3IXEA

Structural basis of competition between pinch1 and pinch2 for binding to the ankyrin repeat domain of integrin-linked kinase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
b'GSPEFMDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin-linked protein kinase
publication title Structural basis of competition between PINCH1 and PINCH2 for binding to the ankyrin repeat domain of integrin-linked kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
total genus 59
structure length 171
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3ixeA00
2FO1E 1IHBA 4DX5D 1BU9A 5BXUA 2XEEA 4HI8A 3F6QA 2HE0A 3TWXA 4F1PA 1SVXA 4K5CA 5EIDA 5ENPD 1AP7A 1QYMA 3T9KA 1IXVA 2QC9A 4O60A 2PNNA 4YDYA 4U95D 3JUEA 3W9GA 3DEPA 4BESA 2RFAA 2QYJA 5ENTD 3IXEA 5AAOA 1DC2A 1BI7B 1NFIE 2VGEA 1S70B 5CERB 3V30A 4DX7D 4DX6D 5AQ7A 3HRAA 2MYOA 1MX2A 3TWVA 2ETCA 2DZNA 5KWDA 3KEAA 1N11A 4ZFHA 2L6BA 2XZDG 5FINA 4HQDA 3B95A 1MX4A 2KXPC 5EYPF 2BKKB 3ZKJA 2KBXA 2DWZA 4QFVA 5ENRD 5KNHD 1G3NB 5AARA 5AQ9A 3SO8A 3UXGA 3D9HA 4G8KA 4TUMA 4F6RD 1DCQA 3UTMA 5ENSD 3AJIA 3J5QB 1MYOA 2F8XK 3Q9NC 4GMRA 5ENOD 1WDYA 5EIBE 4ATZD 5EILA 5HKPA 5CECB 1TR4A 1YMPA 4J7WA 3TWUA 1OT8A 4G8LA 3EU9A 3TWWA 1K3ZD 2Y1LE 2AJAA 2V4HC 2RFMA 5KNGA 4BERA 5CEAA 4DX2A 4LSZE 4O1PA 5JMND 5AQAA 4B93B 3UI2A 1BD8A 1YCSB 1N0RA 3AAAC 3DEOA 5AN8A 3Q9UC 1A5EA 1D9SA 2XZTG 2Y0BG 4HBDA 4J8YA 5D66A 4HI9A 2V5QC 3TWRA 3TWSA 3TWQA 4HRLA 1SW6A 3J5PA 5EN5D 4N5QA 1N0QA 2ZGGA 3V2XA 3NBNB 1K1BA 1MJ0A 2B0OE 5HRYA 4BETA 4UUCA 1AWCB 3NOGD 4BEPA 3C5RA 3TWTA 2JABA 2DVWA 4HRNA 2XEHA 4BSZB 4ZHBA 5CBOA 3V79K 4CZ2D 4LG6A 4C48B 3NOCD 2DZOA 2NYJA 4HNAD 3W9FA 4DX1A 3LJNA 1BLXB 4LNUD 2BKGA 4Z68A 1MX6A 4RLYA 2A5EA 3V2OA 1K1AA 5CEDB 4OAUC 5AQBA 4O1OA 4DUIA 5HS0A 3T8KA 5ENQD 2P2CP 4JB8P 4K5BA 4HB5A 3JXIA 4A63B 1YYHA 5FIOA 5KBAA 2ETBA 1BI8B 3EHQA 3V31A 2F37A 3HG0D 2F8YA 3ZU7B 2ETAA 2ZGDA 4U96D 4OAVB 4HLLA 4DRXE 4QQIA 4U8YD 3ZNGA 4K5AB 2J8SD 4NIKA 4YDWA 5JA4D 3JXJA 4HRMB 1OY3D 1UOHA 2XENA 4U8VD 4CYMD 1IKND 5ITZF 3EHRA 3ZUVB 5CBNA 1WG0A 5BXOA 4GPMA 5EYLA 3B7BA
chains in the Genus database with same CATH superfamily
4GTVA 2E2EA 3TXMA 4WNDA 1OWPA 4F1PA 2EIME 2X38A 4UWFA 4P29A 3FEYA 4U95D 2Q7FA 3LY8A 4TRQA 5ENTD 2VJ8A 3DSWA 3SNXA 3HXFA 4NACA 3LKUA 3ASDA 4GCOA 2HO1A 2KXPC 2A4ZA 3B7SA 2PQNA 4J8DA 3FUNA 1MYOA 3EHNA 5ENOD 2ZU6B 5EILA 3MZLB 1OCCE 3TWUA 1K3ZD 2FULA 2RFMA 3ABME 3FUJA 4TXQA 1N0RA 5JJ6A 4GTTA 4I1MA 3FTZA 3HXEA 3HDXA 3EIQC 4HRLA 1N0QA 1MQSA 2LO6A 1E8WA 3B13A 4Q69A 4XI9A 3TWTA 4XX5A 4GZ6A 4JW1A 3D3MA 1N54A 1KZOA 4L2YA 5CEDB 5AQBA 3SD5A 2P9PG 3L6AA 4RSYA 4LNGA 1DVPA 3LY9A 5HQ8A 5CMWA 4TUUA 1NL4A 2BF0X 3BQOA 4CYMD 3G2TA 1INZA 5LOZA 3F6QA 4HXIA 1SVXA 2PNNA 5G04J 3AS5A 2KM4A 4XI0A 1H6OA 2VGEA 3KS2A 2DBAA 3TWVA 3CHSA 4XEIG 4I43A 4DJAA 2XZDG 3I4RB 1Z6TA 1OUVA 3ZKJA 1L5JA 1E90A 5B3SE 2X6JA 3MKQA 4F6RD 1U3CA 4FULA 4G8LA 4FHKA 4OVVA 4DLOA 5IY5E 3ZGQA 2GRRB 5AQAA 3CVYA 3ULEG 5D66A 3ASGA 3L82A 4GAAA 3NBNB 3IBEA 3AG3E 5H7PA 2EINE 2DVWA 3VTXA 4Q94A 2WM9A 4PUCA 3PZ1A 3LJNA 4EZLA 3FWVA 3ZXSA 3CK7A 3DSSA 3FTSA 4ACKA 2OVFA 2GW1A 3T8KA 3KSLA 1Z5SC 1JCSA 4RG6A 2AW6A 1E7VA 3L16A 3PREA 2DIWA 4MBGA 3UKUG 4U0UA 2CHWA 4N5CA 3DSUA 4N2QA 4JPSA 2GROB 2QC9A 1UG3A 3RIBA 2VTBA 2VGXB 4ANUA 1BI7B 3CEQA 4ANXA 5A7DB 1N11A 2L6BA 1S64A 2QFCA 2PL2A 3NAWA 4QFVA 3RO2A 1G3NB 3JUIA 1ZU2A 2KZTB 3HYMB 1KLXA 5A23A 3SQVA 3TL5A 4U04A 1BPOA 3CVUA 3QDNA 3LVRE 3TWWA 2YHEA 4WUYA 4GTMA 1E8XA 3UI2A 2WXNA 1HS6A 3ML9A 1JUQA 1HFAA 2VSXE 3DPDA 2LXMA 2KCVA 4A3TA 1LF8A 1WY6A 2V0PA 3E32A 4HOQA 3V2XA 2WPVA 3Q73A 4G11A 2NSZA 3FU3A 3NB2A 3DSXA 4GZ3A 4L9PA 3RKVA 1MZCA 3HIZA 1TNZA 2WQHA 2V8SE 5G05J 4U8YD 5G04C 4A1SA 3FU6A 1HXIA 3JXJA 2FBNA 3G2WA 3UT4A 2H6GA 5BW8C 4CT4A 4UQXA 3ZFWA 3Q5MA 5EIDA 4ATGA 4O60A 4Q96A 