3IXEA

Structural basis of competition between pinch1 and pinch2 for binding to the ankyrin repeat domain of integrin-linked kinase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
171
structure length
171
Chain Sequence
GSPEFMDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/signaling protein
molecule keywords Integrin-linked protein kinase
publication title Structural basis of competition between PINCH1 and PINCH2 for binding to the ankyrin repeat domain of integrin-linked kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 171
sequence length 171
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13637 Ank_4 Ankyrin repeats (many copies)
A PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3ixeA00
3JXIA 4K5AB 1IHBA 1K1BA 5KNHD 1SVXA 1BU9A 4DX1A 5EYLA 4BESA 3UTMA 2ZGGA 4DX6D 1BI7B 1YYHA 3AAAC 3T9KA 2B0OE 4HRMB 2F37A 2ZGDA 3D9HA 4HRLA 3Q9NC 5HRYA 4DX5D 1MYOA 2XEHA 5CBNA 4NIKA 3W9GA 4F6RD 5CECB 1N0QA 4B93B 2A5EA 3B7BA 4ATZD 3DEPA 3AJIA 5AN8A 1N0RA 5AQ9A 4YDYA 3C5RA 3TWQA 5JA4D 1WDYA 2VGEA 4HRNA 5KWDA 2MYOA 3HG0D 4ZFHA 4C48B 4DRXE 4QFVA 2V5QC 3J5PA 3V2XA 4DX2A 2F8XK 2Y0BG 1SW6A 2XZTG 1K3ZD 5HS0A 2RFMA 2DZOA 2ETBA 1MX2A 3TWXA 5BXUA 1DC2A 4K5BA 2NYJA 1OY3D 5JMND 4RLYA 2XZDG 5EILA 2XENA 5EN5D 3F6QA 1BI8B 2J8SD 3EHRA 4HNAD 1S70B 2QC9A 4TUMA 5AAOA 1D9SA 1IKND 2KBXA 4U8YD 1K1AA 4HI8A 5EIDA 5ENRD 5BXOA 4HLLA 3ZKJA 5AQAA 3Q9UC 4U95D 5FINA 4O1OA 4G8KA 3HRAA 2F8YA 4UUCA 4OAVB 2Y1LE 5FIOA 4CYMD 3NOGD 4N5QA 4QQIA 1AWCB 1MJ0A 4HB5A 1BD8A 3EHQA 2L6BA 4F1PA 1AP7A 4O60A 4BSZB 4HQDA 5KBAA 2V4HC 3J5QB 4LG6A 1IXVA 4ZHBA 4G8LA 1TR4A 3TWWA 2ETCA 4GPMA 5KNGA 2PNNA 3V30A 3V79K 5ENSD 3UI2A 5HKPA 1UOHA 4OAUC 5ITZF 4GMRA 5AQBA 3TWSA 2BKKB 5AQ7A 1NFIE 2RFAA 2P2CP 4LNUD 1QYMA 3LJNA 1BLXB 3DEOA 2FO1E 2DVWA 2JABA 4U96D 5ENOD 4Z68A 3IXEA 2QYJA 4HI9A 4J8YA 5AARA 1MX4A 5ENTD 4DX7D 1YCSB 3W9FA 3EU9A 5ENQD 3UXGA 3TWUA 4K5CA 4BEPA 4JB8P 5EYPF 1MX6A 5D66A 5CBOA 1N11A 2XEEA 5CERB 4BERA 2BKGA 2AJAA 1DCQA 2DZNA 3TWVA 4YDWA 3ZUVB 5CEAA 3NOCD 3KEAA 3T8KA 4U8VD 4O1PA 3ZNGA 1A5EA 3V2OA 3JUEA 4J7WA 3B95A 4DUIA 3TWTA 4A63B 3JXJA 3SO8A 1YMPA 4LSZE 4CZ2D 1G3NB 2ETAA 4BETA 3ZU7B 2HE0A 5CEDB 5EIBE 2DWZA 1WG0A 5ENPD 3NBNB 4HBDA 3V31A 2KXPC 3TWRA 1OT8A
chains in the Genus database with same CATH superfamily
3ASHA 4JEHA 3NB2A 3JYSA 2Y4TA 3SNXA 3CVWA 4DX5D 4HRLA 4JEUA 4B93B 2A5EA 2WVIA 2LO6A 3TWQA 4ZFHA 1U2VG 3TG4A 4GAAA 2IOLA 1FCHA 2X6JA 1HFAA 4I6GA 4B8AA 5JJTA 1IKND 2KBXA 5FINA 3B7RL 4UUCA 4I1MA 3OXLA 5LCWJ 4PDXA 2WQHA 2EIME 4G8LA 3TWWA 2DYSE 3ZRHA 4M3OA 3HXEA 3TWUA 4HLEA 4BEPA 4XI0A 3C3QA 2XS1A 3ZYMA 3ZUVB 2P9LG 3L08A 1O1SA 4N3CA 3LY9A 4N2SA 3TG5A 2B6CA 3FUIA 3JXJA 3SO8A 4JVSA 3CK8A 4BETA 4AY5A 5J90A 3ZU7B 3LKUA 3HHMA 4K03A 1TNOA 4KZCA 2XPYA 4M7CA 1OCCE 4EBAA 1BI7B 3PZ3A 4TXPA 1IQRA 4PS3A 2Y69E 5ENNA 1N4SA 1DCEA 3QKYA 2EINE 5HS0A 2DZOA 5BXUA 3AS8A 3DBSA 2P9SG 1TNBA 3CGHA 4TRQA 1HXIA 1W3BA 4EPZA 3CHOA 2L9BA 4EECA 4O1OA 4G8KA 3ZIMA 2Y1LE 2WXPA 4FADA 2XS8A 3FEYA 4I9EA 4LG6A 1L5JA 2VYIA 3APDA 2ETCA 3RU0A 3AG3E 3Q47B 3TWSA 2IO3C 4Q94A 2CG3A 2OEVA 5T4YA 3CK7A 2L0TB 1KZPA 3EU9A 3ZGQA 4CRWA 5D0QD 1A17A 4DPRA 4UWFA 4B8CB 3UQ3A 1N95A 1NA3A 3S7JA 2P9KG 4AY6A 2LAHA 4LERA 3NZUA 4FLBA 5B1AE 1IHBA 4UQYA 2BF0X 4Q69A 2HO1A 3EJNA 1FT1A 3SY2A 5AJDA 3FTWA 3JQ1A 4UWGA 2XCBA 2VGYA 4GCOA 1YA0A 3G2UA 3ZYLA 4FC8A 4CGWA 2X38A 3HXFA 3WG7E 2VQ2A 4QFVA 2XZTG 1Z5SC 1K3ZD 4X8QA 3UT7A 2CHWA 1OUVA 3L22A 3FTSA 4K5BA 3TXMA 3ENEA 3LYAA 5JMND 3MGBA 2IEJA 1N9AA 2WM9A 3CLJA 2V5FA 2GRLA 5CRVA 2IO2C 3PE3A 4U95D 3CEQA 2F8YA 1TEZA 3ZYQA 4HB5A 3L17A 3J5QB 3QB2A 4N2QA 4HXIA 4ABNA 3RRMB 3C3OA 5B3SE 2WXJA 3EDTB 3V79K 1EPUA 2KC7A 3FH7A 4G23A 2AXZA 4FJYA 2GGFA 2JABA 2QYJA 3S7BA 4AJWA 2WPVA 4K5CA 2V8SE 4J8FA 3G2WA 3E34A 4BERA 4ANWA 1TYQG 1JPLA 