3IXEA

Structural basis of competition between pinch1 and pinch2 for binding to the ankyrin repeat domain of integrin-linked kinase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
GSPEFMDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrin-linked protein kinase
publication title Structural basis of competition between PINCH1 and PINCH2 for binding to the ankyrin repeat domain of integrin-linked kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
total genus 59
structure length 171
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3ixeA00
4BERA 2XENA 2FO1E 3J5PA 5ENTD 4U8YD 3T9KA 2XEHA 2ZGDA 4O1PA 3B7BA 2J8SD 2BKGA 2V4HC 2Y1LE 3D9HA 5AQBA 2ETAA 3TWVA 5EIBE 3NOCD 3TWQA 4DX5D 1IXVA 3V2OA 4LG6A 2KBXA 2BKKB 2XZTG 4K5AB 5ENQD 1K1BA 3W9GA 4OAVB 2MYOA 1MX2A 3EHRA 3NOGD 3AAAC 3DEPA 5KBAA 1AP7A 2NYJA 5EILA 4JB8P 2ETBA 5EIDA 5FINA 5KNGA 3TWRA 3ZU7B 5CEAA 1BI7B 5HRYA 3B95A 3ZKJA 2RFAA 5ENOD 5KWDA 4LSZE 4GMRA 3KEAA 5CBOA 2Y0BG 5D66A 4HI8A 4DX7D 3Q9UC 1NFIE 4O1OA 1OY3D 3JXIA 1YCSB 5HS0A 4HQDA 3TWXA 4BETA 1IKND 5AQ9A 2V5QC 2DVWA 1YMPA 5ENRD 4HI9A 1S70B 4K5BA 5AARA 5EYPF 4K5CA 1IHBA 5EN5D 5ENSD 2P2CP 4LNUD 3T8KA 3TWSA 3AJIA 3EU9A 2QYJA 4HBDA 2F37A 1K1AA 5FIOA 3UXGA 4DX2A 5ENPD 3TWWA 5CBNA 4HLLA 3HG0D 3JUEA 4YDYA 3C5RA 5AN8A 1D9SA 4F6RD 1DC2A 1MYOA 4GPMA 3V79K 1MJ0A 2ETCA 5KNHD 4F1PA 5CERB 2AJAA 1K3ZD 5AQAA 1MX6A 4C48B 1SW6A 2KXPC 3J5QB 4A63B 2RFMA 4G8KA 3NBNB 4U95D 3TWTA 5AQ7A 5CEDB 3IXEA 3ZUVB 4CYMD 4DUIA 1TR4A 5ITZF 3ZNGA 1BI8B 5EYLA 1SVXA 1OT8A 2A5EA 1MX4A 1WG0A 2QC9A 2VGEA 4J8YA 4NIKA 4Z68A 4G8LA 1AWCB 1N11A 1N0QA 3UTMA 4ZFHA 3F6QA 4HB5A 2JABA 5CECB 4UUCA 1BU9A 4QFVA 4QQIA 3V2XA 2DZOA 4HRMB 4DRXE 1QYMA 5JMND 4J7WA 4OAUC 3HRAA 4ZHBA 4HNAD 3W9FA 4HRLA 3TWUA 1WDYA 2XZDG 3EHQA 5JA4D 1N0RA 4DX6D 5AAOA 2XEEA 2B0OE 1BD8A 1UOHA 1YYHA 2F8YA 1A5EA 3UI2A 5BXUA 2HE0A 4HRNA 2DZNA 1G3NB 4O60A 1DCQA 2F8XK 2ZGGA 4N5QA 2DWZA 4YDWA 3V31A 2PNNA 3Q9NC 4U8VD 4BEPA 2L6BA 3SO8A 3V30A 4RLYA 4TUMA 3LJNA 4CZ2D 4U96D 4ATZD 4DX1A 4BESA 4BSZB 3JXJA 5HKPA 4B93B 1BLXB 3DEOA 5BXOA
chains in the Genus database with same CATH superfamily
2AVPA 4U8YD 4K03A 5G2NA 3UUXA 1W3BA 4WNFA 3LVQE 4JA7A 1N94A 4AV7A 2I6HA 4GYOA 5M72A 5EILA 4PS8A 1TNZA 1OWOA 5KWDA 2KCVA 2EINE 4Q96A 3BG0B 4K5CA 3S7BA 3RRUA 1JWGA 4L2YA 4HLLA 4GB9A 2VQ2A 3ZRHA 5ENNA 3R7QA 4G8KA 4XI9A 3LXUX 3ASFA 3EHNA 2HM8A 1FT2A 2NXPA 2L9BA 1SQMA 1D8DA 4QQIA 3MV3B 4JW1A 3LVRE 3EU5A 1TN8A 2PQRA 3HRAA 4FHKA 2C0LA 2J4BA 1A5EA 3FU3A 3LJ3A 2DBAA 3ML8A 4HRNA 4N3AA 4TV3A 2J09A 1IQRA 3C98A 3CVUA 4J8SA 2VSXE 3JCKC 1OXJA 1U3CA 2HR2A 3UQ3A 3VLDA 1SA5A 1FT1A 4BSZB 1TYQG 3D9IA 4O1PA 1O5MA 3OXFA 5EIBE 1HX8A 2ZIRA 2BKKB 3SBSA 1K1BA 5J90A 4Q69A 3RJVA 3SY2A 2WVIA 1H2VC 5KNGA 3ZKJA 3ISMC 3HXFA 5FJYA 2HYZA 3UIPC 5B3SE 2EIJE 4N5CA 2J9QA 3JXIA 5BT1A 3ESLA 2LO6A 2P2CP 4FHJA 2LSUA 3UXGA 1MQSA 4DX2A 3ULYA 4MBGA 3JUEA 4YDYA 4MRUA 3UKUG 4EZJA 3MEKA 2GW1A 3LEWA 1HFAA 3Q75A 3OXLA 3B7UX 3BUAA 5KJNA 5A6CA 3D9PA 2VGXB 4NIKA 2Y69E 3UM2A 3R9MA 5KJMA 5FQ6A 4LEUA 3ZGQA 4CGVA 3KAEA 3RKVA 3G2TA 1N4QA 4HRLA 3U66A 2R2LA 1ZU2A 4HOUA 3T5XA 1YA0A 2F8XK 4L9PA 2X38A 2ZGGA 2E0IA 3MKQA 3AG3E 5FQ4A 3V30A 4OYSA 5AENA 3CQGB 3Q4AB 1OWMA 3FULA 2GRQB 2H6HA 3ZFWA 2GROB 5DIZA 3LS8A 3E32A 3FP3A 5EIDA 3VLEA 1BI7B 3APCA 2P58C 3CKCA 4BX9A 1A17A 3CVXA 2WXIA 4FLHA 1L5JA 2OVFA 5ENRD 3T8KA 4R7LA 1ELKA 1O1TA 1U3DA 1U2VG 3ONLA 1IYGA 3NF1A 5CMWA 3B7SA 3HVEB 3Q79A 1ELRA 4CEMA 3AG1E 4ILGA 3UM1A 3FEXA 3BEEA 4D10C 5BUZA 3QNKA 2AWIA 3CK8A 2AXUA 1FVFA 4JHRA 3FEYA 2RKKA 4Z68A 5ANLA 3G2SA 2QZAA 3CQCB 4GCNA 4F7AA 4NRHB 3TG4A 2H6GA 2IO2C 3AU5A 2F8YA 5G05J 4GA1A 2FEZA 3PZ1A 3DPDA 4I1AA 3U64A 3L17A 4YDWA 4BEPA 3GZ2A 2LUHA 3CEQA 2KCKA 4MKTA 5BXOA 2J8SD 1QBQA 4OAVB 4DLOA 5ANRA 5CMYA 4U0ZA 2P9KG 2QY7A 