3HHMA 2I1KA 3PH0C 4HVBA 2QYJA 5AAOA 5AJLA 2WXOA 3HXCA 3V30A 1JCRA 5AQ7A 1WAO1 3KEAA 2WQ6A 4FADA 2AWIA 4HQDA 3QWWA 3SO8A 1HG5A 2BTDA 2XCBA 3FDHA 4XZ4A 3ONKA 4I6EA 4TXPA 3G2VA 1HE8A 1D9SA 4MRUA 3CQGB 3NF1A 1UN9A 4E85A 4N5QA 5T8IA 5HRYA 2B0OE 3BUAA 2E0IA 2LUHA 3GYZA 5KJLA 3E37A 4HOSA 2J07A 3ASNE 4HNAD 4GZ5A 2RG8A 3PE3A 4H7YA 4NQ0A 3UT8A 4ILGA 4K5BA 2LSVA 1Q2ZA 4AP2A 3ZYQA 1O1SA 2CFZA 1OCRE 3BG0B 2XPYA 1QNFA 4GYYA 4GTSA 5FWQA 1XNFA 4DX5D 5J08A 4HLEA 2QYUA 4I6JA 3Q49B 2MOWA 3JCKC 5CCLA 3K9IA 2IO2C 4F7AA 2R02A 5ENPD 4JL0A 4DI3A 3DXKG 3CHPA 1DCEA 1IHGA 4APOA 3ZRHA 1NFIE 3CVXA 4I2WA 4L2LA 5CERB 1FT2A 1EF1C 3VLEA 1PC2A 4X8QA 3ABLE 1IQRA 5FINA 4LUNU 1MX4A 2AVPA 4DPRA 4M7CA 2F8XK 3Q9NC 1FVHA 1NZNA 2V4HC 4GTOA 3CKCA 3TJPA 3CK8A 3RRMB 1VDYA 4BT8A 4FU3A 2V5QC 1HO8A 4FJZA 5D0OD 4BX9A 2X6IA 2F0YA 4U8HA 4UUCA 2JABA 3S7FA 1N4QA 1NA0A 3U64A 3V2OA 2P2CP 4JXTA 1W3BA 3JXIA 3DRAA 3RO3A 4AV7A 3L08A 4HLLA 3CVPA 4K5AB 5JJTA 1LTXA 1OY3D 5BXOA 4GZCA 2LNIA 3DBSA 4Y6WA 3ZW3A 5C2YA 1X5BA 2XCCA 4AEZC 3HVEA 4LRZA 4LEUA 3AG1E 3B7TA 4WNEA 3Q7AA 3RRUA 3ZYKA 1E96B 4PDXA 3G2UA 4ANWA 3UM0A 3OAWA 5BT1A 3GZ2A 2R59A 1H2VC 5EYPF 1EPUA 2XRZA 1P5QA 1TNBA 3B7UX 3LJ3A 2WMOA 1SQMA 2PM7A 5CCMA 1TNYA 4UI9K 4J8EA 5CECB 1N4PA 5ARGA 4BTBA 3LPZA 1S0PA 1TJCA 2C0MA 3PZ3A 5T3RA 5FQ7A 3CK9A 4GYOA 4JHJA 3D9OA 3I5PA 3FP3A 5KJNA 3L17A 5A6CA 4J6IA 1Z3YA 4KVOA 1H2UA 2PM6A 2Y3AA 1V55E 4AY5A 3NOGD 4JHRA 4AY6A 3CIAA 4XKCA 5CBOA 3TGOA 1JPLA 1TN6A 2DZOA 2JLBA 3ZHEA 1EYHA 2IONA 4UWGA 5ANLA 5HS0A 3UUXA 3PUKA 4R7LA 3ASFA 3MEKA 3ZYLA 4YVQC 4V3IA 4J8SA 2YQ8A 3QJZA 3MJWA 4KYOB 3HG0D 3ZYMA 1OXJA 3UINC 4OAVB 4WWPA 2FF4A 4XKBA 2YHCA 1UJJA 3PZDA 5C1DA 1IKND 4WWNA 4IN3B 2XGSA 2FO1E 1RZ4A 3Q78A 3FU0A 1BU9A 3L13A 2VYIA 3ZPJA 2XGMA 3I3NA 5ARFA 4YDYA 4GYWA 4GA0A 4CRWA 2ILRA 4BESA 1S70B 3FY4A 3NZUA 2P9NG 4URKA 4UI9J 2X6HA 4FHJA 2DYRE 2IJGX 3EHMA 1N52A 5ENRD 3MV3B 4Y6CA 5B1AE 2H6HA 2OV8A 3VLDA 2IEJA 1V54E 2M63A 2YINA 4I9CA 3BEEA 2X3MA 4GMRA 2R17C 2X6FA 5KNGA 3FFLA 3C3QA 3IHYA 1BD8A 3DEOA 3ZXPA 4HS2A 4BWRA 4HBDA 4D10C 4EQFA 5BNWA 1FPPA 5EN5D 4U0ZA 4CGVA 4GB9A 4YDEA 2WXRA 3FUHA 2WXKA 2UWJG 2MRIA 2FI7A 4YVOA 4HB5A 2PZIA 2IU1A 2ETBA 2VSOE 4G26A 3C98A 5ENNA 3V31A 1TYQG 2F8YA 1B89A 5G55A 4K03A 5BPPA 2JEKA 2VSYA 3E4BA 3CR3A 3SY2A 2P9LG 3APCA 4HI8A 4HOTA 1O5MA 4EBAA 1FCHA 3ZEFA 1HH8A 1E7UA 2WXJA 3CGHA 3HXDA 4I9EA 3FHEA 5J90A 4N3AA 3TG4A 5LX8A 4J0UA 2OEVA 1MX2A 2ETCA 3Q75A 3FH5A 4A55A 3R9MA 2IO3C 3QWVA 4JEUA 3U66A 4K0RA 1X81A 4B94A 2CHXA 2XPZA 5JJ7A 3AS4A 3S7JA 2WXFA 3R9AB 5FT9A 3ASOE 2WB2A 1PY1A 4I17A 4GU5A 2L0TB 4BERA 4DX2A 2IQCA 2GGFA 1UW4B 1YCSB 3AAAC 2AXZA 2EILE 3KEZA 1U3DA 4O6FA 2ZIRA 2MHKA 3TWSA 4PS7A 3DSVA 1AWCB 3SF4A 3Q79A 4BX8A 4HRNA 4TXRA 3W9FA 2A5EA 2P9SG 4MLPA 2KC7A 2IY0C 4XE0A 2EIJE 3FUFA 5ENQD 3FUEA 4JD2G 5FIOA 3QAQA 3MYVA 2ETAA 1HU3A 2H6IA 4GA2A 3SFYA 4QQIA 3ZNGA 2GRPB 2L9BA 4KMOA 4U8VD 3ESKA 3FUKA 1IHBA 2V4LA 4FLHA 4UI9C 3CVQA 2UY1A 2P9UG 3CHRA 2LSUA 3JUEA 3EUVA 3JQ0A 4G25A 3CVWA 2MYOA 2AXUA 5T4YA 5E76A 4U07A 2QY7A 5CHEE 3ULYA 4A3VA 5JHBA 4UWLA 3CVLA 3APFA 1NA3A 1QBQA 3GZ1A 2J09A 4BTAA 3FU5A 4N39A 3D9IA 4O1PA 1Y6IA 3RSEG 3Q9UC 2XRYA 3U9WA 3URZA 3ML8A 1H6KA 4AIFA 3SGHA 4CDRA 3TWQA 1IYGA 3D9KA 1K8KG 4BEPA 1JCQA 4WNGA 4BSZB 4J8FA 4C48B 3AS8A 2NYJA 4DX1A 5HI7A 4LNUD 3IHVA 1SA4A 1U2VG 1NI1A 2CFUA 2I9CA 2GRQB 2WXIA 5BV0A 5KBAA 3AG2E 1BI8B 1TEZA 4L7TA 3N71A 3KAEA 2RKKA 2H6FA 3TAXA 4CT0A 4HRMB 1HF8A 4B8CB 2XQ0A 4GTPA 1A17A 5EX0A 3B7BA 5BXUA 3T5XA 4K5CA 1AP7A 3UPVA 1QYMA 3T9KA 4JVSA 3D9LA 4WNFA 1QQEA 4EZKA 1DC2A 1N4RA 4DX7D 4BFRA 3QWPA 4F1SA 3C3OA 4JHKA 3R7QA 3QOUA 5D2MC 2DWZA 1UJKA 5B1BE 5KNHD 3S7BA 1DCQA 3J5QB 4EHMA 2KCKA 3OTNA 2AJAA 3DSTA 2EIKE 1OWNA 3D9JA 2WXHA 3G2SA 1ELKA 1A5EA 2VQ2A 2Y69E 4HOUA 3L22A 1SW6A 2J4BA 1ELWA 