3D9LA

Snapshots of the rna processing factor scaf8 bound to different phosphorylated forms of the carboxy-terminal domain of rna-polymerase ii
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
140
structure length
140
Chain Sequence
EAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAALEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/peptide
molecule keywords RNA-binding protein 16
publication title Snapshots of the RNA Processing Factor SCAF8 Bound to Different Phosphorylated Forms of the Carboxyl-terminal Domain of RNA Polymerase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3d9lA00
5LOZA 3G2UA 4FU3A 3ONLA 1JPLA 1HF8A 1EDUA 4AVXA 4NACA 2MOWA 4GZDA 3LDZA 1EYHA 3G2SA 4FLBA 3D9MA 2DIWA 4GZCA 3ZYLA 1X5BA 3ZYQA 2LO6A 2KM4A 1HX8A 3ONKA 1HG2A 2L0TB 1UJJA 1SZAA 1ELKA 5CMWA 3CLJA 1INZA 3D9LA 3D9JA 1LF8A 3D9NA 3RRUA 1DVPA 2BF0X 3D9OA 2DCPA 4Q96A 1MHQA 2L0IA 1XGWA 5LP0A 1HG5A 2QY7A 3ZYKA 1UJKA 3D9KA 3D9PA 5J08A 2V8SE 1JWGA 1H0AA 1HFAA 1PY1A 1JWFA 1SZ9A 3D9IA 1JUQA 3G2TA 1VDYA 4JXTA 3G2VA 4HFGA 4Q94A 3G2WA 5CMYA 3ZYMA
chains in the Genus database with same CATH superfamily
3U66A 3D3MA 2L6JA 2IOSA 1TNBA 1RW2A 5G04C 3SD5A 3R9AB 2J09A 2AJAA 3B7UX 3EHRA 3KAEA 3UTMA 4B0ZA 3GW4A 3ZYKA 4G8KA 4IULA 4B89A 2H6GA 5HS0A 1OXJA 3ZEFA 3KSLA 3C72A 3CR3A 4FULA 2KCKA 4OVVA 3ULQA 4H7YA 2YINA 2PNNA 3Q9NC 3AS5A 3CK8A 2V4LA 3LKUA 2Y1LE 1N4SA 2PZIA 3WXXA 3CHMA 1OWPA 2R03A 1H2UA 1DCQA 4CRWA 4JHKA 2LAIA 4GPMA 3R7RA 4OVUA 4HRLA 1IYGA 4HRNA 1G3NB 3PEVB 3MJWA 4JHJA 3DSWA 1TEZA 4GTOA 5CMWA 3TWQA 4AIFA 3ML9A 3FFLA 5FQ6A 2HE0A 4BTAA 1OCRE 3D9IA 1ZBPA 1VDYA 1BU9A 4R7LA 3ZPJA 3R9MA 5T8IA 1A5EA 3NF1A 4WWNA 3GZ2A 3LVRE 3G2SA 2QYUA 4G23A 4EBAA 2VSOE 4BX8A 3FEYA 5BV1A 2XGMA 2GROB 4AEZC 4CEMA 4LSZE 4B8CB 3TXNA 3SFZA 1AP7A 2YQ8A 1NZNA 1OY3D 2WVIA 3T5VA 3LCAA 2XRZA 2J8SD 2XRYA 4J0UA 3VLFA 5CERB 4N5QA 1XGWA 4U8YD 2PQNA 1KLXA 1N4RA 2X6HA 1Z3YA 3CK9A 1TN6A 3FTVA 5EN5D 2ILRA 5AIJA 2R02A 4J8DA 3TWTA 4CT4A 2CHWA 3HXFA 1O1RA 2ZIRA 5AQAA 3QC1A 1Z5SC 1TNZA 5ITZF 4HVBA 4B94A 2IY0C 1XNFA 2OOEA 4IYPA 4G24A 3UM0A 2MHKA 4ZHBA 4GTQA 3DEOA 3QKYA 3AU5A 3QB2A 4F53A 4G1TA 4GTVA 5ANLA 5CRVA 1HZ4A 1FCHA 3CHQA 1JCQA 4DX6D 4I17A 4W9RA 2X6JA 1O1TA 4EPZA 2FBNA 3JUEA 3PNTB 5FIOA 1GW6A 4IN3B 3ZU7B 4HI8A 3QK0A 5D0QD 1FVHA 2GRNB 2OEVA 1N94A 2AVPA 3DEPA 2L6BA 3ZYMA 5KNGA 2EQXA 2WXKA 2A4ZA 2GRMA 3ZYLA 4KT6B 3FUJA 1TR4A 3UM1A 2BTDA 3LEWA 1H2TC 1NA0A 2WMNA 5ENOD 3PDNA 4NIKA 3MKQA 4XIFA 4YDWA 5AYWD 3HVEB 4J8YA 4BERA 1OWNA 2JABA 3BUAA 3LDZA 5FTPA 2BUGA 5EDSA 5E75A 5JMND 4GTRA 3E30A 5CCMA 5IY5E 5AN8A 3IEGA 5AJDA 3HXBA 3V2OA 3HVEA 4GAAA 2J49A 3FUHA 1RZ4A 3Q15A 4JEUA 5KJLA 1Z6TA 1HE8A 3UT7A 4HQDA 3CKCA 3FUMA 1SA5A 1P5QA 2DZOA 3LJNA 1ZB1A 3CGHA 2AW6A 3BEEA 4Q94A 3LS8A 3ZHEB 3IBEA 2XGOA 3UM3A 3J5PA 4ANUA 3Q7FA 1EF1C 4EBAG 1OCZE 4I6JA 4GTTA 3SO8A 1DVPA 4OAUC 3E32A 4WNGA 3I5PA 4NURA 3FU3A 4DK5A 2LXLA 1BI7B 3ZHEA 3GZ1A 2YHCA 4KZCA 4FADA 1DCEA 4GA2A 4UQXA 2C2LA 5KJKA 3CSFA 4XI9A 3ULYA 2CG3A 3S7JA 3VTXA 3DWLG 2AXUA 3EJNA 4DRXE 2HO1A 1JPLA 5HRYA 3ZIMA 4BSXA 3CQCB 4L9PA 2WXHA 3FY4A 4BESA 3HIZA 4GYYA 3CHPA 3QOUA 5A23A 3V79K 4Q96A 2WXOA 3QWVA 2CHXA 1IQRA 2HR2A 3FUNA 5KNHD 3Q4AB 1O1SA 3LPZA 3EDTB 5AQ9A 2MOWA 3DBSA 4ATGA 1OCOE 1YYHA 2YNQA 3ZYQA 4HOUA 3JXJA 3NZUA 4BT9A 5EIDA 1H6PA 3IKOB 2ZXWE 3AAAC 2KZTB 4AOFA 2NC9A 2KBXA 4PUCA 3IHVA 2YHEA 3PE4A 2X6IA 3C98A 4I1OB 3ABKE 2WXQA 3QWPA 3ZGQA 4JHRA 5HI7A 2V5FA 4HXIA 1TNOA 3CVLA 1H2VC 3B7RL 3G2VA 3PEUB 3SZ7A 1TJCA 4I9EA 5D0OD 5A6CA 3CHSA 3E4BA 4I1MA 4UWHA 2ONDA 5KCMA 3TWVA 2X38A 3ZW3A 2PQRA 2DCPA 4X8QA 4A1GA 4UI9J 2PM6A 4GZ3A 5CCLA 3FTUA 1E8XA 3L17A 4KVMA 4CDNA 3ASOE 2R59A 3UT8A 4KZ0A 4EZLA 3JUIA 4I43A 3LXUX 3SGHA 3CK7A 4TXQA 3EU5A 4A63B 4DLOA 5B1AE 3RRUA 3TG4A 5ENQD 3FU0A 4BETA 4A55A 5CMYA 3QNKA 1TYQG 4FLBA 3SFXA 5KJMA 2WXJA 3D9MA 1ZU2A 2FO1E 4GYOA 2PM7A 3CSTA 4K03A 5J08A 2IFUA 2J4BA 1PY1A 1WAO1 3ABME 1KT1A 2KCLA 5LFAA 2QZAA 5CRUA 2AWIA 1YMPA 2FULA 5FT9A 3Q5MA 4N2QA 4WNFA 1WDYA 2ETBA 2MRIA 3CVNA 4EZKA 4GMRA 5CHEE 2VTBA 4OAVB 2Y69E 3MA5A 3AG4E 2LAHA 3MGBA 5AAOA 3RSEG 1HU3A 3W9GA 4F1SA 3UIOC 5FZRA 4RVBA 4DPRA 2DIWA 2GRQB 4JL0A 2WXFA 2LUHA 3PZ3A 3D9JA 4AJWA 1WG0A 2X6FA 2CHZA 4AY6A 1Z3XA 3IHYA 3L82A 1NI1A 2IEJA 4U04A 5J90A 2QYJA 3PZ1A 3U9WA 2P9LG 3FH7A 1IXVA 2P58C 4GYWA 3HDXA 4UI9C 3EIQC 4ILGA 4MLPA 3FUIA 4U96D 3C5RA 1OWOA 4JW1A 2PL2A 4AV7A 1H19A 4MRUA 2P2CP 4UQYA 3EIJA 1DC2A 2R5SA 1N4QA 1L5JA 5D66A 2V5QC 3ESLA 2IONA 4O6FA 4IRUA 1B89A 4ATZD 1HF8A 4GZDA 3OXLA 5G05J 4J8EA 1JCRA 4ILHB 1TNUA 3TL5A 3ONKA 4GA1A 2V4HC 5LCWC 2WXPA 2FO7A 2VSYA 2IU1A 1JWGA 2EIKE 2I1JA 4XI0A 4OYSA 2UWJG 3Q9UC 3ULEG 1N4PA 4L2YA 1KZOA 2WPVA 4MKTA 2Q7FA 1PAQA 3FUEA 4LUNU 5AQ7A 5AQBA 4F3VA 3Q79A 3SFYA 4U0ZA 4C0EA 4GTMA 4EHMA 2ETCA 3PRZA 5KBAA 3L08A 2HYZA 4AP2A 4GCOA 3P1UA 3FTZA 1S63A 4RLYA 3APFA 