 2E2EA 2L0TB 2UWJG 3D9KA 4BFRA 4LCTA 4CDMA 4WNFA 3FUEA 1UN8A 5BNWA 5ENNA 3LY9A 4B8AA 4XI9A 5EDSA 5FZRA 3OXGA 5AENA 3P2BA 1E96B 2WXRA 1ZU2A 2VJ8A 2WXLA 3D9PA 4H7YA 4EZLA 1TJFA 3FEXA 3C98A 3LCAA 4IN3B 3FHEA 4KZ0A 3RRMB 3SD5A 4N3CA 3PDNA 3ZVVA 4XZ4A 2KM4A 4U04A 3K9IA 3OXLA 4Q69A 3Q5MA 4J6IA 5T8IA 4EPZA 5JHBA 1EYHA 3FFLA 1NA0A 1JWFA 4AOFA 4J8FA 5A23A 1WM5A 3FUFA 4AY6A 1A17A 2OVBA 2HYZA 1S0PA 2VTBB 3UUXA 4AP2A 2L9BA 2XGMA 3D3MA 4CDRA 3FUKA 2WXNA 2WM9A 1Y6IA 4FLHA 1TEZA 3FH5A 4F7AA 3MKQA 5LOZA 3CIAA 3ASDA 4ILGA 1H0AA 4UI9K 3PH0C 2I1KA 3VTXA 4F53A 3PNLB 2FBNA 1H6KA 3CHRA 3FWVA 3ZYLA 3QAQA 3HVEB 5JJ7A 2KCLA 2PQNA 2XCCA 3LVQE 3SGHA 1YA0A 4A55A 3I3NA 4JA7A 3GZ1A 4I17A 2YNQA 3ZW3A 4R7LA 4C0MA 4FP7A 1H19A 3RRNB 1W3BA 2MRIA 4B8CB 2YINA 3JQ1A 1HX8A 4B89A 3MX3A 3LXUX 3APCA 2DBAA 2GRMA 4L2LA 3PVLA 3CLJA 3FU3A 3HYMB 2Q7FA 2J4DA 3MZLB 1IQUA 4CDNA 3D9JA 4PH4B 2XRZA 3QC1A 3CVPA 3O48A 3ZFWA 3CVQA 1NP7A 3OXFA 4I1OB 5G05C 2RG8A 1UW4B 3CGHA 1EF1C 2PQRA 4GU5A 4XI0A 3T8MA 3ZHEB 4ANUA 4BSXA 3JUIA 2FEZA 3LPZA 3TGOA 4WNEA 5AIJA 4V3IA 2Y3AA 2LAIA 4KXKB 1Y8MA 1HZ4A 4GYYA 3PUKA 4EBAA 2VGXB 5FQ6A 3G2TA 3B7UX 3FU0A 4JA9A 3I4GA 5J08A 4FLBA 3PE3A 4FULA 2DIWA 3DPDA 5FT9A 4BX9A 4DJAA 2UY1B 5BUZA 3ONKA 5KJNA 3CKBA 4AM9A 3MV2B 4O6FA 3SBTB 3SHFA 3ULQA 3URZA 5AYWD 3U64A 3R7RA 4ME2A 1JPLA 4MS6A 2L0IA 2WXOA 4QFVA 4U63A 4GZCA 2HM8A 5JHAA 3LDZA 4J0UA 2KCVA 4JEUA 1JUQA 3VLEA 1OWMA 4ANXA 4HOTA 1MHQA 2IU1A 3JYSA 4B0ZA 2IF4A 3CVNA 1OWNA 3ZYQA 3RJVA 2IONA 2WXIA 2FO7A 2MHKA 3G2SA 2WXFA 3Q47B 2NXPA 4BY6A 4G1TA 3HDXA 1HFAA 1KT0A 5CMYA 4AIFA 3S7FA 5A7DB 3FTUA 1QZ2A 3FEYA 3L16A 3LJ3A 3S2AA 1U3DA 2XRYA 3ML9A 4PDXA 3IV0A 5FWQA 4G2VA 2IJGX 3FUHA 3I5PA 2XPIA 3ZN3A 2PM6A 2WMOA 3L22A 4TUUA 2WVIA 3G2UA 2WQ7A 3MGBA 4U8HA 5BPPA 2XGOA 3B7TA 5KCMA 1OUVA 4WUYA 1EDUA 2GRLA 3ZGQA 5LFAA 2I1JA 4I2WA 5G04J 3MCXA 1HH8A 4J8EA 4FA6A 5CMWA 3SF4A 4UWGA 5BV0A 3QK0A 5ARFA 4LUNU 4I6EA 1INZA 5FQ7A 3FUDA 3QJZA 5DIZA 4KBQA 4BTAA 3CQGB 1XNFA 2KCKA 4UWLA 4E85A 4CGVA 3ESKA 4EQFA 4TV3A 5FQ8A 3CR3A 1E8WA 1KT1A 3G2WA 5FQ4A 3NZUA 2X38A 1HS6A 3CV0A 3GYZA 1E8ZA 4JW1A 4UQYA 3WXXA 4IULA 1UJKA 3B13A 3MYVA 4N39A 3TG5A 3DBSA 3I4RB 3MEKA 2C0MA 3PS6A 4A3TA 4OVUA 4NQ0A 3RRUA 4PS7A 2XHEA 3FULA 2E0IA 2V8SE 4PUCA 3D9OA 4J8SA 4Q96A 3BEEA 2PZIA 2J08A 4GZ5A 4B94A 3CVYA 2VSOE 4XKCA 3GZ2A 2KZTA 3FTSA 2WXHA 5JJ6A 2L6JA 3QKYA 1QNFA 5FJYA 5BV1A 2XEVA 4ANWA 2GGFA 3ENEA 4FC8A 1PY1A 2PM7A 2WMNA 1HO8A 1E8YA 3GW4A 3SFZA 3MA5A 3R7QA 1WAO1 2AXUA 2PL2A 3CHPA 4U0SA 4UQZA 3EDTB 4WNDA 4GMJA 5FZQA 3CVWA 5D0QD 3RIBA 1DVPA 1PC2A 1ELRA 3PNTB 3UPVA 2CFUA 4HFGA 5EX0A 1B89A 4URKA 3S7DA 4KMOA 1IYGA 4N3AA 3NZSA 4JZYA 2J4BA 3ZXSA 4EBAG 5LCWJ 1VDYA 2P58C 3LS8A 4M3OA 1HXIA 4JPSA 5AJDA 1GW6A 5ANLA 2XPYA 3VTYA 2ZU6B 1JWGA 4FHJA 3RO2A 3R9AB 4I9EA 3KAEA 4BTBA 1N54A 3ZPJA 2LSUA 3LY7A 2NSZA 3BG1B 3FDHA 1SZ9A 4GZ3A 4DI3A 2R59A 3HHMA 3SI5A 2C2LA 2JEKA 2M63A 2WXJA 3QWVA 4ILIA 2J49A 1N52A 4UI9J 2A5UA 1L5JA 1UJJA 3UQ3A 4C9BB 5J90A 4CEMA 2VYIA 3IEGA 4JHJA 5E76A 1FCHA 4I1MA 4FJZA 3D9LA 2Y4UA 3FTVA 2WPVA 4LERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VSY A;  5KJM A;  5HQ8 A;  2C0L A;  4GCN A;  5BT1 A;  4BWR A;  2LSV A;  3Q15 A;  3TG4 A;  2GW1 A;  3KS2 A;  2VGY A;  4NRH B;  5HI7 A;  1QQE A;  4BT9 A;  4BT8 A;  3QWP A;  3Q4A B;  4H7X A;  5C1D A;  2VQ2 A;  4RG6 A;  3CVL A;  4GCO A;  3E4B A;  1NZN A;  3Q49 B;  2JLB A;  5JJT A;  3QWW A;  4I9C A;  2HR2 A;  2AVP A;  4N2S A;  3ZHE A;  4KYO B;  5DBK A;  3S7J A;  5KJL A;  4HOQ A;  3CEQ A;  4F3V A;  4G24 A;  4ABN A;  4G26 