4IYPA 4W9RA 3MKQB 3Q7FA 4CZ2D 2R2LA 4AVXA 2VGXA 1FT1A 3Q47B 4KZCA 2F37A 3ZU7B 4I1AA 4APFA 5JA4D 3UX4A 2XENA 3SHFA 3ZUVB 5EKQD 4DK5A 2KZTA 4GTRA 3D9MA 2XEEA 4FJYA 3UM2A 1RW2A 3UQ3A 4NRHB 3SI5A 4F53A 2J9QA 3SBSA 2RFAA 2KCLA 2VGYA 3VTYA 4FA6A 5KWDA 1S63A 4FLBA 1UN8A 3HXBA 4LERA 4BY6A 1KZPA 5FQ6A 2KBXA 3DWLG 3T8MA 3EDTB 3SFXA 1SA5A 1JWGA 2WXPA 3LY7A 1YA0A 5ENSD 3UMVA 5LCWJ 3U3WA 2WVIA 1QZ2A 4U63A 4ANVA 3MV2B 5HKPA 2L6JA 3E33A 3EU9A 1HZ4A 1N94A 2LXLA 4C0EA 3L9TA 3D9NA 2VTBB 3JYSA 3SBTB 2Y4UA 5FZQA 3Q15A 3CHMA 5EDSA 3U4TA 2CG3A 3RAUA 3ZIMA 3CLJA 3CSTA 3UM3A 2YNQA 1E8YA 3C5RA 3IKOB 3ONLA 2OCCE 3PZ4A 3PRZA 2L0IA 3NZSA 1N4SA 4C9BB 4A1GA 3LDZA 4U7EB 4Z68A 1K1AA 1XGWA 4H7XA 3RJVA 2DYSE 2DCPA 3PNTB 1D8EA 4U96D 3CVVA 3JQ1A 2I6HA 2BEDA 4L23A 5E75A 4GPKA 2HR2A 4GPMA 3O48A 3P1UA 4EECA 2HYZA 4DI4A 1OWMA 1ELRA 1N95A 3LS8A 1SZAA 1OWOA 4KBQA 1KPSB 3BU8A 2UY1B 3AG4E 3FEXA 4PS3A 4EPZA 1H2TC 2XGOA 3CHQA 4OVUA 4ZFHA 3APDA 3B95A 3BG1B 3L54A 5AARA 3MA5A 5AQ9A 3FTVA 5FJYA 4IRUA 2XHEA 3PNLB 3AJIA 5KCMA 5M72A 1O1RA 1OT8A 4B89A 3RU0A 2Y1LE 5CEAA 4XIFA 3LVQE 2GRMA 1FVFA 4JA9A 4J8YA 3ESLA 4L1BA 1DNPA 4WWOA 2WMNA 1MJ0A 4AJWA 2P9KG 2R5SA 2VSNA 3UT7A 2XEHA 4LG6A 3I4GA 4CCAA 3MGBA 1MX6A 2ZISA 3FH8A 1YYHA 1TNUA 1H6PA 2NC9A 1TNOA 4U0SA 5FQ8A 3FUDA 4ME2A 2HE0A 1D8DA 1IQUA 3TWXA 2GRNB 4UWKA 3ZN3A 2PQRA 4MKTA 3W9GA 5EX3A 5LCWC 3LEWA 4CDMA 1N9AA 4CDNA 2DZNA 4IULA 3UIPC 4GMLA 2XS1A 3OXFA 3PEVB 2R05A 3ASHA 4UQZA 4C0MA 4G2VA 4TUMA 3UTMA 5CRVA 3QARA 1WDYA 1YMPA 4J7WA 3WG7E 3FULA 4LSZE 4B93B 5G2NA 5AN8A 2XEVA 1TN7A 4JEHA 3MKRA 3KSQA 4B8AA 3QKYA 1TJFA 2RD0A 2V5FA 1K1BA 4B0ZA 5CRUA 3QK0A 4BETA 3UIOC 2OEWA 5JHAA 4I6GA 4HORA 2KATA 1LD8A 3MCXA 4PS8A 3WXXA 1BLXB 1EDUA 4LNBA 4AOFA 3GW4A 4GZDA 2ZGDA 1HG2A 4YDWA 4NIKA 5ITZF 5LFAA 5EYLA 4G23A 3LYAA 2A5UA 3PE4A 3IEGA 1LD7A 4YDOA 3EJNA 3FTUA 4PH4B 1GW6A 5DIZA 4DX6D 3AU5A 3PVLA 1SZ9A 4KZ0A 3E30A 4BT9A 3FH7A 3TG5A 4E6HA 3D9HA 4G8KA 4MS6A 5KJMA 2J08A 3D9PA 4M3OA 4BSXA 3HVEB 3FTXA 4ILIA 3UKRG 2XZTG 2Y0BG 4RG9A 3ULQA 2QZAA 1Y8MA 1OWLA 3TXNA 1E8ZA 3S7DA 3CV0A 4ZHBA 4RQIA 4KVMA 3NOCD 3UM1A 4FC8A 3SZ7A 2P58C 2XPIA 4EBAG 4GTQA 2ONDA 4UQYA 4AM9A 4OYSA 4ACLA 3EHQA 3Q4AB 4G1TA 2IOSA 4GCNA 3E34A 4GMJA 2J8SD 4I2ZA 1UOHA 3IV0A 3S2AA 3QC1A 3FUMA 2WQ7A 2IOLA 1H19A 3ZVVA 2AXVA 1JWFA 3PUJA 2NXPA 3ZHEB 1HX8A 4RVBA 2BUGA 1H0AA 3P2BA 3HRAA 4N2SA 3LXUX 1OCZE 3CVNA 2BKKB 3UXGA 2OOEA 3DXMG 5EIBE 1TR4A 4JA7A 5DBKA 5AENA 3GZSA 4HFGA 1ZBPA 3ABKE 5JMND 3B7RL 2Y4TA 3R7RA 3CSFA 5ANRA 3RRNB 4HI9A 4YNDA 3TWRA 2IF4A 3FTWA 2C2LA 2ZGGA 4G24A 1MHQA 4F3VA 1O1TA 3NQPA 2XS8A 3O4ZA 3AU4A 2WXQA 3RK6A 3CQCB 2P9IG 5KJKA 3ENEA 3T5VA 4OAUC 4O1OA 5AIJA 3PS6A 4JB8P 4A63B 3OXLA 1OCOE 1WM5A 2IFUA 5CBNA 1WG0A 4N3BA 4DLQA 4UWHA 2EQXA 1KT0A 3MX3A 2J4DA 2OVBA 2ZXWE 2WXLA 3ISMC 2CHZA 4TV3A 3KD7A 3X2QE 1IXVA 2GRLA 3EU5A 3QNKA 3DEPA 5FZRA 3IXEA 1Z3XA 4ABNA 2I1JA 4LCTA 5BV1A 4JC8A 3DPYA 4AXHA 3OXGA 2WXMA 5FQ4A 5FZSA 2B6CA 2J49A 4ATZD 3PEUB 3PZ2A 1TN8A 4GA1A 5G05C 3C3RA 5BUZA 1KT1A 3CKBA 3QB2A 1ZB1A 5LP0A 4CEMA 1NP7A 4FP7A 3J5PA 3FUIA 4KXKB 2FEZA 4CGWA 4EZJA 2CG2A 3SFZA 4NURA 3CHOA 3VLFA 4ILHB 3V79K 4WAFA 5D0QD 3C72A 3EIJA 5AYWD 2HM8A 5FTPA 2BKGA 2FO7A 4RLYA 4DUIA 2LAIA 1PAQA 2I2OA 3FTYA 3PDNA 4JZYA 2R03A 3LCAA 2C0LA 5CMYA 4N3CA 4DRXE 2LAHA 2WXGA 2X6KA 4I1OB 3EHRA 4KT6B 5AJDA
chains in the Genus database with same CATH topology