2IOSA 1XGWA 4APFA 3ZNGA 4A1SA 2KATA 1PC2A 4A63B 4KZ0A 3B7TA 3S7DA 2KZTB 1SVXA 2FULA 3ZPJA 4U63A 4HRMB 2F37A 3CHSA 2V0PA 4U8HA 5CECB 4L2LA 4KXKB 4DRXE 3L9TA 1E90A 3PREA 1MX2A 2J4BA 3CIAA 3UM2A 2NYJA 2LSUA 5EN5D 5EILA 2XENA 4RG6A 4I2WA 2IF4A 3RIBA 4A3VA 2R17C 4TXRA 4U8YD 4XI9A 5BXOA 1X81A 3GZ1A 3FUJA 2XGMA 4G11A 1MJ0A 3ZXPA 3SF4A 3KSQA 3U66A 2MOWA 2XHEA 2ZU6B 3TAXA 1IXVA 5ENSD 3CR3A 4XE0A 4Z68A 1DVPA 4CDNA 1YCSB 4FP7A 1HE8A 2X6HA 2OV8A 2IU1A 4GCNA 3FUHA 4LCTA 1S64A 3TL5A 4B94A 5CBOA 3FFLA 2ZIRA 2AJAA 2NSZA 3O4ZA 4YDWA 1JCSA 2R5SA 2C2LA 1NL4A 3FU6A 4RG9A 2ZISA 4JHRA 3PZ2A 2QZAA 5FZQA 4P29A 1ZB1A 3MYVA 1N4PA 5HQ8A 5EYLA 3Q73A 4I1AA 3T5XA 3T9KA 1NA0A 2GRNB 2UY1B 3D9OA 3KAEA 5FZSA 1OCZE 3P1UA 4ILGA 4ATZD 2WMOA 4WNGA 2YQ8A 3C5RA 4MKTA 4JL0A 2MYOA 1P5QA 5BV1A 2X6KA 2DIWA 3PRZA 4WNEA 3R7QA 4N3AA 1IYGA 3GZSA 4HFGA 3E33A 3C3RA 1B89A 3PS6A 3D9KA 4UI9C 4EZLA 3OAWA 3CQGB 2MHKA 4WNFA 2R02A 2QY7A 3R9AB 4WWNA 3UX4A 4GMRA 4U07A 4LNUD 1ZBPA 3CVLA 1ELRA 4JA9A 2FI7A 1QZ2A 1FVFA 1JWGA 5IY5E 1OWMA 1H0AA 4MBGA 1SA4A 3WXXA 1EDUA 2F0YA 2XQ0A 3SZ7A 2GW1A 4YDEA 3ZN3A 3KS2A 5LX8A 3ABLE 4HBDA 3CVYA 2P9PG 2OVFA 3UM3A 4U0SA 4G25A 4GPKA 3IKOB 4GZ3A 2B0OE 4HOQA 3FDHA 3D9HA 4GZDA 4NIKA 5BW8C 2C0LA 4KYOB 4L2YA 5DIZA 2UY1A 5KJNA 3PE4A 2ETBA 1TJCA 1H2TC 4ACKA 4RLYA 1UN8A 3EHRA 3JQ0A 3ML9A 2R2LA 2EIKE 2IQCA 3FWVA 3CKCA 4OAVB 3LVRE 2RD0A 3FTYA 3URZA 1PY1A 4AM9A 2L6BA 4BSZB 4G26A 4HVBA 1UJJA 3UKRG 4J6IA 3VLDA 2BKKB 5EDSA 4HOTA 4BSXA 2OCCE 4U7EB 3UKUG 3CHPA 3UXGA 1VDYA 3ASFA 2P9UG 4EQFA 4ANUA 1D8EA 2J49A 3U3WA 3UMVA 5B1BE 2DZNA 2XGSA 3FUEA 2X6FA 2J08A 3EHNA 1U3DA 1HG2A 1GW6A 4UWHA 3ZHEB 3B95A 3TGOA 3QDNA 5LP0A 1JUQA 5CCLA 1N52A 2J09A 1JWFA 4MLPA 5FZRA 3CVVA 5G04C 5JJ6A 2X6IA 5FQ6A 1ELWA 3E4BA 5AJLA 3AJIA 3RO3A 1SW6A 1H2UA 2P9NG 3FULA 4BFRA 1Z6TA 4L1BA 4J8SA 1XNFA 4RQIA 3CHQA 2XZDG 4MS6A 3ASNE 4HLLA 3HRAA 2BUGA 4J8DA 1FVHA 3EHQA 4DI3A 3RRUA 3CVXA 3CV0A 3U4TA 4XKCA 5AQBA 1S0PA 4BY6A 3LEWA 5LOZA 4C0MA 3W9FA 2GRRB 5BT1A 2L6JA 2QFCA 4UQXA 3ULYA 5H7PA 2WXOA 4AP2A 4OYSA 5C1DA 2VJ8A 1Y8MA 3PZ1A 4HS2A 2ETAA 3B13A 2DWZA 4WAFA 1UJKA 5ENPD 1QQEA 2ONDA 3LVQE 4JW1A 1K1BA 5KNHD 3QWWA 3T5VA 2DYRE 3UTMA 4GTRA 3OXGA 4WUYA 3QC1A 3PH0C 4N5CA 5M72A 3Q9NC 3CSFA 1SZAA 4HOSA 5CRUA 2P9IG 4BTAA 2GROB 1Q2ZA 4DI4A 3G2VA 1TNYA 3HG0D 1KT0A 2F8XK 4GZ6A 3HVEB 2GRPB 4XZ4A 4DJAA 1JCQA 1WY6A 3PZDA 5EKQD 3TWXA 1E7UA 3SGHA 2XPIA 3Q75A 4ATGA 3RK6A 1HX8A 4ANXA 5EIDA 4YDOA 5AQAA 3PEVB 2CHZA 3CHMA 5FQ4A 3MCXA 3UPVA 5A7DB 1LD8A 3S7FA 2KM4A 3DPYA 4HORA 5A6CA 2RFAA 2P2CP 3AS5A 1MZCA 4JPSA 3D9MA 3SHFA 3T8MA 1SQMA 4L23A 4FJZA 3QNKA 4UI9J 5FWQA 3UM1A 3FHEA 4BT8A 3NOCD 3KEAA 2WB2A 2Y3AA 3Q15A 3KEZA 1Y6IA 3DSVA 4KBQA 1QBQA 4I1OB 4FHJA 3FUNA 5LCWC 2BTDA 4DX6D 4GYOA 4JC8A 3DXMG 3CVPA 3LDZA 1OWNA 2M63A 2Q7FA 3DSUA 5HRYA 2E0IA 4F53A 1UN9A 1N0QA 2YNQA 3NF1A 4GTSA 5AN8A 5AQ9A 5JA4D 2OVBA 1WDYA 1EF1C 3RJVA 4C48B 4LNGA 4UQZA 4GTMA 5BPPA 3D9PA 3PUKA 1DC2A 2A4ZA 3Q5MA 5ARFA 3MV3B 4AIFA 4AOFA 1TNUA 2WXMA 2YHEA 1D9SA 3HVEA 3ZKJA 2AXVA 1O5MA 3ZYKA 4OVUA 4A1GA 4J0UA 4ZHBA 5FT9A 4GYYA 5BNWA 3EU5A 5ANRA 5ENOD 3IXEA 3NZSA 4HI9A 3BU8A 5ENTD 5EX0A 3ZW3A 4NRHB 4CT0A 2WQ7A 1KLXA 1E96B 2CG2A 2OOEA 2PQRA 4CDMA 4KVMA 2BKGA 3R7RA 2AWIA 1A5EA 3SI5A 5A23A 4AV7A 2R59A 4J7WA 4DUIA 4IYPA 3L16A 4IN3B 4G1TA 3VLFA 4I6EA 3CVUA 2BEDA 2HR2A 4XKBA 2P58C 3PNLB 4K5AB 3TJPA 5ARGA 4A55A 4H7XA 3HYMB 1OCRE 1N4QA 2PM7A 5CMWA 4G2VA 5E76A 3UUXA 4GU5A 5CMYA 4ILIA 3C72A 4E6HA 2EIJE 3EIJA 3MEKA 4HRNA 4I43A 4DX2A 2V5QC 3ULQA 3D9JA 3VLEA 3HXBA 2CFZA 4F3VA 5KCMA 5G04J 5BUZA 3Q78A 3IBEA 3U64A 1N54A 3LS8A 2CHXA 2KZTA 4CGVA 3MKQB 5G05C 3Q9UC 3B7UX 3D9NA 4QQIA 2LSVA 4Y6WA 3CSTA 3HDXA 3ZFWA 4TV3A 2I2OA 4WWOA 2IONA 4JD2G 1ZU2A 3V30A 2H6HA 3Q4AB 1HO8A 4XIFA 2C0MA 1TN8A 1NFIE 3JCKC 5T3RA 2FO1E 3DEOA 4U96D 4V3IA 