3UT7A

Structural view of a non pfam singleton and crystal packing analysis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
127
Chain Sequence
LRDLIPKHKFDNSTIDQLCKLIDNEIEPIIFDLLKWLQDYNWPIAKDILPVVVLHQSIAMPHILTILQGNDIMWKYWVIKLMIPYLIYPNKQLVKSELERLSSLEIINEDIREIVNLSKDYLHFYYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative uncharacterized protein
publication title Structural view of a non pfam singleton and crystal packing analysis.
pubmed doi rcsb
source organism Clostridium thermocellum
total genus 38
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16804 DUF5071 Domain of unknown function (DUF5071)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.750 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ut7A00
3UT8A 3UT4A 3UT7A
chains in the Genus database with same CATH superfamily
1E7UA 3UMVA 2CHXA 4BSZB 4G8KA 1JCQA 3FU0A 1PC2A 1HO8A 2WPVA 4JB8P 3ML8A 3T5VA 3ASNE 4U95D 4AEZC 4JC8A 2ONDA 1FT2A 2WXGA 4TXRA 3V2OA 4AJWA 3ZHEA 3TWXA 4GMLA 2NXPA 1OT8A 2Y4UA 4YVOA 4ME2A 4IYPA 2GRMA 3KEAA 4K5CA 3APCA 3VTYA 3ULQA 5FT9A 3HIZA 4K0RA 3EHNA 5EDSA 3Q9NC 1U2VG 5JJ7A 3HXEA 3MA5A 2AJAA 3SO8A 2OV8A 2WQ6A 3IBEA 2J4BA 5ARFA 2YHEA 3CHPA 3TJPA 4GTVA 3CHMA 3FUJA 3PUKA 3D9OA 1EYHA 2YNQA 5AQ7A 3I3NA 2P58C 4URKA 3ASFA 2EINE 1OUVA 1ELRA 4KVOA 3PZ3A 1DCQA 4PS8A 1HH8A 5HRYA 3FTVA 3B7TA 4DX1A 4EZJA 2RD0A 4HBDA 3UM1A 3LVRE 4CCAA 4RLYA 2QC9A 2XZTG 4GZ3A 4MRUA 3SBTB 3UM3A 4FA6A 2B6CA 2KBXA 3RRNB 3RU0A 4YNDA 5T4YA 4NURA 2EIME 2F0YA 2R5SA 5ANLA 1E8ZA 4QFVA 3V2XA 3MV3B 3TWRA 3TWSA 1SVXA 1K8KG 4L1BA 2KATA 4GZCA 3D9NA 1Z5SC 5EX3A 4AV7A 4A3VA 4CDMA 2WVIA 3B7SA 2GRRB 5EIDA 4OVUA 3UT8A 4JVSA 3AU5A 2V4HC 3CLJA 5A7DB 2CFZA 5JJ6A 1KT1A 3ONKA 5AENA 4GZ5A 3LS8A 1UN9A 3FWVA 2XPYA 3PDNA 4N3BA 1HZ4A 5LP0A 4DX2A 3R9AB 2FBNA 5BXUA 2YQ8A 4GTSA 4JHKA 4XIFA 3HVEB 5CECB 3CVPA 3VTXA 3AG4E 3UI2A 4EBAG 1LTXA 4U8VD 2AWIA 2H6FA 4O1PA 4U8YD 3LXUX 3SFZA 3DXMG 3UT7A 1AP7A 1BPOA 3LY8A 2FULA 4I9EA 1LD7A 4KZCA 5HQ8A 5ENSD 4FC8A 4UWKA 2JLBA 4HRLA 4GAAA 3FH5A 3PREA 4JHRA 4KYOB 5KJMA 3FH7A 3P1UA 5C2YA 1WY6A 4G24A 4AY5A 4L23A 3FUFA 1KZPA 3LYAA 3IV0A 4UWLA 1ZB1A 5JHAA 4UI9K 5G04J 2WXNA 3RKVA 3EU9A 3DPDA 2FF4A 3CHOA 1MJ0A 3VLDA 3QWWA 4U7EB 3ABME 2V5FA 1Q2ZA 1Z3XA 4UQXA 4CT4A 2HR2A 1DNPA 3KS2A 2V5QC 1S63A 4BEPA 1O1TA 4B8AA 4I6JA 3FEXA 4A55A 2F8YA 2J49A 1TJCA 3ULYA 4LNGA 4Y6WA 3GW4A 1DCEA 4O6FA 2XRYA 3UKRG 5D0OD 4NACA 4QQIA 3JQ1A 2ILRA 2P2CP 3HXFA 3ZXSA 2WXQA 1PY1A 2GRNB 2UY1A 3HRAA 1NI1A 1Y8MA 3ZW3A 5CEAA 5EYLA 2P9IG 3NOGD 2IO2C 3QC1A 3RIBA 4ZFHA 3FH8A 5D66A 4DX7D 1MX4A 1IQRA 2J8SD 3EIQC 3D3MA 1MHQA 3CHRA 2X6KA 1WAO1 3U3WA 4BY6A 3KAEA 4ATZD 3ABLE 2ZGGA 2CG3A 1HG5A 2C0LA 3QWVA 4CGWA 4UQZA 5G04C 3I5PA 2OCCE 5EKQD 3CKBA 4K03A 3Q73A 2NYJA 1MZCA 3BUAA 2X38A 4LERA 1HU3A 3DSTA 4IRUA 1QNFA 4JL0A 4KT6B 3ZYMA 4CDNA 4DPRA 4PDXA 2GW1A 4U96D 3FUEA 4U8HA 5FQ4A 1ELWA 5J90A 4Q69A 3D9PA 3VLFA 3B7BA 3DSVA 3QK0A 2DYSE 5BW8C 2IOLA 4L2YA 3G2WA 1S64A 4BTBA 4J8YA 3KD7A 5FZRA 3D9IA 2LO6A 3CK9A 2C0MA 2UWJG 4AIFA 2WMOA 3PH0C 2FO1E 5BUZA 3CVUA 3E34A 2I2OA 4HVBA 3P2BA 4JHJA 3UT4A 1BD8A 3CHQA 2RKKA 4WNEA 4IULA 3IEGA 5FINA 2V8SE 1N4SA 1H6KA 3CSTA 1SA4A 3BQOA 4OAUC 4NRHB 4U04A 1RZ4A 3C72A 4RG9A 4OAVB 1H6OA 2VTBB 1Z6TA 3FU5A 1N4QA 3S7BA 3Q78A 1SZAA 3ZUVB 4DK5A 3FUNA 3FTWA 3EUVA 4GB9A 1TNOA 2ETBA 4HLEA 5KCMA 5AARA 2Y1LE 2QYUA 4A63B 3LDZA 3FTXA 4J6IA 1YA0A 4LSZE 4PS7A 2PNNA 4YDEA 4AP2A 3OTNA 4C0EA 1BI8B 3ASOE 2P9KG 3CVYA 4TXQA 4W9RA 4KZ0A 3TWQA 4TXPA 3FTYA 2DVWA 4LG6A 3ESLA 4K5AB 4JD2G 2GROB 4EHMA 4UI9J 4I43A 3EIJA 3GYZA 5EILA 2HE0A 3C3RA 1DC2A 1E8YA 2WXLA 3HHMA 5KNHD 3AS4A 1SW6A 4B94A 4J0UA 3I4GA 3RAUA 5CBNA 5KJNA 2VGXB 3ML9A 4V3IA 1YYHA 3B13A 2WQHA 3MYVA 4MKTA 5FTPA 4FLBA 3RO3A 1NL4A 3EJNA 3GZ2A 1Z3YA 3RK6A 2E2EA 4JW1A 3UTMA 5E76A 3T8MA 2IY0C 4I17A 4YDWA 3PUJA 5LOZA 3DEPA 1JUQA 2PL2A 4C9BB 2P9SG 2CHWA 1EDUA 2HO1A 3G2SA 3FULA 1OWNA 2OEVA 2R03A 3JXJA 1D9SA 4N39A 1TNZA 2IJGX 3FTZA 4PS3A 3ZRHA 4CZ2D 1N52A 4FJZA 1PAQA 2VSNA 4CDRA 2B0OE 2RFMA 3CVNA 5AQ9A 3IKOB 3ASHA 5AAOA 5B3SE 4H7YA 4GTMA 3ZNGA 3TWWA 3FUHA 1BU9A 1D8EA 4ANUA 4BX9A 5ENTD 3BEEA 4GMJA 3L22A 4UI9C 4C0MA 3TGOA 5ANRA 3UINC 2VGEA 2ZISA 1N95A 1X81A 3ZYLA 1HS6A 2LNIA 4J8DA 3DRAA 3HVEA 2PM6A 2I1KA 2WXMA 1TEZA 4WNGA 2XZDG 4HOUA 3S7FA 4WNFA 3IXEA 2A5UA 1MX6A 2R59A 2MYOA 2WM9A 4I6GA 3FFLA 2XS8A 2XPIA 1E8XA 2KC7A 4ATGA 1NA3A 2XEHA 3D9KA 2QYJA 3QKYA 3MZLB 3CK8A 3BU8A 4JXTA 1AWCB 3Q15A 1MYOA 3SHFA 3ABKE 3DSXA 4GYOA 1G3NB 3Q47B 3TWUA 4ABNA 1A17A 4BFRA 2KM4A 2M63A 3N71A 3RRUA 2XGSA 4UWHA 1OWPA 5ITZF 5FZSA 3ZHEB 2QY7A 1FVFA 3MX3A 4KMOA 1OWLA 2VJ8A 3ZYKA 2VGYA 1TN7A 4I6EA 5B1AE 1O1SA 2ZGDA 3URZA 4BX8A 3FP3A 3HXDA 3PRZA 2GGFA 4NIKA 2AXZA 3JXIA 3EU5A 2FO7A 