4ME2A

Crystal structure of tha8 protein from brachypodium distachyon
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
194
structure length
194
Chain Sequence
SLSTEAIHAVQALKRLTAADRSPPAATAAASAALGRLLRADLLAAMAELQRQGHWSLALAALHVARAEPWYRPDPELYATFVSSSPSNDPAAAAAVDALVEAFIEEKERGAAGGSSEGVWVGEDVYKLTRLVRALVAKGRARAAWRVYEAAVRKGGCEVDEYMYRVMAKGMKRLGLDEEAAEVEADLADWEARH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Structural basis for RNA recognition by a dimeric PPR-protein complex.
pubmed doi rcsb
source organism Brachypodium distachyon
molecule tags Rna binding protein
total genus 71
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2013-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4me2A00
1ELWA 4U0ZA 5LCWJ 3N71A 1QZ2A 2J9QA 3CK7A 2WQHA 3SZ7A 4N3CA 3QWWA 3LY9A 4F3VA 2L6JA 3HYMB 3UUXA 5LCWC 3S7DA 4H7YA 4G1TA 5FJYA 3ZHEA 2E2EA 1TJCA 4HOSA 3O48A 2UWJG 2V5FA 5FTPA 3ZFWA 3MKRA 4NQ0A 5BW8C 2ONDA 3U4TA 3GYZA 4HOUA 3QWPA 4G25A 3TG4A 2KC7A 4I9EA 1WM5A 2HR2A 3RO3A 3ZGQA 3FFLA 4YVOA 4KYOB 5AYWD 3ASFA 2KATA 3UPVA 4XIFA 3ULQA 1B89A 2LSVA 4JA7A 3GZ1A 1KT1A 4GCOA 2AVPA 2FEZA 5BT1A 3ASHA 2PQRA 5EX0A 1PC2A 4EQFA 4W9RA 2VGXA 3ASGA 4GYOA 4CGWA 3RU0A 3K9IA 4G24A 3TGOA 3VTXA 4CDRA 4BT9A 3OXGA 2PZIA 2FI7A 2FBNA 4WNGA 1NA0A 3BEEA 2VSYA 2Q7FA 4N5CA 3Q4AB 2Y4TA 4AY6A 4RG9A 3RIBA 3NF1A 4GZ5A 3VTYA 3CV0A 4GPKA 3LYAA 4JHRA 3TAXA 2JLBA 5BNWA 3ZPJA 5CHEE 3S7JA 5FZQA 5EKQD 5KJNA 2VGYA 1Y8MA 4RG6A 5M72A 5JJ7A 2I6HA 4I17A 1ZBPA 3AS4A 4N39A 3CVPA 2NC9A 4AM9A 5A6CA 5DBKA 4J8EA 3LKUA 4N2QA 3ASDA 3R9AB 3CK9A 5EX3A 4KXKB 5HQ8A 2UY1B 5A7DB 4UQZA 2XGSA 2XCBA 4HOQA 3CVLA 2PL2A 5FT9A 1E96B 2WPVA 4J8DA 4U0UA 4N2SA 4YNDA 3FWVA 4LEUA 2VSNA 1YA0A 4HORA 3RKVA 5CCMA 2QFCA 5JJTA 5C1DA 4GA1A 3LY8A 3CK8A 3QWVA 4BT8A 3CVQA 2VQ2A 3WXXA 2OOEA 4GA0A 3URZA 2XPIA 5D0OD 3PE3A 1P5QA 4J8FA 1A17A 3S7BA 2XGMA 2XEVA 4I2ZA 4XI0A 4IN3B 4G26A 4O6FA 5KJMA 4UI9K 2LNIA 5ARGA 2HO1A 5ARFA 3MV3B 4Y6WA 4BTAA 3ESKA 4BTBA 2FF4A 4GYYA 4G2VA 4N3BA 3Q15A 3KAEA 1NZNA 2FO7A 3TG5A 3Q49B 4CGVA 2UY1A 4WNFA 3MV2B 4G23A 2YQ8A 3CEQA 4H7XA 1HZ4A 3LCAA 3KD7A 2IFUA 4U07A 3JYSA 3SF4A 4JL0A 4UQYA 4B94A 4ME2A 5D0QD 5DIZA 4WNDA 3RJVA 3MA5A 4JA9A 4WNEA 2C2LA 2R5SA 2MHKA 3CVNA 4APOA 2KCVA 4KBQA 3LY7A 2DBAA 3Q5MA 3GZ2A 2XCCA 1OUVA 2VYIA 5G05J 5JJ6A 3QOUA 3RO2A 2PQNA 4GZ3A 3AS8A 2C0MA 2KCLA 4GYWA 4I1AA 2C0LA 5G04J 4AIFA 1QQEA 3CKBA 3QKYA 2XGOA 3S7FA 5KJKA 4GZ6A 5HI7A 4I2WA 1ELRA 1FCHA 3E4BA 5G05C 4XI9A 2Y4UA 3ZN3A 4UQXA 3U3WA 5G04C 4N3AA 1HH8A 3MEKA 4J0UA 1W3BA 3EDTB 3CKCA 1ZU2A 3FP3A 4I9CA 3KS2A 1IYGA 3ZHEB 5FZRA 1HXIA 3IEGA 4GCNA 2IF4A 2LSUA 3QDNA 1WAO1 5KJLA 3GW4A 4WUYA 4Y6CA 3PE4A 3UQ3A 1KT0A 2HYZA 5CCLA 4U0SA 4YVQC 2KCKA 4UI9J 1IHGA 4HOTA 3Q47B 3OXLA 4NRHB 3LPZA 4A1SA 1NA3A 3PDNA 2GW1A 4AY5A 4ABNA 4UI9C 4GA2A 4U04A 2YHCA 1XNFA 3OXFA 1KLXA 2BUGA 5FZSA 3AS5A 2P58C 2VGXB 4BWRA
chains in the Genus database with same CATH superfamily
2LAIA 4M3OA 3AG3E 5LCWJ 3KEAA 4FADA 2AXVA 2WQHA 3UM0A 2ETBA 4F7AA 4N3CA 3LY9A 3PVLA 5KNHD 2AWIA 1FVHA 4HB5A 3ISMC 4KT6B 2GGFA 5FJYA 3UIPC 2P9KG 1V54E 2P9IG 3QARA 1TN7A 4NQ0A 2EIKE 5BXUA 3U4TA 5AQ9A 1N94A 3FUMA 1JWGA 4E85A 2KC7A 2RD0A 2HR2A 4YVOA 5CMWA 1UN9A 3HXEA 2KATA 3LS8A 1K3ZD 3FUNA 1B89A 2LSVA 4JA7A 4C0EA 4DK5A 4GTMA 4LCTA 3ZIMA 3FU6A 2WMOA 3ASHA 2PQRA 1PC2A 4O1PA 3FUFA 2WM9A 1BI7B 3ASGA 4BSXA 4L2LA 3DSTA 2P2CP 3APFA 4G24A 3E30A 4HS2A 2F8XK 4BT9A 3OXGA 1Z5SC 3D9OA 5C2YA 3D9LA 3Q4AB 2Y69E 4RG9A 1SA4A 1UJJA 3APCA 4MKTA 3CLJA 3ZYKA 2ZGGA 4GPKA 4GTRA 3RRUA 1MHQA 3S7JA 2V4HC 5EKQD 3ZW3A 4BETA 5E75A 4JPSA 1S64A 1KZPA 3ZXSA 3DSWA 3CHOA 3FU0A 3C3OA 4J8EA 2XS1A 1N4SA 3ASDA 3R9AB 2AXZA 2CG2A 4KXKB 2AW6A 4HNAD 3MJWA 3TWUA 2OVFA 4FLHA 4HOQA 1E96B 2WPVA 4AEZC 5CBNA 3EU9A 4HLEA 4CZ2D 1SA5A 3ABLE 3ZYMA 3Q75A 1BD8A 3PZDA 1MX6A 3U9WA 2XRYA 2OV8A 2VSNA 3CHQA 1NP7A 2XZDG 5AQAA 2BKGA 4OVVA 4HORA 4GTSA 1EDUA 2VTBA 1E7VA 2P9PG 3SD5A 5C1DA 4GA1A 3LY8A 3AAAC 3CVQA 3NZSA 4TV3A 3WXXA 2OOEA 1GW6A 3T8MA 1N54A 3LEWA 4R7LA 1P5QA 2XGMA 4IN3B 3ML9A 1HU3A 4UI9K 5ARGA 1PAQA 4QFVA 3MV3B 4Y6WA 3UKRG 4DLOA 2FF4A 3UT7A 2HE0A 3PEVB 5D2MC 4I6EA 3KAEA 1NZNA 1E7UA 3BG0B 3TG5A 3Q49B 4PS8A 2UY1A 5AAOA 1N11A 4JB8P 4WNFA 2P9LG 4TUMA 2GRLA 3PUKA 4E6HA 4U95D 4UWLA 3CEQA 1HZ4A 3FUKA 3LCAA 3KD7A 3UKUG 4BSZB 5CECB 3UX4A 4U07A 5ENPD 1LD7A 1IKND 4UQYA 2KZTA 5D0QD 3DSXA 4EZKA 4DI4A 2MHKA 2ETAA 1YYHA 4XZ4A 2KCVA 4ILIA 1O1RA 3LY7A 2DBAA 3L6AA 3T9KA 2VYIA 2BKKB 1RW2A 5EYLA 4NIKA 1UW4B 2AXUA 3D9NA 3KSQA 3AS8A 2C0MA 2ILRA 4GYWA 4X8QA 4LUNU 4I1AA 2C0LA 5G04J 1H2TC 5KJKA 4JEHA 4CT0A 5HKPA 3IKOB 2Y0BG 5BPPA 2R05A 5ENQD 3E4BA 4A63B 2M63A 3ZN3A 4TXRA 4UQXA 4I1OB 2Y1LE 3LDZA 2RG8A 4N3AA 5FINA 1HH8A 4A3TA 3MEKA 2WQ6A 2X6KA 4K5BA 1L5JA 3HHMA 4CCAA 3EDTB 3B7BA 3CKCA 4DX7D 4DX1A 4OVUA 5FZRA 1MYOA 2V4LA 4D10C 5KWDA 1D9SA 2LSUA 5KJLA 3KSLA 3CQCB 3PE4A 3NBNB 2V8SE 1SZAA 4U0SA 2F0YA 1MX4A 5ENRD 5ENTD 3JCKC 3FTVA 4O60A 4HOTA 3AG4E 3OXLA 2L9BA 1A5EA 2LO6A 3ZNGA 1Z3YA 4GZDA 1OCZE 3LPZA 3CVXA 1EYHA 3J5PA 4FLBA 2E0IA 4AY5A 3Q78A 2YNQA 1H6PA 2V0PA 4DX6D 4I6GA 4G8KA 4JEUA 2P58C 4GZCA 4ANWA 2EINE 3N71A 1QZ2A 3JQ1A 3RRNB 5FWQA 3OTNA 5A23A 4ILGA 4HXIA 3W9GA 3FUIA 4IRUA 3QWWA 1OWLA 4BERA 2H6HA 1V55E 3ULYA 3MGBA 1DC2A 5LCWC 3S7DA 1HE8A 4C9BB 2OCCE 1TN8A 1N52A 3ZHEA 5KNGA 3EIQC 2XPZA 4UWGA 3SGHA 1MZCA 3CHPA 4GTQA 3ZFWA 3G2TA 2CHZA 3NQPA 2X6IA 5BW8C 5CERB 2ONDA 3BG1B 