2J9QA 4DX7D 4W9RA 3DXKG 2WXQA 3D3MA 3UT4A 4NQ0A 1LD7A 1PAQA 1HG5A 2XGOA 3JUEA 5KJMA 5EX3A 4IULA 1YMPA 2HE0A 5CEDB 1KT1A 2ZXWE 2IFUA 2E2EA 3ONLA 3JXIA 3ESLA 4BESA 1K8KG 3MX3A 2ZGGA 4BTBA 4EBAG 3FU0A 1BPOA 3ZVVA 3LJ3A 3IEGA 1MYOA 3LY7A 3PDNA 4LEUA 5FQ7A 5CBNA 3MJWA 3RAUA 1U3CA 1WAO1 5CHEE 3I4GA 1H19A 3OTNA 3CVNA 1N0RA 4WWPA 3GW4A 1OWPA 5KWDA 2ILRA 3I3NA 2FF4A 1E8WA 2KCLA 3ZEFA 2H6IA 5AAOA 4BX9A 1K1AA 3L13A 2GRQB 5FJYA 2I6HA 4BT9A 5KBAA 5J08A 4LRZA 2PNNA 3QOUA 4FLHA 5ITZF 1MHQA 2FO7A 4N39A 4PS8A 1V54E 3SD5A 1NI1A 5AARA 3AS4A 3BQOA 5D2MC 2VSOE 3PEUB 3U9WA 4U04A 5CEAA 3I4RB 1OWLA 1QNFA 3PNTB 2WXHA 4O1PA 1LTXA 2YHCA 4GZ5A 4ILHB 3UIPC 3JUIA 4ME2A 1WM5A 3S2AA 3TWRA 3K9IA 4JHJA 4YVOA 3ASOE 4EHMA 4DX1A 3FU5A 4KMOA 3Q79A 4JXTA 3HIZA 4GTVA 4D10C 3AU5A 4RSYA 4GYWA 4GA0A 3EUVA 2MRIA 4JA7A 3DEPA 3NAWA 1Z3XA 3MA5A 3L54A 2LXLA 2PM6A 3LCAA 3BUAA 4JHKA 3G2SA 3MKRA 2VSYA 1D8DA 1BI8B 4DLOA 5BV0A 4XEIG 2XEVA 2LAIA 5G55A 3RKVA 1AWCB 1IHGA 3ASGA 3BG1B 3DSTA 2DBAA 3FUKA 4OAUC 1UOHA 3DRAA 5AQ7A 3HXCA 1E7VA 5E75A 2WXNA 4J8YA 5ENQD 3FH5A 4MRUA 1MX6A 3CHRA 3ONKA 3EHMA 1S63A 3T8KA 4CEMA 2XPZA 3FU3A 4LSZE 1EYHA 3E37A 3LPZA 4BX8A 3FP3A 3TXNA 2KXPC 3FTVA 4GTQA 3FH8A 3QARA 5CCMA 3FEXA 3NQPA 3AU4A 1O1TA 1O1RA 2XEHA 4F6RD 4E85A 4GB9A 3ESKA 3B7BA 2KCVA 3CVQA 4WNDA 4UWLA 3ULEG 3V2XA 4GMJA 4GA2A 3UT8A 4ANVA 4GMLA 4LUNU 3ZHEA 1INZA 1RZ4A 4C0EA 2VGXB 3F6QA 5JHBA 4C9BB 2QC9A 3CK9A 2RG8A 1KZOA 5KJLA 4NACA 1BD8A 3FTZA 3G2TA 4PH4B 4I17A 4O60A 5C2YA 2V4HC 3MZLB 2LXMA 1TR4A 5KNGA 1NP7A 4N3BA 3UINC 4AXHA 3L82A 1QYMA 2AVPA 2XRYA 3DPDA 3PUJA 3Q7AA 3SBTB 3B7SA 1TNZA 4U0UA 5G05J 2HYZA 5EYPF 1N11A 5D0OD 1UG3A 3O48A 1DCQA 4GA1A 5KJKA 2I1KA 3Q7FA 2EQXA 3IHYA 4XX5A 1WG0A 2GRMA 1Z3YA 2UWJG 3D9IA 3V31A 3ISMC 1X5BA 5AIJA 1V55E 1BU9A 3SFYA 4FULA 3E30A 1OXJA 4GTPA 5ANLA 3AAAC 4FU3A 3OXFA 4RVBA 4B89A 3FTXA 4BWRA 1MQSA 1N94A 3SFZA 3VTYA 2Y0BG 2VSXE 2FBNA 2RFMA 4CT4A 2QYUA 4GZCA 4AEZC 2A5UA 3KD7A 3I5PA 3L6AA 4KVOA 2NXPA 2WXGA 4F1SA 3Q49B 3LXUX 1HH8A 4NURA 2PQNA 4G24A 3IHVA 2EILE 5G2NA 1AP7A 2VGXA 3LY8A 2XRZA 2NC9A 2PZIA 2WQ6A 2I1JA 4GTOA 2VTBB 4EZJA 3LJNA 2AW6A 2JEKA 2IY0C 1IQUA 3N71A 3AG1E 3D9LA 4H7YA 2CFUA 4B0ZA 3RO2A 1TN7A 5LFAA 4KT6B 3R9MA 2WXLA 1SA5A 2KCKA 3C98A 5AYWD 3QAQA 3QWVA 3BG0B 3APFA 3ML8A 2XCCA 4L9PA 3NBNB 1E8ZA 1ELKA 5T8IA 3AG4E 1JCRA 4EZKA 1YYHA 3RSEG 2ZGDA 1E8YA 2WMNA 4AVXA 4CCAA 3FUFA 3VTXA 5HI7A 2J07A 4URKA 4YDYA 2HM8A 2OEWA 2VGEA 3DWLG 1FT2A 1N4RA 2RKKA 2FEZA 4UI9K 5FQ8A 2R03A 2IJGX 1HF8A 1TN6A 4PUCA 4UWKA 5JHAA 2J8SD 3FUMA 4HNAD 3FY4A 5ENRD 5DBKA 3CQCB 5FIOA 4CYMD 3E32A 2R05A 3FUDA 4A3TA 4K0RA 4LNBA 4GTTA 3DSSA 1HZ4A 3GYZA 4R7LA 2X3MA 5FTPA 3SBSA 3UI2A 2Y4UA 2I9CA 1BLXB 3PVLA 4Y6CA 1MX4A 2AXUA 4FHKA 3SQVA 3QJZA 1H2VC 3HXDA 1OCOE 1H6OA 1SZ9A 3CKBA 4JB8P 4U0ZA 5CERB 1DNPA 2VTBA 3AG2E 3ASDA 3ABME 4I6JA 3TWVA 4L7TA 1UW4B 2LUHA 3QWPA 3DSWA 1TJFA 4CZ2D 4YVQC 3FTUA 1H6KA 2H6FA 3TWTA 4DK5A 4CDRA 2J4DA 4OVVA 4TUUA 1HS6A 4F7AA 3PZ4A 5JJ7A 5AENA 3W9GA 4FA6A 3MV2B 4ACLA 4O6FA 2V4LA 1RW2A 1KPSB 3UIOC 1FPPA 1NZNA 2YINA 3UM0A 3J5PA 2WXIA 3IV0A 3ZXSA 1H6PA 3EIQC 1OY3D 1OWOA 1E8XA 1S70B 2LNIA 4TUMA 3GZ2A 4DLQA 2WXRA 4IRUA 3P2BA 4HI8A 2WXKA 4I9CA 3NOGD 4N5QA 4F1PA 3APCA 4HQDA 4GPMA 2WXFA 3QK0A 3ABKE 3BEEA 5HKPA 1LF8A 2JLBA 2DVWA 3RRNB 2PL2A 4JZYA 4PS7A 2L0IA 3DSXA 5D66A 3X2QE 4APOA 2DCPA 2XEEA 4HOUA 4Q96A 3KSLA 4I2ZA 2VSNA 3SFXA 2H6GA 3MKQA 4J8EA 4U8VD 3V2OA 1G3NB 4TXQA 5EIBE 4YNDA 1HU3A 1OT8A
chains in the Genus database with same CATH topology