5ENNA 3T8KA 4HOQA 3UX4A 2R17C 3TG5A 3RSEG 4ANVA 3ZIMA 1ZBPA 4Q96A 4BETA 5G2NA 4OYSA 2BUGA 3G2VA 1LF8A 3CGHA 4J8SA 3JUEA 3SQVA 3DSUA 2YINA 5KJLA 3LY7A 4BWRA 4GCNA 1TNUA 4XI0A 3LVQE 2L6BA 4RVBA 3B7RL 4CYMD 3HDXA 4APFA 1S70B 2XRZA 5LX8A 2EILE 1WG0A 2ZXWE 3PZDA 4O60A 3MKRA 4I1AA 4GMRA 3GZ1A 2ZU6B 3HXBA 4I2ZA 2WXKA 4TRQA 3ZN3A 3I4RB 1N4PA 1UW4B 4L9PA 1VDYA 4IN3B 4JEUA 4GYYA 4EPZA 2F8XK 2AXVA 4CT0A 1TJFA 4OVVA 4EECA 3UKUG 4NQ0A 3TXNA 3Q5MA 5CRVA 3PS6A 2P9NG 3AS5A 2IQCA 4LUNU 2WXIA 4M3OA 4GTTA 4ACLA 3SZ7A 3ZU7B 1TYQG 3C3OA 4I1OB 2C2LA 3CSFA 4BERA 3ISMC 2LAIA 2BTDA 5H7PA 2DYRE 1BI7B 3S2AA 3SD5A 3DSSA 2X3MA 2CHZA 3MV2B 4GCOA 3GZSA 3V30A 3NQPA 4DX5D 3R9MA 4WWNA 2ETAA 3FUIA 5G55A 4ZHBA 2WXOA 3FU3A 1H2TC 2XCBA 2DZOA 3QDNA 3APDA 4TUMA 4I9CA 3UUXA 4EZLA 3ZGQA 4U0SA 4XX5A 1N94A 5KJKA 2IU1A 2VTBA 4AY6A 5HKPA 3L82A 1H0AA 4FU3A 3U4TA 3NF1A 3ZEFA 2WQ7A 1E96B 5E75A 4G2VA 4G26A 2P9PG 2FEZA 2DCPA 3ZKJA 1ELKA 3APFA 4H7XA 3ENEA 4PUCA 4G23A 2WXFA 2GRLA 5ENPD 3J5PA 3UQ3A 5BT1A 3KSQA 3VLEA 3L08A 2AXUA 1K1AA 3SFXA 3ZVVA 2L0TB 3CK7A 3SF4A 4FJYA 5LCWJ 2FI7A 5FQ8A 3KEZA 3TWTA 4GZDA 3Q75A 5ENOD 1QZ2A 4G11A 4LEUA 4GA1A 5T8IA 3MKQB 3TL5A 4HORA 1MQSA 3L6AA 3D9MA 4PH4B 4RSYA 3MJWA 2J07A 3E37A 2QFCA 1E7VA 1E8WA 3FEYA 4F7AA 4UQYA 1DVPA 3NB2A 1Y6IA 2ZIRA 3L16A 1A5EA 3QNKA 4R7LA 4ILGA 3MEKA 4Q94A 3LPZA 5FIOA 5BXOA 3O48A 3CEQA 4RG6A 3PEVB 2NSZA 2UY1B 4B0ZA 1HFAA 3MGBA 5FWQA 3TG4A 5IY5E 4N3CA 3FUDA 3SNXA 4F6RD 3W9GA 2GRQB 1FCHA 4ANXA 4BSXA 4FADA 3E33A 3MCXA 3WG7E 2GRPB 2P9UG 5ENRD 2DIWA 3UPVA 4XZ4A 3Q79A 2J08A 2X6IA 4GA2A 5J08A 2KCVA 4GTPA 3TAXA 3PE4A 1EF1C 3RRMB 4BESA 2IFUA 3FUMA 5D2MC 4BT9A 4I2WA 1OXJA 5CHEE 1SA5A 5ENQD 5LCWC 1UJJA 2BKKB 2L9BA 4CEMA 2AVPA 3DPYA 5T3RA 3ASDA 2Y69E 2HM8A 3QJZA 4N3AA 5JMND 3LY9A 1OWOA 3SFYA 1H6PA 4TV3A 2R02A 4D10C 3CV0A 3FY4A 2V4LA 2MOWA 5KNGA 4EZKA 3SY2A 4B8CB 5LFAA 2VSYA 4DUIA 4HNAD 2JABA 2MHKA 3HYMB 4YDOA 5CMYA 3HXCA 2Y0BG 4BTAA 2L6JA 4YVQC 3JYSA 2XCCA 2XGMA 1E90A 1HG2A 4K5BA 4JEHA 3L9TA 3FTSA 3LKUA 4HI9A 5AJDA 3F6QA 4X8QA 2JEKA 3PZ4A 2IF4A 1V55E 3UIPC 3ZFWA 1UJKA 3PNLB 3U9WA 2AW6A 1TNBA 3K9IA 4FP7A 5B1BE 4U0ZA 3D9LA 2XEEA 2IO3C 4XEIG 2VSXE 4G25A 2EIKE 5EIBE 3IHYA 3JUIA 1WM5A 4HFGA 2LUHA 2VYIA 4GZ6A 2VSOE 3NBNB 1JWGA 3LJNA 3X2QE 4MS6A 5EYPF 1BLXB 2LXLA 3C3QA 1OCOE 4N5QA 5ARGA 2I1JA 2DWZA 4M7CA 1MX2A 2KCLA 4ILHB 1N11A 2RG8A 2I6HA 3Q7FA 4U63A 1UOHA 1WDYA 5G05J 1KLXA 2KXPC 4B89A 2Y4TA 4N2QA 2HYZA 3CVLA 2Y3AA 2KCKA 3EHRA 3G2UA 3FUKA 3Q9UC 2KZTB 1UG3A 4XE0A 3ASGA 2IEJA 2X6JA 1KZOA 3BG1B 5AJLA 5CERB 2F37A 3CHSA 2WXPA 1RW2A 2PQNA 1QBQA 4J8FA 3CQGB 2OVFA 2A4ZA 3L13A 2LXMA 2CFUA 1YMPA 1N9AA 3EHQA 3SBSA 1HE8A 4L2LA 2XGOA 4DRXE 4HOSA 4Y6CA 5JHBA 3PEUB 3OXLA 5C1DA 1K1BA 1H19A 1N0RA 4F1SA 3U64A 3IHVA 4FULA 1HX8A 4HRMB 2PQRA 5A23A 4HLLA 1UN8A 2XHEA 4XI9A 3PZ2A 5FZQA 2PZIA 2DZNA 5JA4D 4KVMA 2L0IA 4HXIA 3LCAA 1U3CA 3L54A 3CKCA 3PVLA 4UWGA 1TN6A 2J9QA 1S0PA 3UXGA 2OVBA 2QZAA 5AQBA 3CQCB 5G05C 4C48B 1D8DA 3S7JA 5EN5D 3ZYQA 3ZXPA 3LJ3A 3DWLG 1NFIE 3T9KA 5D0QD 1YCSB 3PZ1A 4A1GA 3SGHA 3L17A 1K3ZD 3UIOC 3NAWA 2H6HA 4GYWA 1SZ9A 1FT1A 1N4RA 3S7DA 1QYMA 3AG3E 3CVWA 3OAWA 4AOFA 2YHCA 4GTRA 2I9CA 4WWPA 4LCTA 3FHEA 1KPSB 1IHBA 3O4ZA 4APOA 3U66A 2EQXA 1IXVA 5EX0A 3R7QA 1OCRE 4EBAA 4G1TA 4HRNA 1JPLA 1X5BA 1L5JA 4MLPA 3B95A 2A5EA 1SQMA 2EIJE 2H6IA 4CRWA 1JCSA 4AM9A 4DX6D 2XS1A 3MKQA 2XQ0A 1HF8A 3E4BA 1U3DA 4RQIA 5DIZA 2E0IA 3UM0A 4ANWA 5CBOA 4Z68A 3DXKG 2WXRA 3Q49B 4WNDA 1W3BA 2Q7FA 4AVXA 3QOUA 3Q4AB 2H6GA 2X6FA 3BG0B 4UUCA 4FLHA 4I1MA 1QQEA 3EHMA 5CCMA 1P5QA 4GA0A 5BV1A 3UM2A 4LNUD 4HB5A 5HI7A 1FPPA 4HQDA 3DBSA 4DJAA 3QB2A 2IONA 2NC9A 2P9LG 2WXHA 4F1PA 3V31A 1O1RA 3G2TA 5DBKA 1JWFA 3DSWA 1ZU2A 1HXIA 4GPKA 5HS0A 2PM7A 2R05A 3WXXA 3SI5A 1B89A 4FHKA 5CEDB 3E32A 3D9HA 1V54E 3PNTB 3JCKC 2OEWA 2VQ2A 1IHGA 1TNYA 3QAQA 2MRIA 3B7UX 3FDHA 3E30A 2LAHA 5AIJA 5AQAA 4MBGA 4KBQA 4GTQA 3OXFA 4DI3A 3AG1E 3NOCD 1NP7A 3R7RA 3CR3A 4A3TA 1IKND 2XPZA 2WMNA 4ACKA 3D9JA 1NZNA 2RFAA 3CVVA 3HG0D 3OXGA 1TN8A 5AYWD 2CG2A 4XKBA 4B93B 2XEVA 3QARA 3ZPJA 5CMWA 4UWFA 4G8LA 2VGXA 4JPSA 2ETCA 3CVQA 4AXHA 4CGVA 3RJVA 3KSLA 2BEDA 5FJYA 4TUUA 4ILIA 5M72A 4EQFA 3EDTB 5KBAA 1H2UA 3CIAA 2X6HA 4LNBA 3CVXA 3Q7AA 4JA9A 1N54A 5KWDA 1KT0A 4XKCA 4J8EA 4F3VA 1IYGA 1OY3D 1OWMA 3C5RA 3AAAC 2V0PA 1LD8A 3QWPA 4GTOA 3DEOA 1GW6A 1H2VC 5CCLA 5BV0A 2BF0X 3AS8A 5A6CA 5CRUA 5BNWA 3FTUA 4A1SA 4DLOA 1XNFA 3ESKA 2LSUA 3NZUA 4DLQA 3AG2E 4BT8A 1NA0A 3RO2A 2DBAA 4DI4A 1INZA 2R2LA 2BKGA 4KXKB 3C98A 3ONLA 4GPMA 5JJTA 4E6HA 2J4DA 4N2SA 5FQ6A 4E85A 4JA7A 4N5CA 3J5QB 5AN8A 4L7TA 3JQ0A 1FVHA 4LRZA 3AU4A 1OCZE 4WUYA 2XENA 4GU5A 4U0UA 3ULEG 2J09A 4JZYA 4WAFA 1O5MA 3AJIA 4J7WA 4HOTA 4U07A 1EPUA 3NZSA 4F53A 3FU6A 2WXJA 3T5XA 2WB2A 4O1OA 4HS2A 4WWOA 1JCRA 4FHJA 4P29A 1IQUA 3PE3A 3TWVA 4YDYA 2KZTA 1N0QA 2IOSA 2OOEA 5FQ7A 3TXMA 5BPPA 2LSVA 3V79K 1OCCE 3LEWA 1TR4A 1XGWA 3W9FA 4HI8A