2FO1E 1IHBA 4DX5D 1BU9A 5BXUA 2XEEA 4HI8A 3F6QA 2HE0A 3TWXA 4F1PA 1SVXA 4K5CA 5EIDA 5ENPD 1AP7A 1QYMA 3T9KA 1IXVA 2QC9A 4O60A 2PNNA 4YDYA 4U95D 3JUEA 3W9GA 3DEPA 4BESA 2RFAA 2QYJA 5ENTD 3IXEA 5AAOA 1DC2A 1BI7B 1NFIE 2VGEA 1S70B 5CERB 3V30A 4DX7D 4DX6D 5AQ7A 3HRAA 2MYOA 1MX2A 3TWVA 2ETCA 2DZNA 5KWDA 3KEAA 1N11A 4ZFHA 2L6BA 2XZDG 5FINA 4HQDA 3B95A 1MX4A 2KXPC 5EYPF 2BKKB 3ZKJA 2KBXA 2DWZA 4QFVA 5ENRD 5KNHD 1G3NB 5AARA 5AQ9A 3SO8A 3UXGA 3D9HA 4G8KA 4TUMA 4F6RD 1DCQA 3UTMA 5ENSD 3AJIA 3J5QB 1MYOA 2F8XK 3Q9NC 4GMRA 5ENOD 1WDYA 5EIBE 4ATZD 5EILA 5HKPA 5CECB 1TR4A 1YMPA 4J7WA 3TWUA 1OT8A 4G8LA 3EU9A 3TWWA 1K3ZD 2Y1LE 2AJAA 2V4HC 2RFMA 5KNGA 4BERA 5CEAA 4DX2A 4LSZE 4O1PA 5JMND 5AQAA 4B93B 3UI2A 1BD8A 1YCSB 1N0RA 3AAAC 3DEOA 5AN8A 3Q9UC 1A5EA 1D9SA 2XZTG 2Y0BG 4HBDA 4J8YA 5D66A 4HI9A 2V5QC 3TWRA 3TWSA 3TWQA 4HRLA 1SW6A 3J5PA 5EN5D 4N5QA 1N0QA 2ZGGA 3V2XA 3NBNB 1K1BA 1MJ0A 2B0OE 5HRYA 4BETA 4UUCA 1AWCB 3NOGD 4BEPA 3C5RA 3TWTA 2JABA 2DVWA 4HRNA 2XEHA 4BSZB 4ZHBA 5CBOA 3V79K 4CZ2D 4LG6A 4C48B 3NOCD 2DZOA 2NYJA 4HNAD 3W9FA 4DX1A 3LJNA 1BLXB 4LNUD 2BKGA 4Z68A 1MX6A 4RLYA 2A5EA 3V2OA 1K1AA 5CEDB 4OAUC 5AQBA 4O1OA 4DUIA 5HS0A 3T8KA 5ENQD 2P2CP 4JB8P 4K5BA 4HB5A 3JXIA 4A63B 1YYHA 5FIOA 5KBAA 2ETBA 1BI8B 3EHQA 3V31A 2F37A 3HG0D 2F8YA 3ZU7B 2ETAA 2ZGDA 4U96D 4OAVB 4HLLA 4DRXE 4QQIA 4U8YD 3ZNGA 4K5AB 2J8SD 4NIKA 4YDWA 5JA4D 3JXJA 4HRMB 1OY3D 1UOHA 2XENA 4U8VD 4CYMD 1IKND 5ITZF 3EHRA 3ZUVB 5CBNA 1WG0A 5BXOA 4GPMA 5EYLA 3B7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FO1 E;  1IHB A;  4DX5 D;  1BU9 A;  5BXU A;  2XEE A;  4HI8 A;  3F6Q A;  2HE0 A;  3TWX A;  4F1P A;  1SVX A;  4K5C A;  5EID A;  5ENP D;  1AP7 A;  1QYM A;  3T9K A;  1IXV A;  2QC9 A;  4O60 A;  2PNN A;  4YDY A;  4U95 D;  3JUE A;  3W9G A;  3DEP A;  4BES A;  2RFA A;  2QYJ A;  5ENT D;  3IXE A;  5AAO A;  1DC2 A;  1BI7 B;  1NFI E;  2VGE A;  1S70 B;  5CER B;  3V30 A;  4DX7 D;  4DX6 D;  5AQ7 A;  3HRA A;  2MYO A;  1MX2 A;  3TWV A;  2ETC A;  2DZN A;  5KWD A;  3KEA A;  1N11 A;  4ZFH A;  2L6B A;  2XZD G;  5FIN A;  4HQD A;  3B95 A;  1MX4 A;  2KXP C;  5EYP F;  2BKK B;  3ZKJ A;  2KBX A;  2DWZ A;  4QFV A;  5ENR D;  5KNH D;  1G3N B;  5AAR A;  5AQ9 A;  3SO8 A;  3UXG A;  3D9H A;  4G8K A;  4TUM A;  4F6R D;  1DCQ A;  3UTM A;  5ENS D;  3AJI A;  3J5Q B;  1MYO A;  2F8X K;  3Q9N C;  4GMR A;  5ENO D;  1WDY A;  5EIB E;  4ATZ D;  5EIL A;  5HKP A;  5CEC B;  1TR4 A;  1YMP A;  4J7W A;  3TWU A;  1OT8 A;  4G8L A;  3EU9 A;  3TWW A;  1K3Z D;  2Y1L E;  2AJA A;  2V4H C;  2RFM A;  5KNG A;  4BER A;  5CEA A;  4DX2 A;  4LSZ E;  4O1P A;  5JMN D;  5AQA A;  4B93 B;  3UI2 A;  1BD8 A;  1YCS B;  1N0R A;  3AAA C;  3DEO A;  5AN8 A;  3Q9U C;  1A5E A;  1D9S A;  2XZT G;  2Y0B G;  4HBD A;  4J8Y A;  5D66 A;  4HI9 A;  2V5Q C;  3TWR A;  3TWS A;  3TWQ A;  4HRL A;  1SW6 A;  3J5P A;  5EN5 D;  4N5Q A;  1N0Q A;  2ZGG A;  3V2X A;  3NBN B;  1K1B A;  1MJ0 A;  2B0O E;  5HRY A;  4BET A;  4UUC A;  1AWC B;  3NOG D;  4BEP A;  3C5R A;  3TWT A;  2JAB A;  2DVW A;  4HRN A;  2XEH A;  4BSZ B;  4ZHB A;  5CBO A;  3V79 K;  4CZ2 D;  4LG6 A;  4C48 B;  3NOC D;  2DZO A;  2NYJ A;  4HNA D;  3W9F A;  4DX1 A;  3LJN A;  1BLX B;  4LNU D;  2BKG A;  4Z68 A;  1MX6 A;  4RLY A;  2A5E A;  3V2O A;  1K1A A;  5CED B;  4OAU C;  5AQB A;  4O1O A;  4DUI A;  5HS0 A;  3T8K A;  5ENQ D;  2P2C P;  4JB8 P;  4K5B A;  4HB5 A;  3JXI A;  4A63 B;  1YYH A;  5FIO A;  5KBA A;  2ETB A;  1BI8 B;  3EHQ A;  3V31 A;  2F37 A;  3HG0 D;  2F8Y A;  3ZU7 B;  2ETA A;  2ZGD A;  4U96 D;  4OAV B;  4HLL A;  4DRX E;  4QQI A;  4U8Y D;  3ZNG A;  4K5A B;  2J8S D;  4NIK A;  4YDW A;  5JA4 D;  3JXJ A;  4HRM B;  1OY3 D;  1UOH A;  2XEN A;  4U8V D;  4CYM D;  1IKN D;  5ITZ F;  3EHR A;  3ZUV B;  5CBN A;  1WG0 A;  5BXO A;  4GPM A;  5EYL A;  3B7B A; 
#chains in the Genus database with same CATH topology
