5EILA

Computational design of a high-affinity metalloprotein homotrimer containing a metal chelating non-canonical amino acid
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
157
Chain Sequence
MSKLGEMLIAVLIGSKEAVKVLLDLGADPNASDEDGLTPLHAAAMAGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNTSDSDGRTPLDLAREHGNEEIVKLLEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Computational design of a homotrimeric metalloprotein with a trisbipyridyl core.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords TRI-05
total genus 54
structure length 157
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5eilA00
4G8KA 4K5BA 2F8XK 2Y0BG 3DEPA 5AQ9A 5CERB 1AWCB 1BI7B 1WDYA 2F37A 5KWDA 4OAVB 4O60A 1K1BA 3SO8A 4BERA 4J8YA 4LSZE 2XZDG 1OY3D 3C5RA 3NOGD 3T8KA 3AJIA 2XENA 1K1AA 3JXIA 3Q9NC 4HI8A 3V31A 5KBAA 4YDWA 3ZKJA 4F1PA 1MYOA 3AAAC 4CZ2D 4HQDA 2BKGA 2ETBA 4N5QA 4U96D 5EN5D 1S70B 2V5QC 3V2XA 4C48B 1BI8B 4B93B 3EHQA 3EU9A 1N11A 2AJAA 2ETAA 2ETCA 4HRMB 5CBOA 5AQ7A 5KNGA 5HKPA 3J5PA 4GPMA 5EYLA 3NBNB 3TWRA 4HI9A 3JXJA 2DWZA 4QQIA 4DUIA 4DX2A 5EYPF 5EILA 3V30A 1G3NB 1YMPA 1OT8A 4BESA 4ZFHA 3B95A 5JMND 5HS0A 4HLLA 3Q9UC 3DEOA 5AAOA 1IXVA 5ENRD 5ENTD 4F6RD 2FO1E 2Y1LE 3UI2A 5FIOA 3EHRA 4U8YD 3TWXA 2VGEA 2ZGDA 1SVXA 5CECB 4DRXE 1TR4A 3T9KA 1A5EA 3B7BA 1N0QA 4JB8P 3HG0D 2XEEA 4U95D 3V79K 4NIKA 2XEHA 2ZGGA 1IHBA 4HBDA 4LNUD 1NFIE 1SW6A 1WG0A 2A5EA 3NOCD 3ZNGA 4GMRA 5D66A 4LG6A 4DX1A 4TUMA 3ZUVB 4K5CA 4A63B 5HRYA 4HNAD 5ENPD 3TWVA 4BETA 4BSZB 5KNHD 4Z68A 4U8VD 4DX5D 5CBNA 3ZU7B 4UUCA 3V2OA 5BXOA 4QFVA 1YYHA 2DZNA 3KEAA 5CEDB 1QYMA 2KBXA 3TWQA 3F6QA 2JABA 3TWUA 2DVWA 3J5QB 3TWSA 4J7WA 5ENSD 2F8YA 3UTMA 2P2CP 4CYMD 5ENQD 3W9FA 4O1OA 2NYJA 2QC9A 4K5AB 4HRLA 4O1PA 4DX7D 2KXPC 1YCSB 4ZHBA 5AQAA 1MJ0A 4RLYA 5BXUA 3LJNA 4YDYA 2MYOA 4BEPA 3TWWA 1MX4A 5EIDA 1D9SA 2HE0A 2PNNA 2DZOA 2L6BA 4DX6D 4ATZD 1DC2A 5CEAA 3UXGA 1K3ZD 1AP7A 3IXEA 1BLXB 1IKND 1MX2A 3D9HA 3JUEA 4G8LA 2J8SD 5AQBA 4OAUC 5EIBE 1BD8A 1UOHA 2RFAA 3TWTA 2BKKB 2XZTG 2B0OE 5ENOD 4HB5A 5FINA 5ITZF 5AARA 5JA4D 1BU9A 2RFMA 1DCQA 5AN8A 2QYJA 3W9GA 1MX6A 3HRAA 4HRNA 2V4HC 1N0RA
chains in the Genus database with same CATH superfamily
2ZXWE 5EX0A 2IOLA 3PNTB 4LNBA 2P9SG 2LXLA 1ELRA 4C48B 3JCKC 4EHMA 3ULEG 1BI8B 4AEZC 4GPKA 4TXRA 3IKOB 4G11A 3Q73A 4EBAA 4LRZA 3DWLG 3CVPA 5HI7A 3UPVA 2R17C 3MV2B 2BTDA 2M63A 2Y3AA 3CKCA 3UKUG 2GRQB 4FHKA 1TJCA 2PM7A 2WXPA 5FQ6A 1JCSA 2XHEA 2V8SE 3NAWA 3UTMA 1JCQA 2LUHA 4J8DA 4O1OA 4GTPA 1INZA 3SF4A 4GAAA 3HXFA 3BQOA 4G25A 2X6KA 3G2UA 3FU5A 4OVVA 2VJ8A 4HOSA 3TXNA 2XRZA 5CMWA 2H6HA 1OCCE 2V4HC 4HOQA 3FUKA 1AWCB 3PZ2A 2F37A 4FULA 1K1BA 4NACA 3X2QE 1Z6TA 2WXJA 3QARA 3GW4A 3HDXA 4WAFA 3GZ1A 3RO2A 5CEAA 2BKGA 3LY7A 5DBKA 2KZTB 5HKPA 4WWNA 3Q47B 3J5PA 4CRWA 4HI9A 4I1OB 4UI9C 4ME2A 2YHEA 3FUHA 3PZ3A 2XPZA 3VLFA 4HLLA 3FUIA 3IHYA 5AAOA 4U07A 2P9KG 