chains in the Genus database with same CATH topology
1E7UA 4LUNU 5BUZA 2WXIA 4M3OA 3UMVA 2CHXA 3CVUA 1H19A 2I2OA 4HVBA 4ACLA 4F1SA 3FU0A 1PC2A 3P2BA 1HO8A 4JHJA 2WPVA 3UT4A 3SZ7A 3U64A 4I1OB 3IHVA 2C2LA 3CHQA 3CSFA 4FULA 2LAIA 4WNEA 3ML8A 4IULA 2BTDA 3IEGA 5JHBA 3T5VA 2V8SE 1H6KA 3CSTA 4NRHB 4U04A 4AEZC 1HX8A 4JC8A 3S2AA 3SD5A 2ONDA 2PQRA 5A23A 2WXGA 1UN8A 2XHEA 4XI9A 4RG9A 5FZQA 2X3MA 2CHZA 4AJWA 3MV2B 4GCOA 3GZSA 3NQPA 3ZHEA 2PZIA 4WWNA 4KVMA 2VTBB 2L0IA 3FUIA 4GMLA 2NXPA 4HXIA 2WXOA 5G55A 3FU3A 1H2TC 2XCBA 1Z6TA 3LCAA 1U3CA 3L54A 3FU5A 3CKCA 3QDNA 3PVLA 3APDA 2Y4UA 2J9QA 4UWGA 3S7BA 1S0PA 2OVBA 4YVOA 1SZAA 3CQCB 5G05C 4ME2A 4IYPA 4I9CA 3FUNA 3UUXA 4DK5A 3FTWA 4GB9A 4EZLA 2GRMA 3ZGQA 4U0SA 3APCA 4XX5A 3S7JA 4HLEA 5KJKA 5KCMA 3VTYA 3ULQA 3ZYQA 5FT9A 3HIZA 4K0RA 3LJ3A 2IU1A 3EHNA 2VTBA 5EDSA 4AY6A 3LDZA 1H0AA 5D0QD 3FTXA 4J6IA 4FU3A 5JJ7A 1YA0A 3U4TA 3NF1A 3ZEFA 2WQ7A 4A1GA 1E96B 5E75A 3SGHA 3MA5A 2OV8A 4G2VA 3L17A 4G26A 2WQ6A 3IBEA 4PS7A 2J4BA 2FEZA 5ARFA 2YHEA 3CHPA 2DCPA 3TJPA 1ELKA 3CHMA 3OTNA 4AP2A 4GYWA 3FUJA 4C0EA 1SZ9A 3PUKA 3APFA 4H7XA 3D9OA 3ENEA 3CVYA 4W9RA 4PUCA 4G23A 4KZ0A 1EYHA 2WXFA 2YNQA 3S7DA 3FTYA 3I3NA 2GRLA 2P58C 4URKA 3ASFA 3CVWA 3OAWA 4AOFA 1OUVA 2YHCA 3UQ3A 1ELRA 2I9CA 3ESLA 4KVOA 5BT1A 4WWPA 3VLEA 4LCTA 3L08A 4PS8A 2AXUA 3FHEA 4UI9J 1HH8A 4I43A 2L0TB 3CK7A 3FTVA 3B7TA 4FJYA 3EIJA 3SF4A 4EZJA 3GYZA 5LCWJ 3O4ZA 2FI7A 2RD0A 3ZVVA 1E8YA 2WXLA 3HHMA 3LVRE 5FQ8A 4APOA 4CCAA 3KEZA 3AS4A 4GZDA 4B94A 4J0UA 3I4GA 3U66A 2EQXA 1QZ2A 5KJNA 4G11A 4GZ3A 2VGXB 3ML9A 4MRUA 5EX0A 3R7QA 4EBAA 4V3IA 3SBTB 4LEUA 4FA6A 4G1TA 3B13A 4GA1A 5T8IA 2WQHA 3RU0A 3RRNB 3MKQB 3MYVA 4YNDA 4NURA 5T4YA 3TL5A 4HORA 1JPLA 4MKTA 5FTPA 1MQSA 4FLBA 3RO3A 3EJNA 3L6AA 1X5BA 3D9MA 3GZ2A 2R5SA 5ANLA 4PH4B 4RSYA 1L5JA 1Z3YA 3MJWA 1E8ZA 2J07A 2E2EA 4JW1A 3MV3B 4MLPA 2QFCA 4QFVA 3RK6A 5E76A 1E7VA 3T8MA 1E8WA 3FEYA 1SQMA 4F7AA 4UQYA 1DVPA 1Y6IA 4CRWA 4L1BA 4AM9A 2KATA 2XQ0A 3L16A 1HF8A 3D9NA 3E4BA 1U3DA 3MKQA 3QNKA 4GZCA 4I17A 5EX3A 4AV7A 4A3VA 3PUJA 4R7LA 4CDMA 5LOZA 5DIZA 2WVIA 2E0IA 3B7SA 4ILGA 1JUQA 2PL2A 3MEKA 4Q94A 4ANWA 3LPZA 4OVUA 3UT8A 2WXRA 3O48A 3Q49B 3CEQA 4WNDA 4JVSA 1W3BA 4C9BB 4RG6A 2Q7FA 4AVXA 2CHWA 3QOUA 3PEVB 3Q4AB 1EDUA 2HO1A 2NSZA 3AU5A 3G2SA 2UY1B 4B0ZA 2X6FA 3FULA 1OWNA 3BG0B 1HFAA 3MGBA 5FWQA 3CLJA 3TG4A 4FLHA 4I1MA 4N3CA 1QQEA 3FUDA 5A7DB 3EHMA 5CCMA 3SNXA 4N39A 2CFZA 5JJ6A 2IJGX 1KT1A 3ONKA 3FTZA 4PS3A 3ZRHA 4GZ5A 5AENA 1P5QA 1FCHA 3LS8A 1UN9A 4GA0A 3FWVA 4ANXA 1N52A 2XPYA 4BSXA 3PDNA 4N3BA 5BV1A 1HZ4A 4FADA 4FJZA 3MCXA 1PAQA 5LP0A 5HI7A 2VSNA 4CDRA 3CVNA 2DIWA 3R9AB 3UPVA 4XZ4A 3IKOB 3ASHA 2FBNA 2J08A 2X6IA 4GA2A 5J08A 2KCVA 4H7YA 2YQ8A 4JHKA 4XIFA 3PE4A 3TAXA 1EF1C 3DBSA 4DJAA 3FUHA 3HVEB 3QB2A 3CVPA 2IONA 2NC9A 3RRMB 4ANUA 4BX9A 2WXHA 3VTXA 3BEEA 4EBAG 2IFUA 3G2TA 5DBKA 3FUMA 1JWFA 4GMJA 2AWIA 1ZU2A 3L22A 4BT9A 4I2WA 4UI9C 4C0MA 3TGOA 3LXUX 5ANRA 1HXIA 3SFZA 5CHEE 4GPKA 5LCWC 1UJJA 2PM7A 3UT7A 1BPOA 3SI5A 3WXXA 3LY8A 2FULA 3ZYLA 1HS6A 2L9BA 4I9EA 2AVPA 1B89A 2LNIA 4J8DA 4FHKA 5T3RA 4CEMA 3ASDA 3HVEA 4KZCA 5HQ8A 3PNTB 2PM6A 3JCKC 4FC8A 4UWKA 2I1KA 2HM8A 2JLBA 2WXMA 1TEZA 4WNGA 3QJZA 4GAAA 2VQ2A 1IHGA 4N3AA 3FH5A 3QAQA 2MRIA 3PREA 3B7UX 4HOUA 3LY9A 4WNFA 3FDHA 4JHRA 1OWOA 2LAHA 3S7FA 4KYOB 2A5UA 5AIJA 5KJMA 3FH7A 3P1UA 5C2YA 4KBQA 1WY6A 4TV3A 3OXFA 4G24A 4D10C 4AY5A 2R59A 3CV0A 4DI3A 4L23A 3FY4A 2V4LA 3FUFA 3R7RA 1NP7A 2WM9A 2MOWA 3LYAA 3CR3A 4EZKA 4B8CB 4I6GA 3IV0A 4UWLA 5LFAA 3FFLA 2VSYA 2XPIA 1E8XA 4A3TA 2KC7A 2XPZA 2WMNA 4ATGA 4ACKA 1NA3A 5JHAA 3D9KA 4UI9K 5G04J 2WXNA 1NZNA 3D9JA 3QKYA 3MZLB 3CVVA 3RKVA 2MHKA 3HYMB 3DPDA 3CK8A 5CMYA 2FF4A 3OXGA 4JXTA 3CHOA 4BTAA 2L6JA 4YVQC 3VLDA 3Q15A 2CG2A 4XKBA 5AYWD 2XEVA 3JYSA 3QARA 3QWWA 3SHFA 2XCCA 3ZPJA 5CMWA 2XGMA 4UWFA 2VGXA 4JPSA 1E90A 4GYOA 3CVQA 1HG2A 2V5FA 3Q47B 4Y6CA 4JEHA 4AXHA 4CGVA 3FTSA 1Z3XA 3RJVA 4ABNA 4UQXA 1A17A 4CT4A 5FJYA 3LKUA 2HR2A 4TUUA 5AJDA 1DNPA 4ILIA 4BFRA 2KM4A 3KS2A 5M72A 2M63A 3N71A 3RRUA 4EQFA 2JEKA 3EDTB 2IF4A 2XGSA 4B8AA 4I6JA 3FEXA 1H2UA 1UJKA 3CIAA 4UWHA 2X6HA 3ZFWA 1OWPA 5FZSA 3PNLB 3U9WA 2AW6A 4A55A 3ZHEB 2QY7A 1FVFA 3MX3A 4KMOA 1OWLA 2J49A 3CVXA 2VJ8A 2VGYA 1N54A 1TJCA 3K9IA 4FP7A 4JA9A 3ZYKA 4U0ZA 1KT0A 4I6EA 3D9LA 4J8EA 4XKCA 4F3VA 1IYGA 1OWMA 4Y6WA 2VSXE 4G25A 3GW4A 4O6FA 2XRYA 2V0PA 3IHYA 3QWPA 1GW6A 3JUIA 1H2VC 1WM5A 5CCLA 3URZA 5BV0A 5D0OD 3AS8A 2BF0X 4HFGA 4NACA 4BX8A 3JQ1A 2VYIA 5A6CA 2ILRA 4GZ6A 2VSOE 3FP3A 1JWGA 3ZXSA 2WXQA 5BNWA 3FTUA 4MS6A 4A1SA 1PY1A 4DLOA 1XNFA 