3UT7A

Structural view of a non pfam singleton and crystal packing analysis
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
127
structure length
127
Chain Sequence
LRDLIPKHKFDNSTIDQLCKLIDNEIEPIIFDLLKWLQDYNWPIAKDILPVVVLHQSIAMPHILTILQGNDIMWKYWVIKLMIPYLIYPNKQLVKSELERLSSLEIINEDIREIVNLSKDYLHFYYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural view of a non pfam singleton and crystal packing analysis.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Unknown function
total genus 38
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2011-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16804 DUF5071 Domain of unknown function (DUF5071)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.750 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3ut7A00
3UT7A 3UT4A 3UT8A
chains in the Genus database with same CATH superfamily
1JCQA 3Q7FA 5KWDA 4FADA 3L54A 2XRZA 2AXZA 4P29A 2ETCA 4DX5D 2LXLA 1AP7A 5T8IA 1UN9A 2F37A 5EYPF 4PDXA 4AM9A 3QARA 3HVEB 1OCZE 4I9CA 3FULA 3UXGA 4GPMA 4ANVA 3DWLG 4EPZA 5FQ7A 3I4GA 4LERA 3FU3A 4EBAA 1N4QA 3TG4A 3ZU7B 2J09A 1HG5A 2BKGA 4F1SA 3TXMA 4GCNA 4B8CB 3FUKA 4HNAD 4J8FA 2A5EA 5E75A 4HXIA 5ANRA 1O1SA 2EILE 1N0QA 1K8KG 2WXGA 4EBAG 4K0RA 4ANXA 2X3MA 2OV8A 2RFAA 3EHRA 3V2OA 4LEUA 2R59A 2B6CA 4B0ZA 1OCOE 3SD5A 4JVSA 4PS3A 4IULA 3QC1A 3DEPA 3VLFA 3S7FA 2VGXB 3C5RA 3C3QA 4AXHA 3B95A 2J4BA 2OEVA 1GW6A 4BY6A 5LOZA 5C2YA 3KEZA 1G3NB 1RW2A 2QC9A 4L23A 5M72A 5LP0A 4WNGA 1JCSA 3FTYA 3SGHA 1TR4A 3SHFA 3D9KA 2JLBA 2WXJA 4ANWA 5BXUA 3Q15A 3CK8A 2KXPC 2LAHA 2P9KG 4DI3A 4AIFA 5ARGA 3RK6A 3HDXA 3RSEG 4ATZD 4GA1A 4KBQA 4CGWA 3AG1E 3T5VA 3CK9A 4HI9A 4B93B 2GRLA 1N95A 1FVFA 4DPRA 2J9QA 1OWPA 3BQOA 3JQ1A 4EZJA 5DBKA 4RG9A 3CVUA 3DEOA 1OCRE 2L6BA 2MOWA 4CT0A 4UQYA 4N2QA 1HO8A 4TUUA 5AYWD 3TWTA 3D9JA 2R02A 3ABLE 4ATGA 3CKBA 1N52A 2J07A 4AJWA 2L6JA 5AQ7A 4JB8P 3EU9A 4JZYA 4UWFA 3FTUA 3KSLA 3L16A 2H6FA 3UTMA 2WQHA 4MS6A 4DLOA 4MKTA 5EX3A 1HX8A 5G04C 3TWVA 3EUVA 3MJWA 4DK5A 4L2LA 1OWMA 2UY1B 3MKQA 3FU0A 3NZUA 1ZBPA 3CHMA 1BLXB 3SQVA 5CMWA 1TEZA 4GTSA 4AOFA 3ASDA 3NBNB 2WXPA 1NZNA 2DYSE 1NA0A 5AN8A 3PNLB 3FEXA 2A4ZA 1QBQA 4BX9A 3DPYA 5KNHD 2P9IG 3ASHA 3BG0B 4J8YA 3CHPA 4JEHA 3DPDA 4WNFA 3HG0D 4HLLA 2FI7A 1KZPA 5EILA 3MEKA 3EIQC 4GYYA 1OT8A 3JQ0A 1KPSB 3E4BA 3ESLA 2M63A 1K1AA 3I5PA 2X6IA 1JWGA 3FUDA 2IQCA 2XHEA 4B89A 2L0TB 5G04J 3DSSA 2J4DA 3ISMC 2ETBA 4DX7D 2VQ2A 4EZLA 3VTYA 4OVUA 4OVVA 3ZGQA 4RQIA 4DX6D 1JPLA 3UM3A 2FBNA 1RZ4A 4X8QA 4GZDA 1NL4A 3LXUX 3FY4A 4YNDA 4TUMA 1TNOA 4UWGA 4WNDA 5CHEE 3T5XA 1BI7B 4OYSA 3RIBA 3CIAA 1E7UA 4BETA 5E76A 4GTPA 1KT0A 4WAFA 2ZU6B 3ASOE 3ZXPA 5AQBA 4HQDA 3J5QB 3HRAA 3LKUA 4V3IA 4GTMA 4GZ6A 1A5EA 3FTZA 4UQZA 4HOUA 5ENQD 4N2SA 2A5UA 1WDYA 2NXPA 3PZ1A 3EHNA 3PEVB 3UT8A 5FZQA 4U8VD 1O5MA 2V4LA 4L2YA 3HXBA 4K5BA 2KATA 5AJLA 4EZKA 4G2VA 5JMND 1S64A 3TWUA 2LUHA 3PEUB 2WXKA 2Y4TA 3UINC 4Q96A 3VLEA 4A63B 5HQ8A 3RO2A 3J5PA 4F3VA 3C3RA 2AVPA 3FUIA 4GMRA 1E8WA 4E85A 3LY9A 4CCAA 5KJKA 2P9UG 2VSOE 1MQSA 3QOUA 5FTPA 1K1BA 2YNQA 3FUJA 2GRPB 1MX4A 3UX4A 3UI2A 3DXMG 2IJGX 2ZGGA 2P9LG 3HXFA 3RU0A 4RG6A 4JHRA 1TNBA 4I6JA 1AWCB 4RVBA 4G8KA 1H19A 2I2OA 3TWXA 5KNGA 1FVHA 3S2AA 2OEWA 1HS6A 3UUXA 1E96B 1VDYA 4C0EA 1N9AA 1O1RA 4FC8A 2WXNA 4F1PA 3E32A 4LNGA 2CHXA 3ZRHA 1NFIE 3U9WA 3MX3A 1Y6IA 3LS8A 3ZIMA 5FIOA 2OOEA 2CG3A 3GW4A 3QKYA 4I1MA 3IKOB 1Z5SC 2P9PG 2XPZA 3ONKA 2WXLA 2DIWA 3ASNE 5CBNA 2LNIA 1HE8A 3ZVVA 2EIME 3UKRG 2XCBA 3SFYA 3D9IA 1IYGA 5AENA 3ZYMA 2PM7A 5J90A 4LSZE 2J08A 3OXGA 3W9GA 2IY0C 5ENOD 4GTRA 4J8EA 4RLYA 3SY2A 3NZSA 4GA0A 2V8SE 4W9RA 2I6HA 1OWNA 2GRRB 3MKQB 4XI0A 3ZHEA 2GRQB 3FH5A 3CHSA 2ETAA 1U2VG 2Y3AA 5HS0A 2WXHA 3DSUA 3LJ3A 4JD2G 3LDZA 4ACLA 3L08A 3FU6A 4J6IA 3FUNA 3MZLB 1FCHA 4BX8A 5FT9A 3Q7AA 4A55A 3Q5MA 3CVXA 5JA4D 4HORA 1QYMA 4N3BA 2XS1A 5AAOA 4HRLA 1N54A 4C0MA 3AAAC 4U0SA 4FHKA 3Q79A 4C9BB 5FQ6A 3QDNA 3ZPJA 4GMLA 3EDTB 3ASFA 2RKKA 2FEZA 3GZSA 3BUAA 4FULA 4L9PA 4ZHBA 2GW1A 1EDUA 3APCA 4Q94A 3Q9NC 1PY1A 3UM2A 3KEAA 4G23A 3ZUVB 4AP2A 4AEZC 5BNWA 4KYOB 3RRNB 2DBAA 3NB2A 2E2EA 3Q9UC 3PREA 3S7DA 4UWHA 3B7BA 3RKVA 4N39A 2H6IA 1U3DA 1A17A 3Q47B 4YVQC 4U7EB 4HVBA 5KJMA 3I4RB 3G2VA 3QNKA 1YCSB 4HOTA 4GB9A 3Q75A 1QNFA 1JUQA 1BPOA 1K3ZD 1SQMA 4U63A 2MRIA 2VJ8A 2XGOA 3VLDA 1KLXA 5BW8C 3AG2E 1DC2A 2BTDA 1SVXA 3MKRA 2DYRE 3TWRA 3LY7A 5AQAA 2VSXE 4I1OB 2BKKB 3FP3A 4NIKA 3PE4A 2AWIA 2IU1A 2X6KA 4HBDA 2AXVA 3L9TA 4ILHB 4MRUA 2R03A 1X5BA 4JL0A 4D10C 4A3VA 3FUFA 4Z68A 3L17A 3AS8A 3GZ2A 2OVFA 3QWVA 3NOGD 1U3CA 4CZ2D 2VYIA 2H6GA 4GU5A 4AY5A 4WWPA 4I43A 3FHEA 4FLBA 3UIPC 3ULYA 3OXFA 3MA5A 1MZCA 2GGFA 4K03A 3PH0C 2XPYA 5CERB 3QWWA 4YDOA 4WUYA 3EIJA 3ESKA 2CFZA 1EYHA 4XE0A 5BXOA 5D0OD 2JEKA 3ZYQA 