A;  4HOS A;  2VGX A;  1P5Q A;  4UQX A;  4Y6C A;  1TJC A;  2UY1 A;  1KLX A;  5D0O D;  2BUG A;  5KJK A;  2KC7 A;  3KD7 A;  4I1A A;  4YVO A;  3QOU A;  3N71 A;  5CHE E;  4JL0 A;  3MV3 B;  3CK8 A;  2OND A;  5EX3 A;  5G05 J;  4N5C A;  2I6H A;  3ASG A;  1ZBP A;  4I2Z A;  3ASF A;  2FF4 A;  5EKQ D;  4XIF A;  5G04 C;  5CCM A;  4JHR A;  4G23 A;  2HO1 A;  4AY5 A;  3CK9 A;  3NF1 A;  2YHC A;  2WQH A;  4A1S A;  1ELW A;  5M72 A;  4Y6W A;  4GYO A;  4U0Z A;  2XGS A;  4N3B A;  4GZ6 A;  4GA0 A;  2J9Q A;  4U07 A;  2FI7 A;  3RKV A;  2NC9 A;  4N2Q A;  5FTP A;  1IHG A;  3LKU A;  4LEU A;  2LNI A;  3TAX A;  3MKR A;  4W9R A;  5A6C A;  2QFC A;  3U4T A;  3FP3 A;  1NA3 A;  3AS8 A;  4YND A;  3CK7 A;  4GPK A;  2IFU A;  3RU0 A;  3LYA A;  4CGW A;  3PE4 A;  4YVQ C;  5LCW C;  3ASH A;  2VSN A;  2KAT A;  3AS4 A;  4HOR A;  3CKC A;  4APO A;  4HOU A;  3U3W A;  5FZS A;  3QDN A;  3AS5 A;  3LY8 A;  2Y4T A;  2YQ8 A;  4WNG A;  2XCB A;  5BW8 C;  4UI9 C;  2R5S A;  2OOE A;  5ARG A;  4GA2 A;  4GA1 A;  4GYW A;  5CCL A;  4G25 A;  2V5F A;  3S7B A;  3SZ7 A;  4U0U A;  4J8D A;  4RG9 A;  3RO3 A;  2E2E A;  2UWJ G;  4WNF A;  5BNW A;  3LY9 A;  4XI9 A;  5FZR A;  3OXG A;  1E96 B;  1ZU2 A;  4H7Y A;  4IN3 B;  3LCA A;  4N3C A;  3PDN A;  4U04 A;  3K9I A;  3OXL A;  3Q5M A;  3FFL A;  1NA0 A;  4J8F A;  1WM5 A;  4AY6 A;  1A17 A;  2HYZ A;  3UUX A;  2XGM A;  4CDR A;  3ASD A;  4UI9 K;  3VTX A;  2FBN A;  3FWV A;  5JJ7 A;  2KCL A;  2PQN A;  2XCC A;  1YA0 A;  4JA7 A;  3GZ1 A;  4I17 A;  1W3B A;  2DBA A;  3HYM B;  2Q7F A;  3CVP A;  3O48 A;  3ZFW A;  3CVQ A;  3OXF A;  5G05 C;  2PQR A;  4XI0 A;  3ZHE B;  2FEZ A;  3LPZ A;  3TGO A;  4WNE A;  4KXK B;  1Y8M A;  1HZ4 A;  4GYY A;  2VGX B;  4JA9 A;  3PE3 A;  5FT9 A;  5KJN A;  2UY1 B;  3CKB A;  4AM9 A;  3MV2 B;  4O6F A;  3ULQ A;  3URZ A;  5AYW D;  4ME2 A;  4J0U A;  2KCV A;  4HOT A;  3JYS A;  2IF4 A;  3CVN A;  3RJV A;  2MHK A;  2FO7 A;  3Q47 B;  4G1T A;  1KT0 A;  4AIF A;  3S7F A;  5A7D B;  1QZ2 A;  4G2V A;  2XPI A;  3ZN3 A;  2XGO A;  1OUV A;  4WUY A;  3ZGQ A;  4I2W A;  5G04 J;  1HH8 A;  4J8E A;  3SF4 A;  5ARF A;  4BTA A;  5DIZ A;  4KBQ A;  1XNF A;  2KCK A;  4CGV A;  3ESK A;  4EQF A;  1KT1 A;  3CV0 A;  3GYZ A;  4UQY A;  3WXX A;  3TG5 A;  4N39 A;  3MEK A;  2C0M A;  4NQ0 A;  3BEE A;  2PZI A;  4GZ5 A;  4B94 A;  3GZ2 A;  5JJ6 A;  2L6J A;  3QKY A;  5FJY A;  2XEV A;  3GW4 A;  3MA5 A;  1WAO 1;  2PL2 A;  4U0S A;  4UQZ A;  3EDT B;  4WND A;  5FZQ A;  5D0Q D;  3RIB A;  1PC2 A;  1ELR A;  3UPV A;  5EX0 A;  1B89 A;  3S7D A;  1IYG A;  4N3A A;  5LCW J;  2P58 C;  1HXI A;  3VTY A;  3RO2 A;  3R9A B;  4I9E A;  3KAE A;  4BTB A;  3ZPJ A;  2LSU A;  3LY7 A;  4GZ3 A;  2C2L A;  3QWV A;  4UI9 J;  3UQ3 A;  2VYI A;  3IEG A;  1FCH A;  2Y4U A;  2WPV A; 
#chains in the Genus database with same CATH topology
 2VSY A;  5KJM A;  1E7V A;  3FTX A;  2XS8 A;  2OV8 A;  5AAO A;  4XE0 A;  1Z5S C;  3LVR E;  3TG4 A;  2VGY A;  3FY4 A;  5HI7 A;  1HG5 A;  4GZD A;  4YDY A;  4RG6 A;  4HB5 A;  4ACL A;  3CVL A;  4EHM A;  1NZN A;  3FU6 A;  4UWF A;  3Q49 B;  5CBN A;  3MKQ B;  5JJT A;  3QWW A;  1ELK A;  2LUH A;  1K1A A;  2P9S G;  1N9A A;  2ZIS A;  4E6H A;  4N2S A;  5ANR A;  4L23 A;  4KYO B;  3EIJ A;  3ASN E;  3CEQ A;  4F3V A;  4G24 A;  1N0R A;  3PZ3 A;  4HOS A;  1LTX A;  3FU5 A;  1P5Q A;  4UQX A;  3TXM A;  4Y6C A;  3L6A A;  2X3M A;  2DYS E;  4GB9 A;  4PS8 A;  1NI1 A;  2KC7 A;  5CRU A;  4I1A A;  4KVM A;  3L54 A;  5CHE E;  4WWO A;  4GAA A;  2X6H A;  2XPZ A;  2RD0 A;  3AJI A;  3CK8 A;  1OWL A;  2BKK B;  5EX3 A;  3UT4 A;  