2ZGDA 4CEMA 2IQCA 3BEEA 1Q2ZA 2PQNA 4ILHB 5T3RA 3MKQA 2XEHA 4RG9A 2KCLA 5D66A 4LEUA 2QY7A 2DCPA 2KATA 4UUCA 5G04C 4GTRA 2IOSA 4IULA 3FU3A 2J9QA 4K03A 3TWSA 3PUKA 1E8WA 3RKVA 1E96B 4Q94A 1TEZA 4Y6CA 5LX8A 3AS4A 3ZHEA 1UN8A 1K3ZD 3RIBA 2UY1A 3D9LA 2KC7A 3MEKA 5AQBA 4I9EA 3C3OA 1TN7A 1HZ4A 4HB5A 2WXQA 1BU9A 5C2YA 4NQ0A 3O48A 1IYGA 1QZ2A 3UT7A 1Y6IA 4JZYA 3TG5A 2LNIA 4OAVB 1HH8A 3CIAA 4AXHA 2KM4A 1JCRA 4PS7A 4LNGA 3UMVA 1DNPA 3N71A 1E8YA 2QZAA 3ASNE 3D9PA 3Q49B 4GZ6A 4I2WA 4GCNA 4XI9A 4B93B 3SI5A 2ETCA 4AY6A 3R7RA 3S7BA 2B6CA 5AJDA 4EZLA 2IF4A 1TNZA 2BEDA 2ZIRA 1NP7A 3O4ZA 3B95A 5HS0A 3RRMB 3Q9UC 5BT1A 3EHNA 4BT9A 3ZVVA 3CQGB 1SZ9A 5FQ8A 3CK8A 1HS6A 4L1BA 4N3BA 3UT4A 2IO3C 2VTBB 4YDOA 2ZGGA 4N2SA 4CT0A 4XI0A 2QFCA 4ATGA 3CVQA 3Q75A 5HRYA 4AVXA 2C0LA 3OAWA 3PNLB 3SFYA 2DZNA 2X6FA 3RSEG 2OCCE 4F1SA 1VDYA 3MZLB 2WMOA 1H0AA 2DBAA 2ONDA 3L13A 2IY0C 1YCSB 4D10C 4DJAA 5G05J 4GZ5A 2PNNA 1MQSA 3FUFA 3IV0A 5FZRA 5BNWA 3FH7A 5EIBE 3HVEA 4KXKB 2B0OE 2WXGA 5AN8A 4U7EB 3SD5A 4PUCA 1BI7B 5KWDA 4WUYA 4C0EA 4CDMA 4ABNA 1K1AA 3ENEA 4X8QA 4FJZA 1S70B 1N11A 2J49A 3ABME 4JHRA 4B94A 1D8EA 4DLOA 3JQ1A 1N4QA 2X3MA 4DUIA 3CVNA 4UWFA 3DEOA 5CCLA 2Y1LE 1N4SA 3UIPC 1TR4A 3DXMG 1OXJA 4AOFA 4HORA 4FA6A 3CR3A 2AWIA 2WXIA 4LNUD 3UM3A 2A5EA 2AXUA 1H6KA 4A55A 4Y6WA 1FT1A 3P1UA 1H2UA 5KNHD 4Z68A 2WQ6A 4JA7A 3ASGA 3MKRA 2NSZA 1NI1A 1OUVA 2XPIA 1N9AA 1Z3YA 3W9FA 3MX3A 3QK0A 2EILE 3UUXA 1N94A 4AM9A 2R03A 3CHMA 2KZTA 4ANVA 2EIJE 4OAUC 5B3SE 1H6PA 1TN8A 3DSUA 3D9OA 4CGWA 4L23A 3I4RB 4U04A 4JHKA 3E33A 4U0ZA 1O1RA 4O60A 5HQ8A 4J8YA 4RG6A 3PE4A 3FUNA 3U3WA 2ETBA 3HHMA 3EHQA 3RJVA 3LS8A 3QJZA 4FLHA 4EBAG 2R2LA 2GROB 3ONKA 3SY2A 4TRQA 3FTXA 1RW2A 3QKYA 1HO8A 4XKBA 2GRNB 4GA0A 1A5EA 4JB8P 3MV3B 3PVLA 5FZSA 2JEKA 1OCRE 4WNFA 3D9MA 3LPZA 4H7YA 5CCMA 3AS5A 4J8EA 3SZ7A 3LYAA 3ZU7B 4F3VA 3DRAA 3TXMA 3AG1E 3PH0C 2Y4UA 4HRLA 3NQPA 4ZHBA 4KZ0A 3EHMA 1BLXB 4HLEA 4DPRA 2Y69E 4JPSA 4FHJA 4GTOA 2XPYA 4I6EA 4JC8A 5AIJA 2P9UG 1MZCA 5BPPA 4FP7A 5BW8C 1MYOA 2XS1A 1E8XA 1S64A 2V5QC 3ZW3A 3CSTA 1KLXA 3L08A 3U64A 3TWRA 2V4LA 2AW6A 2CHXA 1NA3A 1OWPA 3B7SA 3UQ3A 2Y4TA 2HM8A 4U8VD 5CBNA 1FVHA 4U0SA 3APCA 4BFRA 3CVVA 3D3MA 2JABA 4FLBA 2F8YA 4CYMD 3ULQA 2NYJA 4K5AB 4DX7D 1TNBA 3VLDA 4A1SA 3E34A 1MJ0A 5BXUA 2CFUA 2L6BA 3Q15A 3FH5A 3OXLA 3ESKA 2WXOA 4Q69A 4AIFA 3LVRE 5KJNA 3FTWA 4UQYA 3V2OA 3Q9NC 4B89A 3W9GA 3AAAC 4M7CA 4MLPA 5AQ9A 4GTVA 1IQRA 3PZDA 3SO8A 3ML9A 1ELWA 3SQVA 3ZPJA 2XZDG 3BU8A 3NOGD 3DSWA 1D8DA 3D9KA 4YDWA 4CZ2D 3V2XA 1FT2A 3E30A 4WNGA 3EU9A 4UWKA 2WPVA 5EYLA 3RK6A 3PZ4A 3DSXA 5A23A 4WWOA 1EYHA 4WNEA 1NA0A 3R7QA 4DI4A 3FDHA 3TGOA 1UG3A 2LSVA 2YINA 3C3QA 4EPZA 3TG4A 3FTSA 4GA1A 1SW6A 5CMYA 3S7JA 4GZ3A 3LXUX 3CSFA 3D9NA 1OWOA 2Q7FA 3ZXPA 3KEAA 4GYWA 3P2BA 1TNYA 4XZ4A 4J8FA 4U8HA 3HXCA 3KS2A 4RSYA 4MBGA 4FC8A 2XGMA 1ZU2A 3AG4E 3DSSA 4RLYA 4M3OA 5A7DB 3CEQA 2DZOA 4ILGA 