4HOUA 4FJYA 4ACLA 3QWPA 4KZ0A 3PZ3A 2KZTB 4LERA 4A55A 2A5EA 3RO3A 3ASOE 3R7RA 4KYOB 3IHYA 5AYWD 3HIZA 3P1UA 4J6IA 3L16A 3ABKE 5E76A 4PUCA 2IY0C 3GZ1A 4JW1A 4NURA 1H2VC 2AVPA 2FEZA 2L0TB 4CDMA 5BT1A 2PM7A 4LRZA 4EQFA 2RFMA 4AP2A 3TWWA 2VGXA 4TXPA 3TL5A 3K9IA 3TGOA 4DX5D 3FU3A 3FTYA 2PZIA 2FI7A 1NA0A 1TEZA 3BEEA 4F53A 3LVRE 4ANUA 2Q7FA 3PZ4A 4N5CA 4M7CA 4AVXA 4AY6A 4CYMD 4LNUD 3FTUA 3VTYA 3CV0A 3LYAA 2GRRB 3I3NA 4P29A 5JHBA 3EHNA 1EF1C 2J49A 3C98A 3SY2A 1S0PA 2VGYA 4HRMB 3ULEG 3SFZA 3PS6A 2GRQB 3E37A 3FTZA 2I6HA 4GTVA 5JMND 3ONKA 2NC9A 3LKUA 1BLXB 5FQ4A 5HRYA 3CK9A 2R17C 5EX3A 4KZCA 4APFA 3SFXA 1H6KA 1O5MA 2XCBA 3AU5A 2QY7A 5FT9A 2YHEA 3FU5A 4U8YD 5LX8A 2GROB 2NSZA 4YNDA 4Q96A 3PNLB 3FTWA 1WY6A 3DPYA 4HQDA 5CCMA 3BUAA 1JUQA 3CK8A 1WG0A 4BT8A 3UM2A 3B7SA 2F8YA 5B1AE 2H6FA 1QNFA 2WXGA 3L9TA 4DX2A 2XPIA 1QBQA 5IY5E 3HXCA 4J8FA 4UWHA 1UN8A 1HF8A 4XI0A 4G8LA 5LOZA 4UUCA 4O6FA 3AU4A 4YDEA 2HO1A 3CHSA 3MYVA 1HO8A 5ANRA 5ARFA 5T4YA 5AQ7A 1INZA 1FPPA 4JZYA 5J90A 4WWOA 3Q15A 4F1SA 2CHXA 1OY3D 1DCEA 5BXOA 4GB9A 3UM3A 4EBAA 2QC9A 4CGVA 1SW6A 4CEMA 2XHEA 4CDNA 5CEAA 4URKA 4G23A 1AP7A 4HFGA 3EHQA 1FVFA 1OCRE 3V31A 4BX9A 2X6JA 4B8AA 4B94A 3B7TA 4UWKA 3DBSA 3L54A 4WNEA 3ZUVB 5AIJA 3CVNA 1UG3A 3D9JA 1PY1A 3PZ2A 3SFYA 1OUVA 5G05J 3CHRA 5JJ6A 3FUHA 2EILE 1N9AA 5ENNA 3HXFA 2KCLA 4EZJA 1OWMA 2JABA 3CKBA 3QKYA 2XGOA 4GZ6A 2OEWA 3G2UA 5HI7A 1FCHA 1IQUA 5CBOA 5FQ8A 3PEUB 3L08A 3V30A 1EPUA 2GRNB 3T5VA 5G04C 3QJZA 1TNUA 2X3MA 3ABME 4RSYA 2CG3A 3UT4A 2WXMA 3QAQA 3D3MA 4WAFA 1ZU2A 3FP3A 2RFAA 5B1BE 3IEGA 2BTDA 3ZEFA 4GCNA 1S70B 3D9IA 3SQVA 1WAO1 3GW4A 1HFAA 3LJNA 3T5XA 3FULA 2BEDA 4Y6CA 1OXJA 3Q7AA 1KT0A 5H7PA 2WXPA 2HYZA 4XKCA 2JEKA 5G55A 3PRZA 3B7UX 2WXHA 3Q47B 3JUEA 4NACA 4L2YA 4A1SA 3PDNA 2KM4A 1NL4A 2HM8A 4QQIA 1K1AA 3GZSA 2XZTG 4U04A 4HI8A 3NOGD 3S2AA 3OXFA 3Q73A 1UJKA 5EDSA 5FIOA 4TUUA 2BUGA 2WMNA 3UMVA 4I43A 3HRAA 4BWRA 1ELWA 2MYOA 4JC8A 1TYQG 2J9QA 2WXIA 1D8DA 2ZU6B 2FO1E 5HS0A 3SZ7A 4BY6A 4F3VA 4B8CB 1HG2A 3FH5A 3QC1A 5ENSD 2L6JA 3ONLA 3HYMB 4H7YA 1D8EA 2WXKA 5KBAA 3ASNE 5CRUA 1NI1A 3LVQE 4AXHA 5G2NA 2E2EA 1N0QA 1TJFA 1U3DA 3O48A 2WQ7A 3MKRA 1AWCB 1KZOA 2IOSA 5BV0A 3CGHA 5EIDA 2VJ8A 4G25A 4J8SA 4U7EB 1E8XA 3C3QA 5AJLA 4I9EA 2KBXA 1JCRA 3RRMB 3APDA 3TXNA 3FFLA 5CMYA 4B0ZA 3CVUA 3X2QE 4EZLA 3UPVA 3HVEA 3ULQA 4GMLA 1KT1A 2EIJE 1JWFA 5EX0A 1SZ9A 4L23A 3TWXA 3R7QA 2DVWA 3I4GA 2A5UA 3SHFA 4GYOA 1S63A 2VGEA 1BU9A 2B6CA 3B95A 4CDRA 3FH7A 2FBNA 3HXBA 3TWRA 2VTBB 4GTTA 3C72A 5B3SE 2PM6A 2Y4TA 1JCQA 5AARA 1SQMA 4PH4B 4ATZD 4GZ5A 1FT1A 4G11A 4GPMA 1OCOE 2XQ0A 2WVIA 3FHEA 2WXLA 2JLBA 2F37A 3DXKG 3JXIA 1ELKA 4YDWA 5BNWA 3FY4A 3RAUA 4B89A 5KJNA 4HVBA 1Y8MA 2P9NG 2I1KA 4RG6A 5M72A 1KPSB 4I17A 1LTXA 4N39A 3DSUA 4JVSA 5A6CA 5DBKA 4FJZA 2IO2C 1SVXA 2GRMA 1O1SA 4DLQA 4EECA 2LXLA 5HQ8A 2UY1B 2FULA 2LUHA 5A7DB 5ITZF 2XGSA 3CVLA 3SBSA 3ZKJA 3EHMA 1OT8A 4J8DA 3ML8A 3C5RA 4U0UA 4N2SA 3P2BA 2L0IA 3AG2E 1E8YA 3EIJA 2R03A 3JQ0A 1Z6TA 1N4QA 1U3CA 3BU8A 2ZGDA 3PUJA 1O1TA 3VLFA 3FTSA 3D9MA 1Y6IA 4MLPA 4KVOA 3RKVA 3HXDA 5JJTA 3TWTA 2EIME 2WXOA 5JA4D 3QWVA 4DI3A 3OAWA 2VQ2A 1OWNA 4GAAA 4FULA 3FDHA 3VLDA 3F6QA 4A3VA 4DJAA 4OAVB 2ZIRA 5D0OD 4KMOA 1A17A 3RSEG 3ZRHA 2XEVA 1DNPA 5KJMA 2XENA 3I4RB 4BTAA 3ESKA 5AJDA 3U66A 4GYYA 4G2VA 4N3BA 4EBAG 2LAHA 2FO7A 1MQSA 1FT2A 3ZXPA 3CVYA 1LF8A 3CIAA 3MV2B 3HVEB 2IU1A 2H6GA 4I1MA 2IFUA 4V3IA 2CHWA 1E90A 4JL0A 2QZAA 1N4RA 1Z3XA 2ZISA 4ME2A 4WNDA 3RJVA 2DZOA 3MA5A 5J08A 4FHKA 2R5SA 4GTPA 3FUJA 1OWOA 4BEPA 1NFIE 2DZNA 4APOA 3SI5A 2IEJA 3QB2A 3UXGA 3Q5MA 3GZ2A 4LNGA 3B7RL 4C0MA 3QOUA 1QYMA 2PQNA 3JXJA 4GZ3A 4HRLA 1N95A 3D9HA 5G05C 4XI9A 5ANLA 2ETCA 4BESA 4I6JA 2Y4UA 3ZU7B 1RZ4A 4Q69A 2RKKA 4IULA 2VSOE 2NXPA 3SNXA 2V5QC 5AN8A 3J5QB 4J0UA 4K0RA 4L9PA 4I9CA 4MRUA 2DWZA 3KS2A 4U8HA 1IYGA 2CFZA 3ZHEB 3B13A 2IF4A 2AJAA 4ANXA 4EPZA 4U63A 2WXRA 4AOFA 3UQ3A 4F1PA 5CCLA 1OCCE 4YVQC 3HG0D 2IOLA 3CSTA 2J09A 4UI9J 1VDYA 4TRQA 2LXMA 4FA6A 3MKQA 2J8SD 4HI9A 3Q79A 2IONA 3DWLG 3E32A 1NA3A 1HS6A 3QK0A 3RK6A 1G3NB 3CSFA 4ABNA 2YHCA 4YDOA 2EQXA 2I9CA 1XNFA 4HBDA 3L22A 4C48B 1KLXA 5BV1A 4ZFHA 3FEYA 2GRPB 4RVBA 3VLEA 5EIBE 4WWNA 2VGXB 1JCSA 3IXEA 4U0ZA 2P9UG 3PH0C 2P9SG 4F6RD 3CK7A 3ESLA 3FUEA 3DEPA 3G2WA 2R59A 4JXTA 5EYPF 2I2OA 4AJWA 1E8WA 4JHKA 4DPRA 3NOCD 2B0OE 2IJGX 3UUXA 4K03A 4L7TA 3TJPA 4K5CA 2ZXWE 3Q9UC 4G1TA 2XEEA 1Q2ZA 3WG7E 1TJCA 4ZHBA 4HOSA 2UWJG 2V5FA 4ACKA 5FTPA 2YINA 3I5PA 3ZVVA 3E34A 3EJNA 3GYZA 4IYPA 2WB2A 1YCSB 3DEOA 3DPDA 3TG4A 1TNYA 4XEIG 1YMPA 3V79K 4YDYA 1H0AA 1WM5A 3ZGQA 3MZLB 2J07A 4EHMA 3Q9NC 4LG6A 1WDYA 2H6IA 3ASFA 1XGWA 3FUDA 3NZUA 4XIFA 3D9PA 1BI8B 4A1GA 4DRXE 3LXUX 2WXNA 4GCOA 2Y3AA 4U96D 3IV0A 3Q7FA 1TNZA 4MS6A 4W9RA 3C3RA 3PNTB 1MX2A 3G2VA 4PDXA 4CGWA 3RU0A 4FU3A 3UINC 3BQOA 4J7WA 3VTXA 4WNGA 2VSYA 3D9KA 4OYSA 3AJIA 3RIBA 3NF1A 2X38A 4HLLA 2PNNA 3JUIA 4JHRA 3V2OA 3TAXA 2IO3C 5D66A 4LSZE 1IXVA 4RLYA 3ZPJA 5CHEE 2R02A 3CR3A 5FZQA 5CEDB 4JD2G 3TWVA 3DSSA 4FHJA 2J4BA 3FTXA 3HDXA 4XE0A 4HRNA 2OVBA 5JJ7A 1ZBPA 3AS4A 2CFUA 3CVPA 4AM9A 4GMRA 4J8YA 5BUZA 4N2QA 2J08A 1TN6A 4XX5A 4WWPA 3MKQB 4UQZA 5CRVA 4GU5A 4ANVA 2PL2A 4Q94A 4Z68A 4K5AB 2XEHA 3ZYQA 3FWVA 5AQBA 1TR4A 5KCMA 4LEUA 2KXPC 3DSVA 4UWFA 1YA0A 2DYRE 2R2LA 4BX8A 1H19A 2QFCA 3G2SA 2X6HA 5FQ6A 5AENA 2A4ZA 1X81A 3W9FA 4GA0A 5EN5D 3URZA 1ZB1A 5ENOD 3PE3A 2XRZA 4BFRA 5FQ7A 3TWQA 4FP7A 3L82A 3S7BA 