3Q73A 4NQ0A 4F1PA 1HG5A 4I9CA 3U64A 1U3DA 3MZLB 3TJPA 3DXMG 1Q2ZA 3ABLE 4V3IA 1KZPA 1N52A 3IV0A 4WNEA 2EIJE 5FJYA 4CT0A 3MEKA 3UI2A 5EX0A 3MV3B 2AXVA 1SQMA 4I1AA 4TRQA 3B13A 2QC9A 2XENA 3TG5A 4U8VD 4FLHA 3S7FA 2ZGDA 1D9SA 2LXMA 4KYOB 2XS8A 4DLQA 3MKQB 3ASNE 1OWMA 4UWGA 3RRNB 3Q47B 3NZSA 2XZDG 5T4YA 5DIZA 4Z68A 4RG9A 2KM4A 3BU8A 1HG2A 2P9IG 1PC2A 2QFCA 3FULA 1FT1A 4UWFA 3CVVA 1MX6A 2ZISA 1QZ2A 3GYZA 2F37A 2V8SE 3P2BA 4M3OA 2CG2A 5G2NA 1K8KG 5H7PA 3URZA 2FF4A 2BKGA 3FH8A 3FUKA 3APCA 1E7VA 5JHAA 5G05C 3RO3A 5A7DB 2GGFA 4G2VA 3ZRHA 5HKPA 2WM9A 3RKVA 3DSTA 4JA9A 2VGXA 4FA6A 3CVYA 2ZGGA 4YDYA 4U07A 4GMLA 4C0MA 4GTPA 3T5XA 1X5BA 4TUUA 5EILA 1H6OA 3JQ0A 3K9IA 5LP0A 3O4ZA 4FHJA 2EILE 4URKA 4Y6WA 4N2SA 1E7UA 1KPSB 3V30A 1UN9A 4HS2A 4BT8A 4KBQA 1SZAA 1AWCB 2ETAA 3FP3A 2J9QA 3LY9A 3FU5A 1IKND 4LERA 3R7QA 2EINE 4HFGA 1OT8A 1FVFA 5JHBA 2XPZA 2A5UA 3U4TA 1KT0A 4J8FA 2WXLA 1U2VG 3D9LA 2RD0A 5ENRD 3UXGA 4ME2A 3FUFA 2P9UG 2LSUA 1NFIE 1Y8MA 2R2LA 3CVUA 2RFMA 1BLXB 3SY2A 1MJ0A 4HLEA 4AY5A 2WQHA 3V2XA 5BUZA 2F8XK 4F6RD 3DXKG 3SQVA 3SI5A 3T8KA 4O1PA 1E90A 3QAQA 2XCBA 3CVXA 3E33A 4O60A 2BF0X 2L9BA 2QY7A 3PUKA 5EX3A 3PNLB 4TUMA 5EYLA 4NRHB 4ANWA 3ASFA 4MS6A 2JLBA 2WQ7A 3B7SA 4PS7A 3L22A 3ZKJA 2L0TB 3UKRG 5AENA 4LEUA 3OAWA 2L0IA 5CEDB 2P9PG 3E37A 3TWUA 3SHFA 4K0RA 3I4GA 3ZN3A 5HQ8A 2H6HA 1UN8A 3L6AA 4ABNA 4FC8A 5FQ7A 4BFRA 2KCVA 3GZSA 5ENSD 2BEDA 2B6CA 4C9BB 3NAWA 5M72A 3ZXSA 1MHQA 4E6HA 1BD8A 2CFZA 1JWFA 3V31A 3UUXA 4EQFA 3KEAA 2DBAA 1UG3A 4CYMD 3CQGB 4ACKA 3PZ4A 3FDHA 4GPKA 1INZA 1S64A 2X3MA 3SBTB 4J6IA 4JVSA 5JJ7A 2OV8A 1TN8A 4F7AA 4GCNA 3G2UA 4XZ4A 2DYSE 3PE3A 4K5AB 4PH4B 5JJTA 4ACLA 3HHMA 4N39A 2IQCA 3WG7E 1MZCA 3I4RB 4WWOA 3UT4A 1EDUA 3RO2A 3ZXPA 3D9OA 5FINA 4K5CA 4U8HA 5LCWJ 5CBNA 2XGSA 5EIBE 3ZVVA 5BPPA 3PS6A 3HRAA 1N9AA 1EYHA 3VLEA 4HB5A 2VTBB 4TXPA 1ELKA 4LG6A 4EZJA 2RG8A 3Q78A 3B7BA 2RFAA 2FEZA 3D9PA 4H7XA 4GZ5A 3HXEA 1DNPA 5BXUA 5FQ4A 2GW1A 2VGYA 3FHEA 1N95A 5D2MC 2Y4TA 4CDMA 1E8YA 1X81A 3LY8A 2LO6A 3TGOA 3FEXA 4ANXA 4DX7D 4C48B 2VJ8A 4YDOA 1QNFA 4L7TA 2XCCA 2WQ6A 2IOLA 3ONLA 4B93B 3DPYA 4KXKB 1IQUA 4CCAA 3KD7A 3JXIA 4DX2A 2J4DA 3CHOA 2KXPC 3CVWA 3UM2A 3IXEA 3VTYA 1SZ9A 1JUQA 5ANRA 3HYMB 4LNUD 3NBNB 2WXRA 1N11A 3RU0A 1V55E 4ILIA 4DI4A 2WB2A 3W9FA 3TWSA 5CECB 2UY1A 1V54E 3ZFWA 4HNAD 3SF4A 5ENPD 5JA4D 4I6EA 3CIAA 4LNGA 4DX1A 3NB2A 3PREA 3CKBA 3JQ1A 5AJLA 4RQIA 3S7BA 4QQIA 3L9TA 2WXGA 2XQ0A 4HOQA 4CZ2D 4L2LA 2H6FA 2LSVA 2OEWA 3KS2A 2I9CA 3FU6A 4KVOA 4G8LA 1ELWA 4ZFHA 4BY6A 4WWPA 3DSVA 3FUDA 3Q75A 4O1OA 1D8DA 2C0LA 1K1AA 4WUYA 3JYSA 3QDNA 4UWKA 3S2AA 4L1BA 2ZU6B 2VSXE 1HO8A 3D9KA 2Y4UA 4N3AA 1OCCE 2I6HA 3LVQE 3AU4A 5C1DA 5LOZA 4M7CA 1QBQA 3PVLA 1FT2A 3S7DA 4RSYA 4XX5A 5FZQA 3BQOA 3RJVA 3UQ3A 1LF8A 3TWRA 1W3BA 2F0YA 3MKRA 2I2OA 3HG0D 4U95D 4N3CA 2AXZA 2FI7A 4P29A 4FJZA 4APOA 5EYPF 4G26A 3I3NA 4YNDA 2C0MA 1D8EA 1OWLA 2R05A 3CEQA 1SW6A 4Q69A 4JZYA 3G2TA 3EHNA 3JCKC 1BI8B 2XPYA 3NOCD 2XPIA 3TAXA 5FWQA 3E34A 1HX8A 3C3OA 3ISMC 2XEEA 3SBSA 1H0AA 2WXMA 5E76A 2Y3AA 2NYJA 3UMVA 4XKCA 4APFA 3DPDA 5BXOA 5ENNA 2IO3C 4TV3A 3EHQA 2NSZA 3O48A 5B3SE 1K3ZD 3D9HA 5CBOA 3LY7A 2VQ2A 4N5CA 3ML8A 2RKKA 3TXMA 3FTWA 4DX5D 2GRPB 1TNYA 5LX8A 4G25A 3ASGA 4GA0A 4PS3A 5FZSA 3NOGD 4GZ6A 2VGXB 3TWWA 1FPPA 2R17C 1SA4A 4LNBA 2DWZA 3MYVA 4I6GA 1LD8A 4JEHA 1YCSB 4RG6A 3ESKA 2I1KA 2DZNA 3C3QA 3NQPA 3DSXA 4J8SA 3HXCA 4PDXA 1OUVA 1BPOA 2CFUA 4FJYA 5BT1A 1IHBA 1MX2A 2KATA 4LRZA 3DSSA 4CGWA 1LD7A 4I2ZA 3EU9A 4NACA 4E85A 4UWLA 1O5MA 1ELRA 2F8YA 2OVBA 2EIME 2E2EA 3RRMB 3CVQA 4G11A 3DSUA 3RAUA 2M63A 4UUCA 2DYRE 4D10C 2WMOA 3APDA 4FU3A 2GRRB 4Y6CA 3N71A 3ZNGA 4WNDA 4AM9A 3BG0B 3UIPC 2XEVA 3PZDA 4KMOA 4HORA 4GTSA 4CGVA 4U7EB 4LCTA 4JXTA 1HS6A 1E8WA 4AXHA 1E8ZA 4GU5A 4K5BA 3L16A 2P9NG 1NL4A 2KC7A 3B95A 3UX4A 4JB8P 3F6QA 3ASHA 2XZTG 5AARA 4N3BA 3QWWA 3KSQA 3T8MA 2Y0BG 3L13A 3T9KA 1UJKA 1HFAA 4YVQC 3AJIA 2IO2C 3PUJA 4U63A 5BNWA 4L23A 3AG2E 3QJZA 3FTXA 2J08A 2OCCE 4JA7A 4BWRA 1UW4B 4HRMB 4U0SA 4A1SA 1N0QA 5ARGA 5CEAA 3TWXA 2IF4A 3ASDA 3VLDA 5ENTD 3MCXA 3Q49B 2WXNA 2LNIA 3MX3A 1S70B 2E0IA 3AS8A 1TJFA 3CV0A 3UINC 3B7TA 1EPUA 3J5QB 3LYAA 2X6KA 5EKQD 5BW8C 3KEZA 1NA3A 2VYIA 4MBGA 1K1BA 3FTYA 1MQSA 4BX9A 2B0OE 3FWVA 1S0PA 2DVWA 4XEIG 1LTXA 3EUVA 5KJNA 4UQZA 3DRAA 3RIBA 2VSNA 3AG1E 1YA0A 4BSZB 3UPVA 2J07A 5DBKA 1U3CA 4HBDA 5FQ8A 4HI9A 4A3VA 3G2WA 2MYOA 5JJ6A 4BTBA 4HOTA 1MYOA 4HOSA 1N54A 2JEKA 3QARA 5G04J 1QYMA 2XHEA 1SVXA 2XEHA 2P9KG 2KZTA 4I2WA 5B1BE 3OXGA 2XS1A 3Q7AA 4GB9A 4U0UA 4A3TA 4J7WA 2H6IA 2OVFA 4AVXA 2P9SG 5BV0A 2WXIA 3X2QE 4JC8A 3ENEA 3HXDA 3BG1B 3D9NA 3C3RA 3MV2B 3L54A 1H6KA 4YDEA 4GMJA 2V0PA 4B8AA 3OTNA 2BKKB 1MX4A 4XE0A 4JPSA 5ARFA 3LJ3A 4FHKA 2HM8A 1WY6A 3EHMA 1UOHA 3FH5A 2IJGX 3OXFA 4HLLA 3AG3E 4UI9K 4TXRA 1E96B 1Y6IA 3ZUVB 4QFVA 3PZ2A 4DI3A 5KWDA 5C2YA 4JD2G 4FP7A 1HXIA 1A17A 1WM5A 2NXPA 4YVOA 1IHGA 1QQEA 4CDRA 1UJJA 3FTSA 3AS4A 1HH8A 3RK6A 1TN7A 2VGEA 3CVPA 3CHRA 4PS8A 4DJAA 4GZCA 5G55A 4DUIA 4XKBA 1NP7A 4ANVA 2A5EA 5T3RA 4EECA 4WAFA 3CLJA 3SNXA 3PH0C 3U3WA 4BEPA 3UKUG 2UY1B 1JCSA 1N0RA 2GRLA
