3D9LA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
140
structure length
140
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/peptide
total genus 54
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9lA00
1H0AA 1UJKA 1HFAA 1EYHA 1JWGA 2QY7A 1ELKA 1LF8A 1X5BA 3D9MA 4Q94A 3RRUA 3ZYLA 5LP0A 1HX8A 1JUQA 2KM4A 2LO6A 1UJJA 3D9IA 3ONLA 4NACA 4AVXA 1INZA 4JXTA 1SZAA 1HG2A 1EDUA 3D9PA 2MOWA 2V8SE 3CLJA 3D9KA 1XGWA 3ZYKA 1MHQA 3G2VA 3ZYQA 2BF0X 3D9NA 1DVPA 3D9JA 3G2TA 1HG5A 4HFGA 2DIWA 2L0TB 4Q96A 3G2WA 3ONKA 4GZDA 4GZCA 5CMYA 3D9LA 3G2UA 1VDYA 1SZ9A 1PY1A 1HF8A 3D9OA 3ZYMA 5CMWA 4FLBA 5LOZA 5J08A 4FU3A 3G2SA 3LDZA 1JPLA 1JWFA 2L0IA 2DCPA
chains in the Genus database with same CATH superfamily
2DZOA 3T5XA 4U0SA 1ZU2A 4MKTA 3FEXA 1RW2A 4H7YA 4GU5A 1N4PA 4L2LA 3KEAA 5JJTA 4C9BB 2FEZA 4N5QA 3SO8A 3HRAA 3R9AB 3TWTA 5LOZA 2P9KG 3ML9A 2QZAA 3QC1A 3OAWA 5D0OD 5AENA 4DX1A 3ZYQA 3D9JA 1HG5A 3EJNA 3V79K 2E0IA 5AJLA 3HXCA 5EKQD 4KVMA 3UQ3A 2HE0A 3FH7A 3EIJA 3PZ2A 2M63A 2R5SA 4DLOA 4J6IA 1TNZA 4I1MA 3SD5A 4TUUA 3DPDA 3SGHA 4AXHA 2VSYA 1IHGA 4AIFA 4DI3A 1E7UA 1E8WA 3GZ1A 3FTSA 3S7FA 3I3NA 1HXIA 3C3OA 3Q7FA 5D2MC 5ANLA 3CVVA 4URKA 2OEVA 2FO7A 2UY1B 4MRUA 1N52A 3FULA 2EIME 2L9BA 1MYOA 3CVLA 5FJYA 2J49A 1MQSA 5ARGA 4ZHBA 1HX8A 4UI9J 1V55E 4QQIA 4GA1A 4JHKA 1BU9A 4KMOA 4MBGA 4J8EA 2E2EA 1N54A 1SA4A 2J8SD 1TN7A 2J9QA 2X38A 1NL4A 2DCPA 2YHEA 1Y8MA 2VSXE 4RG6A 2R17C 3CSFA 1ELRA 3DXKG 4JHJA 4UQYA 3TL5A 5EX0A 4UQXA 4JL0A 4FULA 1OUVA 2WXOA 2KCLA 4Y6WA 2ZIRA 2XGOA 4RQIA 1TJFA 3RO3A 5EIBE 3LPZA 2V4HC 4O1PA 3ASOE 1BLXB 3QAQA 2YINA 3ISMC 3AG2E 3UMVA 2J08A 4UWLA 3CGHA 5HKPA 4DX2A 3VLDA 2DYRE 4IULA 4I17A 3HXBA 4AY5A 3EHQA 3ZEFA 1OCZE 3MZLB 3UIPC 3JYSA 2X6FA 3PNTB 4DX6D 4I2WA 2XGSA 5FZQA 4EHMA 4UWFA 4JEHA 1KZPA 2CHXA 1O5MA 2V5FA 4GTOA 1P5QA 3GZ2A 4A1SA 1OWMA 5JHBA 3URZA 5AQ7A 1FT2A 1QBQA 2NYJA 4ILIA 3E32A 3UXGA 2RG8A 3J5QB 3CLJA 3QWVA 4ILGA 4XI0A 2L0TB 5FQ7A 3CV0A 2XEEA 4ANXA 3D9OA 3LY7A 3FTZA 3VLFA 1WM5A 4B8CB 4YDWA 4RLYA 5AQAA 4G2VA 2JLBA 3DSUA 4A3TA 3GZSA 4OVUA 2KXPC 4G25A 1LTXA 2QYUA 1HU3A 3FUNA 2PNNA 4U8VD 2NSZA 1K3ZD 5KJKA 4RVBA 2R2LA 2B0OE 4EZLA 2WMOA 4KBQA 2ETBA 3FH8A 2ZXWE 2VQ2A 4L2YA 3RJVA 4BESA 5KJNA 2P58C 4EZKA 3U66A 3SFXA 3D9NA 3MEKA 4BETA 3B7TA 4U8HA 2V4LA 4L23A 4J8YA 3ULQA 2IO3C 2WQHA 4F6RD 1TN6A 5EYLA 4IRUA 1O1TA 4PDXA 4G1TA 2OVBA 2WXKA 3B7RL 3D9IA 4GTRA 3V31A 1ZBPA 2ONDA 3QNKA 4HVBA 4N3BA 4J8DA 3PZDA 3MX3A 4GB9A 4YDYA 2FI7A 2PQRA 2IJGX 3BG0B 2NXPA 3LYAA 4HI8A 2XRYA 4A3VA 3DXMG 4OAUC 1HE8A 2NC9A 1INZA 5BXUA 2A5EA 5CECB 2WM9A 3CHQA 3FUHA 4DK5A 4GYYA 5HS0A 3ULEG 4BERA 2YHCA 4HOSA 1TNYA 5C1DA 3IBEA 2ETAA 3D9KA 2IO2C 5BPPA 2J4DA 4D10C 1HZ4A 4I6GA 3IEGA 4BWRA 5EX3A 1BPOA 3LXUX 5ENPD 2F37A 3TXMA 1UN9A 5HI7A 3FWVA 4B94A 4JB8P 4Z68A 4GTPA 3SFZA 2BF0X 4BTBA 4Q96A 3HVEA 3TWRA 4EECA 4PS3A 1VDYA 4DLQA 2IEJA 3ZRHA 3JQ1A 2J09A 1S64A 2V5QC 5M72A 3ESLA 3N71A 4FC8A 3BUAA 3IXEA 3I4GA 1SZ9A 4A1GA 4LEUA 4FHJA 4FJYA 4YDOA 3B95A 5ENNA 2HR2A 1FPPA 5CERB 1MX6A 2IY0C 2WXNA 3DSSA 1EYHA 5JHAA 2FULA 3NZSA 3QB2A 5T8IA 3LY8A 1SZAA 3IKOB 1E96B 3L9TA 3W9FA 1H2UA 4DX5D 3DBSA 3MV2B 2EQXA 3U64A 1OWPA 3RAUA 2F8XK 3SBSA 3LDZA 1HFAA 4G23A 3LS8A 4Q94A 3FUJA 3ONLA 3Q78A 4Q69A 3E37A 4P29A 4OYSA 4O60A 4U7EB 3AS8A 3UM2A 3ZXPA 5FIOA 3G2TA 3ZXSA 2IOSA 2WPVA 5AYWD 4FA6A 3O48A 2R03A 1PY1A 5CHEE 1YA0A 3L82A 3OXLA 4UWKA 5FQ8A 4I9EA 3ZVVA 3PUJA 4N3CA 1OWNA 3FTVA 4I9CA 3TGOA 1XNFA 2LSVA 5B3SE 1N95A 4J7WA 5J08A 4U63A 2XENA 1YMPA 3SHFA 2P9SG 2ZGDA 4YDEA 1DC2A 4N3AA 5HRYA 2OCCE 3C98A 4XKBA 3D3MA 4XEIG 3ZFWA 3OTNA 3CHOA 3JXJA 1MJ0A 3PREA 4KZ0A 4APOA 1NZNA 4CDRA 1U3DA 1LF8A 4DUIA 4DPRA 3RRUA 2ZGGA 4HOTA 3WXXA 1EDUA 3D9PA 2MRIA 2XS8A 4CDMA 3HYMB 1NFIE 4DJAA 2WMNA 1TNOA 5KJMA 4KYOB 4V3IA 3S2AA 4LERA 5FWQA 1RZ4A 5AQ9A 2EIKE 3UM0A 4WWOA 2RFMA 3MV3B 2IOLA 2XPZA 4M3OA 2RD0A 5B1BE 3NBNB 2Y0BG 2CHWA 4PS7A 3L13A 3FU0A 4E85A 4HI9A 4I1AA 3RIBA 3TWQA 4UWGA 3ASNE 3EU5A 1H2VC 2X6HA 4N5CA 4KT6B 3CVQA 3MYVA 5CMYA 4R7LA 5E75A 5G05C 2P9NG 2QYJA 5AARA 3UPVA 1SQMA 3L17A 4APFA 5FZSA 3UT4A 3KAEA 1OXJA 3HXFA 2C0MA 1N94A 4HFGA 2BKKB 2I2OA 3JCKC 4FHKA 2Y4UA 1PAQA 1HF8A 2VGYA 1S63A 4LNBA 3MKQA 4I2ZA 3ZNGA 2P9IG 4JVSA 2VJ8A 3Q5MA 5CEDB 2VSNA 1V54E 3MA5A 3FU5A 3VLEA 4UUCA 4HQDA 2I6HA 3L08A 3UUXA 1DCEA 4I6JA 3Q47B 1Z3XA 3FH5A 3SQVA 4GA2A 3G2UA 5CCLA 1U3CA 3KEZA 3B7SA 4I6EA 3PRZA 3UM1A 4WWPA 3SBTB 5FQ6A 4BSZB 4WNFA 4C0MA 5FINA 4GTTA 3S7BA 2EINE 4BY6A 3MKRA 4LG6A 2ILRA 1TNUA 5ARFA 5DBKA 5KJLA 3EHNA 3ZIMA 4ANWA 2Y4TA 4AJWA 2B6CA 2GRNB 2AXVA 1H2TC 4QFVA 3CHRA 3NOGD 2KZTA 3JUIA 4XIFA 4HRLA 1JCQA 4UI9K 2VTBA 3TWXA 3L16A 3SNXA 1LD7A 2XZDG 5BW8C 4NIKA 4ILHB 2AWIA 3K9IA 3DSXA 3PH0C 1FVFA 4WAFA 1H6KA 4I1OB 4L1BA 3PZ3A 2GRPB 1H19A 5T4YA 4JW1A 4U04A 4BX8A 4ABNA 4CT4A 4K03A 3C3QA 