4ME2A

Crystal structure of tha8 protein from brachypodium distachyon
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
194
structure length
194
Chain Sequence
SLSTEAIHAVQALKRLTAADRSPPAATAAASAALGRLLRADLLAAMAELQRQGHWSLALAALHVARAEPWYRPDPELYATFVSSSPSNDPAAAAAVDALVEAFIEEKERGAAGGSSEGVWVGEDVYKLTRLVRALVAKGRARAAWRVYEAAVRKGGCEVDEYMYRVMAKGMKRLGLDEEAAEVEADLADWEARH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural basis for RNA recognition by a dimeric PPR-protein complex.
pubmed doi rcsb
source organism Brachypodium distachyon
molecule tags Rna binding protein
total genus 71
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2013-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4me2A00
2KATA 3PE4A 3LPZA 3IEGA 3AS5A 4GA2A 2AVPA 4N3BA 3LCAA 4UQYA 1IYGA 2R5SA 2XGSA 1HH8A 1WM5A 1E96B 4AY6A 5JJTA 3CK7A 4GYWA 2XGOA 4XIFA 2L6JA 3LY8A 4EQFA 3Q4AB 3OXGA 3UUXA 2KCLA 3VTYA 4CDRA 3ESKA 5LCWJ 1KLXA 1KT1A 2DBAA 3CEQA 3LYAA 4JHRA 2FBNA 1YA0A 2UY1A 2Q7FA 3ZPJA 5G05J 1XNFA 3TAXA 5CHEE 4HOUA 2VSNA 5FTPA 4GCOA 5KJMA 1W3BA 3S7BA 4UQXA 1KT0A 4H7XA 4HORA 2PL2A 5CCLA 3OXLA 4AIFA 3GW4A 3N71A 4KBQA 2QFCA 2YHCA 5KJKA 3SF4A 2OOEA 2LSVA 4I9EA 2IFUA 2C2LA 2LSUA 5LCWC 1QQEA 1NA0A 1ZBPA 3FP3A 3U4TA 2J9QA 1ELRA 5G05C 2HO1A 2VQ2A 2Y4TA 2V5FA 3CKCA 2XEVA 2VGYA 3RIBA 2Y4UA 4GA1A 4I9CA 4Y6CA 5BT1A 4J8EA 3BEEA 2XCBA 5AYWD 4U07A 3U3WA 1ZU2A 2FEZA 3Q47B 3UPVA 3LY7A 4N3AA 4I2WA 5BNWA 3GZ1A 2ONDA 4YNDA 3QDNA 1PC2A 4RG9A 4N2SA 2PQNA 3CVLA 3MEKA 3KS2A 5G04J 4GZ6A 3S7JA 4WNDA 4UI9J 3NF1A 3S7DA 2VYIA 3CK8A 1OUVA 3RJVA 2VGXB 3ASFA 3FWVA 2XCCA 5BW8C 5KJLA 4BTAA 5EX0A 3TG4A 1HXIA 4UQZA 4KYOB 3QKYA 3Q15A 3MA5A 4WNFA 4KXKB 3QWPA 5FZQA 5CCMA 1WAO1 4IN3B 3JYSA 3ZHEB 4G2VA 4BT9A 3AS4A 4GZ3A 3ZN3A 2VSYA 2E2EA 4CGWA 3TG5A 3FFLA 1NA3A 2KCKA 5M72A 2MHKA 3PDNA 2WPVA 5G04C 2BUGA 3RU0A 4UI9C 1HZ4A 2UWJG 5JJ7A 1NZNA 3QWVA 3TGOA 3K9IA 4U0SA 4NRHB 4JA7A 3CK9A 4G23A 3URZA 5FT9A 4G1TA 4I1AA 2VGXA 4NQ0A 2PQRA 4BT8A 4Y6WA 4O6FA 5D0QD 4BWRA 4J8FA 1TJCA 4YVOA 4N3CA 2FF4A 4N39A 3RKVA 2NC9A 3ASGA 2UY1B 2LNIA 3E4BA 4U0ZA 2WQHA 4J8DA 4H7YA 2PZIA 5ARGA 2C0LA 4ABNA 3UQ3A 4APOA 1QZ2A 5FZRA 3ASHA 3ZHEA 3QOUA 4J0UA 4U0UA 5EX3A 5A6CA 2FO7A 4G25A 5EKQD 1IHGA 4BTBA 2P58C 4B94A 2YQ8A 2XGMA 1B89A 3AS8A 4GCNA 3ASDA 1A17A 4HOSA 4WNGA 4G26A 3GZ2A 2C0MA 3PE3A 3R9AB 2IF4A 3KD7A 3MV3B 3HYMB 4XI0A 3RO2A 3LKUA 3CVNA 3KAEA 2I6HA 5DBKA 2HYZA 5FZSA 5KJNA 4CGVA 4F3VA 4XI9A 3MV2B 3S7FA 4AY5A 1FCHA 4LEUA 5ARFA 1Y8MA 3CVPA 3VTXA 2XPIA 3MKRA 5HQ8A 4W9RA 5C1DA 3ZFWA 3SZ7A 4GA0A 2KC7A 5JJ6A 3CKBA 5A7DB 1ELWA 4JA9A 4I2ZA 4WNEA 4UI9K 5DIZA 3Q5MA 4HOQA 4RG6A 5FJYA 4A1SA 3O48A 3CVQA 1P5QA 2JLBA 4GZ5A 2HR2A 4N5CA 4YVQC 3ZGQA 4JL0A 4ME2A 4GPKA 4N2QA 2GW1A 2KCVA 4G24A 4U04A 3QWWA 3ULQA 3RO3A 3CV0A 3Q49B 4GYOA 3GYZA 3OXFA 5HI7A 4I17A 3WXXA 4WUYA 4HOTA 3EDTB 4AM9A 2FI7A 3LY9A 5D0OD 4GYYA
chains in the Genus database with same CATH superfamily
3AU5A 4C0MA 4URKA 2VTBA 1MJ0A 1BLXB 4GA2A 4JZYA 4EBAA 5ENPD 2FO1E 2WXQA 3B13A 4F53A 2WMNA 3D9IA 1TNZA 4JC8A 2X6KA 3PUKA 4ANWA 2WXIA 2ZIRA 1HH8A 1DNPA 1EF1C 5C2YA 3LY8A 4FADA 4LUNU 5J90A 4L1BA 3Q4AB 4GTOA 1S70B 2KCLA 3VTYA 1JCSA 3U64A 4CDRA 4AOFA 5LCWJ 3UM0A 4JEHA 1JWGA 3CR3A 2XRYA 3CEQA 2P9UG 3LYAA 4LG6A 2X6IA 1YA0A 2UY1A 3SI5A 2H6GA 3TAXA 5BXOA 2I1JA 3J5PA 2ETAA 2WXJA 1W3BA 1E8WA 3DEOA 3ML9A 4GTRA 4H7XA 2ETBA 4J8YA 3UM1A 4HORA 2PL2A 1IKND 4K03A 3S2AA 3E30A 4B0ZA 4JHJA 4BY6A 4AIFA 3GW4A 5ENNA 4OAUC 2WXHA 3Q73A 3JCKC 1Y6IA 2QFCA 3TWUA 1K3ZD 3FEYA 1N9AA 3EHRA 4DX2A 2OOEA 2LSVA 4ATGA 4EBAG 5HRYA 4EZKA 5LCWC 1QQEA 3SHFA 5EILA 2H6FA 1ZBPA 1U3CA 1FVFA 1TR4A 2CHWA 3VLEA 4YDOA 4GTVA 4DI4A 3U4TA 3D9MA 3KSLA 2IOSA 4TRQA 3FUMA 3IKOB 2VQ2A 4BX8A 2DZOA 2OCCE 3DXMG 4GA1A 4Y6CA 4J8EA 3BEEA 4I1OB 2GRRB 4HFGA 5ANRA 3TJPA 4IRUA 4I2WA 3UT8A 3C3RA 3GZ1A 3KEAA 2R02A 3E37A 4I43A 4GZ6A 2OVFA 3NF1A 2J49A 3RJVA 3G2VA 2VGXB 3FWVA 5KJLA 3DBSA 2KBXA 4HBDA 1UN8A 4TUUA 3Q15A 1HG2A 5CECB 1PY1A 1BD8A 2VGEA 2GGFA 3JUIA 4DPRA 2IQCA 4JD2G 1WAO1 4RLYA 4GTSA 3ABKE 3ZRHA 2R17C 2IONA 4MS6A 3R7RA 3TWWA 1Z5SC 2E2EA 4F7AA 3I4GA 4JHKA 3TG5A 1NA3A 4RVBA 4ACKA 2MHKA 4LNUD 1E8XA 4P29A 3L9TA 3DEPA 3TGOA 3DSUA 2ZU6B 2CHXA 5JHAA 3ML8A 3B95A 2AXZA 3DSWA 1TNYA 3PZDA 4EECA 3DSXA 2EINE 4JB8P 5D0QD 3Q9NC 4A55A 3MZLB 4J8FA 3VLDA 2LAHA 2XQ0A 4N3CA 4KZ0A 2P9IG 4U0ZA 2WQHA 5ARGA 2NSZA 4CT4A 2J8SD 4FP7A 5FZRA 4J0UA 4U0UA 5EX3A 5A6CA 3AG2E 3TXNA 4M3OA 4GAAA 4UWLA 1HS6A 1IHGA 3L22A 3P2BA 2RFMA 3CLJA 4B94A 3ABLE 4GMLA 3SFYA 3R7QA 2GRLA 1B89A 2XEEA 3EIQC 1BU9A 4GCNA 3IHVA 2XZDG 4KVOA 3PEUB 2F0YA 2L0IA 5AQBA 3ZXPA 4TXQA 3QNKA 3JXJA 4LCTA 4L9PA 3MV3B 1K1AA 3HYMB 2R2LA 3MX3A 2GRMA 3KAEA 4OVVA 3T8KA 3FTUA 2I6HA 2HYZA 5LX8A 4XI9A 3B7UX 4GZCA 4TXRA 5ARFA 2VTBB 2BF0X 5KNHD 5FWQA 2OV8A 3Q7FA 4W9RA 3G2UA 2XENA 4K5CA 1HX8A 3CKBA 2OEWA 1DCQA 2V8SE 4I2ZA 1QBQA 1O1TA 2LXLA 5LP0A 4FJZA 4UI9K 2MOWA 4HI9A 4R7LA 2YNQA 3PNLB 3DRAA 1BPOA 3Q9UC 2HR2A 1N0RA 1N95A 3DXKG 4YVQC 3ZGQA 2QYJA 4ME2A 4C0EA 2F37A 2ZISA 3QB2A 3RO3A 3CV0A 3DPDA 1EPUA 3GYZA 3FU5A 3OXFA 3CHRA 4AEZC 5HI7A 4I17A 3DSTA 3WXXA 4WUYA 3L6AA 2WXNA 3DSSA 4FU3A 4AM9A 2LO6A 4HRMB 3HRAA 3UIPC 5D0OD 2KXPC 5AN8A 4GYYA 2PNNA 3MGBA 4IYPA 3PE4A 4U95D 4IULA 4C9BB 3LPZA 2YHEA 2WXPA 2WXKA 4HS2A 1H0AA 1TN7A 3CGHA 4GMRA 2JABA 4UWFA 1TN8A 5ENOD 5AAOA 2RFAA 1OWLA 4UQYA 3I5PA 2CFUA 1IYGA 5KWDA 3RRMB 5JJTA 1N0QA 3CK7A 4GYWA 