4FA6A 4DRXE 3IHYA 3NOCD 2YINA 3HIZA 4ILGA 3QJZA 2WB2A 1BI8B 4GPKA 4U95D 3EHMA 4JA9A 2HO1A 4CDMA 4CT4A 4N5CA 1H6KA 1WAO1 3CVNA 5H7PA 5KBAA 2H6HA 2GRMA 3OXLA 5ENPD 4FJYA 1EF1C 3KSQA 3G2SA 2ZGDA 3B7RL 2HM8A 3ENEA 2WM9A 3UQ3A 3JCKC 3FU5A 1SZAA 3CVVA 2HYZA 3Q49B 3SNXA 5CEAA 4KVOA 4J8SA 2WQ7A 1LD7A 3SO8A 4JHKA 2IO2C 1ZB1A 4UI9C 4QQIA 3APDA 3EU5A 3G2WA 2XZTG 3ZHEB 3D3MA 2X6FA 2WMNA 4DX1A 2PM6A 4NRHB 4PS8A 1IQRA 2CG2A 4N3CA 2QZAA 3AS4A 4O1OA 1TYQG 3UT4A 1OY3D 4B8AA 1JWFA 2F8XK 1HFAA 3P2BA 3URZA 2PQRA 1B89A 3V2XA 3T8MA 1ELRA 4XKCA 3EJNA 4GZ3A 2NYJA 4APFA 5JJ7A 1SA4A 1H6PA 2GROB 1MHQA 1X81A 5A23A 4FHJA 3RJVA 4UI9J 3DRAA 2R5SA 3NQPA 4CYMD 4F6RD 2XEVA 5ENSD 4LNBA 3X2QE 1UJKA 3ULQA 3ONLA 2KCKA 3IV0A 5BPPA 2HE0A 2WXOA 3MV3B 2C2LA 3NF1A 2DCPA 3PUJA 4HRNA 5ARFA 3TXNA 3L22A 4BTBA 1KT1A 3AG3E 2P58C 4G1TA 4APOA 4GAAA 2F0YA 3CQCB 4FJZA 1TJCA 2WVIA 3DXKG 3ZXSA 5ENTD 2EIKE 5B1AE 3PNTB 3IEGA 4GZ5A 3S7JA 5EYLA 4KXKB 3W9FA 1OCCE 5JHBA 4BT9A 3HYMB 4XI9A 2E0IA 4Q69A 2LXMA 4CDNA 3ZN3A 5EKQD 4I1AA 3CEQA 3TG5A 3UIOC 3ULEG 2VGYA 3HXDA 2RFMA 2CHWA 3C98A 3TWQA 2VSNA 3JUIA 1UW4B 3U66A 2XS8A 4K5AB 5ITZF 3MCXA 4K5CA 3FUEA 1MX6A 1E8ZA 1H6OA 4BSXA 1Y8MA 4DLQA 3DSXA 3AG4E 4KT6B 3ZYLA 3IHVA 4PUCA 2I1KA 2WPVA 1LF8A 3LVRE 3ABKE 3TWSA 3E34A 3CKCA 4DJAA 2KCVA 4GYOA 4U8YD 4UUCA 2YHCA 3HXCA 1TNZA 4GTQA 3QAQA 3SI5A 1E7VA 5G05J 1NP7A 4Y6CA 3MYVA 4J8DA 4LUNU 4HRMB 3PZ2A 3O4ZA 4TXQA 4ILIA 4BESA 4GTTA 4I2ZA 5CCLA 3BU8A 3PZ3A 3Q73A 4JHJA 4J0UA 4E6HA 2ZISA 5ENRD 2P9NG 3CHQA 5CRUA 3SBSA 2I9CA 1MX2A 2KC7A 1NA3A 2FF4A 1OXJA 3CHRA 1QZ2A 3CVPA 3FH7A 1YMPA 5FZSA 4G25A 2QYUA 1V55E 3FTXA 3CVYA 2CHZA 1TNUA 4BERA 4FU3A 2XZDG 4ANUA 1O1TA 3LY8A 3D9HA 4XZ4A 3D9MA 3FTVA 4DUIA 4GZCA 1BD8A 3HXEA 4H7YA 4U0ZA 3FUMA 5AJDA 1WG0A 1JCRA 1OWOA 4GTVA 4H7XA 2XEEA 3ABME 5CBOA 3V79K 4U07A 3U64A 3BEEA 2V5FA 2IOSA 3E30A 4CEMA 3JUEA 1HG2A 2EIJE 3D9OA 4ABNA 3U3WA 4JW1A 3SF4A 2ILRA 4N5QA 4I17A 3DBSA 5LCWC 3CVQA 4U0UA 2PL2A 4YDEA 2X6HA 3R7QA 5LFAA 1L5JA 4O60A 2Y1LE 4GA2A 4A1SA 3CV0A 2X38A 1N94A 2P9SG 4WNEA 2WMOA 3OAWA 1ELKA 1H2VC 1XNFA 2UWJG 4U96D 1IXVA 2R2LA 3ML9A 2EQXA 2IF4A 2XRYA 1PAQA 4NACA 4BWRA 2DZOA 5JHAA 3WXXA 3T9KA 2C0MA 4O6FA 1YA0A 1QQEA 1S0PA 2WXRA 5AIJA 3MGBA 4HB5A 5A6CA 4EQFA 4LCTA 4GCOA 5LCWJ 3FFLA 5CCMA 1TNYA 3JXJA 1KZOA 2KZTA 2XQ0A 2NSZA 3RAUA 4ZFHA 1OUVA 2J49A 3ASGA 1IHBA 5G55A 2BUGA 3TAXA 3V31A 4XIFA 3SFXA 4LG6A 2YHEA 3PDNA 4CDRA 5C1DA 2LAIA 3CVWA 3FTSA 3CGHA 1UOHA 2IOLA 2PZIA 2RD0A 2ONDA 4G26A 3Q4AB 4GYWA 4I6EA 3FTWA 4KZ0A 4HOQA 1D8DA 3TJPA 3PS6A 4L1BA 2L0IA 5D2MC 4EECA 1H0AA 3ZNGA 4L7TA 1IHGA 3NAWA 5CEDB 4J7WA 4UQXA 3QK0A 3SZ7A 3CK7A 1N4RA 3LVQE 3Q78A 3CSTA 2Y69E 1YYHA 2Y0BG 3AU4A 4DX2A 4O1PA 1WM5A 4HLEA 3U4TA 2MYOA 3TL5A 4MBGA 3E37A 4UI9K 2C0LA 4JXTA 3G2TA 3RRUA 2IFUA 4HS2A 5HKPA 2Y4UA 1W3BA 2RG8A 2AJAA 3VTXA 2VTBA 3R9AB 4U04A 2BEDA 3B7TA 3CVLA 2XPIA 5CECB 4G8LA 2XGSA 5EIBE 4YDWA 3RRMB 1OWLA 4IN3B 2JABA 2PQNA 5J08A 4TXPA 1Z3XA 1N4SA 5FZRA 1E90A 4CRWA 5DIZA 1S70B 1TN8A 4XKBA 4I6GA 2V4HC 3EHQA 2EINE 4HI8A 2KCLA 2XCCA 2X6JA 1LD8A 3PZDA 3DSTA 2V0PA 5BT1A 1P5QA 3PE3A 4G24A 3CSFA 2IONA 2LO6A 5AQ9A 4G11A 4JA7A 3LJNA 4BSZB 2F8YA 3AS5A 4URKA 3FH8A 3L82A 1SA5A 2PNNA 1D8EA 2KBXA 2WXFA 4F7AA 3KD7A 1TN7A 2HR2A 5A7DB 4HOSA 4U8HA 5JJTA 5ANLA 1DVPA 4MLPA 1SZ9A 5KJLA 3KAEA 4DI4A 3PUKA 3ZW3A 1DCQA 4A1GA 5CMYA 3RO3A 3N71A 5EDSA 1INZA 2LSVA 2B0OE 1TN6A 2ZXWE 4FP7A 3B7UX 3ML8A 5FQ4A 2OCCE 2ZIRA 4F53A 1V54E 2AXUA 3WG7E 1IKND 2CFUA 4PS7A 1E8YA 5EIDA 1FT2A 3LYAA 3UPVA 3LCAA 3BG1B 1TJFA 4RSYA 1HU3A 4I2WA 2XGMA 4JC8A 5IY5E 1DNPA 1UJJA 4C48B 2R17C 3ZFWA 5BV1A 2XEHA 1ZU2A 3K9IA 4AY6A 4AVXA 4IRUA 4R7LA 1Z6TA 3LEWA 2DVWA 5ENNA 2QFCA 2Q7FA 4Y6WA 1DCEA 4EHMA 3HVEA 2LSUA 4PH4B 2WXMA 3QWPA 5T4YA 2DWZA 1HH8A 4YDYA 5D66A 2OVBA 3P1UA 2KZTB 3FEYA 1FT1A 1UN8A 1S63A 3PRZA 2VSYA 3CHOA 3T8KA 4OAUC 4ME2A 4FLHA 5FJYA 5CRVA 5FQ8A 4B94A 1N4PA 3C3OA 2GRNB 4XEIG 3D9LA 3HHMA 3TGOA 4YVOA 1HF8A 4JPSA 2DZNA 4NURA 2AW6A 3I3NA 4M7CA 4LRZA 3FUHA 5G05C 1Q2ZA 4AV7A 3GYZA 3CR3A 4BFRA 3CLJA 4GTOA 2VGXA 3FWVA 1BU9A 3E33A 5KCMA 2FO7A 3S7BA 1H2TC 4LNUD 2J8SD 3IXEA 4KMOA 4KZCA 1LTXA 5LX8A 3O48A 3AJIA 2I1JA 3SFZA 2V5QC 4BT8A 3GZ1A 3TWWA 4I9EA 4JEUA 3APFA 4TXRA 1PC2A 2R05A 3B7SA 5FWQA 5JJ6A 2WQ6A 4TV3A 3JYSA 5EN5D 3KS2A 1Z3YA 2L9BA 2VTBB 3L13A 4CGVA 2MHKA 3ZKJA 1NI1A 3R9MA 5HI7A 1MJ0A 2FO1E 3MV2B 3LPZA 3UMVA 4QFVA 3D9PA 1ELWA 4BEPA 2IO3C 3ZEFA 3G2UA 4UWLA 3UM0A 4GMJA 4M3OA 2FULA 2VGEA 1SW6A 3D9NA 3QB2A 3JXIA 5B1BE 3UKUG 1HZ4A 3R7RA 3L6AA 3DSVA 2XENA 3FDHA 5EX0A 5D0QD 1FPPA 2IEJA 4ACKA 3DSWA 3UT7A 4HFGA 3ZYKA 3B13A 2BF0X 3F6QA 4KVMA 2WXIA 5AARA 1EPUA 1WY6A 3AU5A 2P2CP 2NC9A 4BTAA 2QY7A 1IQUA 4OAVB 4N3AA 5KJNA 3UM1A 2YQ8A 1UG3A 1E8XA 2UY1A 2KM4A 4NQ0A 4IYPA 3V30A 5BV0A 1MYOA 3SBTB 3IBEA 1H2UA 1HXIA 1N0RA 1D9SA 1XGWA 4XX5A 3PVLA 2QYJA 4A3TA 5HRYA 5FINA 4UWKA 3C72A 4TRQA 1N11A 4WWNA 2WXQA 3PZ4A 5T3RA 5B3SE 4WWOA 3CQGB 5G2NA 5BUZA 3OTNA