3CHMA 3RO2A 4F1PA 2AJAA 1JCSA 3Q9UC 3ZHEA 1QYMA 5AN8A 1O1RA 3BU8A 3LJ3A 1JWFA 1FCHA 2GRMA 3SY2A 3MGBA 4YVOA 1KZOA 3EHRA 4G26A 4J8SA 5FTPA 3FFLA 2OOEA 2KATA 3SFYA 5BV0A 1NA3A 1ZB1A 1Q2ZA 2Q7FA 1IYGA 1UOHA 2P2CP 4B89A 3TG4A 5CRUA 1UW4B 2YNQA 4CGWA 3SI5A 4HS2A 4K5AB 3CVPA 1MHQA 5JJ7A 3UM3A 2PZIA 3ASFA 4JA9A 4CEMA 3RKVA 2QFCA 1JPLA 4EBAA 4JC8A 1WAO1 1HS6A 3FTXA 4O1OA 1X5BA 3Q15A 2DZNA 1N11A 2XEVA 1N0RA 3HIZA 3C5RA 3DSTA 3DSVA 3JXIA 2F0YA 4J0UA 3MCXA 1ELWA 5D0QD 1IKND 1E8YA 3CVNA 3FUEA 2XCCA 3PE3A 3AG4E 2JEKA 3UKUG 4GYWA 5FQ4A 3QOUA 2AW6A 3D9LA 4WNGA 2GRRB 4HOUA 4J8FA 1WG0A 5CMWA 3ASGA 3PS6A 3HHMA 3R9MA 2L0IA 4AP2A 4GMLA 3J5PA 1IXVA 3NF1A 2KC7A 2GRQB 3KSLA 1AP7A 3Q79A 1WY6A 4PH4B 4C0EA 5FT9A 3PVLA 4HRNA 1A5EA 5CEAA 5G04C 4WNDA 1OT8A 3PEUB 3T8KA 2C0LA 2Y1LE 4HXIA 1H6PA 3UIOC 4TXPA 2WXMA 5LFAA 3QJZA 4OVVA 5G05J 4U95D 1AWCB 4GAAA 4HLLA 4PS8A 2IFUA 2A5UA 3EHMA 4XKCA 2WXGA 3ABME 4F7AA 1TYQG 2DWZA 5ENQD 1E7VA 2RKKA 2CFUA 2PM7A 2Y3AA 3Q7AA 4AY6A 5KCMA 1X81A 1H0AA 4N39A 3ZGQA 2V0PA 4H7XA 3IHVA 3WG7E 3GYZA 3NQPA 3ASHA 4GZ6A 4NQ0A 4TXQA 4JZYA 3S7DA 4MLPA 4NRHB 3D9HA 3PE4A 4YNDA 3VTXA 3T5VA 4G8LA 5HQ8A 5A6CA 5ITZF 2WXLA 3UI2A 3W9GA 1S70B 4CYMD 3ULYA 3CKCA 5JMND 4BFRA 3V2OA 4C48B 2H6IA 2P9PG 2HM8A 3P1UA 4IN3B 1KT1A 1N9AA 4U07A 2EIJE 5BT1A 3ZU7B 4F1SA 2R02A 4X8QA 2L6JA 4GPMA 4EQFA 1MZCA 4ME2A 4GYOA 4G8KA 3HXDA 5KNHD 4LCTA 4HNAD 2ZISA 2VGEA 2PM6A 4EBAG 3QARA 3CVXA 1N4RA 3L54A 3P2BA 2XGMA 5EILA 1FT1A 3UT7A 1IQRA 5AJDA 1E8ZA 5LCWC 3RU0A 4HB5A 4FU3A 4BSXA 1YYHA 3AU4A 3QWPA 4GZ5A 3AJIA 3PEVB 1E8XA 2LXMA 2H6FA 4JHRA 1XGWA 3FUKA 5ENRD 1SA5A 2DIWA 1QZ2A 3FTYA 2GGFA 4IYPA 5JJ6A 2WXJA 5KNGA 3ENEA 1NI1A 3CKBA 1TJCA 2LSUA 4HOQA 3EU9A 4GA0A 4EPZA 3DSWA 4L7TA 3AG3E 4UQZA 4GZ3A 2EILE 3LCAA 4BTAA 1G3NB 4GTVA 1TNBA 3U4TA 3EUVA 3AU5A 2H6GA 4JPSA 2FBNA 2WB2A 3ZW3A 2BUGA 4GMJA 3TG5A 2XCBA 4K5BA 1QQEA 4CDNA 3AG1E 4DRXE 3RRMB 3U3WA 3QK0A 5ANRA 3R7QA 2Y69E 3KD7A 4ATZD 1O1SA 2WXRA 2BEDA 1OCCE 1N4SA 3HVEB 2L6BA 2LAIA 5AIJA 3FUMA 1DVPA 2P9LG 4HBDA 4AOFA 3PUKA 3NB2A 2VSOE 3T8MA 3X2QE 2I1JA 2WQ6A 3FEYA 3HXEA 3ZYLA 1IQUA 2KM4A 2LAHA 2VGXA 3DWLG 3DPYA 4K5CA 3EIQC 4L9PA 1D8EA 4KXKB 2C2LA 2X6JA 5A7DB 3ZN3A 3B13A 1NA0A 1PC2A 2VYIA 4JXTA 4LSZE 1OCOE 3IV0A 2X3MA 3UKRG 1K1BA 2QC9A 2XRZA 4B8AA 1OY3D 4UWHA 1BD8A 3O4ZA 4PUCA 2UWJG 2I1KA 3ABLE 3V30A 1DCQA 1JCRA 1Z6TA 5CCMA 5IY5E 2J4BA 3G2WA 3QDNA 3UT8A 4AV7A 5G04J 4GTQA 2XPIA 4HORA 3DEPA 3ASDA 3CQCB 4CGVA 2FO1E 4W9RA 1UJKA 2ETCA 1K1AA 3RSEG 3E4BA 2CHZA 3EDTB 2R59A 4B0ZA 2MOWA 3AAAC 4CZ2D 2IU1A 3BEEA 2FF4A 5T3RA 4TV3A 2CG2A 2KBXA 5CRVA 1DNPA 4GCOA 2XHEA 4I43A 3FUDA 5A23A 1BI7B 4FP7A 3D9MA 4HLEA 5FZRA 3TWVA 4RSYA 3G2VA 4LNUD 3ESKA 4KZCA 3HG0D 4GTMA 3VTYA 3UX4A 4GCNA 3ZYMA 3FP3A 3IHYA 1UG3A 3SF4A 2DYSE 1KT0A 4FADA 1H6OA 4NACA 2AVPA 3CQGB 3FTWA 4N2QA 3CK7A 4WNEA 4A63B 1UN8A 5ENTD 2X6KA 4CT0A 3S7JA 2F8YA 5ENOD 4BEPA 4EZJA 5G2NA 4GPKA 1EPUA 1B89A 3B7BA 3Q4AB 1OWLA 3JUEA 3QWWA 3GW4A 4FLHA 3KS2A 2XEHA 3APDA 3ZUVB 1KPSB 1E90A 4GZCA 4XE0A 5DIZA 5BUZA 2R05A 5LX8A 4BT9A 3I5PA 2DVWA 4LRZA 2GRLA 5G55A 3LY9A 5LP0A 4U8YD 2LO6A 3F6QA 1GW6A 2X6IA 1OWOA 4NURA 5EIDA 3Q73A 3BQOA 1S0PA 3TJPA 1IHBA 3G2SA 4B93B 5J90A 2P9UG 1MX2A 3RK6A 5KBAA 1TN8A 3KSQA 3NZUA 3APFA 1FVHA 1OCRE 1D8DA 3AS5A 4K0RA 3MJWA 5LCWJ 4M7CA 2XPYA 2CFZA 3L6AA 3ONKA 2WXQA 4DX7D 3FTUA 4GMRA 5H7PA 2KCVA 3MKQB 4ATGA 4ACKA 3FUIA 3PZ1A 5BNWA 4TUMA 5KWDA 1BI8B 2VGXB 1U2VG 2JABA 3RRNB 2GROB 4JD2G 1NP7A 2QY7A 3FU3A 4AVXA 3ABKE 2V8SE 1Y6IA 5JA4D 2OEWA 4TXRA 4CRWA 5AQBA 4AM9A 2XZTG 3CVWA 5ENSD 3ZPJA 5BXOA 3TWSA 2A4ZA 4F3VA 3CSTA 3LEWA 2WXHA 1UJJA 3T9KA 5CBOA 1HG2A 4UI9C 4G11A 4ANVA 3TAXA 4GZDA 4F53A 2ZU6B 4U0ZA 3CHPA 3DEOA 3PDNA 4ANUA 3LKUA 3LVQE 1WDYA 4ACLA 4U0UA 1SW6A 3PZ4A 1HO8A 3R7RA 4Y6CA 3FDHA 4WWNA 5E76A 1YCSB 4LUNU 4FJZA 2KZTB 3TXNA 1KLXA 3B7UX 2J07A 3JQ0A 1JUQA 3CK9A 4BX9A 5D66A 4ZFHA 2VTBB 4RG9A 3NAWA 3OXGA 4U96D 3V2XA 2HO1A 1TR4A 3E33A 4GTSA 2YQ8A 3CHSA 2IF4A 4XX5A 4LNGA 3CR3A 2GW1A 4AEZC 3I4RB 3ZKJA 2WXPA 2HYZA 3ML8A 5EYPF 4N2SA 4WUYA 3PNLB 2LXLA 5EN5D 1D9SA 3Q49B 2KCKA 4DI4A 2UY1A 2BTDA 4BT8A 4KVOA 3TWWA 3Q9NC 4HRMB 2XQ0A 3CVYA 1QNFA 2DBAA 4JEUA 1TEZA 3APCA 2H6HA 2RFAA 3ZYKA 3ZHEB 2WXIA 1HH8A 2PL2A 2IQCA 3CIAA 3U9WA 5AAOA 2AXZA 1MX4A 3AS4A 4O6FA 2OVFA 3LVRE 4XZ4A 4A55A 2PQNA 5EDSA 5BV1A 3QKYA 3SZ7A 1A17A 2I9CA 3TWUA 4G24A 3CK8A 2MHKA 4MS6A 1K8KG 3Q75A 1N0QA 4OAVB 2AXUA 4YVQC 3HDXA 2OV8A 1N4QA 3LJNA 4XI9A 5B1AE 3E30A 2WXFA 3FUFA 2XS1A 2MYOA 1L5JA 3FHEA 3CEQA 2IONA 3OXFA 2CG3A 1JWGA 3FU6A 1Z5SC 3BG1B 1EF1C 3FY4A 3C3RA 3NOCD 1Z3YA 1W3BA 3C72A 4CCAA 4FLBA 3UTMA 4E6HA 5CBNA 1LD8A 1SVXA 1ELKA 5C2YA 4JA7A 2WVIA 3UINC 2BKGA 2LUHA 4TRQA 3L22A 3E34A 3DRAA 2WQ7A 2LNIA 3CVUA
chains in the Genus database with same CATH topology