2XPIA 4HOQA 4A1GA 3SI5A 4DI3A 2IO3C 4GA2A 1NA0A 3IV0A 4B94A 2LSVA 4RG6A 3G2WA 4FJZA 4U7EB 3HXCA 1IKND 4KVOA 5AQ9A 4HI9A 1S70B 5DBKA 3EDTB 4JEUA 5EYPF 3ASNE 2E2EA 3L16A 3HG0D 1JCQA 1OWNA 3UT7A 5CERB 1K3ZD 1DNPA 2KXPC 3NBNB 1INZA 3IXEA 4CYMD 4I1MA 3SFXA 3FTYA 3B7RL 4J8YA 1TJCA 4BX8A 4ZFHA 4C0EA 3Q15A 1E96B 3HHMA 4RQIA 2ZISA 1QYMA 3CLJA 3B13A 3ASOE 4J0UA 3KEZA 5JA4D 1N0RA 4AP2A 1BD8A 3K9IA 4FJYA 4FADA 2GRRB 2P9NG 4XE0A 2DWZA 4C0MA 3PZ4A 4GZ5A 2VGYA 3PUKA 5FWQA 3RAUA 4U96D 3TGOA 5D0OD 2VJ8A 3PREA 5CHEE 4A1SA 3FTVA 3AS4A 2KATA 3MA5A 2Y1LE 4L23A 4BT9A 2J08A 3BU8A 4HVBA 5G55A 1N52A 2GRPB 5G04J 3ZU7B 3HXEA 3ONKA 3QWPA 4LSZE 2ILRA 2OEWA 3WG7E 3E33A 4F1SA 4P29A 2GRLA 4BETA 2FO7A 3MV2B 3AG2E 2P9LG 3ULEG 4FU3A 3SFZA 4GYWA 3CHQA 3LYAA 4KYOB 1PC2A 4GZCA 4EZLA 4U0UA 3FH8A 3CV0A 2GGFA 3LKUA 4YNDA 2L0TB 4U04A 4GYYA 4KXKB 4HB5A 3PNTB 2WB2A 1UN8A 3FTSA 2XS1A 3VTXA 3CSTA 1BPOA 2P9SG 3FUDA 3CGHA 3P1UA 4X8QA 4AJWA 3E37A 4AM9A 3PE3A 4B0ZA 3TXNA 2I1JA 3J5PA 3TXMA 2R17C 3FFLA 2LAHA 3FUIA 4GZ6A 2YINA 3KSLA 1H6OA 2ETBA 2F0YA 3UIOC 1FVHA 3DSSA 4G25A 4JHJA 5G05C 3VLFA 3MKRA 1E7UA 2J4DA 4FC8A 3RSEG 4K5BA 3FWVA 2WXJA 1WAO1 3TWSA 4PDXA 1ZB1A 3Q7FA 2WXFA 4EQFA 4ACKA 4F6RD 1LD8A 3SQVA 1NP7A 2V5FA 4C48B 4RVBA 2NSZA 2Y3AA 2I2OA 3ZYLA 5B1BE 4YVQC 3IHVA 4JZYA 1Z3XA 1BI8B 2A5EA 2VGEA 5CCMA 2QC9A 1TNUA 3QWWA 1HZ4A 2IQCA 2DYRE 4CDMA 4A3VA 2VSNA 5HI7A 2XGSA 1TEZA 2XEEA 3RRNB 5CRUA 4XIFA 1G3NB 3DPYA 4GZDA 3S2AA 3ZHEB 3CHRA 3FU6A 2VTBA 2EILE 5FTPA 2JLBA 2IOLA 1Z6TA 1O1RA 1K8KG 4CZ2D 3MCXA 2X6HA 3TG5A 3UM3A 3T9KA 3FY4A 2ZGDA 3I3NA 2IEJA 4WWOA 4A55A 2PM6A 1KZOA 2NYJA 3QARA 3LY8A 3FUNA 5KJLA 5HRYA 5ENOD 2XCCA 3ZXPA 4LUNU 4O1OA 3FUEA 4J8DA 3QOUA 2R59A 5EDSA 3U4TA 2CFZA 3DSWA 4EECA 4GTSA 5FIOA 4W9RA 1JUQA 2UY1A 3C5RA 4BT8A 3O48A 4F1PA 4E85A 5FZSA 4WNGA 5E76A 1SW6A 2IJGX 2DCPA 3UINC 3IKOB 4JL0A 5G04C 4AEZC 4L7TA 3ASDA 3CVPA 4M7CA 2LXMA 3UTMA 3F6QA 4AXHA 2CHWA 4J7WA 4UQXA 4DJAA 1Q2ZA 3ZYMA 5LFAA 2XPZA 3AS5A 4HXIA 3D9JA 2XGOA 3CR3A 3R9AB 1TNBA 3VTYA 3B7TA 4I2ZA 4UWLA 5ARFA 1OUVA 2XENA 4AIFA 2FO1E 2XCBA 1HH8A 3RRMB 3DSVA 3AU4A 5KBAA 2KCLA 3I4GA 3LDZA 5CEAA 3PEUB 3EIJA 2C0MA 2R05A 3P2BA 2Y0BG 4HI8A 2X6FA 5JHBA 4GPKA 1IHBA 4KZ0A 1PY1A 4I2WA 2QYJA 4URKA 4GPMA 3V79K 1OWPA 4ME2A 2OCCE 2JEKA 2AJAA 5AQAA 3HXBA 5LOZA 1NZNA 3ZW3A 3C3RA 4MS6A 4U95D 5JJTA 5AQ7A 4HFGA 5LP0A 2BTDA 4G8LA 1TNYA 2XQ0A 1UJKA 3CVVA 4GU5A 3DSTA 3V2XA 3ZPJA 4AY6A 2WXKA 1DCEA 5AAOA 2MHKA 3L9TA 1UN9A 3MJWA 4C9BB 4N5QA 4LNBA 4WWPA 3NZSA 5CRVA 5JJ6A 3SNXA 4BESA 5HKPA 3NQPA 3L13A 1HS6A 3D9KA 5ENTD 4XKBA 4ILHB 2Y4TA 1EDUA 3ZEFA 2WXRA 1IXVA 2XHEA 4LG6A 1MX2A 2KZTA 2I1KA 1OWLA 5AYWD 2X6KA 5CBOA 4KVMA 4PS7A 5B1AE 5BPPA 3E34A 1N4PA 2LNIA 4M3OA 3RIBA 3D9MA 3SGHA 3ZIMA 5C1DA 3APFA 4CGWA 2F37A 3FTXA 2EIKE 4IRUA 4ANWA 5AN8A 2B6CA 1ZBPA 3EJNA 4ATGA 4IULA 5A23A 4I9CA 1S63A 3C3OA 1MX6A 5LX8A 2PQNA 4GCOA 3MKQB 4WNEA 4A63B 2RFMA 4N3BA 4Q94A 1D8EA 1TR4A 5ITZF 5ARGA 3PZ2A 4PUCA 1WY6A 4YVOA 3JUIA 5E75A 3SHFA 3BQOA 2GRNB 4QFVA 4HRMB 4AVXA 1DVPA 2AXVA 4BTBA 5BXUA 4GTTA 2HE0A 3CVLA 3QC1A 4L1BA 5D0QD 4A3TA 3U9WA 2FI7A 3NAWA 2XRYA 5FZRA 4H7XA 3LJNA 2P9PG 2XEHA 5FZQA 4G2VA 2V4HC 3TWVA 2KC7A 3D9HA 4BWRA 3V2OA 2EIME 3EHRA 2WQHA 1AP7A 1RW2A 3CSFA 4UI9J 2C2LA 4L2LA 2RFAA 3ZXSA 3L6AA 2CHXA 4DX7D 3DSUA 4JEHA 4OVUA 5EX3A 3TWXA 4KMOA 2WXPA 4PS3A 2RD0A 1FPPA 1MZCA 3UMVA 1XNFA 4TRQA 1MJ0A 2VYIA 2ETCA 2YQ8A 2WXHA 1RZ4A 3FTZA 4NURA 2X3MA 3ML9A 3TWTA 2WM9A 4PH4B 4LCTA 4B8AA 4JA9A 1UG3A 3MGBA 4GZ3A 2WQ6A 3CKBA 2BF0X 3FUMA 1AWCB 2VSOE 4UWKA 4CDNA 3DWLG 4DRXE 4LERA 3Q49B 4N2SA 2WXOA 3CHOA 2XZDG 4F53A 4I43A 4WUYA 2WMNA 2DZNA 1HF8A 1DCQA 1IQUA 4RSYA 3ZYKA 3CVNA 1H2UA 3I4RB 2PNNA 3Q9NC 2YHCA 4LNGA 3ZHEA 2Y4UA 4B93B 3PVLA 5LCWJ 3DEOA 1HE8A 1XGWA 2XRZA 2WXGA 2X6IA 4ILIA 2Q7FA 