5G05 J;  2CG2 A;  1ZBP A;  2FF4 A;  4L9P A;  1A5E A;  3D9N A;  4G23 A;  3UIO C;  2VGE A;  4BET A;  2WQH A;  4ATG A;  4I43 A;  4Q94 A;  3CVU A;  1ELW A;  4HLL A;  2BF0 X;  3L82 A;  4K5C A;  3FTZ A;  2XEN A;  2ETB A;  4K0R A;  2AXV A;  4IYP A;  3TL5 A;  4MBG A;  1IHG A;  3TAX A;  2RFA A;  1U2V G;  3LEW A;  4W9R A;  4GMR A;  5A6C A;  3C72 A;  4HS2 A;  3UX4 A;  2LXL A;  3SNX A;  3D9I A;  3RU0 A;  3LYA A;  1AWC B;  3AG1 E;  4HI8 A;  2DWZ A;  4A63 B;  4GTS A;  4UWK A;  4HBD A;  1LD7 A;  3UXG A;  4APO A;  3U3W A;  3Q79 A;  1FVH A;  2X6I A;  1OCC E;  1X5B A;  3IHY A;  3DSV A;  1Z3Y A;  5BW8 C;  3J5P A;  3TJP A;  4CCA A;  4FAD A;  2Y1L E;  3T8K A;  3EJN A;  4NAC A;  3S7B A;  3CHM A;  3KSQ A;  3SZ7 A;  3FUJ A;  2CFZ A;  4OAU C;  2X6J A;  3DSU A;  3NB2 A;  2L0T B;  4CDM A;  3SQV A;  1S70 B;  4H7Y A;  4IN3 B;  3C98 A;  2KXP C;  3ZVV A;  3PDN A;  3Q5M A;  2H6I A;  1TYQ G;  5JHB A;  5JA4 D;  1N94 A;  2OVB A;  2DZO A;  3D3M A;  4CDR A;  3FUK A;  4HQD A;  1TEZ A;  2J8S D;  3MKQ A;  4N5Q A;  3ABL E;  4ILG A;  3PNL B;  3FWV A;  3ZYL A;  3QAQ A;  2KCL A;  3SGH A;  3GZ1 A;  4FP7 A;  1V55 E;  1HX8 A;  4B89 A;  3CLJ A;  3FU3 A;  2R2L A;  1S63 A;  3MZL B;  3UM1 A;  5G05 C;  1UW4 B;  1EF1 C;  3T8M A;  3WG7 E;  3DST A;  4V3I A;  1Y8M A;  4GYY A;  4JA9 A;  4FLB A;  4F6R D;  2DIW A;  3DPD A;  5BUZ A;  2UY1 B;  3ONK A;  3UIP C;  3ZXP A;  1TNO A;  3CKB A;  5EID A;  4AM9 A;  3SHF A;  5AYW D;  3U64 A;  4NIK A;  5JMN D;  3R7R A;  5JHA A;  4JEU A;  1OWM A;  1MHQ A;  3JYS A;  2IF4 A;  2ION A;  2FO7 A;  2WXF A;  3DRA A;  3V2O A;  5CMY A;  4AIF A;  5A7D B;  3FTU A;  2BED A;  1QZ2 A;  3FEY A;  3S2A A;  4G2V A;  2XPI A;  3L22 A;  2WVI A;  3G2U A;  4U8H A;  5BPP A;  2EIK E;  5ENP D;  2ZGD A;  3ZGQ A;  2P9L G;  3MCX A;  4J8E A;  1YMP A;  3QK0 A;  1INZ A;  4E85 A;  2IO2 C;  1TN6 A;  3ESK A;  4TV3 A;  2KBX A;  5FQ8 A;  3CR3 A;  1E8W A;  3G2W A;  1HS6 A;  4UQY A;  3MYV A;  3PS6 A;  4A3T A;  3RRU A;  3FUL A;  2E0I A;  4PUC A;  4DRX E;  5EYP F;  2AJA A;  4GZ5 A;  4XKC A;  3GZ2 A;  1OT8 A;  4JB8 P;  5JJ6 A;  2L6J A;  1QNF A;  2XEV A;  3TWQ A;  1BI7 B;  1E8Y A;  1WAO 1;  4UQZ A;  5FZQ A;  2XZT G;  2QYJ A;  1DVP A;  1PC2 A;  1ELR A;  5EX0 A;  2J4B A;  2FO1 E;  4M3O A;  1IXV A;  4BEP A;  4I9E A;  3KAE A;  3ZPJ A;  2R59 A;  3HHM A;  2F8Y A;  3ULE G;  3QWV A;  2J49 A;  1L5J A;  3UQ3 A;  2VYI A;  3IEG A;  1FCH A;  3C3O A;  2A4Z A;  2P9K G;  1FVF A;  2YHE A;  3R9M A;  3KSL A;  2LO6 A;  3QNK A;  5BT1 A;  4P29 A;  4EEC A;  3CVX A;  1K8K G;  1TNU A;  1Z6T A;  2GRO B;  4GML A;  2GW1 A;  5HKP A;  1QQE A;  4BT9 A;  3QB2 A;  4H7X A;  2WXM A;  3Q7F A;  4L2Y A;  4QQI A;  2KZT B;  3ZYM A;  4EZK A;  3T5X A;  4I9C A;  2HR2 A;  2EIJ E;  5AQ9 A;  3RSE G;  3CSF A;  4HXI A;  2DVW A;  4I6J A;  2B0O E;  4GTO A;  3HXC A;  5KJL A;  1LD8 A;  3OTN A;  1XGW A;  4GTM A;  3TWS A;  4MLP A;  3NQP A;  5CER B;  4C0E A;  2MYO A;  2UY1 A;  5D0O D;  3D9H A;  3PRE A;  2LAH A;  4AVX A;  3QOU A;  3ZIM A;  4HRN A;  3MV3 B;  5AQB A;  2P9I G;  3FUM A;  2QY7 A;  2OND A;  3RK6 A;  5E75 A;  5T4Y A;  4N5C A;  2I6H A;  3DWL G;  1FPP A;  3O4Z A;  2MOW A;  3U66 A;  3FUN A;  5CCM A;  3CK9 A;  4AY5 A;  2YHC A;  5AQA A;  4A1S A;  4OAV B;  3HXD A;  3Q9U C;  5M72 A;  3X2Q E;  4PS3 A;  3FTW A;  3ML8 A;  3ABK E;  2WQ6 A;  2J9Q A;  2OVF A;  4U07 A;  2WXG A;  3RKV A;  3UT7 A;  2NC9 A;  4N2Q A;  5G2N A;  2XS1 A;  4CYM D;  2LNI A;  2AWI A;  1KPS B;  1U3C A;  3E30 A;  2CHZ A;  4DX5 D;  2QFC A;  3FH8 A;  3FP3 A;  4F1S A;  1NA3 A;  4TXP