1UJKA 1HS6A 3FTXA 1EYHA 5JHAA 3E4BA 1X5BA 2CHZA 3T5XA 2FULA 3NZSA 3EDTB 4U0SA 3Q15A 2R59A 3QB2A 5T8IA 1ZU2A 4B0ZA 3LY8A 1SZAA 4MKTA 1TEZA 3FEXA 2MOWA 3ZYMA 2XEVA 3IKOB 1E96B 3HIZA 1H2UA 2IU1A 3BEEA 2FF4A 3DBSA 4GU5A 4H7YA 4L2LA 3MV2B 5JJTA 4C9BB 2FEZA 2EQXA 5T3RA 4TV3A 2CG2A 3U64A 1OWPA 3R9AB 4J0UA 1DNPA 4GCOA 3MCXA 1ELWA 2XHEA 4I43A 5LOZA 3SBSA 5D0QD 3LDZA 3FUDA 3ML9A 5A23A 1HFAA 3QC1A 3LS8A 4G23A 3OAWA 4FP7A 1E8YA 3CVNA 3D9MA 4Q94A 3FUJA 5D0OD 4HLEA 3FUEA 2XCCA 3ONLA 3PE3A 4Q69A 5AENA 5FZRA 4P29A 4OYSA 2JEKA 3AS8A 4RSYA 4GYWA 3G2VA 3ZYQA 3D9JA 5FQ4A 3G2TA 3QOUA 2AW6A 1HG5A 2IOSA 3EJNA 3ESKA 3ZXSA 2E0IA 5AJLA 4KZCA 2WPVA 3VTYA 3D9LA 4WNGA 3UX4A 5AYWD 4GCNA 4FA6A 3O48A 1PY1A 4HOUA 4KVMA 3FP3A 5CHEE 5EKQD 3IHYA 4J8FA 1UG3A 3UQ3A 1YA0A 3ASGA 5CMWA 3FH7A 3EIJA 3PS6A 3OXLA 3HHMA 2M63A 2R5SA 2L0IA 3SF4A 4AP2A 4GMLA 4UWKA 1KT0A 4J6IA 4DLOA 5FQ8A 4FADA 4I1MA 3SD5A 4I9EA 4NACA 4TUUA 2AVPA 3CQGB 3FTWA 3ZVVA 3NF1A 3PUJA 2KC7A 3DPDA 4N3CA 3SGHA 4AXHA 4N2QA 3CK7A 4WNEA 1WY6A 2VSYA 1IHGA 1OWNA 1UN8A 4PH4B 3FTVA 4I9CA 4AIFA 4C0EA 3TGOA 4DI3A 5FT9A 1E7UA 1XNFA 2X6KA 3PVLA 2LSVA 1E8WA 5G04C 4CT0A 5J08A 4U63A 4WNDA 3S7JA 3PEUB 3GZ1A 3FTSA 3SHFA 2C0LA 3S7FA 4EZJA 4N3AA 5G2NA 4GPKA 1EPUA 1B89A 3C98A 4XKBA 3I3NA 3D3MA 3Q4AB 4HXIA 1OWLA 1HXIA 3QWWA 2WXMA 3GW4A 4FLHA 5ANLA 3KS2A 3CVVA 4URKA 5LFAA 3QJZA 3APDA 2FO7A 4OVVA 3ZFWA 2UY1B 4MRUA 1N52A 3FULA 3OTNA 1E90A 3CHOA 5G05J 2L9BA 4GZCA 4XE0A 5DIZA 5BUZA 5LX8A 3CVLA 5FJYA 2J49A 1MQSA 3PREA 4KZ0A 4APOA 1NZNA 4CDRA 4BT9A 3I5PA 1U3DA 4LRZA 2GRLA 4GAAA 5G55A 1LF8A 3LY9A 4DPRA 3RRUA 5LP0A 5ARGA 1HX8A 2LO6A 4PS8A 4UI9J 4HOTA 3WXXA 2IFUA 1EDUA 3D9PA 2MRIA 4GA1A 2A5UA 4JHKA 4CDMA 3HYMB 1GW6A 2X6IA 1OWOA 4NURA 3EHMA 4KMOA 4XKCA 4DJAA 2WMNA 2WXGA 4J8EA 4F7AA 5KJMA 2E2EA 1N54A 4KYOB 1E7VA 4V3IA 3S2AA 1S0PA 3TJPA 2J9QA 2CFUA 2X38A 2PM7A 3G2SA 2Y3AA 4LERA 5FWQA 4AY6A 5J90A 5KCMA 2DCPA 1H0AA 2YHEA 3RK6A 1Y8MA 3NZUA 2VSXE 4N39A 4RG6A 3ZGQA 3APFA 2R17C 1FVHA 2V0PA 3CSFA 4H7XA 3IHVA 1ELRA 3AS5A 4JHJA 3GYZA 4UQYA 4WWOA 4K0RA 3TL5A 3MJWA 3MV3B 3ASHA 3NQPA 5EX0A 2IOLA 2XPZA 4M3OA 4UQXA 5LCWJ 2RD0A 4JL0A 4FULA 4GZ6A 2XPYA 2CFZA 3L6AA 3ONKA 2WXQA 1OUVA 4NQ0A 2CHWA 3FTUA 4JZYA 4PS7A 2WXOA 2KCLA 4Y6WA 2KCVA 3MKQB 3S7DA 3L13A 4MLPA 2XGOA 4NRHB 4ATGA 4ACKA 1TJFA 3RO3A 3FUIA 3FU0A 4E85A 5BNWA 4I1AA 2VGXB 3LPZA 3PE4A 4YNDA 3RIBA 3VTXA 3T5VA 4UWGA 3QAQA 3RRNB 5HQ8A 5LCWC 1NP7A 2QY7A 2YINA 3FU3A 5A6CA 2WXLA 4AVXA 1H2VC 2X6HA 2V8SE 1Y6IA 4N5CA 3UMVA 2J08A 4UWLA 3CGHA 3CKCA 4KT6B 4CRWA 3CVQA 3MYVA 4AM9A 5CMYA 4R7LA 3VLDA 4IULA 4BFRA 4I17A 5E75A 5G05C 3CVWA 3ZPJA 4AY5A 3ZEFA 2A4ZA 3UPVA 1SQMA 4F3VA 3CSTA 3LEWA 3L17A 2HM8A 3MZLB 4APFA 3JYSA 2WXHA 1UJJA 3P1UA 4IN3B 2X6FA 3PNTB 1KT1A 1HG2A 5FZSA 4U07A 3UT4A 4I2WA 4UI9C 4G11A 3KAEA 2C0MA 2XGSA 4W9RA 5BT1A 5FZQA 4F1SA 4HFGA 4UWFA 4JEHA 2I2OA 3JCKC 4ANVA 2L6JA 4FHKA 3TAXA 2Y4UA 4GZDA 2CHXA 2V5FA 4EQFA 4F53A 2ZU6B 1PAQA 1HF8A 2VGYA 1P5QA 4GYOA 4ME2A 3GZ2A 4U0ZA 3CHPA 4A1SA 1OWMA 3PDNA 3MKQA 5JHBA 3URZA 4LCTA 4ANUA 4I2ZA 4ILIA 4JVSA 2VJ8A 2PM6A 3Q5MA 2VSNA 2RG8A 3LKUA 4EBAG 3CLJA 3QWVA 3LVQE 3QARA 4ILGA 3CVXA 3L54A 4U0UA 3P2BA 4XI0A 2XGMA 2L0TB 3FU5A 3MA5A 4ACLA 3UT7A 1IQRA 1HO8A 1E8ZA 5AJDA 5FQ7A 3CV0A 3R7RA 3VLEA 3RU0A 4Y6CA 4ANXA 3D9OA 3LY7A 3FDHA 4WWNA 2I6HA 3FTZA 4FU3A 4JC8A 3L08A 5E76A 4BSXA 3VLFA 1WM5A 3AU4A 4LUNU 4FJZA 2KZTB 3TXNA 3QWPA 1KLXA 4B8CB 4GZ5A 3B7UX 3PEVB 3UUXA 2J07A 3JQ0A 1E8XA 1JUQA 4I6JA 4G2VA 3CK9A 4BX9A 2JLBA 4JHRA 3Q47B 1XGWA 3FUKA 4A3TA 3GZSA 1Z3XA 3FH5A 4OVUA 2VTBB 2DIWA 4G25A 1QZ2A 3FTYA 4RG9A 1HU3A 3FUNA 3OXGA 2GGFA 4GA2A 3G2UA 2HO1A 4IYPA 5JJ6A 2NSZA 2WXJA 3ENEA 5KJKA 5CCLA 2YQ8A 1U3CA 3CHSA 3KEZA 2IF4A 3B7SA 3CKBA 4I6EA 4RVBA 4XX5A 3PRZA 1TJCA 4WWPA 3SBTB 4EZLA 2LSUA 2WMOA 4HOQA 3CR3A 2GW1A 4KBQA 5FQ6A 4WNFA 4AEZC 4GA0A 3FH8A 4EPZA 3I4RB 4C0MA 2VQ2A 4L7TA 4L2YA 3RJVA 2WXPA 4UQZA 4GZ3A 3LCAA 2P58C 4EZKA 2HYZA 3ML8A 5KJNA 3U66A 3S7BA 3D9NA 4BTAA 3MEKA 4N2SA 4WUYA 3B7TA 4U8HA 4BY6A 3PNLB 3MKRA 2V4LA 4L23A 3U4TA 3ULQA 3Q49B 2WQHA 2KCKA 2ILRA 4DI4A 5ARFA 5DBKA 2UY1A 5KJLA 2BTDA 3EHNA 3ZIMA 4BT8A 4ANWA 2Y4TA 3AU5A 4AJWA 4KVOA 4IRUA 4PDXA 2AXVA 1H2TC 4QFVA 4G1TA 2OVBA 2WXKA 3B7RL 3CHRA 4JPSA 2FBNA 2XQ0A 2WB2A 3ZW3A 3D9IA 2KZTA 3JUIA 3CVYA 2BUGA 4GMJA 1QNFA 1ZBPA 2DBAA 2ONDA 3QNKA 4JEUA 4N3BA 4XIFA 3APCA 4HVBA 4J8DA 3ZYKA 3ZHEB 3TG5A 2XCBA 3PZDA 2WXIA 3MX3A 1QQEA 4CDNA 4GB9A 4UI9K 3RRMB 2VTBA 1HH8A 2PL2A 2IQCA 3U3WA 3QK0A 5ANRA 2FI7A 2PQRA 3CIAA 3U9WA 2IJGX 3R7QA 3BG0B 3L16A 2NXPA 3SNXA 3KD7A 2AXZA 3LYAA 2XRYA 3AS4A 4A3VA 4O6FA 2WXRA 5BW8C 2OVFA 3LVRE 4ILHB 1HE8A 2NC9A 4XZ4A 4A55A 2PQNA 1INZA 2AWIA 3K9IA 3HVEB 5EDSA 5BV1A 3QKYA 3PH0C 3SZ7A 1A17A 2I9CA 2LAIA 5AIJA 3FUMA 1DVPA 1FVFA 4WAFA 1H6KA 4I1OB 4G24A 3CK8A 2MHKA 4L1BA 2WM9A 4MS6A 3CHQA 