2XGOA 4HLEA 4L2YA 3L82A 2AXUA 4EQFA 5AENA 3VLFA 4JW1A 1JUQA 2EILE 4DK5A 4YDYA 2FBNA 4LNBA 4A3TA 2Q7FA 2QZAA 3W9FA 5G05J 1TN6A 2VJ8A 3D9OA 2CG3A 5FINA 2V5QC 5FTPA 5KJMA 4I6GA 3HDXA 1HF8A 1KZOA 4UQXA 4AVXA 4D10C 1GW6A 2YINA 2WXRA 3RSEG 2XPYA 5CCLA 1K8KG 1FPPA 4DRXE 3N71A 3ENEA 1HO8A 2V4HC 2YHCA 2WB2A 3PZ4A 3SNXA 2I1KA 3T5XA 3KEZA 4DUIA 1N11A 5CEAA 3AG3E 4FHKA 4B89A 5G05C 2LAIA 3PREA 1ZB1A 3ZYLA 3APFA 4XZ4A 3FU6A 5CRUA 2EQXA 3RIBA 4I9CA 5BT1A 3NB2A 3EJNA 2XCBA 4G8KA 3FUFA 3U3WA 1ZU2A 3LS8A 2FEZA 3V31A 1IQUA 2LXMA 5T3RA 3LJNA 2X6HA 5CMWA 1O1SA 4GPMA 4N2SA 2PQNA 1E90A 4BX9A 3QC1A 5G04J 1LTXA 5FQ4A 4BERA 5G55A 4O60A 2XCCA 2WMOA 2XRZA 4KYOB 1X5BA 3CVVA 1HFAA 1WY6A 4KXKB 5CCMA 1NP7A 4JEUA 5ENTD 3D9KA 5AARA 3AS4A 1D8DA 1OCZE 3ZN3A 5CBNA 4CGWA 2WXOA 4ZHBA 2X6JA 3FFLA 1K1BA 3ZKJA 5G04C 1E8ZA 3RU0A 2IO3C 3P1UA 2GROB 2J4BA 2KZTA 3K9IA 3FDHA 4NRHB 4JA7A 1QYMA 4DX1A 3UTMA 4LRZA 3L16A 4I1AA 1DCEA 2L6BA 4L23A 4Z68A 3NBNB 4NQ0A 4PDXA 1N52A 5T4YA 5H7PA 2OVBA 3NQPA 3UMVA 1FT1A 3FULA 2FF4A 2MYOA 3ASGA 5LFAA 2LNIA 2HE0A 4B8CB 3ASOE 2DVWA 4H7YA 3RRNB 3FEXA 2DCPA 2Y69E 3D3MA 3MCXA 2BKKB 3GZSA 1KZPA 3ZHEA 3HXFA 2ZXWE 3UM3A 4FJYA 4GMJA 3BG0B 1Z3YA 3V2XA 2J08A 2IOLA 3C72A 1DVPA 2YQ8A 4A3VA 2J09A 3SY2A 2I2OA 4HRNA 4HOSA 4KZCA 1TNBA 4WNGA 2DIWA 3HG0D 2C0MA 4PH4B 5AIJA 3E34A 4UWKA 1H2TC 3LVRE 3KD7A 1N54A 3EU5A 1RW2A 4MLPA 3RRUA 4EZLA 5FZSA 4AV7A 1TYQG 3FU3A 4HLLA 4ILGA 4WAFA 4HI8A 3FH8A 1KPSB 3HIZA 2OEVA 4JVSA 3T8MA 3ZW3A 1Y8MA 1LF8A 5CRVA 4APFA 3SZ7A 2KC7A 5JJ6A 2KM4A 3FTZA 2AJAA 5A7DB 4Q94A 3TL5A 2RG8A 4TUMA 3V2OA 5EYLA 1TEZA 4RG6A 3ESLA 3F6QA 5FJYA 3ULYA 3O48A 2QYUA 3NZSA 1BI7B 2B6CA 3FUJA 4GZ5A 4KT6B 3TWQA 3ZYQA 4GPKA 5EIDA 3FTSA 1OWOA 3ULQA 3ZNGA 2V0PA 4PS3A 3ZVVA 2FULA 2XS8A 5BPPA 1MZCA 3V30A 4HOTA 3EDTB 4CCAA 3FU0A 2I9CA 2FI7A 3QJZA 3LY9A 1EDUA 1WDYA 3HXCA 3LVQE 3G2TA 4PS8A 3IEGA 3CHQA 1OWPA 1NI1A 3Q78A 3CHSA 3LCAA 4NIKA 1X81A 4V3IA 3SFZA 4N5QA 3PZ3A 5CMYA 5EDSA 4GTTA 1U2VG 4DLOA 2IO2C 2XGSA 1WM5A 2BEDA 3L08A 5B3SE 1UJJA 1OWMA 4XIFA 1FT2A 2L6JA 4CDNA 3TXMA 4F6RD 3EHMA 2WQ6A 3AJIA 1NFIE 3FUDA 2P9SG 1MX4A 1MYOA 3UKUG 1XNFA 1H6KA 5CHEE 2VSNA 5IY5E 4GCOA 4DX6D 2AXVA 3S7BA 1KT0A 1MQSA 3L54A 4GTMA 4CYMD 3APDA 3G2WA 4G8LA 1V55E 1N4QA 4KBQA 4HQDA 3CVUA 2C2LA 2PM6A 5BV1A 3HXEA 1INZA 3B7SA 3QAQA 1G3NB 3BG1B 2P2CP 1VDYA 4BFRA 4X8QA 3LXUX 3ONKA 1ELRA 2HO1A 4ILHB 2Y4TA 1H19A 2XEVA 3NOCD 4U63A 2M63A 1WG0A 4QFVA 3Q47B 1JPLA 3LY7A 2X3MA 2KZTB 3PNTB 3O4ZA 3SBTB 3FUIA 4YNDA 1E7VA 3QDNA 1PC2A 4KVMA 3MEKA 5T8IA 3IXEA 3SBSA 4UI9J 3S7DA 2AW6A 2VYIA 5AJLA 1E7UA 3HVEA 4B93B 3D9LA 4BEPA 3BQOA 3OAWA 4MBGA 3FTWA 1TJFA 4BTAA 3TG4A 3BUAA 3QKYA 3QWPA 5FZQA 1PAQA 3ZYKA 4U8VD 4CZ2D 3CHMA 3JYSA 1LD7A 3ZHEB 2P9KG 2WM9A 1TNOA 4G11A 3NZUA 4FULA 5D66A 2VSYA 4O1OA 1N4RA 4MRUA 3MYVA 4AXHA 3PDNA 3Q7AA 2WPVA 3PS6A 4UI9C 3CVWA 1HZ4A 3PEVB 2UWJG 5JJ7A 4FHJA 1NZNA 3CSFA 3TWRA 3QWVA 1BI8B 4E85A 4U0SA 2CFZA 4DJAA 4NURA 1NL4A 4AP2A 4DLQA 4G23A 3URZA 5FT9A 4HB5A 3FUNA 4GTQA 1XGWA 3L17A 2PQRA 4Y6WA 4UWHA 5D2MC 1FVHA 2RD0A 2MRIA 3RKVA 4N39A 2WXGA 3SD5A 3ZIMA 4O1PA 5AJDA 4J8SA 5FQ7A 2L9BA 4EHMA 5HS0A 1Q2ZA 2C0LA 3TWSA 2XHEA 3ULEG 3QARA 3CHPA 4APOA 1V54E 1OXJA 4U8HA 1HE8A 3WG7E 1RZ4A 2J4DA 2GRQB 3ASDA 3CVYA 1A17A 5AQ9A 1AWCB 3GZ2A 4HRLA 1H2UA 4WWPA 3PE3A 4CDMA 3R9AB 3UM2A 3EHQA 2VSOE 3UIOC 5CERB 5BUZA 2X6FA 2E0IA 3RK6A 5ITZF 2R59A 1MX6A 4MKTA 3MKQA 5KJNA 3Q79A 4CGVA 4F3VA 1JCRA 3NOGD 5JA4D 2DYSE 2IU1A 4DX5D 5FIOA 4YDWA 1H2VC 3CVPA 3JQ1A 3VTXA 4BESA 2XPIA 2WXFA 5HQ8A 1A5EA 1LD8A 4KMOA 4GA0A 4JA9A 3SGHA 2EIME 3CQCB 3B7TA 4ANUA 4ANXA 2IY0C 4HOQA 3UXGA 4I6JA 3CQGB 3T9KA 3U9WA 1JWFA 1SA4A 3TWXA 1P5QA 2J07A 4U96D 2JLBA 1O5MA 4N5CA 2DWZA 4N2QA 2GW1A 2XEHA 2KCVA 4G24A 3QWWA 4Q96A 4RSYA 3Q49B 4ZFHA 4EZJA 3W9GA 1S0PA 1D8EA 2XZTG 3JQ0A 2CHZA 2A5UA 3C98A 2WVIA 1Z3XA 5ENRD 3TWVA 2PM7A 4U8YD 2ILRA 2KATA 3QK0A 5ANLA 3AS5A 1SZAA 2A4ZA 2AVPA 2BTDA 4N3BA 3EUVA 2X38A 2R05A 5CBOA 3D9HA 4UUCA 4OYSA 2R5SA 3EU9A 2H6HA 1H6PA 1E96B 4AY6A 3D9NA 2GRNB 5EYPF 3FY4A 4FC8A 1QNFA 1UW4B 3C3QA 2P9NG 3AG1E 3OXGA 3HXDA 1MX2A 5B1AE 3UUXA 1UJKA 3PH0C 3ESKA 1KLXA 1YYHA 4WWOA 1KT1A 2DBAA 4TXPA 2DYRE 4K0RA 2IJGX 4JHRA 4LNGA 1H6OA 1TNUA 3DWLG 1D9SA 2EIKE 3ZPJA 5EN5D 1OCCE 3IV0A 3V79K 3FTXA 4HOUA 1YMPA 1N4SA 2BKGA 3PZ1A 3FTVA 1U3DA 3HVEB 3OXLA 3DPYA 4WWNA 5KJKA 3SF4A 3APCA 4LSZE 2XPZA 3FUEA 4FLHA 4I9EA 2IFUA 1N94A 1OCOE 5B1BE 1OWNA 3SFXA 2LSUA 5FQ8A 2Y1LE 5E75A 1NA0A 3FP3A 3ZUVB 2NXPA 4HNAD 2NYJA 3SQVA 4DX7D 3AG4E 2J9QA 1SVXA 2DZNA 5G2NA 4L2LA 3ABME 3FTYA 5JHBA 1HG5A 4F1PA 2V5FA 3CKCA 4CRWA 1N4PA 2VGYA 2Y4UA 2EIJE 3J5QB 5AYWD 4U07A 3UPVA 3BU8A 5HKPA 4N3AA 5BNWA 5CEDB 5BV0A 4CEMA 2ONDA 3ZEFA 3TWTA 4RG9A 4PUCA 2JEKA 3CVLA 4GU5A 3X2QE 3KS2A 4TV3A 5FQ6A 3S7JA 4WNDA 3CK8A 1OUVA 4JXTA 4ACLA 5AQAA 3AAAC 3E32A 4K5AB 3ASFA 3C5RA 5BW8C 5EX0A 1HXIA 2LUHA 3MJWA 4UQZA 1S64A 3DSVA 5KBAA 3MA5A 4WNFA 2VSXE 3FUHA 4LERA 1UG3A 5ENSD 4E6HA 4NACA 5KCMA 2F8YA 3E33A 4IN3B 2QY7A 4G2VA 4BT9A 3LEWA 4BSZB 4GZ3A 3ONLA 2CG2A 1HU3A 3CVXA 2WXMA 3FUKA 1SW6A 5AQ7A 2KCKA 2GRPB 5M72A 1IXVA 5EIBE 2BUGA 5KNGA 3CIAA 3OTNA 1O1RA 1YCSB 1ELKA 3HHMA 3UT7A 3UI2A 4QQIA 1SQMA 3IBEA 3CK9A 4B8AA 4ANVA 4GB9A 3I4RB 4A1GA 3ZU7B 2QC9A 3MKQB 4FLBA 2B0OE 3KSQA 2A5EA 2WXLA 1OCRE 4G1TA 2VGXA 2Y3AA 3CSTA 1AP7A 4K5BA 3AU4A 4BT8A 4O6FA 5E76A 3FHEA 4AJWA 5J08A 2P9LG 4BWRA 2ZGDA 1TJCA 4YVOA 3EHNA 2NC9A 