A;  3DPY A;  2IOL A;  1E7U A;  2V0P A;  4FHK A;  3CQC B;  1HF8 A;  4HNA D;  3PRZ A;  3L08 A;  3UIN C;  5C2Y A;  4MKT A;  1JCQ A;  5FZS A;  1IKN D;  2XQ0 A;  2WXQ A;  3AS5 A;  4ZFH A;  3UT8 A;  2GRR B;  2YQ8 A;  4AEZ C;  2XCB A;  3EIQ C;  2P2C P;  2R5S A;  2OOE A;  4GA1 A;  2F8X K;  4G25 A;  2AXZ A;  3TWT A;  3ZEF A;  1LF8 A;  4U0U A;  4J8D A;  4J8Y A;  3ZKJ A;  1HE8 A;  2IQC A;  3D9K A;  4LCT A;  3ZNG A;  3LY9 A;  5EDS A;  1YYH A;  1TNZ A;  3UM0 A;  1E96 B;  1ZU2 A;  2VJ8 A;  2WXL A;  3FEX A;  3SO8 A;  4XZ4 A;  4U04 A;  4Q69 A;  2LXM A;  4EPZ A;  3FFL A;  3ASO E;  1JWF A;  5B3S E;  5A23 A;  1WM5 A;  1A17 A;  3AG2 E;  4G8L A;  3UUX A;  4AP2 A;  2EIN E;  1TN8 A;  2L9B A;  3RAU A;  4TXR A;  2WXN A;  4JD2 G;  1S64 A;  5D66 A;  3PH0 C;  3HVE B;  2PQN A;  1YA0 A;  4JA7 A;  3Q7A A;  4I17 A;  2YNQ A;  3ZW3 A;  1JCR A;  3RRN B;  1W3B A;  4B8C B;  3BUA A;  5EIB E;  3MX3 A;  4L2L A;  3PVL A;  1V54 E;  2Q7F A;  3QC1 A;  3CVP A;  4O1O A;  4I1O B;  3ZHE B;  4BSX A;  1OXJ A;  2BKG A;  3JUI A;  3E37 A;  3TGO A;  5AIJ A;  3EHR A;  2HE0 A;  2LAI A;  1HZ4 A;  3PUK A;  4EBA A;  5FQ6 A;  3G2T A;  3B7U X;  5J08 A;  4FUL A;  5FT9 A;  5FIO A;  3MV2 B;  3TWW A;  4M7C A;  1SA4 A;  2P9P G;  3ZUV B;  4QFV A;  4MS6 A;  3LDZ A;  4J0U A;  2KCV A;  4LSZ E;  2IU1 A;  4GTR A;  4B0Z A;  1OWN A;  2WXI A;  4BY6 A;  1D8D A;  1AP7 A;  4PDX A;  2IJG X;  3ZU7 B;  3FUH A;  3E32 A;  4YDW A;  4YDO A;  2PM6 A;  2WMO A;  1DCE A;  4LNU D;  3TWU A;  4K5B A;  3TWX A;  3B7T A;  1OUV A;  4WUY A;  1EDU A;  3EHQ A;  5G04 J;  1FT2 A;  3AG4 E;  5FQ7 A;  3QJZ A;  4KBQ A;  3TWV A;  3CQG B;  2KCK A;  3V2X A;  4DX7 D;  3ISM C;  3TG5 A;  3I4R B;  2XHE A;  2R05 A;  2P9N G;  3D9O A;  4J8S A;  4Q96 A;  3NOC D;  3SFX A;  2J08 A;  3W9F A;  1KZO A;  3FTS A;  2WXH A;  4U8V D;  1TR4 A;  4ANW A;  2V5Q C;  1PY1 A;  3CHP A;  3EDT B;  2DZN A;  3RIB A;  1H6O A;  3PNT B;  1MX4 A;  4ATZ D;  3S7D A;  4N3A A;  3ZXS A;  1VDY A;  4JPS A;  1HXI A;  5AJD A;  2XPY A;  2XEH A;  5B1A E;  1N54 A;  3LY7 A;  2NSZ A;  4DI3 A;  4GZ3 A;  2B6C A;  2WXJ A;  1IHB A;  4ILI A;  4TXQ A;  1MZC A;  1N52 A;  4UI9 J;  2A5U A;  4C9B B;  3J5Q B;  5ENS D;  5HQ8 A;  3JQ0 A;  4Z68 A;  4U96 D;  4GCN A;  4KT6 B;  2LSV A;  3DSW A;  5CEC B;  4BX8 A;  4HLE A;  4BT8 A;  4RSY A;  4K03 A;  5C1D A;  5T3R A;  2VQ2 A;  5ENO D;  4GCO A;  3L13 A;  3JXJ A;  2EIL E;  4HRL A;  4I6G A;  4JEH A;  3AU4 A;  2I9C A;  4AV7 A;  1WY6 A;  3BG0 B;  2A5E A;  5KWD A;  4ACK A;  3ZHE A;  3Q75 A;  4IRU A;  3S7J A;  5CED B;  3FH7 A;  3G2V A;  4EZJ A;  1TJC A;  4ZHB A;  1BPO A;  4JVS A;  1MYO A;  3KD7 A;  4F1P A;  5B1B E;  2WXP A;  1H2T C;  3IBE A;  3APF A;  4CT4 A;  4X8Q A;  3ESL A;  4I2Z A;  5ENR D;  4GPM A;  4XIF A;  2JAB A;  5G04 C;  4KVO A;  4DUI A;  3UKR G;  3EHN A;  1G3N B;  3AU5 A;  3HIZ A;  4OYS A;  4Y6W A;  4U0Z A;  1MQS A;  2J07 A;  3QAR A;  4GZ6 A;  4MRU A;  5KNH D;  2XZD G;  3T5V A;  4TRQ A;  2FI7 A;  1D8E A;  3NOG D;  4G11 A;  4DLO A;  5FTP A;  1N4P A;  2EQX A;  2CHW A;  3UMV A;  3MKR A;  1SW6 A;  5ITZ F;  2GRQ B;  3UM2 A;  1QYM A;  1UN9 A;  2ETC A;  3U4T A;  4YND A;  3SY2 A;  4GPK A;  1DNP A;  2IFU A;  3PE4 A;  4DPR A;  2DCP A;  1OWO A;  3ASH A;  4LNG A;  3TWR A;  3P1U A;  5CEA A;  2CHX A;  2H6F A;  3KEZ A;  4D10 C;  2BTD A;  1OCR E;  4OVV A;  2X6K A;  2Y4T A;  2ZIR A;  4WNG A;  4UI9 C;  3FUI A;  3PZD A;  5ARG A;  4GA2 A;  5CRV A;  2ZXW E;  4GYW A;  5D2M C;  4A3V A;  3NAW A;  2V5F A;  4RVB A;  3IXE A;  5KBA A;  4U95 D;  2IEJ A;  2QYU A;  2I2O A;  