3FUHA 4AOFA 3PUKA 4DK5A 4GYYA 2VSOE 3T8MA 1H19A 5T4YA 4JW1A 2I1JA 2WQ6A 3FEYA 4U04A 4BX8A 2AXUA 4ABNA 4CT4A 4K03A 4YVQC 3ZYLA 1IQUA 3HDXA 2YHCA 2KM4A 4HOSA 2LAHA 2VGXA 2OV8A 3CHMA 5C1DA 3IBEA 3RO2A 4XI9A 3D9KA 3EIQC 5BPPA 2J4DA 4D10C 1HZ4A 2WXFA 3FUFA 3ZHEA 4KXKB 4I6GA 2C2LA 2X6JA 3IEGA 1L5JA 4BWRA 5EX3A 3FHEA 3LJ3A 1BPOA 3CEQA 3LXUX 5A7DB 2IONA 3ZN3A 3B13A 1JWFA 3TXMA 1UN9A 1FCHA 2GRMA 3MGBA 3OXFA 5HI7A 2CG3A 3FWVA 1JWGA 3FU6A 4YVOA 4G26A 1NA0A 4B94A 3BG1B 1EF1C 4J8SA 1PC2A 5FTPA 2VYIA 3FY4A 4JXTA 3FFLA 3SFZA 1Z3YA 2BF0X 4BTBA 4Q96A 2OOEA 1W3BA 2X3MA 3HVEA 3IV0A 4EECA 2KATA 4PS3A 4CCAA 1VDYA 5BV0A 4DLQA 1NA3A 3ZRHA 2XRZA 4FLBA 4B8AA 4E6HA 2Q7FA 3JQ1A 2J09A 1IYGA 4UWHA 4B89A 3TG4A 1ELKA 5C2YA 3O4ZA 4PUCA 2UWJG 5M72A 2I1KA 1UW4B 2YNQA 4CGWA 4JA7A 3ESLA 3SI5A 2WVIA 3N71A 4HS2A 3CVPA 1MHQA 4FC8A 1Z6TA 4TRQA 5CCMA 5JJ7A 2PZIA 2J4BA 3L22A 3G2WA 3QDNA 3UT8A 4AV7A 2WQ7A 3ASFA 5G04J 4JA9A 3I4GA 1SZ9A 4A1GA 4LEUA 4FHJA 4FJYA 2XPIA 4HORA 4CEMA 5ENNA 3RKVA 2HR2A 3ASDA 3CQCB 4CGVA 2QFCA 1JPLA 4EBAA 2WXNA 2LNIA 1WAO1 3CVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0A A;  1UJK A;  1HFA A;  1EYH A;  1JWG A;  2QY7 A;  1ELK A;  1LF8 A;  1X5B A;  3D9M A;  4Q94 A;  3RRU A;  3ZYL A;  5LP0 A;  1HX8 A;  1JUQ A;  2KM4 A;  2LO6 A;  1UJJ A;  3D9I A;  3ONL A;  4NAC A;  4AVX A;  1INZ A;  4JXT A;  1SZA A;  1HG2 A;  1EDU A;  3D9P A;  2MOW A;  2V8S E;  3CLJ A;  3D9K A;  1XGW A;  3ZYK A;  1MHQ A;  3G2V A;  3ZYQ A;  2BF0 X;  3D9N A;  1DVP A;  3D9J A;  3G2T A;  1HG5 A;  4HFG A;  2DIW A;  2L0T B;  4Q96 A;  3G2W A;  3ONK A;  4GZD A;  4GZC A;  5CMY A;  3D9L A;  3G2U A;  1VDY A;  1SZ9 A;  1PY1 A;  1HF8 A;  3D9O A;  3ZYM A;  5CMW A;  4FLB A;  5LOZ A;  5J08 A;  4FU3 A;  3G2S A;  3LDZ A;  1JPL A;  1JWF A;  2L0I A;  2DCP A; 
#chains in the Genus database with same CATH topology
 2DZO A;  3T5X A;  4U0S A;  1ZU2 A;  4MKT A;  3FEX A;  1RW2 A;  4H7Y A;  4GU5 A;  1N4P A;  4L2L A;  3KEA A;  5JJT A;  4C9B B;  2FEZ A;  4N5Q A;  3SO8 A;  3HRA A;  3R9A B;  3TWT A;  5LOZ A;  2P9K G;  3ML9 A;  2QZA A;  3QC1 A;  3OAW A;  5D0O D;  5AEN A;  4DX1 A;  3ZYQ A;  3D9J A;  1HG5 A;  3EJN A;  3V79 K;  2E0I A;  5AJL A;  3HXC A;  5EKQ D;  4KVM A;  3UQ3 A;  2HE0 A;  3FH7 A;  3EIJ A;  3PZ2 A;  2M63 A;  2R5S A;  4DLO A;  4J6I A;  1TNZ A;  4I1M A;  3SD5 A;  4TUU A;  3DPD A;  3SGH A;  4AXH A;  2VSY A;  1IHG A;  4AIF A;  4DI3 A;  1E7U A;  1E8W A;  3GZ1 A;  3FTS A;  3S7F A;  3I3N A;  1HXI A;  3C3O A;  3Q7F A;  5D2M C;  5ANL A;  3CVV A;  4URK A;  2OEV A;  2FO7 A;  2UY1 B;  4MRU A;  1N52 A;  3FUL A;  2EIM E;  2L9B A;  1MYO A;  3CVL A;  5FJY A;  2J49 A;  1MQS A;  5ARG A;  4ZHB A;  1HX8 A;  4UI9 J;  1V55 E;  4QQI A;  4GA1 A;  4JHK A;  1BU9 A;  4KMO A;  4MBG A;  4J8E A;  2E2E A;  1N54 A;  1SA4 A;  2J8S D;  1TN7 A;  2J9Q A;  2X38 A;  1NL4 A;  2DCP A;  2YHE A;  1Y8M A;  2VSX E;  4RG6 A;  2R17 C;  3CSF A;  1ELR A;  3DXK G;  4JHJ A;  4UQY A;  3TL5 A;  5EX0 A;  4UQX A;  4JL0 A;  4FUL A;  1OUV A;  2WXO A;  2KCL A;  4Y6W A;  2ZIR A;  2XGO A;  4RQI A;  1TJF A;  3RO3 A;  5EIB E;  3LPZ A;  2V4H C;  4O1P A;  3ASO E;  1BLX B;  3QAQ A;  2YIN A;  3ISM C;  3AG2 E;  3UMV A;  2J08 A;  4UWL A;  3CGH A;  5HKP A;  4DX2 A;  3VLD A;  2DYR E;  4IUL A;  4I17 A;  3HXB A;  4AY5 A;  3EHQ A;  3ZEF A;  1OCZ E;  3MZL B;  3UIP C;  3JYS A;  2X6F A;  3PNT B;  4DX6 D;  4I2W A;  2XGS A;  5FZQ A;  4EHM A;  4UWF A;  4JEH A;  1KZP A;  2CHX A;  1O5M A;  2V5F A;  4GTO A;  1P5Q A;  3GZ2 A;  4A1S A;  1OWM A;  5JHB A;  3URZ A;  5AQ7 A;  1FT2 A;  1QBQ A;  2NYJ A;  4ILI A;  3E32 A;  3UXG A;  2RG8 A;  3J5Q B;  3CLJ A;  3QWV A;  4ILG A;  4XI0 A;  2L0T B;  5FQ7 A;  3CV0 A;  2XEE A;  4ANX A;  3D9O A;  3LY7 A;  3FTZ A;  3VLF A;  1WM5 A;  4B8C B;  4YDW A;  4RLY A;  5AQA A;  4G2V A;  2JLB A;  3DSU A;  4A3T A;  3GZS A;  4OVU A;  2KXP C;  4G25 A;  1LTX A;  2QYU A;  1HU3 A;  3FUN A;  2PNN A;  4U8V D;  2NSZ A;  1K3Z D;  5KJK A;  4RVB A;  2R2L A;  2B0O E;  4EZL A;  2WMO A;  4KBQ A;  2ETB A;  3FH8 A;  2ZXW E;  2VQ2 A;  4L2Y A;  3RJV A;  4BES A;  5KJN A;  2P58 C;  4EZK A;  3U66 A;  3SFX A;  3D9N A;  3MEK A;  4BET A;  3B7T A;  4U8H A;  2V4L A;  4L23 A;  4J8Y A;  3ULQ A;  2IO3 C;  2WQH A;  4F6R D;  1TN6 A;  5EYL A;  4IRU A;  1O1T A;  4PDX A;  4G1T A;  2OVB A;  2WXK A;  3B7R L;  3D9I A;  4GTR A;  3V31 A;  1ZBP A;  2OND A;  3QNK A;  4HVB A;  4N3B A;  4J8D A;  3PZD A;  3MX3 A;  4GB9 A;  4YDY A;  2FI7 A;  2PQR A;  2IJG X;  3BG0 B;  2NXP A;  3LYA A;  4HI8 A;  2XRY A;  4A3V A;  3DXM G;  4OAU C;  1HE8 A;  2NC9 A;  1INZ A;  5BXU A;  2A5E A;  5CEC B;  2WM9 A;  3CHQ A;  3FUH A;  4DK5 A;  4GYY A;  5HS0 A;  3ULE G;  4BER A;  2YHC A;  4HOS A;  1TNY A;  5C1D A;  3IBE A;  2ETA A;  3D9K A;  2IO2 C;  5BPP A;  2J4D A;  4D10 