3JXIA 4K5AB 1IHBA 1K1BA 5KNHD 1SVXA 1BU9A 4DX1A 5EYLA 4BESA 3UTMA 2ZGGA 4DX6D 1BI7B 1YYHA 3AAAC 3T9KA 2B0OE 4HRMB 2F37A 2ZGDA 3D9HA 4HRLA 3Q9NC 5HRYA 4DX5D 1MYOA 2XEHA 5CBNA 4NIKA 3W9GA 4F6RD 5CECB 1N0QA 4B93B 2A5EA 3B7BA 4ATZD 3DEPA 3AJIA 5AN8A 1N0RA 5AQ9A 4YDYA 3C5RA 3TWQA 5JA4D 1WDYA 2VGEA 4HRNA 5KWDA 2MYOA 3HG0D 4ZFHA 4C48B 4DRXE 4QFVA 2V5QC 3J5PA 3V2XA 4DX2A 2F8XK 2Y0BG 1SW6A 2XZTG 1K3ZD 5HS0A 2RFMA 2DZOA 2ETBA 1MX2A 3TWXA 5BXUA 1DC2A 4K5BA 2NYJA 1OY3D 5JMND 4RLYA 2XZDG 5EILA 2XENA 5EN5D 3F6QA 1BI8B 2J8SD 3EHRA 4HNAD 1S70B 2QC9A 4TUMA 5AAOA 1D9SA 1IKND 2KBXA 4U8YD 1K1AA 4HI8A 5EIDA 5ENRD 5BXOA 4HLLA 3ZKJA 5AQAA 3Q9UC 4U95D 5FINA 4O1OA 4G8KA 3HRAA 2F8YA 4UUCA 4OAVB 2Y1LE 5FIOA 4CYMD 3NOGD 4N5QA 4QQIA 1AWCB 1MJ0A 4HB5A 1BD8A 3EHQA 2L6BA 4F1PA 1AP7A 4O60A 4BSZB 4HQDA 5KBAA 2V4HC 3J5QB 4LG6A 1IXVA 4ZHBA 4G8LA 1TR4A 3TWWA 2ETCA 4GPMA 5KNGA 2PNNA 3V30A 3V79K 5ENSD 3UI2A 5HKPA 1UOHA 4OAUC 5ITZF 4GMRA 5AQBA 3TWSA 2BKKB 5AQ7A 1NFIE 2RFAA 2P2CP 4LNUD 1QYMA 3LJNA 1BLXB 3DEOA 2FO1E 2DVWA 2JABA 4U96D 5ENOD 4Z68A 3IXEA 2QYJA 4HI9A 4J8YA 5AARA 1MX4A 5ENTD 4DX7D 1YCSB 3W9FA 3EU9A 5ENQD 3UXGA 3TWUA 4K5CA 4BEPA 4JB8P 5EYPF 1MX6A 5D66A 5CBOA 1N11A 2XEEA 5CERB 4BERA 2BKGA 2AJAA 1DCQA 2DZNA 3TWVA 4YDWA 3ZUVB 5CEAA 3NOCD 3KEAA 3T8KA 4U8VD 4O1PA 3ZNGA 1A5EA 3V2OA 3JUEA 4J7WA 3B95A 4DUIA 3TWTA 4A63B 3JXJA 3SO8A 1YMPA 4LSZE 4CZ2D 1G3NB 2ETAA 4BETA 3ZU7B 2HE0A 5CEDB 5EIBE 2DWZA 1WG0A 5ENPD 3NBNB 4HBDA 3V31A 2KXPC 3TWRA 1OT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXI A;  4K5A B;  1IHB A;  1K1B A;  5KNH D;  1SVX A;  1BU9 A;  4DX1 A;  5EYL A;  4BES A;  3UTM A;  2ZGG A;  4DX6 D;  1BI7 B;  1YYH A;  3AAA C;  3T9K A;  2B0O E;  4HRM B;  2F37 A;  2ZGD A;  3D9H A;  4HRL A;  3Q9N C;  5HRY A;  4DX5 D;  1MYO A;  2XEH A;  5CBN A;  4NIK A;  3W9G A;  4F6R D;  5CEC B;  1N0Q A;  4B93 B;  2A5E A;  3B7B A;  4ATZ D;  3DEP A;  3AJI A;  5AN8 A;  1N0R A;  5AQ9 A;  4YDY A;  3C5R A;  3TWQ A;  5JA4 D;  1WDY A;  2VGE A;  4HRN A;  5KWD A;  2MYO A;  3HG0 D;  4ZFH A;  4C48 B;  4DRX E;  4QFV A;  2V5Q C;  3J5P A;  3V2X A;  4DX2 A;  2F8X K;  2Y0B G;  1SW6 A;  2XZT G;  1K3Z D;  5HS0 A;  2RFM A;  2DZO A;  2ETB A;  1MX2 A;  3TWX A;  5BXU A;  1DC2 A;  4K5B A;  2NYJ A;  1OY3 D;  5JMN D;  4RLY A;  2XZD G;  5EIL A;  2XEN A;  5EN5 D;  3F6Q A;  1BI8 B;  2J8S D;  3EHR A;  4HNA D;  1S70 B;  2QC9 A;  4TUM A;  5AAO A;  1D9S A;  1IKN D;  2KBX A;  4U8Y D;  1K1A A;  4HI8 A;  5EID A;  5ENR D;  5BXO A;  4HLL A;  3ZKJ A;  5AQA A;  3Q9U C;  4U95 D;  5FIN A;  4O1O A;  4G8K A;  3HRA A;  2F8Y A;  4UUC A;  4OAV B;  2Y1L E;  5FIO A;  4CYM D;  3NOG D;  4N5Q A;  4QQI A;  1AWC B;  1MJ0 A;  4HB5 A;  1BD8 A;  3EHQ A;  2L6B A;  4F1P A;  1AP7 A;  4O60 A;  4BSZ B;  4HQD A;  5KBA A;  2V4H C;  3J5Q B;  4LG6 A;  1IXV A;  4ZHB A;  4G8L A;  1TR4 A;  3TWW A;  2ETC A;  4GPM A;  5KNG A;  2PNN A;  3V30 A;  3V79 K;  5ENS D;  3UI2 A;  5HKP A;  1UOH A;  4OAU C;  5ITZ F;  4GMR A;  5AQB A;  3TWS A;  2BKK B;  5AQ7 A;  1NFI E;  2RFA A;  2P2C P;  4LNU D;  1QYM A;  3LJN A;  1BLX B;  3DEO A;  2FO1 E;  2DVW A;  2JAB A;  4U96 D;  5ENO D;  4Z68 A;  3IXE A;  2QYJ A;  4HI9 A;  4J8Y A;  5AAR A;  1MX4 A;  5ENT D;  4DX7 D;  1YCS B;  3W9F A;  3EU9 A;  5ENQ D;  3UXG A;  3TWU A;  4K5C A;  4BEP A;  4JB8 P;  5EYP F;  1MX6 A;  5D66 A;  5CBO A;  1N11 A;  2XEE A;  5CER B;  4BER A;  2BKG A;  2AJA A;  1DCQ A;  2DZN A;  3TWV A;  4YDW A;  3ZUV B;  5CEA A;  3NOC D;  3KEA A;  3T8K A;  4U8V D;  4O1P A;  3ZNG A;  1A5E A;  3V2O A;  3JUE A;  4J7W A;  3B95 A;  4DUI A;  3TWT A;  4A63 B;  3JXJ A;  3SO8 A;  1YMP A;  4LSZ E;  4CZ2 D;  1G3N B;  2ETA A;  4BET A;  3ZU7 B;  2HE0 A;  5CED B;  5EIB E;  2DWZ A;  1WG0 A;  5ENP D;  3NBN B;  4HBD A;  3V31 A;  2KXP C;  3TWR A;  1OT8 A; 
#chains in the Genus database with same CATH topology