3ESKA 2LSUA 2UY1A 2GGFA 3NZUA 3PRZA 4DLQA 2AXZA 4BT8A 2FO7A 1NA0A 5ENNA 3RO2A 1Y8MA 2DBAA 4DI4A 1INZA 3ZW3A 4HOQA 3UX4A 2R17C 5ARGA 2I1JA 3QC1A 4KXKB 3TG5A 3RIBA 4ANVA 2KCLA 3ZIMA 3C98A 1ZBPA 3ONLA 4Q96A 5G2NA 4OYSA 4ILHB 2RG8A 2BUGA 3G2VA 2I6HA 5JJTA 4U63A 3FH8A 1LF8A 3CGHA 4J8SA 4E6HA 1IQRA 3EIQC 2J4DA 2YINA 5KJLA 3D3MA 4N2SA 5G05J 5FQ6A 3LY7A 4E85A 1KLXA 4JA7A 4BWRA 1MHQA 3CHRA 4N5CA 4GCNA 2X6KA 1WAO1 4B89A 4L7TA 3KAEA 4XI0A 3JQ0A 4BY6A 1FVHA 4LRZA 3U3WA 2CG3A 3LVQE 1HG5A 2C0LA 2Y4TA 4RVBA 3AU4A 3QWVA 3B7RL 4CGWA 4UQZA 4WUYA 5G04C 3HDXA 4APFA 3TXNA 4GU5A 2XRZA 4U0UA 3I5PA 2J09A 5LX8A 4N2QA 5EKQD 2HYZA 4JZYA 4WAFA 3CKBA 3CVLA 2Y3AA 4K03A 4HOTA 4U07A 1EPUA 2KCKA 3NZSA 4F53A 3G2UA 3PZDA 3MKRA 3FUKA 2KZTB 4I1AA 1UG3A 4XE0A 2X38A 3ASGA 3FU6A 3GZ1A 2WXJA 2X6JA 4LERA 3BG1B 5AJLA 1HU3A 3T5XA 4IRUA 2ZU6B 1QNFA 3CHSA 4I2ZA 2WB2A 2WXKA 4JL0A 4TRQA 4HS2A 2WXPA 3ZN3A 4WWOA 3I4RB 4KT6B 2PQNA 3ZYMA 1UW4B 4CDNA 4DPRA 4PDXA 1VDYA 2GW1A 4J8FA 3CQGB 4IN3B 3FUEA 4JEUA 4U8HA 1ELWA 4FHJA 5FQ4A 5J90A 2OVFA 4Q69A 4GYYA 4P29A 4EPZA 2A4ZA 3D9PA 1IQUA 3VLFA 3PE3A 2KZTA 2AXVA 3L13A 2IOSA 3QK0A 2OOEA 5FQ7A 4CT0A 2CFUA 1TJFA 3TXMA 4OVVA 5BPPA 2LSVA 5BW8C 2IOLA 4L2YA 3G2WA 4EECA 3LEWA 3SBSA 1HE8A 4L2LA 4NQ0A 2XGOA 4BTBA 3KD7A 5FZRA 4HOSA 3D9IA 3CK9A 2LO6A 3PEUB 3OXLA 1XGWA 3Q5MA 3PS6A 2C0MA 2UWJG 5C1DA 3AS5A 4AIFA 2WMOA 2IQCA 3PH0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT8 A;  3UT4 A;  3UT7 A; 
#chains in the Genus database with same CATH topology
 1E7U A;  3UMV A;  2CHX A;  4BSZ B;  4G8K A;  1JCQ A;  3FU0 A;  1PC2 A;  1HO8 A;  2WPV A;  4JB8 P;  3ML8 A;  3T5V A;  3ASN E;  4U95 D;  4AEZ C;  4JC8 A;  2OND A;  1FT2 A;  2WXG A;  4TXR A;  3V2O A;  4AJW A;  3ZHE A;  3TWX A;  4GML A;  2NXP A;  1OT8 A;  2Y4U A;  4YVO A;  4ME2 A;  4IYP A;  2GRM A;  3KEA A;  4K5C A;  3APC A;  3VTY A;  3ULQ A;  5FT9 A;  3HIZ A;  4K0R A;  3EHN A;  5EDS A;  3Q9N C;  1U2V G;  5JJ7 A;  3HXE A;  3MA5 A;  2AJA A;  3SO8 A;  2OV8 A;  2WQ6 A;  3IBE A;  2J4B A;  5ARF A;  2YHE A;  3CHP A;  3TJP A;  4GTV A;  3CHM A;  3FUJ A;  3PUK A;  3D9O A;  1EYH A;  2YNQ A;  5AQ7 A;  3I3N A;  2P58 C;  4URK A;  3ASF A;  2EIN E;  1OUV A;  1ELR A;  4KVO A;  3PZ3 A;  1DCQ A;  4PS8 A;  1HH8 A;  5HRY A;  3FTV A;  3B7T A;  4DX1 A;  4EZJ A;  2RD0 A;  4HBD A;  3UM1 A;  3LVR E;  4CCA A;  4RLY A;  2QC9 A;  2XZT G;  4GZ3 A;  4MRU A;  3SBT B;  3UM3 A;  4FA6 A;  2B6C A;  2KBX A;  3RRN B;  3RU0 A;  4YND A;  5T4Y A;  4NUR A;  2EIM E;  2F0Y A;  2R5S A;  5ANL A;  1E8Z A;  4QFV A;  3V2X A;  3MV3 B;  3TWR A;  3TWS A;  1SVX A;  1K8K G;  4L1B A;  2KAT A;  4GZC A;  3D9N A;  1Z5S C;  5EX3 A;  4AV7 A;  4A3V A;  4CDM A;  2WVI A;  3B7S A;  2GRR B;  5EID A;  4OVU A;  3UT8 A;  4JVS A;  3AU5 A;  2V4H C;  3CLJ A;  5A7D B;  2CFZ A;  5JJ6 A;  1KT1 A;  3ONK A;  5AEN A;  4GZ5 A;  3LS8 A;  1UN9 A;  3FWV A;  2XPY A;  3PDN A;  4N3B A;  1HZ4 A;  5LP0 A;  4DX2 A;  3R9A B;  2FBN A;  5BXU A;  2YQ8 A;  4GTS A;  4JHK A;  4XIF A;  3HVE B;  5CEC B;  3CVP A;  3VTX A;  3AG4 E;  3UI2 A;  4EBA G;  1LTX A;  4U8V D;  2AWI A;  2H6F A;  4O1P A;  4U8Y D;  3LXU X;  3SFZ A;  3DXM G;  3UT7 A;  1AP7 A;  1BPO A;  3LY8 A;  2FUL A;  4I9E A;  1LD7 A;  4KZC A;  5HQ8 A;  5ENS D;  4FC8 A;  4UWK A;  2JLB A;  4HRL A;  4GAA A;  3FH5 A;  3PRE A;  4JHR A;  4KYO B;  5KJM A;  3FH7 A;  3P1U A;  5C2Y A;  1WY6 A;  4G24 A;  4AY5 A;  4L23 A;  3FUF A;  1KZP A;  3LYA A;  3IV0 A;  4UWL A;  1ZB1 A;  5JHA A;  4UI9 K;  5G04 J;  2WXN A;  3RKV A;  3EU9 A;  3DPD A;  2FF4 A;  3CHO A;  1MJ0 A;  3VLD A;  3QWW A;  4U7E B;  3ABM E;  2V5F A;  1Q2Z A;  1Z3X A;  4UQX A;  4CT4 A;  2HR2 A;  1DNP A;  3KS2 A;  2V5Q C;  1S63 A;  4BEP A;  1O1T A;  4B8A A;  4I6J A;  3FEX A;  4A55 A;  2F8Y A;  2J49 A;  1TJC A;  3ULY A;  4LNG A;  4Y6W A;  3GW4 A;  1DCE A;  4O6F A;  2XRY A;  3UKR G;  5D0O D;  4NAC A;  4QQI A;  3JQ1 A;  2ILR A;  2P2C P;  3HXF A;  3ZXS A;  2WXQ A;  1PY1 A;  2GRN B;  2UY1 A;  3HRA A;  1NI1 A;  1Y8M A;  3ZW3 A;  5CEA A;  5EYL A;  2P9I G;  3NOG D;  2IO2 C;  3QC1 A;  3RIB A;  4ZFH A;  3FH8 A;  5D66 A;  4DX7 D;  1MX4 A;  1IQR A;  2J8S D;  3EIQ C;  3D3M A;  1MHQ A;  3CHR A;  2X6K A;  1WAO 1;  3U3W A;  4BY6 A;  3KAE A;  4ATZ D;  3ABL E;  2ZGG A;  2CG3 A;  1HG5 A;  2C0L A;  3QWV A;  4CGW A;  4UQZ A;  5G04 C;  3I5P A;  2OCC E;  5EKQ D;  3CKB A;  4K03 A;  3Q73 A;  2NYJ A;  1MZC A;  3BUA A;  2X38 A;  4LER A;  1HU3 A;  3DST A;  4IRU A;  1QNF A;  4JL0 A;  4KT6 B;  3ZYM A;  4CDN A;  4DPR A;  4PDX A;  2GW1 A;  4U96 D;  3FUE A;  4U8H A;  5FQ4 A;  1ELW A;  5J90 A;  4Q69 A;  3D9P A;  3VLF A;  3B7B A;  3DSV A;  3QK0 A;  2DYS E;  5BW8 C;  2IOL A;  4L2Y A;  3G2W A;  1S64 A;  4BTB A;  4J8Y A;  