4TXQA 1OWMA 3PZ1A 2BKKB 2P9PG 3ASFA 4LUNU 3PS6A 1N0RA 4HRMB 3SHFA 3QWPA 4K5BA 2F8XK 5DIZA 3FFLA 5JJ7A 3C98A 4LSZE 3LKUA 2WVIA 3MA5A 4GTSA 4KVOA 4AJWA 3FULA 4U63A 2P58C 3PE3A 3GZSA 2LAIA 3KSQA 4L2YA 4P29A 5FIOA 3EHRA 5CECB 3IBEA 4BWRA 1OCZE 4ACLA 3ISMC 4G23A 2FO7A 3HXEA 2I1KA 2L0IA 4HS2A 4KZCA 3Q7AA 4XE0A 1H6OA 5G04J 1UW4B 2FF4A 5BXOA 5CEDB 4MRUA 3SBSA 2HYZA 3BUAA 5ENQD 2WXKA 3RRNB 2GRLA 4E85A 4BEPA 2OVBA 5B1BE 1D9SA 2R5SA 3MYVA 1OWNA 3FP3A 3UXGA 1H2VC 1O5MA 2DIWA 4KT6B 3C3RA 4R7LA 1BD8A 4N3CA 3CV0A 1DCQA 2XEVA 2KCVA 4KVMA 2WMNA 5BV0A 1B89A 3AJIA 3V31A 4CDRA 4BT8A 1HG2A 4N5QA 3NB2A 3KD7A 4O6FA 1LTXA 5AQ7A 2YHCA 2FO1E 3TWXA 4DLQA 5FZQA 3PUJA 2BF0X 3PREA 4B8CB 3JQ0A 2QYUA 1A17A 3ZGQA 4L2LA 4CGVA 4IRUA 2LXMA 4UWGA 3PEVB 4I17A 3Q7FA 4HNAD 3R9MA 2R02A 4IYPA 2OVFA 1QYMA 2IO2C 2GGFA 2WXLA 1RZ4A 3UKRG 3CVLA 3FY4A 2IU1A 3CVXA 3FUDA 4O1PA 2VYIA 5D0OD 5ENNA 4GZCA 5ARFA 3DPDA 2HO1A 4NURA 4PH4B 5LP0A 5KCMA 3ESLA 4ATZD 5ARGA 3OXGA 2UWJG 2WQHA 2CFZA 3HXBA 3L82A 2OEWA 1PAQA 5ITZF 5AARA 2H6FA 2P2CP 2FI7A 4N2QA 3SFXA 3E4BA 3URZA 4J6IA 1O1TA 3G2VA 4BERA 4G2VA 3ABKE 4YVOA 1IHGA 3U9WA 3T8KA 4WWPA 5KBAA 4AY5A 3ZKJA 4F1PA 2ETAA 5KJLA 4AP2A 1FPPA 2J4BA 5EYPF 4MKTA 5LFAA 1Z5SC 4RQIA 1HFAA 1QQEA 3FUEA 4G26A 1U3DA 3ZRHA 2WXNA 5BUZA 2V5FA 2X6HA 4N5CA 3FH8A 4URKA 5CHEE 2J08A 3QAQA 4DRXE 3HG0D 2CHWA 3D9JA 4B0ZA 4BX9A 3FUMA 4NIKA 3CHRA 4HBDA 3L6AA 5AYWD 4U0UA 4LG6A 4DX1A 4TUMA 4BY6A 1V55E 3BG1B 4K5CA 1LF8A 3LDZA 5ENPD 2VSNA 4ANWA 4ACKA 4CCAA 3UM0A 5M72A 3TWUA 1FVFA 4JEUA 2R59A 5IY5E 5JHBA 4J0UA 5ENSD 2FBNA 3AU4A 2MOWA 3AU5A 5FT9A 4HFGA 3ZIMA 1E90A 4GYOA 3UIOC 4YDYA 2E0IA 2HE0A 1Z3XA 3CHOA 2IEJA 3Q78A 1AP7A 4FADA 4N3AA 3D9HA 3LY9A 1PC2A 4GZDA 2ILRA 3L16A 3OTNA 3ONLA 3TWTA 3QNKA 2VGXB 2BUGA 4GPMA 5ANLA 1MX6A 3V30A 3EUVA 1OT8A 4G8KA 3VTXA 4GMJA 1DVPA 1KZPA 3ASDA 3PRZA 5EX3A 2GW1A 3ABLE 3VTYA 2XQ0A 3KSLA 2GRPB 3S2AA 3APFA 2XRYA 4HQDA 4U96D 2PQRA 2AJAA 3CGHA 2XS8A 3ULYA 5LOZA 2DYRE 3QWWA 3HVEB 4YNDA 4K0RA 5JMND 2VTBA 4TUUA 3MKQB 4CDNA 4F6RD 3FTVA 5B1AE 2VSXE 5FQ7A 3CK9A 3DSTA 3B7BA 4N39A 2EIKE 4UQXA 5AENA 2WXHA 3L54A 3WG7E 2A5UA 5T4YA 4DI3A 3U4TA 3ZNGA 3HYMB 4ILIA 1EDUA 2L0TB 3JUIA 5KJMA 4DX5D 3ZN3A 3EJNA 3CVWA 4QFVA 3R9AB 2KBXA 3ZHEB 3QWVA 2DVWA 3DPYA 3J5QB 3LY8A 2UY1B 1E7VA 2KXPC 1TJFA 3KEZA 3RU0A 4A3VA 1HG5A 3LJNA 4JD2G 3FU6A 3L17A 5BV1A 4UI9K 4APOA 3CHQA 1SA4A 3B7UX 3WXXA 1N52A 2A4ZA 2XGOA 3BG0B 2RFAA 1HXIA 4JVSA 1N95A 5JJ6A 2QYJA 4BESA 3QDNA 4DX6D 3I4GA 5ANRA 2RG8A 2DYSE 2YQ8A 3SNXA 1TNUA 1U2VG 4I9CA 5C1DA 3QOUA 4WNDA 3GYZA 4OYSA 4GTMA 4KMOA 2EQXA 4GMLA 4PS8A 2OV8A 3TJPA 3LEWA 4BSXA 5AJLA 3ZYMA 3TAXA 2L9BA 4H7XA 3CHSA 1G3NB 5JJTA 2LO6A 4HOUA 4ZFHA 3ASHA 4HOTA 4EZKA 3VLEA 4U8YD 2I2OA 3ZYKA 1NZNA 4PS3A 4C9BB 1H2TC 1X5BA 3SGHA 2I6HA 4U95D 4A1GA 2WM9A 4TXPA 2J4DA 3ZFWA 2GRMA 3U66A 4A63B 4BSZB 3TWVA 3S7FA 2H6IA 3TWQA 4LCTA 4PDXA 4GCOA 1XNFA 