3CQGB 4I2ZA 1TNOA 4CRWA 1N4PA 4G26A 2LNIA 3AG1E 4O1OA 3QNKA 4BTBA 1DCQA 3IBEA 2MRIA 4CT4A 2WXQA 4MBGA 1U2VG 3UTMA 4N5QA 5T8IA 2L6BA 1K1BA 3EUVA 3R9MA 3NB2A 5T3RA 1TNBA 2YQ8A 1IQRA 3KEZA 4H7XA 4AV7A 1IHBA 3UIOC 3JYSA 4DUIA 3SF4A 3UT8A 4PS7A 2X6FA 3MX3A 3FH8A 5DIZA 4KVMA 4JA9A 3EHRA 2C2LA 3NAWA 2DCPA 3TXMA 3MCXA 3EU5A 4KBQA 3E33A 3O4ZA 2I1JA 2XCCA 1E8ZA 5EILA 3RO2A 3UM1A 4OAUC 3L13A 4AIFA 1QQEA 4FC8A 3S7FA 1OWPA 3FEXA 4LNBA 4I2WA 3SO8A 2BF0X 1ELRA 1MJ0A 2IQCA 3UI2A 3T8KA 2J4DA 1H6OA 1X5BA 1UOHA 4B93B 1BPOA 3U3WA 2QYUA 3ENEA 4ILHB 3IHVA 4L1BA 2DIWA 2DYSE 2NYJA 2XS8A 3TWSA 2OEVA 2XPYA 3LJ3A 3PZ1A 1K8KG 1W3BA 4XKBA 3CHMA 2VSXE 3SBTB 2WXJA 4ATGA 4GTOA 1HX8A 1HXIA 3L17A 3QDNA 1H2UA 4WUYA 3PREA 3U64A 2KCKA 1LD8A 2QYJA 4RQIA 1IHGA 3DRAA 3DXMG 1HG5A 2MOWA 4NRHB 3V2XA 5JHAA 1N0RA 2GW1A 4GMJA 3CVWA 4U8VD 4TXQA 4UI9C 4GA2A 3CVVA 1JPLA 3ZYLA 5LP0A 5FZSA 1DVPA 3AS5A 5LFAA 4JHJA 4PS3A 2WXFA
chains in the Genus database with same CATH topology
1ELWA 2LAIA 4M3OA 4U0ZA 5LCWJ 3N71A 1QZ2A 4JC8A 3JQ1A 4FADA 2AXVA 3RRNB 3PH0C 5FWQA 2J9QA 3CK7A 3ESLA 3FUEA 2WXIA 2ZU6B 2WQHA 3OTNA 3G2WA 5A23A 2R59A 4ILGA 4HXIA 3FUIA 4IRUA 4JXTA 3SZ7A 4N3CA 2I2OA 4BY6A 4F7AA 4AJWA 3QWWA 3LY9A 1E8WA 4F3VA 4JHKA 4DPRA 3PVLA 4B8CB 1OWLA 1HG2A 3FH5A 3QC1A 2L6JA 3ONLA 2AWIA 3MGBA 2IJGX 3HYMB 1FVHA 3UUXA 4K03A 4L7TA 5LCWC 3TJPA 3S7DA 4H7YA 1HE8A 2WXKA 4KT6B 4C9BB 4G1TA 2GGFA 5FJYA 1N52A 3ZHEA 3LVQE 4AXHA 3EIQC 5G2NA 2E2EA 1TJCA 1TJFA 2XPZA 1U3DA 4UWGA 4HOSA 3SGHA 3O48A 2UWJG 3QARA 2V5FA 4ACKA 3CHPA 5FTPA 3ZFWA 2WQ7A 2YINA 3G2TA 3MKRA 2CHZA 3I5PA 3NQPA 4CDMA 4NQ0A 2X6IA 5BW8C 3ZVVA 2IOSA 2ONDA 3U4TA 3EJNA 5BV0A 3BG1B 3CGHA 3GYZA 4HOUA 4IYPA 2VJ8A 4FJYA 4ACLA 2WB2A 3DPDA 3FUMA 3QWPA 4G25A 4J8SA 1JWGA 4E85A 3TG4A 2KC7A 4KZ0A 1E8XA 5AJLA 2RD0A 2KZTB 4LERA 4I9EA 4A55A 1H0AA 1WM5A 2HR2A 3RO3A 3ZGQA 3MZLB 3RRMB 3R7RA 2J07A 3APDA 3TXNA 3FFLA 5CMYA 4YVOA 4KYOB 1UN9A 3IHYA 5AYWD 3HIZA 5CMWA 4B0ZA 3CVUA 3ASFA 1XGWA 3P1UA 2KATA 4J6IA 3FUDA 4EZLA 3UPVA 3HVEA 3NZUA 3L16A 3LS8A 4XIFA 5E76A 3ULQA 3D9PA 4PUCA 4GMLA 3FUNA 1B89A 4A1GA 3LXUX 2LSVA 2WXNA 4JA7A 4C0EA 4DK5A 3GZ1A 1KT1A 4GCOA 4JW1A 4LCTA 1H2VC 2Y3AA 2WMOA 2AVPA 2FEZA 2L0TB 2PQRA 3ASHA 3FU6A 3ZIMA 5BT1A 1JWFA 3IV0A 5EX0A 1PC2A 1SZ9A 2PM7A 4MS6A 4L23A 4LRZA 4EQFA 4W9RA 3PNTB 3R7QA 3FUFA 4AP2A 3I4GA 3G2VA 2A5UA 3SHFA 2WM9A 4PDXA 2VGXA 3ASGA 4GYOA 3TL5A 4BSXA 4CGWA 4L2LA 3RU0A 3APFA 3K9IA 4G24A 4FU3A 3TGOA 4HS2A 3FU3A 3VTXA 4CDRA 4BT9A 3FTYA 3FH7A 3OXGA 2PZIA 2FI7A 2FBNA 4WNGA 2VTBB 1NA0A 1TEZA 3BEEA 3D9OA 2VSYA 5C2YA 4F53A 2PM6A 3D9LA 3D9KA 3LVRE 4ANUA 2Q7FA 4OYSA 4N5CA 3Q4AB 2Y4TA 4AVXA 4AY6A 4RG9A 1UJJA 3APCA 4MKTA 1SQMA 3CLJA 3NF1A 4PH4B 3RIBA 4GZ5A 3ZYKA 3FTUA 4G11A 3VTYA 3CV0A 2X38A 4GPKA 3LYAA 3JUIA 4JHRA 2XQ0A 3I3NA 2WVIA 3FHEA 3TAXA 2WXLA 2JLBA 4P29A 1ELKA 5BNWA 5JHBA 3RRUA 1MHQA 5CHEE 3ZPJA 3EHNA 3FY4A 1EF1C 2J49A 3S7JA 3C98A 3CR3A 5FZQA 5EKQD 4B89A 3ZW3A 5E75A 1S0PA 4JPSA 5KJNA 2VGYA 4FHJA 4HVBA 2J4BA 1Y8MA 3FTXA 2I1KA 3HDXA 4XE0A 4RG6A 5M72A 3SFZA 3ZXSA 2OVBA 3PS6A 5JJ7A 3FTZA 2I6HA 4I17A 1ZBPA 3CHOA 3AS4A 4N39A 2CFUA 3CVPA 4JVSA 3ONKA 3FU0A 2NC9A 4AM9A 5A6CA 5DBKA 4J8EA 3LKUA 4FJZA 5BUZA 4N2QA 2GRMA 3ASDA 5FQ4A 3R9AB 3CK9A 2J08A 4DLQA 2R17C 2AXZA 2CG2A 4KXKB 5EX3A 4EECA 5HQ8A 4KZCA 2AW6A 4WWPA 4XX5A 3MKQB 2UY1B 3MJWA 2FULA 4APFA 5A7DB 4UQZA 2OVFA 1H6KA 2XGSA 4FLHA 2XCBA 4GU5A 3AU5A 4HOQA 3CVLA 4ANVA 2QY7A 3SBSA 2PL2A 3EHMA 1E96B 2WPVA 5FT9A 4AEZC 4J8DA 2YHEA 3FU5A 4HLEA 3ML8A 4U0UA 4N2SA 4Q94A 5LX8A 2NSZA 3P2BA 2L0IA 4YNDA 3ZYMA 1E8YA 3EIJA 3ZYQA 4Q96A 3PNLB 3FWVA 3JQ0A 1Z6TA 3FTWA 1U3CA 5KCMA 4LEUA 3PUJA 3PZDA 1WY6A 3U9WA 2XRYA 2OV8A 3VLFA 2VSNA 3CHQA 4UWFA 3FTSA 1NP7A 1YA0A 3D9MA 4OVVA 1Y6IA 4MLPA 4HORA 4KVOA 1EDUA 2VTBA 3RKVA 5CCMA 4BX8A 1H19A 1E7VA 2QFCA 3G2SA 5JJTA 3SD5A 5C1DA 4GA1A 2X6HA 1JUQA 2WXOA 3LY8A 3CK8A 3QWVA 4DI3A 3OAWA 5FQ6A 5AENA 4BT8A 3CVQA 2VQ2A 3B7SA 3NZSA 4TV3A 3WXXA 1OWNA 2A4ZA 2OOEA 4GA0A 4GAAA 4FULA 1GW6A 1QNFA 3T8MA 3URZA 1N54A 3FDHA 3VLDA 4A3VA 2WXGA 4DJAA 3LEWA 2XPIA 5D0OD 3PE3A 2XRZA 4BFRA 4R7LA 5FQ7A 1P5QA 4FP7A 4J8FA 4KMOA 4UWHA 1A17A 3S7BA 1UN8A 2XGMA 3ZRHA 3CQGB 2XEVA 4I2ZA 1HF8A 4CRWA 4XI0A 4IN3B 5LOZA 1DNPA 3ML9A 1HU3A 3AU4A 4G26A 4O6FA 3I4RB 4UI9K 5KJMA 2LNIA 5ARGA 2HO1A 3CHSA 1PAQA 3MYVA 1HO8A 4QFVA 5ANRA 3QNKA 5ARFA 3MV3B 4Y6WA 4DLOA 5T4YA 1INZA 4BTAA 4JZYA 5J90A 3ESKA 4BTBA 5AJDA 2FF4A 3UT7A 4WWOA 3U66A 3PEVB 4GYYA 4G2VA 4N3BA 3Q15A 4F1SA 2CHXA 3IBEA 2MRIA 4I6EA 4CT4A 4EBAG 2LAHA 3KAEA 2WXQA 4GB9A 1NZNA 5T8IA 1E7UA 2FO7A 1MQSA 3BG0B 3TG5A 4EBAA 3Q49B 4CGVA 4PS8A 2UY1A 4CEMA 2XHEA 4CDNA 3CVYA 4WNFA 1LF8A 3CIAA 2GRLA 3MV2B 5T3RA 3PUKA 4E6HA 4URKA 3HVEB 4G23A 2IU1A 4UWLA 4HFGA 2YQ8A 1IQRA 3CEQA 3KEZA 4H7XA 1HZ4A 3FUKA 1FVFA 3KD7A 3LCAA 4I1MA 4AV7A 3UX4A 2IFUA 4U07A 4V3IA 3JYSA 3SF4A 2CHWA 1E90A 4JL0A 3UT8A 4UQYA 4PS7A 4BX9A 2X6FA 1Z3XA 2X6JA 4B8AA 4B94A 3MX3A 2KZTA 3FH8A 3B7TA 4ME2A 4UWKA 3DBSA 5D0QD 5DIZA 4WNDA 3L54A 4KVMA 3RJVA 3MA5A 4EZKA 4JA9A 4WNEA 4DI4A 5J08A 4FHKA 2C2LA 2R5SA 2DCPA 2MHKA 3FUJA 1OWOA 3TXMA 3MCXA 5AIJA 3CVNA 4XZ4A 4APOA 1UG3A 2KCVA 3D9JA 1PY1A 4KBQA 4ILIA 3O4ZA 2I1JA 3SI5A 3LY7A 2DBAA 3L6AA 3QB2A 3Q5MA 3GZ2A 2XCCA 3B7RL 1E8ZA 1OUVA 2VYIA 4NURA 5G05J 4C0MA 3CHRA 5JJ6A 3QOUA 1UW4B 2AXUA 3RO2A 3FUHA 2PQNA 3D9NA 4GZ3A 3AS8A 2C0MA 5ENNA 2KCLA 2ILRA 4GYWA 3L13A 4LUNU 4I1AA 