3B7BA 2ETAA 1IHGA 4FP7A 2KBXA 3GW4A 4K5AB 5ENQD 2CFUA 3WXXA 3MYVA 4Y6CA 1NL4A 2WMOA 1KT0A 5BV1A 3FUHA 5BW8C 3PZ3A 4AOFA 2CG2A 5EKQD 4TXPA 1N4SA 4BSXA 1O1SA 2WXNA 1H0AA 4HQDA 2XEVA 4ANXA 5AARA 2V0PA 2IY0C 4LNUD 2V8SE 1H6KA 3AJIA 4HBDA 3DRAA 5T4YA 5D2MC 1DC2A 5KNHD 3ESKA 5BNWA 4JXTA 4UQZA 3FUFA 3GZSA 3ZNGA 5JHAA 3D9OA 5AJDA 1HG5A 3DXKG 4GAAA 4UUCA 4RG9A 1E8WA 4HS2A 1P5QA 5HQ8A 4JPSA 1KT1A 3APDA 1QNFA 4U07A 3L54A 2ONDA 2BEDA 4G26A 1EYHA 1H19A 4TUMA 2J07A 2R5SA 3JXJA 5H7PA 2VGXA 2IONA 4BERA 2OV8A 2EQXA 3QB2A 2XS8A 1MHQA 3NZUA 3D3MA 3DEPA 1NI1A 4CDRA 2DYSE 4JB8P 3CHSA 5FINA 4NQ0A 3TWRA 4EBAA 3GYZA 3B95A 4TXQA 4WWNA 3CVWA 3Q9UC 1NFIE 4U0SA 1OY3D 3UT4A 3RO2A 1V54E 4BTAA 4N2QA 3AS8A 2ZXWE 1E7VA 3EU9A 4F3VA 1SZAA 2R03A 4XX5A 3RK6A 2M63A 4U63A 2R02A 3DBSA 4GMLA 3ENEA 4MLPA 4UWGA 3QK0A 5KCMA 4GTQA 3EIQC 3T8MA 3Q73A 2YNQA 2BUGA 4BFRA 3UPVA 4JHKA 2ZU6B 1SZ9A 4GTMA 4UI9C 3HXDA 3O4ZA 4CT4A 4N3CA 4CCAA 4ANVA 1JCSA 1B89A 2JABA 4HOTA 5A7DB 3TAXA 2CG3A 3E4BA 4IN3B 4OAUC 3T5VA 1N4RA 2FULA 3OTNA 4H7YA 3HVEA 1OCOE 2WXMA 3CIAA 4UQYA 3AG4E 1OCRE 1TN7A 3FU5A 1Z3YA 1TNOA 3CHMA 1VDYA 1S0PA 1ELWA 3PS6A 1H2TC 2QYUA 4TXRA 3PH0C 3PZDA 5EX0A 1OCZE 4G23A 2NC9A 2LXLA 3TWQA 2CHZA 3ULQA 2DIWA 1TN6A 1QQEA 2RG8A 3AAAC 3SZ7A 2YHEA 4HOSA 3BG1B 4BY6A 3CK9A 2I9CA 3HIZA 2IF4A 4GMRA 3KEAA 4WNDA 3TL5A 1E8ZA 3C72A 4UWFA 2V5QC 4KT6B 1YMPA 3G2VA 2FBNA 4EZKA 4EPZA 1TJFA 2AW6A 3ZYQA 4JC8A 5LCWC 1K1AA 1LD7A 4HORA 5ENPD 3TWWA 1D9SA 4G24A 1HU3A 1GW6A 4UWHA 4G1TA 3J5QB 5J08A 3R7RA 4GTVA 2VTBB 3ZUVB 3UM0A 4APOA 3PNLB 5EYLA 1OT8A 2WXQA 2P9IG 3MX3A 2IU1A 3SD5A 1KLXA 5CECB 5T8IA 1BU9A 4K0RA 3ZN3A 3JYSA 2V4LA 1E90A 1E8YA 3FTWA 4J6IA 4LRZA 3W9FA 3PEVB 2B0OE 1YYHA 3KS2A 3FUKA 4HLEA 1X5BA 2PM7A 2L6JA 4I6JA 1X81A 5KJKA 3V31A 4FLBA 4RLYA 3D9NA 4V3IA 3PRZA 2OOEA 3LY7A 3UI2A 4APFA 2X6JA 1N54A 3Q47B 5AQBA 3E30A 3NOCD 2UY1B 4G11A 2WQ7A 3OXGA 3NOGD 3CVYA 5IY5E 4J8EA 4FA6A 3FUJA 3PUJA 4B8CB 3SBTB 1QZ2A 5JJ7A 2L0IA 1YCSB 5HS0A 5CCLA 3I5PA 2DVWA 2J49A 4JD2G 3S7DA 3UX4A 3G2UA 4YDEA 3JQ0A 3ZVVA 2H6IA 4ACLA 1V55E 4Y6WA 3LY9A 3QWVA 3UKRG 2OVBA 2QFCA 3S7JA 3FU0A 5CEDB 1Z5SC 3KSQA 1HG2A 1MX4A 1WG0A 1SA4A 3CK7A 1N11A 1LTXA 1N0QA 3FH7A 4GTPA 3CVQA 4YDOA 1WDYA 4I1OB 3EHQA 4TUUA 1UOHA 1Y8MA 3Q5MA 4O60A 3FHEA 3ASHA 2UWJG 3FDHA 3SO8A 3KD7A 4ATZD 3IBEA 4NACA 4DLQA 3L08A 3MZLB 1BLXB 2VSYA 2AXZA 3L82A 4GTOA 2BKGA 4DI4A 4JVSA 3FTUA 1N95A 1JPLA 4KBQA 3W9GA 2MYOA 4DPRA 4I6GA 2MRIA 5BV0A 5D66A 3SF4A 5T3RA 5FT9A 5C2YA 3TJPA 2KM4A 5CBNA 5FQ8A 3QKYA 4GTRA 1JCRA 3DSXA 3ABME 2PL2A 4I9EA 1JWFA 4XKCA 4I17A 3QDNA 3D9LA 4DUIA 3HYMB 4I6EA 1KPSB 3OAWA 4EBAG 2DZOA 5JMND 1UJJA 4HNAD 3QAQA 3TWUA 5FQ7A 2A4ZA 5AIJA 2KZTB 1NA3A 3IEGA 4ANUA 2GRMA 2WPVA 4KZCA 4E6HA 1HXIA 4U8VD 2L6BA 4GA0A 4OVVA 4CT0A 3NB2A 3JQ1A 4IYPA 4J8FA 4N39A 3EHMA 1WM5A 3URZA 4O6FA 1LF8A 4DX5D 1EPUA 3C3QA 2XZTG 3L22A 1S64A 4XZ4A 3ASGA 1EF1C 3FH5A 3LPZA 1Y6IA 1FCHA 4DK5A 4EHMA 3CHPA 2XGMA 4XEIG 2OEVA 1E8XA 4XI0A 3QJZA 3X2QE 5EN5D 1UW4B 2XPYA 5ENSD 1H6PA 4B89A 1HO8A 1N9AA 3EUVA 3Q7AA 2MOWA 1MYOA 1OCCE 4UI9K 3ABLE 5AJLA 2WXLA 4WAFA 3SFYA 4CRWA 4ABNA 4GMJA 1SVXA 3Q78A 3PDNA 3RU0A 3PE4A 2FF4A 3HDXA 3ABKE 4FULA 2LAIA 3U3WA 4AY5A 1KZPA 4U8HA 4ZHBA 4DX6D 2A5UA 3LCAA 1PAQA 3IHYA 3S7FA 3N71A 2IFUA 3RO3A 2HO1A 2P9UG 2PZIA 3DXMG 2H6FA 2IOSA 4DX1A 3UT8A 3GZ1A
chains in the Genus database with same CATH topology