 4GTV A;  2E2E A;  3TXM A;  4WND A;  1OWP A;  4F1P A;  2EIM E;  2X38 A;  4UWF A;  4P29 A;  3FEY A;  4U95 D;  2Q7F A;  3LY8 A;  4TRQ A;  5ENT D;  2VJ8 A;  3DSW A;  3SNX A;  3HXF A;  4NAC A;  3LKU A;  3ASD A;  4GCO A;  2HO1 A;  2KXP C;  2A4Z A;  3B7S A;  2PQN A;  4J8D A;  3FUN A;  1MYO A;  3EHN A;  5ENO D;  2ZU6 B;  5EIL A;  3MZL B;  1OCC E;  3TWU A;  1K3Z D;  2FUL A;  2RFM A;  3ABM E;  3FUJ A;  4TXQ A;  1N0R A;  5JJ6 A;  4GTT A;  4I1M A;  3FTZ A;  3HXE A;  3HDX A;  3EIQ C;  4HRL A;  1N0Q A;  1MQS A;  2LO6 A;  1E8W A;  3B13 A;  4Q69 A;  4XI9 A;  3TWT A;  4XX5 A;  4GZ6 A;  4JW1 A;  3D3M A;  1N54 A;  1KZO A;  4L2Y A;  5CED B;  5AQB A;  3SD5 A;  2P9P G;  3L6A A;  4RSY A;  4LNG A;  1DVP A;  3LY9 A;  5HQ8 A;  5CMW A;  4TUU A;  1NL4 A;  2BF0 X;  3BQO A;  4CYM D;  3G2T A;  1INZ A;  5LOZ A;  3F6Q A;  4HXI A;  1SVX A;  2PNN A;  5G04 J;  3AS5 A;  2KM4 A;  4XI0 A;  1H6O A;  2VGE A;  3KS2 A;  2DBA A;  3TWV A;  3CHS A;  4XEI G;  4I43 A;  4DJA A;  2XZD G;  3I4R B;  1Z6T A;  1OUV A;  3ZKJ A;  1L5J A;  1E90 A;  5B3S E;  2X6J A;  3MKQ A;  4F6R D;  1U3C A;  4FUL A;  4G8L A;  4FHK A;  4OVV A;  4DLO A;  5IY5 E;  3ZGQ A;  2GRR B;  5AQA A;  3CVY A;  3ULE G;  5D66 A;  3ASG A;  3L82 A;  4GAA A;  3NBN B;  3IBE A;  3AG3 E;  5H7P A;  2EIN E;  2DVW A;  3VTX A;  4Q94 A;  2WM9 A;  4PUC A;  3PZ1 A;  3LJN A;  4EZL A;  3FWV A;  3ZXS A;  3CK7 A;  3DSS A;  3FTS A;  4ACK A;  2OVF A;  2GW1 A;  3T8K A;  3KSL A;  1Z5S C;  1JCS A;  4RG6 A;  2AW6 A;  1E7V A;  3L16 A;  3PRE A;  2DIW A;  4MBG A;  3UKU G;  4U0U A;  2CHW A;  4N5C A;  3DSU A;  4N2Q A;  4JPS A;  2GRO B;  2QC9 A;  1UG3 A;  3RIB A;  2VTB A;  2VGX B;  4ANU A;  1BI7 B;  3CEQ A;  4ANX A;  5A7D B;  1N11 A;  2L6B A;  1S64 A;  2QFC A;  2PL2 A;  3NAW A;  4QFV A;  3RO2 A;  1G3N B;  3JUI A;  1ZU2 A;  2KZT B;  3HYM B;  1KLX A;  5A23 A;  3SQV A;  3TL5 A;  4U04 A;  1BPO A;  3CVU A;  3QDN A;  3LVR E;  3TWW A;  2YHE A;  4WUY A;  4GTM A;  1E8X A;  3UI2 A;  2WXN A;  1HS6 A;  3ML9 A;  1JUQ A;  1HFA A;  2VSX E;  3DPD A;  2LXM A;  2KCV A;  4A3T A;  1LF8 A;  1WY6 A;  2V0P A;  3E32 A;  4HOQ A;  3V2X A;  2WPV A;  3Q73 A;  4G11 A;  2NSZ A;  3FU3 A;  3NB2 A;  3DSX A;  4GZ3 A;  4L9P A;  3RKV A;  1MZC A;  3HIZ A;  1TNZ A;  2WQH A;  2V8S E;  5G05 J;  4U8Y D;  5G04 C;  4A1S A;  3FU6 A;  1HXI A;  3JXJ A;  2FBN A;  3G2W A;  3UT4 A;  2H6G A;  5BW8 C;  4CT4 A;  4UQX A;  3ZFW A;  3Q5M A;  5EID A;  4ATG A;  4O60 A;  4Q96 A;  3HHM A;  2I1K A;  3PH0 C;  4HVB A;  2QYJ A;  5AAO A;  5AJL A;  2WXO A;  3HXC A;  3V30 A;  1JCR A;  5AQ7 A;  1WAO 1;  3KEA A;  2WQ6 A;  4FAD A;  2AWI A;  4HQD A;  3QWW A;  3SO8 A;  1HG5 A;  2BTD A;  2XCB A;  3FDH A;  4XZ4 A;  3ONK A;  4I6E A;  4TXP A;  3G2V A;  1HE8 A;  1D9S A;  4MRU A;  3CQG B;  3NF1 A;  1UN9 A;  4E85 A;  4N5Q A;  5T8I A;  5HRY A;  2B0O E;  3BUA A;  2E0I A;  2LUH A;  3GYZ A;  5KJL A;  3E37 A;  4HOS A;  2J07 A;  3ASN E;  4HNA D;  4GZ5 A;  2RG8 A;  3PE3 A;  4H7Y A;  4NQ0 A;  3UT8 A;  4ILG A;  4K5B A;  2LSV A;  1Q2Z A;  4AP2 A;  3ZYQ A;  1O1S A;  2CFZ A;  1OCR E;  3BG0 B;  2XPY A;  1QNF A;  4GYY A;  4GTS A;  5FWQ A;  1XNF A;  4DX5 D;  5J08 A;  4HLE A;  2QYU A;  4I6J A;  3Q49 B;  2MOW A;  3JCK C;  5CCL A;  3K9I A;  2IO2 C;  4F7A A;  2R02 A;  5ENP D;  4JL0 A;  4DI3 A;  3DXK G;  3CHP A;  1DCE A;  1IHG A;  4APO A;  3ZRH A;  1NFI E;  3CVX A;  4I2W A;  4L2L A;  5CER B;  1FT2 A;  1EF1 C;  3VLE A;  1PC2 A;  4X8Q A;  3ABL E;  1IQR A;  5FIN A;  4LUN U;  1MX4 A;  2AVP A;  4DPR A;  4M7C A;  2F8X K;  3Q9N C;  1FVH A;  1NZN A;  2V4H C;  4GTO A;  3CKC A;  3TJP A;  3CK8 A;  3RRM B;  1VDY A;  4BT8 A;  4FU3 A;  2V5Q C;  1HO8 A;  4FJZ A;  5D0O D;  4BX9 A;  2X6I A;  2F0Y A;  4U8H A;  4UUC A;  2JAB A;  3S7F A;  1N4Q A;  1NA0 A;  3U64 A;  3V2O A;  2P2C P;  4JXT A;  1W3B A;  3JXI A;  3DRA A;  3RO3 A;  4AV7 A;  3L08 A;  4HLL A;  3CVP A;  4K5A B;  5JJT A;  1LTX A;  1OY3 D;  5BXO A;  4GZC A;  2LNI A;  3DBS A;  4Y6W A;  3ZW3 A;  5C2Y A;  1X5B A;  2XCC A;  4AEZ C;  3HVE A;  4LRZ A;  4LEU A;  3AG1 E;  3B7T A;  4WNE A;  3Q7A A;  3RRU A;  3ZYK A;  1E96 B;  4PDX A;  3G2U A;  