4EZJA 1OWMA 2C0LA 5G04J 4AIFA 1QQEA 4FC8A 3CKBA 1H2TC 3QKYA 2XGOA 3S7FA 5KJKA 1OWPA 3FEXA 4JEHA 4GZ6A 3G2UA 5HI7A 4CT0A 4I2WA 2BF0X 1ELRA 1FCHA 1IQUA 3IKOB 5BPPA 3E4BA 2IQCA 5G05C 4XI9A 5ANLA 5FQ8A 3PEUB 2J4DA 4I6JA 2M63A 2Y4UA 1X5BA 3L08A 3ZN3A 4UQXA 1EPUA 4I1OB 1BPOA 3T5VA 3U3WA 3LDZA 5G04C 3ENEA 4Q69A 4ILHB 3QJZA 2RG8A 4N3AA 3IHVA 4L1BA 1HH8A 4A3TA 3MEKA 2X3MA 2DIWA 4IULA 2VSOE 2NXPA 2WQ6A 3SNXA 2X6KA 4RSYA 2CG3A 2XPYA 3LJ3A 3UT4A 1L5JA 4J0UA 1W3BA 3HHMA 2WXMA 3QAQA 4XKBA 4CCAA 3D3MA 4K0RA 4WAFA 3EDTB 3CHMA 3CKCA 1ZU2A 3FP3A 4I9CA 2VSXE 4MRUA 3KS2A 4U8HA 3SBTB 2CFZA 2WXJA 1IYGA 4OVUA 4ATGA 3ZHEB 1HX8A 5FZRA 1HXIA 3IEGA 2BTDA 3ZEFA 2V4LA 4GCNA 3L17A 3B13A 4D10C 2IF4A 3D9IA 2LSUA 3QDNA 1H2UA 1WAO1 4ANXA 5KJLA 3GW4A 1HFAA 4EPZA 4U63A 4WUYA 3CQCB 3PREA 2WXRA 3U64A 4AOFA 3T5XA 3FULA 4Y6CA 3PE4A 3UQ3A 1KT0A 2V8SE 1SZAA 2WXPA 2HYZA 4XKCA 2JEKA 5CCLA 4U0SA 4YVQC 5G55A 2KCKA 2IOLA 3PRZA 3CSTA 2J09A 3JCKC 3FTVA 4UI9J 1IHGA 3B7UX 4HOTA 1VDYA 2WXHA 3Q47B 4TRQA 4FA6A 3OXLA 2L9BA 4NACA 3MKQA 1HG5A 2LO6A 1Z3YA 4GZDA 2MOWA 4L2YA 4NRHB 3LPZA 3CVXA 4A1SA 5JHAA 2IONA 1NA3A 3PDNA 1EYHA 4FLBA 2KM4A 1HS6A 3QK0A 3RK6A 2E0IA 2GW1A 4GMJA 4AY5A 2HM8A 3CVWA 3CSFA 3GZSA 4ABNA 4UI9C 4GA2A 4U04A 3CVVA 2YHCA 1JPLA 2EQXA 2I9CA 2YNQA 1XNFA 2V0PA 3ZYLA 3L22A 3S2AA 3OXFA 5LP0A 1KLXA 5BV1A 4I6GA 1UJKA 3FEYA 4RVBA 3VLEA 5EDSA 4TUUA 4JEUA 2BUGA 2WMNA 5FZSA 1DVPA 3AS5A 5LFAA 4WWNA 3UMVA 2P58C 2VGXB 4JHJA 4PS3A 4I43A 4GZCA 4BWRA 4ANWA 2WXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELW A;  4U0Z A;  5LCW J;  3N71 A;  1QZ2 A;  2J9Q A;  3CK7 A;  2WQH A;  3SZ7 A;  4N3C A;  3QWW A;  3LY9 A;  4F3V A;  2L6J A;  3HYM B;  3UUX A;  5LCW C;  3S7D A;  4H7Y A;  4G1T A;  5FJY A;  3ZHE A;  2E2E A;  1TJC A;  4HOS A;  3O48 A;  2UWJ G;  2V5F A;  5FTP A;  3ZFW A;  3MKR A;  4NQ0 A;  5BW8 C;  2OND A;  3U4T A;  3GYZ A;  4HOU A;  3QWP A;  4G25 A;  3TG4 A;  2KC7 A;  4I9E A;  1WM5 A;  2HR2 A;  3RO3 A;  3ZGQ A;  3FFL A;  4YVO A;  4KYO B;  5AYW D;  3ASF A;  2KAT A;  3UPV A;  4XIF A;  3ULQ A;  1B89 A;  2LSV A;  4JA7 A;  3GZ1 A;  1KT1 A;  4GCO A;  2AVP A;  2FEZ A;  5BT1 A;  3ASH A;  2PQR A;  5EX0 A;  1PC2 A;  4EQF A;  4W9R A;  2VGX A;  3ASG A;  4GYO A;  4CGW A;  3RU0 A;  3K9I A;  4G24 A;  3TGO A;  3VTX A;  4CDR A;  4BT9 A;  3OXG A;  2PZI A;  2FI7 A;  2FBN A;  4WNG A;  1NA0 A;  3BEE A;  2VSY A;  2Q7F A;  4N5C A;  3Q4A B;  2Y4T A;  4AY6 A;  4RG9 A;  3RIB A;  3NF1 A;  4GZ5 A;  3VTY A;  3CV0 A;  4GPK A;  3LYA A;  4JHR A;  3TAX A;  2JLB A;  5BNW A;  3ZPJ A;  5CHE E;  3S7J A;  5FZQ A;  5EKQ D;  5KJN A;  2VGY A;  1Y8M A;  4RG6 A;  5M72 A;  5JJ7 A;  2I6H A;  4I17 A;  1ZBP A;  3AS4 A;  4N39 A;  3CVP A;  2NC9 A;  4AM9 A;  5A6C A;  5DBK A;  4J8E A;  3LKU A;  4N2Q A;  3ASD A;  3R9A B;  3CK9 A;  5EX3 A;  4KXK B;  5HQ8 A;  2UY1 B;  5A7D B;  4UQZ A;  2XGS A;  2XCB A;  4HOQ A;  3CVL A;  2PL2 A;  5FT9 A;  1E96 B;  2WPV A;  4J8D A;  4U0U A;  4N2S A;  4YND A;  3FWV A;  4LEU A;  2VSN A;  1YA0 A;  4HOR A;  3RKV A;  5CCM A;  2QFC A;  5JJT A;  5C1D A;  4GA1 A;  3LY8 A;  3CK8 A;  3QWV A;  4BT8 A;  3CVQ A;  2VQ2 A;  3WXX A;  2OOE A;  4GA0 A;  3URZ A;  2XPI A;  5D0O D;  3PE3 A;  1P5Q A;  4J8F A;  1A17 A;  3S7B A;  2XGM A;  2XEV A;  4I2Z A;  4XI0 A;  4IN3 B;  4G26 A;  4O6F A;  5KJM A;  4UI9 K;  2LNI A;  5ARG A;  2HO1 A;  5ARF A;  3MV3 B;  4Y6W A;  4BTA A;  3ESK A;  4BTB A;  2FF4 A;  4GYY A;  4G2V A;  4N3B A;  3Q15 A;  3KAE A;  1NZN A;  2FO7 A;  3TG5 A;  3Q49 B;  4CGV A;  2UY1 A;  4WNF A;  3MV2 B;  4G23 A;  2YQ8 A;  3CEQ A;  4H7X A;  1HZ4 A;  3LCA A;  3KD7 A;  2IFU A;  4U07 A;  3JYS A;  3SF4 A;  4JL0 A;  4UQY A;  4B94 A;  4ME2 A;  5D0Q D;  5DIZ A;  4WND A;  3RJV A;  3MA5 A;  4JA9 A;  4WNE A;  2C2L A;  2R5S A;  2MHK A;  3CVN A;  4APO A;  2KCV A;  4KBQ A;  3LY7 A;  2DBA A;  3Q5M A;  3GZ2 A;  2XCC A;  1OUV A;  2VYI A;  5G05 J;  5JJ6 A;  3QOU A;  3RO2 A;  2PQN A;  4GZ3 A;  3AS8 A;  2C0M A;  2KCL A;  4GYW A;  4I1A A;  2C0L A;  5G04 J;  4AIF A;  1QQE A;  3CKB A;  3QKY A;  2XGO A;  3S7F A;  5KJK A;  4GZ6 A;  5HI7 A;  4I2W A;  1ELR A;  1FCH A;  3E4B A;  5G05 C;  4XI9 A;  2Y4U A;  3ZN3 A;  4UQX A;  3U3W A;  5G04 C;  4N3A A;  1HH8 A;  3MEK A;  4J0U A;  1W3B A;  3EDT B;  3CKC A;  1ZU2 A;  3FP3 A;  4I9C A;  3KS2 A;  1IYG A;  3ZHE B;  5FZR A;  1HXI A;  3IEG A;  4GCN A;  2IF4 A;  2LSU A;  3QDN A;  1WAO 1;  5KJL A;  3GW4 A;  4WUY A;  4Y6C A;  3PE4 A;  3UQ3 A;  1KT0 A;  2HYZ A;  5CCL A;  4U0S A;  4YVQ C;  2KCK A;  4UI9 J;  1IHG A;  4HOT A;  3Q47 B;  3OXL A;  4NRH B;  3LPZ A;  4A1S A;  1NA3 A;  3PDN A;  2GW1 A;  4AY5 A;  4ABN A;  4UI9 C;  4GA2 A;  4U04 A;  2YHC A;  1XNF A;  3OXF A;  1KLX A;  2BUG A;  5FZS A;  3AS5 A;  2P58 C;  2VGX B;  4BWR A; 
#chains in the Genus database with same CATH topology