4BERA 2XENA 2FO1E 3J5PA 5ENTD 4U8YD 3T9KA 2XEHA 2ZGDA 4O1PA 3B7BA 2J8SD 2BKGA 2V4HC 2Y1LE 3D9HA 5AQBA 2ETAA 3TWVA 5EIBE 3NOCD 3TWQA 4DX5D 1IXVA 3V2OA 4LG6A 2KBXA 2BKKB 2XZTG 4K5AB 5ENQD 1K1BA 3W9GA 4OAVB 2MYOA 1MX2A 3EHRA 3NOGD 3AAAC 3DEPA 5KBAA 1AP7A 2NYJA 5EILA 4JB8P 2ETBA 5EIDA 5FINA 5KNGA 3TWRA 3ZU7B 5CEAA 1BI7B 5HRYA 3B95A 3ZKJA 2RFAA 5ENOD 5KWDA 4LSZE 4GMRA 3KEAA 5CBOA 2Y0BG 5D66A 4HI8A 4DX7D 3Q9UC 1NFIE 4O1OA 1OY3D 3JXIA 1YCSB 5HS0A 4HQDA 3TWXA 4BETA 1IKND 5AQ9A 2V5QC 2DVWA 1YMPA 5ENRD 4HI9A 1S70B 4K5BA 5AARA 5EYPF 4K5CA 1IHBA 5EN5D 5ENSD 2P2CP 4LNUD 3T8KA 3TWSA 3AJIA 3EU9A 2QYJA 4HBDA 2F37A 1K1AA 5FIOA 3UXGA 4DX2A 5ENPD 3TWWA 5CBNA 4HLLA 3HG0D 3JUEA 4YDYA 3C5RA 5AN8A 1D9SA 4F6RD 1DC2A 1MYOA 4GPMA 3V79K 1MJ0A 2ETCA 5KNHD 4F1PA 5CERB 2AJAA 1K3ZD 5AQAA 1MX6A 4C48B 1SW6A 2KXPC 3J5QB 4A63B 2RFMA 4G8KA 3NBNB 4U95D 3TWTA 5AQ7A 5CEDB 3IXEA 3ZUVB 4CYMD 4DUIA 1TR4A 5ITZF 3ZNGA 1BI8B 5EYLA 1SVXA 1OT8A 2A5EA 1MX4A 1WG0A 2QC9A 2VGEA 4J8YA 4NIKA 4Z68A 4G8LA 1AWCB 1N11A 1N0QA 3UTMA 4ZFHA 3F6QA 4HB5A 2JABA 5CECB 4UUCA 1BU9A 4QFVA 4QQIA 3V2XA 2DZOA 4HRMB 4DRXE 1QYMA 5JMND 4J7WA 4OAUC 3HRAA 4ZHBA 4HNAD 3W9FA 4HRLA 3TWUA 1WDYA 2XZDG 3EHQA 5JA4D 1N0RA 4DX6D 5AAOA 2XEEA 2B0OE 1BD8A 1UOHA 1YYHA 2F8YA 1A5EA 3UI2A 5BXUA 2HE0A 4HRNA 2DZNA 1G3NB 4O60A 1DCQA 2F8XK 2ZGGA 4N5QA 2DWZA 4YDWA 3V31A 2PNNA 3Q9NC 4U8VD 4BEPA 2L6BA 3SO8A 3V30A 4RLYA 4TUMA 3LJNA 4CZ2D 4U96D 4ATZD 4DX1A 4BESA 4BSZB 3JXJA 5HKPA 4B93B 1BLXB 3DEOA 5BXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BER A;  2XEN A;  2FO1 E;  3J5P A;  5ENT D;  4U8Y D;  3T9K A;  2XEH A;  2ZGD A;  4O1P A;  3B7B A;  2J8S D;  2BKG A;  2V4H C;  2Y1L E;  3D9H A;  5AQB A;  2ETA A;  3TWV A;  5EIB E;  3NOC D;  3TWQ A;  4DX5 D;  1IXV A;  3V2O A;  4LG6 A;  2KBX A;  2BKK B;  2XZT G;  4K5A B;  5ENQ D;  1K1B A;  3W9G A;  4OAV B;  2MYO A;  1MX2 A;  3EHR A;  3NOG D;  3AAA C;  3DEP A;  5KBA A;  1AP7 A;  2NYJ A;  5EIL A;  4JB8 P;  2ETB A;  5EID A;  5FIN A;  5KNG A;  3TWR A;  3ZU7 B;  5CEA A;  1BI7 B;  5HRY A;  3B95 A;  3ZKJ A;  2RFA A;  5ENO D;  5KWD A;  4LSZ E;  4GMR A;  3KEA A;  5CBO A;  2Y0B G;  5D66 A;  4HI8 A;  4DX7 D;  3Q9U C;  1NFI E;  4O1O A;  1OY3 D;  3JXI A;  1YCS B;  5HS0 A;  4HQD A;  3TWX A;  4BET A;  1IKN D;  5AQ9 A;  2V5Q C;  2DVW A;  1YMP A;  5ENR D;  4HI9 A;  1S70 B;  4K5B A;  5AAR A;  5EYP F;  4K5C A;  1IHB A;  5EN5 D;  5ENS D;  2P2C P;  4LNU D;  3T8K A;  3TWS A;  3AJI A;  3EU9 A;  2QYJ A;  4HBD A;  2F37 A;  1K1A A;  5FIO A;  3UXG A;  4DX2 A;  5ENP D;  3TWW A;  5CBN A;  4HLL A;  3HG0 D;  3JUE A;  4YDY A;  3C5R A;  5AN8 A;  1D9S A;  4F6R D;  1DC2 A;  1MYO A;  4GPM A;  3V79 K;  1MJ0 A;  2ETC A;  5KNH D;  4F1P A;  5CER B;  2AJA A;  1K3Z D;  5AQA A;  1MX6 A;  4C48 B;  1SW6 A;  2KXP C;  3J5Q B;  4A63 B;  2RFM A;  4G8K A;  3NBN B;  4U95 D;  3TWT A;  5AQ7 A;  5CED B;  3IXE A;  3ZUV B;  4CYM D;  4DUI A;  1TR4 A;  5ITZ F;  3ZNG A;  1BI8 B;  5EYL A;  1SVX A;  1OT8 A;  2A5E A;  1MX4 A;  1WG0 A;  2QC9 A;  2VGE A;  4J8Y A;  4NIK A;  4Z68 A;  4G8L A;  1AWC B;  1N11 A;  1N0Q A;  3UTM A;  4ZFH A;  3F6Q A;  4HB5 A;  2JAB A;  5CEC B;  4UUC A;  1BU9 A;  4QFV A;  4QQI A;  3V2X A;  2DZO A;  4HRM B;  4DRX E;  1QYM A;  5JMN D;  4J7W A;  4OAU C;  3HRA A;  4ZHB A;  4HNA D;  3W9F A;  4HRL A;  3TWU A;  1WDY A;  2XZD G;  3EHQ A;  5JA4 D;  1N0R A;  4DX6 D;  5AAO A;  2XEE A;  2B0O E;  1BD8 A;  1UOH A;  1YYH A;  2F8Y A;  1A5E A;  3UI2 A;  5BXU A;  2HE0 A;  4HRN A;  2DZN A;  1G3N B;  4O60 A;  1DCQ A;  2F8X K;  2ZGG A;  4N5Q A;  2DWZ A;  4YDW A;  3V31 A;  2PNN A;  3Q9N C;  4U8V D;  4BEP A;  2L6B A;  3SO8 A;  3V30 A;  4RLY A;  4TUM A;  3LJN A;  4CZ2 D;  4U96 D;  4ATZ D;  4DX1 A;  4BES A;  4BSZ B;  3JXJ A;  5HKP A;  4B93 B;  1BLX B;  3DEO A;  5BXO A; 
#chains in the Genus database with same CATH topology