3KD7 A;  5FZR A;  3D9I A;  2LO6 A;  3CK9 A;  2C0M A;  2UWJ G;  4AIF A;  2WMO A;  3PH0 C;  2FO1 E;  5BUZ A;  3CVU A;  3E34 A;  2I2O A;  4HVB A;  3P2B A;  4JHJ A;  3UT4 A;  1BD8 A;  3CHQ A;  2RKK A;  4WNE A;  4IUL A;  3IEG A;  5FIN A;  2V8S E;  1N4S A;  1H6K A;  3CST A;  1SA4 A;  3BQO A;  4OAU C;  4NRH B;  4U04 A;  1RZ4 A;  3C72 A;  4RG9 A;  4OAV B;  1H6O A;  2VTB B;  1Z6T A;  3FU5 A;  1N4Q A;  3S7B A;  3Q78 A;  1SZA A;  3ZUV B;  4DK5 A;  3FUN A;  3FTW A;  3EUV A;  4GB9 A;  1TNO A;  2ETB A;  4HLE A;  5KCM A;  5AAR A;  2Y1L E;  2QYU A;  4A63 B;  3LDZ A;  3FTX A;  4J6I A;  1YA0 A;  4LSZ E;  4PS7 A;  2PNN A;  4YDE A;  4AP2 A;  3OTN A;  4C0E A;  1BI8 B;  3ASO E;  2P9K G;  3CVY A;  4TXQ A;  4W9R A;  4KZ0 A;  3TWQ A;  4TXP A;  3FTY A;  2DVW A;  4LG6 A;  3ESL A;  4K5A B;  4JD2 G;  2GRO B;  4EHM A;  4UI9 J;  4I43 A;  3EIJ A;  3GYZ A;  5EIL A;  2HE0 A;  3C3R A;  1DC2 A;  1E8Y A;  2WXL A;  3HHM A;  5KNH D;  3AS4 A;  1SW6 A;  4B94 A;  4J0U A;  3I4G A;  3RAU A;  5CBN A;  5KJN A;  2VGX B;  3ML9 A;  4V3I A;  1YYH A;  3B13 A;  2WQH A;  3MYV A;  4MKT A;  5FTP A;  4FLB A;  3RO3 A;  1NL4 A;  3EJN A;  3GZ2 A;  1Z3Y A;  3RK6 A;  2E2E A;  4JW1 A;  3UTM A;  5E76 A;  3T8M A;  2IY0 C;  4I17 A;  4YDW A;  3PUJ A;  5LOZ A;  3DEP A;  1JUQ A;  2PL2 A;  4C9B B;  2P9S G;  2CHW A;  1EDU A;  2HO1 A;  3G2S A;  3FUL A;  1OWN A;  2OEV A;  2R03 A;  3JXJ A;  1D9S A;  4N39 A;  1TNZ A;  2IJG X;  3FTZ A;  4PS3 A;  3ZRH A;  4CZ2 D;  1N52 A;  4FJZ A;  1PAQ A;  2VSN A;  4CDR A;  2B0O E;  2RFM A;  3CVN A;  5AQ9 A;  3IKO B;  3ASH A;  5AAO A;  5B3S E;  4H7Y A;  4GTM A;  3ZNG A;  3TWW A;  3FUH A;  1BU9 A;  1D8E A;  4ANU A;  4BX9 A;  5ENT D;  3BEE A;  4GMJ A;  3L22 A;  4UI9 C;  4C0M A;  3TGO A;  5ANR A;  3UIN C;  2VGE A;  2ZIS A;  1N95 A;  1X81 A;  3ZYL A;  1HS6 A;  2LNI A;  4J8D A;  3DRA A;  3HVE A;  2PM6 A;  2I1K A;  2WXM A;  1TEZ A;  4WNG A;  2XZD G;  4HOU A;  3S7F A;  4WNF A;  3IXE A;  2A5U A;  1MX6 A;  2R59 A;  2MYO A;  2WM9 A;  4I6G A;  3FFL A;  2XS8 A;  2XPI A;  1E8X A;  2KC7 A;  4ATG A;  1NA3 A;  2XEH A;  3D9K A;  2QYJ A;  3QKY A;  3MZL B;  3CK8 A;  3BU8 A;  4JXT A;  1AWC B;  3Q15 A;  1MYO A;  3SHF A;  3ABK E;  3DSX A;  4GYO A;  1G3N B;  3Q47 B;  3TWU A;  4ABN A;  1A17 A;  4BFR A;  2KM4 A;  2M63 A;  3N71 A;  3RRU A;  2XGS A;  4UWH A;  1OWP A;  5ITZ F;  5FZS A;  3ZHE B;  2QY7 A;  1FVF A;  3MX3 A;  4KMO A;  1OWL A;  2VJ8 A;  3ZYK A;  2VGY A;  1TN7 A;  4I6E A;  5B1A E;  1O1S A;  2ZGD A;  3URZ A;  4BX8 A;  3FP3 A;  3HXD A;  3PRZ A;  2GGF A;  4NIK A;  2AXZ A;  3JXI A;  3EU5 A;  2FO7 A;  5ENN A;  3T8K A;  4HOQ A;  3UX4 A;  2R17 C;  3TG5 A;  3RSE G;  4ANV A;  3ZIM A;  1ZBP A;  4Q96 A;  4BET A;  5G2N A;  4OYS A;  2BUG A;  3G2V A;  1LF8 A;  3CGH A;  4J8S A;  3JUE A;  3SQV A;  3DSU A;  2YIN A;  5KJL A;  3LY7 A;  4BWR A;  4GCN A;  1TNU A;  4XI0 A;  3LVQ E;  2L6B A;  4RVB A;  3B7R L;  4CYM D;  3HDX A;  4APF A;  1S70 B;  2XRZ A;  5LX8 A;  2EIL E;  1WG0 A;  2ZXW E;  3PZD A;  4O60 A;  3MKR A;  4I1A A;  4GMR A;  3GZ1 A;  2ZU6 B;  3HXB A;  4I2Z A;  2WXK A;  4TRQ A;  3ZN3 A;  3I4R B;  1N4P A;  1UW4 B;  4L9P A;  1VDY A;  4IN3 B;  4JEU A;  4GYY A;  4EPZ A;  2F8X K;  2AXV A;  4CT0 A;  1TJF A;  4OVV A;  4EEC A;  3UKU G;  4NQ0 A;  3TXN A;  3Q5M A;  5CRV A;  3PS6 A;  2P9N G;  3AS5 A;  2IQC A;  4LUN U;  2WXI A;  4M3O A;  4GTT A;  4ACL A;  3SZ7 A;  3ZU7 B;  1TYQ G;  3C3O A;  4I1O B;  2C2L A;  3CSF A;  4BER A;  3ISM C;  2LAI A;  2BTD A;  5H7P A;  2DYR E;  1BI7 B;  3S2A A;  3SD5 A;  3DSS A;  2X3M A;  2CHZ A;  3MV2 B;  4GCO A;  3GZS A;  3V30 A;  3NQP A;  4DX5 D;  3R9M A;  4WWN A;  2ETA A;  3FUI A;  5G55 A;  4ZHB A;  2WXO A;  3FU3 A;  1H2T C;  2XCB A;  2DZO A;  3QDN A;  3APD A;  4TUM A;  4I9C A;  3UUX A;  4EZL A;  3ZGQ A;  4U0S A;  4XX5 A;  1N94 A;  5KJK A;  2IU1 A;  2VTB A;  4AY6 A;  5HKP A;  3L82 A;  1H0A A;  4FU3 A;  3U4T A;  3NF1 A;  3ZEF A;  2WQ7 A;  1E96 B;  5E75 A;  4G2V A;  4G26 A;  2P9P G;  2FEZ A;  2DCP A;  3ZKJ A;  1ELK A;  3APF A;  4H7X A;  3ENE A;  4PUC A;  4G23 A;  2WXF A;  2GRL A;  5ENP D;  3J5P A;  3UQ3 A;  5BT1 A;  3KSQ A;  3VLE A;  3L08 A;  2AXU A;  1K1A A;  3SFX A;  3ZVV A;  2L0T B;  3CK7 A;  3SF4 A;  4FJY A;  5LCW J;  2FI7 A;  5FQ8 A;  3KEZ A;  3TWT A;  4GZD A;  3Q75 A;  5ENO D;  1QZ2 A;  4G11 A;  4LEU A;  4GA1 A;  5T8I A;  3MKQ B;  3TL5 A;  4HOR A;  1MQS A;  3L6A A;  3D9M A;  4PH4 B;  4RSY A;  3MJW A;  2J07 A;  3E37 A;  2QFC A;  1E7V A;  1E8W A;  3FEY A;  4F7A A;  4UQY A;  1DVP A;  3NB2 A;  1Y6I A;  2ZIR A;  3L16 A;  1A5E A;  3QNK A;  4R7L A;  4ILG A;  3MEK A;  4Q94 A;  3LPZ A;  5FIO A;  5BXO A;  3O48 A;  3CEQ A;  4RG6 A;  3PEV B;  2NSZ A;  2UY1 B;  4B0Z A;  1HFA