 2LAI A;  4M3O A;  3AG3 E;  5LCW J;  3KEA A;  4FAD A;  2AXV A;  2WQH A;  3UM0 A;  2ETB A;  4F7A A;  4N3C A;  3LY9 A;  3PVL A;  5KNH D;  2AWI A;  1FVH A;  4HB5 A;  3ISM C;  4KT6 B;  2GGF A;  5FJY A;  3UIP C;  2P9K G;  1V54 E;  2P9I G;  3QAR A;  1TN7 A;  4NQ0 A;  2EIK E;  5BXU A;  3U4T A;  5AQ9 A;  1N94 A;  3FUM A;  1JWG A;  4E85 A;  2KC7 A;  2RD0 A;  2HR2 A;  4YVO A;  5CMW A;  1UN9 A;  3HXE A;  2KAT A;  3LS8 A;  1K3Z D;  3FUN A;  1B89 A;  2LSV A;  4JA7 A;  4C0E A;  4DK5 A;  4GTM A;  4LCT A;  3ZIM A;  3FU6 A;  2WMO A;  3ASH A;  2PQR A;  1PC2 A;  4O1P A;  3FUF A;  2WM9 A;  1BI7 B;  3ASG A;  4BSX A;  4L2L A;  3DST A;  2P2C P;  3APF A;  4G24 A;  3E30 A;  4HS2 A;  2F8X K;  4BT9 A;  3OXG A;  1Z5S C;  3D9O A;  5C2Y A;  3D9L A;  3Q4A B;  2Y69 E;  4RG9 A;  1SA4 A;  1UJJ A;  3APC A;  4MKT A;  3CLJ A;  3ZYK A;  2ZGG A;  4GPK A;  4GTR A;  3RRU A;  1MHQ A;  3S7J A;  2V4H C;  5EKQ D;  3ZW3 A;  4BET A;  5E75 A;  4JPS A;  1S64 A;  1KZP A;  3ZXS A;  3DSW A;  3CHO A;  3FU0 A;  3C3O A;  4J8E A;  2XS1 A;  1N4S A;  3ASD A;  3R9A B;  2AXZ A;  2CG2 A;  4KXK B;  2AW6 A;  4HNA D;  3MJW A;  3TWU A;  2OVF A;  4FLH A;  4HOQ A;  1E96 B;  2WPV A;  4AEZ C;  5CBN A;  3EU9 A;  4HLE A;  4CZ2 D;  1SA5 A;  3ABL E;  3ZYM A;  3Q75 A;  1BD8 A;  3PZD A;  1MX6 A;  3U9W A;  2XRY A;  2OV8 A;  2VSN A;  3CHQ A;  1NP7 A;  2XZD G;  5AQA A;  2BKG A;  4OVV A;  4HOR A;  4GTS A;  1EDU A;  2VTB A;  1E7V A;  2P9P G;  3SD5 A;  5C1D A;  4GA1 A;  3LY8 A;  3AAA C;  3CVQ A;  3NZS A;  4TV3 A;  3WXX A;  2OOE A;  1GW6 A;  3T8M A;  1N54 A;  3LEW A;  4R7L A;  1P5Q A;  2XGM A;  4IN3 B;  3ML9 A;  1HU3 A;  4UI9 K;  5ARG A;  1PAQ A;  4QFV A;  3MV3 B;  4Y6W A;  3UKR G;  4DLO A;  2FF4 A;  3UT7 A;  2HE0 A;  3PEV B;  5D2M C;  4I6E A;  3KAE A;  1NZN A;  1E7U A;  3BG0 B;  3TG5 A;  3Q49 B;  4PS8 A;  2UY1 A;  5AAO A;  1N11 A;  4JB8 P;  4WNF A;  2P9L G;  4TUM A;  2GRL A;  3PUK A;  4E6H A;  4U95 D;  4UWL A;  3CEQ A;  1HZ4 A;  3FUK A;  3LCA A;  3KD7 A;  3UKU G;  4BSZ B;  5CEC B;  3UX4 A;  4U07 A;  5ENP D;  1LD7 A;  1IKN D;  4UQY A;  2KZT A;  5D0Q D;  3DSX A;  4EZK A;  4DI4 A;  2MHK A;  2ETA A;  1YYH A;  4XZ4 A;  2KCV A;  4ILI A;  1O1R A;  3LY7 A;  2DBA A;  3L6A A;  3T9K A;  2VYI A;  2BKK B;  1RW2 A;  5EYL A;  4NIK A;  1UW4 B;  2AXU A;  3D9N A;  3KSQ A;  3AS8 A;  2C0M A;  2ILR A;  4GYW A;  4X8Q A;  4LUN U;  4I1A A;  2C0L A;  5G04 J;  1H2T C;  5KJK A;  4JEH A;  4CT0 A;  5HKP A;  3IKO B;  2Y0B G;  5BPP A;  2R05 A;  5ENQ D;  3E4B A;  4A63 B;  2M63 A;  3ZN3 A;  4TXR A;  4UQX A;  4I1O B;  2Y1L E;  3LDZ A;  2RG8 A;  4N3A A;  5FIN A;  1HH8 A;  4A3T A;  3MEK A;  2WQ6 A;  2X6K A;  4K5B A;  1L5J A;  3HHM A;  4CCA A;  3EDT B;  3B7B A;  3CKC A;  4DX7 D;  4DX1 A;  4OVU A;  5FZR A;  1MYO A;  2V4L A;  4D10 C;  5KWD A;  1D9S A;  2LSU A;  5KJL A;  3KSL A;  3CQC B;  3PE4 A;  3NBN B;  2V8S E;  1SZA A;  4U0S A;  2F0Y A;  1MX4 A;  5ENR D;  5ENT D;  3JCK C;  3FTV A;  4O60 A;  4HOT A;  3AG4 E;  3OXL A;  2L9B A;  1A5E A;  2LO6 A;  3ZNG A;  1Z3Y A;  4GZD A;  1OCZ E;  3LPZ A;  3CVX A;  1EYH A;  3J5P A;  4FLB A;  2E0I A;  4AY5 A;  3Q78 A;  2YNQ A;  1H6P A;  2V0P A;  4DX6 D;  4I6G A;  4G8K A;  4JEU A;  2P58 C;  4GZC A;  4ANW A;  2EIN E;  3N71 A;  1QZ2 A;  3JQ1 A;  3RRN B;  5FWQ A;  3OTN A;  5A23 A;  4ILG A;  4HXI A;  3W9G A;  3FUI A;  4IRU A;  3QWW A;  1OWL A;  4BER A;  2H6H A;  1V55 E;  3ULY A;  3MGB A;  1DC2 A;  5LCW C;  3S7D A;  1HE8 A;  4C9B B;  2OCC E;  1TN8 A;  1N52 A;  3ZHE A;  5KNG A;  3EIQ C;  2XPZ A;  4UWG A;  3SGH A;  1MZC A;  3CHP A;  4GTQ A;  3ZFW A;  3G2T A;  2CHZ A;  3NQP A;  2X6I A;  5BW8 C;  5CER B;  2OND A;  3BG1 B;  4HOU A;  4FJY A;  4ACL A;  3QWP A;  4KZ0 A;  3PZ3 A;  2KZT B;  4LER A;  4A55 A;  2A5E A;  3RO3 A;  3ASO E;  3R7R A;  4KYO B;  3IHY A;  5AYW D;  3HIZ A;  3P1U A;  4J6I A;  3L16 A;  3ABK E;  5E76 A;  4PUC A;  2IY0 C;  3GZ1 A;  4JW1 A;  4NUR A;  1H2V C;  2AVP A;  2FEZ A;  2L0T B;  4CDM A;  5BT1 A;  2PM7 A;  4LRZ A;  4EQF A;  2RFM A;  4AP2 A;  3TWW A;  2VGX A;  4TXP A;  3TL5 A;  3K9I A;  3TGO A;  4DX5 D;  3FU3 A;  3FTY A;  2PZI A;  2FI7 A;  1NA0 A;  1TEZ A;  3BEE A;  4F53 A;  3LVR E;  4ANU A;  2Q7F A;  3PZ4 A;  4N5C A;  4M7C A;  4AVX A;  4AY6 A;  4CYM D;  4LNU D;  3FTU A;  3VTY A;  3CV0 A;  3LYA A;  2GRR B;  3I3N A;  4P29 A;  5JHB A;  3EHN A;  1EF1 C;  2J49 A;  3C98 A;  3SY2 A;  1S0P A;  2VGY A;  4HRM B;  3ULE G;  3SFZ A;  3PS6 A;  2GRQ B;  3E37 A;  3FTZ A;  2I6H A;  4GTV A;  5JMN D;  3ONK A;  2NC9 A;  3LKU A;  1BLX B;  5FQ4 A;  5HRY A;  3CK9 A;  2R17 C;  5EX3 A;  4KZC A;  4APF A;  3SFX A;  1H6K A;  1O5M A;  2XCB A;  3AU5 A;  2QY7 A;  5FT9 A;  2YHE A;  3FU5 A;  4U8Y D;  5LX8 A;  2GRO B;  2NSZ A;  4YND A;  4Q96 A;  3PNL B;  3FTW A;  1WY6 A;  3DPY A;  4HQD A;  5CCM A;  3BUA A;  1JUQ A;  3CK8 A;  1WG0 A;  4BT8 A;  3UM2 A;  3B7S A;  2F8Y A;  5B1A E;  2H6F A;  1QNF A;  2WXG A;  3L9T A;  4DX2 A;  2XPI A;  1QBQ A;  5IY5 E;  3HXC A;  4J8F A;  4UWH A;  1UN8 A;  1HF8 A;  4XI0 A;  4G8L A;  5LOZ A;  4UUC A;  4O6F A;  3AU4 A;  4YDE A;  2HO1 A;  3CHS A;  3MYV A;  1HO8 A;  5ANR A;  5ARF A;  5T4Y A;  5AQ7 A;  1INZ A;  1FPP A;  4JZY A;  5J90 A;  4WWO A;  3Q15 A;  4F1S A;  2CHX A;  1OY3 D;  1DCE A;  5BXO A;  4GB9 A;  3UM3 A;  4EBA A;  2QC9 A;  4CGV A;  1SW6 A;  4CEM A;  2XHE A;  4CDN A;  5CEA A;  4URK A;  4G23 A;  1AP7 A;  4HFG A;  3EHQ A;  1FVF A;  1OCR E;  3V31 A;  4BX9 A;  2X6J A;  4B8A A;  4B94 A;  3B7T A;  4UWK A;  3DBS A;  3L54 A;  4WNE A;  3ZUV B;  5AIJ A;  3CVN A;  1UG3 A;  3D9J A;  1PY1 A;  3PZ2 A;  3SFY A;  1OUV A;  5G05 J;  3CHR A;  5JJ6 A;  3FUH A;  2EIL E;  1N9A A;  5ENN A;  3HXF A;  2KCL A;  4EZJ A;  1OWM A;  2JAB A;  3CKB A;  3QKY A;  2XGO A;  4GZ6 A;  2OEW A;  3G2U A;  5HI7 A;  1FCH A;  1IQU A;  5CBO A;  5FQ8 A;  3PEU B;  3L08 A;  3V30 A;  1EPU A;  2GRN B;  3T5V A;  5G04 C;  3QJZ A;  1TNU A;  2X3M A;  3ABM E;  4RSY A;  2CG3 A;  3UT4 A;  