4ANW A;  3UM0 A;  3OAW A;  5BT1 A;  3GZ2 A;  2R59 A;  1H2V C;  5EYP F;  1EPU A;  2XRZ A;  1P5Q A;  1TNB A;  3B7U X;  3LJ3 A;  2WMO A;  1SQM A;  2PM7 A;  5CCM A;  1TNY A;  4UI9 K;  4J8E A;  5CEC B;  1N4P A;  5ARG A;  4BTB A;  3LPZ A;  1S0P A;  1TJC A;  2C0M A;  3PZ3 A;  5T3R A;  5FQ7 A;  3CK9 A;  4GYO A;  4JHJ A;  3D9O A;  3I5P A;  3FP3 A;  5KJN A;  3L17 A;  5A6C A;  4J6I A;  1Z3Y A;  4KVO A;  1H2U A;  2PM6 A;  2Y3A A;  1V55 E;  4AY5 A;  3NOG D;  4JHR A;  4AY6 A;  3CIA A;  4XKC A;  5CBO A;  3TGO A;  1JPL A;  1TN6 A;  2DZO A;  2JLB A;  3ZHE A;  1EYH A;  2ION A;  4UWG A;  5ANL A;  5HS0 A;  3UUX A;  3PUK A;  4R7L A;  3ASF A;  3MEK A;  3ZYL A;  4YVQ C;  4V3I A;  4J8S A;  2YQ8 A;  3QJZ A;  3MJW A;  4KYO B;  3HG0 D;  3ZYM A;  1OXJ A;  3UIN C;  4OAV B;  4WWP A;  2FF4 A;  4XKB A;  2YHC A;  1UJJ A;  3PZD A;  5C1D A;  1IKN D;  4WWN A;  4IN3 B;  2XGS A;  2FO1 E;  1RZ4 A;  3Q78 A;  3FU0 A;  1BU9 A;  3L13 A;  2VYI A;  3ZPJ A;  2XGM A;  3I3N A;  5ARF A;  4YDY A;  4GYW A;  4GA0 A;  4CRW A;  2ILR A;  4BES A;  1S70 B;  3FY4 A;  3NZU A;  2P9N G;  4URK A;  4UI9 J;  2X6H A;  4FHJ A;  2DYR E;  2IJG X;  3EHM A;  1N52 A;  5ENR D;  3MV3 B;  4Y6C A;  5B1A E;  2H6H A;  2OV8 A;  3VLD A;  2IEJ A;  1V54 E;  2M63 A;  2YIN A;  4I9C A;  3BEE A;  2X3M A;  4GMR A;  2R17 C;  2X6F A;  5KNG A;  3FFL A;  3C3Q A;  3IHY A;  1BD8 A;  3DEO A;  3ZXP A;  4HS2 A;  4BWR A;  4HBD A;  4D10 C;  4EQF A;  5BNW A;  1FPP A;  5EN5 D;  4U0Z A;  4CGV A;  4GB9 A;  4YDE A;  2WXR A;  3FUH A;  2WXK A;  2UWJ G;  2MRI A;  2FI7 A;  4YVO A;  4HB5 A;  2PZI A;  2IU1 A;  2ETB A;  2VSO E;  4G26 A;  3C98 A;  5ENN A;  3V31 A;  1TYQ G;  2F8Y A;  1B89 A;  5G55 A;  4K03 A;  5BPP A;  2JEK A;  2VSY A;  3E4B A;  3CR3 A;  3SY2 A;  2P9L G;  3APC A;  4HI8 A;  4HOT A;  1O5M A;  4EBA A;  1FCH A;  3ZEF A;  1HH8 A;  1E7U A;  2WXJ A;  3CGH A;  3HXD A;  4I9E A;  3FHE A;  5J90 A;  4N3A A;  3TG4 A;  5LX8 A;  4J0U A;  2OEV A;  1MX2 A;  2ETC A;  3Q75 A;  3FH5 A;  4A55 A;  3R9M A;  2IO3 C;  3QWV A;  4JEU A;  3U66 A;  4K0R A;  1X81 A;  4B94 A;  2CHX A;  2XPZ A;  5JJ7 A;  3AS4 A;  3S7J A;  2WXF A;  3R9A B;  5FT9 A;  3ASO E;  2WB2 A;  1PY1 A;  4I17 A;  4GU5 A;  2L0T B;  4BER A;  4DX2 A;  2IQC A;  2GGF A;  1UW4 B;  1YCS B;  3AAA C;  2AXZ A;  2EIL E;  3KEZ A;  1U3D A;  4O6F A;  2ZIR A;  2MHK A;  3TWS A;  4PS7 A;  3DSV A;  1AWC B;  3SF4 A;  3Q79 A;  4BX8 A;  4HRN A;  4TXR A;  3W9F A;  2A5E A;  2P9S G;  4MLP A;  2KC7 A;  2IY0 C;  4XE0 A;  2EIJ E;  3FUF A;  5ENQ D;  3FUE A;  4JD2 G;  5FIO A;  3QAQ A;  3MYV A;  2ETA A;  1HU3 A;  2H6I A;  4GA2 A;  3SFY A;  4QQI A;  3ZNG A;  2GRP B;  2L9B A;  4KMO A;  4U8V D;  3ESK A;  3FUK A;  1IHB A;  2V4L A;  4FLH A;  4UI9 C;  3CVQ A;  2UY1 A;  2P9U G;  3CHR A;  2LSU A;  3JUE A;  3EUV A;  3JQ0 A;  4G25 A;  3CVW A;  2MYO A;  2AXU A;  5T4Y A;  5E76 A;  4U07 A;  2QY7 A;  5CHE E;  3ULY A;  4A3V A;  5JHB A;  4UWL A;  3CVL A;  3APF A;  1NA3 A;  1QBQ A;  3GZ1 A;  2J09 A;  4BTA A;  3FU5 A;  4N39 A;  3D9I A;  4O1P A;  1Y6I A;  3RSE G;  3Q9U C;  2XRY A;  3U9W A;  3URZ A;  3ML8 A;  1H6K A;  4AIF A;  3SGH A;  4CDR A;  3TWQ A;  1IYG A;  3D9K A;  1K8K G;  4BEP A;  1JCQ A;  4WNG A;  4BSZ B;  4J8F A;  4C48 B;  3AS8 A;  2NYJ A;  4DX1 A;  5HI7 A;  4LNU D;  3IHV A;  1SA4 A;  1U2V G;  1NI1 A;  2CFU A;  2I9C A;  2GRQ B;  2WXI A;  5BV0 A;  5KBA A;  3AG2 E;  1BI8 B;  1TEZ A;  4L7T A;  3N71 A;  3KAE A;  2RKK A;  2H6F A;  3TAX A;  4CT0 A;  4HRM B;  1HF8 A;  4B8C B;  2XQ0 A;  4GTP A;  1A17 A;  5EX0 A;  3B7B A;  5BXU A;  3T5X A;  4K5C A;  1AP7 A;  3UPV A;  1QYM A;  3T9K A;  4JVS A;  3D9L A;  4WNF A;  1QQE A;  4EZK A;  1DC2 A;  1N4R A;  4DX7 D;  4BFR A;  3QWP A;  4F1S A;  3C3O A;  4JHK A;  3R7Q A;  3QOU A;  5D2M C;  2DWZ A;  1UJK