1MHQA 2CHZA 1S0PA 5EIDA 1OWLA 3JUEA 2H6GA 4MS6A 3EU5A 2CG3A 2XZTG 2OOEA 3AG3E 3CVYA 3TWWA 4Q96A 3HRAA 5ENRD 4HRNA 3T5XA 1JUQA 1SQMA 3DEPA 1WDYA 5G55A 3L9TA 3CLJA 3CQCB 4HI8A 3ML8A 5G2NA 3FTUA 3FEYA 2IJGX 2WXRA 3FTYA 2IFUA 4I6GA 3NBNB 3FTZA 5EILA 4RVBA 1N54A 1IXVA 3UI2A 1TN6A 2VGEA 1V54E 3AG2E 4YDEA 4JXTA 1GW6A 1HU3A 5J08A 5EDSA 3RRUA 4UWHA 4OVUA 1KZOA 3NZSA 3NOCD 1QBQA 4XX5A 1TYQG 4TV3A 1KT1A 3EDTB 1H19A 3G2SA 3FWVA 1ZBPA 1YYHA 2ZISA 1OCOE 1X81A 5LCWC 1EPUA 1NL4A 2IONA 1U3CA 2ZU6B 4I1AA 4I43A 1N4PA 3Q4AB 4FU3A 2MYOA 3OXFA 2EIME 3B7TA 1JPLA 3Q79A 5A6CA 1KT0A 3IXEA 1MX2A 2P9LG 4G8LA 2J8SD 4F53A 4JA9A 2OEVA 3QB2A 2YNQA 1UOHA 4XIFA 5FWQA 1E7UA 2PZIA 1JWFA 5FINA 2PM6A 5JA4D 4G24A 2L6JA 3I3NA 3HIZA 4JEHA 2RD0A 4XEIG 1UJKA 5CBOA 3UM2A 3Q5MA 3ZEFA 4GTQA 4QQIA 2HR2A 1TNOA 4GU5A 4L9PA 3PDNA 2F0YA 5ENTD 1JWGA 1P5QA 5E76A 2AXZA 4FJYA 1SVXA 3LJ3A 3E32A 4UI9J 2FULA 3FEXA 3T9KA 1N0QA 4E6HA 2AVPA 2WQ7A 2XEEA 2EINE 1IHBA 1WG0A 2WXFA 3EIQC 2P9IG 4ANUA 4GMRA 5J90A 5CRUA 4XKCA 4EZJA 5FQ4A 4F7AA 1FCHA 4JHJA 3B7RL 3DBSA 3G2WA 1WY6A 3B13A 1DCEA 1N4RA 3T5VA 4J7WA 4I2ZA 4KBQA 2FEZA 2V0PA 4EQFA 4NRHB 4B8AA 4YVQC 3CHPA 1LD7A 1DC2A 3GZ2A 3ZXSA 1YA0A 2KCKA 5EKQD 5CRVA 2C2LA 4GA2A 1QNFA 3FHEA 2RFMA 1L5JA 1HF8A 1XGWA 1HE8A 3UM1A 5FJYA 4AV7A 5CERB 3MJWA 4GB9A 4V3IA 3S7DA 5FTPA 3MCXA 3D9IA 2J07A 3T8MA 2WB2A 3APDA 3EIJA 2CG2A 4HVBA 4LERA 3CVUA 2LAHA 5KNGA 3G2TA 1S63A 4I1MA 1UN9A 2LSUA 4UWLA 2PL2A 2X6IA 2MRIA 3SFZA 4CT4A 5D2MC 3RO3A 3UX4A 2XGSA 1SZAA 3UT8A 2JLBA 3V79K 4APFA 2XCBA 4EECA 3QC1A 1NFIE 2GRRB 3RAUA 4BETA 2VSYA 3TL5A 1HX8A 4HXIA 3AS8A 2MHKA 3F6QA 4JW1A 3IEGA 3SBTB 1ELKA 5LCWJ 3ASOE 4BTAA 3HXDA 3KAEA 1IKND 1K8KG 1LD8A 1E8ZA 5G05C 2NC9A 1WAO1 2VQ2A 4BTBA 2WXMA 2I1JA 3LVQE 2RKKA 2Y0BG 4L7TA 4GTTA 1SA5A 3C72A 1OY3D 3C5RA 3PEUB 4DK5A 2XENA 4I6JA 3JXIA 3CK7A 1ZB1A 3FU0A 2J09A 2I9CA 5EN5D 4GYYA 2X38A 2X6JA 3DSVA 3JXJA 2DWZA 4DX2A 4UQZA 1EF1C 1YMPA 3ZYLA 1PY1A 3CKBA 2AXVA 3E37A 4A3TA 2VGYA 5H7PA 1O1SA 2R05A 3NF1A 1UJJA 3MGBA 4ANXA 5T8IA 4IN3B 4BX8A 3NZUA 3ZUVB 5JHAA 1KPSB 5KJKA 1W3BA 2E2EA 2VGXA 3UINC 3L22A 4KYOB 2NXPA 4W9RA 1BPOA 2P9NG 4J8SA 2QC9A 2C0MA 2XCCA 5AQAA 3IHVA 1MX4A 4JL0A 5E75A 1Y8MA 3I5PA 3JYSA 3DXKG 4C0MA 4G1TA 1IQUA 5D0QD 3LCAA 3K9IA 5ENOD 1WM5A 3ZYQA 3FUJA 2VSOE
chains in the Genus database with same CATH topology
4G8KA 4K5BA 2F8XK 2Y0BG 3DEPA 5AQ9A 5CERB 1AWCB 1BI7B 1WDYA 2F37A 5KWDA 4OAVB 4O60A 1K1BA 3SO8A 4BERA 4J8YA 4LSZE 2XZDG 1OY3D 3C5RA 3NOGD 3T8KA 3AJIA 2XENA 1K1AA 3JXIA 3Q9NC 4HI8A 3V31A 5KBAA 4YDWA 3ZKJA 4F1PA 1MYOA 3AAAC 4CZ2D 4HQDA 2BKGA 2ETBA 4N5QA 4U96D 5EN5D 1S70B 2V5QC 3V2XA 4C48B 1BI8B 4B93B 3EHQA 3EU9A 1N11A 2AJAA 2ETAA 2ETCA 4HRMB 5CBOA 5AQ7A 5KNGA 5HKPA 3J5PA 4GPMA 5EYLA 3NBNB 3TWRA 4HI9A 3JXJA 2DWZA 4QQIA 4DUIA 4DX2A 5EYPF 5EILA 3V30A 1G3NB 1YMPA 1OT8A 4BESA 4ZFHA 3B95A 5JMND 5HS0A 4HLLA 3Q9UC 3DEOA 5AAOA 