chains in the Genus database with same CATH topology
4I6JA 3VTXA 4XKCA 4RVBA 2VTBA 3R9AB 4FADA 4U04A 3B7TA 3L54A 3CVLA 2XRZA 2AXZA 2XPIA 1H19A 3EJNA 2I2OA 4GZ3A 3S2AA 1FVHA 4APFA 5JJ7A 4P29A 1HS6A 3UUXA 1E96B 2XGSA 1MHQA 4CDRA 1VDYA 5A23A 4FHJA 3RRMB 4C0EA 1OWLA 3RJVA 4FC8A 2WXNA 4IN3B 4UI9J 2PQNA 2R5SA 5T8IA 5J08A 1UN9A 2CHXA 4PDXA 1Z3XA 3NQPA 4AM9A 3ZRHA 5FZRA 1E90A 4CRWA 2XEVA 3U9WA 3MX3A 3QARA 3HVEB 1UJKA 1Y6IA 3LS8A 5DIZA 4I9CA 3ONLA 3ULQA 2KCKA 3FULA 3IV0A 3ZIMA 2OOEA 2CG3A 2WXOA 5BPPA 3MV3B 2C2LA 3NF1A 4XKBA 2DCPA 4I6GA 3PUJA 5ARFA 3GW4A 3TXNA 2KCLA 3L22A 4BTBA 2XCCA 2X6JA 1KT1A 4ANVA 3QKYA 3PZDA 4EPZA 2P58C 5FQ7A 4I1MA 3IKOB 2V0PA 3I4GA 5BT1A 1P5QA 2XPZA 3ONKA 4G1TA 4LERA 2WXLA 2DIWA 3FU3A 4APOA 4GAAA 4EBAA 3PE3A 4G24A 3CQCB 4FJZA 3TG4A 1TJCA 2LNIA 1HE8A 2J09A 1HG5A 2WVIA 3ZVVA 3CSFA 3ZXSA 2IONA 4F1SA 2LO6A 3TXMA 3PNTB 4G11A 4GCNA 3IEGA 2XCBA 4GZ5A 3S7JA 3FUKA 4JA7A 4B8CB 3D9IA 1IYGA 4KXKB 4J8FA 5E75A 4HXIA 5JHBA 5ANRA 4BT9A 3AS5A 4URKA 3FH8A 5AENA 3HYMB 3ZYMA 4XI9A 2E0IA 2WXGA 2PM7A 4EBAG 4K0RA 4Q69A 4ANXA 5J90A 2X3MA 2OV8A 4CDNA 3ZN3A 5EKQD 2J08A 4I1AA 3OXGA 2WXFA 3CEQA 4F7AA 3KD7A 4J8EA 3TG5A 2HR2A 5A7DB 4HOSA 4U8HA 2VGYA 4LEUA 2R59A 2CHWA 4B0ZA 5JJTA 3SD5A 3NZSA 4JVSA 4GA0A 4PS3A 2V8SE 4IULA 4W9RA 3QC1A 2I6HA 3C98A 1OWNA 3VLFA 5ANLA 3S7FA 1DVPA 4MLPA 1SZ9A 2VGXB 5KJLA 3KAEA 3MKQB 4XI0A 3ZHEA 4AXHA 2J4BA 2VSNA 4DI4A 3PUKA 1GW6A 3FH5A 3CHSA 3JUIA 4BY6A 5LOZA 1UW4B 2Y3AA 3ZW3A 3U66A 2WXHA 5C2YA 4A1GA 5CMYA 3LJ3A 3KEZA 3RO3A 3N71A 5EDSA 3MCXA 3FUEA 1INZA 4L23A 2LSVA 3LDZA 4ACLA 1E8ZA 3L08A 3FU6A 4FP7A 4J6IA 3FUNA 5LP0A 3B7UX 5M72A 4BSXA 1Y8MA 3ML8A 3MZLB 5FQ4A 4WNGA 1FCHA 4DLQA 4F53A 2AXUA 3FTYA 5FT9A 4BX8A 3SGHA 4KT6B 3SHFA 2CFUA 4PS7A 3ZYLA 3IHVA 1E8YA 3Q5MA 2I1KA 2WPVA 3D9KA 4PUCA 2JLBA 1LF8A 3CVXA 3LVRE 4HORA 2WXJA 4N3BA 3CKCA 3LYAA 2KCVA 4DJAA 4ANWA 4GYOA 3UPVA 1N54A 3LCAA 4C0MA 3BG1B 2YHCA 1TJFA 4RSYA 4U0SA 3Q15A 4FHKA 3CK8A 1HU3A 4I2WA 2XGMA 4JC8A 3QAQA 5FQ6A 2LAHA 4C9BB 1DNPA 1UJJA 3QDNA 3SI5A 4DI3A 4AIFA 1E7VA 5ARGA 3RK6A 3ZPJA 3HDXA 2R17C 4GMLA 5G05J 3ZFWA 5BV1A 4GA1A 1NP7A 1ZU2A 4KBQA 3K9IA 3EDTB 4AY6A 3ASFA 4CGWA 4AVXA 4Y6CA 3MYVA 4J8DA 4IRUA 2FEZA 3T5VA 3CK9A 4LUNU 1Z6TA 4R7LA 3LEWA 3O4ZA 4ILIA 3GZSA 5ENNA 4FULA 2GRLA 2QFCA 2Q7FA 1FVFA 4DPRA 2J9QA 4Y6WA 1OWPA 4I2ZA 2GW1A 1EDUA 3APCA 3HVEA 3JQ1A 4Q94A 5CCLA 4EZJA 5DBKA 1PY1A 4RG9A 4JHJA 2LSUA 4J0UA 4E6HA 4G23A 4PH4B 4AP2A 3CVUA 2WXMA 4AEZC 5BNWA 3QWPA 4KYOB 3CHQA 5T4YA 2I9CA 3SBSA 2MOWA 3RRNB 2KC7A 2DBAA 4CT0A 1HH8A 4UQYA 1NA3A 2FF4A 4N2QA 2OVBA 1HO8A 3P1UA 2E2EA 3CHRA 2KZTB 1QZ2A 4TUUA 3CVPA 5AYWD 3FEYA 3FH7A 3PREA 4A55A 3S7DA 4UWHA 3D9JA 3RKVA 4ATGA 1UN8A 3PRZA 4N39A 2VSYA 1U3DA 1A17A 5FZSA 3CKBA 1N52A 3CHOA 3Q47B 4G25A 4YVQC 2J07A 4AJWA 3FTXA 3CVYA 2L6JA 2CHZA 4HVBA 5KJMA 4ME2A 4FLHA 3I4RB 3G2VA 5FJYA 5FQ8A 4B94A 4FU3A 3QNKA 4ANUA 4JZYA 4UWFA 3FTUA 3LY8A 3D9LA 3L16A 3HHMA 3TGOA 4HOTA 4YVOA 1HF8A 4JPSA 2WQHA 4XZ4A 4NURA 3D9MA 2AW6A 3FTVA 4GB9A 1QNFA 4GZCA 4MS6A 3I3NA 4H7YA 5G05C 4LRZA 1JUQA 3FUHA 4DLOA 1BPOA 4U0ZA 1SQMA 3FUMA 4MKTA 5EX3A 5AJDA 1HX8A 4AV7A 1OWOA 3GYZA 3CR3A 4U63A 4H7XA 5G04C 3MJWA 4DK5A 4BFRA 2MRIA 2VJ8A 2XGOA 3CLJA 4L2LA 2VGXA 3FWVA 1OWMA 4U07A 2UY1B 3VLDA 3U64A 3MKQA 1KLXA 5BW8C 5KCMA 3BEEA 3FU0A 2V5FA 3NZUA 2FO7A 2IOSA 1H2TC 3S7BA 2BTDA 4CEMA 1ZBPA 1HG2A 3MKRA 3CHMA 4KMOA 4KZCA 3D9OA 5CMWA 1TEZA 3LY7A 4ABNA 4AOFA 3ASDA 3U3WA 4JW1A 3SF4A 2VSXE 5LX8A 4I1OB 2ILRA 4I17A 2WXPA 1NZNA 3O48A 1NA0A 2I1JA 3FP3A 3PNLB 3DBSA 3FEXA 3SFZA 2A4ZA 5LCWC 3CVQA 3PE4A 4U0UA 4BT8A 2PL2A 4BX9A 2X6HA 3GZ1A 3R7QA 5LFAA 1L5JA 4I9EA 2AWIA 2IU1A 3ASHA 3BG0B 4JEUA 2X6KA 3CHPA 4JEHA 3APFA 2AXVA 3DPDA 4WNFA 4GA2A 1PC2A 2FI7A 4A1SA 4ILHB 3CV0A 2X38A 3B7SA 4MRUA 5FWQA 5JJ6A 3MEKA 4JL0A 1X5BA 3EIQC 4D10C 4GYYA 4A3VA 2WQ6A 4WNEA 3JQ0A 4TV3A 3ESLA 3E4BA 2M63A 3FUFA 3JYSA 3KS2A 3I5PA 2X6IA 1Z3YA 3L17A 1JWGA 3AS8A 2IQCA 2WMOA 2XHEA 2OVFA 1ELKA 2L9BA 3FUDA 3GZ2A 3OAWA 2L0TB 3QWVA 1H2VC 3L13A 1XNFA 4B89A 4CGVA 2VTBB 2MHKA 2UWJG 5G04J 2J4DA 2VQ2A 1U3CA 5HI7A 4EZLA 3MV2B 2VYIA 3LPZA 3VTYA 4GU5A 3ML9A 4OVVA 2EQXA 4OVUA 2IF4A 4WWPA 4AY5A 4I43A 3FHEA 4FLBA 3UMVA 2XRYA 3ZGQA 1PAQA 4NACA 3OXFA 4QFVA 3D9PA 1ELWA 3MA5A 4BWRA 1JPLA 3ZEFA 5JHAA 2GGFA 4K03A 2FBNA 3PH0C 4GZDA 3G2UA 3WXXA 2XPYA 3LXUX 2C0MA 4UWLA 4GMJA 4M3OA 3QWWA 2FULA 4O6FA 1YA0A 4WUYA 1QQEA 3FY4A 4YNDA 1S0PA 2WXRA 5AIJA 3D9NA 3QB2A 3EIJA 4UWGA 4WNDA 3ESKA 5CHEE 3T5XA 3MGBA 4OYSA 4EQFA 2CFZA 5A6CA 1EYHA 4LCTA 4GCOA 4XE0A 3RIBA 