 2AVP A;  4U8Y D;  4K03 A;  5G2N A;  3UUX A;  1W3B A;  4WNF A;  3LVQ E;  4JA7 A;  1N94 A;  4AV7 A;  2I6H A;  4GYO A;  5M72 A;  5EIL A;  4PS8 A;  1TNZ A;  1OWO A;  5KWD A;  2KCV A;  2EIN E;  4Q96 A;  3BG0 B;  4K5C A;  3S7B A;  3RRU A;  1JWG A;  4L2Y A;  4HLL A;  4GB9 A;  2VQ2 A;  3ZRH A;  5ENN A;  3R7Q A;  4G8K A;  4XI9 A;  3LXU X;  3ASF A;  3EHN A;  2HM8 A;  1FT2 A;  2NXP A;  2L9B A;  1SQM A;  1D8D A;  4QQI A;  3MV3 B;  4JW1 A;  3LVR E;  3EU5 A;  1TN8 A;  2PQR A;  3HRA A;  4FHK A;  2C0L A;  2J4B A;  1A5E A;  3FU3 A;  3LJ3 A;  2DBA A;  3ML8 A;  4HRN A;  4N3A A;  4TV3 A;  2J09 A;  1IQR A;  3C98 A;  3CVU A;  4J8S A;  2VSX E;  3JCK C;  1OXJ A;  1U3C A;  2HR2 A;  3UQ3 A;  3VLD A;  1SA5 A;  1FT1 A;  4BSZ B;  1TYQ G;  3D9I A;  4O1P A;  1O5M A;  3OXF A;  5EIB E;  1HX8 A;  2ZIR A;  2BKK B;  3SBS A;  1K1B A;  5J90 A;  4Q69 A;  3RJV A;  3SY2 A;  2WVI A;  1H2V C;  5KNG A;  3ZKJ A;  3ISM C;  3HXF A;  5FJY A;  2HYZ A;  3UIP C;  5B3S E;  2EIJ E;  4N5C A;  2J9Q A;  3JXI A;  5BT1 A;  3ESL A;  2LO6 A;  2P2C P;  4FHJ A;  2LSU A;  3UXG A;  1MQS A;  4DX2 A;  3ULY A;  4MBG A;  3JUE A;  4YDY A;  4MRU A;  3UKU G;  4EZJ A;  3MEK A;  2GW1 A;  3LEW A;  1HFA A;  3Q75 A;  3OXL A;  3B7U X;  3BUA A;  5KJN A;  5A6C A;  3D9P A;  2VGX B;  4NIK A;  2Y69 E;  3UM2 A;  3R9M A;  5KJM A;  5FQ6 A;  4LEU A;  3ZGQ A;  4CGV A;  3KAE A;  3RKV A;  3G2T A;  1N4Q A;  4HRL A;  3U66 A;  2R2L A;  1ZU2 A;  4HOU A;  3T5X A;  1YA0 A;  2F8X K;  4L9P A;  2X38 A;  2ZGG A;  2E0I A;  3MKQ A;  3AG3 E;  5FQ4 A;  3V30 A;  4OYS A;  5AEN A;  3CQG B;  3Q4A B;  1OWM A;  3FUL A;  2GRQ B;  2H6H A;  3ZFW A;  2GRO B;  5DIZ A;  3LS8 A;  3E32 A;  3FP3 A;  5EID A;  3VLE A;  1BI7 B;  3APC A;  2P58 C;  3CKC A;  4BX9 A;  1A17 A;  3CVX A;  2WXI A;  4FLH A;  1L5J A;  2OVF A;  5ENR D;  3T8K A;  4R7L A;  1ELK A;  1O1T A;  1U3D A;  1U2V G;  3ONL A;  1IYG A;  3NF1 A;  5CMW A;  3B7S A;  3HVE B;  3Q79 A;  1ELR A;  4CEM A;  3AG1 E;  4ILG A;  3UM1 A;  3FEX A;  3BEE A;  4D10 C;  5BUZ A;  3QNK A;  2AWI A;  3CK8 A;  2AXU A;  1FVF A;  4JHR A;  3FEY A;  2RKK A;  4Z68 A;  5ANL A;  3G2S A;  2QZA A;  3CQC B;  4GCN A;  4F7A A;  4NRH B;  3TG4 A;  2H6G A;  2IO2 C;  3AU5 A;  2F8Y A;  5G05 J;  4GA1 A;  2FEZ A;  3PZ1 A;  3DPD A;  4I1A A;  3U64 A;  3L17 A;  4YDW A;  4BEP A;  3GZ2 A;  2LUH A;  3CEQ A;  2KCK A;  4MKT A;  5BXO A;  2J8S D;  1QBQ A;  4OAV B;  4DLO A;  5ANR A;  5CMY A;  4U0Z A;  2P9K G;  2QY7 A;  2XPI A;  4HOQ A;  4A1G A;  3SI5 A;  4DI3 A;  2IO3 C;  4GA2 A;  1NA0 A;  3IV0 A;  4B94 A;  2LSV A;  4RG6 A;  3G2W A;  4FJZ A;  4U7E B;  3HXC A;  1IKN D;  4KVO A;  5AQ9 A;  4HI9 A;  1S70 B;  5DBK A;  3EDT B;  4JEU A;  5EYP F;  3ASN E;  2E2E A;  3L16 A;  3HG0 D;  1JCQ A;  1OWN A;  3UT7 A;  5CER B;  1K3Z D;  1DNP A;  2KXP C;  3NBN B;  1INZ A;  3IXE A;  4CYM D;  4I1M A;  3SFX A;  3FTY A;  3B7R L;  4J8Y A;  1TJC A;  4BX8 A;  4ZFH A;  4C0E A;  3Q15 A;  1E96 B;  3HHM A;  4RQI A;  2ZIS A;  1QYM A;  3CLJ A;  3B13 A;  3ASO E;  4J0U A;  3KEZ A;  5JA4 D;  1N0R A;  4AP2 A;  1BD8 A;  3K9I A;  4FJY A;  4FAD A;  2GRR B;  2P9N G;  4XE0 A;  2DWZ A;  4C0M A;  3PZ4 A;  4GZ5 A;  2VGY A;  3PUK A;  5FWQ A;  3RAU A;  4U96 D;  3TGO A;  5D0O D;  2VJ8 A;  3PRE A;  5CHE E;  4A1S A;  3FTV A;  3AS4 A;  2KAT A;  3MA5 A;  2Y1L E;  4L23 A;  4BT9 A;  2J08 A;  3BU8 A;  4HVB A;  5G55 A;  1N52 A;  2GRP B;  5G04 J;  3ZU7 B;  3HXE A;  3ONK A;  3QWP A;  4LSZ E;  2ILR A;  2OEW A;  3WG7 E;  3E33 A;  4F1S A;  4P29 A;  2GRL A;  4BET A;  2FO7 A;  3MV2 B;  3AG2 E;  2P9L G;  3ULE G;  4FU3 A;  3SFZ A;  4GYW A;  3CHQ A;  3LYA A;  4KYO B;  1PC2 A;  4GZC A;  4EZL A;  4U0U A;  3FH8 A;  3CV0 A;  2GGF A;  3LKU A;  4YND A;  2L0T B;  4U04 A;  4GYY A;  4KXK B;  4HB5 A;  3PNT B;  2WB2 A;  1UN8 A;  3FTS A;  2XS1 A;  3VTX A;  3CST A;  1BPO A;  2P9S G;  3FUD A;  3CGH A;  3P1U A;  4X8Q A;  4AJW A;  3E37 A;  4AM9 A;  3PE3 A;  4B0Z A;  3TXN A;  2I1J A;  3J5P A;  3TXM A;  2R17 C;  3FFL A;  2LAH A;  3FUI A;  4GZ6 A;  2YIN A;  3KSL A;  1H6O A;  2ETB A;  2F0Y A;  3UIO C;  1FVH A;  3DSS A;  4G25 A;  4JHJ A;  5G05 C;  3VLF A;  