1IXVA 5ENRD 5ENTD 4F6RD 2FO1E 2Y1LE 3UI2A 5FIOA 3EHRA 4U8YD 3TWXA 2VGEA 2ZGDA 1SVXA 5CECB 4DRXE 1TR4A 3T9KA 1A5EA 3B7BA 1N0QA 4JB8P 3HG0D 2XEEA 4U95D 3V79K 4NIKA 2XEHA 2ZGGA 1IHBA 4HBDA 4LNUD 1NFIE 1SW6A 1WG0A 2A5EA 3NOCD 3ZNGA 4GMRA 5D66A 4LG6A 4DX1A 4TUMA 3ZUVB 4K5CA 4A63B 5HRYA 4HNAD 5ENPD 3TWVA 4BETA 4BSZB 5KNHD 4Z68A 4U8VD 4DX5D 5CBNA 3ZU7B 4UUCA 3V2OA 5BXOA 4QFVA 1YYHA 2DZNA 3KEAA 5CEDB 1QYMA 2KBXA 3TWQA 3F6QA 2JABA 3TWUA 2DVWA 3J5QB 3TWSA 4J7WA 5ENSD 2F8YA 3UTMA 2P2CP 4CYMD 5ENQD 3W9FA 4O1OA 2NYJA 2QC9A 4K5AB 4HRLA 4O1PA 4DX7D 2KXPC 1YCSB 4ZHBA 5AQAA 1MJ0A 4RLYA 5BXUA 3LJNA 4YDYA 2MYOA 4BEPA 3TWWA 1MX4A 5EIDA 1D9SA 2HE0A 2PNNA 2DZOA 2L6BA 4DX6D 4ATZD 1DC2A 5CEAA 3UXGA 1K3ZD 1AP7A 3IXEA 1BLXB 1IKND 1MX2A 3D9HA 3JUEA 4G8LA 2J8SD 5AQBA 4OAUC 5EIBE 1BD8A 1UOHA 2RFAA 3TWTA 2BKKB 2XZTG 2B0OE 5ENOD 4HB5A 5FINA 5ITZF 5AARA 5JA4D 1BU9A 2RFMA 1DCQA 5AN8A 2QYJA 3W9GA 1MX6A 3HRAA 4HRNA 2V4HC 1N0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G8K A;  4K5B A;  2F8X K;  2Y0B G;  3DEP A;  5AQ9 A;  5CER B;  1AWC B;  1BI7 B;  1WDY A;  2F37 A;  5KWD A;  4OAV B;  4O60 A;  1K1B A;  3SO8 A;  4BER A;  4J8Y A;  4LSZ E;  2XZD G;  1OY3 D;  3C5R A;  3NOG D;  3T8K A;  3AJI A;  2XEN A;  1K1A A;  3JXI A;  3Q9N C;  4HI8 A;  3V31 A;  5KBA A;  4YDW A;  3ZKJ A;  4F1P A;  1MYO A;  3AAA C;  4CZ2 D;  4HQD A;  2BKG A;  2ETB A;  4N5Q A;  4U96 D;  5EN5 D;  1S70 B;  2V5Q C;  3V2X A;  4C48 B;  1BI8 B;  4B93 B;  3EHQ A;  3EU9 A;  1N11 A;  2AJA A;  2ETA A;  2ETC A;  4HRM B;  5CBO A;  5AQ7 A;  5KNG A;  5HKP A;  3J5P A;  4GPM A;  5EYL A;  3NBN B;  3TWR A;  4HI9 A;  3JXJ A;  2DWZ A;  4QQI A;  4DUI A;  4DX2 A;  5EYP F;  5EIL A;  3V30 A;  1G3N B;  1YMP A;  1OT8 A;  4BES A;  4ZFH A;  3B95 A;  5JMN D;  5HS0 A;  4HLL A;  3Q9U C;  3DEO A;  5AAO A;  1IXV A;  5ENR D;  5ENT D;  4F6R D;  2FO1 E;  2Y1L E;  3UI2 A;  5FIO A;  3EHR A;  4U8Y D;  3TWX A;  2VGE A;  2ZGD A;  1SVX A;  5CEC B;  4DRX E;  1TR4 A;  3T9K A;  1A5E A;  3B7B A;  1N0Q A;  4JB8 P;  3HG0 D;  2XEE A;  4U95 D;  3V79 K;  4NIK A;  2XEH A;  2ZGG A;  1IHB A;  4HBD A;  4LNU D;  1NFI E;  1SW6 A;  1WG0 A;  2A5E A;  3NOC D;  3ZNG A;  4GMR A;  5D66 A;  4LG6 A;  4DX1 A;  4TUM A;  3ZUV B;  4K5C A;  4A63 B;  5HRY A;  4HNA D;  5ENP D;  3TWV A;  4BET A;  4BSZ B;  5KNH D;  4Z68 A;  4U8V D;  4DX5 D;  5CBN A;  3ZU7 B;  4UUC A;  3V2O A;  5BXO A;  4QFV A;  1YYH A;  2DZN A;  3KEA A;  5CED B;  1QYM A;  2KBX A;  3TWQ A;  3F6Q A;  2JAB A;  3TWU A;  2DVW A;  3J5Q B;  3TWS A;  4J7W A;  5ENS D;  2F8Y A;  3UTM A;  2P2C P;  4CYM D;  5ENQ D;  3W9F A;  4O1O A;  2NYJ A;  2QC9 A;  4K5A B;  4HRL A;  4O1P A;  4DX7 D;  2KXP C;  1YCS B;  4ZHB A;  5AQA A;  1MJ0 A;  4RLY A;  5BXU A;  3LJN A;  4YDY A;  2MYO A;  4BEP A;  3TWW A;  1MX4 A;  5EID A;  1D9S A;  2HE0 A;  2PNN A;  2DZO A;  2L6B A;  4DX6 D;  4ATZ D;  1DC2 A;  5CEA A;  3UXG A;  1K3Z D;  1AP7 A;  3IXE A;  1BLX B;  1IKN D;  1MX2 A;  3D9H A;  3JUE A;  4G8L A;  2J8S D;  5AQB A;  4OAU C;  5EIB E;  1BD8 A;  1UOH A;  2RFA A;  3TWT A;  2BKK B;  2XZT G;  2B0O E;  5ENO D;  4HB5 A;  5FIN A;  5ITZ F;  5AAR A;  5JA4 D;  1BU9 A;  2RFM A;  1DCQ A;  5AN8 A;  2QYJ A;  3W9G A;  1MX6 A;  3HRA A;  4HRN A;  2V4H C;  1N0R A; 