 3ASH A;  4JEH A;  3NB2 A;  3JYS A;  2Y4T A;  3SNX A;  3CVW A;  4DX5 D;  4HRL A;  4JEU A;  4B93 B;  2A5E A;  2WVI A;  2LO6 A;  3TWQ A;  4ZFH A;  1U2V G;  3TG4 A;  4GAA A;  2IOL A;  1FCH A;  2X6J A;  1HFA A;  4I6G A;  4B8A A;  5JJT A;  1IKN D;  2KBX A;  5FIN A;  3B7R L;  4UUC A;  4I1M A;  3OXL A;  5LCW J;  4PDX A;  2WQH A;  2EIM E;  4G8L A;  3TWW A;  2DYS E;  3ZRH A;  4M3O A;  3HXE A;  3TWU A;  4HLE A;  4BEP A;  4XI0 A;  3C3Q A;  2XS1 A;  3ZYM A;  3ZUV B;  2P9L G;  3L08 A;  1O1S A;  4N3C A;  3LY9 A;  4N2S A;  3TG5 A;  2B6C A;  3FUI A;  3JXJ A;  3SO8 A;  4JVS A;  3CK8 A;  4BET A;  4AY5 A;  5J90 A;  3ZU7 B;  3LKU A;  3HHM A;  4K03 A;  1TNO A;  4KZC A;  2XPY A;  4M7C A;  1OCC E;  4EBA A;  1BI7 B;  3PZ3 A;  4TXP A;  1IQR A;  4PS3 A;  2Y69 E;  5ENN A;  1N4S A;  1DCE A;  3QKY A;  2EIN E;  5HS0 A;  2DZO A;  5BXU A;  3AS8 A;  3DBS A;  2P9S G;  1TNB A;  3CGH A;  4TRQ A;  1HXI A;  1W3B A;  4EPZ A;  3CHO A;  2L9B A;  4EEC A;  4O1O A;  4G8K A;  3ZIM A;  2Y1L E;  2WXP A;  4FAD A;  2XS8 A;  3FEY A;  4I9E A;  4LG6 A;  1L5J A;  2VYI A;  3APD A;  2ETC A;  3RU0 A;  3AG3 E;  3Q47 B;  3TWS A;  2IO3 C;  4Q94 A;  2CG3 A;  2OEV A;  5T4Y A;  3CK7 A;  2L0T B;  1KZP A;  3EU9 A;  3ZGQ A;  4CRW A;  5D0Q D;  1A17 A;  4DPR A;  4UWF A;  4B8C B;  3UQ3 A;  1N95 A;  1NA3 A;  3S7J A;  2P9K G;  4AY6 A;  2LAH A;  4LER A;  3NZU A;  4FLB A;  5B1A E;  1IHB A;  4UQY A;  2BF0 X;  4Q69 A;  2HO1 A;  3EJN A;  1FT1 A;  3SY2 A;  5AJD A;  3FTW A;  3JQ1 A;  4UWG A;  2XCB A;  2VGY A;  4GCO A;  1YA0 A;  3G2U A;  3ZYL A;  4FC8 A;  4CGW A;  2X38 A;  3HXF A;  3WG7 E;  2VQ2 A;  4QFV A;  2XZT G;  1Z5S C;  1K3Z D;  4X8Q A;  3UT7 A;  2CHW A;  1OUV A;  3L22 A;  3FTS A;  4K5B A;  3TXM A;  3ENE A;  3LYA A;  5JMN D;  3MGB A;  2IEJ A;  1N9A A;  2WM9 A;  3CLJ A;  2V5F A;  2GRL A;  5CRV A;  2IO2 C;  3PE3 A;  4U95 D;  3CEQ A;  2F8Y A;  1TEZ A;  3ZYQ A;  4HB5 A;  3L17 A;  3J5Q B;  3QB2 A;  4N2Q A;  4HXI A;  4ABN A;  3RRM B;  3C3O A;  5B3S E;  2WXJ A;  3EDT B;  3V79 K;  1EPU A;  2KC7 A;  3FH7 A;  4G23 A;  2AXZ A;  4FJY A;  2GGF A;  2JAB A;  2QYJ A;  3S7B A;  4AJW A;  2WPV A;  4K5C A;  2V8S E;  4J8F A;  3G2W A;  3E34 A;  4BER A;  4ANW A;  1TYQ G;  1JPL A;  2IOS A;  1XGW A;  4APF A;  3ZNG A;  4A1S A;  2KAT A;  1PC2 A;  4A63 B;  4KZ0 A;  3B7T A;  3S7D A;  2KZT B;  1SVX A;  2FUL A;  3ZPJ A;  4U63 A;  4HRM B;  2F37 A;  3CHS A;  2V0P A;  4U8H A;  5CEC B;  4L2L A;  4KXK B;  4DRX E;  3L9T A;  1E90 A;  3PRE A;  1MX2 A;  2J4B A;  3CIA A;  3UM2 A;  2NYJ A;  2LSU A;  5EN5 D;  5EIL A;  2XEN A;  4RG6 A;  4I2W A;  2IF4 A;  3RIB A;  4A3V A;  2R17 C;  4TXR A;  4U8Y D;  4XI9 A;  5BXO A;  1X81 A;  3GZ1 A;  3FUJ A;  2XGM A;  4G11 A;  1MJ0 A;  3ZXP A;  3SF4 A;  3KSQ A;  3U66 A;  2MOW A;  2XHE A;  2ZU6 B;  3TAX A;  1IXV A;  5ENS D;  3CR3 A;  4XE0 A;  4Z68 A;  1DVP A;  4CDN A;  1YCS B;  4FP7 A;  1HE8 A;  2X6H A;  2OV8 A;  2IU1 A;  4GCN A;  3FUH A;  4LCT A;  1S64 A;  3TL5 A;  4B94 A;  5CBO A;  3FFL A;  2ZIR A;  2AJA A;  2NSZ A;  3O4Z A;  4YDW A;  1JCS A;  2R5S A;  2C2L A;  1NL4 A;  3FU6 A;  4RG9 A;  2ZIS A;  4JHR A;  3PZ2 A;  2QZA A;  5FZQ A;  4P29 A;  1ZB1 A;  3MYV A;  1N4P A;  5HQ8 A;  5EYL A;  3Q73 A;  4I1A A;  3T5X A;  3T9K A;  1NA0 A;  2GRN B;  2UY1 B;  3D9O A;  3KAE A;  5FZS A;  1OCZ E;  3P1U A;  4ILG A;  4ATZ D;  2WMO A;  4WNG A;  2YQ8 A;  3C5R A;  4MKT A;  4JL0 A;  2MYO A;  1P5Q A;  5BV1 A;  2X6K A;  2DIW A;  3PRZ A;  4WNE A;  3R7Q A;  4N3A A;  1IYG A;  3GZS A;  4HFG A;  3E33 A;  3C3R A;  1B89 A;  3PS6 A;  3D9K A;  4UI9 C;  4EZL A;  3OAW A;  3CQG B;  2MHK A;  4WNF A;  2R02 A;  2QY7 A;  3R9A B;  4WWN A;  3UX4 A;  4GMR A;  4U07 A;  4LNU D;  1ZBP A;  3CVL A;  1ELR A;  4JA9 A;  2FI7 A;  1QZ2 A;  1FVF A;  1JWG A;  5IY5 E;  1OWM A;  1H0A A;  4MBG A;  1SA4 A;  3WXX A;  1EDU A;  2F0Y A;  2XQ0 A;  3SZ7 A;  2GW1 A;  4YDE A;  3ZN3 A;  3KS2 A;  5LX8 A;  3ABL E;  4HBD A;  3CVY A;  2P9P G;  2OVF A;  3UM3 A;  4U0S A;  4G25 A;  4GPK A;  3IKO B;  4GZ3 A;  2B0O E;  4HOQ A;  3FDH A;  3D9H A;  4GZD A;  