chains in the Genus database with same CATH topology
1TJCA 4I9EA 5A6CA 3U66A 3D3MA 3CHSA 2L6JA 3E4BA 2XPYA 1UN9A 2IOSA 4HS2A 4I1MA 2XPIA 4UWHA 3TAXA 2ONDA 5FWQA 5G04C 4BT8A 3SD5A 4KBQA 5KCMA 3R9AB 1HX8A 2J09A 1SZAA 2X38A 3ZW3A 3B7UX 2PQRA 3KAEA 2DCPA 3FP3A 2J9QA 3LY9A 4B0ZA 3GW4A 3ZYKA 4A1GA 4UI9J 3SBSA 3FU5A 4IULA 4LERA 3R7QA 4B89A 1H0AA 2WXMA 2PM6A 4GZ3A 4HFGA 5CCLA 1FVFA 3ZEFA 3FTUA 5JHBA 1E8XA 3L17A 4KVMA 2XPZA 4CDNA 3CR3A 2R59A 5E76A 4FULA 2KCKA 2A5UA 4OVVA 3U4TA 4KZ0A 3UT8A 3ULQA 1KT0A 2Y3AA 4H7YA 2WXLA 4J8FA 3UMVA 2YINA 4EZLA 4XKCA 3JUIA 3DPDA 4I43A 4APFA 3LXUX 5ENNA 3AS5A 3SGHA 4TV3A 3D9LA 3CK7A 2RD0A 3CK8A 4ME2A 2V4LA 2NSZA 3FUFA 3LKUA 3O48A 4DLOA 2LSUA 1Y8MA 2PZIA 3RRUA 3TG4A 3CVUA 3FU0A 3LY7A 2VQ2A 4N5CA 3ML8A 3WXXA 4A55A 3CHMA 1OWPA 5CMYA 1H2UA 3QNKA 4CRWA 4AY5A 3TXMA 4HLEA 4JHKA 3FTWA 2LAIA 2WQHA 5BUZA 4FLBA 3R7RA 5KJMA 2WXJA 3D9MA 1ZU2A 4OVUA 3SI5A 5LX8A 1IYGA 1E90A 4G25A 3ASGA 3PEVB 3MJWA 3QAQA 4JHJA 2XCBA 3CVXA 1TEZA 4GA0A 4PS3A 4GYOA 5FZSA 2PM7A 3SZ7A 5CMWA 4GZ6A 2VGXB 3CSTA 2R17C 2BF0X 3ML9A 4AIFA 3FFLA 5FQ6A 2L9BA 2QY7A 4K03A 4BTAA 3PUKA 3MYVA 3PNLB 5EX3A 2IFUA 2J4BA 4I6GA 3D9IA 1ZBPA 1PY1A 4NRHB 5J08A 1VDYA 4ANWA 4JEHA 4N2SA 3ASFA 4R7LA 1WAO1 4RG6A 3ZPJA 5T8IA 1KT1A 2KCLA 3NF1A 3ESKA 4WWNA 3GZ2A 3LVRE 3G2SA 5LFAA 4MS6A 2I1KA 2JLBA 4G23A 4EBAA 3B7SA 2WQ7A 3NQPA 4PS7A 3L22A 2VSOE 4BX8A 3FEYA 5BV1A 4J8SA 2L0TB 2XGMA 4AEZC 2AWIA 5AENA 2FULA 4LEUA 1OUVA 3OAWA 1BPOA 3Q5MA 2CFUA 2L0IA 4FJYA 4PDXA 4B8CB 4WNFA 5BT1A 4N2QA 3SHFA 4K0RA 3TXNA 3I4GA 3ZN3A 2KATA 3SFZA 5HQ8A 4LRZA 1UN8A 2YQ8A 1NZNA 3L6AA 2MRIA 3CVNA 4CGWA 4I2ZA 4ABNA 4EZKA 2WVIA 3T5VA 4NACA 4FC8A 5CHEE 5FQ7A 4BFRA 2VTBA 2KCVA 3LCAA 3MA5A 3GZSA 4E85A 4UWLA 1ELRA 2LAHA 3MGBA 2OVBA 2E2EA 4C9BB 2XRZA 3RRMB 2XRYA 3CVQA 4G11A 4J0UA 3VLFA 3ZXSA 5M72A 1MHQA 1XGWA 1HU3A 2M63A 2PQNA 1KLXA 4E6HA 2CFZA 1JWFA 3UUXA 4F1SA 2X6HA 4D10C 4EQFA 1Z3YA 3CK9A 2WMOA 5FZRA 4RVBA 2DBAA 3APDA 4FU3A 3FTVA 4Y6CA 4DPRA 3N71A 1UG3A 4WNDA 4AM9A 3BG0B 2XEVA 3CQGB 2ILRA 4ACKA 5AIJA 2DIWA 3PZDA 2WXFA 4JL0A 4KMOA 4HORA 4J8DA 3FDHA 4GPKA 4CT4A 2CHWA 1INZA 3D9JA 4AJWA 3QC1A 4CGVA 2X3MA 3SBTB 4LCTA 4HVBA 2X6FA 2CHZA 4AY6A 4JXTA 1HS6A 4J6IA 1Z3XA 1E8WA 3IHYA 1XNFA 4AXHA 4JVSA 2OOEA 4B94A 2OV8A 1E8ZA 4IYPA 4G24A 4GU5A 4U04A 2MHKA 3L16A 5J90A 4F7AA 4GCNA 3G2UA 4XZ4A 2KC7A 3PE3A 3QKYA 3UX4A 3AU5A 4PH4B 3QB2A 5JJTA 3ASHA 3U9WA 4F53A 4N3BA 3QWWA 4ACLA 3FH7A 4G1TA 3HHMA 4N39A 5ANLA 5FT9A 2P58C 2IQCA 4GYWA 3T8MA 1HZ4A 3HDXA 4UI9C 3L13A 1FCHA 3EIQC 1UJKA 3CHQA 4ILGA 4MLPA 3FUIA 1HFAA 4YVQC 3PUJA 4I17A 4U63A 4W9RA 4L23A 3I4RB 5BNWA 2X6JA 1OWOA 4EPZA 2FBNA 3QJZA 4JW1A 4WWOA 3UT4A 3FTXA 2J08A 1EDUA 3PNTB 3RO2A 2PL2A 4AV7A 4JA7A 1H19A 4MRUA 4BWRA 1GW6A 4UQYA 3EIJA 1UW4B 4IN3B 4U0SA 2R5SA 5ARGA 4A1SA 2IF4A 3ASDA 1L5JA 3VLDA 3MCXA 3Q49B 3QK0A 2WXNA 3D9OA 5D0QD 1FVHA 2LNIA 3MX3A 2E0IA 3AS8A 2AVPA 1TJFA 3CV0A 3ESLA 4U8HA 3B7TA 5LCWJ 1EPUA 2IONA 3LYAA 4O6FA 4IRUA 3ZYMA 2XGSA 1B89A 2X6KA 2EQXA 1HF8A 3ZVVA 5BPPA 3PS6A 2WXKA 5EKQD 4GZDA 2A4ZA 1EYHA 3VLEA 2GRMA 3OXLA 5G05J 5BW8C 2VTBB 4J8EA 3KEZA 1NA3A 2VYIA 4ILHB 4KT6B 3ZYLA 3TL5A 3FUJA 3ONKA 2BTDA 1ELKA 3LEWA 1H2TC 1NA0A 2WMNA 3FTYA 4GA1A 4EZJA 2RG8A 1MQSA 3PDNA 4BX9A 5LCWC 2WXPA 3MKQA 3FWVA 2FEZA 4XIFA 3D9PA 5JJ7A 4H7XA 4GZ5A 2FO7A 2VSYA 1JWGA 2IU1A 1S0PA 5AYWD 3HVEB 2I1JA 4XI0A 1DNPA 4OYSA 2UWJG 1OWNA 5FQ4A 2GW1A 5KJNA 2VGYA 4UQZA 3FHEA 4L2YA 3LDZA 2Y4TA 3RIBA 2WPVA 4MKTA 1E8YA 1PAQA 2Q7FA 2VSNA 2BUGA 3LY8A 5FTPA 4CDMA 5EDSA 1YA0A 2LO6A 5E75A 3UPVA 3FUEA 3FEXA 3TGOA 5CCMA 2J07A 5DBKA 1U3CA 4LUNU 5FQ8A 3IEGA 4ANXA 5AJDA 2VJ8A 1QNFA 4L7TA 4F3VA 4A3VA 3HVEA 4GAAA 4U0ZA 2J49A 3G2WA 3FUHA 4C0EA 2XCCA 3Q15A 2WQ6A 4JEUA 5KJLA 2IOLA 3ONLA 3PRZA 3L08A 5JJ6A 4BTBA 2HYZA 4KXKB 1Z6TA 1IQUA 1HE8A 4GCOA 3KD7A 4AP2A 4CCAA 4HOTA 3UT7A 4HOSA 1N54A 2J4DA 2JEKA 3QARA 3CKCA 3P1UA 3FTZA 5G04J 3FUMA 5D0OD 3APFA 1P5QA 3CHOA 2XHEA 3CVWA 4NQ0A 3CGHA 1HG5A 2KZTA 4I2WA 4I9CA 2AW6A 3U64A 3OXGA 3VTYA 1SZ9A 1U3DA 3MZLB 3TJPA 1JUQA 3BEEA 4GB9A 4Q94A 3LS8A 5ANRA 3HYMB 1E7UA 4U0UA 4V3IA 4A3TA 2WXRA 1N52A 3IV0A 3ZHEB 3RU0A 2OVFA 3IBEA 4AVXA 2XGOA 4ANUA 4WNEA 1EF1C 5BV0A 2WXIA 4EBAG 4I6JA 4JC8A 3ENEA 4ILIA 4DI4A 2WB2A 5FJYA 3BG1B 4CT0A 3MEKA 3D9NA 1DVPA 5EX0A 3MV3B 2AXVA 3MV2B 4WNGA 3L54A 1SQMA 1H6KA 4I1AA 2UY1A 3I5PA 4NURA 3ZFWA 3FU3A 4GMJA 2V0PA 4TRQA 3SF4A 4B8AA 3B13A 4DK5A 3OTNA 4I6EA 3ZHEA 3GZ1A 2YHCA 3TG5A 3CIAA 4KZCA 4FLHA 4XE0A 4FADA 4JPSA 3PREA 5ARFA 3CKBA 4GA2A 3JQ1A 4UQXA 3S7FA 3LJ3A 2C2LA 5KJKA 5AJLA 3S7BA 3CSFA 4XI9A 4KYOB 2CG3A 3S7JA 2WXGA 2XQ0A 4HOQA 3VTXA 4L2LA 