3CHQ A;  3D9M A;  4LRZ A;  4WWP A;  4RG9 A;  5AQ7 A;  3RO3 A;  2E2E A;  2UWJ G;  4BFR A;  4WNF A;  3FUE A;  1UN8 A;  5ENN A;  4XI9 A;  5AEN A;  1TJF A;  3LCA A;  3FHE A;  3RRM B;  4N3C A;  2KM4 A;  3K9I A;  3E33 A;  3OXL A;  4GTP A;  5T8I A;  4AOF A;  1NFI E;  4AY6 A;  1BI8 B;  2VTB B;  2RKK A;  2WM9 A;  4FLH A;  4LNB A;  3FH5 A;  5LOZ A;  3CIA A;  3ASD A;  1H0A A;  3AAA C;  4LG6 A;  3I3N A;  4R7L A;  4YDE A;  1H19 A;  2MRI A;  2YIN A;  3JQ1 A;  2IO3 C;  3LXU X;  3APC A;  2GRM A;  2OCC E;  2J4D A;  3T9K A;  4CDN A;  4PH4 B;  3C3Q A;  3ZFW A;  3CVQ A;  1NP7 A;  2PQR A;  4XI0 A;  4ANU A;  3SFY A;  4KXK B;  2VGX B;  3PE3 A;  3HXB A;  5FIN A;  4B93 B;  3SBT B;  3URZ A;  3JXI A;  1JPL A;  4U63 A;  2L0I A;  2WXO A;  4GZC A;  2HM8 A;  1FT1 A;  3VLE A;  1JUQ A;  3LJN A;  3CVN A;  3ZYQ A;  2MHK A;  3G2S A;  3Q47 B;  3HDX A;  1HFA A;  1KT0 A;  3S7F A;  4CZ2 D;  3L16 A;  3LJ3 A;  3ML9 A;  1D9S A;  2H6H A;  5FWQ A;  3HXE A;  3I5P A;  3ZN3 A;  1BU9 A;  5ENQ D;  3MGB A;  3JUE A;  2XGO A;  5KCM A;  2GRL A;  4HRM B;  5LFA A;  2I1J A;  1N4Q A;  5CMW A;  1N11 A;  1DC2 A;  3SF4 A;  3Q78 A;  4LUN U;  4BTA A;  3FUD A;  1XNF A;  4UWL A;  4CGV A;  4U8Y D;  4EQF A;  1KT1 A;  5FQ4 A;  3NZU A;  2X38 A;  3CV0 A;  1E8Z A;  1ZB1 A;  4JW1 A;  3B13 A;  4N39 A;  3DBS A;  3V30 A;  3MEK A;  2C0M A;  4NQ0 A;  2Y0B G;  4PS7 A;  4O1P A;  3BEE A;  3HG0 D;  4RLY A;  3CVY A;  2KZT A;  3QKY A;  5FJY A;  5BV1 A;  3SFZ A;  3MA5 A;  3B95 A;  2PL2 A;  2AXU A;  4U0S A;  4WND A;  3CVW A;  5D0Q D;  3ABM E;  3UPV A;  2CFU A;  1B89 A;  1IYG A;  1K3Z D;  4JZY A;  5LCW J;  4EBA G;  3LS8 A;  5ANL A;  3VTY A;  2ZU6 B;  4FHJ A;  3R9A B;  1DCQ A;  1QBQ A;  3BG1 B;  1SZ9 A;  2C2L A;  2JEK A;  2P9U G;  5EN5 D;  2RFM A;  2F37 A;  5J90 A;  4CEM A;  1O1S A;  4JHJ A;  4I1M A;  4FJZ A;  3D9L A;  3C5R A;  3V31 A;  2WPV A;  4DLQ A;  3VLF A;  4JXT A;  3DSX A;  2C0L A;  2VTB A;  3MJW A;  2ZGG A;  4BWR A;  3Q15 A;  1E8X A;  3BQO A;  3CHS A;  4KZC A;  2QZA A;  3KS2 A;  4AJW A;  4JC8 A;  4NRH B;  3ZRH A;  4BES A;  3V79 K;  3UI2 A;  3QWP A;  3Q4A B;  5LX8 A;  2V4L A;  5EYL A;  4CRW A;  3EHM A;  3U9W A;  4XEI G;  3E4B A;  2WB2 A;  3JCK C;  3PEV B;  3SBS A;  4WWN A;  2JLB A;  1RW2 A;  3IHV A;  2CG3 A;  3VLD A;  1MJ0 A;  4DI4 A;  3CST A;  3B7S A;  2AW6 A;  1WDY A;  2AVP A;  2ETA A;  3B7R L;  1OWP A;  2R17 C;  5HRY A;  1PAQ A;  5DBK A;  4TUM A;  4ANV A;  1SQM A;  4HOQ A;  4ABN A;  4G26 A;  3PZ2 A;  2VGX A;  1IQR A;  1EPU A;  5EIL A;  1KLX A;  2BUG A;  5KJK A;  4HI9 A;  1RZ4 A;  1N95 A;  4YVO A;  4O60 A;  1SZA A;  3GZS A;  5ENT D;  4NUR A;  4G8K A;  3N71 A;  4JL0 A;  5LP0 A;  2J09 A;  3DSS A;  4AXH A;  4HVB A;  3ASG A;  3ASF A;  1OCO E;  2OEW A;  5EKQ D;  2EIM E;  3DXK G;  4UUC A;  1N4S A;  5AJL A;  4JHR A;  4ILH B;  2HO1 A;  3NF1 A;  3FTY A;  1UOH A;  1TNY A;  3TXN A;  2L6B A;  2VSX E;  5G55 A;  3CHO A;  4JHK A;  4FU3 A;  4GYO A;  3OAW A;  5BXO A;  1MX2 A;  2XGS A;  4N3B A;  4GA0 A;  4U7E B;  3ULY A;  1HG2 A;  5CBO A;  2FUL A;  1UG3 A;  2IY0 C;  4FJY A;  3DEO A;  3PZ1 A;  1H2V C;  3LKU A;  4LEU A;  4DX1 A;  1HU3 A;  4XX5 A;  3IKO B;  3ZYK A;  3ONL A;  2ILR A;  4L7T A;  1Z3X A;  2NYJ A;  2WXK A;  3AS8 A;  3Q73 A;  3UM3 A;  3CVV A;  3CK7 A;  3AG3 E;  1BD8 A;  2X6F A;  4CGW A;  4YVQ C;  5LCW C;  3PEU B;  3HVE A;  2VSN A;  4A1G A;  4CT0 A;  3L17 A;  2KAT A;  4APF A;  3AS4 A;  4XKB A;  3PUJ A;  4HOR A;  3Q9N C;  3CKC A;  4L1B A;  2QC9 A;  2F0Y A;  4HOU A;  3QDN A;  3NBN B;  3LY8 A;  2IOS A;  4DK5 A;  1TN7 