3L13A 4XKBA 4GZDA 1UOHA 2AWIA 2UY1B 1Z6TA 3E4BA 4CT0A 4J8DA 1IHBA 2PZIA 3UINC 3PUJA 4ABNA 2H6IA 3UQ3A 1QZ2A 3UX4A 4GTPA 4XE0A 3ASHA 3B7RL 3QOUA 2FO7A 2WQ7A 4G25A 5EKQD 4BTBA 1E8YA 2P58C 2V4LA 1DC2A 4BETA 1EYHA 1OY3D 2XGMA 2IEJA 4HXIA 2P9PG 3FH5A 4UWGA 3AS8A 1L5JA 3PRZA 3JUEA 3PZ2A 3UKRG 3JXIA 3LJ3A 4Q69A 4DI3A 3ISMC 5ENQD 4C48B 4G26A 3C3OA 3D9JA 2IF4A 3ASNE 4OVUA 2HM8A 4XI0A 3RO2A 3LKUA 3CVNA 3NAWA 3LDZA 5DBKA 1MHQA 4PS7A 5JMND 3FH7A 2L0TB 4I1MA 3MV2B 4XX5A 1UN9A 3S7FA 1IQRA 2XS1A 4AY5A 2Y0BG 5A23A 1FCHA 4RQIA 4LEUA 2F8XK 2ETCA 4L7TA 5LOZA 4U7EB 3MKRA 3CHOA 5C1DA 3HXBA 1SZ9A 3B7BA 3ZFWA 2RKKA 4J7WA 1ELWA 3ZYMA 3T5VA 4F1SA 4WNEA 4OAVB 5DIZA 4J6IA 4ILIA 3Q5MA 4A1SA 3EIJA 4I6EA 3PVLA 4XEIG 4XKCA 3CVQA 1OT8A 3R9MA 1JCQA 4JL0A 4HVBA 3RAUA 3I3NA 2R03A 4U04A 3UT4A 4JPSA 4EPZA 4GYOA 5BXUA 4BSXA 3IHYA 3SO8A 4FA6A 4M7CA 3D9PA 3Q75A 1SA5A 1S63A 4YDEA 3U66A 4A63B 3ZXSA 4ATZD 2ZGGA 3G2SA
chains in the Genus database with same CATH topology
2KATA 3PE4A 3AU5A 4IULA 4C9BB 3LPZA 3LVQE 4C0MA 3G2TA 2YHEA 3QK0A 4URKA 5ANLA 2WXPA 4PS8A 2VTBA 3IEGA 2WXKA 3AS5A 4GA2A 4JZYA 3CHQA 1OWPA 1SZAA 4HS2A 4EBAA 1H0AA 2A4ZA 3CGHA 2AVPA 2BTDA 4N3BA 2WXQA 3CHSA 3LCAA 2X38A 4UWFA 4V3IA 3B13A 3SFZA 5CMYA 2WMNA 4F53A 5EDSA 3D9IA 4JC8A 4ANWA 2X6KA 1OWLA 3PUKA 4UQYA 2WXIA 3I5PA 2CFUA 4OYSA 4DLOA 1IYGA 2R5SA 2XGSA 1HH8A 1DNPA 1WM5A 1EF1C 1E96B 4AY6A 3L08A 3RRMB 5C2YA 5JJTA 3D9NA 3CK7A 1UJJA 1OWMA 4GYWA 2XGOA 4XIFA 2L6JA 4HLEA 4L2YA 3FY4A 3LY8A 4CDNA 4FC8A 1QNFA 1UW4B 4FADA 4LUNU 2AXUA 3TXMA 4EQFA 5J90A 4L1BA 3Q4AB 3OXGA 5AENA 3UUXA 2KCLA 3VTYA 3U64A 4CDRA 3EHMA 4AOFA 3VLFA 1UJKA 3PH0C 2WQ6A 3ESKA 5LCWJ 1KLXA 4JW1A 4WWOA 1KT1A 2DBAA 4JEHA 1JWGA 3CR3A 2XRYA 3CEQA 1JUQA 3FUDA 3LYAA 4K0RA 2IJGX 4DK5A 4JHRA 2X6IA 2FBNA 1YA0A 2UY1A 4A3TA 2Q7FA 3SI5A 3ZPJA 5G05J 1XNFA 1H6KA 3TAXA 2VJ8A 3IV0A 3D9OA 5CHEE 2I1JA 2CG3A 3FTXA 4HOUA 2VSNA 2WXJA 5FTPA 4GCOA 5KJMA 4I6GA 2AXVA 1W3BA 3HDXA 1HF8A 1E8WA 3S7BA 4UQXA 1KT0A 4AVXA 1MQSA 3L54A 3FTVA 1GW6A 1U3DA 2YINA 3ML9A 4H7XA 4D10C 2WXRA 3HVEB 2XPYA 4HORA 3APDA 2PL2A 5CCLA 4K03A 3S2AA 4B0ZA 4JHJA 3OXLA 4BY6A 4AIFA 3GW4A 5ENNA 3N71A 3ENEA 1HO8A 3G2WA 2WXHA 4WWNA 3JCKC 1Y6IA 4KBQA 2QFCA 2YHCA 5KJKA 2WB2A 3FEYA 3SF4A 2OOEA 3APCA 3SNXA 2LSVA 2XPZA 3FUEA 4FLHA 2IFUA 4I9EA 2I1KA 3CVUA 2C2LA 2PM6A 4ATGA 1OWNA 4EBAG 5BV1A 4EZKA 3T5XA 2LSUA 3KEZA 5LCWC 5FQ8A 1QQEA 3SHFA 1INZA 5E75A 3B7SA 3QAQA 1NA0A 1ZBPA 1U3CA 1FVFA 3FP3A 3BG1B 1VDYA 2NXPA 2CHWA 3VLEA 4BFRA 4DI4A 4FHKA 3U4TA 3D9MA 4B89A 2J9QA 3LXUX 3ONKA 1ELRA 5G05C 2LAIA 2IOSA 3PREA 2HO1A 4TRQA 5G2NA 4L2LA 4ILHB 3ZYLA 3APFA 3FUMA 3IKOB 4XZ4A 3FTYA 5JHBA 3FU6A 2VQ2A 4BX8A 1HG5A 2Y4TA 2V5FA 1H19A 2EQXA 2XEVA 2VGYA 3CKCA 4CRWA 3RIBA 2Y4UA 4GA1A 4I9CA 4Y6CA 5BT1A 4J8EA 3BEEA 3EJNA 2M63A 2XCBA 4U63A 5AYWD 3FUFA 4QFVA 4I1OB 4U07A 3U3WA 1ZU2A 3LS8A 2FEZA 3Q47B 1JPLA 4HFGA 3UPVA 1IQUA 3LY7A 5ANRA 5T3RA 4IRUA 4I2WA 4N3AA 3TJPA 5BNWA 2X3MA 2KZTB 3UT8A 3PNTB 3O4ZA 3SBTB 5BV0A 3GZ1A 4CEMA 3FUIA 2ONDA 2X6HA 4YNDA 1E7VA 3QDNA 3ZEFA 1PC2A 5CMWA 4RG9A 4N2SA 4PUCA 2PQNA 2JEKA 4KVMA 4I43A 3CVLA 1E90A 4GU5A 4BX9A 3MEKA 5T8IA 3KS2A 3QC1A 4GZ6A 5G04J 4TV3A 5FQ6A 3S7JA 3SBSA 4WNDA 2OVFA 4UI9J 5FQ4A 3NF1A 3S7DA 2AW6A 2J49A 2VYIA 3CK8A 1E7UA 1OUVA 3G2VA 4JXTA 3HVEA 5AJLA 3RJVA 4ACLA 2VGXB 3ASFA 3FWVA 3D9LA 5G55A 3OAWA 2XCCA 5BW8C 5KJLA 3FTWA 2WMOA 1TJFA 2XRZA 5EX0A 3TG4A 1HXIA 3DBSA 3MJWA 4BTAA 4UQZA 4KYOB 1UN8A 1X5BA 3CVVA 1HFAA 3QKYA 4TUUA 1WY6A 3MA5A 3Q15A 1HG2A 4WNFA 4KXKB 2VSXE 1PY1A 3FUHA 3QWPA 5FZQA 5CCMA 1PAQA 4LERA 3ZYKA 1UG3A 1NP7A 4E6HA 4NACA 2GGFA 3JUIA 4JEUA 4DPRA 3D9KA 5KCMA 2IQCA 1WAO1 4IN3B 3CHMA 3JYSA 3ZHEB 2QY7A 4G2VA 4BT9A 3AS4A 3ZRHA 2WM9A 3LEWA 2R17C 2IONA 4MS6A 4GZ3A 3R7RA 4G11A 3NZUA 4FULA 3ONLA 3ZN3A 2CG2A 2VSYA 1HU3A 2E2EA 3I4GA 4F7AA 2WXMA 4CGWA 2WXOA 3FUKA 4JHKA 2X6JA 3CVXA 3FFLA 1NA3A 3TG5A 2KCKA 4MRUA 4RVBA 3MYVA 4ACKA 4AXHA 5M72A 2MHKA 3PDNA 2WPVA 5G04C 1E8ZA 2BUGA 3RU0A 3PS6A 4UI9C 3CVWA 1HZ4A 3CIAA 3P1UA 3PEVB 2UWJG 1E8XA 3OTNA 5JJ7A 4P29A 4FHJA 2J4BA 1ELKA 1NZNA 3CSFA 3QWVA 3HHMA 3TGOA 2KZTA 3K9IA 2ZU6B 4E85A 4U0SA 3UT7A 2CHXA 5JHAA 3ML8A 3FDHA 2CFZA 4NRHB 4DJAA 1SQMA 3IBEA 4JA7A 3CK9A 4NURA 4B8AA 2AXZA 4ANVA 4GB9A 4AP2A 4DLQA 4G23A 3I4RB 3URZA 4A1GA 3MKQB 4FLBA 3PZDA 2WXLA 4EECA 5FT9A 4LRZA 3L16A 4G1TA 4I1AA 4L23A 2VGXA 2Y3AA 3CSTA 3FUNA 1XGWA 3L17A 4NQ0A 1N52A 4PDXA 5T4YA 3AU4A 2OVBA 2PQRA 4BT8A 4Y6WA 4O6FA 5E76A 3FHEA 4AJWA 3NQPA 5J08A 4UWHA 5D0QD 3UMVA 1FVHA 4A55A 2RD0A 3MZLB 4J8FA 3FULA 3VLDA 4BWRA 2LAHA 1TJCA 2MRIA 4YVOA 2XQ0A 4N3CA 2FF4A 3EHNA 4N39A 2NC9A 3RKVA 3L13A 4XKBA 4GZDA 4KZ0A 2AWIA 3ASGA 2UY1B 2LNIA 5LFAA 1Z6TA 2WXGA 3E4BA 3SD5A 4B8CB 4U0ZA 3ZIMA 5AJDA 4CT0A 2WQHA 4J8DA 2L9BA 4H7YA 4J8SA 3FEXA 5FQ7A 3RRNB 2PZIA 5ARGA 2NSZA 4CT4A 2DCPA 2C0LA 3D3MA 2XHEA 3PUJA 4ABNA 3MCXA 3QARA 3UQ3A 3CHPA 4APOA 1QZ2A 3GZSA 4FP7A 4XE0A 5FZRA 3UX4A 3ASHA 3ZHEA 3B7RL 3QOUA 4J0UA 4U0UA 5EX3A 5A6CA 2FO7A 4FJYA 4GMJA 3TXNA 3BG0B 2WQ7A 1Z3YA 4U8HA 1HE8A 2J08A 4G25A 4M3OA 4GAAA 4UWLA 5EKQD 1HS6A 1IHGA 4BTBA 1E8YA 3L22A 3P2BA 2P58C 3CLJA 2V4LA 4B94A 4GMLA 2IOLA 1DVPA 2GRLA 1EYHA 2YQ8A 3R7QA 2XGMA 2J4DA 2J09A 4A3VA 4HXIA 1B89A 3EIQC 3FH5A 4UWGA 3AS8A 4GCNA 1L5JA 3ASDA 3CVYA 3PRZA 3IHVA 2I2OA 3LJ3A 4Q69A 4DI3A 1A17A 4KVOA 4HOSA 4KZCA 3PEUB 4WNGA 4G26A 3GZ2A 2DIWA 1H2UA 2L0IA 2C0MA 4PH4B 4WWPA 3PE3A 