2LSVA 4DLQA 3KS2A 2AXUA 2I9CA 3MKQB 3FU6A 3EJNA 4FHKA 2HM8A 4KVOA 1OWMA 2HO1A 4UWGA 3RRNB 3Q47B 1WY6A 1ELWA 3EHMA 3FH5A 4BY6A 2IJGX 3NZSA 3OXFA 1JPLA 5T4YA 3ZIMA 4UI9K 4BSXA 4WWPA 3CQCB 5DIZA 3FUDA 4RG9A 2WXHA 3FY4A 1E96B 3HIZA 4GYYA 2KM4A 3CHPA 1HG2A 2C0LA 1PC2A 1Y6IA 4WUYA 3JYSA 3QDNA 2QFCA 3FULA 3QOUA 4UWKA 5A23A 4UWFA 4QFVA 3S2AA 3CVVA 4Q96A 4L1BA 2ZU6B 2WXOA 2VSXE 4DI3A 1HO8A 3QWVA 2CHXA 5C2YA 1QZ2A 3D9KA 3GYZA 1IQRA 2Y4UA 2V8SE 2HR2A 3FUNA 3P2BA 4FP7A 4N3AA 4M3OA 1HXIA 2CG2A 2I6HA 5G2NA 3LVQE 1A17A 3AU4A 3Q4AB 3URZA 1WM5A 2FF4A 2NXPA 5C1DA 3FH8A 5LOZA 3LPZA 4CEMA 3EDTB 3APCA 1E7VA 3FUKA 3PVLA 3S7DA 5JHAA 2MOWA 3DBSA 4RSYA 5G05C 5A7DB 3RO3A 2GGFA 4ATGA 4YVOA 1IHGA 4XX5A 1QQEA 2YNQA 4G2VA 5FZQA 3ZRHA 3RJVA 3UQ3A 3ZYQA 2WM9A 3RKVA 4CDRA 1UJJA 4HOUA 2VGXA 4JA9A 4FA6A 3CVYA 3NZUA 1LF8A 3FTSA 4BT9A 3AS4A 3IKOB 4U07A 1HH8A 3RK6A 1W3BA 2KZTB 4AOFA 3CVPA 2NC9A 3MKRA 3CHRA 2I2OA 4N3CA 2AXZA 2FI7A 4P29A 3IHVA 4PUCA 4FJZA 4APOA 4PS8A 4GMLA 2YHEA 4C0MA 3PE4A 3T5XA 4DJAA 4G26A 4GZCA 5G55A 1X5BA 2X6IA 3C98A 4TUUA 4XKBA 1NP7A 4ANVA 4EECA 3I3NA 4I1OB 5T3RA 2WXQA 4WAFA 3CLJA 3JQ0A 4YNDA 3K9IA 3QWPA 2C0MA 3ZGQA 4JHRA 1OWLA 3PH0C 3SNXA 3U3WA 5HI7A 2V5FA 5LP0A 4HXIA 3CEQA 3CVLA 3O4ZA 4FHJA 1H2VC 3B7RL 4Q69A 4JZYA 3G2TA 4URKA 2UY1B 3G2VA 3EHNA 3PEUB 3JCKC 4Y6WA 2GRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LOZ A;  3G2U A;  4FU3 A;  3ONL A;  1JPL A;  1HF8 A;  1EDU A;  4AVX A;  4NAC A;  2MOW A;  4GZD A;  3LDZ A;  1EYH A;  3G2S A;  4FLB A;  3D9M A;  2DIW A;  4GZC A;  3ZYL A;  1X5B A;  3ZYQ A;  2LO6 A;  2KM4 A;  1HX8 A;  3ONK A;  1HG2 A;  2L0T B;  1UJJ A;  1SZA A;  1ELK A;  5CMW A;  3CLJ A;  1INZ A;  3D9L A;  3D9J A;  1LF8 A;  3D9N A;  3RRU A;  1DVP A;  2BF0 X;  3D9O A;  2DCP A;  4Q96 A;  1MHQ A;  2L0I A;  1XGW A;  5LP0 A;  1HG5 A;  2QY7 A;  3ZYK A;  1UJK A;  3D9K A;  3D9P A;  5J08 A;  2V8S E;  1JWG A;  1H0A A;  1HFA A;  1PY1 A;  1JWF A;  1SZ9 A;  3D9I A;  1JUQ A;  3G2T A;  1VDY A;  4JXT A;  3G2V A;  4HFG A;  4Q94 A;  3G2W A;  5CMY A;  3ZYM A; 
#chains in the Genus database with same CATH topology
 3U66 A;  3D3M A;  2L6J A;  2IOS A;  1TNB A;  1RW2 A;  5G04 C;  3SD5 A;  3R9A B;  2J09 A;  2AJA A;  3B7U X;  3EHR A;  3KAE A;  3UTM A;  4B0Z A;  3GW4 A;  3ZYK A;  4G8K A;  4IUL A;  4B89 A;  2H6G A;  5HS0 A;  1OXJ A;  3ZEF A;  3KSL A;  3C72 A;  3CR3 A;  4FUL A;  2KCK A;  4OVV A;  3ULQ A;  4H7Y A;  2YIN A;  2PNN A;  3Q9N C;  3AS5 A;  3CK8 A;  2V4L A;  3LKU A;  2Y1L E;  1N4S A;  2PZI A;  3WXX A;  3CHM A;  1OWP A;  2R03 A;  1H2U A;  1DCQ A;  4CRW A;  4JHK A;  2LAI A;  4GPM A;  3R7R A;  4OVU A;  4HRL A;  1IYG A;  4HRN A;  1G3N B;  3PEV B;  3MJW A;  4JHJ A;  3DSW A;  1TEZ A;  4GTO A;  5CMW A;  3TWQ A;  4AIF A;  3ML9 A;  3FFL A;  5FQ6 A;  2HE0 A;  4BTA A;  1OCR E;  3D9I A;  1ZBP A;  1VDY A;  1BU9 A;  4R7L A;  3ZPJ A;  3R9M A;  5T8I A;  1A5E A;  3NF1 A;  4WWN A;  3GZ2 A;  3LVR E;  3G2S A;  2QYU A;  4G23 A;  4EBA A;  2VSO E;  4BX8 A;  3FEY A;  5BV1 A;  2XGM A;  2GRO B;  4AEZ C;  4CEM A;  4LSZ E;  4B8C B;  3TXN A;  3SFZ A;  1AP7 A;  2YQ8 A;  1NZN A;  1OY3 D;  2WVI A;  3T5V A;  3LCA A;  2XRZ A;  2J8S D;  2XRY A;  4J0U A;  3VLF A;  5CER B;  4N5Q A;  1XGW A;  4U8Y D;  2PQN A;  1KLX A;  1N4R A;  2X6H A;  1Z3Y A;  3CK9 A;  1TN6 A;  3FTV A;  5EN5 D;  2ILR A;  5AIJ A;  2R02 A;  4J8D A;  3TWT A;  4CT4 A;  2CHW A;  3HXF A;  1O1R A;  2ZIR A;  5AQA A;  3QC1 A;  1Z5S C;  1TNZ A;  5ITZ F;  4HVB A;  4B94 A;  2IY0 C;  1XNF A;  2OOE A;  4IYP A;  4G24 A;  3UM0 A;  2MHK A;  4ZHB A;  4GTQ A;  3DEO A;  3QKY A;  3AU5 A;  3QB2 A;  4F53 A;  4G1T A;  4GTV A;  5ANL A;  5CRV A;  1HZ4 A;  1FCH A;  3CHQ A;  1JCQ A;  4DX6 D;  4I17 A;  4W9R A;  2X6J A;  1O1T A;  4EPZ A;  2FBN A;  3JUE A;  3PNT B;  5FIO A;  1GW6 A;  4IN3 B;  3ZU7 B;  4HI8 A;  3QK0 A;  5D0Q D;  1FVH A;  2GRN B;  2OEV A;  1N94 A;  2AVP A;  3DEP A;  2L6B A;  3ZYM A;  5KNG A;  2EQX A;  2WXK A;  2A4Z A;  2GRM A;  3ZYL A;  4KT6 B;  3FUJ A;  1TR4 A;  3UM1 A;  2BTD A;  3LEW A;  1H2T C;  1NA0 A;  2WMN A;  5ENO D;  3PDN A;  4NIK A;  3MKQ A;  4XIF A;  4YDW A;  5AYW D;  3HVE B;  4J8Y A;  4BER A;  1OWN A;  2JAB A;  3BUA A;  3LDZ A;  5FTP A;  2BUG A;  5EDS A;  5E75 A;  5JMN D;  4GTR A;  3E30 A;  5CCM A;  5IY5 E;  5AN8 A;  3IEG A;  5AJD A;  3HXB A;  3V2O A;  3HVE A;  4GAA A;  2J49 A;  3FUH A;  1RZ4 A;  3Q15 A;  4JEU A;  5KJL A;  1Z6T A;  1HE8 A;  3UT7 A;  4HQD A;  3CKC A;  3FUM A;  1SA5 A;  1P5Q A;  2DZO A;  3LJN A;  1ZB1 A;  3CGH A;  2AW6 A;  3BEE A;  4Q94 A;  3LS8 A;  3ZHE B;  3IBE A;  2XGO A;  3UM3 A;  3J5P A;  4ANU A;  3Q7F A;  1EF1 C;  4EBA G;  1OCZ E;  4I6J A;  4GTT A;  3SO8 A;  1DVP A;  4OAU C;  3E32 A;  4WNG A;  3I5P A;  4NUR A;  3FU3 A;  4DK5 A;  2LXL A;  1BI7 B;  3ZHE A;  3GZ1 A;  2YHC A;  4KZC A;  4FAD A;  1DCE A;  4GA2 