A;  2XEE A;  4WAF A;  1H2U A;  5CCL A;  3L9T A;  1N4R A;  1Q2Z A;  1OY3 D;  1E90 A;  4UWH A;  1N0Q A;  3APD A;  4K5A B;  1MX6 A;  5BNW A;  4B8A A;  5FZR A;  3OXG A;  4J7W A;  1SVX A;  1O5M A;  3P2B A;  2WXR A;  3D9P A;  4EZL A;  4KZ0 A;  3SD5 A;  4GTQ A;  1O1R A;  4J6I A;  1EYH A;  1SA5 A;  1WG0 A;  1NA0 A;  4J8F A;  3FUF A;  2HYZ A;  1S0P A;  3F6Q A;  2XGM A;  2V4H C;  1Y6I A;  1K1B A;  1BLX B;  4F7A A;  3HRA A;  4UI9 K;  3VTX A;  2I1K A;  4F53 A;  2FBN A;  1H6K A;  3CHR A;  3B7B A;  5JJ7 A;  3UTM A;  2XCC A;  3LVQ E;  1X81 A;  2H6G A;  4A55 A;  4C0M A;  2DYR E;  2DBA A;  3HYM B;  1IQU A;  3D9J A;  1TNB A;  1YCS B;  2XRZ A;  3O48 A;  3OXF A;  2RG8 A;  3CGH A;  4GU5 A;  5H7P A;  1H6P A;  2FEZ A;  3LPZ A;  4WNE A;  1NL4 A;  2Y3A A;  5HS0 A;  3FU0 A;  2GRP B;  3I4G A;  4BER A;  5KJN A;  4BX9 A;  3PZ4 A;  1O1T A;  4O6F A;  3ULQ A;  4ME2 A;  4BSZ B;  4ANX A;  4HOT A;  2R03 A;  3RJV A;  5KNG A;  4DX6 D;  2NXP A;  4GTV A;  4G1T A;  1U3D A;  2XRY A;  3IV0 A;  3EU9 A;  3DXM G;  4TUU A;  4GTT A;  2WQ7 A;  2Y69 E;  4DX2 A;  4RQI A;  3UKU G;  5BXU A;  3C3R A;  4I2W A;  5IY5 E;  1HH8 A;  4FA6 A;  4UWG A;  5AAR A;  5BV0 A;  5ARF A;  4I6E A;  5DIZ A;  2OEV A;  3GYZ A;  5AN8 A;  3WXX A;  1JCS A;  4IUL A;  1UJK A;  4DJA A;  4OVU A;  2V8S E;  1KZP A;  2PZI A;  4B94 A;  2VSO E;  1OCZ E;  2GGF A;  3ENE A;  4FC8 A;  2PM7 A;  2WMN A;  1HO8 A;  3GW4 A;  3R7Q A;  3DEP A;  4GMJ A;  3BU8 A;  3EU5 A;  4HFG A;  4URK A;  4KMO A;  3HXF A;  3NZS A;  2R02 A;  2PNN A;  2P58 C;  3EUV A;  2GRN B;  1GW6 A;  1JWG A;  3RO2 A;  3W9G A;  4BTB A;  4C48 B;  2LSU A;  3FDH A;  3SI5 A;  3KEA A;  2M63 A;  1UJJ A;  5E76 A;  2Y4U A;  3FTV A;  3E34 A;  4LER A; 
#chains in the Genus database with same CATH homology
 2VSY A;  5KJM A;  4DLQ A;  1E7V A;  2A4Z A;  3VLF A;  4JXT A;  1FVF A;  3FTX A;  5HQ8 A;  3JQ0 A;  2YHE A;  2C0L A;  4GCN A;  2VTB A;  2LO6 A;  4KT6 B;  3MJW A;  3QNK A;  5BT1 A;  2OV8 A;  4XE0 A;  4P29 A;  4EEC A;  4BWR A;  2LSV A;  3Q15 A;  3CVX A;  1E8X A;  3LVR E;  3TG4 A;  3CHS A;  1Z6T A;  4KZC A;  4GML A;  2GW1 A;  3KS2 A;  4AJW A;  2VGY A;  3FY4 A;  4JC8 A;  4NRH B;  5HI7 A;  3ZRH A;  4BX8 A;  1QQE A;  4BT9 A;  4HLE A;  1HG5 A;  4GZD A;  4BT8 A;  4RSY A;  3QWP A;  3QB2 A;  3Q4A B;  4H7X A;  2V4L A;  4K03 A;  5T3R A;  5C1D A;  4CRW A;  2VQ2 A;  5LX8 A;  4RG6 A;  3EHM A;  4ACL A;  3U9W A;  2WXM A;  3CVL A;  4GCO A;  3L13 A;  3E4B A;  4L2Y A;  1NZN A;  2WB2 A;  4I6G A;  4JEH A;  3FU6 A;  3JCK C;  2KZT B;  4UWF A;  3AU4 A;  2I9C A;  3Q49 B;  3ZYM A;  4EZK A;  3PEV B;  3SBS A;  4AV7 A;  4WWN A;  1WY6 A;  3MKQ B;  2JLB A;  3T5X A;  5JJT A;  3QWW A;  4I9C A;  3BG0 B;  3IHV A;  1ELK A;  2CG3 A;  2HR2 A;  3VLD A;  4DI4 A;  3CST A;  3B7S A;  2AW6 A;  4ACK A;  2AVP A;  3B7R L;  1OWP A;  4E6H A;  4N2S A;  2R17 C;  5ANR A;  4L23 A;  3ZHE A;  4KYO B;  3CSF A;  4HXI A;  1PAQ A;  5DBK A;  4I6J A;  3EIJ A;  4IRU A;  4ANV A;  3S7J A;  5KJL A;  1SQM A;  3OTN A;  4HOQ A;  3CEQ A;  4F3V A;  1XGW A;  4G24 A;  4ABN A;  4G26 A;  4HOS A;  3FH7 A;  3G2V A;  3FU5 A;  4MLP A;  2VGX A;  1P5Q A;  3NQP A;  4UQX A;  3TXM A;  4Y6C A;  1TJC A;  1IQR A;  3L6A A;  1EPU A;  2X3M A;  4EZJ A;  1BPO A;  4C0E A;  4GB9 A;  4PS8 A;  2UY1 A;  1KLX A;  5D0O D;  2BUG A;  4JVS A;  2KC7 A;  5KJK A;  3PRE A;  3KD7 A;  4I1A A;  4YVO A;  1SZA A;  2LAH A;  3GZS A;  4KVM A;  4NUR A;  4AVX A;  3L54 A;  3QOU A;  3N71 A;  3ZIM A;  5CHE E;  4WWO A;  4JL0 A;  4GAA A;  2X6H A;  2XPZ A;  2WXP A;  3MV3 B;  5LP0 