C;  1HZ4 A;  4I6G A;  3IEG A;  4BWR A;  5EX3 A;  1BPO A;  3LXU X;  5ENP D;  2F37 A;  3TXM A;  1UN9 A;  5HI7 A;  3FWV A;  4B94 A;  4JB8 P;  4Z68 A;  4GTP A;  3SFZ A;  2BF0 X;  4BTB A;  4Q96 A;  3HVE A;  3TWR A;  4EEC A;  4PS3 A;  1VDY A;  4DLQ A;  2IEJ A;  3ZRH A;  3JQ1 A;  2J09 A;  1S64 A;  2V5Q C;  5M72 A;  3ESL A;  3N71 A;  4FC8 A;  3BUA A;  3IXE A;  3I4G A;  1SZ9 A;  4A1G A;  4LEU A;  4FHJ A;  4FJY A;  4YDO A;  3B95 A;  5ENN A;  2HR2 A;  1FPP A;  5CER B;  1MX6 A;  2IY0 C;  2WXN A;  3DSS A;  1EYH A;  5JHA A;  2FUL A;  3NZS A;  3QB2 A;  5T8I A;  3LY8 A;  1SZA A;  3IKO B;  1E96 B;  3L9T A;  3W9F A;  1H2U A;  4DX5 D;  3DBS A;  3MV2 B;  2EQX A;  3U64 A;  1OWP A;  3RAU A;  2F8X K;  3SBS A;  3LDZ A;  1HFA A;  4G23 A;  3LS8 A;  4Q94 A;  3FUJ A;  3ONL A;  3Q78 A;  4Q69 A;  3E37 A;  4P29 A;  4OYS A;  4O60 A;  4U7E B;  3AS8 A;  3UM2 A;  3ZXP A;  5FIO A;  3G2T A;  3ZXS A;  2IOS A;  2WPV A;  5AYW D;  4FA6 A;  3O48 A;  2R03 A;  1PY1 A;  5CHE E;  1YA0 A;  3L82 A;  3OXL A;  4UWK A;  5FQ8 A;  4I9E A;  3ZVV A;  3PUJ A;  4N3C A;  1OWN A;  3FTV A;  4I9C A;  3TGO A;  1XNF A;  2LSV A;  5B3S E;  1N95 A;  4J7W A;  5J08 A;  4U63 A;  2XEN A;  1YMP A;  3SHF A;  2P9S G;  2ZGD A;  4YDE A;  1DC2 A;  4N3A A;  5HRY A;  2OCC E;  3C98 A;  4XKB A;  3D3M A;  4XEI G;  3ZFW A;  3OTN A;  3CHO A;  3JXJ A;  1MJ0 A;  3PRE A;  4KZ0 A;  4APO A;  1NZN A;  4CDR A;  1U3D A;  1LF8 A;  4DUI A;  4DPR A;  3RRU A;  2ZGG A;  4HOT A;  3WXX A;  1EDU A;  3D9P A;  2MRI A;  2XS8 A;  4CDM A;  3HYM B;  1NFI E;  4DJA A;  2WMN A;  1TNO A;  5KJM A;  4KYO B;  4V3I A;  3S2A A;  4LER A;  5FWQ A;  1RZ4 A;  5AQ9 A;  2EIK E;  3UM0 A;  4WWO A;  2RFM A;  3MV3 B;  2IOL A;  2XPZ A;  4M3O A;  2RD0 A;  5B1B E;  3NBN B;  2Y0B G;  2CHW A;  4PS7 A;  3L13 A;  3FU0 A;  4E85 A;  4HI9 A;  4I1A A;  3RIB A;  3TWQ A;  4UWG A;  3ASN E;  3EU5 A;  1H2V C;  2X6H A;  4N5C A;  4KT6 B;  3CVQ A;  3MYV A;  5CMY A;  4R7L A;  5E75 A;  5G05 C;  2P9N G;  2QYJ A;  5AAR A;  3UPV A;  1SQM A;  3L17 A;  4APF A;  5FZS A;  3UT4 A;  3KAE A;  1OXJ A;  3HXF A;  2C0M A;  1N94 A;  4HFG A;  2BKK B;  2I2O A;  3JCK C;  4FHK A;  2Y4U A;  1PAQ A;  1HF8 A;  2VGY A;  1S63 A;  4LNB A;  3MKQ A;  4I2Z A;  3ZNG A;  2P9I G;  4JVS A;  2VJ8 A;  3Q5M A;  5CED B;  2VSN A;  1V54 E;  3MA5 A;  3FU5 A;  3VLE A;  4UUC A;  4HQD A;  2I6H A;  3L08 A;  3UUX A;  1DCE A;  4I6J A;  3Q47 B;  1Z3X A;  3FH5 A;  3SQV A;  4GA2 A;  3G2U A;  5CCL A;  1U3C A;  3KEZ A;  3B7S A;  4I6E A;  3PRZ A;  3UM1 A;  4WWP A;  3SBT B;  5FQ6 A;  4BSZ B;  4WNF A;  4C0M A;  5FIN A;  4GTT A;  3S7B A;  2EIN E;  4BY6 A;  3MKR A;  4LG6 A;  2ILR A;  1TNU A;  5ARF A;  5DBK A;  5KJL A;  3EHN A;  3ZIM A;  4ANW A;  2Y4T A;  4AJW A;  2B6C A;  2GRN B;  2AXV A;  1H2T C;  4QFV A;  3CHR A;  3NOG D;  2KZT A;  3JUI A;  4XIF A;  4HRL A;  1JCQ A;  4UI9 K;  2VTB A;  3TWX A;  3L16 A;  3SNX A;  1LD7 A;  2XZD G;  5BW8 C;  4NIK A;  4ILH B;  2AWI A;  3K9I A;  3DSX A;  3PH0 C;  1FVF A;  4WAF A;  1H6K A;  4I1O B;  4L1B A;  3PZ3 A;  2GRP B;  1H19 A;  5T4Y A;  4JW1 A;  4U04 A;  4BX8 A;  4ABN A;  4CT4 A;  4K03 A;  3C3Q A;  3CHM A;  3RO2 A;  4F1P A;  2AJA A;  1JCS A;  3Q9U C;  3ZHE A;  1QYM A;  5AN8 A;  1O1R A;  3BU8 A;  3LJ3 A;  1JWF A;  1FCH A;  2GRM A;  3SY2 A;  3MGB A;  4YVO A;  1KZO A;  3EHR A;  4G26 A;  4J8S A;  5FTP A;  3FFL A;  2OOE A;  2KAT A;  3SFY A;  5BV0 A;  1NA3 A;  1ZB1 A;  1Q2Z A;  2Q7F A;  1IYG A;  1UOH A;  2P2C P;  4B89 A;  3TG4 A;  5CRU A;  1UW4 B;  2YNQ A;  4CGW A;  3SI5 A;  4HS2 A;  4K5A B;  3CVP A;  1MHQ A;  5JJ7 A;  3UM3 A;  2PZI A;  3ASF A;  4JA9 A;  4CEM A;  3RKV A;  2QFC A;  1JPL A;  4EBA A;  4JC8 A;  1WAO 1;  1HS6 A;  3FTX A;  4O1O A;  1X5B A;  3Q15 A;  2DZN A;  1N11 A;  2XEV A;  1N0R A;  3HIZ A;  3C5R A;  3DST A;  3DSV A;  3JXI A;  2F0Y A;  4J0U A;  3MCX A;  1ELW A;  5D0Q D;  1IKN D;  1E8Y A;  3CVN A;  3FUE A;  2XCC A;  3PE3 A;  3AG4 E;  2JEK A;  3UKU G;  4GYW A;  5FQ4 A;  3QOU A;  2AW6 A;  3D9L A;  4WNG A;  2GRR B;  4HOU A;  4J8F A;  1WG0 A;  5CMW A;  3ASG A;  3PS6 A;  3HHM A;  3R9M A;  2L0I A;  4AP2 A;  4GML A;  3J5P A;  1IXV A;  3NF1 A;  2KC7 A;  2GRQ B;  3KSL A;  1AP7 A;  3Q79 A;  1WY6 A;  4PH4 B;  4C0E A;  5FT9 A;  3PVL A;  4HRN A;  1A5E A;  5CEA A;  5G04 C;  4WND A;  1OT8 A;  3PEU B;  3T8K A;  2C0L A;  2Y1L E;  4HXI A;  1H6P A;  3UIO C;  4TXP A;  2WXM A;  5LFA A;  3QJZ A;  4OVV A;  5G05 J;  4U95 D;  1AWC B;  4GAA A;  4HLL A;  4PS8 A;  2IFU A;  2A5U A;  3EHM A;  4XKC A;  2WXG A;  3ABM E;  4F7A A;  1TYQ G;  2DWZ A;  5ENQ D;  1E7V A;  2RKK A;  2CFU A;  2PM7 A;  2Y3A A;  3Q7A A;  4AY6 A;  5KCM A;  1X81 A;  1H0A A;  4N39 A;  3ZGQ A;  2V0P A;  4H7X A;  3IHV A;  3WG7 E;  3GYZ A;  3NQP A;  3ASH A;  4GZ6 A;  4NQ0 A;  4TXQ A;  4JZY A;  