A;  4UQX A;  2C2L A;  5KJK A;  3CSF A;  4XI9 A;  3ULY A;  2CG3 A;  3S7J A;  3VTX A;  3DWL G;  2AXU A;  3EJN A;  4DRX E;  2HO1 A;  1JPL A;  5HRY A;  3ZIM A;  4BSX A;  3CQC B;  4L9P A;  2WXH A;  3FY4 A;  4BES A;  3HIZ A;  4GYY A;  3CHP A;  3QOU A;  5A23 A;  3V79 K;  4Q96 A;  2WXO A;  3QWV A;  2CHX A;  1IQR A;  2HR2 A;  3FUN A;  5KNH D;  3Q4A B;  1O1S A;  3LPZ A;  3EDT B;  5AQ9 A;  2MOW A;  3DBS A;  4ATG A;  1OCO E;  1YYH A;  2YNQ A;  3ZYQ A;  4HOU A;  3JXJ A;  3NZU A;  4BT9 A;  5EID A;  1H6P A;  3IKO B;  2ZXW E;  3AAA C;  2KZT B;  4AOF A;  2NC9 A;  2KBX A;  4PUC A;  3IHV A;  2YHE A;  3PE4 A;  2X6I A;  3C98 A;  4I1O B;  3ABK E;  2WXQ A;  3QWP A;  3ZGQ A;  4JHR A;  5HI7 A;  2V5F A;  4HXI A;  1TNO A;  3CVL A;  1H2V C;  3B7R L;  3G2V A;  3PEU B;  3SZ7 A;  1TJC A;  4I9E A;  5D0O D;  5A6C A;  3CHS A;  3E4B A;  4I1M A;  4UWH A;  2OND A;  5KCM A;  3TWV A;  2X38 A;  3ZW3 A;  2PQR A;  2DCP A;  4X8Q A;  4A1G A;  4UI9 J;  2PM6 A;  4GZ3 A;  5CCL A;  3FTU A;  1E8X A;  3L17 A;  4KVM A;  4CDN A;  3ASO E;  2R59 A;  3UT8 A;  4KZ0 A;  4EZL A;  3JUI A;  4I43 A;  3LXU X;  3SGH A;  3CK7 A;  4TXQ A;  3EU5 A;  4A63 B;  4DLO A;  5B1A E;  3RRU A;  3TG4 A;  5ENQ D;  3FU0 A;  4BET A;  4A55 A;  5CMY A;  3QNK A;  1TYQ G;  4FLB A;  3SFX A;  5KJM A;  2WXJ A;  3D9M A;  1ZU2 A;  2FO1 E;  4GYO A;  2PM7 A;  3CST A;  4K03 A;  5J08 A;  2IFU A;  2J4B A;  1PY1 A;  1WAO 1;  3ABM E;  1KT1 A;  2KCL A;  5LFA A;  2QZA A;  5CRU A;  2AWI A;  1YMP A;  2FUL A;  5FT9 A;  3Q5M A;  4N2Q A;  4WNF A;  1WDY A;  2ETB A;  2MRI A;  3CVN A;  4EZK A;  4GMR A;  5CHE E;  2VTB A;  4OAV B;  2Y69 E;  3MA5 A;  3AG4 E;  2LAH A;  3MGB A;  5AAO A;  3RSE G;  1HU3 A;  3W9G A;  4F1S A;  3UIO C;  5FZR A;  4RVB A;  4DPR A;  2DIW A;  2GRQ B;  4JL0 A;  2WXF A;  2LUH A;  3PZ3 A;  3D9J A;  4AJW A;  1WG0 A;  2X6F A;  2CHZ A;  4AY6 A;  1Z3X A;  3IHY A;  3L82 A;  1NI1 A;  2IEJ A;  4U04 A;  5J90 A;  2QYJ A;  3PZ1 A;  3U9W A;  2P9L G;  3FH7 A;  1IXV A;  2P58 C;  4GYW A;  3HDX A;  4UI9 C;  3EIQ C;  4ILG A;  4MLP A;  3FUI A;  4U96 D;  3C5R A;  1OWO A;  4JW1 A;  2PL2 A;  4AV7 A;  1H19 A;  4MRU A;  2P2C P;  4UQY A;  3EIJ A;  1DC2 A;  2R5S A;  1N4Q A;  1L5J A;  5D66 A;  2V5Q C;  3ESL A;  2ION A;  4O6F A;  4IRU A;  1B89 A;  4ATZ D;  1HF8 A;  4GZD A;  3OXL A;  5G05 J;  4J8E A;  1JCR A;  4ILH B;  1TNU A;  3TL5 A;  3ONK A;  4GA1 A;  2V4H C;  5LCW C;  2WXP A;  2FO7 A;  2VSY A;  2IU1 A;  1JWG A;  2EIK E;  2I1J A;  4XI0 A;  4OYS A;  2UWJ G;  3Q9U C;  3ULE G;  1N4P A;  4L2Y A;  1KZO A;  2WPV A;  4MKT A;  2Q7F A;  1PAQ A;  3FUE A;  4LUN U;  5AQ7 A;  5AQB A;  4F3V A;  3Q79 A;  3SFY A;  4U0Z A;  4C0E A;  4GTM A;  4EHM A;  2ETC A;  3PRZ A;  5KBA A;  3L08 A;  2HYZ A;  4AP2 A;  4GCO A;  3P1U A;  3FTZ A;  1S63 A;  4RLY A;  3APF A;  3Q73 A;  4NQ0 A;  4F1P A;  1HG5 A;  4I9C A;  3U64 A;  1U3D A;  3MZL B;  3TJP A;  3DXM G;  1Q2Z A;  3ABL E;  4V3I A;  1KZP A;  1N52 A;  3IV0 A;  4WNE A;  2EIJ E;  5FJY A;  4CT0 A;  3MEK A;  3UI2 A;  5EX0 A;  3MV3 B;  2AXV A;  1SQM A;  4I1A A;  4TRQ A;  3B13 A;  2QC9 A;  2XEN A;  3TG5 A;  4U8V D;  4FLH A;  3S7F A;  2ZGD A;  1D9S A;  2LXM A;  4KYO B;  2XS8 A;  4DLQ A;  3MKQ B;  3ASN E;  1OWM A;  4UWG A;  3RRN B;  3Q47 B;  3NZS A;  2XZD G;  5T4Y A;  5DIZ A;  4Z68 A;  4RG9 A;  2KM4 A;  3BU8 A;  1HG2 A;  2P9I G;  1PC2 A;  2QFC A;  3FUL A;  1FT1 A;  4UWF A;  3CVV A;  1MX6 A;  2ZIS A;  1QZ2 A;  3GYZ A;  2F37 A;  2V8S E;  3P2B A;  4M3O A;  2CG2 A;  5G2N A;  1K8K G;  5H7P A;  3URZ A;  2FF4 A;  2BKG A;  3FH8 A;  3FUK A;  3APC A;  1E7V A;  5JHA A;  5G05 C;  3RO3 A;  5A7D B;  2GGF A;  4G2V A;  3ZRH A;  5HKP A;  2WM9 A;  3RKV A;  3DST A;  4JA9 A;  2VGX A;  4FA6 A;  3CVY A;  2ZGG A;  4YDY A;  4U07 A;  4GML A;  4C0M A;  4GTP A;  3T5X A;  1X5B A;  4TUU A;  5EIL A;  1H6O A;  3JQ0 A;  3K9I A;  5LP0 A;  3O4Z A;  4FHJ A;  2EIL E;  4URK A;  4Y6W A;  4N2S A;  1E7U A;  1KPS B;  3V30 A;  1UN9 A;  4HS2 A;  4BT8 A;  4KBQ A;  1SZA A;  1AWC B;  2ETA A;  3FP3 A;  2J9Q A;  3LY9 A;  3FU5 A;  1IKN D;  4LER A;  3R7Q A;  2EIN E;  4HFG A;  1OT8 A;  1FVF A;  5JHB A;  2XPZ A;  2A5U A;  3U4T A;  1KT0 A;  4J8F A;  2WXL A;  1U2V G;  3D9L A;  2RD0 A;  5ENR D;  3UXG A;  4ME2 A;  3FUF A;  2P9U G;  2LSU A;  1NFI E;  1Y8M A;  2R2L A;  3CVU A;  2RFM A;  1BLX B;  3SY2 A;  1MJ0 A;  4HLE A;  4AY5 A;  2WQH A;  3V2X A;  5BUZ A;  2F8X K;  4F6R D;  3DXK G;  3SQV A;  3SI5 A;  3T8K A;  4O1P A;  1E90 A;  3QAQ A;  2XCB A;  3CVX A;  3E33 A;  4O60 A;  2BF0 X;  2L9B A;  2QY7 A;  3PUK A;  5EX3 A;  3PNL B;  4TUM A;  5EYL A;  4NRH B;  4ANW A;  3ASF A;  4MS6 A;  2JLB A;  2WQ7 A;  3B7S A;  4PS7 A;  3L22 A;  3ZKJ A;  2L0T B;  3UKR G;  5AEN A;  4LEU A;  3OAW A;  2L0I A;  5CED B;  2P9P G;  3E37 A;  3TWU A;  3SHF A;  4K0R A;  3I4G A;  3ZN3 A;  5HQ8 A;  2H6H A;  1UN8 