3CIAA 1E7UA 5LCWJ 3FFLA 5D0OD 5CCMA 2JEKA 5E76A 2KZTA 1HZ4A 2XQ0A 3ZYQA 3R7RA 3L6AA 1KT0A 4FA6A 4WAFA 2ZU6B 3IHYA 2NSZA 2YINA 3HIZA 4ILGA 3QJZA 2WB2A 1OUVA 2J49A 3ASGA 3FDHA 5EX0A 5D0QD 3LKUA 4GPKA 5G55A 4V3IA 2BUGA 3TAXA 3EHMA 4GZ6A 4JA9A 4ACKA 2HO1A 4XIFA 4CDMA 4CT4A 3FTZA 4HFGA 2YHEA 3PDNA 4HOUA 4UQZA 3UT7A 4N5CA 3ZYKA 1H6KA 1WAO1 3B13A 3CVNA 2BF0X 5C1DA 4KVMA 2WXIA 2GRMA 2LAIA 3OXLA 3CVWA 3FTSA 3CGHA 4N2SA 1EPUA 2A5UA 2NXPA 2IOLA 3EHNA 4FJYA 2PZIA 2RD0A 1WY6A 2ONDA 3AU5A 3PEVB 1EF1C 4G26A 3Q4AB 2NC9A 4GYWA 3UT8A 3G2SA 4I6EA 5FZQA 2QY7A 4BTAA 4HLEA 3FTWA 1IQUA 4KZ0A 3B7RL 4HOQA 2HM8A 4N3AA 5KJNA 2V4LA 3PS6A 4L2YA 4L1BA 3ENEA 3TJPA 2L0IA 4EECA 5AJLA 2KATA 1H0AA 2YQ8A 2WM9A 3UQ3A 3CVVA 1UG3A 4L7TA 4EZKA 3JCKC 1IHGA 1E8XA 4G2VA 3FU5A 1SZAA 2UY1A 2KM4A 2HYZA 3PEUB 3QK0A 4NQ0A 2WXKA 3Q49B 2Y4TA 4IYPA 4UQXA 3CK7A 3SNXA 3SZ7A 4KVOA 4Q96A 4J8SA 3VLEA 5BV0A 2WQ7A 4JHKA 3SBTB 3IBEA 5HQ8A 1H2UA 4UI9C 3RO2A 1HXIA 3LVQE 3CSTA 4F3VA 3APDA 3G2WA 1XGWA 2AVPA 4XX5A 3ZHEB 3D3MA 3FUIA 1E8WA 2X6FA 3AU4A 2WMNA 3PVLA 4E85A 3LY9A 4A3TA 2PM6A 4NRHB 1WM5A 4CCAA 5KJKA 4PS8A 1IQRA 2CG2A 2VSOE 4N3CA 1MQSA 3QOUA 4UWKA 3U4TA 3AS4A 4TRQA 3TL5A 5FTPA 3UT4A 2YNQA 3FUJA 4B8AA 1JWFA 4UI9K 3UX4A 2C0LA 1HFAA 3P2BA 2PQRA 4JXTA 4WWNA 3G2TA 1B89A 2IFUA 3RRUA 4HS2A 3URZA 2IJGX 2WXQA 5T3RA 4WWOA 3CQGB 2Y4UA 1W3BA 2RG8A 5G2NA 3RU0A 3T8MA 5BUZA 4RG6A 1ELRA 4JHRA 3OTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UT7 A;  3UT4 A;  3UT8 A; 
#chains in the Genus database with same CATH topology
 1JCQ A;  3Q7F A;  5KWD A;  4FAD A;  3L54 A;  2XRZ A;  2AXZ A;  4P29 A;  2ETC A;  4DX5 D;  2LXL A;  1AP7 A;  5T8I A;  1UN9 A;  2F37 A;  5EYP F;  4PDX A;  4AM9 A;  3QAR A;  3HVE B;  1OCZ E;  4I9C A;  3FUL A;  3UXG A;  4GPM A;  4ANV A;  3DWL G;  4EPZ A;  5FQ7 A;  3I4G A;  4LER A;  3FU3 A;  4EBA A;  1N4Q A;  3TG4 A;  3ZU7 B;  2J09 A;  1HG5 A;  2BKG A;  4F1S A;  3TXM A;  4GCN A;  4B8C B;  3FUK A;  4HNA D;  4J8F A;  2A5E A;  5E75 A;  4HXI A;  5ANR A;  1O1S A;  2EIL E;  1N0Q A;  1K8K G;  2WXG A;  4EBA G;  4K0R A;  4ANX A;  2X3M A;  2OV8 A;  2RFA A;  3EHR A;  3V2O A;  4LEU A;  2R59 A;  2B6C A;  4B0Z A;  1OCO E;  3SD5 A;  4JVS A;  4PS3 A;  4IUL A;  3QC1 A;  3DEP A;  3VLF A;  3S7F A;  2VGX B;  3C5R A;  3C3Q A;  4AXH A;  3B95 A;  2J4B A;  2OEV A;  1GW6 A;  4BY6 A;  5LOZ A;  5C2Y A;  3KEZ A;  1G3N B;  1RW2 A;  2QC9 A;  4L23 A;  5M72 A;  5LP0 A;  4WNG A;  1JCS A;  3FTY A;  3SGH A;  1TR4 A;  3SHF A;  3D9K A;  2JLB A;  2WXJ A;  4ANW A;  5BXU A;  3Q15 A;  3CK8 A;  2KXP C;  2LAH A;  2P9K G;  4DI3 A;  4AIF A;  5ARG A;  3RK6 A;  3HDX A;  3RSE G;  4ATZ D;  4GA1 A;  4KBQ A;  4CGW A;  3AG1 E;  3T5V A;  3CK9 A;  4HI9 A;  4B93 B;  2GRL A;  1N95 A;  1FVF A;  4DPR A;  2J9Q A;  1OWP A;  3BQO A;  3JQ1 A;  4EZJ A;  5DBK A;  4RG9 A;  3CVU A;  3DEO A;  1OCR E;  2L6B A;  2MOW A;  4CT0 A;  4UQY A;  4N2Q A;  1HO8 A;  4TUU A;  5AYW D;  3TWT A;  3D9J A;  2R02 A;  3ABL E;  4ATG A;  3CKB A;  1N52 A;  2J07 A;  4AJW A;  2L6J A;  5AQ7 A;  4JB8 P;  3EU9 A;  4JZY A;  4UWF A;  3FTU A;  3KSL A;  3L16 A;  2H6F A;  3UTM A;  2WQH A;  4MS6 A;  4DLO A;  4MKT A;  5EX3 A;  1HX8 A;  5G04 C;  3TWV A;  3EUV A;  3MJW A;  4DK5 A;  4L2L A;  1OWM A;  2UY1 B;  3MKQ A;  3FU0 A;  3NZU A;  1ZBP A;  3CHM A;  1BLX B;  3SQV A;  5CMW A;  1TEZ A;  4GTS A;  4AOF A;  3ASD A;  3NBN B;  2WXP A;  1NZN A;  2DYS E;  1NA0 A;  5AN8 A;  3PNL B;  3FEX A;  2A4Z A;  1QBQ A;  4BX9 A;  3DPY A;  5KNH D;  2P9I G;  3ASH A;  3BG0 B;  4J8Y A;  3CHP A;  4JEH A;  3DPD A;  4WNF A;  3HG0 D;  4HLL A;  2FI7 A;  1KZP A;  5EIL A;  3MEK A;  3EIQ C;  4GYY A;  1OT8 A;  3JQ0 A;  1KPS B;  3E4B A;  3ESL A;  2M63 A;  1K1A A;  3I5P A;  2X6I A;  1JWG A;  3FUD A;  2IQC A;  2XHE A;  4B89 A;  2L0T B;  5G04 J;  3DSS A;  2J4D A;  3ISM C;  2ETB A;  4DX7 D;  2VQ2 A;  4EZL A;  3VTY A;  4OVU A;  4OVV A;  3ZGQ A;  4RQI A;  4DX6 D;  1JPL A;  3UM3 A;  2FBN A;  1RZ4 A;  4X8Q A;  4GZD A;  1NL4 A;  3LXU X;  3FY4 A;  4YND A;  4TUM A;  1TNO A;  4UWG A;  4WND A;  5CHE E;  3T5X A;  1BI7 B;  4OYS A;  3RIB A;  3CIA A;  1E7U A;  4BET A;  5E76 A;  4GTP A;  1KT0 A;  4WAF A;  2ZU6 B;  3ASO E;  3ZXP A;  5AQB A;  4HQD A;  3J5Q B;  3HRA A;  3LKU A;  4V3I A;  4GTM A;  4GZ6 A;  1A5E A;  3FTZ A;  4UQZ A;  4HOU A;  5ENQ D;  4N2S A;  2A5U A;  1WDY A;  2NXP A;  3PZ1 A;  3EHN A;  3PEV B;  3UT8 A;  5FZQ A;  4U8V D;  1O5M A;  2V4L A;  4L2Y A;  3HXB A;  4K5B A;  2KAT A;  5AJL A;  4EZK A;  4G2V A;  5JMN D;  1S64 A;  3TWU A;  2LUH A;  3PEU B;  2WXK A;  2Y4T A;  3UIN C;  4Q96 A;  3VLE A;  4A63 B;  5HQ8 A;  3RO2 A;  3J5P A;  4F3V A;  3C3R A;  2AVP A;  3FUI A;  4GMR A;  1E8W A;  4E85 A;  3LY9 A;  4CCA A;  5KJK A;  