A;  3MGB A;  5FWQ A;  3TG4 A;  5IY5 E;  4N3C A;  3FUD A;  3SNX A;  4F6R D;  3W9G A;  2GRQ B;  1FCH A;  4ANX A;  4BSX A;  4FAD A;  3E33 A;  3MCX A;  3WG7 E;  2GRP B;  2P9U G;  5ENR D;  2DIW A;  3UPV A;  4XZ4 A;  3Q79 A;  2J08 A;  2X6I A;  4GA2 A;  5J08 A;  2KCV A;  4GTP A;  3TAX A;  3PE4 A;  1EF1 C;  3RRM B;  4BES A;  2IFU A;  3FUM A;  5D2M C;  4BT9 A;  4I2W A;  1OXJ A;  5CHE E;  1SA5 A;  5ENQ D;  5LCW C;  1UJJ A;  2BKK B;  2L9B A;  4CEM A;  2AVP A;  3DPY A;  5T3R A;  3ASD A;  2Y69 E;  2HM8 A;  3QJZ A;  4N3A A;  5JMN D;  3LY9 A;  1OWO A;  3SFY A;  1H6P A;  4TV3 A;  2R02 A;  4D10 C;  3CV0 A;  3FY4 A;  2V4L A;  2MOW A;  5KNG A;  4EZK A;  3SY2 A;  4B8C B;  5LFA A;  2VSY A;  4DUI A;  4HNA D;  2JAB A;  2MHK A;  3HYM B;  4YDO A;  5CMY A;  3HXC A;  2Y0B G;  4BTA A;  2L6J A;  4YVQ C;  3JYS A;  2XCC A;  2XGM A;  1E90 A;  1HG2 A;  4K5B A;  4JEH A;  3L9T A;  3FTS A;  3LKU A;  4HI9 A;  5AJD A;  3F6Q A;  4X8Q A;  2JEK A;  3PZ4 A;  2IF4 A;  1V55 E;  3UIP C;  3ZFW A;  1UJK A;  3PNL B;  3U9W A;  2AW6 A;  1TNB A;  3K9I A;  4FP7 A;  5B1B E;  4U0Z A;  3D9L A;  2XEE A;  2IO3 C;  4XEI G;  2VSX E;  4G25 A;  2EIK E;  5EIB E;  3IHY A;  3JUI A;  1WM5 A;  4HFG A;  2LUH A;  2VYI A;  4GZ6 A;  2VSO E;  3NBN B;  1JWG A;  3LJN A;  3X2Q E;  4MS6 A;  5EYP F;  1BLX B;  2LXL A;  3C3Q A;  1OCO E;  4N5Q A;  5ARG A;  2I1J A;  2DWZ A;  4M7C A;  1MX2 A;  2KCL A;  4ILH B;  1N11 A;  2RG8 A;  2I6H A;  3Q7F A;  4U63 A;  1UOH A;  1WDY A;  5G05 J;  1KLX A;  2KXP C;  4B89 A;  2Y4T A;  4N2Q A;  2HYZ A;  3CVL A;  2Y3A A;  2KCK A;  3EHR A;  3G2U A;  3FUK A;  3Q9U C;  2KZT B;  1UG3 A;  4XE0 A;  3ASG A;  2IEJ A;  2X6J A;  1KZO A;  3BG1 B;  5AJL A;  5CER B;  2F37 A;  3CHS A;  2WXP A;  1RW2 A;  2PQN A;  1QBQ A;  4J8F A;  3CQG B;  2OVF A;  2A4Z A;  3L13 A;  2LXM A;  2CFU A;  1YMP A;  1N9A A;  3EHQ A;  3SBS A;  1HE8 A;  4L2L A;  2XGO A;  4DRX E;  4HOS A;  4Y6C A;  5JHB A;  3PEU B;  3OXL A;  5C1D A;  1K1B A;  1H19 A;  1N0R A;  4F1S A;  3U64 A;  3IHV A;  4FUL A;  1HX8 A;  4HRM B;  2PQR A;  5A23 A;  4HLL A;  1UN8 A;  2XHE A;  4XI9 A;  3PZ2 A;  5FZQ A;  2PZI A;  2DZN A;  5JA4 D;  4KVM A;  2L0I A;  4HXI A;  3LCA A;  1U3C A;  3L54 A;  3CKC A;  3PVL A;  4UWG A;  1TN6 A;  2J9Q A;  1S0P A;  3UXG A;  2OVB A;  2QZA A;  5AQB A;  3CQC B;  5G05 C;  4C48 B;  1D8D A;  3S7J A;  5EN5 D;  3ZYQ A;  3ZXP A;  3LJ3 A;  3DWL G;  1NFI E;  3T9K A;  5D0Q D;  1YCS B;  3PZ1 A;  4A1G A;  3SGH A;  3L17 A;  1K3Z D;  3UIO C;  3NAW A;  2H6H A;  4GYW A;  1SZ9 A;  1FT1 A;  1N4R A;  3S7D A;  1QYM A;  3AG3 E;  3CVW A;  3OAW A;  4AOF A;  2YHC A;  4GTR A;  2I9C A;  4WWP A;  4LCT A;  3FHE A;  1KPS B;  1IHB A;  3O4Z A;  4APO A;  3U66 A;  2EQX A;  1IXV A;  5EX0 A;  3R7Q A;  1OCR E;  4EBA A;  4G1T A;  4HRN A;  1JPL A;  1X5B A;  1L5J A;  4MLP A;  3B95 A;  2A5E A;  1SQM A;  2EIJ E;  2H6I A;  4CRW A;  1JCS A;  4AM9 A;  4DX6 D;  2XS1 A;  3MKQ A;  2XQ0 A;  1HF8 A;  3E4B A;  1U3D A;  4RQI A;  5DIZ A;  2E0I A;  3UM0 A;  4ANW A;  5CBO A;  4Z68 A;  3DXK G;  2WXR A;  3Q49 B;  4WND A;  1W3B A;  2Q7F A;  4AVX A;  3QOU A;  3Q4A B;  2H6G A;  2X6F A;  3BG0 B;  4UUC A;  4FLH A;  4I1M A;  1QQE A;  3EHM A;  5CCM A;  1P5Q A;  4GA0 A;  5BV1 A;  3UM2 A;  4LNU D;  4HB5 A;  5HI7 A;  1FPP A;  4HQD A;  3DBS A;  4DJA A;  3QB2 A;  2ION A;  2NC9 A;  2P9L G;  2WXH A;  4F1P A;  3V31 A;  1O1R A;  3G2T A;  5DBK A;  1JWF A;  3DSW A;  1ZU2 A;  1HXI A;  4GPK A;  5HS0 A;  2PM7 A;  2R05 A;  3WXX A;  3SI5 A;  1B89 A;  4FHK A;  5CED B;  3E32 A;  3D9H A;  1V54 E;  3PNT B;  3JCK C;  2OEW A;  2VQ2 A;  1IHG A;  1TNY A;  3QAQ A;  2MRI A;  3B7U X;  3FDH A;  3E30 A;  2LAH A;  5AIJ A;  5AQA A;  4MBG A;  4KBQ A;  4GTQ A;  3OXF A;  4DI3 A;  3AG1 E;  3NOC D;  1NP7 A;  3R7R A;  3CR3 A;  4A3T A;  1IKN D;  2XPZ A;  2WMN A;  4ACK A;  3D9J A;  1NZN A;  2RFA A;  3CVV A;  3HG0 D;  3OXG A;  1TN8 A;  5AYW D;  2CG2 A;  4XKB A;  4B93 B;  2XEV A;  3QAR A;  3ZPJ A;  5CMW A;  4UWF A;  4G8L A;  2VGX A;  4JPS A;  2ETC A;  3CVQ A;  4AXH A;  4CGV A;  3RJV A;  3KSL A;  2BED A;  5FJY A;  4TUU A;  4ILI A;  5M72 A;  4EQF A;  3EDT B;  5KBA A;  1H2U A;  3CIA A;  2X6H A;  4LNB A;  3CVX A;  3Q7A A;  4JA9 A;  1N54 A;  5KWD A;  1KT0 A;  4XKC A;  4J8E A;  4F3V A;  1IYG A;  1OY3 D;  1OWM A;  3C5R A;  3AAA C;  2V0P A;  1LD8 A;  3QWP A;  4GTO A;  3DEO A;  1GW6 A;  1H2V C;  5CCL A;  5BV0 A;  2BF0 X;  3AS8 A;  5A6C A;  5CRU A;  5BNW A;  3FTU A;  4A1S A;  4DLO A;  1XNF A;  3ESK A;  2LSU A;  3NZU A;  4DLQ A;  3AG2 E;  4BT8 A;  1NA0 A;  3RO2 A;  2DBA A;  4DI4 A;  1INZ A;  2R2L A;  2BKG A;  4KXK B;  3C98 A;  3ONL A;  4GPM A;  5JJT A;  4E6H A;  2J4D A;  4N2S A;  5FQ6 A;  4E85 A;  4JA7 A;  4N5C A;  3J5Q B;  5AN8 A;  4L7T A;  3JQ0 A;  1FVH A;  4LRZ A;  3AU4 A;  1OCZ E;  4WUY A;  2XEN A;  4GU5 A;  4U0U A;  3ULE G;  2J09 A;  4JZY A;  4WAF A;  1O5M A;  3AJI A;  4J7W A;  4HOT A;  4U07 A;  1EPU A;  3NZS A;  4F53 A;  3FU6 A;  2WXJ A;  3T5X A;  2WB2 A;  4O1O A;  4HS2 A;  4WWO A;  1JCR A;  4FHJ A;  4P29 A;  1IQU A;  3PE3 A;  3TWV A;  4YDY A;  2KZT A;  1N0Q A;  2IOS A;  2OOE A;  5FQ7 A;  3TXM A;  5BPP A;  2LSV A;  3V79 K;  1OCC E;  3LEW A;  1TR4 A;  1XGW A;  3W9F A;  4HI8 A; 