A;  3L6A A;  4ABN A;  4FC8 A;  5FQ7 A;  4BFR A;  2KCV A;  3GZS A;  5ENS D;  2BED A;  2B6C A;  4C9B B;  3NAW A;  5M72 A;  3ZXS A;  1MHQ A;  4E6H A;  1BD8 A;  2CFZ A;  1JWF A;  3V31 A;  3UUX A;  4EQF A;  3KEA A;  2DBA A;  1UG3 A;  4CYM D;  3CQG B;  4ACK A;  3PZ4 A;  3FDH A;  4GPK A;  1INZ A;  1S64 A;  2X3M A;  3SBT B;  4J6I A;  4JVS A;  5JJ7 A;  2OV8 A;  1TN8 A;  4F7A A;  4GCN A;  3G2U A;  4XZ4 A;  2DYS E;  3PE3 A;  4K5A B;  4PH4 B;  5JJT A;  4ACL A;  3HHM A;  4N39 A;  2IQC A;  3WG7 E;  1MZC A;  3I4R B;  4WWO A;  3UT4 A;  1EDU A;  3RO2 A;  3ZXP A;  3D9O A;  5FIN A;  4K5C A;  4U8H A;  5LCW J;  5CBN A;  2XGS A;  5EIB E;  3ZVV A;  5BPP A;  3PS6 A;  3HRA A;  1N9A A;  1EYH A;  3VLE A;  4HB5 A;  2VTB B;  4TXP A;  1ELK A;  4LG6 A;  4EZJ A;  2RG8 A;  3Q78 A;  3B7B A;  2RFA A;  2FEZ A;  3D9P A;  4H7X A;  4GZ5 A;  3HXE A;  1DNP A;  5BXU A;  5FQ4 A;  2GW1 A;  2VGY A;  3FHE A;  1N95 A;  5D2M C;  2Y4T A;  4CDM A;  1E8Y A;  1X81 A;  3LY8 A;  2LO6 A;  3TGO A;  3FEX A;  4ANX A;  4DX7 D;  4C48 B;  2VJ8 A;  4YDO A;  1QNF A;  4L7T A;  2XCC A;  2WQ6 A;  2IOL A;  3ONL A;  4B93 B;  3DPY A;  4KXK B;  1IQU A;  4CCA A;  3KD7 A;  3JXI A;  4DX2 A;  2J4D A;  3CHO A;  2KXP C;  3CVW A;  3UM2 A;  3IXE A;  3VTY A;  1SZ9 A;  1JUQ A;  5ANR A;  3HYM B;  4LNU D;  3NBN B;  2WXR A;  1N11 A;  3RU0 A;  1V55 E;  4ILI A;  4DI4 A;  2WB2 A;  3W9F A;  3TWS A;  5CEC B;  2UY1 A;  1V54 E;  3ZFW A;  4HNA D;  3SF4 A;  5ENP D;  5JA4 D;  4I6E A;  3CIA A;  4LNG A;  4DX1 A;  3NB2 A;  3PRE A;  3CKB A;  3JQ1 A;  5AJL A;  4RQI A;  3S7B A;  4QQI A;  3L9T A;  2WXG A;  2XQ0 A;  4HOQ A;  4CZ2 D;  4L2L A;  2H6F A;  2LSV A;  2OEW A;  3KS2 A;  2I9C A;  3FU6 A;  4KVO A;  4G8L A;  1ELW A;  4ZFH A;  4BY6 A;  4WWP A;  3DSV A;  3FUD A;  3Q75 A;  4O1O A;  1D8D A;  2C0L A;  1K1A A;  4WUY A;  3JYS A;  3QDN A;  4UWK A;  3S2A A;  4L1B A;  2ZU6 B;  2VSX E;  1HO8 A;  3D9K A;  2Y4U A;  4N3A A;  1OCC E;  2I6H A;  3LVQ E;  3AU4 A;  5C1D A;  5LOZ A;  4M7C A;  1QBQ A;  3PVL A;  1FT2 A;  3S7D A;  4RSY A;  4XX5 A;  5FZQ A;  3BQO A;  3RJV A;  3UQ3 A;  1LF8 A;  3TWR A;  1W3B A;  2F0Y A;  3MKR A;  2I2O A;  3HG0 D;  4U95 D;  4N3C A;  2AXZ A;  2FI7 A;  4P29 A;  4FJZ A;  4APO A;  5EYP F;  4G26 A;  3I3N A;  4YND A;  2C0M A;  1D8E A;  1OWL A;  2R05 A;  3CEQ A;  1SW6 A;  4Q69 A;  4JZY A;  3G2T A;  3EHN A;  3JCK C;  1BI8 B;  2XPY A;  3NOC D;  2XPI A;  3TAX A;  5FWQ A;  3E34 A;  1HX8 A;  3C3O A;  3ISM C;  2XEE A;  3SBS A;  1H0A A;  2WXM A;  5E76 A;  2Y3A A;  2NYJ A;  3UMV A;  4XKC A;  4APF A;  3DPD A;  5BXO A;  5ENN A;  2IO3 C;  4TV3 A;  3EHQ A;  2NSZ A;  3O48 A;  5B3S E;  1K3Z D;  3D9H A;  5CBO A;  3LY7 A;  2VQ2 A;  4N5C A;  3ML8 A;  2RKK A;  3TXM A;  3FTW A;  4DX5 D;  2GRP B;  1TNY A;  5LX8 A;  4G25 A;  3ASG A;  4GA0 A;  4PS3 A;  5FZS A;  3NOG D;  4GZ6 A;  2VGX B;  3TWW A;  1FPP A;  2R17 C;  1SA4 A;  4LNB A;  2DWZ A;  3MYV A;  4I6G A;  1LD8 A;  4JEH A;  1YCS B;  4RG6 A;  3ESK A;  2I1K A;  2DZN A;  3C3Q A;  3NQP A;  3DSX A;  4J8S A;  3HXC A;  4PDX A;  1OUV A;  1BPO A;  2CFU A;  4FJY A;  5BT1 A;  1IHB A;  1MX2 A;  2KAT A;  4LRZ A;  3DSS A;  4CGW A;  1LD7 A;  4I2Z A;  3EU9 A;  4NAC A;  4E85 A;  4UWL A;  1O5M A;  1ELR A;  2F8Y A;  2OVB A;  2EIM E;  2E2E A;  3RRM B;  3CVQ A;  4G11 A;  3DSU A;  3RAU A;  2M63 A;  4UUC A;  2DYR E;  4D10 C;  2WMO A;  3APD A;  4FU3 A;  2GRR B;  4Y6C A;  3N71 A;  3ZNG A;  4WND A;  4AM9 A;  3BG0 B;  3UIP C;  2XEV A;  3PZD A;  4KMO A;  4HOR A;  4GTS A;  4CGV A;  4U7E B;  4LCT A;  4JXT A;  1HS6 A;  1E8W A;  4AXH A;  1E8Z A;  4GU5 A;  4K5B A;  3L16 A;  2P9N G;  1NL4 A;  2KC7 A;  3B95 A;  3UX4 A;  4JB8 P;  3F6Q A;  3ASH A;  2XZT G;  5AAR A;  4N3B A;  3QWW A;  3KSQ A;  3T8M A;  2Y0B G;  3L13 A;  3T9K A;  1UJK A;  1HFA A;  4YVQ C;  3AJI A;  2IO2 C;  3PUJ A;  4U63 A;  5BNW A;  4L23 A;  3AG2 E;  3QJZ A;  3FTX A;  2J08 A;  2OCC E;  4JA7 A;  4BWR A;  1UW4 B;  4HRM B;  4U0S A;  4A1S A;  1N0Q A;  5ARG A;  5CEA A;  3TWX A;  2IF4 A;  3ASD A;  3VLD A;  5ENT D;  3MCX A;  3Q49 B;  2WXN A;  2LNI A;  3MX3 A;  1S70 B;  2E0I A;  3AS8 A;  1TJF A;  3CV0 A;  3UIN C;  3B7T A;  1EPU A;  3J5Q B;  3LYA A;  2X6K A;  5EKQ D;  5BW8 C;  3KEZ A;  1NA3 A;  2VYI A;  4MBG A;  1K1B A;  3FTY A;  1MQS A;  4BX9 A;  2B0O E;  3FWV A;  1S0P A;  2DVW A;  4XEI G;  1LTX A;  3EUV A;  5KJN A;  4UQZ A;  3DRA A;  3RIB A;  2VSN A;  3AG1 E;  1YA0 A;  4BSZ B;  3UPV A;  2J07 A;  5DBK A;  1U3C A;  4HBD A;  5FQ8 A;  4HI9 A;  4A3V A;  3G2W A;  2MYO A;  5JJ6 A;  4BTB A;  4HOT A;  1MYO A;  4HOS A;  1N54 A;  2JEK A;  3QAR A;  5G04 J;  1QYM A;  2XHE A;  1SVX A;  2XEH A;  2P9K G;  2KZT A;  4I2W A;  5B1B E;  3OXG A;  2XS1 A;  3Q7A A;  4GB9 A;  4U0U A;  4A3T A;  4J7W A;  2H6I A;  2OVF A;  4AVX A;  2P9S G;  5BV0 A;  2WXI A;  3X2Q E;  4JC8 A;  3ENE A;  3HXD A;  