#chains in the Genus database with same CATH topology
 2ZXW E;  5EX0 A;  2IOL A;  3PNT B;  4LNB A;  2P9S G;  2LXL A;  1ELR A;  4C48 B;  3JCK C;  4EHM A;  3ULE G;  1BI8 B;  4AEZ C;  4GPK A;  4TXR A;  3IKO B;  4G11 A;  3Q73 A;  4EBA A;  4LRZ A;  3DWL G;  3CVP A;  5HI7 A;  3UPV A;  2R17 C;  3MV2 B;  2BTD A;  2M63 A;  2Y3A A;  3CKC A;  3UKU G;  2GRQ B;  4FHK A;  1TJC A;  2PM7 A;  2WXP A;  5FQ6 A;  1JCS A;  2XHE A;  2V8S E;  3NAW A;  3UTM A;  1JCQ A;  2LUH A;  4J8D A;  4O1O A;  4GTP A;  1INZ A;  3SF4 A;  4GAA A;  3HXF A;  3BQO A;  4G25 A;  2X6K A;  3G2U A;  3FU5 A;  4OVV A;  2VJ8 A;  4HOS A;  3TXN A;  2XRZ A;  5CMW A;  2H6H A;  1OCC E;  2V4H C;  4HOQ A;  3FUK A;  1AWC B;  3PZ2 A;  2F37 A;  4FUL A;  1K1B A;  4NAC A;  3X2Q E;  1Z6T A;  2WXJ A;  3QAR A;  3GW4 A;  3HDX A;  4WAF A;  3GZ1 A;  3RO2 A;  5CEA A;  2BKG A;  3LY7 A;  5DBK A;  2KZT B;  5HKP A;  4WWN A;  3Q47 B;  3J5P A;  4CRW A;  4HI9 A;  4I1O B;  4UI9 C;  4ME2 A;  2YHE A;  3FUH A;  3PZ3 A;  2XPZ A;  3VLF A;  4HLL A;  3FUI A;  3IHY A;  5AAO A;  4U07 A;  2P9K G;  2ZGD A;  4CEM A;  2IQC A;  3BEE A;  1Q2Z A;  2PQN A;  4ILH B;  5T3R A;  3MKQ A;  2XEH A;  4RG9 A;  2KCL A;  5D66 A;  4LEU A;  2QY7 A;  2DCP A;  2KAT A;  4UUC A;  5G04 C;  4GTR A;  2IOS A;  4IUL A;  3FU3 A;  2J9Q A;  4K03 A;  3TWS A;  3PUK A;  1E8W A;  3RKV A;  1E96 B;  4Q94 A;  1TEZ A;  4Y6C A;  5LX8 A;  3AS4 A;  3ZHE A;  1UN8 A;  1K3Z D;  3RIB A;  2UY1 A;  3D9L A;  2KC7 A;  3MEK A;  5AQB A;  4I9E A;  3C3O A;  1TN7 A;  1HZ4 A;  4HB5 A;  2WXQ A;  1BU9 A;  5C2Y A;  4NQ0 A;  3O48 A;  1IYG A;  1QZ2 A;  3UT7 A;  1Y6I A;  4JZY A;  3TG5 A;  2LNI A;  4OAV B;  1HH8 A;  3CIA A;  4AXH A;  2KM4 A;  1JCR A;  4PS7 A;  4LNG A;  3UMV A;  1DNP A;  3N71 A;  1E8Y A;  2QZA A;  3ASN E;  3D9P A;  3Q49 B;  4GZ6 A;  4I2W A;  4GCN A;  4XI9 A;  4B93 B;  3SI5 A;  2ETC A;  4AY6 A;  3R7R A;  3S7B A;  2B6C A;  5AJD A;  4EZL A;  2IF4 A;  1TNZ A;  2BED A;  2ZIR A;  1NP7 A;  3O4Z A;  3B95 A;  5HS0 A;  3RRM B;  3Q9U C;  5BT1 A;  3EHN A;  4BT9 A;  3ZVV A;  3CQG B;  1SZ9 A;  5FQ8 A;  3CK8 A;  1HS6 A;  4L1B A;  4N3B A;  3UT4 A;  2IO3 C;  2VTB B;  4YDO A;  2ZGG A;  4N2S A;  4CT0 A;  4XI0 A;  2QFC A;  4ATG A;  3CVQ A;  3Q75 A;  5HRY A;  4AVX A;  2C0L A;  3OAW A;  3PNL B;  3SFY A;  2DZN A;  2X6F A;  3RSE G;  2OCC E;  4F1S A;  1VDY A;  3MZL B;  2WMO A;  1H0A A;  2DBA A;  2OND A;  3L13 A;  2IY0 C;  1YCS B;  4D10 C;  4DJA A;  5G05 J;  4GZ5 A;  2PNN A;  1MQS A;  3FUF A;  3IV0 A;  5FZR A;  5BNW A;  3FH7 A;  