A;  1H2T C;  2RD0 A;  3FUM A;  3IBE A;  2J09 A;  2QY7 A;  3CK8 A;  1OWL A;  2OND A;  3RK6 A;  5EX3 A;  3UT4 A;  5E75 A;  5G05 J;  4AXH A;  2CG2 A;  3APF A;  5T4Y A;  4HVB A;  4N5C A;  2I6H A;  3ASG A;  4CT4 A;  1ZBP A;  3ESL A;  4I2Z A;  3ASF A;  2FF4 A;  5EKQ D;  3O4Z A;  2MOW A;  5AJL A;  3U66 A;  3FUN A;  4XIF A;  5G04 C;  5CCM A;  3D9N A;  4G23 A;  4ILH B;  2HO1 A;  3CK9 A;  4JHR A;  4AY5 A;  3NF1 A;  4KVO A;  2YHC A;  2WQH A;  4A1S A;  4ATG A;  4I43 A;  4Q94 A;  3FTY A;  3TXN A;  3CVU A;  1ELW A;  2VSX E;  5G55 A;  3EHN A;  2BF0 X;  3CHO A;  5M72 A;  3AU5 A;  4PS3 A;  3HIZ A;  4OYS A;  4JHK A;  4Y6W A;  4FU3 A;  4GYO A;  3FTW A;  3ML8 A;  3OAW A;  4U0Z A;  1MQS A;  2J07 A;  2XGS A;  3FTZ A;  4N3B A;  3QAR A;  4GZ6 A;  4GA0 A;  4MRU A;  2WQ6 A;  2J9Q A;  4K0R A;  2OVF A;  4U07 A;  3T5V A;  1HG2 A;  2WXG A;  2FUL A;  1UG3 A;  2AXV A;  2FI7 A;  2NC9 A;  4TRQ A;  3RKV A;  4G11 A;  3UT7 A;  4DLO A;  4N2Q A;  5FTP A;  5G2N A;  2EQX A;  4FJY A;  4IYP A;  3TL5 A;  1H2V C;  1IHG A;  3LKU A;  4LEU A;  1HU3 A;  2LNI A;  2CHW A;  2AWI A;  3TAX A;  4XX5 A;  1U3C A;  2CHZ A;  3IKO B;  3UMV A;  3LEW A;  3MKR A;  4W9R A;  3ZYK A;  5A6C A;  3ONL A;  2ILR A;  2QFC A;  1UN9 A;  4HS2 A;  3FH8 A;  3UX4 A;  3U4T A;  3FP3 A;  4L7T A;  4F1S A;  1Z3X A;  1NA3 A;  2WXK A;  3AS8 A;  3SNX A;  4YND A;  3CVV A;  3CK7 A;  4GPK A;  1DNP A;  3D9I A;  2IOL A;  2IFU A;  3RU0 A;  2X6F A;  3LYA A;  1E7U A;  2V0P A;  4FHK A;  3CQC B;  3PE4 A;  2DCP A;  1HF8 A;  4DPR A;  4YVQ C;  4CGW A;  1OWO A;  5LCW C;  3PEU B;  3ASH A;  3HVE A;  2VSN A;  4A1G A;  3P1U A;  3PRZ A;  4CT0 A;  2CHX A;  2KAT A;  3L17 A;  3L08 A;  4APF A;  3AS4 A;  4XKB A;  3PUJ A;  3KEZ A;  4UWK A;  4HOR A;  3CKC A;  4D10 C;  4L1B A;  2BTD A;  5C2Y A;  4MKT A;  4APO A;  4HOU A;  3U3W A;  5FZS A;  3QDN A;  1FVH A;  2XQ0 A;  2WXQ A;  3AS5 A;  4OVV A;  2X6K A;  3LY8 A;  3UT8 A;  2X6I A;  2Y4T A;  1X5B A;  2YQ8 A;  3IHY A;  4AEZ C;  2IOS A;  4WNG A;  2XCB A;  1Z3Y A;  4DK5 A;  5BW8 C;  3EIQ C;  4UI9 C;  3TJP A;  3FUI A;  2R5S A;  2OOE A;  3PZD A;  5ARG A;  4CCA A;  4GA2 A;  4GA1 A;  4WAF A;  4FAD A;  1H2U A;  3EJN A;  4GYW A;  5CCL A;  4A3V A;  4G25 A;  4NAC A;  2AXZ A;  2V5F A;  4RVB A;  3S7B A;  3CHM A;  3ZEF A;  1LF8 A;  3SZ7 A;  3FUJ A;  2CFZ A;  4U0U A;  2I2O A;  3CHQ A;  1E90 A;  2X6J A;  4J8D A;  3D9M A;  4LRZ A;  4WWP A;  4UWH A;  3APD A;  1HE8 A;  4RG9 A;  2IQC A;  3RO3 A;  2E2E A;  2L0T B;  2UWJ G;  3D9K A;  4BFR A;  4LCT A;  4CDM A;  4WNF A;  3FUE A;  1UN8 A;  5BNW A;  5ENN A;  3LY9 A;  4B8A A;  4XI9 A;  5EDS A;  5FZR A;  3OXG A;  5AEN A;  3P2B A;  1E96 B;  2WXR A;  1ZU2 A;  2VJ8 A;  2WXL A;  3D9P A;  4H7Y A;  4EZL A;  1TJF A;  3FEX A;  3C98 A;  3LCA A;  4IN3 B;  3FHE A;  4KZ0 A;  3RRM B;  3SD5 A;  4N3C A;  3PDN A;  3ZVV A;  4XZ4 A;  2KM4 A;  4U04 A;  3K9I A;  3OXL A;  4Q69 A;  3Q5M A;  4J6I A;  5T8I A;  4EPZ A;  5JHB A;  1EYH A;  3FFL A;  1NA0 A;  1JWF A;  4AOF A;  4J8F A;  5A23 A;  1WM5 A;  3FUF A;  4AY6 A;  1A17 A;  2OVB A;  2HYZ A;  1S0P A;  2VTB B;  3UUX A;  4AP2 A;  2L9B A;  2XGM A;  3D3M A;  4CDR A;  3FUK A;  2WXN A;  2WM9 A;  1Y6I A;  4FLH A;  1TEZ A;  3FH5 A;  4F7A A;  3MKQ A;  5LOZ A;  3CIA A;  3ASD A;  4ILG A;  1H0A A;  4UI9 K;  3PH0 C;  2I1K A;  3VTX A;  4F53 A;  3PNL B;  2FBN A;  1H6K A;  3CHR A;  3FWV A;  3ZYL A;  3QAQ A;  3HVE B;  5JJ7 A;  2KCL A;  2PQN A;  2XCC A;  3LVQ E;  3SGH A;  1YA0 A;  4A55 A;  3I3N A;  4JA7 A;  3GZ1 A;  4I17 A;  2YNQ A;  3ZW3 A;  4R7L A;  4C0M A;  