4CDMA 3QNKA 5AIJA 3R9AB 3D9JA 2IF4A 4UWKA 1H2TC 3LVRE 4LCTA 4OVUA 2VSOE 3KD7A 3MV3B 2HM8A 3HYMB 1N54A 3MX3A 4XI0A 3RO2A 2GRMA 3LKUA 3CVNA 3KAEA 4OVVA 3FTUA 5BUZA 2X6FA 2E0IA 2I6HA 4MLPA 3LDZA 5DBKA 3RK6A 3RRUA 2R59A 2HYZA 4MKTA 1MHQA 4EZLA 4PS7A 5LX8A 3MKQA 5FZSA 5KJNA 4AV7A 4CGVA 3FU3A 3FH7A 4F3VA 2L0TB 4XI9A 4I1MA 3MV2B 3B7UX 4GZCA 1UN9A 4ILGA 4XX5A 3S7FA 1IQRA 2IU1A 4WAFA 4AY5A 5A23A 1FCHA 3FH8A 4LEUA 1H2VC 3HIZA 4JVSA 3T8MA 3ZW3A 5ARFA 1Y8MA 2VTBB 3CVPA 2BF0X 3JQ1A 4L7TA 5LOZA 3VTXA 2XPIA 5FWQA 2OV8A 2WXFA 1LF8A 3MKRA 5HQ8A 3CHOA 4W9RA 4APFA 5C1DA 1SZ9A 3ZFWA 3G2UA 4KMOA 3SZ7A 4GA0A 2KC7A 5JJ6A 1HX8A 2KM4A 3FTZA 3CKBA 5A7DB 1ELWA 2V8SE 4JA9A 3SGHA 4I2ZA 4Q94A 3TL5A 3ZYMA 3CQCB 3T5VA 4F1SA 2RG8A 5LP0A 4WNEA 4FJZA 4UI9K 3B7TA 4ANUA 4ANXA 5DIZA 4J6IA 4ILIA 1TEZA 3Q5MA 2MOWA 4HOQA 4RG6A 4I6JA 3ESLA 3CQGB 5FJYA 3U9WA 4A1SA 3EIJA 4R7LA 1JWFA 3O48A 4I6EA 3PVLA 4XKCA 3CVQA 2YNQA 3NZSA 3PNLB 1P5QA 2J07A 3FUJA 1BPOA 2JLBA 2HR2A 4GZ5A 4N5CA 4KT6B 4YVQC 3ZGQA 4JL0A 4HVBA 3I3NA 3ZYQA 4ME2A 4C0EA 4GPKA 4N2QA 2GW1A 2KCVA 4G24A 3FTSA 4U04A 1OWOA 3QWWA 3ULQA 3UT4A 3QB2A 3RO3A 4JPSA 2V0PA 4Q96A 3CV0A 3DPDA 4RSYA 1EPUA 3Q49B 4EPZA 4GYOA 3GYZA 3FU5A 3OXFA 4BSXA 3CHRA 4PS3A 3ZVVA 3IHYA 4EZJA 2FULA 5HI7A 4AEZC 4I17A 5BPPA 3WXXA 4FA6A 1S0PA 3D9PA 4WUYA 4HOTA 3EDTB 3L6AA 2WXNA 4CCAA 3FU0A 2CHZA 3JQ0A 2A5UA 4FU3A 4AM9A 2I9CA 2LO6A 3C98A 3U66A 2FI7A 2WVIA 1Z3XA 3QJZA 3LY9A 5D0OD 3ZXSA 1EDUA 4GYYA 2PM7A 3G2SA 3MGBA 2ILRA 4IYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KAT A;  3PE4 A;  3LPZ A;  3IEG A;  3AS5 A;  4GA2 A;  2AVP A;  4N3B A;  3LCA A;  4UQY A;  1IYG A;  2R5S A;  2XGS A;  1HH8 A;  1WM5 A;  1E96 B;  4AY6 A;  5JJT A;  3CK7 A;  4GYW A;  2XGO A;  4XIF A;  2L6J A;  3LY8 A;  4EQF A;  3Q4A B;  3OXG A;  3UUX A;  2KCL A;  3VTY A;  4CDR A;  3ESK A;  5LCW J;  1KLX A;  1KT1 A;  2DBA A;  3CEQ A;  3LYA A;  4JHR A;  2FBN A;  1YA0 A;  2UY1 A;  2Q7F A;  3ZPJ A;  5G05 J;  1XNF A;  3TAX A;  5CHE E;  4HOU A;  2VSN A;  5FTP A;  4GCO A;  5KJM A;  1W3B A;  3S7B A;  4UQX A;  1KT0 A;  4H7X A;  4HOR A;  2PL2 A;  5CCL A;  3OXL A;  4AIF A;  3GW4 A;  3N71 A;  4KBQ A;  2QFC A;  2YHC A;  5KJK A;  3SF4 A;  2OOE A;  2LSV A;  4I9E A;  2IFU A;  2C2L A;  2LSU A;  5LCW C;  1QQE A;  1NA0 A;  1ZBP A;  3FP3 A;  3U4T A;  2J9Q A;  1ELR A;  5G05 C;  2HO1 A;  2VQ2 A;  2Y4T A;  2V5F A;  3CKC A;  2XEV A;  2VGY A;  3RIB A;  2Y4U A;  4GA1 A;  4I9C A;  4Y6C A;  5BT1 A;  4J8E A;  3BEE A;  2XCB A;  5AYW D;  4U07 A;  3U3W A;  1ZU2 A;  2FEZ A;  3Q47 B;  3UPV A;  3LY7 A;  4N3A A;  4I2W A;  5BNW A;  3GZ1 A;  2OND A;  4YND A;  3QDN A;  1PC2 A;  4RG9 A;  4N2S A;  2PQN A;  3CVL A;  3MEK A;  3KS2 A;  5G04 J;  4GZ6 A;  3S7J A;  4WND A;  4UI9 J;  3NF1 A;  3S7D A;  2VYI A;  3CK8 A;  1OUV A;  3RJV A;  2VGX B;  3ASF A;  3FWV A;  2XCC A;  5BW8 C;  5KJL A;  4BTA A;  5EX0 A;  3TG4 A;  1HXI A;  4UQZ A;  4KYO B;  3QKY A;  3Q15 A;  3MA5 A;  4WNF A;  4KXK B;  3QWP A;  5FZQ A;  5CCM A;  1WAO 1;  4IN3 B;  3JYS A;  3ZHE B;  4G2V A;  4BT9 A;  3AS4 A;  4GZ3 A;  3ZN3 A;  2VSY A;  2E2E A;  4CGW A;  3TG5 A;  3FFL A;  1NA3 A;  2KCK A;  5M72 A;  2MHK A;  3PDN A;  2WPV A;  5G04 C;  2BUG A;  3RU0 A;  4UI9 C;  1HZ4 A;  2UWJ G;  5JJ7 A;  1NZN A;  3QWV A;  3TGO A;  3K9I A;  4U0S A;  4NRH B;  4JA7 A;  3CK9 A;  4G23 A;  3URZ A;  5FT9 A;  4G1T A;  4I1A A;  2VGX A;  4NQ0 A;  2PQR A;  4BT8 A;  4Y6W A;  4O6F A;  5D0Q D;  4BWR A;  4J8F A;  1TJC A;  4YVO A;  4N3C A;  2FF4 A;  4N39 A;  3RKV A;  2NC9 A;  3ASG A;  2UY1 B;  2LNI A;  3E4B A;  4U0Z A;  2WQH A;  4J8D A;  4H7Y A;  2PZI A;  5ARG A;  2C0L A;  4ABN A;  3UQ3 A;  4APO A;  1QZ2 A;  5FZR A;  3ASH A;  3ZHE A;  3QOU A;  4J0U A;  4U0U A;  5EX3 A;  5A6C A;  2FO7 A;  4G25 A;  5EKQ D;  1IHG A;  4BTB A;  2P58 C;  4B94 A;  2YQ8 A;  2XGM A;  1B89 A;  3AS8 A;  4GCN A;  3ASD A;  1A17 A;  4HOS A;  4WNG A;  4G26 A;  3GZ2 A;  2C0M A;  3PE3 A;  3R9A B;  2IF4 A;  3KD7 A;  3MV3 B;  3HYM B;  4XI0 A;  3RO2 A;  3LKU A;  3CVN A;  3KAE A;  2I6H A;  5DBK A;  2HYZ A;  5FZS A;  5KJN A;  4CGV A;  4F3V A;  4XI9 A;  3MV2 B;  3S7F A;  4AY5 A;  1FCH A;  4LEU A;  5ARF A;  1Y8M A;  3CVP A;  3VTX A;  2XPI A;  3MKR A;  5HQ8 A;  4W9R A;  5C1D A;  3ZFW A;  3SZ7 A;  4GA0 A;  2KC7 A;  5JJ6 A;  3CKB A;  5A7D B;  1ELW A;  4JA9 A;  4I2Z A;  4WNE A;  4UI9 K;  5DIZ A;  3Q5M A;  4HOQ A;  4RG6 A;  5FJY A;  4A1S A;  3O48 A;  3CVQ A;  1P5Q A;  2JLB A;  4GZ5 A;  2HR2 A;  4N5C A;  4YVQ C;  3ZGQ A;  4JL0 A;  4ME2 A;  4GPK A;  4N2Q A;  2GW1 A;  2KCV A;  4G24 A;  4U04 A;  3QWW A;  3ULQ A;  3RO3 A;  3CV0 A;  3Q49 B;  4GYO A;  3GYZ A;  3OXF A;  5HI7 A;  4I17 A;  3WXX A;  4WUY A;  4HOT A;  3EDT B;  4AM9 A;  2FI7 A;  3LY9 A;  5D0O D;  4GYY A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  4C0M A;  4URK A;  2VTB A;  1MJ0 A;  1BLX B;  4GA2 A;  4JZY A;  4EBA A;  5ENP D;  2FO1 E;  2WXQ A;  3B13 A;  4F53 A;  2WMN A;  3D9I A;  1TNZ A;  4JC8 A;  2X6K A;  3PUK A;  4ANW A;  2WXI A;  2ZIR A;  1HH8 A;  1DNP A;  1EF1 C;  5C2Y A;  3LY8 A;  4FAD A;  4LUN U;  5J90 A;  4L1B A;  3Q4A B;  4GTO A;  1S70 B;  2KCL A;  3VTY A;  1JCS A;  3U64 A;  4CDR A;  4AOF A;  5LCW J;  3UM0 A;  4JEH A;  1JWG A;  3CR3 A;  2XRY A;  3CEQ A;  2P9U G;  3LYA A;  4LG6 A;  2X6I A;  1YA0 A;  2UY1 A;  3SI5 A;  2H6G A;  3TAX A;  5BXO A;  2I1J A;  3J5P A;  2ETA