2WXM A;  3QAQ A;  3D3M A;  4WAF A;  1ZU2 A;  3FP3 A;  2RFA A;  5B1B E;  3IEG A;  2BTD A;  3ZEF A;  4GCN A;  1S70 B;  3D9I A;  3SQV A;  1WAO 1;  3GW4 A;  1HFA A;  3LJN A;  3T5X A;  3FUL A;  2BED A;  4Y6C A;  1OXJ A;  3Q7A A;  1KT0 A;  5H7P A;  2WXP A;  2HYZ A;  4XKC A;  2JEK A;  5G55 A;  3PRZ A;  3B7U X;  2WXH A;  3Q47 B;  3JUE A;  4NAC A;  4L2Y A;  4A1S A;  3PDN A;  2KM4 A;  1NL4 A;  2HM8 A;  4QQI A;  1K1A A;  3GZS A;  2XZT G;  4U04 A;  4HI8 A;  3NOG D;  3S2A A;  3OXF A;  3Q73 A;  1UJK A;  5EDS A;  5FIO A;  4TUU A;  2BUG A;  2WMN A;  3UMV A;  4I43 A;  3HRA A;  4BWR A;  1ELW A;  2MYO A;  4JC8 A;  1TYQ G;  2J9Q A;  2WXI A;  1D8D A;  2ZU6 B;  2FO1 E;  5HS0 A;  3SZ7 A;  4BY6 A;  4F3V A;  4B8C B;  1HG2 A;  3FH5 A;  3QC1 A;  5ENS D;  2L6J A;  3ONL A;  3HYM B;  4H7Y A;  1D8E A;  2WXK A;  5KBA A;  3ASN E;  5CRU A;  1NI1 A;  3LVQ E;  4AXH A;  5G2N A;  2E2E A;  1N0Q A;  1TJF A;  1U3D A;  3O48 A;  2WQ7 A;  3MKR A;  1AWC B;  1KZO A;  2IOS A;  5BV0 A;  3CGH A;  5EID A;  2VJ8 A;  4G25 A;  4J8S A;  4U7E B;  1E8X A;  3C3Q A;  5AJL A;  4I9E A;  2KBX A;  1JCR A;  3RRM B;  3APD A;  3TXN A;  3FFL A;  5CMY A;  4B0Z A;  3CVU A;  3X2Q E;  4EZL A;  3UPV A;  3HVE A;  3ULQ A;  4GML A;  1KT1 A;  2EIJ E;  1JWF A;  5EX0 A;  1SZ9 A;  4L23 A;  3TWX A;  3R7Q A;  2DVW A;  3I4G A;  2A5U A;  3SHF A;  4GYO A;  1S63 A;  2VGE A;  1BU9 A;  2B6C A;  3B95 A;  4CDR A;  3FH7 A;  2FBN A;  3HXB A;  3TWR A;  2VTB B;  4GTT A;  3C72 A;  5B3S E;  2PM6 A;  2Y4T A;  1JCQ A;  5AAR A;  1SQM A;  4PH4 B;  4ATZ D;  4GZ5 A;  1FT1 A;  4G11 A;  4GPM A;  1OCO E;  2XQ0 A;  2WVI A;  3FHE A;  2WXL A;  2JLB A;  2F37 A;  3DXK G;  3JXI A;  1ELK A;  4YDW A;  5BNW A;  3FY4 A;  3RAU A;  4B89 A;  5KJN A;  4HVB A;  1Y8M A;  2P9N G;  2I1K A;  4RG6 A;  5M72 A;  1KPS B;  4I17 A;  1LTX A;  4N39 A;  3DSU A;  4JVS A;  5A6C A;  5DBK A;  4FJZ A;  2IO2 C;  1SVX A;  2GRM A;  1O1S A;  4DLQ A;  4EEC A;  2LXL A;  5HQ8 A;  2UY1 B;  2FUL A;  2LUH A;  5A7D B;  5ITZ F;  2XGS A;  3CVL A;  3SBS A;  3ZKJ A;  3EHM A;  1OT8 A;  4J8D A;  3ML8 A;  3C5R A;  4U0U A;  4N2S A;  3P2B A;  2L0I A;  3AG2 E;  1E8Y A;  3EIJ A;  2R03 A;  3JQ0 A;  1Z6T A;  1N4Q A;  1U3C A;  3BU8 A;  2ZGD A;  3PUJ A;  1O1T A;  3VLF A;  3FTS A;  3D9M A;  1Y6I A;  4MLP A;  4KVO A;  3RKV A;  3HXD A;  5JJT A;  3TWT A;  2EIM E;  2WXO A;  5JA4 D;  3QWV A;  4DI3 A;  3OAW A;  2VQ2 A;  1OWN A;  4GAA A;  4FUL A;  3FDH A;  3VLD A;  3F6Q A;  4A3V A;  4DJA A;  4OAV B;  2ZIR A;  5D0O D;  4KMO A;  1A17 A;  3RSE G;  3ZRH A;  2XEV A;  1DNP A;  5KJM A;  2XEN A;  3I4R B;  4BTA A;  3ESK A;  5AJD A;  3U66 A;  4GYY A;  4G2V A;  4N3B A;  4EBA G;  2LAH A;  2FO7 A;  1MQS A;  1FT2 A;  3ZXP A;  3CVY A;  1LF8 A;  3CIA A;  3MV2 B;  3HVE B;  2IU1 A;  2H6G A;  4I1M A;  2IFU A;  4V3I A;  2CHW A;  1E90 A;  4JL0 A;  2QZA A;  1N4R A;  1Z3X A;  2ZIS A;  4ME2 A;  4WND A;  3RJV A;  2DZO A;  3MA5 A;  5J08 A;  4FHK A;  2R5S A;  4GTP A;  3FUJ A;  1OWO A;  4BEP A;  1NFI E;  2DZN A;  4APO A;  3SI5 A;  2IEJ A;  3QB2 A;  3UXG A;  3Q5M A;  3GZ2 A;  4LNG A;  3B7R L;  4C0M A;  3QOU A;  1QYM A;  2PQN A;  3JXJ A;  4GZ3 A;  4HRL A;  1N95 A;  3D9H A;  5G05 C;  4XI9 A;  5ANL A;  2ETC A;  4BES A;  4I6J A;  2Y4U A;  3ZU7 B;  1RZ4 A;  4Q69 A;  2RKK A;  4IUL A;  2VSO E;  2NXP A;  3SNX A;  2V5Q C;  5AN8 A;  3J5Q B;  4J0U A;  4K0R A;  4L9P A;  4I9C A;  4MRU A;  2DWZ A;  3KS2 A;  4U8H A;  1IYG A;  2CFZ A;  3ZHE B;  3B13 A;  2IF4 A;  2AJA A;  4ANX A;  4EPZ A;  4U63 A;  2WXR A;  4AOF A;  3UQ3 A;  4F1P A;  5CCL A;  1OCC E;  4YVQ C;  3HG0 D;  2IOL A;  3CST A;  2J09 A;  4UI9 J;  1VDY A;  4TRQ A;  2LXM A;  4FA6 A;  3MKQ A;  2J8S D;  4HI9 A;  3Q79 A;  2ION A;  3DWL G;  3E32 A;  1NA3 A;  1HS6 A;  3QK0 A;  3RK6 A;  1G3N B;  3CSF A;  4ABN A;  2YHC A;  4YDO A;  2EQX A;  2I9C A;  1XNF A;  4HBD A;  3L22 A;  4C48 B;  1KLX A;  5BV1 A;  4ZFH A;  3FEY A;  2GRP B;  4RVB A;  3VLE A;  5EIB E;  4WWN A;  2VGX B;  1JCS A;  3IXE A;  4U0Z A;  2P9U G;  3PH0 C;  2P9S G;  4F6R D;  3CK7 A;  3ESL A;  3FUE A;  3DEP A;  3G2W A;  2R59 A;  4JXT A;  5EYP F;  2I2O A;  4AJW A;  1E8W A;  4JHK A;  4DPR A;  3NOC D;  2B0O E;  2IJG X;  3UUX A;  4K03 A;  4L7T A;  3TJP A;  4K5C A;  2ZXW E;  3Q9U C;  4G1T A;  2XEE A;  1Q2Z A;  3WG7 E;  1TJC A;  4ZHB A;  4HOS A;  2UWJ G;  2V5F A;  4ACK A;  5FTP A;  2YIN A;  3I5P A;  3ZVV A;  3E34 A;  3EJN A;  3GYZ A;  4IYP A;  2WB2 A;  1YCS B;  3DEO A;  3DPD A;  3TG4 A;  1TNY A;  4XEI G;  1YMP A;  3V79 K;  4YDY A;  1H0A A;  1WM5 A;  3ZGQ A;  3MZL B;  2J07 A;  4EHM A;  3Q9N C;  4LG6 A;  1WDY A;  2H6I A;  3ASF A;  1XGW A;  3FUD A;  3NZU A;  4XIF A;  3D9P A;  1BI8 B;  4A1G A;  4DRX E;  3LXU X;  2WXN A;  4GCO A;  2Y3A A;  4U96 D;  3IV0 A;  3Q7F A;  1TNZ A;  4MS6 A;  4W9R A;  3C3R A;  3PNT B;  1MX2 A;  3G2V A;  4PDX A;  4CGW A;  3RU0 A;  4FU3 A;  3UIN C;  3BQO A;  4J7W A;  3VTX A;  4WNG A;  2VSY A;  3D9K A;  4OYS A;  3AJI A;  3RIB A;  3NF1 A;  2X38 A;  4HLL A;  2PNN A;  3JUI A;  4JHR A;  3V2O A;  3TAX A;  2IO3 C;  5D66 A;  4LSZ E;  1IXV A;  4RLY A;  3ZPJ A;  5CHE E;  2R02 A;  3CR3 A;  5FZQ A;  5CED B;  4JD2 G;  3TWV A;  3DSS A;  4FHJ A;  2J4B A;  3FTX A;  3HDX A;  4XE0 A;  4HRN A;  2OVB A;  5JJ7 A;  1ZBP A;  3AS4 A;  2CFU A;  3CVP A;  4AM9 A;  4GMR A;  4J8Y A;  5BUZ A;  4N2Q A;  2J08 A;  1TN6 A;  4XX5 A;  4WWP A;  3MKQ B;  