2P9U G;  2VSO E;  1MQS A;  3QOU A;  5FTP A;  1K1B A;  2YNQ A;  3FUJ A;  2GRP B;  1MX4 A;  3UX4 A;  3UI2 A;  3DXM G;  2IJG X;  2ZGG A;  2P9L G;  3HXF A;  3RU0 A;  4RG6 A;  4JHR A;  1TNB A;  4I6J A;  1AWC B;  4RVB A;  4G8K A;  1H19 A;  2I2O A;  3TWX A;  5KNG A;  1FVH A;  3S2A A;  2OEW A;  1HS6 A;  3UUX A;  1E96 B;  1VDY A;  4C0E A;  1N9A A;  1O1R A;  4FC8 A;  2WXN A;  4F1P A;  3E32 A;  4LNG A;  2CHX A;  3ZRH A;  1NFI E;  3U9W A;  3MX3 A;  1Y6I A;  3LS8 A;  3ZIM A;  5FIO A;  2OOE A;  2CG3 A;  3GW4 A;  3QKY A;  4I1M A;  3IKO B;  1Z5S C;  2P9P G;  2XPZ A;  3ONK A;  2WXL A;  2DIW A;  3ASN E;  5CBN A;  2LNI A;  1HE8 A;  3ZVV A;  2EIM E;  3UKR G;  2XCB A;  3SFY A;  3D9I A;  1IYG A;  5AEN A;  3ZYM A;  2PM7 A;  5J90 A;  4LSZ E;  2J08 A;  3OXG A;  3W9G A;  2IY0 C;  5ENO D;  4GTR A;  4J8E A;  4RLY A;  3SY2 A;  3NZS A;  4GA0 A;  2V8S E;  4W9R A;  2I6H A;  1OWN A;  2GRR B;  3MKQ B;  4XI0 A;  3ZHE A;  2GRQ B;  3FH5 A;  3CHS A;  2ETA A;  1U2V G;  2Y3A A;  5HS0 A;  2WXH A;  3DSU A;  3LJ3 A;  4JD2 G;  3LDZ A;  4ACL A;  3L08 A;  3FU6 A;  4J6I A;  3FUN A;  3MZL B;  1FCH A;  4BX8 A;  5FT9 A;  3Q7A A;  4A55 A;  3Q5M A;  3CVX A;  5JA4 D;  4HOR A;  1QYM A;  4N3B A;  2XS1 A;  5AAO A;  4HRL A;  1N54 A;  4C0M A;  3AAA C;  4U0S A;  4FHK A;  3Q79 A;  4C9B B;  5FQ6 A;  3QDN A;  3ZPJ A;  4GML A;  3EDT B;  3ASF A;  2RKK A;  2FEZ A;  3GZS A;  3BUA A;  4FUL A;  4L9P A;  4ZHB A;  2GW1 A;  1EDU A;  3APC A;  4Q94 A;  3Q9N C;  1PY1 A;  3UM2 A;  3KEA A;  4G23 A;  3ZUV B;  4AP2 A;  4AEZ C;  5BNW A;  4KYO B;  3RRN B;  2DBA A;  3NB2 A;  2E2E A;  3Q9U C;  3PRE A;  3S7D A;  4UWH A;  3B7B A;  3RKV A;  4N39 A;  2H6I A;  1U3D A;  1A17 A;  3Q47 B;  4YVQ C;  4U7E B;  4HVB A;  5KJM A;  3I4R B;  3G2V A;  3QNK A;  1YCS B;  4HOT A;  4GB9 A;  3Q75 A;  1QNF A;  1JUQ A;  1BPO A;  1K3Z D;  1SQM A;  4U63 A;  2MRI A;  2VJ8 A;  2XGO A;  3VLD A;  1KLX A;  5BW8 C;  3AG2 E;  1DC2 A;  2BTD A;  1SVX A;  3MKR A;  2DYR E;  3TWR A;  3LY7 A;  5AQA A;  2VSX E;  4I1O B;  2BKK B;  3FP3 A;  4NIK A;  3PE4 A;  2AWI A;  2IU1 A;  2X6K A;  4HBD A;  2AXV A;  3L9T A;  4ILH B;  4MRU A;  2R03 A;  1X5B A;  4JL0 A;  4D10 C;  4A3V A;  3FUF A;  4Z68 A;  3L17 A;  3AS8 A;  3GZ2 A;  2OVF A;  3QWV A;  3NOG D;  1U3C A;  4CZ2 D;  2VYI A;  2H6G A;  4GU5 A;  4AY5 A;  4WWP A;  4I43 A;  3FHE A;  4FLB A;  3UIP C;  3ULY A;  3OXF A;  3MA5 A;  1MZC A;  2GGF A;  4K03 A;  3PH0 C;  2XPY A;  5CER B;  3QWW A;  4YDO A;  4WUY A;  3EIJ A;  3ESK A;  2CFZ A;  1EYH A;  4XE0 A;  5BXO A;  5D0O D;  2JEK A;  3ZYQ A;  4FA6 A;  4DRX E;  3IHY A;  3NOC D;  2YIN A;  3HIZ A;  4ILG A;  3QJZ A;  2WB2 A;  1BI8 B;  4GPK A;  4U95 D;  3EHM A;  4JA9 A;  2HO1 A;  4CDM A;  4CT4 A;  4N5C A;  1H6K A;  1WAO 1;  3CVN A;  5H7P A;  5KBA A;  2H6H A;  2GRM A;  3OXL A;  5ENP D;  4FJY A;  1EF1 C;  3KSQ A;  3G2S A;  2ZGD A;  3B7R L;  2HM8 A;  3ENE A;  2WM9 A;  3UQ3 A;  3JCK C;  3FU5 A;  1SZA A;  3CVV A;  2HYZ A;  3Q49 B;  3SNX A;  5CEA A;  4KVO A;  4J8S A;  2WQ7 A;  1LD7 A;  3SO8 A;  4JHK A;  2IO2 C;  1ZB1 A;  4UI9 C;  4QQI A;  3APD A;  3EU5 A;  3G2W A;  2XZT G;  3ZHE B;  3D3M A;  2X6F A;  2WMN A;  4DX1 A;  2PM6 A;  4NRH B;  4PS8 A;  1IQR A;  2CG2 A;  4N3C A;  2QZA A;  3AS4 A;  4O1O A;  1TYQ G;  3UT4 A;  1OY3 D;  4B8A A;  1JWF A;  2F8X K;  1HFA A;  3P2B A;  3URZ A;  2PQR A;  1B89 A;  3V2X A;  3T8M A;  1ELR A;  4XKC A;  3EJN A;  4GZ3 A;  2NYJ A;  4APF A;  5JJ7 A;  1SA4 A;  1H6P A;  2GRO B;  1MHQ A;  1X81 A;  5A23 A;  4FHJ A;  3RJV A;  4UI9 J;  3DRA A;  2R5S A;  3NQP A;  4CYM D;  4F6R D;  2XEV A;  5ENS D;  4LNB A;  3X2Q E;  1UJK A;  3ULQ A;  3ONL A;  2KCK A;  3IV0 A;  5BPP A;  2HE0 A;  2WXO A;  3MV3 B;  2C2L A;  3NF1 A;  2DCP A;  3PUJ A;  4HRN A;  5ARF A;  3TXN A;  3L22 A;  4BTB A;  1KT1 A;  3AG3 E;  2P58 C;  4G1T A;  4APO A;  4GAA A;  2F0Y A;  3CQC B;  4FJZ A;  1TJC A;  2WVI A;  3DXK G;  3ZXS A;  5ENT D;  2EIK E;  5B1A E;  3PNT B;  3IEG A;  4GZ5 A;  3S7J A;  5EYL A;  4KXK B;  3W9F A;  1OCC E;  5JHB A;  4BT9 A;  3HYM B;  4XI9 A;  2E0I A;  4Q69 A;  2LXM A;  4CDN A;  3ZN3 A;  5EKQ D;  4I1A A;  3CEQ A;  3TG5 A;  3UIO C;  3ULE G;  2VGY A;  3HXD A;  2RFM A;  2CHW A;  3C98 A;  3TWQ A;  2VSN A;  3JUI A;  1UW4 B;  3U66 A;  2XS8 A;  4K5A B;  5ITZ F;  3MCX A;  4K5C A;  3FUE A;  1MX6 A;  1E8Z A;  1H6O A;  4BSX A;  1Y8M A;  4DLQ A;  3DSX A;  3AG4 E;  4KT6 B;  3ZYL A;  3IHV A;  4PUC A;  2I1K A;  2WPV A;  1LF8 A;  3LVR E;  3ABK E;  3TWS A;  3E34 A;  3CKC A;  4DJA A;  2KCV A;  4GYO A;  4U8Y D;  4UUC A;  2YHC A;  3HXC A;  1TNZ A;  4GTQ A;  3QAQ A;  3SI5 A;  1E7V A;  5G05 J;  1NP7 A;  4Y6C A;  3MYV A;  4J8D A;  4LUN U;  4HRM B;  3PZ2 A;  3O4Z A;  4TXQ A;  4ILI A;  4BES A;  