5EIB E;  3HVE A;  4KXK B;  2B0O E;  2WXG A;  5AN8 A;  4U7E B;  3SD5 A;  4PUC A;  1BI7 B;  5KWD A;  4WUY A;  4C0E A;  4CDM A;  4ABN A;  1K1A A;  3ENE A;  4X8Q A;  4FJZ A;  1S70 B;  1N11 A;  2J49 A;  3ABM E;  4JHR A;  4B94 A;  1D8E A;  4DLO A;  3JQ1 A;  1N4Q A;  2X3M A;  4DUI A;  3CVN A;  4UWF A;  3DEO A;  5CCL A;  2Y1L E;  1N4S A;  3UIP C;  1TR4 A;  3DXM G;  1OXJ A;  4AOF A;  4HOR A;  4FA6 A;  3CR3 A;  2AWI A;  2WXI A;  4LNU D;  3UM3 A;  2A5E A;  2AXU A;  1H6K A;  4A55 A;  4Y6W A;  1FT1 A;  3P1U A;  1H2U A;  5KNH D;  4Z68 A;  2WQ6 A;  4JA7 A;  3ASG A;  3MKR A;  2NSZ A;  1NI1 A;  1OUV A;  2XPI A;  1N9A A;  1Z3Y A;  3W9F A;  3MX3 A;  3QK0 A;  2EIL E;  3UUX A;  1N94 A;  4AM9 A;  2R03 A;  3CHM A;  2KZT A;  4ANV A;  2EIJ E;  4OAU C;  5B3S E;  1H6P A;  1TN8 A;  3DSU A;  3D9O A;  4CGW A;  4L23 A;  3I4R B;  4U04 A;  4JHK A;  3E33 A;  4U0Z A;  1O1R A;  4O60 A;  5HQ8 A;  4J8Y A;  4RG6 A;  3PE4 A;  3FUN A;  3U3W A;  2ETB A;  3HHM A;  3EHQ A;  3RJV A;  3LS8 A;  3QJZ A;  4FLH A;  4EBA G;  2R2L A;  2GRO B;  3ONK A;  3SY2 A;  4TRQ A;  3FTX A;  1RW2 A;  3QKY A;  1HO8 A;  4XKB A;  2GRN B;  4GA0 A;  1A5E A;  4JB8 P;  3MV3 B;  3PVL A;  5FZS A;  2JEK A;  1OCR E;  4WNF A;  3D9M A;  3LPZ A;  4H7Y A;  5CCM A;  3AS5 A;  4J8E A;  3SZ7 A;  3LYA A;  3ZU7 B;  4F3V A;  3DRA A;  3TXM A;  3AG1 E;  3PH0 C;  2Y4U A;  4HRL A;  3NQP A;  4ZHB A;  4KZ0 A;  3EHM A;  1BLX B;  4HLE A;  4DPR A;  2Y69 E;  4JPS A;  4FHJ A;  4GTO A;  2XPY A;  4I6E A;  4JC8 A;  5AIJ A;  2P9U G;  1MZC A;  5BPP A;  4FP7 A;  5BW8 C;  1MYO A;  2XS1 A;  1E8X A;  1S64 A;  2V5Q C;  3ZW3 A;  3CST A;  1KLX A;  3L08 A;  3U64 A;  3TWR A;  2V4L A;  2AW6 A;  2CHX A;  1NA3 A;  1OWP A;  3B7S A;  3UQ3 A;  2Y4T A;  2HM8 A;  4U8V D;  5CBN A;  1FVH A;  4U0S A;  3APC A;  4BFR A;  3CVV A;  3D3M A;  2JAB A;  4FLB A;  2F8Y A;  4CYM D;  3ULQ A;  2NYJ A;  4K5A B;  4DX7 D;  1TNB A;  3VLD A;  4A1S A;  3E34 A;  1MJ0 A;  5BXU A;  2CFU A;  2L6B A;  3Q15 A;  3FH5 A;  3OXL A;  3ESK A;  2WXO A;  4Q69 A;  4AIF A;  3LVR E;  5KJN A;  3FTW A;  4UQY A;  3V2O A;  3Q9N C;  4B89 A;  3W9G A;  3AAA C;  4M7C A;  4MLP A;  5AQ9 A;  4GTV A;  1IQR A;  3PZD A;  3SO8 A;  3ML9 A;  1ELW A;  3SQV A;  3ZPJ A;  2XZD G;  3BU8 A;  3NOG D;  3DSW A;  1D8D A;  3D9K A;  4YDW A;  4CZ2 D;  3V2X A;  1FT2 A;  3E30 A;  4WNG A;  3EU9 A;  4UWK A;  2WPV A;  5EYL A;  3RK6 A;  3PZ4 A;  3DSX A;  5A23 A;  4WWO A;  1EYH A;  4WNE A;  1NA0 A;  3R7Q A;  4DI4 A;  3FDH A;  3TGO A;  1UG3 A;  2LSV A;  2YIN A;  3C3Q A;  4EPZ A;  3TG4 A;  3FTS A;  4GA1 A;  1SW6 A;  5CMY A;  3S7J A;  4GZ3 A;  3LXU X;  3CSF A;  3D9N A;  1OWO A;  2Q7F A;  3ZXP A;  3KEA A;  4GYW A;  3P2B A;  1TNY A;  4XZ4 A;  4J8F A;  4U8H A;  3HXC A;  3KS2 A;  4RSY A;  4MBG A;  4FC8 A;  2XGM A;  1ZU2 A;  3AG4 E;  3DSS A;  4RLY A;  4M3O A;  5A7D B;  3CEQ A;  2DZO A;  4ILG A;  4TXQ A;  