A;  2WXJ A;  1W3B A;  1E8W A;  3DEO A;  3ML9 A;  4GTR A;  4H7X A;  2ETB A;  4J8Y A;  3UM1 A;  4HOR A;  2PL2 A;  1IKN D;  4K03 A;  3S2A A;  3E30 A;  4B0Z A;  4JHJ A;  4BY6 A;  4AIF A;  3GW4 A;  5ENN A;  4OAU C;  2WXH A;  3Q73 A;  3JCK C;  1Y6I A;  2QFC A;  3TWU A;  1K3Z D;  3FEY A;  1N9A A;  3EHR A;  4DX2 A;  2OOE A;  2LSV A;  4ATG A;  4EBA G;  5HRY A;  4EZK A;  5LCW C;  1QQE A;  3SHF A;  5EIL A;  2H6F A;  1ZBP A;  1U3C A;  1FVF A;  1TR4 A;  2CHW A;  3VLE A;  4YDO A;  4GTV A;  4DI4 A;  3U4T A;  3D9M A;  3KSL A;  2IOS A;  4TRQ A;  3FUM A;  3IKO B;  2VQ2 A;  4BX8 A;  2DZO A;  2OCC E;  3DXM G;  4GA1 A;  4Y6C A;  4J8E A;  3BEE A;  4I1O B;  2GRR B;  4HFG A;  5ANR A;  3TJP A;  4IRU A;  4I2W A;  3UT8 A;  3C3R A;  3GZ1 A;  3KEA A;  2R02 A;  3E37 A;  4I43 A;  4GZ6 A;  2OVF A;  3NF1 A;  2J49 A;  3RJV A;  3G2V A;  2VGX B;  3FWV A;  5KJL A;  3DBS A;  2KBX A;  4HBD A;  1UN8 A;  4TUU A;  3Q15 A;  1HG2 A;  5CEC B;  1PY1 A;  1BD8 A;  2VGE A;  2GGF A;  3JUI A;  4DPR A;  2IQC A;  4JD2 G;  1WAO 1;  4RLY A;  4GTS A;  3ABK E;  3ZRH A;  2R17 C;  2ION A;  4MS6 A;  3R7R A;  3TWW A;  1Z5S C;  2E2E A;  4F7A A;  3I4G A;  4JHK A;  3TG5 A;  1NA3 A;  4RVB A;  4ACK A;  2MHK A;  4LNU D;  1E8X A;  4P29 A;  3L9T A;  3DEP A;  3TGO A;  3DSU A;  2ZU6 B;  2CHX A;  5JHA A;  3ML8 A;  3B95 A;  2AXZ A;  3DSW A;  1TNY A;  3PZD A;  4EEC A;  3DSX A;  2EIN E;  4JB8 P;  5D0Q D;  3Q9N C;  4A55 A;  3MZL B;  4J8F A;  3VLD A;  2LAH A;  2XQ0 A;  4N3C A;  4KZ0 A;  2P9I G;  4U0Z A;  2WQH A;  5ARG A;  2NSZ A;  4CT4 A;  2J8S D;  4FP7 A;  5FZR A;  4J0U A;  4U0U A;  5EX3 A;  5A6C A;  3AG2 E;  3TXN A;  4M3O A;  4GAA A;  4UWL A;  1HS6 A;  1IHG A;  3L22 A;  3P2B A;  2RFM A;  3CLJ A;  4B94 A;  3ABL E;  4GML A;  3SFY A;  3R7Q A;  2GRL A;  1B89 A;  2XEE A;  3EIQ C;  1BU9 A;  4GCN A;  3IHV A;  2XZD G;  4KVO A;  3PEU B;  2F0Y A;  2L0I A;  5AQB A;  3ZXP A;  4TXQ A;  3QNK A;  3JXJ A;  4LCT A;  4L9P A;  3MV3 B;  1K1A A;  3HYM B;  2R2L A;  3MX3 A;  2GRM A;  3KAE A;  4OVV A;  3T8K A;  3FTU A;  2I6H A;  2HYZ A;  5LX8 A;  4XI9 A;  3B7U X;  4GZC A;  4TXR A;  5ARF A;  2VTB B;  2BF0 X;  5KNH D;  5FWQ A;  2OV8 A;  3Q7F A;  4W9R A;  3G2U A;  2XEN A;  4K5C A;  1HX8 A;  3CKB A;  2OEW A;  1DCQ A;  2V8S E;  4I2Z A;  1QBQ A;  1O1T A;  2LXL A;  5LP0 A;  4FJZ A;  4UI9 K;  2MOW A;  4HI9 A;  4R7L A;  2YNQ A;  3PNL B;  3DRA A;  1BPO A;  3Q9U C;  2HR2 A;  1N0R A;  1N95 A;  3DXK G;  4YVQ C;  3ZGQ A;  2QYJ A;  4ME2 A;  4C0E A;  2F37 A;  2ZIS A;  3QB2 A;  3RO3 A;  3CV0 A;  3DPD A;  1EPU A;  3GYZ A;  3FU5 A;  3OXF A;  3CHR A;  4AEZ C;  5HI7 A;  4I17 A;  3DST A;  3WXX A;  4WUY A;  3L6A A;  2WXN A;  3DSS A;  4FU3 A;  4AM9 A;  2LO6 A;  4HRM B;  3HRA A;  3UIP C;  5D0O D;  2KXP C;  5AN8 A;  4GYY A;  2PNN A;  3MGB A;  4IYP A;  3PE4 A;  4U95 D;  4IUL A;  4C9B B;  3LPZ A;  2YHE A;  2WXP A;  2WXK A;  4HS2 A;  1H0A A;  1TN7 A;  3CGH A;  4GMR A;  2JAB A;  4UWF A;  1TN8 A;  5ENO D;  5AAO A;  2RFA A;  1OWL A;  4UQY A;  3I5P A;  2CFU A;  1IYG A;  5KWD A;  3RRM B;  5JJT A;  1N0Q A;  3CK7 A;  4GYW A;  2XGO A;  4HLE A;  4L2Y A;  3L82 A;  2AXU A;  4EQF A;  5AEN A;  3VLF A;  4JW1 A;  1JUQ A;  2EIL E;  4DK5 A;  4YDY A;  2FBN A;  4LNB A;  4A3T A;  2Q7F A;  2QZA A;  3W9F A;  5G05 J;  1TN6 A;  2VJ8 A;  3D9O A;  2CG3 A;  5FIN A;  2V5Q C;  5FTP A;  5KJM A;  4I6G A;  3HDX A;  1HF8 A;  1KZO A;  4UQX A;  4AVX A;  4D10 C;  1GW6 A;  2YIN A;  2WXR A;  3RSE G;  2XPY A;  5CCL A;  1K8K G;  1FPP A;  4DRX E;  3N71 A;  3ENE A;  1HO8 A;  2V4H C;  2YHC A;  2WB2 A;  3PZ4 A;  3SNX A;  2I1K A;  3T5X A;  3KEZ A;  4DUI A;  1N11 A;  5CEA A;  3AG3 E;  4FHK A;  4B89 A;  5G05 C;  2LAI A;  3PRE A;  1ZB1 A;  3ZYL A;  3APF A;  4XZ4 A;  3FU6 A;  5CRU A;  2EQX A;  3RIB A;  4I9C A;  5BT1 A;  3NB2 A;  3EJN A;  2XCB A;  4G8K A;  3FUF A;  3U3W A;  1ZU2 A;  3LS8 A;  2FEZ A;  3V31 A;  1IQU A;  2LXM A;  5T3R A;  3LJN A;  2X6H A;  5CMW A;  1O1S A;  4GPM A;  4N2S A;  2PQN A;  1E90 A;  4BX9 A;  3QC1 A;  5G04 J;  1LTX A;  5FQ4 A;  4BER A;  5G55 A;  4O60 A;  2XCC A;  2WMO A;  2XRZ A;  4KYO B;  1X5B A;  3CVV A;  1HFA A;  1WY6 A;  4KXK B;  5CCM A;  1NP7 A;  4JEU A;  5ENT D;  3D9K A;  5AAR A;  3AS4 A;  1D8D A;  1OCZ E;  3ZN3 A;  5CBN A;  4CGW A;  2WXO A;  4ZHB A;  2X6J A;  3FFL A;  1K1B A;  3ZKJ A;  5G04 C;  1E8Z A;  3RU0 A;  2IO3 C;  3P1U A;  2GRO B;  2J4B A;  2KZT A;  3K9I A;  3FDH A;  4NRH B;  4JA7 A;  1QYM A;  4DX1 A;  3UTM A;  4LRZ A;  3L16 A;  4I1A A;  1DCE A;  2L6B A;  4L23 A;  4Z68 A;  3NBN B;  4NQ0 A;  4PDX A;  1N52 A;  5T4Y A;  5H7P A;  2OVB A;  3NQP A;  3UMV A;  1FT1 A;  3FUL A;  2FF4 A;  2MYO A;  3ASG A;  5LFA A;  2LNI A;  2HE0 A;  4B8C B;  3ASO E;  2DVW A;  4H7Y A;  3RRN B;  3FEX A;  2DCP A;  2Y69 E;  3D3M A;  3MCX A;  2BKK B;  3GZS A;  1KZP A;  3ZHE A;  3HXF A;  2ZXW E;  3UM3 A;  4FJY A;  4GMJ A;  3BG0 B;  1Z3Y A;  3V2X A;  2J08 A;  2IOL A;  3C72 A;  1DVP A;  2YQ8 A;  4A3V A;  2J09 A;  3SY2 A;  2I2O A;  4HRN A;  4HOS A;  4KZC A;  1TNB A;  4WNG A;  2DIW A;  3HG0 D;  2C0M A;  4PH4 B;  5AIJ A;  3E34 A;  4UWK A;  1H2T C;  3LVR E;  3KD7 A;  1N54 A;  3EU5 A;  1RW2 A;  4MLP A;  3RRU A;  4EZL A;  5FZS A;  4AV7 A;  1TYQ G;  3FU3 A;  4HLL A;  4ILG A;  4WAF A;  4HI8 A;  3FH8 A;  1KPS B;  3HIZ A;  2OEV A;  4JVS A;  3T8M A;  3ZW3 A;  1Y8M A;  1LF8 A;  5CRV A;  4APF A;  3SZ7 A;  2KC7 