A;  5B1B E;  5KNH D;  3S7B A;  1DCQ A;  3J5Q B;  4EHM A;  2KCK A;  3OTN A;  2AJA A;  3DST A;  2EIK E;  1OWN A;  3D9J A;  2WXH A;  3G2S A;  1ELK A;  1A5E A;  2VQ2 A;  2Y69 E;  4HOU A;  3L22 A;  1SW6 A;  2J4B A;  1ELW A;  4IYP A;  4W9R A;  3MKQ B;  3Q7F A;  4CZ2 D;  2R2L A;  4AVX A;  2VGX A;  1FT1 A;  3Q47 B;  4KZC A;  2F37 A;  3ZU7 B;  4I1A A;  4APF A;  5JA4 D;  3UX4 A;  2XEN A;  3SHF A;  3ZUV B;  5EKQ D;  4DK5 A;  2KZT A;  4GTR A;  3D9M A;  2XEE A;  4FJY A;  3UM2 A;  1RW2 A;  3UQ3 A;  4NRH B;  3SI5 A;  4F53 A;  2J9Q A;  3SBS A;  2RFA A;  2KCL A;  2VGY A;  3VTY A;  4FA6 A;  5KWD A;  1S63 A;  4FLB A;  1UN8 A;  3HXB A;  4LER A;  4BY6 A;  1KZP A;  5FQ6 A;  2KBX A;  3DWL G;  3T8M A;  3EDT B;  3SFX A;  1SA5 A;  1JWG A;  2WXP A;  3LY7 A;  1YA0 A;  5ENS D;  3UMV A;  5LCW J;  3U3W A;  2WVI A;  1QZ2 A;  4U63 A;  4ANV A;  3MV2 B;  5HKP A;  2L6J A;  3E33 A;  3EU9 A;  1HZ4 A;  1N94 A;  2LXL A;  4C0E A;  3L9T A;  3D9N A;  2VTB B;  3JYS A;  3SBT B;  2Y4U A;  5FZQ A;  3Q15 A;  3CHM A;  5EDS A;  3U4T A;  2CG3 A;  3RAU A;  3ZIM A;  3CLJ A;  3CST A;  3UM3 A;  2YNQ A;  1E8Y A;  3C5R A;  3IKO B;  3ONL A;  2OCC E;  3PZ4 A;  3PRZ A;  2L0I A;  3NZS A;  1N4S A;  4C9B B;  4A1G A;  3LDZ A;  4U7E B;  4Z68 A;  1K1A A;  1XGW A;  4H7X A;  3RJV A;  2DYS E;  2DCP A;  3PNT B;  1D8E A;  4U96 D;  3CVV A;  3JQ1 A;  2I6H A;  2BED A;  4L23 A;  5E75 A;  4GPK A;  2HR2 A;  4GPM A;  3O48 A;  3P1U A;  4EEC A;  2HYZ A;  4DI4 A;  1OWM A;  1ELR A;  1N95 A;  3LS8 A;  1SZA A;  1OWO A;  4KBQ A;  1KPS B;  3BU8 A;  2UY1 B;  3AG4 E;  3FEX A;  4PS3 A;  4EPZ A;  1H2T C;  2XGO A;  3CHQ A;  4OVU A;  4ZFH A;  3APD A;  3B95 A;  3BG1 B;  3L54 A;  5AAR A;  3MA5 A;  5AQ9 A;  3FTV A;  5FJY A;  4IRU A;  2XHE A;  3PNL B;  3AJI A;  5KCM A;  5M72 A;  1O1R A;  1OT8 A;  4B89 A;  3RU0 A;  2Y1L E;  5CEA A;  4XIF A;  3LVQ E;  2GRM A;  1FVF A;  4JA9 A;  4J8Y A;  3ESL A;  4L1B A;  1DNP A;  4WWO A;  2WMN A;  1MJ0 A;  4AJW A;  2P9K G;  2R5S A;  2VSN A;  3UT7 A;  2XEH A;  4LG6 A;  3I4G A;  4CCA A;  3MGB A;  1MX6 A;  2ZIS A;  3FH8 A;  1YYH A;  1TNU A;  1H6P A;  2NC9 A;  1TNO A;  4U0S A;  5FQ8 A;  3FUD A;  4ME2 A;  2HE0 A;  1D8D A;  1IQU A;  3TWX A;  2GRN B;  4UWK A;  3ZN3 A;  2PQR A;  4MKT A;  3W9G A;  5EX3 A;  5LCW C;  3LEW A;  4CDM A;  1N9A A;  4CDN A;  2DZN A;  4IUL A;  3UIP C;  4GML A;  2XS1 A;  3OXF A;  3PEV B;  2R05 A;  3ASH A;  4UQZ A;  4C0M A;  4G2V A;  4TUM A;  3UTM A;  5CRV A;  3QAR A;  1WDY A;  1YMP A;  4J7W A;  3WG7 E;  3FUL A;  4LSZ E;  4B93 B;  5G2N A;  5AN8 A;  2XEV A;  1TN7 A;  4JEH A;  3MKR A;  3KSQ A;  4B8A A;  3QKY A;  1TJF A;  2RD0 A;  2V5F A;  1K1B A;  4B0Z A;  5CRU A;  3QK0 A;  4BET A;  3UIO C;  2OEW A;  5JHA A;  4I6G A;  4HOR A;  2KAT A;  1LD8 A;  3MCX A;  4PS8 A;  3WXX A;  1BLX B;  1EDU A;  4LNB A;  4AOF A;  3GW4 A;  4GZD A;  2ZGD A;  1HG2 A;  4YDW A;  4NIK A;  5ITZ F;  5LFA A;  5EYL A;  4G23 A;  3LYA A;  2A5U A;  3PE4 A;  3IEG A;  1LD7 A;  4YDO A;  3EJN A;  3FTU A;  4PH4 B;  1GW6 A;  5DIZ A;  4DX6 D;  3AU5 A;  3PVL A;  1SZ9 A;  4KZ0 A;  3E30 A;  4BT9 A;  3FH7 A;  3TG5 A;  4E6H A;  3D9H A;  4G8K A;  4MS6 A;  5KJM A;  2J08 A;  3D9P A;  4M3O A;  4BSX A;  3HVE B;  3FTX A;  4ILI A;  3UKR G;  2XZT G;  2Y0B G;  4RG9 A;  3ULQ A;  2QZA A;  1Y8M A;  1OWL A;  3TXN A;  1E8Z A;  3S7D A;  3CV0 A;  4ZHB A;  4RQI A;  4KVM A;  3NOC D;  3UM1 A;  4FC8 A;  3SZ7 A;  2P58 C;  2XPI A;  4EBA G;  4GTQ A;  2OND A;  4UQY A;  4AM9 A;  4OYS A;  4ACL A;  3EHQ A;  3Q4A B;  4G1T A;  2IOS A;  4GCN A;  3E34 A;  4GMJ A;  2J8S D;  4I2Z A;  1UOH A;  3IV0 A;  3S2A A;  3QC1 A;  3FUM A;  2WQ7 A;  2IOL A;  1H19 A;  3ZVV A;  2AXV A;  1JWF A;  3PUJ A;  2NXP A;  3ZHE B;  1HX8 A;  4RVB A;  2BUG A;  1H0A A;  3P2B A;  3HRA A;  4N2S A;  3LXU