4NIK A;  5BW8 C;  2C0L A;  4KYO B;  4L2Y A;  5DIZ A;  2UY1 A;  5KJN A;  3PE4 A;  2ETB A;  1TJC A;  1H2T C;  4ACK A;  4RLY A;  1UN8 A;  3EHR A;  3JQ0 A;  3ML9 A;  2R2L A;  2EIK E;  2IQC A;  3FWV A;  3CKC A;  4OAV B;  3LVR E;  2RD0 A;  3FTY A;  3URZ A;  1PY1 A;  4AM9 A;  2L6B A;  4BSZ B;  4G26 A;  4HVB A;  1UJJ A;  3UKR G;  4J6I A;  3VLD A;  2BKK B;  5EDS A;  4HOT A;  4BSX A;  2OCC E;  4U7E B;  3UKU G;  3CHP A;  3UXG A;  1VDY A;  3ASF A;  2P9U G;  4EQF A;  4ANU A;  1D8E A;  2J49 A;  3U3W A;  3UMV A;  5B1B E;  2DZN A;  2XGS A;  3FUE A;  2X6F A;  2J08 A;  3EHN A;  1U3D A;  1HG2 A;  1GW6 A;  4UWH A;  3ZHE B;  3B95 A;  3TGO A;  3QDN A;  5LP0 A;  1JUQ A;  5CCL A;  1N52 A;  2J09 A;  1JWF A;  4MLP A;  5FZR A;  3CVV A;  5G04 C;  5JJ6 A;  2X6I A;  5FQ6 A;  1ELW A;  3E4B A;  5AJL A;  3AJI A;  3RO3 A;  1SW6 A;  1H2U A;  2P9N G;  3FUL A;  4BFR A;  1Z6T A;  4L1B A;  4J8S A;  1XNF A;  4RQI A;  3CHQ A;  2XZD G;  4MS6 A;  3ASN E;  4HLL A;  3HRA A;  2BUG A;  4J8D A;  1FVH A;  3EHQ A;  4DI3 A;  3RRU A;  3CVX A;  3CV0 A;  3U4T A;  4XKC A;  5AQB A;  1S0P A;  4BY6 A;  3LEW A;  5LOZ A;  4C0M A;  3W9F A;  2GRR B;  5BT1 A;  2L6J A;  2QFC A;  4UQX A;  3ULY A;  5H7P A;  2WXO A;  4AP2 A;  4OYS A;  5C1D A;  2VJ8 A;  1Y8M A;  3PZ1 A;  4HS2 A;  2ETA A;  3B13 A;  2DWZ A;  4WAF A;  1UJK A;  5ENP D;  1QQE A;  2OND A;  3LVQ E;  4JW1 A;  1K1B A;  5KNH D;  3QWW A;  3T5V A;  2DYR E;  3UTM A;  4GTR A;  3OXG A;  4WUY A;  3QC1 A;  3PH0 C;  4N5C A;  5M72 A;  3Q9N C;  3CSF A;  1SZA A;  4HOS A;  5CRU A;  2P9I G;  4BTA A;  2GRO B;  1Q2Z A;  4DI4 A;  3G2V A;  1TNY A;  3HG0 D;  1KT0 A;  2F8X K;  4GZ6 A;  3HVE B;  2GRP B;  4XZ4 A;  4DJA A;  1JCQ A;  1WY6 A;  3PZD A;  5EKQ D;  3TWX A;  1E7U A;  3SGH A;  2XPI A;  3Q75 A;  4ATG A;  3RK6 A;  1HX8 A;  4ANX A;  5EID A;  4YDO A;  5AQA A;  3PEV B;  2CHZ A;  3CHM A;  5FQ4 A;  3MCX A;  3UPV A;  5A7D B;  1LD8 A;  3S7F A;  2KM4 A;  3DPY A;  4HOR A;  5A6C A;  2RFA A;  2P2C P;  3AS5 A;  1MZC A;  4JPS A;  3D9M A;  3SHF A;  3T8M A;  1SQM A;  4L23 A;  4FJZ A;  3QNK A;  4UI9 J;  5FWQ A;  3UM1 A;  3FHE A;  4BT8 A;  3NOC D;  3KEA A;  2WB2 A;  2Y3A A;  3Q15 A;  3KEZ A;  1Y6I A;  3DSV A;  4KBQ A;  1QBQ A;  4I1O B;  4FHJ A;  3FUN A;  5LCW C;  2BTD A;  4DX6 D;  4GYO A;  4JC8 A;  3DXM G;  3CVP A;  3LDZ A;  1OWN A;  2M63 A;  2Q7F A;  3DSU A;  5HRY A;  2E0I A;  4F53 A;  1UN9 A;  1N0Q A;  2YNQ A;  3NF1 A;  4GTS A;  5AN8 A;  5AQ9 A;  5JA4 D;  2OVB A;  1WDY A;  1EF1 C;  3RJV A;  4C48 B;  4LNG A;  4UQZ A;  4GTM A;  5BPP A;  3D9P A;  3PUK A;  1DC2 A;  2A4Z A;  3Q5M A;  5ARF A;  3MV3 B;  4AIF A;  4AOF A;  1TNU A;  2WXM A;  2YHE A;  1D9S A;  3HVE A;  3ZKJ A;  2AXV A;  1O5M A;  3ZYK A;  4OVU A;  4A1G A;  4J0U A;  4ZHB A;  5FT9 A;  4GYY A;  5BNW A;  3EU5 A;  5ANR A;  5ENO D;  3IXE A;  3NZS A;  4HI9 A;  3BU8 A;  5ENT D;  5EX0 A;  3ZW3 A;  4NRH B;  4CT0 A;  2WQ7 A;  1KLX A;  1E96 B;  2CG2 A;  2OOE A;  2PQR A;  4CDM A;  4KVM A;  2BKG A;  3R7R A;  2AWI A;  1A5E A;  3SI5 A;  5A23 A;  4AV7 A;  2R59 A;  4J7W A;  4DUI A;  4IYP A;  3L16 A;  4IN3 B;  4G1T A;  3VLF A;  4I6E A;  3CVU A;  2BED A;  2HR2 A;  4XKB A;  2P58 C;  3PNL B;  4K5A B;  3TJP A;  5ARG A;  4A55 A;  4H7X A;  3HYM B;  1OCR E;  1N4Q A;  2PM7 A;  5CMW A;  4G2V A;  5E76 A;  3UUX A;  4GU5 A;  5CMY A;  4ILI A;  3C72 A;  4E6H A;  2EIJ E;  3EIJ A;  3MEK A;  4HRN A;  4I43 A;  4DX2 A;  2V5Q C;  3ULQ A;  3D9J A;  3VLE A;  3HXB A;  2CFZ A;  4F3V A;  5KCM A;  5G04 J;  5BUZ A;  3Q78 A;  3IBE A;  3U64 A;  1N54 A;  3LS8 A;  2CHX A;  2KZT A;  4CGV A;  3MKQ B;  5G05 C;  3Q9U C;  3B7U X;  3D9N A;  4QQI A;  2LSV A;  4Y6W A;  3CST A;  3HDX A;  3ZFW A;  4TV3 A;  2I2O A;  4WWO A;  2ION A;  4JD2 G;  1ZU2 A;  3V30 A;  2H6H A;  3Q4A B;  1HO8 A;  4XIF A;  2C0M A;  