3S7D A;  4MLP A;  4NRH B;  3D9H A;  3PE4 A;  4YND A;  3VTX A;  3T5V A;  4G8L A;  5HQ8 A;  5A6C A;  5ITZ F;  2WXL A;  3UI2 A;  3W9G A;  1S70 B;  4CYM D;  3ULY A;  3CKC A;  5JMN D;  4BFR A;  3V2O A;  4C48 B;  2H6I A;  2P9P G;  2HM8 A;  3P1U A;  4IN3 B;  1KT1 A;  1N9A A;  4U07 A;  2EIJ E;  5BT1 A;  3ZU7 B;  4F1S A;  2R02 A;  4X8Q A;  2L6J A;  4GPM A;  4EQF A;  1MZC A;  4ME2 A;  4GYO A;  4G8K A;  3HXD A;  5KNH D;  4LCT A;  4HNA D;  2ZIS A;  2VGE A;  2PM6 A;  4EBA G;  3QAR A;  3CVX A;  1N4R A;  3L54 A;  3P2B A;  2XGM A;  5EIL A;  1FT1 A;  3UT7 A;  1IQR A;  5AJD A;  1E8Z A;  5LCW C;  3RU0 A;  4HB5 A;  4FU3 A;  4BSX A;  1YYH A;  3AU4 A;  3QWP A;  4GZ5 A;  3AJI A;  3PEV B;  1E8X A;  2LXM A;  2H6F A;  4JHR A;  1XGW A;  3FUK A;  5ENR D;  1SA5 A;  2DIW A;  1QZ2 A;  3FTY A;  2GGF A;  4IYP A;  5JJ6 A;  2WXJ A;  5KNG A;  3ENE A;  1NI1 A;  3CKB A;  1TJC A;  2LSU A;  4HOQ A;  3EU9 A;  4GA0 A;  4EPZ A;  3DSW A;  4L7T A;  3AG3 E;  4UQZ A;  4GZ3 A;  2EIL E;  3LCA A;  4BTA A;  1G3N B;  4GTV A;  1TNB A;  3U4T A;  3EUV A;  3AU5 A;  2H6G A;  4JPS A;  2FBN A;  2WB2 A;  3ZW3 A;  2BUG A;  4GMJ A;  3TG5 A;  2XCB A;  4K5B A;  1QQE A;  4CDN A;  3AG1 E;  4DRX E;  3RRM B;  3U3W A;  3QK0 A;  5ANR A;  3R7Q A;  2Y69 E;  3KD7 A;  4ATZ D;  1O1S A;  2WXR A;  2BED A;  1OCC E;  1N4S A;  3HVE B;  2L6B A;  2LAI A;  5AIJ A;  3FUM A;  1DVP A;  2P9L G;  4HBD A;  4AOF A;  3PUK A;  3NB2 A;  2VSO E;  3T8M A;  3X2Q E;  2I1J A;  2WQ6 A;  3FEY A;  3HXE A;  3ZYL A;  1IQU A;  2KM4 A;  2LAH A;  2VGX A;  3DWL G;  3DPY A;  4K5C A;  3EIQ C;  4L9P A;  1D8E A;  4KXK B;  2C2L A;  2X6J A;  5A7D B;  3ZN3 A;  3B13 A;  1NA0 A;  1PC2 A;  2VYI A;  4JXT A;  4LSZ E;  1OCO E;  3IV0 A;  2X3M A;  3UKR G;  1K1B A;  2QC9 A;  2XRZ A;  4B8A A;  1OY3 D;  4UWH A;  1BD8 A;  3O4Z A;  4PUC A;  2UWJ G;  2I1K A;  3ABL E;  3V30 A;  1DCQ A;  1JCR A;  1Z6T A;  5CCM A;  5IY5 E;  2J4B A;  3G2W A;  3QDN A;  3UT8 A;  4AV7 A;  5G04 J;  4GTQ A;  2XPI A;  4HOR A;  3DEP A;  3ASD A;  3CQC B;  4CGV A;  2FO1 E;  4W9R A;  1UJK A;  2ETC A;  1K1A A;  3RSE G;  3E4B A;  2CHZ A;  3EDT B;  2R59 A;  4B0Z A;  2MOW A;  3AAA C;  4CZ2 D;  2IU1 A;  3BEE A;  2FF4 A;  5T3R A;  4TV3 A;  2CG2 A;  2KBX A;  5CRV A;  1DNP A;  4GCO A;  2XHE A;  4I43 A;  3FUD A;  5A23 A;  1BI7 B;  4FP7 A;  3D9M A;  4HLE A;  5FZR A;  3TWV A;  4RSY A;  3G2V A;  4LNU D;  3ESK A;  4KZC A;  3HG0 D;  4GTM A;  3VTY A;  3UX4 A;  4GCN A;  3ZYM A;  3FP3 A;  3IHY A;  1UG3 A;  3SF4 A;  2DYS E;  1KT0 A;  4FAD A;  1H6O A;  4NAC A;  2AVP A;  3CQG B;  3FTW A;  4N2Q A;  3CK7 A;  4WNE A;  4A63 B;  1UN8 A;  5ENT D;  2X6K A;  4CT0 A;  3S7J A;  2F8Y A;  5ENO D;  4BEP A;  4EZJ A;  5G2N A;  4GPK A;  1EPU A;  1B89 A;  3B7B A;  3Q4A B;  1OWL A;  3JUE A;  3QWW A;  3GW4 A;  4FLH A;  3KS2 A;  2XEH A;  3APD A;  3ZUV B;  1KPS B;  1E90 A;  4GZC A;  4XE0 A;  5DIZ A;  5BUZ A;  2R05 A;  5LX8 A;  4BT9 A;  3I5P A;  2DVW A;  4LRZ A;  2GRL A;  5G55 A;  3LY9 A;  5LP0 A;  4U8Y D;  2LO6 A;  3F6Q A;  1GW6 A;  2X6I A;  1OWO A;  4NUR A;  5EID A;  3Q73 A;  3BQO A;  1S0P A;  3TJP A;  1IHB A;  3G2S A;  4B93 B;  5J90 A;  2P9U G;  1MX2 A;  3RK6 A;  5KBA A;  1TN8 A;  3KSQ A;  3NZU A;  3APF A;  1FVH A;  1OCR E;  1D8D A;  3AS5 A;  4K0R A;  3MJW A;  5LCW J;  4M7C A;  2XPY A;  2CFZ A;  3L6A A;  3ONK A;  2WXQ A;  4DX7 D;  3FTU A;  4GMR A;  5H7P A;  2KCV A;  3MKQ B;  4ATG A;  4ACK A;  3FUI A;  3PZ1 A;  5BNW A;  4TUM A;  5KWD A;  1BI8 B;  2VGX B;  1U2V G;  2JAB A;  3RRN B;  2GRO B;  4JD2 G;  1NP7 A;  2QY7 A;  3FU3 A;  4AVX A;  3ABK E;  2V8S E;  1Y6I A;  5JA4 D;  2OEW A;  4TXR A;  4CRW A;  5AQB A;  4AM9 A;  2XZT G;  3CVW A;  5ENS D;  3ZPJ A;  5BXO A;  3TWS A;  2A4Z A;  4F3V A;  3CST A;  3LEW A;  2WXH A;  1UJJ A;  3T9K A;  5CBO A;  1HG2 A;  4UI9 C;  4G11 A;  4ANV A;  3TAX A;  4GZD A;  4F53 A;  2ZU6 B;  4U0Z A;  3CHP A;  3DEO A;  3PDN A;  4ANU A;  3LKU A;  3LVQ E;  1WDY A;  4ACL A;  4U0U A;  1SW6 A;  3PZ4 A;  1HO8 A;  3R7R A;  4Y6C A;  3FDH A;  4WWN A;  5E76 A;  1YCS B;  4LUN U;  4FJZ A;  2KZT B;  3TXN A;  1KLX A;  3B7U X;  2J07 A;  3JQ0 A;  1JUQ A;  3CK9 A;  4BX9 A;  5D66 A;  4ZFH A;  2VTB B;  4RG9 A;  3NAW A;  3OXG A;  4U96 D;  3V2X A;  2HO1 A;  1TR4 A;  3E33 A;  4GTS A;  2YQ8 A;  3CHS A;  2IF4 A;  4XX5 A;  4LNG A;  3CR3 A;  2GW1 A;  4AEZ C;  3I4R B;  3ZKJ A;  2WXP A;  2HYZ A;  3ML8 A;  5EYP F;  4N2S A;  4WUY A;  3PNL B;  2LXL A;  5EN5 D;  1D9S A;  3Q49 B;  2KCK A;  4DI4 A;  2UY1 A;  2BTD A;  4BT8 A;  4KVO A;  3TWW A;  3Q9N C;  4HRM B;  2XQ0 A;  3CVY A;  1QNF A;  2DBA A;  4JEU A;  1TEZ A;  3APC A;  2H6H A;  2RFA A;  3ZYK A;  3ZHE B;  2WXI A;  1HH8 A;  2PL2 A;  2IQC A;  3CIA A;  3U9W A;  5AAO A;  2AXZ A;  1MX4 A;  3AS4 A;  4O6F A;  2OVF A;  3LVR E;  4XZ4 A;  4A55 A;  2PQN A;  5EDS A;  5BV1 A;  3QKY A;  3SZ7 A;  1A17 A;  2I9C A;  3TWU A;  4G24 A;  3CK8 A;  2MHK A;  4MS6 A;  1K8K G;  3Q75 A;  1N0Q A;  4OAV B;  2AXU A;  4YVQ C;  3HDX A;  2OV8 A;  1N4Q A;  3LJN A;  4XI9 A;  5B1A E;  3E30 A;  2WXF A;  3FUF A;  2XS1 A;  2MYO A;  1L5J A;  3FHE A;  3CEQ A;  2ION A;  3OXF A;  2CG3 A;  1JWG A;  3FU6 A;  1Z5S C;  3BG1 B;  1EF1 C;  3FY4 A;  3C3R A;  3NOC D;  1Z3Y A;  1W3B A;  3C72 A;  4CCA A;  4FLB A;  3UTM A;  4E6H A;  5CBN A;  1LD8 A;  1SVX A;  1ELK A;  5C2Y A;  4JA7 A;  2WVI A;  3UIN C;  2BKG A;  2LUH A;  4TRQ A;  3L22 A;  3E34 A;  3DRA A;  2WQ7 A;  2LNI A;  3CVU A; 