3MKR A;  1E7U A;  2J4D A;  4FC8 A;  3RSE G;  4K5B A;  3FWV A;  2WXJ A;  1WAO 1;  3TWS A;  4PDX A;  1ZB1 A;  3Q7F A;  2WXF A;  4EQF A;  4ACK A;  4F6R D;  1LD8 A;  3SQV A;  1NP7 A;  2V5F A;  4C48 B;  4RVB A;  2NSZ A;  2Y3A A;  2I2O A;  3ZYL A;  5B1B E;  4YVQ C;  3IHV A;  4JZY A;  1Z3X A;  1BI8 B;  2A5E A;  2VGE A;  5CCM A;  2QC9 A;  1TNU A;  3QWW A;  1HZ4 A;  2IQC A;  2DYR E;  4CDM A;  4A3V A;  2VSN A;  5HI7 A;  2XGS A;  1TEZ A;  2XEE A;  3RRN B;  5CRU A;  4XIF A;  1G3N B;  3DPY A;  4GZD A;  3S2A A;  3ZHE B;  3CHR A;  3FU6 A;  2VTB A;  2EIL E;  5FTP A;  2JLB A;  2IOL A;  1Z6T A;  1O1R A;  1K8K G;  4CZ2 D;  3MCX A;  2X6H A;  3TG5 A;  3UM3 A;  3T9K A;  3FY4 A;  2ZGD A;  3I3N A;  2IEJ A;  4WWO A;  4A55 A;  2PM6 A;  1KZO A;  2NYJ A;  3QAR A;  3LY8 A;  3FUN A;  5KJL A;  5HRY A;  5ENO D;  2XCC A;  3ZXP A;  4LUN U;  4O1O A;  3FUE A;  4J8D A;  3QOU A;  2R59 A;  5EDS A;  3U4T A;  2CFZ A;  3DSW A;  4EEC A;  4GTS A;  5FIO A;  4W9R A;  1JUQ A;  2UY1 A;  3C5R A;  4BT8 A;  3O48 A;  4F1P A;  4E85 A;  5FZS A;  4WNG A;  5E76 A;  1SW6 A;  2IJG X;  2DCP A;  3UIN C;  3IKO B;  4JL0 A;  5G04 C;  4AEZ C;  4L7T A;  3ASD A;  3CVP A;  4M7C A;  2LXM A;  3UTM A;  3F6Q A;  4AXH A;  2CHW A;  4J7W A;  4UQX A;  4DJA A;  1Q2Z A;  3ZYM A;  5LFA A;  2XPZ A;  3AS5 A;  4HXI A;  3D9J A;  2XGO A;  3CR3 A;  3R9A B;  1TNB A;  3VTY A;  3B7T A;  4I2Z A;  4UWL A;  5ARF A;  1OUV A;  2XEN A;  4AIF A;  2FO1 E;  2XCB A;  1HH8 A;  3RRM B;  3DSV A;  3AU4 A;  5KBA A;  2KCL A;  3I4G A;  3LDZ A;  5CEA A;  3PEU B;  3EIJ A;  2C0M A;  2R05 A;  3P2B A;  2Y0B G;  4HI8 A;  2X6F A;  5JHB A;  4GPK A;  1IHB A;  4KZ0 A;  1PY1 A;  4I2W A;  2QYJ A;  4URK A;  4GPM A;  3V79 K;  1OWP A;  4ME2 A;  2OCC E;  2JEK A;  2AJA A;  5AQA A;  3HXB A;  5LOZ A;  1NZN A;  3ZW3 A;  3C3R A;  4MS6 A;  4U95 D;  5JJT A;  5AQ7 A;  4HFG A;  5LP0 A;  2BTD A;  4G8L A;  1TNY A;  2XQ0 A;  1UJK A;  3CVV A;  4GU5 A;  3DST A;  3V2X A;  3ZPJ A;  4AY6 A;  2WXK A;  1DCE A;  5AAO A;  2MHK A;  3L9T A;  1UN9 A;  3MJW A;  4C9B B;  4N5Q A;  4LNB A;  4WWP A;  3NZS A;  5CRV A;  5JJ6 A;  3SNX A;  4BES A;  5HKP A;  3NQP A;  3L13 A;  1HS6 A;  3D9K A;  5ENT D;  4XKB A;  4ILH B;  2Y4T A;  1EDU A;  3ZEF A;  2WXR A;  1IXV A;  2XHE A;  4LG6 A;  1MX2 A;  2KZT A;  2I1K A;  1OWL A;  5AYW D;  2X6K A;  5CBO A;  4KVM A;  4PS7 A;  5B1A E;  5BPP A;  3E34 A;  1N4P A;  2LNI A;  4M3O A;  3RIB A;  3D9M A;  3SGH A;  3ZIM A;  5C1D A;  3APF A;  4CGW A;  2F37 A;  3FTX A;  2EIK E;  4IRU A;  4ANW A;  5AN8 A;  2B6C A;  1ZBP A;  3EJN A;  4ATG A;  4IUL A;  5A23 A;  4I9C A;  1S63 A;  3C3O A;  1MX6 A;  5LX8 A;  2PQN A;  4GCO A;  3MKQ B;  4WNE A;  4A63 B;  2RFM A;  4N3B A;  4Q94 A;  1D8E A;  1TR4 A;  5ITZ F;  5ARG A;  3PZ2 A;  4PUC A;  1WY6 A;  4YVO A;  3JUI A;  5E75 A;  3SHF A;  3BQO A;  2GRN B;  4QFV A;  4HRM B;  4AVX A;  1DVP A;  2AXV A;  4BTB A;  5BXU A;  4GTT A;  2HE0 A;  3CVL A;  3QC1 A;  4L1B A;  5D0Q D;  4A3T A;  3U9W A;  2FI7 A;  3NAW A;  2XRY A;  5FZR A;  4H7X A;  3LJN A;  2P9P G;  2XEH A;  5FZQ A;  4G2V A;  2V4H C;  3TWV A;  2KC7 A;  3D9H A;  4BWR A;  3V2O A;  2EIM E;  3EHR A;  2WQH A;  1AP7 A;  1RW2 A;  3CSF A;  4UI9 J;  2C2L A;  4L2L A;  2RFA A;  3ZXS A;  3L6A A;  2CHX A;  4DX7 D;  3DSU A;  4JEH A;  4OVU A;  5EX3 A;  3TWX A;  4KMO A;  2WXP A;  4PS3 A;  2RD0 A;  1FPP A;  1MZC A;  3UMV A;  1XNF A;  4TRQ A;  1MJ0 A;  2VYI A;  2ETC A;  2YQ8 A;  2WXH A;  1RZ4 A;  3FTZ A;  4NUR A;  2X3M A;  3ML9 A;  3TWT A;  2WM9 A;  4PH4 B;  4LCT A;  4B8A A;  4JA9 A;  1UG3 A;  3MGB A;  4GZ3 A;  2WQ6 A;  3CKB A;  2BF0 X;  3FUM A;  1AWC B;  2VSO E;  4UWK A;  4CDN A;  3DWL G;  4DRX E;  4LER A;  3Q49 B;  4N2S A;  2WXO A;  3CHO A;  2XZD G;  4F53 A;  4I43 A;  4WUY A;  2WMN A;  2DZN A;  1HF8 A;  