1TN8 A;  1NFI E;  3JCK C;  5T3R A;  2FO1 E;  3DEO A;  4U96 D;  4V3I A;  2J9Q A;  4DX7 D;  4W9R A;  3DXK G;  2WXQ A;  3D3M A;  3UT4 A;  4NQ0 A;  1LD7 A;  1PAQ A;  1HG5 A;  2XGO A;  3JUE A;  5KJM A;  5EX3 A;  4IUL A;  1YMP A;  2HE0 A;  5CED B;  1KT1 A;  2ZXW E;  2IFU A;  2E2E A;  3ONL A;  3JXI A;  3ESL A;  4BES A;  1K8K G;  3MX3 A;  2ZGG A;  4BTB A;  4EBA G;  3FU0 A;  1BPO A;  3ZVV A;  3LJ3 A;  3IEG A;  1MYO A;  3LY7 A;  3PDN A;  4LEU A;  5FQ7 A;  5CBN A;  3MJW A;  3RAU A;  1U3C A;  1WAO 1;  5CHE E;  3I4G A;  1H19 A;  3OTN A;  3CVN A;  1N0R A;  4WWP A;  3GW4 A;  1OWP A;  5KWD A;  2ILR A;  3I3N A;  2FF4 A;  1E8W A;  2KCL A;  3ZEF A;  2H6I A;  5AAO A;  4BX9 A;  1K1A A;  3L13 A;  2GRQ B;  5FJY A;  2I6H A;  4BT9 A;  5KBA A;  5J08 A;  4LRZ A;  2PNN A;  3QOU A;  4FLH A;  5ITZ F;  1MHQ A;  2FO7 A;  4N39 A;  4PS8 A;  1V54 E;  3SD5 A;  1NI1 A;  5AAR A;  3AS4 A;  3BQO A;  5D2M C;  2VSO E;  3PEU B;  3U9W A;  4U04 A;  5CEA A;  3I4R B;  1OWL A;  1QNF A;  3PNT B;  2WXH A;  4O1P A;  1LTX A;  2YHC A;  4GZ5 A;  4ILH B;  3UIP C;  3JUI A;  4ME2 A;  1WM5 A;  3S2A A;  3TWR A;  3K9I A;  4JHJ A;  4YVO A;  3ASO E;  4EHM A;  4DX1 A;  3FU5 A;  4KMO A;  3Q79 A;  4JXT A;  3HIZ A;  4GTV A;  4D10 C;  3AU5 A;  4RSY A;  4GYW A;  4GA0 A;  3EUV A;  2MRI A;  4JA7 A;  3DEP A;  3NAW A;  1Z3X A;  3MA5 A;  3L54 A;  2LXL A;  2PM6 A;  3LCA A;  3BUA A;  4JHK A;  3G2S A;  3MKR A;  2VSY A;  1D8D A;  1BI8 B;  4DLO A;  5BV0 A;  4XEI G;  2XEV A;  2LAI A;  5G55 A;  3RKV A;  1AWC B;  1IHG A;  3ASG A;  3BG1 B;  3DST A;  2DBA A;  3FUK A;  4OAU C;  1UOH A;  3DRA A;  5AQ7 A;  3HXC A;  1E7V A;  5E75 A;  2WXN A;  4J8Y A;  5ENQ D;  3FH5 A;  4MRU A;  1MX6 A;  3CHR A;  3ONK A;  3EHM A;  1S63 A;  3T8K A;  4CEM A;  2XPZ A;  3FU3 A;  4LSZ E;  1EYH A;  3E37 A;  3LPZ A;  4BX8 A;  3FP3 A;  3TXN A;  2KXP C;  3FTV A;  4GTQ A;  3FH8 A;  3QAR A;  5CCM A;  3FEX A;  3NQP A;  3AU4 A;  1O1T A;  1O1R A;  2XEH A;  4F6R D;  4E85 A;  4GB9 A;  3ESK A;  3B7B A;  2KCV A;  3CVQ A;  4WND A;  4UWL A;  3ULE G;  3V2X A;  4GMJ A;  4GA2 A;  3UT8 A;  4ANV A;  4GML A;  4LUN U;  3ZHE A;  1INZ A;  1RZ4 A;  4C0E A;  2VGX B;  3F6Q A;  5JHB A;  4C9B B;  2QC9 A;  3CK9 A;  2RG8 A;  1KZO A;  5KJL A;  4NAC A;  1BD8 A;  3FTZ A;  3G2T A;  4PH4 B;  4I17 A;  4O60 A;  5C2Y A;  2V4H C;  3MZL B;  2LXM A;  1TR4 A;  5KNG A;  1NP7 A;  4N3B A;  3UIN C;  4AXH A;  3L82 A;  1QYM A;  2AVP A;  2XRY A;  3DPD A;  3PUJ A;  3Q7A A;  3SBT B;  3B7S A;  1TNZ A;  4U0U A;  5G05 J;  2HYZ A;  5EYP F;  1N11 A;  5D0O D;  1UG3 A;  3O48 A;  1DCQ A;  4GA1 A;  5KJK A;  2I1K A;  3Q7F A;  2EQX A;  3IHY A;  4XX5 A;  1WG0 A;  2GRM A;  1Z3Y A;  2UWJ G;  3D9I A;  3V31 A;  3ISM C;  1X5B A;  5AIJ A;  1V55 E;  1BU9 A;  3SFY A;  4FUL A;  3E30 A;  1OXJ A;  4GTP A;  5ANL A;  3AAA C;  4FU3 A;  3OXF A;  4RVB A;  4B89 A;  3FTX A;  4BWR A;  1MQS A;  1N94 A;  3SFZ A;  3VTY A;  2Y0B G;  2VSX E;  2FBN A;  2RFM A;  4CT4 A;  2QYU A;  4GZC A;  4AEZ C;  2A5U A;  3KD7 A;  3I5P A;  3L6A A;  4KVO A;  2NXP A;  2WXG A;  4F1S A;  3Q49 B;  3LXU X;  1HH8 A;  4NUR A;  2PQN A;  4G24 A;  3IHV A;  2EIL E;  5G2N A;  1AP7 A;  2VGX A;  3LY8 A;  2XRZ A;  2NC9 A;  2PZI A;  2WQ6 A;  2I1J A;  4GTO A;  2VTB B;  4EZJ A;  3LJN A;  2AW6 A;  2JEK A;  2IY0 C;  1IQU A;  3N71 A;  3AG1 E;  3D9L A;  4H7Y A;  2CFU A;  4B0Z A;  3RO2 A;  1TN7 A;  5LFA A;  4KT6 B;  3R9M A;  2WXL A;  1SA5 A;  2KCK A;  3C98 A;  5AYW D;  3QAQ A;  3QWV A;  3BG0 B;  3APF A;  3ML8 A;  2XCC A;  4L9P A;  3NBN B;  1E8Z A;  1ELK A;  5T8I A;  3AG4 E;  1JCR A;  4EZK A;  1YYH A;  3RSE G;  2ZGD A;  1E8Y A;  2WMN A;  4AVX A;  4CCA A;  3FUF A;  3VTX A;  5HI7 A;  2J07 A;  4URK A;  4YDY A;  2HM8 A;  2OEW A;  2VGE A;  3DWL G;  1FT2 A;  1N4R A;  2RKK A;  2FEZ A;  4UI9 K;  5FQ8 A;  2R03 