X;  1OCZ E;  3CVN A;  2BKK B;  3UXG A;  2OOE A;  3DXM G;  5EIB E;  1TR4 A;  4JA7 A;  5DBK A;  5AEN A;  3GZS A;  4HFG A;  1ZBP A;  3ABK E;  5JMN D;  3B7R L;  2Y4T A;  3R7R A;  3CSF A;  5ANR A;  3RRN B;  4HI9 A;  4YND A;  3TWR A;  2IF4 A;  3FTW A;  2C2L A;  2ZGG A;  4G24 A;  1MHQ A;  4F3V A;  1O1T A;  3NQP A;  2XS8 A;  3O4Z A;  3AU4 A;  2WXQ A;  3RK6 A;  3CQC B;  2P9I G;  5KJK A;  3ENE A;  3T5V A;  4OAU C;  4O1O A;  5AIJ A;  3PS6 A;  4JB8 P;  4A63 B;  3OXL A;  1OCO E;  1WM5 A;  2IFU A;  5CBN A;  1WG0 A;  4N3B A;  4DLQ A;  4UWH A;  2EQX A;  1KT0 A;  3MX3 A;  2J4D A;  2OVB A;  2ZXW E;  2WXL A;  3ISM C;  2CHZ A;  4TV3 A;  3KD7 A;  3X2Q E;  1IXV A;  2GRL A;  3EU5 A;  3QNK A;  3DEP A;  5FZR A;  3IXE A;  1Z3X A;  4ABN A;  2I1J A;  4LCT A;  5BV1 A;  4JC8 A;  3DPY A;  4AXH A;  3OXG A;  2WXM A;  5FQ4 A;  5FZS A;  2B6C A;  2J49 A;  4ATZ D;  3PEU B;  3PZ2 A;  1TN8 A;  4GA1 A;  5G05 C;  3C3R A;  5BUZ A;  1KT1 A;  3CKB A;  3QB2 A;  1ZB1 A;  5LP0 A;  4CEM A;  1NP7 A;  4FP7 A;  3J5P A;  3FUI A;  4KXK B;  2FEZ A;  4CGW A;  4EZJ A;  2CG2 A;  3SFZ A;  4NUR A;  3CHO A;  3VLF A;  4ILH B;  3V79 K;  4WAF A;  5D0Q D;  3C72 A;  3EIJ A;  5AYW D;  2HM8 A;  5FTP A;  2BKG A;  2FO7 A;  4RLY A;  4DUI A;  2LAI A;  1PAQ A;  2I2O A;  3FTY A;  3PDN A;  4JZY A;  2R03 A;  3LCA A;  2C0L A;  5CMY A;  4N3C A;  4DRX E;  2LAH A;  2WXG A;  2X6K A;  4I1O B;  3EHR A;  4KT6 B;  5AJD A; 
#chains in the Genus database with same CATH homology
 2FO1 E;  1IHB A;  4DX5 D;  1BU9 A;  5BXU A;  2XEE A;  4HI8 A;  3F6Q A;  2HE0 A;  3TWX A;  4F1P A;  1SVX A;  4K5C A;  5EID A;  5ENP D;  1AP7 A;  1QYM A;  3T9K A;  1IXV A;  2QC9 A;  4O60 A;  2PNN A;  4YDY A;  4U95 D;  3JUE A;  3W9G A;  3DEP A;  4BES A;  2RFA A;  2QYJ A;  5ENT D;  3IXE A;  5AAO A;  1DC2 A;  1BI7 B;  1NFI E;  2VGE A;  1S70 B;  5CER B;  3V30 A;  4DX7 D;  4DX6 D;  5AQ7 A;  3HRA A;  2MYO A;  1MX2 A;  3TWV A;  2ETC A;  2DZN A;  5KWD A;  3KEA A;  1N11 A;  4ZFH A;  2L6B A;  2XZD G;  5FIN A;  4HQD A;  3B95 A;  1MX4 A;  2KXP C;  5EYP F;  2BKK B;  3ZKJ A;  2KBX A;  2DWZ A;  4QFV A;  5ENR D;  5KNH D;  1G3N B;  5AAR A;  5AQ9 A;  3SO8 A;  3UXG A;  3D9H A;  4G8K A;  4TUM A;  4F6R D;  1DCQ A;  3UTM A;  5ENS D;  3AJI A;  3J5Q B;  1MYO A;  2F8X K;  3Q9N C;  4GMR A;  5ENO D;  1WDY A;  5EIB E;  4ATZ D;  5EIL A;  5HKP A;  5CEC B;  1TR4 A;  1YMP A;  4J7W A;  3TWU A;  1OT8 A;  4G8L A;  3EU9 A;  3TWW A;  1K3Z D;  2Y1L E;  2AJA A;  2V4H C;  2RFM A;  5KNG A;  4BER A;  5CEA A;  4DX2 A;  4LSZ E;  4O1P A;  5JMN D;  5AQA A;  4B93 B;  3UI2 A;  1BD8 A;  1YCS B;  1N0R A;  3AAA C;  3DEO A;  5AN8 A;  3Q9U C;  1A5E A;  1D9S A;  2XZT G;  2Y0B G;  4HBD A;  4J8Y A;  5D66 A;  4HI9 A;  2V5Q C;  3TWR A;  3TWS A;  3TWQ A;  4HRL A;  1SW6 A;  3J5P A;  5EN5 D;  4N5Q A;  1N0Q A;  2ZGG A;  3V2X A;  3NBN B;  1K1B A;  1MJ0 A;  2B0O E;  5HRY A;  4BET A;  4UUC A;  1AWC B;  3NOG D;  4BEP A;  3C5R A;  3TWT A;  2JAB A;  2DVW A;  4HRN A;  2XEH A;  4BSZ B;  4ZHB A;  5CBO A;  3V79 K;  4CZ2 D;  4LG6 A;  4C48 B;  3NOC D;  2DZO A;  2NYJ A;  4HNA D;  3W9F A;  4DX1 A;  3LJN A;  1BLX B;  4LNU D;  2BKG A;  4Z68 A;  1MX6 A;  4RLY A;  2A5E A;  3V2O A;  1K1A A;  5CED B;  4OAU C;  5AQB A;  4O1O A;  4DUI A;  5HS0 A;  3T8K A;  5ENQ D;  2P2C P;  4JB8 P;  4K5B A;  4HB5 A;  3JXI A;  4A63 B;  1YYH A;  5FIO A;  5KBA A;  2ETB A;  1BI8 B;  3EHQ A;  3V31 A;  2F37 A;  3HG0 D;  2F8Y A;  3ZU7 B;  2ETA A;  2ZGD A;  4U96 D;  4OAV B;  4HLL A;  4DRX E;  4QQI A;  4U8Y D;  3ZNG A;  4K5A B;  2J8S D;  4NIK A;  4YDW A;  5JA4 D;  3JXJ A;  4HRM B;  1OY3 D;  1UOH A;  2XEN A;  4U8V D;  4CYM D;  1IKN D;  5ITZ F;  3EHR A;  3ZUV B;  5CBN A;  1WG0 A;  5BXO A;  4GPM A;  5EYL A;  3B7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...