4GTT A;  4I2Z A;  5CCL A;  3BU8 A;  3PZ3 A;  3Q73 A;  4JHJ A;  4J0U A;  4E6H A;  2ZIS A;  5ENR D;  2P9N G;  3CHQ A;  5CRU A;  3SBS A;  2I9C A;  1MX2 A;  2KC7 A;  1NA3 A;  2FF4 A;  1OXJ A;  3CHR A;  1QZ2 A;  3CVP A;  3FH7 A;  1YMP A;  5FZS A;  4G25 A;  2QYU A;  1V55 E;  3FTX A;  3CVY A;  2CHZ A;  1TNU A;  4BER A;  4FU3 A;  2XZD G;  4ANU A;  1O1T A;  3LY8 A;  3D9H A;  4XZ4 A;  3D9M A;  3FTV A;  4DUI A;  4GZC A;  1BD8 A;  3HXE A;  4H7Y A;  4U0Z A;  3FUM A;  5AJD A;  1WG0 A;  1JCR A;  1OWO A;  4GTV A;  4H7X A;  2XEE A;  3ABM E;  5CBO A;  3V79 K;  4U07 A;  3U64 A;  3BEE A;  2V5F A;  2IOS A;  3E30 A;  4CEM A;  3JUE A;  1HG2 A;  2EIJ E;  3D9O A;  4ABN A;  3U3W A;  4JW1 A;  3SF4 A;  2ILR A;  4N5Q A;  4I17 A;  3DBS A;  5LCW C;  3CVQ A;  4U0U A;  2PL2 A;  4YDE A;  2X6H A;  3R7Q A;  5LFA A;  1L5J A;  4O60 A;  2Y1L E;  4GA2 A;  4A1S A;  3CV0 A;  2X38 A;  1N94 A;  2P9S G;  4WNE A;  2WMO A;  3OAW A;  1ELK A;  1H2V C;  1XNF A;  2UWJ G;  4U96 D;  1IXV A;  2R2L A;  3ML9 A;  2EQX A;  2IF4 A;  2XRY A;  1PAQ A;  4NAC A;  4BWR A;  2DZO A;  5JHA A;  3WXX A;  3T9K A;  2C0M A;  4O6F A;  1YA0 A;  1QQE A;  1S0P A;  2WXR A;  5AIJ A;  3MGB A;  4HB5 A;  5A6C A;  4EQF A;  4LCT A;  4GCO A;  5LCW J;  3FFL A;  5CCM A;  1TNY A;  3JXJ A;  1KZO A;  2KZT A;  2XQ0 A;  2NSZ A;  3RAU A;  4ZFH A;  1OUV A;  2J49 A;  3ASG A;  1IHB A;  5G55 A;  2BUG A;  3TAX A;  3V31 A;  4XIF A;  3SFX A;  4LG6 A;  2YHE A;  3PDN A;  4CDR A;  5C1D A;  2LAI A;  3CVW A;  3FTS A;  3CGH A;  1UOH A;  2IOL A;  2PZI A;  2RD0 A;  2OND A;  4G26 A;  3Q4A B;  4GYW A;  4I6E A;  3FTW A;  4KZ0 A;  4HOQ A;  1D8D A;  3TJP A;  3PS6 A;  4L1B A;  2L0I A;  5D2M C;  4EEC A;  1H0A A;  3ZNG A;  4L7T A;  1IHG A;  3NAW A;  5CED B;  4J7W A;  4UQX A;  3QK0 A;  3SZ7 A;  3CK7 A;  1N4R A;  3LVQ E;  3Q78 A;  3CST A;  2Y69 E;  1YYH A;  2Y0B G;  3AU4 A;  4DX2 A;  4O1P A;  1WM5 A;  4HLE A;  3U4T A;  2MYO A;  3TL5 A;  4MBG A;  3E37 A;  4UI9 K;  2C0L A;  4JXT A;  3G2T A;  3RRU A;  2IFU A;  4HS2 A;  5HKP A;  2Y4U A;  1W3B A;  2RG8 A;  2AJA A;  3VTX A;  2VTB A;  3R9A B;  4U04 A;  2BED A;  3B7T A;  3CVL A;  2XPI A;  5CEC B;  4G8L A;  2XGS A;  5EIB E;  4YDW A;  3RRM B;  1OWL A;  4IN3 B;  2JAB A;  2PQN A;  5J08 A;  4TXP A;  1Z3X A;  1N4S A;  5FZR A;  1E90 A;  4CRW A;  5DIZ A;  1S70 B;  1TN8 A;  4XKB A;  4I6G A;  2V4H C;  3EHQ A;  2EIN E;  4HI8 A;  2KCL A;  2XCC A;  2X6J A;  1LD8 A;  3PZD A;  3DST A;  2V0P A;  5BT1 A;  1P5Q A;  3PE3 A;  4G24 A;  3CSF A;  2ION A;  2LO6 A;  5AQ9 A;  4G11 A;  4JA7 A;  3LJN A;  4BSZ B;  2F8Y A;  3AS5 A;  4URK A;  3FH8 A;  3L82 A;  1SA5 A;  2PNN A;  1D8E A;  2KBX A;  2WXF A;  4F7A A;  3KD7 A;  1TN7 A;  2HR2 A;  5A7D B;  4HOS A;  4U8H A;  5JJT A;  5ANL A;  1DVP A;  4MLP A;  1SZ9 A;  5KJL A;  3KAE A;  4DI4 A;  3PUK A;  3ZW3 A;  1DCQ A;  4A1G A;  5CMY A;  3RO3 A;  3N71 A;  5EDS A;  1INZ A;  2LSV A;  2B0O E;  1TN6 A;  2ZXW E;  4FP7 A;  3B7U X;  3ML8 A;  5FQ4 A;  2OCC E;  2ZIR A;  4F53 A;  1V54 E;  2AXU A;  3WG7 E;  1IKN D;  2CFU A;  4PS7 A;  1E8Y A;  5EID A;  1FT2 A;  3LYA A;  3UPV A;  3LCA A;  3BG1 B;  1TJF A;  4RSY A;  1HU3 A;  4I2W A;  2XGM A;  4JC8 A;  5IY5 E;  1DNP A;  1UJJ A;  4C48 B;  2R17 C;  3ZFW A;  5BV1 A;  2XEH A;  1ZU2 A;  3K9I A;  4AY6 A;  4AVX A;  4IRU A;  4R7L A;  1Z6T A;  3LEW A;  2DVW A;  5ENN A;  2QFC A;  2Q7F A;  4Y6W A;  1DCE A;  4EHM A;  3HVE A;  2LSU A;  4PH4 B;  2WXM A;  3QWP A;  5T4Y A;  2DWZ A;  1HH8 A;  4YDY A;  5D66 A;  2OVB A;  3P1U A;  2KZT B;  3FEY A;  1FT1 A;  1UN8 A;  1S63 A;  3PRZ A;  2VSY A;  3CHO A;  3T8K A;  4OAU C;  4ME2 A;  4FLH A;  5FJY A;  5CRV A;  5FQ8 A;  4B94 A;  1N4P A;  3C3O A;  2GRN B;  4XEI G;  3D9L A;  3HHM A;  3TGO A;  4YVO A;  1HF8 A;  4JPS A;  2DZN A;  4NUR A;  2AW6 A;  3I3N A;  4M7C A;  4LRZ A;  3FUH A;  5G05 C;  1Q2Z A;  4AV7 A;  3GYZ A;  3CR3 A;  4BFR A;  3CLJ A;  4GTO A;  2VGX A;  3FWV A;  1BU9 A;  3E33 A;  5KCM A;  2FO7 A;  3S7B A;  1H2T C;  4LNU D;  2J8S D;  3IXE A;  4KMO A;  4KZC A;  1LTX A;  5LX8 A;  3O48 A;  3AJI A;  2I1J A;  3SFZ A;  2V5Q C;  4BT8 A;  3GZ1 A;  3TWW A;  4I9E A;  4JEU A;  3APF A;  4TXR A;  1PC2 A;  2R05 A;  3B7S A;  5FWQ A;  5JJ6 A;  2WQ6 A;  4TV3 A;  3JYS A;  5EN5 D;  3KS2 A;  1Z3Y A;  2L9B A;  2VTB B;  3L13 A;  4CGV A;  2MHK A;  3ZKJ A;  1NI1 A;  3R9M A;  5HI7 A;  1MJ0 A;  2FO1 E;  3MV2 B;  3LPZ A;  3UMV A;  4QFV A;  3D9P A;  1ELW A;  4BEP A;  2IO3 C;  3ZEF A;  3G2U A;  4UWL A;  3UM0 A;  4GMJ A;  4M3O A;  2FUL A;  2VGE A;  1SW6 A;  3D9N A;  3QB2 A;  3JXI A;  5B1B E;  3UKU G;  1HZ4 A;  3R7R A;  3L6A A;  3DSV A;  2XEN A;  3FDH A;  5EX0 A;  5D0Q D;  1FPP A;  2IEJ A;  4ACK A;  3DSW A;  3UT7 A;  4HFG A;  3ZYK A;  3B13 A;  2BF0 X;  3F6Q A;  4KVM A;  2WXI A;  5AAR A;  1EPU A;  1WY6 A;  3AU5 A;  2P2C P;  2NC9 A;  4BTA A;  2QY7 A;  1IQU A;  4OAV B;  4N3A A;  5KJN A;  3UM1 A;  2YQ8 A;  1UG3 A;  1E8X A;  2UY1 A;  2KM4 A;  4NQ0 A;  4IYP A;  3V30 A;  5BV0 A;  1MYO A;  3SBT B;  3IBE A;  1H2U A;  1HXI A;  1N0R A;  1D9S A;  1XGW A;  4XX5 A;  3PVL A;  2QYJ A;  4A3T A;  5HRY A;  5FIN A;  4UWK A;  3C72 A;  4TRQ A;  1N11 A;  4WWN A;  2WXQ A;  3PZ4 A;  5T3R A;  5B3S E;  4WWO A;  3CQG B;  5G2N A;  5BUZ A;  3OTN A; 