#chains in the Genus database with same CATH homology
 1E7U A;  4LUN U;  5BUZ A;  2WXI A;  4M3O A;  3UMV A;  2CHX A;  3CVU A;  1H19 A;  2I2O A;  4HVB A;  4ACL A;  4F1S A;  3FU0 A;  1PC2 A;  3P2B A;  1HO8 A;  4JHJ A;  2WPV A;  3UT4 A;  3SZ7 A;  3U64 A;  4I1O B;  3IHV A;  2C2L A;  3CHQ A;  3CSF A;  4FUL A;  2LAI A;  4WNE A;  3ML8 A;  4IUL A;  2BTD A;  3IEG A;  5JHB A;  3T5V A;  2V8S E;  1H6K A;  3CST A;  4NRH B;  4U04 A;  4AEZ C;  1HX8 A;  4JC8 A;  3S2A A;  3SD5 A;  2OND A;  2PQR A;  5A23 A;  2WXG A;  1UN8 A;  2XHE A;  4XI9 A;  4RG9 A;  5FZQ A;  2X3M A;  2CHZ A;  4AJW A;  3MV2 B;  4GCO A;  3GZS A;  3NQP A;  3ZHE A;  2PZI A;  4WWN A;  4KVM A;  2VTB B;  2L0I A;  3FUI A;  4GML A;  2NXP A;  4HXI A;  2WXO A;  5G55 A;  3FU3 A;  1H2T C;  2XCB A;  1Z6T A;  3LCA A;  1U3C A;  3L54 A;  3FU5 A;  3CKC A;  3QDN A;  3PVL A;  3APD A;  2Y4U A;  2J9Q A;  4UWG A;  3S7B A;  1S0P A;  2OVB A;  4YVO A;  1SZA A;  3CQC B;  5G05 C;  4ME2 A;  4IYP A;  4I9C A;  3FUN A;  3UUX A;  4DK5 A;  3FTW A;  4GB9 A;  4EZL A;  2GRM A;  3ZGQ A;  4U0S A;  3APC A;  4XX5 A;  3S7J A;  4HLE A;  5KJK A;  5KCM A;  3VTY A;  3ULQ A;  3ZYQ A;  5FT9 A;  3HIZ A;  4K0R A;  3LJ3 A;  2IU1 A;  3EHN A;  2VTB A;  5EDS A;  4AY6 A;  3LDZ A;  1H0A A;  5D0Q D;  3FTX A;  4J6I A;  4FU3 A;  5JJ7 A;  1YA0 A;  3U4T A;  3NF1 A;  3ZEF A;  2WQ7 A;  4A1G A;  1E96 B;  5E75 A;  3SGH A;  3MA5 A;  2OV8 A;  4G2V A;  3L17 A;  4G26 A;  2WQ6 A;  3IBE A;  4PS7 A;  2J4B A;  2FEZ A;  5ARF A;  2YHE A;  3CHP A;  2DCP A;  3TJP A;  1ELK A;  3CHM A;  3OTN A;  4AP2 A;  4GYW A;  3FUJ A;  4C0E A;  1SZ9 A;  3PUK A;  3APF A;  4H7X A;  3D9O A;  3ENE A;  3CVY A;  4W9R A;  4PUC A;  4G23 A;  4KZ0 A;  1EYH A;  2WXF A;  2YNQ A;  3S7D A;  3FTY A;  3I3N A;  2GRL A;  2P58 C;  4URK A;  3ASF A;  3CVW A;  3OAW A;  4AOF A;  1OUV A;  2YHC A;  3UQ3 A;  1ELR A;  2I9C A;  3ESL A;  4KVO A;  5BT1 A;  4WWP A;  3VLE A;  4LCT A;  3L08 A;  4PS8 A;  2AXU A;  3FHE A;  4UI9 J;  1HH8 A;  4I43 A;  2L0T B;  3CK7 A;  3FTV A;  3B7T A;  4FJY A;  3EIJ A;  3SF4 A;  4EZJ A;  3GYZ A;  5LCW J;  3O4Z A;  2FI7 A;  2RD0 A;  3ZVV A;  1E8Y A;  2WXL A;  3HHM A;  3LVR E;  5FQ8 A;  4APO A;  4CCA A;  3KEZ A;  3AS4 A;  4GZD A;  4B94 A;  4J0U A;  3I4G A;  3U66 A;  2EQX A;  1QZ2 A;  5KJN A;  4G11 A;  4GZ3 A;  2VGX B;  3ML9 A;  4MRU A;  5EX0 A;  3R7Q A;  4EBA A;  4V3I A;  3SBT B;  4LEU A;  4FA6 A;  4G1T A;  3B13 A;  4GA1 A;  5T8I A;  2WQH A;  3RU0 A;  3RRN B;  3MKQ B;  3MYV A;  4YND A;  4NUR A;  5T4Y A;  3TL5 A;  4HOR A;  1JPL A;  4MKT A;  5FTP A;  1MQS A;  4FLB A;  3RO3 A;  3EJN A;  3L6A A;  1X5B A;  3D9M A;  3GZ2 A;  2R5S A;  5ANL A;  4PH4 B;  4RSY A;  1L5J A;  1Z3Y A;  3MJW A;  1E8Z A;  2J07 A;  2E2E A;  4JW1 A;  3MV3 B;  4MLP A;  2QFC A;  4QFV A;  3RK6 A;  5E76 A;  1E7V A;  3T8M A;  1E8W A;  3FEY A;  1SQM A;  4F7A A;  4UQY A;  1DVP A;  1Y6I A;  4CRW A;  4L1B A;  4AM9 A;  2KAT A;  2XQ0 A;  3L16 A;  1HF8 A;  3D9N A;  3E4B A;  1U3D A;  3MKQ A;  3QNK A;  4GZC A;  4I17 A;  5EX3 A;  4AV7 A;  4A3V A;  3PUJ A;  4R7L A;  4CDM A;  5LOZ A;  5DIZ A;  2WVI A;  2E0I A;  3B7S A;  4ILG A;  1JUQ A;  2PL2 A;  3MEK A;  4Q94 A;  4ANW A;  3LPZ A;  4OVU A;  3UT8 A;  2WXR A;  3O48 A;  3Q49 B;  3CEQ A;  4WND A;  4JVS A;  1W3B A;  4C9B B;  4RG6 A;  2Q7F A;  4AVX A;  2CHW A;  3QOU A;  3PEV B;  3Q4A B;  1EDU A;  2HO1 A;  2NSZ A;  3AU5 A;  3G2S A;  2UY1 B;  4B0Z A;  2X6F A;  3FUL A;  1OWN A;  3BG0 B;  1HFA A;  3MGB A;  5FWQ A;  3CLJ A;  3TG4 A;  4FLH A;  4I1M A;  4N3C A;  1QQE A;  3FUD A;  5A7D B;  3EHM A;  5CCM A;  3SNX A;  4N39 A;  2CFZ A;  5JJ6 A;  2IJG X;  1KT1 A;  3ONK A;  3FTZ A;  4PS3 A;  3ZRH A;  4GZ5 A;  5AEN A;  1P5Q A;  1FCH A;  3LS8 A;  1UN9 A;  4GA0 A;  3FWV A;  4ANX A;  1N52 A;  2XPY A;  4BSX A;  3PDN A;  4N3B A;  5BV1 A;  1HZ4 A;  4FAD A;  4FJZ A;  3MCX A;  1PAQ A;  5LP0 A;  5HI7 A;  2VSN A;  4CDR A;  3CVN A;  2DIW A;  3R9A B;  3UPV A;  4XZ4 A;  3IKO B;  3ASH A;  2FBN A;  2J08 A;  2X6I A;  4GA2 A;  5J08 A;  2KCV A;  4H7Y A;  2YQ8 A;  4JHK A;  4XIF A;  3PE4 A;  3TAX A;  1EF1 C;  3DBS A;  4DJA A;  3FUH A;  3HVE B;  3QB2 A;  3CVP A;  2ION A;  2NC9 A;  3RRM B;  4ANU A;  4BX9 A;  2WXH A;  3VTX A;  3BEE A;  