4UQZ A;  5CRV A;  4GU5 A;  4ANV A;  2PL2 A;  4Q94 A;  4Z68 A;  4K5A B;  2XEH A;  3ZYQ A;  3FWV A;  5AQB A;  1TR4 A;  5KCM A;  4LEU A;  2KXP C;  3DSV A;  4UWF A;  1YA0 A;  2DYR E;  2R2L A;  4BX8 A;  1H19 A;  2QFC A;  3G2S A;  2X6H A;  5FQ6 A;  5AEN A;  2A4Z A;  1X81 A;  3W9F A;  4GA0 A;  5EN5 D;  3URZ A;  1ZB1 A;  5ENO D;  3PE3 A;  2XRZ A;  4BFR A;  5FQ7 A;  3TWQ A;  4FP7 A;  3L82 A;  3S7B A;  3CQG B;  4I2Z A;  1TNO A;  4CRW A;  1N4P A;  4G26 A;  2LNI A;  3AG1 E;  4O1O A;  3QNK A;  4BTB A;  1DCQ A;  3IBE A;  2MRI A;  4CT4 A;  2WXQ A;  4MBG A;  1U2V G;  3UTM A;  4N5Q A;  5T8I A;  2L6B A;  1K1B A;  3EUV A;  3R9M A;  3NB2 A;  5T3R A;  1TNB A;  2YQ8 A;  1IQR A;  3KEZ A;  4H7X A;  4AV7 A;  1IHB A;  3UIO C;  3JYS A;  4DUI A;  3SF4 A;  3UT8 A;  4PS7 A;  2X6F A;  3MX3 A;  3FH8 A;  5DIZ A;  4KVM A;  4JA9 A;  3EHR A;  2C2L A;  3NAW A;  2DCP A;  3TXM A;  3MCX A;  3EU5 A;  4KBQ A;  3E33 A;  3O4Z A;  2I1J A;  2XCC A;  1E8Z A;  5EIL A;  3RO2 A;  3UM1 A;  4OAU C;  3L13 A;  4AIF A;  1QQE A;  4FC8 A;  3S7F A;  1OWP A;  3FEX A;  4LNB A;  4I2W A;  3SO8 A;  2BF0 X;  1ELR A;  1MJ0 A;  2IQC A;  3UI2 A;  3T8K A;  2J4D A;  1H6O A;  1X5B A;  1UOH A;  4B93 B;  1BPO A;  3U3W A;  2QYU A;  3ENE A;  4ILH B;  3IHV A;  4L1B A;  2DIW A;  2DYS E;  2NYJ A;  2XS8 A;  3TWS A;  2OEV A;  2XPY A;  3LJ3 A;  3PZ1 A;  1K8K G;  1W3B A;  4XKB A;  3CHM A;  2VSX E;  3SBT B;  2WXJ A;  4ATG A;  4GTO A;  1HX8 A;  1HXI A;  3L17 A;  3QDN A;  1H2U A;  4WUY A;  3PRE A;  3U64 A;  2KCK A;  1LD8 A;  2QYJ A;  4RQI A;  1IHG A;  3DRA A;  3DXM G;  1HG5 A;  2MOW A;  4NRH B;  3V2X A;  5JHA A;  1N0R A;  2GW1 A;  4GMJ A;  3CVW A;  4U8V D;  4TXQ A;  4UI9 C;  4GA2 A;  3CVV A;  1JPL A;  3ZYL A;  5LP0 A;  5FZS A;  1DVP A;  3AS5 A;  5LFA A;  4JHJ A;  4PS3 A;  2WXF A; 
#chains in the Genus database with same CATH homology
 1ELW A;  2LAI A;  4M3O A;  4U0Z A;  5LCW J;  3N71 A;  1QZ2 A;  4JC8 A;  3JQ1 A;  4FAD A;  2AXV A;  3RRN B;  3PH0 C;  5FWQ A;  2J9Q A;  3CK7 A;  3ESL A;  3FUE A;  2WXI A;  2ZU6 B;  2WQH A;  3OTN A;  3G2W A;  5A23 A;  2R59 A;  4ILG A;  4HXI A;  3FUI A;  4IRU A;  4JXT A;  3SZ7 A;  4N3C A;  2I2O A;  4BY6 A;  4F7A A;  4AJW A;  3QWW A;  3LY9 A;  1E8W A;  4F3V A;  4JHK A;  4DPR A;  3PVL A;  4B8C B;  1OWL A;  1HG2 A;  3FH5 A;  3QC1 A;  2L6J A;  3ONL A;  2AWI A;  3MGB A;  2IJG X;  3HYM B;  1FVH A;  3UUX A;  4K03 A;  4L7T A;  5LCW C;  3TJP A;  3S7D A;  4H7Y A;  1HE8 A;  2WXK A;  4KT6 B;  4C9B B;  4G1T A;  2GGF A;  5FJY A;  1N52 A;  3ZHE A;  3LVQ E;  4AXH A;  3EIQ C;  5G2N A;  2E2E A;  1TJC A;  1TJF A;  2XPZ A;  1U3D A;  4UWG A;  4HOS A;  3SGH A;  3O48 A;  2UWJ G;  3QAR A;  2V5F A;  4ACK A;  3CHP A;  5FTP A;  3ZFW A;  2WQ7 A;  2YIN A;  3G2T A;  3MKR A;  2CHZ A;  3I5P A;  3NQP A;  4CDM A;  4NQ0 A;  2X6I A;  5BW8 C;  3ZVV A;  2IOS A;  2OND A;  3U4T A;  3EJN A;  5BV0 A;  3BG1 B;  3CGH A;  3GYZ A;  4HOU A;  4IYP A;  2VJ8 A;  4FJY A;  4ACL A;  2WB2 A;  3DPD A;  3FUM A;  3QWP A;  4G25 A;  4J8S A;  1JWG A;  4E85 A;  3TG4 A;  2KC7 A;  4KZ0 A;  1E8X A;  5AJL A;  2RD0 A;  2KZT B;  4LER A;  4I9E A;  4A55 A;  1H0A A;  1WM5 A;  2HR2 A;  3RO3 A;  3ZGQ A;  3MZL B;  3RRM B;  3R7R A;  2J07 A;  3APD A;  3TXN A;  3FFL A;  5CMY A;  4YVO A;  4KYO B;  1UN9 A;  3IHY A;  5AYW D;  3HIZ A;  5CMW A;  4B0Z A;  3CVU A;  3ASF A;  1XGW A;  3P1U A;  2KAT A;  4J6I A;  3FUD A;  4EZL A;  3UPV A;  3HVE A;  3NZU A;  3L16 A;  3LS8 A;  4XIF A;  5E76 A;  3ULQ A;  3D9P A;  4PUC A;  4GML A;  3FUN A;  1B89 A;  4A1G A;  3LXU X;  2LSV A;  2WXN A;  4JA7 A;  4C0E A;  4DK5 A;  3GZ1 A;  1KT1 A;  4GCO A;  4JW1 A;  4LCT A;  1H2V C;  2Y3A A;  2WMO A;  2AVP A;  2FEZ A;  2L0T B;  2PQR A;  3ASH A;  3FU6 A;  3ZIM A;  5BT1 A;  1JWF A;  3IV0 A;  5EX0 A;  1PC2 A;  1SZ9 A;  2PM7 A;  4MS6 A;  4L23 A;  4LRZ A;  4EQF A;  4W9R A;  3PNT B;  3R7Q A;  3FUF A;  4AP2 A;  3I4G A;  3G2V A;  2A5U A;  3SHF A;  2WM9 A;  4PDX A;  2VGX A;  3ASG A;  4GYO A;  3TL5 A;  4BSX A;  4CGW A;  4L2L A;  3RU0 A;  3APF A;  3K9I A;  4G24 A;  4FU3 A;  3TGO A;  4HS2 A;  3FU3 A;  3VTX A;  4CDR A;  4BT9 A;  3FTY A;  3FH7 A;  3OXG A;  2PZI A;  2FI7 A;  2FBN A;  4WNG A;  2VTB B;  1NA0 A;  1TEZ A;  3BEE A;  3D9O A;  2VSY A;  5C2Y A;  4F53 A;  2PM6 A;  3D9L A;  3D9K A;  3LVR E;  4ANU A;  2Q7F A;  4OYS A;  4N5C A;  3Q4A B;  2Y4T A;  4AVX A;  4AY6 A;  4RG9 A;  1UJJ A;  3APC A;  4MKT A;  1SQM A;  3CLJ A;  3NF1 A;  4PH4 B;  3RIB A;  4GZ5 A;  3ZYK A;  3FTU A;  4G11 A;  3VTY A;  3CV0 A;  2X38 A;  4GPK A;  3LYA A;  3JUI A;  4JHR A;  2XQ0 A;  3I3N A;  2WVI A;  3FHE A;  3TAX A;  2WXL A;  2JLB A;  4P29 A;  1ELK A;  5BNW A;  5JHB A;  3RRU A;  1MHQ A;  5CHE E;  3ZPJ A;  3EHN A;  3FY4 A;  1EF1 C;  2J49 A;  3S7J A;  3C98 A;  3CR3 A;  5FZQ A;  5EKQ D;  4B89 A;  3ZW3 A;  5E75 A;  1S0P A;  4JPS A;  5KJN A;  2VGY A;  4FHJ A;  4HVB A;  2J4B A;  1Y8M A;  3FTX A;  2I1K A;  3HDX A;  4XE0 A;  4RG6 A;  5M72 A;  3SFZ A;  3ZXS A;  2OVB A;  3PS6 A;  5JJ7 A;  3FTZ A;  2I6H A;  4I17 A;  1ZBP A;  3CHO A;  3AS4 A;  4N39 A;  2CFU A;  3CVP A;  4JVS A;  3ONK A;  3FU0 A;  2NC9 A;  4AM9 A;  5A6C A;  5DBK A;  4J8E A;  3LKU A;  4FJZ A;  5BUZ A;  4N2Q A;  2GRM A;  3ASD A;  5FQ4 A;  3R9A B;  3CK9 A;  2J08 A;  4DLQ A;  2R17 C;  2AXZ A;  2CG2 A;  4KXK B;  5EX3 A;  4EEC A;  5HQ8 A;  4KZC A;  2AW6 A;  4WWP A;  4XX5 A;  3MKQ B;  2UY1 