1DCQ A;  1IQU A;  4RSY A;  3ZYK A;  3CVN A;  1H2U A;  3I4R B;  2PNN A;  3Q9N C;  2YHC A;  4LNG A;  3ZHE A;  2Y4U A;  4B93 B;  3PVL A;  5LCW J;  3DEO A;  1HE8 A;  1XGW A;  2XRZ A;  2WXG A;  2X6I A;  4ILI A;  2Q7F A;  3B7B A;  2ETA A;  1IHG A;  4FP7 A;  2KBX A;  3GW4 A;  4K5A B;  5ENQ D;  2CFU A;  3WXX A;  3MYV A;  4Y6C A;  1NL4 A;  2WMO A;  1KT0 A;  5BV1 A;  3FUH A;  5BW8 C;  3PZ3 A;  4AOF A;  2CG2 A;  5EKQ D;  4TXP A;  1N4S A;  4BSX A;  1O1S A;  2WXN A;  1H0A A;  4HQD A;  2XEV A;  4ANX A;  5AAR A;  2V0P A;  2IY0 C;  4LNU D;  2V8S E;  1H6K A;  3AJI A;  4HBD A;  3DRA A;  5T4Y A;  5D2M C;  1DC2 A;  5KNH D;  3ESK A;  5BNW A;  4JXT A;  4UQZ A;  3FUF A;  3GZS A;  3ZNG A;  5JHA A;  3D9O A;  5AJD A;  1HG5 A;  3DXK G;  4GAA A;  4UUC A;  4RG9 A;  1E8W A;  4HS2 A;  1P5Q A;  5HQ8 A;  4JPS A;  1KT1 A;  3APD A;  1QNF A;  4U07 A;  3L54 A;  2OND A;  2BED A;  4G26 A;  1EYH A;  1H19 A;  4TUM A;  2J07 A;  2R5S A;  3JXJ A;  5H7P A;  2VGX A;  2ION A;  4BER A;  2OV8 A;  2EQX A;  3QB2 A;  2XS8 A;  1MHQ A;  3NZU A;  3D3M A;  3DEP A;  1NI1 A;  4CDR A;  2DYS E;  4JB8 P;  3CHS A;  5FIN A;  4NQ0 A;  3TWR A;  4EBA A;  3GYZ A;  3B95 A;  4TXQ A;  4WWN A;  3CVW A;  3Q9U C;  1NFI E;  4U0S A;  1OY3 D;  3UT4 A;  3RO2 A;  1V54 E;  4BTA A;  4N2Q A;  3AS8 A;  2ZXW E;  1E7V A;  3EU9 A;  4F3V A;  1SZA A;  2R03 A;  4XX5 A;  3RK6 A;  2M63 A;  4U63 A;  2R02 A;  3DBS A;  4GML A;  3ENE A;  4MLP A;  4UWG A;  3QK0 A;  5KCM A;  4GTQ A;  3EIQ C;  3T8M A;  3Q73 A;  2YNQ A;  2BUG A;  4BFR A;  3UPV A;  4JHK A;  2ZU6 B;  1SZ9 A;  4GTM A;  4UI9 C;  3HXD A;  3O4Z A;  4CT4 A;  4N3C A;  4CCA A;  4ANV A;  1JCS A;  1B89 A;  2JAB A;  4HOT A;  5A7D B;  3TAX A;  2CG3 A;  3E4B A;  4IN3 B;  4OAU C;  3T5V A;  1N4R A;  2FUL A;  3OTN A;  4H7Y A;  3HVE A;  1OCO E;  2WXM A;  3CIA A;  4UQY A;  3AG4 E;  1OCR E;  1TN7 A;  3FU5 A;  1Z3Y A;  1TNO A;  3CHM A;  1VDY A;  1S0P A;  1ELW A;  3PS6 A;  1H2T C;  2QYU A;  4TXR A;  3PH0 C;  3PZD A;  5EX0 A;  1OCZ E;  4G23 A;  2NC9 A;  2LXL A;  3TWQ A;  2CHZ A;  3ULQ A;  2DIW A;  1TN6 A;  1QQE A;  2RG8 A;  3AAA C;  3SZ7 A;  2YHE A;  4HOS A;  3BG1 B;  4BY6 A;  3CK9 A;  2I9C A;  3HIZ A;  2IF4 A;  4GMR A;  3KEA A;  4WND A;  3TL5 A;  1E8Z A;  3C72 A;  4UWF A;  2V5Q C;  4KT6 B;  1YMP A;  3G2V A;  2FBN A;  4EZK A;  4EPZ A;  1TJF A;  2AW6 A;  3ZYQ A;  4JC8 A;  5LCW C;  1K1A A;  1LD7 A;  4HOR A;  5ENP D;  3TWW A;  1D9S A;  4G24 A;  1HU3 A;  1GW6 A;  4UWH A;  4G1T A;  3J5Q B;  5J08 A;  3R7R A;  4GTV A;  2VTB B;  3ZUV B;  3UM0 A;  4APO A;  3PNL B;  5EYL A;  1OT8 A;  2WXQ A;  2P9I G;  3MX3 A;  2IU1 A;  3SD5 A;  1KLX A;  5CEC B;  5T8I A;  1BU9 A;  4K0R A;  3ZN3 A;  3JYS A;  2V4L A;  1E90 A;  1E8Y A;  3FTW A;  4J6I A;  4LRZ A;  3W9F A;  3PEV B;  2B0O E;  1YYH A;  3KS2 A;  3FUK A;  4HLE A;  1X5B A;  2PM7 A;  2L6J A;  4I6J A;  1X81 A;  5KJK A;  3V31 A;  4FLB A;  4RLY A;  3D9N A;  4V3I A;  3PRZ A;  2OOE A;  3LY7 A;  3UI2 A;  4APF A;  2X6J A;  1N54 A;  3Q47 B;  5AQB A;  3E30 A;  3NOC D;  2UY1 B;  4G11 A;  2WQ7 A;  3OXG A;  3NOG D;  3CVY A;  5IY5 E;  4J8E A;  4FA6 A;  3FUJ A;  3PUJ A;  4B8C B;  3SBT B;  1QZ2 A;  5JJ7 A;  2L0I A;  1YCS B;  5HS0 A;  5CCL A;  3I5P A;  2DVW A;  2J49 A;  4JD2 G;  3S7D A;  3UX4 A;  3G2U A;  4YDE A;  3JQ0 A;  3ZVV A;  2H6I A;  4ACL A;  1V55 E;  4Y6W A;  3LY9 A;  3QWV A;  3UKR G;  2OVB A;  2QFC A;  3S7J A;  3FU0 A;  5CED B;  1Z5S C;  3KSQ A;  1HG2 A;  1MX4 A;  1WG0 A;  1SA4 A;  3CK7 A;  1N11 A;  1LTX A;  1N0Q A;  3FH7 A;  4GTP A;  3CVQ A;  4YDO A;  1WDY A;  4I1O B;  3EHQ A;  4TUU A;  1UOH A;  1Y8M A;  3Q5M A;  4O60 A;  3FHE A;  3ASH A;  2UWJ G;  3FDH A;  3SO8 A;  3KD7 A;  4ATZ D;  3IBE A;  4NAC A;  4DLQ A;  3L08 A;  3MZL B;  1BLX B;  2VSY A;  2AXZ A;  3L82 A;  4GTO