A;  5JJ6 A;  2KM4 A;  3FTZ A;  2AJA A;  5A7D B;  4Q94 A;  3TL5 A;  2RG8 A;  4TUM A;  3V2O A;  5EYL A;  1TEZ A;  4RG6 A;  3ESL A;  3F6Q A;  5FJY A;  3ULY A;  3O48 A;  2QYU A;  3NZS A;  1BI7 B;  2B6C A;  3FUJ A;  4GZ5 A;  4KT6 B;  3TWQ A;  3ZYQ A;  4GPK A;  5EID A;  3FTS A;  1OWO A;  3ULQ A;  3ZNG A;  2V0P A;  4PS3 A;  3ZVV A;  2FUL A;  2XS8 A;  5BPP A;  1MZC A;  3V30 A;  4HOT A;  3EDT B;  4CCA A;  3FU0 A;  2I9C A;  2FI7 A;  3QJZ A;  3LY9 A;  1EDU A;  1WDY A;  3HXC A;  3LVQ E;  3G2T A;  4PS8 A;  3IEG A;  3CHQ A;  1OWP A;  1NI1 A;  3Q78 A;  3CHS A;  3LCA A;  4NIK A;  1X81 A;  4V3I A;  3SFZ A;  4N5Q A;  3PZ3 A;  5CMY A;  5EDS A;  4GTT A;  1U2V G;  4DLO A;  2IO2 C;  2XGS A;  1WM5 A;  2BED A;  3L08 A;  5B3S E;  1UJJ A;  1OWM A;  4XIF A;  1FT2 A;  2L6J A;  4CDN A;  3TXM A;  4F6R D;  3EHM A;  2WQ6 A;  3AJI A;  1NFI E;  3FUD A;  2P9S G;  1MX4 A;  1MYO A;  3UKU G;  1XNF A;  1H6K A;  5CHE E;  2VSN A;  5IY5 E;  4GCO A;  4DX6 D;  2AXV A;  3S7B A;  1KT0 A;  1MQS A;  3L54 A;  4GTM A;  4CYM D;  3APD A;  3G2W A;  4G8L A;  1V55 E;  1N4Q A;  4KBQ A;  4HQD A;  3CVU A;  2C2L A;  2PM6 A;  5BV1 A;  3HXE A;  1INZ A;  3B7S A;  3QAQ A;  1G3N B;  3BG1 B;  2P2C P;  1VDY A;  4BFR A;  4X8Q A;  3LXU X;  3ONK A;  1ELR A;  2HO1 A;  4ILH B;  2Y4T A;  1H19 A;  2XEV A;  3NOC D;  4U63 A;  2M63 A;  1WG0 A;  4QFV A;  3Q47 B;  1JPL A;  3LY7 A;  2X3M A;  2KZT B;  3PNT B;  3O4Z A;  3SBT B;  3FUI A;  4YND A;  1E7V A;  3QDN A;  1PC2 A;  4KVM A;  3MEK A;  5T8I A;  3IXE A;  3SBS A;  4UI9 J;  3S7D A;  2AW6 A;  2VYI A;  5AJL A;  1E7U A;  3HVE A;  4B93 B;  3D9L A;  4BEP A;  3BQO A;  3OAW A;  4MBG A;  3FTW A;  1TJF A;  4BTA A;  3TG4 A;  3BUA A;  3QKY A;  3QWP A;  5FZQ A;  1PAQ A;  3ZYK A;  4U8V D;  4CZ2 D;  3CHM A;  3JYS A;  1LD7 A;  3ZHE B;  2P9K G;  2WM9 A;  1TNO A;  4G11 A;  3NZU A;  4FUL A;  5D66 A;  2VSY A;  4O1O A;  1N4R A;  4MRU A;  3MYV A;  4AXH A;  3PDN A;  3Q7A A;  2WPV A;  3PS6 A;  4UI9 C;  3CVW A;  1HZ4 A;  3PEV B;  2UWJ G;  5JJ7 A;  4FHJ A;  1NZN A;  3CSF A;  3TWR A;  3QWV A;  1BI8 B;  4E85 A;  4U0S A;  2CFZ A;  4DJA A;  4NUR A;  1NL4 A;  4AP2 A;  4DLQ A;  4G23 A;  3URZ A;  5FT9 A;  4HB5 A;  3FUN A;  4GTQ A;  1XGW A;  3L17 A;  2PQR A;  4Y6W A;  4UWH A;  5D2M C;  1FVH A;  2RD0 A;  2MRI A;  3RKV A;  4N39 A;  2WXG A;  3SD5 A;  3ZIM A;  4O1P A;  5AJD A;  4J8S A;  5FQ7 A;  2L9B A;  4EHM A;  5HS0 A;  1Q2Z A;  2C0L A;  3TWS A;  2XHE A;  3ULE G;  3QAR A;  3CHP A;  4APO A;  1V54 E;  1OXJ A;  4U8H A;  1HE8 A;  3WG7 E;  1RZ4 A;  2J4D A;  2GRQ B;  3ASD A;  3CVY A;  1A17 A;  5AQ9 A;  1AWC B;  3GZ2 A;  4HRL A;  1H2U A;  4WWP A;  3PE3 A;  4CDM A;  3R9A B;  3UM2 A;  3EHQ A;  2VSO E;  3UIO C;  5CER B;  5BUZ A;  2X6F A;  2E0I A;  3RK6 A;  5ITZ F;  2R59 A;  1MX6 A;  4MKT A;  3MKQ A;  5KJN A;  3Q79 A;  4CGV A;  4F3V A;  1JCR A;  3NOG D;  5JA4 D;  2DYS E;  2IU1 A;  4DX5 D;  5FIO A;  4YDW A;  1H2V C;  3CVP A;  3JQ1 A;  3VTX A;  4BES A;  2XPI A;  2WXF A;  5HQ8 A;  1A5E A;  1LD8 A;  4KMO A;  4GA0 A;  4JA9 A;  3SGH A;  2EIM E;  3CQC B;  3B7T A;  4ANU A;  4ANX A;  2IY0 C;  4HOQ A;  3UXG A;  4I6J A;  3CQG B;  3T9K A;  3U9W A;  1JWF A;  1SA4 A;  3TWX A;  1P5Q A;  2J07 A;  4U96 D;  2JLB A;  1O5M A;  4N5C A;  2DWZ A;  4N2Q A;  2GW1 A;  2XEH A;  2KCV A;  4G24 A;  3QWW A;  4Q96 A;  4RSY A;  3Q49 B;  4ZFH A;  4EZJ A;  3W9G A;  1S0P A;  1D8E A;  2XZT G;  3JQ0 A;  2CHZ A;  2A5U A;  3C98 A;  2WVI A;  1Z3X A;  5ENR D;  3TWV A;  2PM7 A;  4U8Y D;  2ILR A;  2KAT A;  3QK0 A;  5ANL A;  3AS5 A;  1SZA A;  2A4Z A;  2AVP A;  2BTD A;  4N3B A;  3EUV A;  2X38 A;  2R05 A;  5CBO A;  3D9H A;  4UUC A;  4OYS A;  2R5S A;  3EU9 A;  2H6H A;  1H6P A;  1E96 B;  4AY6 A;  3D9N A;  2GRN B;  5EYP F;  3FY4 A;  4FC8 A;  1QNF A;  1UW4 B;  3C3Q A;  2P9N G;  3AG1 E;  3OXG A;  3HXD A;  1MX2 A;  5B1A E;  3UUX A;  1UJK A;  3PH0 C;  3ESK A;  1KLX A;  1YYH A;  4WWO A;  1KT1 A;  2DBA A;  4TXP A;  2DYR E;  4K0R A;  2IJG X;  4JHR A;  4LNG A;  1H6O A;  1TNU A;  3DWL G;  1D9S A;  2EIK E;  3ZPJ A;  5EN5 D;  1OCC E;  3IV0 A;  3V79 K;  3FTX A;  4HOU A;  1YMP A;  1N4S A;  2BKG A;  3PZ1 A;  3FTV A;  1U3D A;  3HVE B;  3OXL A;  3DPY A;  4WWN A;  5KJK A;  3SF4 A;  3APC A;  4LSZ E;  2XPZ A;  3FUE A;  4FLH A;  4I9E A;  2IFU A;  1N94 A;  1OCO E;  5B1B E;  1OWN A;  3SFX A;  2LSU A;  5FQ8 A;  2Y1L E;  5E75 A;  1NA0 A;  3FP3 A;  3ZUV B;  2NXP A;  4HNA D;  2NYJ A;  3SQV A;  4DX7 D;  3AG4 E;  2J9Q A;  1SVX A;  2DZN A;  5G2N A;  4L2L A;  3ABM E;  3FTY A;  5JHB A;  1HG5 A;  4F1P A;  2V5F A;  3CKC A;  4CRW A;  1N4P A;  2VGY A;  2Y4U A;  2EIJ E;  3J5Q B;  5AYW D;  4U07 A;  3UPV A;  3BU8 A;  5HKP A;  4N3A A;  5BNW A;  5CED B;  5BV0 A;  4CEM A;  2OND A;  3ZEF A;  3TWT A;  4RG9 A;  4PUC A;  2JEK A;  3CVL A;  4GU5 A;  3X2Q E;  3KS2 A;  4TV3 A;  5FQ6 A;  3S7J A;  4WND A;  3CK8 A;  1OUV A;  4JXT A;  4ACL A;  5AQA A;  3AAA C;  3E32 A;  4K5A B;  3ASF A;  3C5R A;  5BW8 C;  5EX0 A;  1HXI A;  2LUH A;  3MJW A;  4UQZ A;  1S64 A;  3DSV A;  5KBA A;  3MA5 A;  4WNF A;  2VSX E;  3FUH A;  4LER A;  1UG3 A;  5ENS D;  4E6H A;  4NAC A;  5KCM A;  2F8Y A;  3E33 A;  4IN3 B;  2QY7 A;  4G2V A;  4BT9 A;  3LEW A;  4BSZ B;  4GZ3 A;  3ONL A;  2CG2 A;  1HU3 A;  3CVX A;  2WXM A;  3FUK A;  1SW6 A;  5AQ7 A;  2KCK A;  2GRP B;  5M72 A;  1IXV A;  5EIB E;  2BUG A;  5KNG A;  3CIA A;  3OTN A;  1O1R