B;  3MJW A;  2FUL A;  4APF A;  5A7D B;  4UQZ A;  2OVF A;  1H6K A;  2XGS A;  4FLH A;  2XCB A;  4GU5 A;  3AU5 A;  4HOQ A;  3CVL A;  4ANV A;  2QY7 A;  3SBS A;  2PL2 A;  3EHM A;  1E96 B;  2WPV A;  5FT9 A;  4AEZ C;  4J8D A;  2YHE A;  3FU5 A;  4HLE A;  3ML8 A;  4U0U A;  4N2S A;  4Q94 A;  5LX8 A;  2NSZ A;  3P2B A;  2L0I A;  4YND A;  3ZYM A;  1E8Y A;  3EIJ A;  3ZYQ A;  4Q96 A;  3PNL B;  3FWV A;  3JQ0 A;  1Z6T A;  3FTW A;  1U3C A;  5KCM A;  4LEU A;  3PUJ A;  3PZD A;  1WY6 A;  3U9W A;  2XRY A;  2OV8 A;  3VLF A;  2VSN A;  3CHQ A;  4UWF A;  3FTS A;  1NP7 A;  1YA0 A;  3D9M A;  4OVV A;  1Y6I A;  4MLP A;  4HOR A;  4KVO A;  1EDU A;  2VTB A;  3RKV A;  5CCM A;  4BX8 A;  1H19 A;  1E7V A;  2QFC A;  3G2S A;  5JJT A;  3SD5 A;  5C1D A;  4GA1 A;  2X6H A;  1JUQ A;  2WXO A;  3LY8 A;  3CK8 A;  3QWV A;  4DI3 A;  3OAW A;  5FQ6 A;  5AEN A;  4BT8 A;  3CVQ A;  2VQ2 A;  3B7S A;  3NZS A;  4TV3 A;  3WXX A;  1OWN A;  2A4Z A;  2OOE A;  4GA0 A;  4GAA A;  4FUL A;  1GW6 A;  1QNF A;  3T8M A;  3URZ A;  1N54 A;  3FDH A;  3VLD A;  4A3V A;  2WXG A;  4DJA A;  3LEW A;  2XPI A;  5D0O D;  3PE3 A;  2XRZ A;  4BFR A;  4R7L A;  5FQ7 A;  1P5Q A;  4FP7 A;  4J8F A;  4KMO A;  4UWH A;  1A17 A;  3S7B A;  1UN8 A;  2XGM A;  3ZRH A;  3CQG B;  2XEV A;  4I2Z A;  1HF8 A;  4CRW A;  4XI0 A;  4IN3 B;  5LOZ A;  1DNP A;  3ML9 A;  1HU3 A;  3AU4 A;  4G26 A;  4O6F A;  3I4R B;  4UI9 K;  5KJM A;  2LNI A;  5ARG A;  2HO1 A;  3CHS A;  1PAQ A;  3MYV A;  1HO8 A;  4QFV A;  5ANR A;  3QNK A;  5ARF A;  3MV3 B;  4Y6W A;  4DLO A;  5T4Y A;  1INZ A;  4BTA A;  4JZY A;  5J90 A;  3ESK A;  4BTB A;  5AJD A;  2FF4 A;  3UT7 A;  4WWO A;  3U66 A;  3PEV B;  4GYY A;  4G2V A;  4N3B A;  3Q15 A;  4F1S A;  2CHX A;  3IBE A;  2MRI A;  4I6E A;  4CT4 A;  4EBA G;  2LAH A;  3KAE A;  2WXQ A;  4GB9 A;  1NZN A;  5T8I A;  1E7U A;  2FO7 A;  1MQS A;  3BG0 B;  3TG5 A;  4EBA A;  3Q49 B;  4CGV A;  4PS8 A;  2UY1 A;  4CEM A;  2XHE A;  4CDN A;  3CVY A;  4WNF A;  1LF8 A;  3CIA A;  2GRL A;  3MV2 B;  5T3R A;  3PUK A;  4E6H A;  4URK A;  3HVE B;  4G23 A;  2IU1 A;  4UWL A;  4HFG A;  2YQ8 A;  1IQR A;  3CEQ A;  3KEZ A;  4H7X A;  1HZ4 A;  3FUK A;  1FVF A;  3KD7 A;  3LCA A;  4I1M A;  4AV7 A;  3UX4 A;  2IFU A;  4U07 A;  4V3I A;  3JYS A;  3SF4 A;  2CHW A;  1E90 A;  4JL0 A;  3UT8 A;  4UQY A;  4PS7 A;  4BX9 A;  2X6F A;  1Z3X A;  2X6J A;  4B8A A;  4B94 A;  3MX3 A;  2KZT A;  3FH8 A;  3B7T A;  4ME2 A;  4UWK A;  3DBS A;  5D0Q D;  5DIZ A;  4WND A;  3L54 A;  4KVM A;  3RJV A;  3MA5 A;  4EZK A;  4JA9 A;  4WNE A;  4DI4 A;  5J08 A;  4FHK A;  2C2L A;  2R5S A;  2DCP A;  2MHK A;  3FUJ A;  1OWO A;  3TXM A;  3MCX A;  5AIJ A;  3CVN A;  4XZ4 A;  4APO A;  1UG3 A;  2KCV A;  3D9J A;  1PY1 A;  4KBQ A;  4ILI A;  3O4Z A;  2I1J A;  3SI5 A;  3LY7 A;  2DBA A;  3L6A A;  3QB2 A;  3Q5M A;  3GZ2 A;  2XCC A;  3B7R L;  1E8Z A;  1OUV A;  2VYI A;  4NUR A;  5G05 J;  4C0M A;  3CHR A;  5JJ6 A;  3QOU A;  1UW4 B;  2AXU A;  3RO2 A;  3FUH A;  2PQN A;  3D9N A;  4GZ3 A;  3AS8 A;  2C0M A;  5ENN A;  2KCL A;  2ILR A;  4GYW A;  3L13 A;  4LUN U;  4I1A A;  4EZJ A;  1OWM A;  2C0L A;  5G04 J;  4AIF A;  1QQE A;  4FC8 A;  3CKB A;  1H2T C;  3QKY A;  2XGO A;  3S7F A;  5KJK A;  1OWP A;  3FEX A;  4JEH A;  4GZ6 A;  3G2U A;  5HI7 A;  4CT0 A;  4I2W A;  2BF0 X;  1ELR A;  1FCH A;  1IQU A;  3IKO B;  5BPP A;  3E4B A;  2IQC A;  5G05 C;  4XI9 A;  5ANL A;  5FQ8 A;  3PEU B;  2J4D A;  4I6J A;  2M63 A;  2Y4U A;  1X5B A;  3L08 A;  3ZN3 A;  4UQX A;  1EPU A;  4I1O B;  1BPO A;  3T5V A;  3U3W A;  3LDZ A;  5G04 C;  3ENE A;  4Q69 A;  4ILH B;  3QJZ A;  2RG8 A;  4N3A A;  3IHV A;  4L1B A;  1HH8 A;  4A3T A;  3MEK A;  2X3M A;  2DIW A;  4IUL A;  2VSO E;  2NXP A;  2WQ6 A;  3SNX A;  2X6K A;  4RSY A;  2CG3 A;  2XPY A;  3LJ3 A;  3UT4 A;  1L5J A;  4J0U A;  1W3B A;  3HHM A;  2WXM A;  3QAQ A;  4XKB A;  4CCA A;  3D3M A;  4K0R A;  4WAF A;  3EDT B;  3CHM A;  3CKC A;  1ZU2 A;  3FP3 A;  4I9C A;  2VSX E;  4MRU A;  3KS2 A;  4U8H A;  3SBT B;  2CFZ A;  2WXJ A;  1IYG A;  4OVU A;  4ATG A;  3ZHE B;  1HX8 A;  5FZR A;  1HXI A;  3IEG A;  2BTD A;  3ZEF A;  2V4L A;  4GCN A;  3L17 A;  3B13 A;  4D10 C;  2IF4 A;  3D9I A;  2LSU A;  3QDN A;  1H2U A;  1WAO 1;  4ANX A;  5KJL A;  3GW4 A;  1HFA A;  4EPZ A;  4U63 A;  4WUY A;  3CQC B;  3PRE A;  2WXR A;  3U64 A;  4AOF A;  3T5X A;  3FUL A;  4Y6C A;  3PE4 A;  3UQ3 A;  1KT0 A;  2V8S E;  1SZA A;  2WXP A;  2HYZ A;  4XKC A;  2JEK A;  5CCL A;  4U0S A;  4YVQ C;  5G55 A;  2KCK A;  2IOL A;  3PRZ A;  3CST A;  2J09 A;  3JCK C;  3FTV A;  4UI9 J;  1IHG A;  3B7U X;  4HOT A;  1VDY A;  2WXH A;  3Q47 B;  4TRQ A;  4FA6 A;  3OXL A;  2L9B A;  4NAC A;  3MKQ A;  1HG5 A;  2LO6 A;  1Z3Y A;  4GZD A;  2MOW A;  4L2Y A;  4NRH B;  3LPZ A;  3CVX A;  4A1S A;  5JHA A;  2ION A;  1NA3 A;  3PDN A;  1EYH A;  4FLB A;  2KM4 A;  1HS6 A;  3QK0 A;  3RK6 A;  2E0I A;  2GW1 A;  4GMJ A;  4AY5 A;  2HM8 A;  3CVW A;  3CSF A;  3GZS A;  4ABN A;  4UI9 C;  4GA2 A;  4U04 A;  3CVV A;  2YHC A;  1JPL A;  2EQX A;  2I9C A;  2YNQ A;  1XNF A;  2V0P A;  3ZYL A;  3L22 A;  3S2A A;  3OXF A;  5LP0 A;  1KLX A;  5BV1 A;  4I6G A;  1UJK A;  3FEY A;  4RVB A;  3VLE A;  5EDS A;  4TUU A;  4JEU A;  2BUG A;  2WMN A;  5FZS A;  1DVP A;  3AS5 A;  5LFA A;  4WWN A;  3UMV A;  2P58 C;  2VGX B;  4JHJ A;  4PS3 A;  4I43 A;  4GZC A;  4BWR A;  4ANW A;  2WXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...