A;  2IJG X;  1HF8 A;  1TN6 A;  4PUC A;  4UWK A;  5JHA A;  2J8S D;  3FUM A;  4HNA D;  3FY4 A;  5ENR D;  5DBK A;  3CQC B;  5FIO A;  4CYM D;  3E32 A;  2R05 A;  3FUD A;  4A3T A;  4K0R A;  4LNB A;  4GTT A;  3DSS A;  1HZ4 A;  3GYZ A;  4R7L A;  2X3M A;  5FTP A;  3SBS A;  3UI2 A;  2Y4U A;  2I9C A;  1BLX B;  3PVL A;  4Y6C A;  1MX4 A;  2AXU A;  4FHK A;  3SQV A;  3QJZ A;  1H2V C;  3HXD A;  1OCO E;  1H6O A;  1SZ9 A;  3CKB A;  4JB8 P;  4U0Z A;  5CER B;  1DNP A;  2VTB A;  3AG2 E;  3ASD A;  3ABM E;  4I6J A;  3TWV A;  4L7T A;  1UW4 B;  2LUH A;  3QWP A;  3DSW A;  1TJF A;  4CZ2 D;  4YVQ C;  3FTU A;  1H6K A;  2H6F A;  3TWT A;  4DK5 A;  4CDR A;  2J4D A;  4OVV A;  4TUU A;  1HS6 A;  4F7A A;  3PZ4 A;  5JJ7 A;  5AEN A;  3W9G A;  4FA6 A;  3MV2 B;  4ACL A;  4O6F A;  2V4L A;  1RW2 A;  1KPS B;  3UIO C;  1FPP A;  1NZN A;  2YIN A;  3UM0 A;  3J5P A;  2WXI A;  3IV0 A;  3ZXS A;  1H6P A;  3EIQ C;  1OY3 D;  1OWO A;  1E8X A;  1S70 B;  2LNI A;  4TUM A;  3GZ2 A;  4DLQ A;  2WXR A;  4IRU A;  3P2B A;  4HI8 A;  2WXK A;  4I9C A;  3NOG D;  4N5Q A;  4F1P A;  3APC A;  4HQD A;  4GPM A;  2WXF A;  3QK0 A;  3ABK E;  3BEE A;  5HKP A;  1LF8 A;  2JLB A;  2DVW A;  3RRN B;  2PL2 A;  4JZY A;  4PS7 A;  2L0I A;  3DSX A;  5D66 A;  3X2Q E;  4APO A;  2DCP A;  2XEE A;  4HOU A;  4Q96 A;  3KSL A;  4I2Z A;  2VSN A;  3SFX A;  2H6G A;  3MKQ A;  4J8E A;  4U8V D;  3V2O A;  1G3N B;  4TXQ A;  5EIB E;  4YND A;  1HU3 A;  1OT8 A; 
#chains in the Genus database with same CATH homology
 3JXI A;  4K5A B;  1IHB A;  1K1B A;  5KNH D;  1SVX A;  1BU9 A;  4DX1 A;  5EYL A;  4BES A;  3UTM A;  2ZGG A;  4DX6 D;  1BI7 B;  1YYH A;  3AAA C;  3T9K A;  2B0O E;  4HRM B;  2F37 A;  2ZGD A;  3D9H A;  4HRL A;  3Q9N C;  5HRY A;  4DX5 D;  1MYO A;  2XEH A;  5CBN A;  4NIK A;  3W9G A;  4F6R D;  5CEC B;  1N0Q A;  4B93 B;  2A5E A;  3B7B A;  4ATZ D;  3DEP A;  3AJI A;  5AN8 A;  1N0R A;  5AQ9 A;  4YDY A;  3C5R A;  3TWQ A;  5JA4 D;  1WDY A;  2VGE A;  4HRN A;  5KWD A;  2MYO A;  3HG0 D;  4ZFH A;  4C48 B;  4DRX E;  4QFV A;  2V5Q C;  3J5P A;  3V2X A;  4DX2 A;  2F8X K;  2Y0B G;  1SW6 A;  2XZT G;  1K3Z D;  5HS0 A;  2RFM A;  2DZO A;  2ETB A;  1MX2 A;  3TWX A;  5BXU A;  1DC2 A;  4K5B A;  2NYJ A;  1OY3 D;  5JMN D;  4RLY A;  2XZD G;  5EIL A;  2XEN A;  5EN5 D;  3F6Q A;  1BI8 B;  2J8S D;  3EHR A;  4HNA D;  1S70 B;  2QC9 A;  4TUM A;  5AAO A;  1D9S A;  1IKN D;  2KBX A;  4U8Y D;  1K1A A;  4HI8 A;  5EID A;  5ENR D;  5BXO A;  4HLL A;  3ZKJ A;  5AQA A;  3Q9U C;  4U95 D;  5FIN A;  4O1O A;  4G8K A;  3HRA A;  2F8Y A;  4UUC A;  4OAV B;  2Y1L E;  5FIO A;  4CYM D;  3NOG D;  4N5Q A;  4QQI A;  1AWC B;  1MJ0 A;  4HB5 A;  1BD8 A;  3EHQ A;  2L6B A;  4F1P A;  1AP7 A;  4O60 A;  4BSZ B;  4HQD A;  5KBA A;  2V4H C;  3J5Q B;  4LG6 A;  1IXV A;  4ZHB A;  4G8L A;  1TR4 A;  3TWW A;  2ETC A;  4GPM A;  5KNG A;  2PNN A;  3V30 A;  3V79 K;  5ENS D;  3UI2 A;  5HKP A;  1UOH A;  4OAU C;  5ITZ F;  4GMR A;  5AQB A;  3TWS A;  2BKK B;  5AQ7 A;  1NFI E;  2RFA A;  2P2C P;  4LNU D;  1QYM A;  3LJN A;  1BLX B;  3DEO A;  2FO1 E;  2DVW A;  2JAB A;  4U96 D;  5ENO D;  4Z68 A;  3IXE A;  2QYJ A;  4HI9 A;  4J8Y A;  5AAR A;  1MX4 A;  5ENT D;  4DX7 D;  1YCS B;  3W9F A;  3EU9 A;  5ENQ D;  3UXG A;  3TWU A;  4K5C A;  4BEP A;  4JB8 P;  5EYP F;  1MX6 A;  5D66 A;  5CBO A;  1N11 A;  2XEE A;  5CER B;  4BER A;  2BKG A;  2AJA A;  1DCQ A;  2DZN A;  3TWV A;  4YDW A;  3ZUV B;  5CEA A;  3NOC D;  3KEA A;  3T8K A;  4U8V D;  4O1P A;  3ZNG A;  1A5E A;  3V2O A;  3JUE A;  4J7W A;  3B95 A;  4DUI A;  3TWT A;  4A63 B;  3JXJ A;  3SO8 A;  1YMP A;  4LSZ E;  4CZ2 D;  1G3N B;  2ETA A;  4BET A;  3ZU7 B;  2HE0 A;  5CED B;  5EIB E;  2DWZ A;  1WG0 A;  5ENP D;  3NBN B;  4HBD A;  3V31 A;  2KXP C;  3TWR A;  1OT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...