#chains in the Genus database with same CATH homology
 1UJK A;  1HS6 A;  3FTX A;  1EYH A;  5JHA A;  3E4B A;  1X5B A;  2CHZ A;  3T5X A;  2FUL A;  3NZS A;  3EDT B;  4U0S A;  3Q15 A;  2R59 A;  3QB2 A;  5T8I A;  1ZU2 A;  4B0Z A;  3LY8 A;  1SZA A;  4MKT A;  1TEZ A;  3FEX A;  2MOW A;  3ZYM A;  2XEV A;  3IKO B;  1E96 B;  3HIZ A;  1H2U A;  2IU1 A;  3BEE A;  2FF4 A;  3DBS A;  4GU5 A;  4H7Y A;  4L2L A;  3MV2 B;  5JJT A;  4C9B B;  2FEZ A;  2EQX A;  5T3R A;  4TV3 A;  2CG2 A;  3U64 A;  1OWP A;  3R9A B;  4J0U A;  1DNP A;  4GCO A;  3MCX A;  1ELW A;  2XHE A;  4I43 A;  5LOZ A;  3SBS A;  5D0Q D;  3LDZ A;  3FUD A;  3ML9 A;  5A23 A;  1HFA A;  3QC1 A;  3LS8 A;  4G23 A;  3OAW A;  4FP7 A;  1E8Y A;  3CVN A;  3D9M A;  4Q94 A;  3FUJ A;  5D0O D;  4HLE A;  3FUE A;  2XCC A;  3ONL A;  3PE3 A;  4Q69 A;  5AEN A;  5FZR A;  4P29 A;  4OYS A;  2JEK A;  3AS8 A;  4RSY A;  4GYW A;  3G2V A;  3ZYQ A;  3D9J A;  5FQ4 A;  3G2T A;  3QOU A;  2AW6 A;  1HG5 A;  2IOS A;  3EJN A;  3ESK A;  3ZXS A;  2E0I A;  5AJL A;  4KZC A;  2WPV A;  3VTY A;  3D9L A;  4WNG A;  3UX4 A;  5AYW D;  4GCN A;  4FA6 A;  3O48 A;  1PY1 A;  4HOU A;  4KVM A;  3FP3 A;  5CHE E;  5EKQ D;  3IHY A;  4J8F A;  1UG3 A;  3UQ3 A;  1YA0 A;  3ASG A;  5CMW A;  3FH7 A;  3EIJ A;  3PS6 A;  3OXL A;  3HHM A;  2M63 A;  2R5S A;  2L0I A;  3SF4 A;  4AP2 A;  4GML A;  4UWK A;  1KT0 A;  4J6I A;  4DLO A;  5FQ8 A;  4FAD A;  4I1M A;  3SD5 A;  4I9E A;  4NAC A;  4TUU A;  2AVP A;  3CQG B;  3FTW A;  3ZVV A;  3NF1 A;  3PUJ A;  2KC7 A;  3DPD A;  4N3C A;  3SGH A;  4AXH A;  4N2Q A;  3CK7 A;  4WNE A;  1WY6 A;  2VSY A;  1IHG A;  1OWN A;  1UN8 A;  4PH4 B;  3FTV A;  4I9C A;  4AIF A;  4C0E A;  3TGO A;  4DI3 A;  5FT9 A;  1E7U A;  1XNF A;  2X6K A;  3PVL A;  2LSV A;  1E8W A;  5G04 C;  4CT0 A;  5J08 A;  4U63 A;  4WND A;  3S7J A;  3PEU B;  3GZ1 A;  3FTS A;  3SHF A;  2C0L A;  3S7F A;  4EZJ A;  4N3A A;  5G2N A;  4GPK A;  1EPU A;  1B89 A;  3C98 A;  4XKB A;  3I3N A;  3D3M A;  3Q4A B;  4HXI A;  1OWL A;  1HXI A;  3QWW A;  2WXM A;  3GW4 A;  4FLH A;  5ANL A;  3KS2 A;  3CVV A;  4URK A;  5LFA A;  3QJZ A;  3APD A;  2FO7 A;  4OVV A;  3ZFW A;  2UY1 B;  4MRU A;  1N52 A;  3FUL A;  3OTN A;  1E90 A;  3CHO A;  5G05 J;  2L9B A;  4GZC A;  4XE0 A;  5DIZ A;  5BUZ A;  5LX8 A;  3CVL A;  5FJY A;  2J49 A;  1MQS A;  3PRE A;  4KZ0 A;  4APO A;  1NZN A;  4CDR A;  4BT9 A;  3I5P A;  1U3D A;  4LRZ A;  2GRL A;  4GAA A;  5G55 A;  1LF8 A;  3LY9 A;  4DPR A;  3RRU A;  5LP0 A;  5ARG A;  1HX8 A;  2LO6 A;  4PS8 A;  4UI9 J;  4HOT A;  3WXX A;  2IFU A;  1EDU A;  3D9P A;  2MRI A;  4GA1 A;  2A5U A;  4JHK A;  4CDM A;  3HYM B;  1GW6 A;  2X6I A;  1OWO A;  4NUR A;  3EHM A;  4KMO A;  4XKC A;  4DJA A;  2WMN A;  2WXG A;  4J8E A;  4F7A A;  5KJM A;  2E2E A;  1N54 A;  4KYO B;  1E7V A;  4V3I A;  3S2A A;  1S0P A;  3TJP A;  2J9Q A;  2CFU A;  2X38 A;  2PM7 A;  3G2S A;  2Y3A A;  4LER A;  5FWQ A;  4AY6 A;  5J90 A;  5KCM A;  2DCP A;  1H0A A;  2YHE A;  3RK6 A;  1Y8M A;  3NZU A;  2VSX E;  4N39 A;  4RG6 A;  3ZGQ A;  3APF A;  2R17 C;  1FVH A;  2V0P A;  3CSF A;  4H7X A;  3IHV A;  1ELR A;  3AS5 A;  4JHJ A;  3GYZ A;  4UQY A;  4WWO A;  4K0R A;  3TL5 A;  3MJW A;  3MV3 B;  3ASH A;  3NQP A;  5EX0 A;  2IOL A;  2XPZ A;  4M3O A;  4UQX A;  5LCW J;  2RD0 A;  4JL0 A;  4FUL A;  4GZ6 A;  2XPY A;  2CFZ A;  3L6A A;  3ONK A;  2WXQ A;  1OUV A;  4NQ0 A;  2CHW A;  3FTU A;  4JZY A;  4PS7 A;  2WXO A;  2KCL A;  4Y6W A;  2KCV A;  3MKQ B;  3S7D A;  3L13 A;  4MLP A;  2XGO A;  4NRH B;  4ATG A;  4ACK A;  1TJF A;  3RO3 A;  3FUI A;  3FU0 A;  4E85 A;  5BNW A;  4I1A A;  2VGX B;  3LPZ A;  3PE4 A;  4YND A;  3RIB A;  3VTX A;  3T5V A;  4UWG A;  3QAQ A;  3RRN B;  5HQ8 A;  5LCW C;  1NP7 A;  2QY7 A;  2YIN A;  3FU3 A;  5A6C A;  2WXL A;  4AVX A;  1H2V C;  2X6H A;  2V8S E;  1Y6I A;  4N5C A;  3UMV A;  2J08 A;  4UWL A;  3CGH A;  3CKC A;  4KT6 B;  4CRW A;  3CVQ A;  3MYV A;  4AM9 A;  5CMY A;  4R7L A;  3VLD A;  4IUL A;  4BFR A;  4I17 A;  5E75 A;  5G05 C;  3CVW A;  3ZPJ A;  4AY5 A;  3ZEF A;  2A4Z A;  3UPV A;  1SQM A;  4F3V A;  3CST A;  3LEW A;  3L17 A;  2HM8 A;  3MZL B;  4APF A;  3JYS A;  2WXH A;  1UJJ A;  3P1U A;  4IN3 