#chains in the Genus database with same CATH homology
 4I6J A;  3VTX A;  4XKC A;  4RVB A;  2VTB A;  3R9A B;  4FAD A;  4U04 A;  3B7T A;  3L54 A;  3CVL A;  2XRZ A;  2AXZ A;  2XPI A;  1H19 A;  3EJN A;  2I2O A;  4GZ3 A;  3S2A A;  1FVH A;  4APF A;  5JJ7 A;  4P29 A;  1HS6 A;  3UUX A;  1E96 B;  2XGS A;  1MHQ A;  4CDR A;  1VDY A;  5A23 A;  4FHJ A;  3RRM B;  4C0E A;  1OWL A;  3RJV A;  4FC8 A;  2WXN A;  4IN3 B;  4UI9 J;  2PQN A;  2R5S A;  5T8I A;  5J08 A;  1UN9 A;  2CHX A;  4PDX A;  1Z3X A;  3NQP A;  4AM9 A;  3ZRH A;  5FZR A;  1E90 A;  4CRW A;  2XEV A;  3U9W A;  3MX3 A;  3QAR A;  3HVE B;  1UJK A;  1Y6I A;  3LS8 A;  5DIZ A;  4I9C A;  3ONL A;  3ULQ A;  2KCK A;  3FUL A;  3IV0 A;  3ZIM A;  2OOE A;  2CG3 A;  2WXO A;  5BPP A;  3MV3 B;  2C2L A;  3NF1 A;  4XKB A;  2DCP A;  4I6G A;  3PUJ A;  5ARF A;  3GW4 A;  3TXN A;  2KCL A;  3L22 A;  4BTB A;  2XCC A;  2X6J A;  1KT1 A;  4ANV A;  3QKY A;  3PZD A;  4EPZ A;  2P58 C;  5FQ7 A;  4I1M A;  3IKO B;  2V0P A;  3I4G A;  5BT1 A;  1P5Q A;  2XPZ A;  3ONK A;  4G1T A;  4LER A;  2WXL A;  2DIW A;  3FU3 A;  4APO A;  4GAA A;  4EBA A;  3PE3 A;  4G24 A;  3CQC B;  4FJZ A;  3TG4 A;  1TJC A;  2LNI A;  1HE8 A;  2J09 A;  1HG5 A;  2WVI A;  3ZVV A;  3CSF A;  3ZXS A;  2ION A;  4F1S A;  2LO6 A;  3TXM A;  3PNT B;  4G11 A;  4GCN A;  3IEG A;  2XCB A;  4GZ5 A;  3S7J A;  3FUK A;  4JA7 A;  4B8C B;  3D9I A;  1IYG A;  4KXK B;  4J8F A;  5E75 A;  4HXI A;  5JHB A;  5ANR A;  4BT9 A;  3AS5 A;  4URK A;  3FH8 A;  5AEN A;  3HYM B;  3ZYM A;  4XI9 A;  2E0I A;  2WXG A;  2PM7 A;  4EBA G;  4K0R A;  4Q69 A;  4ANX A;  5J90 A;  2X3M A;  2OV8 A;  4CDN A;  3ZN3 A;  5EKQ D;  2J08 A;  4I1A A;  3OXG A;  2WXF A;  3CEQ A;  4F7A A;  3KD7 A;  4J8E A;  3TG5 A;  2HR2 A;  5A7D B;  4HOS A;  4U8H A;  2VGY A;  4LEU A;  2R59 A;  2CHW A;  4B0Z A;  5JJT A;  3SD5 A;  3NZS A;  4JVS A;  4GA0 A;  4PS3 A;  2V8S E;  4IUL A;  4W9R A;  3QC1 A;  2I6H A;  3C98 A;  1OWN A;  3VLF A;  5ANL A;  3S7F A;  1DVP A;  4MLP A;  1SZ9 A;  2VGX B;  5KJL A;  3KAE A;  3MKQ B;  4XI0 A;  3ZHE A;  4AXH A;  2J4B A;  2VSN A;  4DI4 A;  3PUK A;  1GW6 A;  3FH5 A;  3CHS A;  3JUI A;  4BY6 A;  5LOZ A;  1UW4 B;  2Y3A A;  3ZW3 A;  3U66 A;  2WXH A;  5C2Y A;  4A1G A;  5CMY A;  3LJ3 A;  3KEZ A;  3RO3 A;  3N71 A;  5EDS A;  3MCX A;  3FUE A;  1INZ A;  4L23 A;  2LSV A;  3LDZ A;  4ACL A;  1E8Z A;  3L08 A;  3FU6 A;  4FP7 A;  4J6I A;  3FUN A;  5LP0 A;  3B7U X;  5M72 A;  4BSX A;  1Y8M A;  3ML8 A;  3MZL B;  5FQ4 A;  4WNG A;  1FCH A;  4DLQ A;  4F53 A;  2AXU A;  3FTY A;  5FT9 A;  4BX8 A;  3SGH A;  4KT6 B;  3SHF A;  2CFU A;  4PS7 A;  3ZYL A;  3IHV A;  1E8Y A;  3Q5M A;  2I1K A;  2WPV A;  3D9K A;  4PUC A;  2JLB A;  1LF8 A;  3CVX A;  3LVR E;  4HOR A;  2WXJ A;  4N3B A;  3CKC A;  3LYA A;  2KCV A;  4DJA A;  4ANW A;  4GYO A;  3UPV A;  1N54 A;  3LCA A;  4C0M A;  3BG1 B;  2YHC A;  1TJF A;  4RSY A;  4U0S A;  3Q15 A;  4FHK A;  3CK8 A;  1HU3 A;  4I2W A;  2XGM A;  4JC8 A;  3QAQ A;  5FQ6 A;  2LAH A;  4C9B B;  1DNP A;  1UJJ A;  3QDN A;  3SI5 A;  4DI3 A;  4AIF A;  1E7V A;  5ARG A;  3RK6 A;  3ZPJ A;  3HDX A;  2R17 C;  4GML A;  5G05 J;  3ZFW A;  5BV1 A;  4GA1 A;  1NP7 A;  1ZU2 A;  4KBQ A;  3K9I A;  3EDT B;  4AY6 A;  3ASF A;  4CGW A;  4AVX A;  4Y6C A;  3MYV A;  4J8D A;  4IRU A;  2FEZ A;  3T5V A;  3CK9 A;  4LUN U;  1Z6T A;  4R7L A;  3LEW A;  3O4Z A;  4ILI A;  3GZS A;  5ENN A;  4FUL A;  2GRL A;  2QFC A;  2Q7F A;  1FVF A;  4DPR A;  2J9Q A;  4Y6W A;  1OWP A;  4I2Z A;  2GW1 A;  1EDU A;  3APC A;  3HVE A;  3JQ1 A;  4Q94 A;  5CCL A;  4EZJ A;  5DBK A;  1PY1 A;  4RG9 A;  4JHJ A;  2LSU A;  4J0U A;  4E6H A;  4G23 A;  4PH4 B;  4AP2 A;  3CVU A;  2WXM A;  4AEZ C;  5BNW A;  3QWP A;  4KYO B;  3CHQ A;  5T4Y A;  2I9C A;  3SBS A;  2MOW A;  3RRN B;  2KC7 A;  2DBA A;  4CT0 A;  1HH8 A;  4UQY A;  1NA3 A;  2FF4 A;  4N2Q A;  2OVB A;  1HO8 A;  3P1U A;  2E2E A;  3CHR A;  2KZT B;  1QZ2 A;  4TUU A;  3CVP A;  5AYW D;  3FEY A;  3FH7 A;  3PRE A;  4A55 A;  3S7D A;  4UWH A;  3D9J A;  3RKV A;  4ATG A;  1UN8 A;  3PRZ A;  4N39 A;  2VSY A;  1U3D A;  1A17 A;  5FZS A;  3CKB A;  1N52 A;  3CHO A;  3Q47 B;  4G25 A;  4YVQ C;  2J07 A;  4AJW A;  3FTX A;  3CVY A;  2L6J A;  2CHZ A;  4HVB A;  5KJM A;  4ME2 