3BG1 B;  3D9N A;  3C3R A;  3MV2 B;  3L54 A;  1H6K A;  4YDE A;  4GMJ A;  2V0P A;  4B8A A;  3OTN A;  2BKK B;  1MX4 A;  4XE0 A;  4JPS A;  5ARF A;  3LJ3 A;  4FHK A;  2HM8 A;  1WY6 A;  3EHM A;  1UOH A;  3FH5 A;  2IJG X;  3OXF A;  4HLL A;  3AG3 E;  4UI9 K;  4TXR A;  1E96 B;  1Y6I A;  3ZUV B;  4QFV A;  3PZ2 A;  4DI3 A;  5KWD A;  5C2Y A;  4JD2 G;  4FP7 A;  1HXI A;  1A17 A;  1WM5 A;  2NXP A;  4YVO A;  1IHG A;  1QQE A;  4CDR A;  1UJJ A;  3FTS A;  3AS4 A;  1HH8 A;  3RK6 A;  1TN7 A;  2VGE A;  3CVP A;  3CHR A;  4PS8 A;  4DJA A;  4GZC A;  5G55 A;  4DUI A;  4XKB A;  1NP7 A;  4ANV A;  2A5E A;  5T3R A;  4EEC A;  4WAF A;  3CLJ A;  3SNX A;  3PH0 C;  3U3W A;  4BEP A;  3UKU G;  2UY1 B;  1JCS A;  1N0R A;  2GRL A; 
#chains in the Genus database with same CATH homology
 1TJC A;  4I9E A;  5A6C A;  3U66 A;  3D3M A;  3CHS A;  2L6J A;  3E4B A;  2XPY A;  1UN9 A;  2IOS A;  4HS2 A;  4I1M A;  2XPI A;  4UWH A;  3TAX A;  2OND A;  5FWQ A;  5G04 C;  4BT8 A;  3SD5 A;  4KBQ A;  5KCM A;  3R9A B;  1HX8 A;  2J09 A;  1SZA A;  2X38 A;  3ZW3 A;  3B7U X;  2PQR A;  3KAE A;  2DCP A;  3FP3 A;  2J9Q A;  3LY9 A;  4B0Z A;  3GW4 A;  3ZYK A;  4A1G A;  4UI9 J;  3SBS A;  3FU5 A;  4IUL A;  4LER A;  3R7Q A;  4B89 A;  1H0A A;  2WXM A;  2PM6 A;  4GZ3 A;  4HFG A;  5CCL A;  1FVF A;  3ZEF A;  3FTU A;  5JHB A;  1E8X A;  3L17 A;  4KVM A;  2XPZ A;  4CDN A;  3CR3 A;  2R59 A;  5E76 A;  4FUL A;  2KCK A;  2A5U A;  4OVV A;  3U4T A;  4KZ0 A;  3UT8 A;  3ULQ A;  1KT0 A;  2Y3A A;  4H7Y A;  2WXL A;  4J8F A;  3UMV A;  2YIN A;  4EZL A;  4XKC A;  3JUI A;  3DPD A;  4I43 A;  4APF A;  3LXU X;  5ENN A;  3AS5 A;  3SGH A;  4TV3 A;  3D9L A;  3CK7 A;  2RD0 A;  3CK8 A;  4ME2 A;  2V4L A;  2NSZ A;  3FUF A;  3LKU A;  3O48 A;  4DLO A;  2LSU A;  1Y8M A;  2PZI A;  3RRU A;  3TG4 A;  3CVU A;  3FU0 A;  3LY7 A;  2VQ2 A;  4N5C A;  3ML8 A;  3WXX A;  4A55 A;  3CHM A;  1OWP A;  5CMY A;  1H2U A;  3QNK A;  4CRW A;  4AY5 A;  3TXM A;  4HLE A;  4JHK A;  3FTW A;  2LAI A;  2WQH A;  5BUZ A;  4FLB A;  3R7R A;  5KJM A;  2WXJ A;  3D9M A;  1ZU2 A;  4OVU A;  3SI5 A;  5LX8 A;  1IYG A;  1E90 A;  4G25 A;  3ASG A;  3PEV B;  3MJW A;  3QAQ A;  4JHJ A;  2XCB A;  3CVX A;  1TEZ A;  4GA0 A;  4PS3 A;  4GYO A;  5FZS A;  2PM7 A;  3SZ7 A;  5CMW A;  4GZ6 A;  2VGX B;  3CST A;  2R17 C;  2BF0 X;  3ML9 A;  4AIF A;  3FFL A;  5FQ6 A;  2L9B A;  2QY7 A;  4K03 A;  4BTA A;  3PUK A;  3MYV A;  3PNL B;  5EX3 A;  2IFU A;  2J4B A;  4I6G A;  3D9I A;  1ZBP A;  1PY1 A;  4NRH B;  5J08 A;  1VDY A;  4ANW A;  4JEH A;  4N2S A;  3ASF A;  4R7L A;  1WAO 1;  4RG6 A;  3ZPJ A;  5T8I A;  1KT1 A;  2KCL A;  3NF1 A;  3ESK A;  4WWN A;  3GZ2 A;  3LVR E;  3G2S A;  5LFA A;  4MS6 A;  2I1K A;  2JLB A;  4G23 A;  4EBA A;  3B7S A;  2WQ7 A;  3NQP A;  4PS7 A;  3L22 A;  2VSO E;  4BX8 A;  3FEY A;  5BV1 A;  4J8S A;  2L0T B;  2XGM A;  4AEZ C;  2AWI A;  5AEN A;  2FUL A;  4LEU A;  1OUV A;  3OAW A;  1BPO A;  3Q5M A;  2CFU A;  2L0I A;  4FJY A;  4PDX A;  4B8C B;  4WNF A;  5BT1 A;  4N2Q A;  3SHF A;  4K0R A;  3TXN A;  3I4G A;  3ZN3 A;  2KAT A;  3SFZ A;  5HQ8 A;  4LRZ A;  1UN8 A;  2YQ8 A;  1NZN A;  3L6A A;  2MRI A;  3CVN A;  4CGW A;  4I2Z A;  4ABN A;  4EZK A;  2WVI A;  3T5V A;  4NAC A;  4FC8 A;  5CHE E;  5FQ7 A;  4BFR A;  2VTB A;  2KCV A;  3LCA A;  3MA5 A;  3GZS A;  4E85 A;  4UWL A;  1ELR A;  2LAH A;  3MGB A;  2OVB A;  2E2E A;  4C9B B;  2XRZ A;  3RRM B;  2XRY A;  3CVQ A;  4G11 A;  4J0U A;  3VLF A;  3ZXS A;  5M72 A;  1MHQ A;  1XGW A;  1HU3 A;  2M63 A;  2PQN A;  1KLX A;  4E6H A;  2CFZ A;  1JWF A;  3UUX A;  4F1S A;  2X6H A;  4D10 C;  4EQF A;  1Z3Y A;  3CK9 A;  2WMO A;  5FZR A;  4RVB A;  2DBA A;  3APD A;  4FU3 A;  3FTV A;  4Y6C A;  4DPR A;  3N71 A;  1UG3 A;  4WND A;  4AM9 A;  3BG0 B;  2XEV A;  3CQG B;  2ILR A;  4ACK A;  5AIJ A;  2DIW A;  3PZD A;  2WXF A;  4JL0 A;  4KMO A;  4HOR A;  4J8D A;  3FDH A;  4GPK A;  4CT4 A;  2CHW A;  1INZ A;  3D9J A;  4AJW A;  3QC1 A;  4CGV A;  2X3M A;  3SBT B;  4LCT A;  4HVB A;  2X6F A;  2CHZ A;  4AY6 A;  4JXT A;  1HS6 A;  4J6I A;  1Z3X A;  1E8W A;  3IHY A;  1XNF A;  4AXH A;  4JVS A;  2OOE A;  4B94 A;  2OV8 A;  1E8Z A;  4IYP A;  4G24 A;  4GU5 A;  4U04 A;  2MHK A;  3L16 A;  5J90 A;  4F7A A;  4GCN A;  3G2U A;  4XZ4 A;  2KC7 A;  3PE3 A;  3QKY A;  3UX4 A;  3AU5 A;  4PH4 B;  3QB2 A;  5JJT A;  3ASH A;  3U9W A;  4F53 A;  4N3B A;  3QWW A;  4ACL A;  3FH7 A;  4G1T A;  3HHM A;  4N39 A;  5ANL A;  5FT9 A;  2P58 C;  2IQC A;  4GYW A;  3T8M A;  1HZ4 A;  3HDX A;  4UI9 C;  3L13 A;  1FCH A;  3EIQ C;  1UJK A;  3CHQ A;  4ILG A;  4MLP A;  3FUI A;  1HFA A;  4YVQ C;  3PUJ A;  4I17 A;  4U63 A;  4W9R A;  4L23 A;  3I4R B;  5BNW A;  2X6J A;  1OWO A;  4EPZ A;  2FBN A;  3QJZ A;  4JW1 A;  4WWO A;  3UT4 A;  3FTX A;  2J08 A;  1EDU A;  3PNT B;  3RO2 A;  2PL2 A;  4AV7 A;  4JA7 A;  1H19 A;  4MRU A;  4BWR A;  1GW6 A;  