B;  2X6F A;  3PNT B;  1KT1 A;  1HG2 A;  5FZS A;  4U07 A;  3UT4 A;  4I2W A;  4UI9 C;  4G11 A;  3KAE A;  2C0M A;  2XGS A;  4W9R A;  5BT1 A;  5FZQ A;  4F1S A;  4HFG A;  4UWF A;  4JEH A;  2I2O A;  3JCK C;  4ANV A;  2L6J A;  4FHK A;  3TAX A;  2Y4U A;  4GZD A;  2CHX A;  2V5F A;  4EQF A;  4F53 A;  2ZU6 B;  1PAQ A;  1HF8 A;  2VGY A;  1P5Q A;  4GYO A;  4ME2 A;  3GZ2 A;  4U0Z A;  3CHP A;  4A1S A;  1OWM A;  3PDN A;  3MKQ A;  5JHB A;  3URZ A;  4LCT A;  4ANU A;  4I2Z A;  4ILI A;  4JVS A;  2VJ8 A;  2PM6 A;  3Q5M A;  2VSN A;  2RG8 A;  3LKU A;  4EBA G;  3CLJ A;  3QWV A;  3LVQ E;  3QAR A;  4ILG A;  3CVX A;  3L54 A;  4U0U A;  3P2B A;  4XI0 A;  2XGM A;  2L0T B;  3FU5 A;  3MA5 A;  4ACL A;  3UT7 A;  1IQR A;  1HO8 A;  1E8Z A;  5AJD A;  5FQ7 A;  3CV0 A;  3R7R A;  3VLE A;  3RU0 A;  4Y6C A;  4ANX A;  3D9O A;  3LY7 A;  3FDH A;  4WWN A;  2I6H A;  3FTZ A;  4FU3 A;  4JC8 A;  3L08 A;  5E76 A;  4BSX A;  3VLF A;  1WM5 A;  3AU4 A;  4LUN U;  4FJZ A;  2KZT B;  3TXN A;  3QWP A;  1KLX A;  4B8C B;  4GZ5 A;  3B7U X;  3PEV B;  3UUX A;  2J07 A;  3JQ0 A;  1E8X A;  1JUQ A;  4I6J A;  4G2V A;  3CK9 A;  4BX9 A;  2JLB A;  4JHR A;  3Q47 B;  1XGW A;  3FUK A;  4A3T A;  3GZS A;  1Z3X A;  3FH5 A;  4OVU A;  2VTB B;  2DIW A;  4G25 A;  1QZ2 A;  3FTY A;  4RG9 A;  1HU3 A;  3FUN A;  3OXG A;  2GGF A;  4GA2 A;  3G2U A;  2HO1 A;  4IYP A;  5JJ6 A;  2NSZ A;  2WXJ A;  3ENE A;  5KJK A;  5CCL A;  2YQ8 A;  1U3C A;  3CHS A;  3KEZ A;  2IF4 A;  3B7S A;  3CKB A;  4I6E A;  4RVB A;  4XX5 A;  3PRZ A;  1TJC A;  4WWP A;  3SBT B;  4EZL A;  2LSU A;  2WMO A;  4HOQ A;  3CR3 A;  2GW1 A;  4KBQ A;  5FQ6 A;  4WNF A;  4AEZ C;  4GA0 A;  3FH8 A;  4EPZ A;  3I4R B;  4C0M A;  2VQ2 A;  4L7T A;  4L2Y A;  3RJV A;  2WXP A;  4UQZ A;  4GZ3 A;  3LCA A;  2P58 C;  4EZK A;  2HYZ A;  3ML8 A;  5KJN A;  3U66 A;  3S7B A;  3D9N A;  4BTA A;  3MEK A;  4N2S A;  4WUY A;  3B7T A;  4U8H A;  4BY6 A;  3PNL B;  3MKR A;  2V4L A;  4L23 A;  3U4T A;  3ULQ A;  3Q49 B;  2WQH A;  2KCK A;  2ILR A;  4DI4 A;  5ARF A;  5DBK A;  2UY1 A;  5KJL A;  2BTD A;  3EHN A;  3ZIM A;  4BT8 A;  4ANW A;  2Y4T A;  3AU5 A;  4AJW A;  4KVO A;  4IRU A;  4PDX A;  2AXV A;  1H2T C;  4QFV A;  4G1T A;  2OVB A;  2WXK A;  3B7R L;  3CHR A;  4JPS A;  2FBN A;  2XQ0 A;  2WB2 A;  3ZW3 A;  3D9I A;  2KZT A;  3JUI A;  3CVY A;  2BUG A;  4GMJ A;  1QNF A;  1ZBP A;  2DBA A;  2OND A;  3QNK A;  4JEU A;  4N3B A;  4XIF A;  3APC A;  4HVB A;  4J8D A;  3ZYK A;  3ZHE B;  3TG5 A;  2XCB A;  3PZD A;  2WXI A;  3MX3 A;  1QQE A;  4CDN A;  4GB9 A;  4UI9 K;  3RRM B;  2VTB A;  1HH8 A;  2PL2 A;  2IQC A;  3U3W A;  3QK0 A;  5ANR A;  2FI7 A;  2PQR A;  3CIA A;  3U9W A;  2IJG X;  3R7Q A;  3BG0 B;  3L16 A;  2NXP A;  3SNX A;  3KD7 A;  2AXZ A;  3LYA A;  2XRY A;  3AS4 A;  4A3V A;  4O6F A;  2WXR A;  5BW8 C;  2OVF A;  3LVR E;  4ILH B;  1HE8 A;  2NC9 A;  4XZ4 A;  4A55 A;  2PQN A;  1INZ A;  2AWI A;  3K9I A;  3HVE B;  5EDS A;  5BV1 A;  3QKY A;  3PH0 C;  3SZ7 A;  1A17 A;  2I9C A;  2LAI A;  5AIJ A;  3FUM A;  1DVP A;  1FVF A;  4WAF A;  1H6K A;  4I1O B;  4G24 A;  3CK8 A;  2MHK A;  4L1B A;  2WM9 A;  4MS6 A;  3CHQ A;  3FUH A;  4AOF A;  3PUK A;  4DK5 A;  4GYY A;  2VSO E;  3T8M A;  1H19 A;  5T4Y A;  4JW1 A;  2I1J A;  2WQ6 A;  3FEY A;  4U04 A;  4BX8 A;  2AXU A;  4ABN A;  4CT4 A;  4K03 A;  4YVQ C;  3ZYL A;  1IQU A;  3HDX A;  2YHC A;  2KM4 A;  4HOS A;  2LAH A;  2VGX A;  2OV8 A;  3CHM A;  5C1D A;  3IBE A;  3RO2 A;  4XI9 A;  3D9K A;  3EIQ C;  5BPP A;  2J4D A;  4D10 C;  1HZ4 A;  2WXF A;  3FUF A;  3ZHE A;  4KXK B;  4I6G A;  2C2L A;  2X6J A;  3IEG A;  1L5J A;  4BWR A;  5EX3 A;  3FHE A;  3LJ3 A;  1BPO A;  3CEQ A;  3LXU X;  5A7D B;  2ION A;  3ZN3 A;  3B13 A;  1JWF A;  3TXM A;  1UN9 A;  1FCH A;  2GRM A;  3MGB A;  3OXF A;  5HI7 A;  2CG3 A;  3FWV A;  1JWG A;  3FU6 A;  4YVO A;  4G26 A;  1NA0 A;  4B94 A;  3BG1 B;  1EF1 C;  4J8S A;  1PC2 A;  5FTP A;  2VYI A;  3FY4 A;  4JXT A;  3FFL A;  3SFZ A;  1Z3Y A;  2BF0 X;  4BTB A;  4Q96 A;  2OOE A;  1W3B A;  2X3M A;  3HVE A;  3IV0 A;  4EEC A;  2KAT A;  4PS3 A;  4CCA A;  1VDY A;  5BV0 A;  4DLQ A;  1NA3 A;  3ZRH A;  2XRZ A;  4FLB A;  4B8A A;  4E6H A;  2Q7F A;  3JQ1 A;  2J09 A;  1IYG A;  4UWH A;  4B89 A;  3TG4 A;  1ELK A;  5C2Y A;  3O4Z A;  4PUC A;  2UWJ G;  5M72 A;  2I1K A;  1UW4 B;  2YNQ A;  4CGW A;  4JA7 A;  3ESL A;  3SI5 A;  2WVI A;  3N71 A;  4HS2 A;  3CVP A;  1MHQ A;  4FC8 A;  1Z6T A;  4TRQ A;  5CCM A;  5JJ7 A;  2PZI A;  2J4B A;  3L22 A;  3G2W A;  3QDN A;  3UT8 A;  4AV7 A;  2WQ7 A;  3ASF A;  5G04 J;  4JA9 A;  3I4G A;  1SZ9 A;  4A1G A;  4LEU A;  4FHJ A;  4FJY A;  2XPI A;  4HOR A;  4CEM A;  5ENN A;  3RKV A;  2HR2 A;  3ASD A;  3CQC B;  4CGV A;  2QFC A;  1JPL A;  4EBA A;  2WXN A;  2LNI A;  1WAO 1;  3CVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...