4EBA G;  2IFU A;  3G2T A;  5DBK A;  3FUM A;  1JWF A;  4GMJ A;  2AWI A;  1ZU2 A;  3L22 A;  4BT9 A;  4I2W A;  4UI9 C;  4C0M A;  3TGO A;  3LXU X;  5ANR A;  1HXI A;  3SFZ A;  5CHE E;  4GPK A;  5LCW C;  1UJJ A;  2PM7 A;  3UT7 A;  1BPO A;  3SI5 A;  3WXX A;  3LY8 A;  2FUL A;  3ZYL A;  1HS6 A;  2L9B A;  4I9E A;  2AVP A;  1B89 A;  2LNI A;  4J8D A;  4FHK A;  5T3R A;  4CEM A;  3ASD A;  3HVE A;  4KZC A;  5HQ8 A;  3PNT B;  2PM6 A;  3JCK C;  4FC8 A;  4UWK A;  2I1K A;  2HM8 A;  2JLB A;  2WXM A;  1TEZ A;  4WNG A;  3QJZ A;  4GAA A;  2VQ2 A;  1IHG A;  4N3A A;  3FH5 A;  3QAQ A;  2MRI A;  3PRE A;  3B7U X;  4HOU A;  3LY9 A;  4WNF A;  3FDH A;  4JHR A;  1OWO A;  2LAH A;  3S7F A;  4KYO B;  2A5U A;  5AIJ A;  5KJM A;  3FH7 A;  3P1U A;  5C2Y A;  4KBQ A;  1WY6 A;  4TV3 A;  3OXF A;  4G24 A;  4D10 C;  4AY5 A;  2R59 A;  3CV0 A;  4DI3 A;  4L23 A;  3FY4 A;  2V4L A;  3FUF A;  3R7R A;  1NP7 A;  2WM9 A;  2MOW A;  3LYA A;  3CR3 A;  4EZK A;  4B8C B;  4I6G A;  3IV0 A;  4UWL A;  5LFA A;  3FFL A;  2VSY A;  2XPI A;  1E8X A;  4A3T A;  2KC7 A;  2XPZ A;  2WMN A;  4ATG A;  4ACK A;  1NA3 A;  5JHA A;  3D9K A;  4UI9 K;  5G04 J;  2WXN A;  1NZN A;  3D9J A;  3QKY A;  3MZL B;  3CVV A;  3RKV A;  2MHK A;  3HYM B;  3DPD A;  3CK8 A;  5CMY A;  2FF4 A;  3OXG A;  4JXT A;  3CHO A;  4BTA A;  2L6J A;  4YVQ C;  3VLD A;  3Q15 A;  2CG2 A;  4XKB A;  5AYW D;  2XEV A;  3JYS A;  3QAR A;  3QWW A;  3SHF A;  2XCC A;  3ZPJ A;  5CMW A;  2XGM A;  4UWF A;  2VGX A;  4JPS A;  1E90 A;  4GYO A;  3CVQ A;  1HG2 A;  2V5F A;  3Q47 B;  4Y6C A;  4JEH A;  4AXH A;  4CGV A;  3FTS A;  1Z3X A;  3RJV A;  4ABN A;  4UQX A;  1A17 A;  4CT4 A;  5FJY A;  3LKU A;  2HR2 A;  4TUU A;  5AJD A;  1DNP A;  4ILI A;  4BFR A;  2KM4 A;  3KS2 A;  5M72 A;  2M63 A;  3N71 A;  3RRU A;  4EQF A;  2JEK A;  3EDT B;  2IF4 A;  2XGS A;  4B8A A;  4I6J A;  3FEX A;  1H2U A;  1UJK A;  3CIA A;  4UWH A;  2X6H A;  3ZFW A;  1OWP A;  5FZS A;  3PNL B;  3U9W A;  2AW6 A;  4A55 A;  3ZHE B;  2QY7 A;  1FVF A;  3MX3 A;  4KMO A;  1OWL A;  2J49 A;  3CVX A;  2VJ8 A;  2VGY A;  1N54 A;  1TJC A;  3K9I A;  4FP7 A;  4JA9 A;  3ZYK A;  4U0Z A;  1KT0 A;  4I6E A;  3D9L A;  4J8E A;  4XKC A;  4F3V A;  1IYG A;  1OWM A;  4Y6W A;  2VSX E;  4G25 A;  3GW4 A;  4O6F A;  2XRY A;  2V0P A;  3IHY A;  3QWP A;  1GW6 A;  3JUI A;  1H2V C;  1WM5 A;  5CCL A;  3URZ A;  5BV0 A;  5D0O D;  3AS8 A;  2BF0 X;  4HFG A;  4NAC A;  4BX8 A;  3JQ1 A;  2VYI A;  5A6C A;  2ILR A;  4GZ6 A;  2VSO E;  3FP3 A;  1JWG A;  3ZXS A;  2WXQ A;  5BNW A;  3FTU A;  4MS6 A;  4A1S A;  1PY1 A;  4DLO A;  1XNF A;  3ESK A;  2LSU A;  2UY1 A;  2GGF A;  3NZU A;  3PRZ A;  4DLQ A;  2AXZ A;  4BT8 A;  2FO7 A;  1NA0 A;  5ENN A;  3RO2 A;  1Y8M A;  2DBA A;  4DI4 A;  1INZ A;  3ZW3 A;  4HOQ A;  3UX4 A;  2R17 C;  5ARG A;  2I1J A;  3QC1 A;  4KXK B;  3TG5 A;  3RIB A;  4ANV A;  2KCL A;  3ZIM A;  3C98 A;  1ZBP A;  3ONL A;  4Q96 A;  5G2N A;  4OYS A;  4ILH B;  2RG8 A;  2BUG A;  3G2V A;  2I6H A;  5JJT A;  4U63 A;  3FH8 A;  1LF8 A;  3CGH A;  4J8S A;  4E6H A;  1IQR A;  3EIQ C;  2J4D A;  2YIN A;  5KJL A;  3D3M A;  4N2S A;  5G05 J;  5FQ6 A;  3LY7 A;  4E85 A;  1KLX A;  4JA7 A;  4BWR A;  1MHQ A;  3CHR A;  4N5C A;  4GCN A;  2X6K A;  1WAO 1;  4B89 A;  4L7T A;  3KAE A;  4XI0 A;  3JQ0 A;  4BY6 A;  1FVH A;  4LRZ A;  3U3W A;  2CG3 A;  3LVQ E;  1HG5 A;  2C0L A;  2Y4T A;  4RVB A;  3AU4 A;  3QWV A;  3B7R L;  4CGW A;  4UQZ A;  4WUY A;  5G04 C;  3HDX A;  4APF A;  3TXN A;  4GU5 A;  2XRZ A;  4U0U A;  3I5P A;  2J09 A;  5LX8 A;  4N2Q A;  5EKQ D;  2HYZ A;  4JZY A;  4WAF A;  3CKB A;  3CVL A;  2Y3A A;  4K03 A;  4HOT A;  4U07 A;  1EPU A;  2KCK A;  3NZS A;  4F53 A;  3G2U A;  3PZD A;  3MKR A;  3FUK A;  2KZT B;  4I1A A;  1UG3 A;  4XE0 A;  2X38 A;  3ASG A;  3FU6 A;  3GZ1 A;  2WXJ A;  2X6J A;  4LER A;  3BG1 B;  5AJL A;  1HU3 A;  3T5X A;  4IRU A;  2ZU6 B;  1QNF A;  3CHS A;  4I2Z A;  2WB2 A;  2WXK A;  4JL0 A;  4TRQ A;  4HS2 A;  2WXP A;  3ZN3 A;  4WWO A;  3I4R B;  4KT6 B;  2PQN A;  3ZYM A;  1UW4 B;  4CDN A;  4DPR A;  4PDX A;  1VDY A;  2GW1 A;  4J8F A;  3CQG B;  4IN3 B;  3FUE A;  4JEU A;  4U8H A;  1ELW A;  4FHJ A;  5FQ4 A;  5J90 A;  2OVF A;  4Q69 A;  4GYY A;  4P29 A;  4EPZ A;  2A4Z A;  3D9P A;  1IQU A;  3VLF A;  3PE3 A;  2KZT A;  2AXV A;  3L13 A;  2IOS A;  3QK0 A;  2OOE A;  5FQ7 A;  4CT0 A;  2CFU A;  1TJF A;  3TXM A;  4OVV A;  5BPP A;  2LSV A;  5BW8 C;  2IOL A;  4L2Y A;  3G2W A;  4EEC A;  3LEW A;  3SBS A;  1HE8 A;  4L2L A;  4NQ0 A;  2XGO A;  4BTB A;  3KD7 A;  5FZR A;  4HOS A;  3D9I A;  3CK9 A;  2LO6 A;  3PEU B;  3OXL A;  1XGW A;  3Q5M A;  3PS6 A;  2C0M A;  2UWJ G;  5C1D A;  3AS5 A;  4AIF A;  2WMO A;  2IQC A;  3PH0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...