A;  1YCS B;  1ELK A;  3HHM A;  3UT7 A;  3UI2 A;  4QQI A;  1SQM A;  3IBE A;  3CK9 A;  4B8A A;  4ANV A;  4GB9 A;  3I4R B;  4A1G A;  3ZU7 B;  2QC9 A;  3MKQ B;  4FLB A;  2B0O E;  3KSQ A;  2A5E A;  2WXL A;  1OCR E;  4G1T A;  2VGX A;  2Y3A A;  3CST A;  1AP7 A;  4K5B A;  3AU4 A;  4BT8 A;  4O6F A;  5E76 A;  3FHE A;  4AJW A;  5J08 A;  2P9L G;  4BWR A;  2ZGD A;  1TJC A;  4YVO A;  3EHN A;  2NC9 A;  3L13 A;  4XKB A;  4GZD A;  1UOH A;  2AWI A;  2UY1 B;  1Z6T A;  3E4B A;  4CT0 A;  4J8D A;  1IHB A;  2PZI A;  3UIN C;  3PUJ A;  4ABN A;  2H6I A;  3UQ3 A;  1QZ2 A;  3UX4 A;  4GTP A;  4XE0 A;  3ASH A;  3B7R L;  3QOU A;  2FO7 A;  2WQ7 A;  4G25 A;  5EKQ D;  4BTB A;  1E8Y A;  2P58 C;  2V4L A;  1DC2 A;  4BET A;  1EYH A;  1OY3 D;  2XGM A;  2IEJ A;  4HXI A;  2P9P G;  3FH5 A;  4UWG A;  3AS8 A;  1L5J A;  3PRZ A;  3JUE A;  3PZ2 A;  3UKR G;  3JXI A;  3LJ3 A;  4Q69 A;  4DI3 A;  3ISM C;  5ENQ D;  4C48 B;  4G26 A;  3C3O A;  3D9J A;  2IF4 A;  3ASN E;  4OVU A;  2HM8 A;  4XI0 A;  3RO2 A;  3LKU A;  3CVN A;  3NAW A;  3LDZ A;  5DBK A;  1MHQ A;  4PS7 A;  5JMN D;  3FH7 A;  2L0T B;  4I1M A;  3MV2 B;  4XX5 A;  1UN9 A;  3S7F A;  1IQR A;  2XS1 A;  4AY5 A;  2Y0B G;  5A23 A;  1FCH A;  4RQI A;  4LEU A;  2F8X K;  2ETC A;  4L7T A;  5LOZ A;  4U7E B;  3MKR A;  3CHO A;  5C1D A;  3HXB A;  1SZ9 A;  3B7B A;  3ZFW A;  2RKK A;  4J7W A;  1ELW A;  3ZYM A;  3T5V A;  4F1S A;  4WNE A;  4OAV B;  5DIZ A;  4J6I A;  4ILI A;  3Q5M A;  4A1S A;  3EIJ A;  4I6E A;  3PVL A;  4XEI G;  4XKC A;  3CVQ A;  1OT8 A;  3R9M A;  1JCQ A;  4JL0 A;  4HVB A;  3RAU A;  3I3N A;  2R03 A;  4U04 A;  3UT4 A;  4JPS A;  4EPZ A;  4GYO A;  5BXU A;  4BSX A;  3IHY A;  3SO8 A;  4FA6 A;  4M7C A;  3D9P A;  3Q75 A;  1SA5 A;  1S63 A;  4YDE A;  3U66 A;  4A63 B;  3ZXS A;  4ATZ D;  2ZGG A;  3G2S A; 
#chains in the Genus database with same CATH homology
 2KAT A;  3PE4 A;  3AU5 A;  4IUL A;  4C9B B;  3LPZ A;  3LVQ E;  4C0M A;  3G2T A;  2YHE A;  3QK0 A;  4URK A;  5ANL A;  2WXP A;  4PS8 A;  2VTB A;  3IEG A;  2WXK A;  3AS5 A;  4GA2 A;  4JZY A;  3CHQ A;  1OWP A;  1SZA A;  4HS2 A;  4EBA A;  1H0A A;  2A4Z A;  3CGH A;  2AVP A;  2BTD A;  4N3B A;  2WXQ A;  3CHS A;  3LCA A;  2X38 A;  4UWF A;  4V3I A;  3B13 A;  3SFZ A;  5CMY A;  2WMN A;  4F53 A;  5EDS A;  3D9I A;  4JC8 A;  4ANW A;  2X6K A;  1OWL A;  3PUK A;  4UQY A;  2WXI A;  3I5P A;  2CFU A;  4OYS A;  4DLO A;  1IYG A;  2R5S A;  2XGS A;  1HH8 A;  1DNP A;  1WM5 A;  1EF1 C;  1E96 B;  4AY6 A;  3L08 A;  3RRM B;  5C2Y A;  5JJT A;  3D9N A;  3CK7 A;  1UJJ A;  1OWM A;  4GYW A;  2XGO A;  4XIF A;  2L6J A;  4HLE A;  4L2Y A;  3FY4 A;  3LY8 A;  4CDN A;  4FC8 A;  1QNF A;  1UW4 B;  4FAD A;  4LUN U;  2AXU A;  3TXM A;  4EQF A;  5J90 A;  4L1B A;  3Q4A B;  3OXG A;  5AEN A;  3UUX A;  2KCL A;  3VTY A;  3U64 A;  4CDR A;  3EHM A;  4AOF A;  3VLF A;  1UJK A;  3PH0 C;  2WQ6 A;  3ESK A;  5LCW J;  1KLX A;  4JW1 A;  4WWO A;  1KT1 A;  2DBA A;  4JEH A;  1JWG A;  3CR3 A;  2XRY A;  3CEQ A;  1JUQ A;  3FUD A;  3LYA A;  4K0R A;  2IJG X;  4DK5 A;  4JHR A;  2X6I A;  2FBN A;  1YA0 A;  2UY1 A;  4A3T A;  2Q7F A;  3SI5 A;  3ZPJ A;  5G05 J;  1XNF A;  1H6K A;  3TAX A;  2VJ8 A;  3IV0 A;  3D9O A;  5CHE E;  2I1J A;  2CG3 A;  3FTX A;  4HOU A;  2VSN A;  2WXJ A;  5FTP A;  4GCO A;  5KJM A;  4I6G A;  2AXV A;  1W3B A;  3HDX A;  1HF8 A;  1E8W A;  3S7B A;  4UQX A;  1KT0 A;  4AVX A;  1MQS A;  3L54 A;  3FTV A;  1GW6 A;  1U3D A;  2YIN A;  3ML9 A;  4H7X A;  4D10 C;  2WXR A;  3HVE B;  2XPY A;  4HOR A;  3APD A;  2PL2 A;  5CCL A;  4K03 A;  3S2A A;  4B0Z A;  4JHJ A;  3OXL A;  4BY6 A;  4AIF A;  3GW4 A;  5ENN A;  3N71 A;  3ENE A;  1HO8 A;  3G2W A;  2WXH A;  4WWN A;  3JCK C;  1Y6I A;  4KBQ A;  2QFC A;  2YHC A;  5KJK A;  2WB2 A;  3FEY A;  3SF4 A;  2OOE A;  3APC A;  3SNX A;  2LSV A;  2XPZ A;  3FUE A;  4FLH A;  2IFU A;  4I9E A;  2I1K A;  3CVU A;  2C2L A;  2PM6 A;  4ATG A;  1OWN A;  4EBA G;  5BV1 A;  4EZK A;  3T5X A;  2LSU A;  3KEZ A;  5LCW C;  5FQ8 A;  1QQE A;  3SHF A;  1INZ A;  5E75 A;  3B7S A;  3QAQ A;  1NA0 A;  1ZBP A;  1U3C A;  1FVF A;  3FP3 A;  3BG1 B;  1VDY A;  2NXP A;  2CHW A;  3VLE A;  4BFR A;  4DI4 A;  4FHK A;  3U4T A;  3D9M A;  4B89 A;  2J9Q A;  3LXU X;  3ONK A;  1ELR A;  5G05 C;  2LAI A;  2IOS A;  3PRE A;  2HO1 A;  4TRQ A;  5G2N A;  4L2L A;  4ILH B;  3ZYL A;  3APF A;  3FUM A;  3IKO B;  4XZ4 A;  3FTY A;  5JHB A;  3FU6 A;  2VQ2 A;  4BX8 A;  1HG5 A;  2Y4T A;  2V5F A;  1H19 A;  2EQX A;  2XEV A;  2VGY A;  3CKC A;  4CRW A;  3RIB A;  2Y4U A;  4GA1 A;  4I9C A;  4Y6C A;  5BT1 A;  4J8E A;  3BEE A;  3EJN A;  2M63 A;  2XCB A;  4U63 A;  5AYW D;  3FUF A;  4QFV A;  4I1O B;  4U07 A;  3U3W A;  1ZU2 A;  3LS8 A;  2FEZ A;  3Q47 B;  1JPL A;  4HFG A;  3UPV A;  1IQU A;  3LY7 A;  5ANR A;  5T3R A;  4IRU A;  4I2W A;  4N3A A;  3TJP A;  5BNW A;  2X3M A;  2KZT B;  3UT8 A;  3PNT B;  3O4Z A;  3SBT B;  5BV0 A;  3GZ1 A;  4CEM A;  3FUI A;  2OND A;  2X6H A;  4YND A;  1E7V A;  3QDN A;  3ZEF A;  1PC2 A;  5CMW A;  4RG9 A;  4N2S A;  4PUC A;  2PQN A;  2JEK A;  4KVM A;  4I43 A;  3CVL A;  1E90 A;  4GU5 A;  4BX9 A;  3MEK A;  5T8I A;  3KS2 A;  3QC1 A;  4GZ6 A;  5G04 J;  4TV3 A;  5FQ6 A;  3S7J A;  3SBS A;  4WND A;  2OVF A;  4UI9 J;  5FQ4 A;  3NF1 A;  3S7D A;  2AW6 A;  2J49 A;  2VYI A;  3CK8 A;  1E7U A;  1OUV A;  3G2V A;  4JXT A;  3HVE A;  5AJL A;  3RJV A;  4ACL A;  2VGX B;  3ASF A;  3FWV A;  3D9L