A;  2BKG A;  4DI4 A;  4JVS A;  3FTU A;  1N95 A;  1JPL A;  4KBQ A;  3W9G A;  2MYO A;  4DPR A;  4I6G A;  2MRI A;  5BV0 A;  5D66 A;  3SF4 A;  5T3R A;  5FT9 A;  5C2Y A;  3TJP A;  2KM4 A;  5CBN A;  5FQ8 A;  3QKY A;  4GTR A;  1JCR A;  3DSX A;  3ABM E;  2PL2 A;  4I9E A;  1JWF A;  4XKC A;  4I17 A;  3QDN A;  3D9L A;  4DUI A;  3HYM B;  4I6E A;  1KPS B;  3OAW A;  4EBA G;  2DZO A;  5JMN D;  1UJJ A;  4HNA D;  3QAQ A;  3TWU A;  5FQ7 A;  2A4Z A;  5AIJ A;  2KZT B;  1NA3 A;  3IEG A;  4ANU A;  2GRM A;  2WPV A;  4KZC A;  4E6H A;  1HXI A;  4U8V D;  2L6B A;  4GA0 A;  4OVV A;  4CT0 A;  3NB2 A;  3JQ1 A;  4IYP A;  4J8F A;  4N39 A;  3EHM A;  1WM5 A;  3URZ A;  4O6F A;  1LF8 A;  4DX5 D;  1EPU A;  3C3Q A;  2XZT G;  3L22 A;  1S64 A;  4XZ4 A;  3ASG A;  1EF1 C;  3FH5 A;  3LPZ A;  1Y6I A;  1FCH A;  4DK5 A;  4EHM A;  3CHP A;  2XGM A;  4XEI G;  2OEV A;  1E8X A;  4XI0 A;  3QJZ A;  3X2Q E;  5EN5 D;  1UW4 B;  2XPY A;  5ENS D;  1H6P A;  4B89 A;  1HO8 A;  1N9A A;  3EUV A;  3Q7A A;  2MOW A;  1MYO A;  1OCC E;  4UI9 K;  3ABL E;  5AJL A;  2WXL A;  4WAF A;  3SFY A;  4CRW A;  4ABN A;  4GMJ A;  1SVX A;  3Q78 A;  3PDN A;  3RU0 A;  3PE4 A;  2FF4 A;  3HDX A;  3ABK E;  4FUL A;  2LAI A;  3U3W A;  4AY5 A;  1KZP A;  4U8H A;  4ZHB A;  4DX6 D;  2A5U A;  3LCA A;  1PAQ A;  3IHY A;  3S7F A;  3N71 A;  2IFU A;  3RO3 A;  2HO1 A;  2P9U G;  2PZI A;  3DXM G;  2H6F A;  2IOS A;  4DX1 A;  3UT8 A;  3GZ1 A; 
#chains in the Genus database with same CATH homology
 4BER A;  2XEN A;  2FO1 E;  3J5P A;  5ENT D;  4U8Y D;  3T9K A;  2XEH A;  2ZGD A;  4O1P A;  3B7B A;  2J8S D;  2BKG A;  2V4H C;  2Y1L E;  3D9H A;  5AQB A;  2ETA A;  3TWV A;  5EIB E;  3NOC D;  3TWQ A;  4DX5 D;  1IXV A;  3V2O A;  4LG6 A;  2KBX A;  2BKK B;  2XZT G;  4K5A B;  5ENQ D;  1K1B A;  3W9G A;  4OAV B;  2MYO A;  1MX2 A;  3EHR A;  3NOG D;  3AAA C;  3DEP A;  5KBA A;  1AP7 A;  2NYJ A;  5EIL A;  4JB8 P;  2ETB A;  5EID A;  5FIN A;  5KNG A;  3TWR A;  3ZU7 B;  5CEA A;  1BI7 B;  5HRY A;  3B95 A;  3ZKJ A;  2RFA A;  5ENO D;  5KWD A;  4LSZ E;  4GMR A;  3KEA A;  5CBO A;  2Y0B G;  5D66 A;  4HI8 A;  4DX7 D;  3Q9U C;  1NFI E;  4O1O A;  1OY3 D;  3JXI A;  1YCS B;  5HS0 A;  4HQD A;  3TWX A;  4BET A;  1IKN D;  5AQ9 A;  2V5Q C;  2DVW A;  1YMP A;  5ENR D;  4HI9 A;  1S70 B;  4K5B A;  5AAR A;  5EYP F;  4K5C A;  1IHB A;  5EN5 D;  5ENS D;  2P2C P;  4LNU D;  3T8K A;  3TWS A;  3AJI A;  3EU9 A;  2QYJ A;  4HBD A;  2F37 A;  1K1A A;  5FIO A;  3UXG A;  4DX2 A;  5ENP D;  3TWW A;  5CBN A;  4HLL A;  3HG0 D;  3JUE A;  4YDY A;  3C5R A;  5AN8 A;  1D9S A;  4F6R D;  1DC2 A;  1MYO A;  4GPM A;  3V79 K;  1MJ0 A;  2ETC A;  5KNH D;  4F1P A;  5CER B;  2AJA A;  1K3Z D;  5AQA A;  1MX6 A;  4C48 B;  1SW6 A;  2KXP C;  3J5Q B;  4A63 B;  2RFM A;  4G8K A;  3NBN B;  4U95 D;  3TWT A;  5AQ7 A;  5CED B;  3IXE A;  3ZUV B;  4CYM D;  4DUI A;  1TR4 A;  5ITZ F;  3ZNG A;  1BI8 B;  5EYL A;  1SVX A;  1OT8 A;  2A5E A;  1MX4 A;  1WG0 A;  2QC9 A;  2VGE A;  4J8Y A;  4NIK A;  4Z68 A;  4G8L A;  1AWC B;  1N11 A;  1N0Q A;  3UTM A;  4ZFH A;  3F6Q A;  4HB5 A;  2JAB A;  5CEC B;  4UUC A;  1BU9 A;  4QFV A;  4QQI A;  3V2X A;  2DZO A;  4HRM B;  4DRX E;  1QYM A;  5JMN D;  4J7W A;  4OAU C;  3HRA A;  4ZHB A;  4HNA D;  3W9F A;  4HRL A;  3TWU A;  1WDY A;  2XZD G;  3EHQ A;  5JA4 D;  1N0R A;  4DX6 D;  5AAO A;  2XEE A;  2B0O E;  1BD8 A;  1UOH A;  1YYH A;  2F8Y A;  1A5E A;  3UI2 A;  5BXU A;  2HE0 A;  4HRN A;  2DZN A;  1G3N B;  4O60 A;  1DCQ A;  2F8X K;  2ZGG A;  4N5Q A;  2DWZ A;  4YDW A;  3V31 A;  2PNN A;  3Q9N C;  4U8V D;  4BEP A;  2L6B A;  3SO8 A;  3V30 A;  4RLY A;  4TUM A;  3LJN A;  4CZ2 D;  4U96 D;  4ATZ D;  4DX1 A;  4BES A;  4BSZ B;  3JXJ A;  5HKP A;  4B93 B;  1BLX B;  3DEO A;  5BXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...