A;  4FLH A;  3I4R B;  3G2V A;  5FJY A;  5FQ8 A;  4B94 A;  4FU3 A;  3QNK A;  4ANU A;  4JZY A;  4UWF A;  3FTU A;  3LY8 A;  3D9L A;  3L16 A;  3HHM A;  3TGO A;  4HOT A;  4YVO A;  1HF8 A;  4JPS A;  2WQH A;  4XZ4 A;  4NUR A;  3D9M A;  2AW6 A;  3FTV A;  4GB9 A;  1QNF A;  4GZC A;  4MS6 A;  3I3N A;  4H7Y A;  5G05 C;  4LRZ A;  1JUQ A;  3FUH A;  4DLO A;  1BPO A;  4U0Z A;  1SQM A;  3FUM A;  4MKT A;  5EX3 A;  5AJD A;  1HX8 A;  4AV7 A;  1OWO A;  3GYZ A;  3CR3 A;  4U63 A;  4H7X A;  5G04 C;  3MJW A;  4DK5 A;  4BFR A;  2MRI A;  2VJ8 A;  2XGO A;  3CLJ A;  4L2L A;  2VGX A;  3FWV A;  1OWM A;  4U07 A;  2UY1 B;  3VLD A;  3U64 A;  3MKQ A;  1KLX A;  5BW8 C;  5KCM A;  3BEE A;  3FU0 A;  2V5F A;  3NZU A;  2FO7 A;  2IOS A;  1H2T C;  3S7B A;  2BTD A;  4CEM A;  1ZBP A;  1HG2 A;  3MKR A;  3CHM A;  4KMO A;  4KZC A;  3D9O A;  5CMW A;  1TEZ A;  3LY7 A;  4ABN A;  4AOF A;  3ASD A;  3U3W A;  4JW1 A;  3SF4 A;  2VSX E;  5LX8 A;  4I1O B;  2ILR A;  4I17 A;  2WXP A;  1NZN A;  3O48 A;  1NA0 A;  2I1J A;  3FP3 A;  3PNL B;  3DBS A;  3FEX A;  3SFZ A;  2A4Z A;  5LCW C;  3CVQ A;  3PE4 A;  4U0U A;  4BT8 A;  2PL2 A;  4BX9 A;  2X6H A;  3GZ1 A;  3R7Q A;  5LFA A;  1L5J A;  4I9E A;  2AWI A;  2IU1 A;  3ASH A;  3BG0 B;  4JEU A;  2X6K A;  3CHP A;  4JEH A;  3APF A;  2AXV A;  3DPD A;  4WNF A;  4GA2 A;  1PC2 A;  2FI7 A;  4A1S A;  4ILH B;  3CV0 A;  2X38 A;  3B7S A;  4MRU A;  5FWQ A;  5JJ6 A;  3MEK A;  4JL0 A;  1X5B A;  3EIQ C;  4D10 C;  4GYY A;  4A3V A;  2WQ6 A;  4WNE A;  3JQ0 A;  4TV3 A;  3ESL A;  3E4B A;  2M63 A;  3FUF A;  3JYS A;  3KS2 A;  3I5P A;  2X6I A;  1Z3Y A;  3L17 A;  1JWG A;  3AS8 A;  2IQC A;  2WMO A;  2XHE A;  2OVF A;  1ELK A;  2L9B A;  3FUD A;  3GZ2 A;  3OAW A;  2L0T B;  3QWV A;  1H2V C;  3L13 A;  1XNF A;  4B89 A;  4CGV A;  2VTB B;  2MHK A;  2UWJ G;  5G04 J;  2J4D A;  2VQ2 A;  1U3C A;  5HI7 A;  4EZL A;  3MV2 B;  2VYI A;  3LPZ A;  3VTY A;  4GU5 A;  3ML9 A;  4OVV A;  2EQX A;  4OVU A;  2IF4 A;  4WWP A;  4AY5 A;  4I43 A;  3FHE A;  4FLB A;  3UMV A;  2XRY A;  3ZGQ A;  1PAQ A;  4NAC A;  3OXF A;  4QFV A;  3D9P A;  1ELW A;  3MA5 A;  4BWR A;  1JPL A;  3ZEF A;  5JHA A;  2GGF A;  4K03 A;  2FBN A;  3PH0 C;  4GZD A;  3G2U A;  3WXX A;  2XPY A;  3LXU X;  2C0M A;  4UWL A;  4GMJ A;  4M3O A;  3QWW A;  2FUL A;  4O6F A;  1YA0 A;  4WUY A;  1QQE A;  3FY4 A;  4YND A;  1S0P A;  2WXR A;  5AIJ A;  3D9N A;  3QB2 A;  3EIJ A;  4UWG A;  4WND A;  3ESK A;  5CHE E;  3T5X A;  3MGB A;  4OYS A;  4EQF A;  2CFZ A;  5A6C A;  1EYH A;  4LCT A;  4GCO A;  4XE0 A;  3RIB A;  3CIA A;  1E7U A;  5LCW J;  3FFL A;  5D0O D;  5CCM A;  2JEK A;  5E76 A;  2KZT A;  1HZ4 A;  2XQ0 A;  3ZYQ A;  3R7R A;  3L6A A;  1KT0 A;  4FA6 A;  4WAF A;  2ZU6 B;  3IHY A;  2NSZ A;  2YIN A;  3HIZ A;  4ILG A;  3QJZ A;  2WB2 A;  1OUV A;  2J49 A;  3ASG A;  3FDH A;  5EX0 A;  5D0Q D;  3LKU A;  4GPK A;  5G55 A;  4V3I A;  2BUG A;  3TAX A;  3EHM A;  4GZ6 A;  4JA9 A;  4ACK A;  2HO1 A;  4XIF A;  4CDM A;  4CT4 A;  3FTZ A;  4HFG A;  2YHE A;  3PDN A;  4HOU A;  4UQZ A;  3UT7 A;  4N5C A;  3ZYK A;  1H6K A;  1WAO 1;  3B13 A;  3CVN A;  2BF0 X;  5C1D A;  4KVM A;  2WXI A;  2GRM A;  2LAI A;  3OXL A;  3CVW A;  3FTS A;  3CGH A;  4N2S A;  1EPU A;  2A5U A;  2NXP A;  2IOL A;  3EHN A;  4FJY A;  2PZI A;  2RD0 A;  1WY6 A;  2OND A;  3AU5 A;  3PEV B;  1EF1 C;  4G26 A;  3Q4A B;  2NC9 A;  4GYW A;  3UT8 A;  3G2S A;  4I6E A;  5FZQ A;  2QY7 A;  4BTA A;  4HLE A;  3FTW A;  1IQU A;  4KZ0 A;  3B7R L;  4HOQ A;  2HM8 A;  4N3A A;  5KJN A;  2V4L A;  3PS6 A;  4L2Y A;  4L1B A;  3ENE A;  3TJP A;  2L0I A;  4EEC A;  5AJL A;  2KAT A;  1H0A A;  2YQ8 A;  2WM9 A;  3UQ3 A;  3CVV A;  1UG3 A;  4L7T A;  4EZK A;  3JCK C;  1IHG A;  1E8X A;  4G2V A;  3FU5 A;  1SZA A;  2UY1 A;  2KM4 A;  2HYZ A;  3PEU B;  3QK0 A;  4NQ0 A;  2WXK A;  3Q49 B;  2Y4T A;  4IYP A;  4UQX A;  3CK7 A;  3SNX A;  3SZ7 A;  4KVO A;  4Q96 A;  4J8S A;  3VLE A;  5BV0 A;  2WQ7 A;  4JHK A;  3SBT B;  3IBE A;  5HQ8 A;  1H2U A;  4UI9 C;  3RO2 A;  1HXI A;  3LVQ E;  3CST A;  4F3V A;  3APD A;  3G2W A;  1XGW A;  2AVP A;  4XX5 A;  3ZHE B;  3D3M A;  3FUI A;  1E8W A;  2X6F A;  3AU4 A;  2WMN A;  3PVL A;  4E85 A;  3LY9 A;  4A3T A;  2PM6 A;  4NRH B;  1WM5 A;  4CCA A;  5KJK A;  4PS8 A;  1IQR A;  2CG2 A;  2VSO E;  4N3C A;  1MQS A;  3QOU A;  4UWK A;  3U4T A;  3AS4 A;  4TRQ A;  3TL5 A;  5FTP A;  3UT4 A;  2YNQ A;  3FUJ A;  4B8A A;  1JWF A;  4UI9 K;  3UX4 A;  2C0L A;  1HFA A;  3P2B A;  2PQR A;  4JXT A;  4WWN A;  3G2T A;  1B89 A;  2IFU A;  3RRU A;  4HS2 A;  3URZ A;  2IJG X;  2WXQ A;  5T3R A;  4WWO A;  3CQG B;  2Y4U A;  1W3B A;  2RG8 A;  5G2N A;  3RU0 A;  3T8M A;  5BUZ A;  4RG6 A;  1ELR A;  4JHR A;  3OTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...