4FP7 A;  1H19 A;  3RRN B;  1W3B A;  2MRI A;  4B8C B;  2YIN A;  3JQ1 A;  1HX8 A;  4B89 A;  3MX3 A;  3LXU X;  3APC A;  2DBA A;  2GRM A;  4L2L A;  3PVL A;  3CLJ A;  3FU3 A;  3HYM B;  2Q7F A;  2J4D A;  3MZL B;  1IQU A;  4CDN A;  3D9J A;  4PH4 B;  2XRZ A;  3QC1 A;  3CVP A;  3O48 A;  3ZFW A;  3CVQ A;  1NP7 A;  3OXF A;  4I1O B;  5G05 C;  2RG8 A;  1UW4 B;  3CGH A;  1EF1 C;  2PQR A;  4GU5 A;  4XI0 A;  3T8M A;  3ZHE B;  4ANU A;  4BSX A;  3JUI A;  2FEZ A;  3LPZ A;  3TGO A;  4WNE A;  5AIJ A;  4V3I A;  2Y3A A;  2LAI A;  4KXK B;  1Y8M A;  1HZ4 A;  4GYY A;  3PUK A;  4EBA A;  2VGX B;  5FQ6 A;  3G2T A;  3B7U X;  3FU0 A;  4JA9 A;  3I4G A;  5J08 A;  4FLB A;  3PE3 A;  4FUL A;  2DIW A;  3DPD A;  5FT9 A;  4BX9 A;  4DJA A;  2UY1 B;  5BUZ A;  3ONK A;  5KJN A;  3CKB A;  4AM9 A;  3MV2 B;  4O6F A;  3SBT B;  3SHF A;  3ULQ A;  3URZ A;  5AYW D;  3U64 A;  3R7R A;  4ME2 A;  1JPL A;  4MS6 A;  2L0I A;  2WXO A;  4QFV A;  4U63 A;  4GZC A;  2HM8 A;  5JHA A;  3LDZ A;  4J0U A;  2KCV A;  4JEU A;  1JUQ A;  3VLE A;  1OWM A;  4ANX A;  4HOT A;  1MHQ A;  2IU1 A;  3JYS A;  4B0Z A;  2IF4 A;  3CVN A;  1OWN A;  3ZYQ A;  3RJV A;  2ION A;  2WXI A;  2FO7 A;  2MHK A;  3G2S A;  2WXF A;  3Q47 B;  2NXP A;  4BY6 A;  4G1T A;  3HDX A;  1HFA A;  1KT0 A;  5CMY A;  4AIF A;  3S7F A;  5A7D B;  3FTU A;  1QZ2 A;  3FEY A;  3L16 A;  3LJ3 A;  3S2A A;  1U3D A;  2XRY A;  3ML9 A;  4PDX A;  3IV0 A;  5FWQ A;  4G2V A;  2IJG X;  3FUH A;  3I5P A;  2XPI A;  3ZN3 A;  2PM6 A;  2WMO A;  3L22 A;  4TUU A;  2WVI A;  3G2U A;  2WQ7 A;  3MGB A;  4U8H A;  5BPP A;  2XGO A;  3B7T A;  5KCM A;  1OUV A;  4WUY A;  1EDU A;  2GRL A;  3ZGQ A;  5LFA A;  2I1J A;  4I2W A;  5G04 J;  3MCX A;  1HH8 A;  4J8E A;  4FA6 A;  5CMW A;  3SF4 A;  4UWG A;  5BV0 A;  3QK0 A;  5ARF A;  4LUN U;  4I6E A;  1INZ A;  5FQ7 A;  3FUD A;  3QJZ A;  5DIZ A;  4KBQ A;  4BTA A;  3CQG B;  1XNF A;  2KCK A;  4UWL A;  4E85 A;  4CGV A;  3ESK A;  4EQF A;  4TV3 A;  5FQ8 A;  3CR3 A;  1E8W A;  1KT1 A;  3G2W A;  5FQ4 A;  3NZU A;  2X38 A;  1HS6 A;  3CV0 A;  3GYZ A;  1E8Z A;  4JW1 A;  4UQY A;  3WXX A;  4IUL A;  1UJK A;  3B13 A;  3MYV A;  4N39 A;  3TG5 A;  3DBS A;  3I4R B;  3MEK A;  2C0M A;  3PS6 A;  4A3T A;  4OVU A;  4NQ0 A;  3RRU A;  4PS7 A;  2XHE A;  3FUL A;  2E0I A;  2V8S E;  4PUC A;  3D9O A;  4J8S A;  4Q96 A;  3BEE A;  2PZI A;  2J08 A;  4GZ5 A;  4B94 A;  3CVY A;  2VSO E;  4XKC A;  3GZ2 A;  2KZT A;  3FTS A;  2WXH A;  5JJ6 A;  2L6J A;  3QKY A;  1QNF A;  5FJY A;  5BV1 A;  2XEV A;  4ANW A;  2GGF A;  3ENE A;  4FC8 A;  1PY1 A;  2PM7 A;  2WMN A;  1HO8 A;  1E8Y A;  3GW4 A;  3SFZ A;  3MA5 A;  3R7Q A;  1WAO 1;  2AXU A;  2PL2 A;  3CHP A;  4U0S A;  4UQZ A;  3EDT B;  4WND A;  4GMJ A;  5FZQ A;  3CVW A;  5D0Q D;  3RIB A;  1DVP A;  1PC2 A;  1ELR A;  3PNT B;  3UPV A;  2CFU A;  4HFG A;  5EX0 A;  1B89 A;  4URK A;  3S7D A;  4KMO A;  1IYG A;  4N3A A;  3NZS A;  4JZY A;  2J4B A;  3ZXS A;  4EBA G;  5LCW J;  1VDY A;  2P58 C;  3LS8 A;  4M3O A;  1HXI A;  4JPS A;  5AJD A;  1GW6 A;  5ANL A;  2XPY A;  3VTY A;  2ZU6 B;  1JWG A;  4FHJ A;  3RO2 A;  3R9A B;  4I9E A;  3KAE A;  4BTB A;  1N54 A;  3ZPJ A;  2LSU A;  3LY7 A;  2NSZ A;  3BG1 B;  3FDH A;  1SZ9 A;  4GZ3 A;  4DI3 A;  2R59 A;  3HHM A;  3SI5 A;  2C2L A;  2JEK A;  2M63 A;  2WXJ A;  3QWV A;  4ILI A;  2J49 A;  1N52 A;  4UI9 J;  2A5U A;  1L5J A;  1UJJ A;  3UQ3 A;  4C9B B;  5J90 A;  4CEM A;  2VYI A;  3IEG A;  4JHJ A;  5E76 A;  1FCH A;  4I1M A;  4FJZ A;  3D9L A;  2Y4U A;  3FTV A;  2WPV A;  4LER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...