A;  5G55 A;  3OAW A;  2XCC A;  5BW8 C;  5KJL A;  3FTW A;  2WMO A;  1TJF A;  2XRZ A;  5EX0 A;  3TG4 A;  1HXI A;  3DBS A;  3MJW A;  4BTA A;  4UQZ A;  4KYO B;  1UN8 A;  1X5B A;  3CVV A;  1HFA A;  3QKY A;  4TUU A;  1WY6 A;  3MA5 A;  3Q15 A;  1HG2 A;  4WNF A;  4KXK B;  2VSX E;  1PY1 A;  3FUH A;  3QWP A;  5FZQ A;  5CCM A;  1PAQ A;  4LER A;  3ZYK A;  1UG3 A;  1NP7 A;  4E6H A;  4NAC A;  2GGF A;  3JUI A;  4JEU A;  4DPR A;  3D9K A;  5KCM A;  2IQC A;  1WAO 1;  4IN3 B;  3CHM A;  3JYS A;  3ZHE B;  2QY7 A;  4G2V A;  4BT9 A;  3AS4 A;  3ZRH A;  2WM9 A;  3LEW A;  2R17 C;  2ION A;  4MS6 A;  4GZ3 A;  3R7R A;  4G11 A;  3NZU A;  4FUL A;  3ONL A;  3ZN3 A;  2CG2 A;  2VSY A;  1HU3 A;  2E2E A;  3I4G A;  4F7A A;  2WXM A;  4CGW A;  2WXO A;  3FUK A;  4JHK A;  2X6J A;  3CVX A;  3FFL A;  1NA3 A;  3TG5 A;  2KCK A;  4MRU A;  4RVB A;  3MYV A;  4ACK A;  4AXH A;  5M72 A;  2MHK A;  3PDN A;  2WPV A;  5G04 C;  1E8Z A;  2BUG A;  3RU0 A;  3PS6 A;  4UI9 C;  3CVW A;  1HZ4 A;  3CIA A;  3P1U A;  3PEV B;  2UWJ G;  1E8X A;  3OTN A;  5JJ7 A;  4P29 A;  4FHJ A;  2J4B A;  1ELK A;  1NZN A;  3CSF A;  3QWV A;  3HHM A;  3TGO A;  2KZT A;  3K9I A;  2ZU6 B;  4E85 A;  4U0S A;  3UT7 A;  2CHX A;  5JHA A;  3ML8 A;  3FDH A;  2CFZ A;  4NRH B;  4DJA A;  1SQM A;  3IBE A;  4JA7 A;  3CK9 A;  4NUR A;  4B8A A;  2AXZ A;  4ANV A;  4GB9 A;  4AP2 A;  4DLQ A;  4G23 A;  3I4R B;  3URZ A;  4A1G A;  3MKQ B;  4FLB A;  3PZD A;  2WXL A;  4EEC A;  5FT9 A;  4LRZ A;  3L16 A;  4G1T A;  4I1A A;  4L23 A;  2VGX A;  2Y3A A;  3CST A;  3FUN A;  1XGW A;  3L17 A;  4NQ0 A;  1N52 A;  4PDX A;  5T4Y A;  3AU4 A;  2OVB A;  2PQR A;  4BT8 A;  4Y6W A;  4O6F A;  5E76 A;  3FHE A;  4AJW A;  3NQP A;  5J08 A;  4UWH A;  5D0Q D;  3UMV A;  1FVH A;  4A55 A;  2RD0 A;  3MZL B;  4J8F A;  3FUL A;  3VLD A;  4BWR A;  2LAH A;  1TJC A;  2MRI A;  4YVO A;  2XQ0 A;  4N3C A;  2FF4 A;  3EHN A;  4N39 A;  2NC9 A;  3RKV A;  3L13 A;  4XKB A;  4GZD A;  4KZ0 A;  2AWI A;  3ASG A;  2UY1 B;  2LNI A;  5LFA A;  1Z6T A;  2WXG A;  3E4B A;  3SD5 A;  4B8C B;  4U0Z A;  3ZIM A;  5AJD A;  4CT0 A;  2WQH A;  4J8D A;  2L9B A;  4H7Y A;  4J8S A;  3FEX A;  5FQ7 A;  3RRN B;  2PZI A;  5ARG A;  2NSZ A;  4CT4 A;  2DCP A;  2C0L A;  3D3M A;  2XHE A;  3PUJ A;  4ABN A;  3MCX A;  3QAR A;  3UQ3 A;  3CHP A;  4APO A;  1QZ2 A;  3GZS A;  4FP7 A;  4XE0 A;  5FZR A;  3UX4 A;  3ASH A;  3ZHE A;  3B7R L;  3QOU A;  4J0U A;  4U0U A;  5EX3 A;  5A6C A;  2FO7 A;  4FJY A;  4GMJ A;  3TXN A;  3BG0 B;  2WQ7 A;  1Z3Y A;  4U8H A;  1HE8 A;  2J08 A;  4G25 A;  4M3O A;  4GAA A;  4UWL A;  5EKQ D;  1HS6 A;  1IHG A;  4BTB A;  1E8Y A;  3L22 A;  3P2B A;  2P58 C;  3CLJ A;  2V4L A;  4B94 A;  4GML A;  2IOL A;  1DVP A;  2GRL A;  1EYH A;  2YQ8 A;  3R7Q A;  2XGM A;  2J4D A;  2J09 A;  4A3V A;  4HXI A;  1B89 A;  3EIQ C;  3FH5 A;  4UWG A;  3AS8 A;  4GCN A;  1L5J A;  3ASD A;  3CVY A;  3PRZ A;  3IHV A;  2I2O A;  3LJ3 A;  4Q69 A;  4DI3 A;  1A17 A;  4KVO A;  4HOS A;  4KZC A;  3PEU B;  4WNG A;  4G26 A;  3GZ2 A;  2DIW A;  1H2U A;  2L0I A;  2C0M A;  4PH4 B;  4WWP A;  3PE3 A;  4CDM A;  3QNK A;  5AIJ A;  3R9A B;  3D9J A;  2IF4 A;  4UWK A;  1H2T C;  3LVR E;  4LCT A;  4OVU A;  2VSO E;  3KD7 A;  3MV3 B;  2HM8 A;  3HYM B;  1N54 A;  3MX3 A;  4XI0 A;  3RO2 A;  2GRM A;  3LKU A;  3CVN A;  3KAE A;  4OVV A;  3FTU A;  5BUZ A;  2X6F A;  2E0I A;  2I6H A;  4MLP A;  3LDZ A;  5DBK A;  3RK6 A;  3RRU A;  2R59 A;  2HYZ A;  4MKT A;  1MHQ A;  4EZL A;  4PS7 A;  5LX8 A;  3MKQ A;  5FZS A;  5KJN A;  4AV7 A;  4CGV A;  3FU3 A;  3FH7 A;  4F3V A;  2L0T B;  4XI9 A;  4I1M A;  3MV2 B;  3B7U X;  4GZC A;  1UN9 A;  4ILG A;  4XX5 A;  3S7F A;  1IQR A;  2IU1 A;  4WAF A;  4AY5 A;  5A23 A;  1FCH A;  3FH8 A;  4LEU A;  1H2V C;  3HIZ A;  4JVS A;  3T8M A;  3ZW3 A;  5ARF A;  1Y8M A;  2VTB B;  3CVP A;  2BF0 X;  3JQ1 A;  4L7T A;  5LOZ A;  3VTX A;  2XPI A;  5FWQ A;  2OV8 A;  2WXF A;  1LF8 A;  3MKR A;  5HQ8 A;  3CHO A;  4W9R A;  4APF A;  5C1D A;  1SZ9 A;  3ZFW A;  3G2U A;  4KMO A;  3SZ7 A;  4GA0 A;  2KC7 A;  5JJ6 A;  1HX8 A;  2KM4 A;  3FTZ A;  3CKB A;  5A7D B;  1ELW A;  2V8S E;  4JA9 A;  3SGH A;  4I2Z A;  4Q94 A;  3TL5 A;  3ZYM A;  3CQC B;  3T5V A;  4F1S A;  2RG8 A;  5LP0 A;  4WNE A;  4FJZ A;  4UI9 K;  3B7T A;  4ANU A;  4ANX A;  5DIZ A;  4J6I A;  4ILI A;  1TEZ A;  3Q5M A;  2MOW A;  4HOQ A;  4RG6 A;  4I6J A;  3ESL A;  3CQG B;  5FJY A;  3U9W A;  4A1S A;  3EIJ A;  4R7L A;  1JWF A;  3O48 A;  4I6E A;  3PVL A;  4XKC A;  3CVQ A;  2YNQ A;  3NZS A;  3PNL B;  1P5Q A;  2J07 A;  3FUJ A;  1BPO A;  2JLB A;  2HR2 A;  4GZ5 A;  4N5C A;  4KT6 B;  4YVQ C;  3ZGQ A;  4JL0 A;  4HVB A;  3I3N A;  3ZYQ A;  4ME2 A;  4C0E A;  4GPK A;  4N2Q A;  2GW1 A;  2KCV A;  4G24 A;  3FTS A;  4U04 A;  1OWO A;  3QWW A;  3ULQ A;  3UT4 A;  3QB2 A;  3RO3 A;  4JPS A;  2V0P A;  4Q96 A;  3CV0 A;  3DPD A;  4RSY A;  1EPU A;  3Q49 B;  4EPZ A;  4GYO A;  3GYZ A;  3FU5 A;  3OXF A;  4BSX A;  3CHR A;  4PS3 A;  3ZVV A;  3IHY A;  4EZJ A;  2FUL A;  5HI7 A;  4AEZ C;  4I17 A;  5BPP A;  3WXX A;  4FA6 A;  1S0P A;  3D9P A;  4WUY A;  4HOT A;  3EDT B;  3L6A A;  2WXN A;  4CCA A;  3FU0 A;  2CHZ A;  3JQ0 A;  2A5U A;  4FU3 A;  4AM9 A;  2I9C A;  2LO6 A;  3C98 A;  3U66 A;  2FI7 A;  2WVI A;  1Z3X A;  3QJZ A;  3LY9 A;  5D0O D;  3ZXS A;  1EDU A;  4GYY A;  2PM7 A;  3G2S A;  3MGB A;  2ILR A;  4IYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...