4UQY A;  3EIJ A;  1UW4 B;  4IN3 B;  4U0S A;  2R5S A;  5ARG A;  4A1S A;  2IF4 A;  3ASD A;  1L5J A;  3VLD A;  3MCX A;  3Q49 B;  3QK0 A;  2WXN A;  3D9O A;  5D0Q D;  1FVH A;  2LNI A;  3MX3 A;  2E0I A;  3AS8 A;  2AVP A;  1TJF A;  3CV0 A;  3ESL A;  4U8H A;  3B7T A;  5LCW J;  1EPU A;  2ION A;  3LYA A;  4O6F A;  4IRU A;  3ZYM A;  2XGS A;  1B89 A;  2X6K A;  2EQX A;  1HF8 A;  3ZVV A;  5BPP A;  3PS6 A;  2WXK A;  5EKQ D;  4GZD A;  2A4Z A;  1EYH A;  3VLE A;  2GRM A;  3OXL A;  5G05 J;  5BW8 C;  2VTB B;  4J8E A;  3KEZ A;  1NA3 A;  2VYI A;  4ILH B;  4KT6 B;  3ZYL A;  3TL5 A;  3FUJ A;  3ONK A;  2BTD A;  1ELK A;  3LEW A;  1H2T C;  1NA0 A;  2WMN A;  3FTY A;  4GA1 A;  4EZJ A;  2RG8 A;  1MQS A;  3PDN A;  4BX9 A;  5LCW C;  2WXP A;  3MKQ A;  3FWV A;  2FEZ A;  4XIF A;  3D9P A;  5JJ7 A;  4H7X A;  4GZ5 A;  2FO7 A;  2VSY A;  1JWG A;  2IU1 A;  1S0P A;  5AYW D;  3HVE B;  2I1J A;  4XI0 A;  1DNP A;  4OYS A;  2UWJ G;  1OWN A;  5FQ4 A;  2GW1 A;  5KJN A;  2VGY A;  4UQZ A;  3FHE A;  4L2Y A;  3LDZ A;  2Y4T A;  3RIB A;  2WPV A;  4MKT A;  1E8Y A;  1PAQ A;  2Q7F A;  2VSN A;  2BUG A;  3LY8 A;  5FTP A;  4CDM A;  5EDS A;  1YA0 A;  2LO6 A;  5E75 A;  3UPV A;  3FUE A;  3FEX A;  3TGO A;  5CCM A;  2J07 A;  5DBK A;  1U3C A;  4LUN U;  5FQ8 A;  3IEG A;  4ANX A;  5AJD A;  2VJ8 A;  1QNF A;  4L7T A;  4F3V A;  4A3V A;  3HVE A;  4GAA A;  4U0Z A;  2J49 A;  3G2W A;  3FUH A;  4C0E A;  2XCC A;  3Q15 A;  2WQ6 A;  4JEU A;  5KJL A;  2IOL A;  3ONL A;  3PRZ A;  3L08 A;  5JJ6 A;  4BTB A;  2HYZ A;  4KXK B;  1Z6T A;  1IQU A;  1HE8 A;  4GCO A;  3KD7 A;  4AP2 A;  4CCA A;  4HOT A;  3UT7 A;  4HOS A;  1N54 A;  2J4D A;  2JEK A;  3QAR A;  3CKC A;  3P1U A;  3FTZ A;  5G04 J;  3FUM A;  5D0O D;  3APF A;  1P5Q A;  3CHO A;  2XHE A;  3CVW A;  4NQ0 A;  3CGH A;  1HG5 A;  2KZT A;  4I2W A;  4I9C A;  2AW6 A;  3U64 A;  3OXG A;  3VTY A;  1SZ9 A;  1U3D A;  3MZL B;  3TJP A;  1JUQ A;  3BEE A;  4GB9 A;  4Q94 A;  3LS8 A;  5ANR A;  3HYM B;  1E7U A;  4U0U A;  4V3I A;  4A3T A;  2WXR A;  1N52 A;  3IV0 A;  3ZHE B;  3RU0 A;  2OVF A;  3IBE A;  4AVX A;  2XGO A;  4ANU A;  4WNE A;  1EF1 C;  5BV0 A;  2WXI A;  4EBA G;  4I6J A;  4JC8 A;  3ENE A;  4ILI A;  4DI4 A;  2WB2 A;  5FJY A;  3BG1 B;  4CT0 A;  3MEK A;  3D9N A;  1DVP A;  5EX0 A;  3MV3 B;  2AXV A;  3MV2 B;  4WNG A;  3L54 A;  1SQM A;  1H6K A;  4I1A A;  2UY1 A;  3I5P A;  4NUR A;  3ZFW A;  3FU3 A;  4GMJ A;  2V0P A;  4TRQ A;  3SF4 A;  4B8A A;  3B13 A;  4DK5 A;  3OTN A;  4I6E A;  3ZHE A;  3GZ1 A;  2YHC A;  3TG5 A;  3CIA A;  4KZC A;  4FLH A;  4XE0 A;  4FAD A;  4JPS A;  3PRE A;  5ARF A;  3CKB A;  4GA2 A;  3JQ1 A;  4UQX A;  3S7F A;  3LJ3 A;  2C2L A;  5KJK A;  5AJL A;  3S7B A;  3CSF A;  4XI9 A;  4KYO B;  2CG3 A;  3S7J A;  2WXG A;  2XQ0 A;  4HOQ A;  3VTX A;  4L2L A;  2LSV A;  4DLQ A;  3KS2 A;  2AXU A;  2I9C A;  3MKQ B;  3FU6 A;  3EJN A;  4FHK A;  2HM8 A;  4KVO A;  1OWM A;  2HO1 A;  4UWG A;  3RRN B;  3Q47 B;  1WY6 A;  1ELW A;  3EHM A;  3FH5 A;  4BY6 A;  2IJG X;  3NZS A;  3OXF A;  1JPL A;  5T4Y A;  3ZIM A;  4UI9 K;  4BSX A;  4WWP A;  3CQC B;  5DIZ A;  3FUD A;  4RG9 A;  2WXH A;  3FY4 A;  1E96 B;  3HIZ A;  4GYY A;  2KM4 A;  3CHP A;  1HG2 A;  2C0L A;  1PC2 A;  1Y6I A;  4WUY A;  3JYS A;  3QDN A;  2QFC A;  3FUL A;  3QOU A;  4UWK A;  5A23 A;  4UWF A;  4QFV A;  3S2A A;  3CVV A;  4Q96 A;  4L1B A;  2ZU6 B;  2WXO A;  2VSX E;  4DI3 A;  1HO8 A;  3QWV A;  2CHX A;  5C2Y A;  1QZ2 A;  3D9K A;  3GYZ A;  1IQR A;  2Y4U A;  2V8S E;  2HR2 A;  3FUN A;  3P2B A;  4FP7 A;  4N3A A;  4M3O A;  1HXI A;  2CG2 A;  2I6H A;  5G2N A;  3LVQ E;  1A17 A;  3AU4 A;  3Q4A B;  3URZ A;  1WM5 A;  2FF4 A;  2NXP A;  5C1D A;  3FH8 A;  5LOZ A;  3LPZ A;  4CEM A;  3EDT B;  3APC A;  1E7V A;  3FUK A;  3PVL A;  3S7D A;  5JHA A;  2MOW A;  3DBS A;  4RSY A;  5G05 C;  5A7D B;  3RO3 A;  2GGF A;  4ATG A;  4YVO A;  1IHG A;  4XX5 A;  1QQE A;  2YNQ A;  4G2V A;  5FZQ A;  3ZRH A;  3RJV A;  3UQ3 A;  3ZYQ A;  2WM9 A;  3RKV A;  4CDR A;  1UJJ A;  4HOU A;  2VGX A;  4JA9 A;  4FA6 A;  3CVY A;  3NZU A;  1LF8 A;  3FTS A;  4BT9 A;  3AS4 A;  3IKO B;  4U07 A;  1HH8 A;  3RK6 A;  1W3B A;  2KZT B;  4AOF A;  3CVP A;  2NC9 A;  3MKR A;  3CHR A;  2I2O A;  4N3C A;  2AXZ A;  2FI7 A;  4P29 A;  3IHV A;  4PUC A;  4FJZ A;  4APO A;  4PS8 A;  4GML A;  2YHE A;  4C0M A;  3PE4 A;  3T5X A;  4DJA A;  4G26 A;  4GZC A;  5G55 A;  1X5B A;  2X6I A;  3C98 A;  4TUU A;  4XKB A;  1NP7 A;  4ANV A;  4EEC A;  3I3N A;  4I1O B;  5T3R A;  2WXQ A;  4WAF A;  3CLJ A;  3JQ0 A;  4YND A;  3K9I A;  3QWP A;  2C0M A;  3ZGQ A;  4JHR A;  1OWL A;  3PH0 C;  3SNX A;  3U3W A;  5HI7 A;  2V5F A;  5LP0 A;  4HXI A;  3CEQ A;  3CVL A;  3O4Z A;  4FHJ A;  1H2V C;  3B7R L;  4Q69 A;  4JZY A;  3G2T A;  4URK A;  2UY1 B;  3G2V A;  3EHN A;  3PEU B;  3JCK C;  4Y6W A;  2GRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...