1OWM A;  3PZ1 A;  2BKK B;  2P9P G;  3ASF A;  4LUN U;  3PS6 A;  1N0R A;  4HRM B;  3SHF A;  3QWP A;  4K5B A;  2F8X K;  5DIZ A;  3FFL A;  5JJ7 A;  3C98 A;  4LSZ E;  3LKU A;  2WVI A;  3MA5 A;  4GTS A;  4KVO A;  4AJW A;  3FUL A;  4U63 A;  2P58 C;  3PE3 A;  3GZS A;  2LAI A;  3KSQ A;  4L2Y A;  4P29 A;  5FIO A;  3EHR A;  5CEC B;  3IBE A;  4BWR A;  1OCZ E;  4ACL A;  3ISM C;  4G23 A;  2FO7 A;  3HXE A;  2I1K A;  2L0I A;  4HS2 A;  4KZC A;  3Q7A A;  4XE0 A;  1H6O A;  5G04 J;  1UW4 B;  2FF4 A;  5BXO A;  5CED B;  4MRU A;  3SBS A;  2HYZ A;  3BUA A;  5ENQ D;  2WXK A;  3RRN B;  2GRL A;  4E85 A;  4BEP A;  2OVB A;  5B1B E;  1D9S A;  2R5S A;  3MYV A;  1OWN A;  3FP3 A;  3UXG A;  1H2V C;  1O5M A;  2DIW A;  4KT6 B;  3C3R A;  4R7L A;  1BD8 A;  4N3C A;  3CV0 A;  1DCQ A;  2XEV A;  2KCV A;  4KVM A;  2WMN A;  5BV0 A;  1B89 A;  3AJI A;  3V31 A;  4CDR A;  4BT8 A;  1HG2 A;  4N5Q A;  3NB2 A;  3KD7 A;  4O6F A;  1LTX A;  5AQ7 A;  2YHC A;  2FO1 E;  3TWX A;  4DLQ A;  5FZQ A;  3PUJ A;  2BF0 X;  3PRE A;  4B8C B;  3JQ0 A;  2QYU A;  1A17 A;  3ZGQ A;  4L2L A;  4CGV A;  4IRU A;  2LXM A;  4UWG A;  3PEV B;  4I17 A;  3Q7F A;  4HNA D;  3R9M A;  2R02 A;  4IYP A;  2OVF A;  1QYM A;  2IO2 C;  2GGF A;  2WXL A;  1RZ4 A;  3UKR G;  3CVL A;  3FY4 A;  2IU1 A;  3CVX A;  3FUD A;  4O1P A;  2VYI A;  5D0O D;  5ENN A;  4GZC A;  5ARF A;  3DPD A;  2HO1 A;  4NUR A;  4PH4 B;  5LP0 A;  5KCM A;  3ESL A;  4ATZ D;  5ARG A;  3OXG A;  2UWJ G;  2WQH A;  2CFZ A;  3HXB A;  3L82 A;  2OEW A;  1PAQ A;  5ITZ F;  5AAR A;  2H6F A;  2P2C P;  2FI7 A;  4N2Q A;  3SFX A;  3E4B A;  3URZ A;  4J6I A;  1O1T A;  3G2V A;  4BER A;  4G2V A;  3ABK E;  4YVO A;  1IHG A;  3U9W A;  3T8K A;  4WWP A;  5KBA A;  4AY5 A;  3ZKJ A;  4F1P A;  2ETA A;  5KJL A;  4AP2 A;  1FPP A;  2J4B A;  5EYP F;  4MKT A;  5LFA A;  1Z5S C;  4RQI A;  1HFA A;  1QQE A;  3FUE A;  4G26 A;  1U3D A;  3ZRH A;  2WXN A;  5BUZ A;  2V5F A;  2X6H A;  4N5C A;  3FH8 A;  4URK A;  5CHE E;  2J08 A;  3QAQ A;  4DRX E;  3HG0 D;  2CHW A;  3D9J A;  4B0Z A;  4BX9 A;  3FUM A;  4NIK A;  3CHR A;  4HBD A;  3L6A A;  5AYW D;  4U0U A;  4LG6 A;  4DX1 A;  4TUM A;  4BY6 A;  1V55 E;  3BG1 B;  4K5C A;  1LF8 A;  3LDZ A;  5ENP D;  2VSN A;  4ANW A;  4ACK A;  4CCA A;  3UM0 A;  5M72 A;  3TWU A;  1FVF A;  4JEU A;  2R59 A;  5IY5 E;  5JHB A;  4J0U A;  5ENS D;  2FBN A;  3AU4 A;  2MOW A;  3AU5 A;  5FT9 A;  4HFG A;  3ZIM A;  1E90 A;  4GYO A;  3UIO C;  4YDY A;  2E0I A;  2HE0 A;  1Z3X A;  3CHO A;  2IEJ A;  3Q78 A;  1AP7 A;  4FAD A;  4N3A A;  3D9H A;  3LY9 A;  1PC2 A;  4GZD A;  2ILR A;  3L16 A;  3OTN A;  3ONL A;  3TWT A;  3QNK A;  2VGX B;  2BUG A;  4GPM A;  5ANL A;  1MX6 A;  3V30 A;  3EUV A;  1OT8 A;  4G8K A;  3VTX A;  4GMJ A;  1DVP A;  1KZP A;  3ASD A;  3PRZ A;  5EX3 A;  2GW1 A;  3ABL E;  3VTY A;  2XQ0 A;  3KSL A;  2GRP B;  3S2A A;  3APF A;  2XRY A;  4HQD A;  4U96 D;  2PQR A;  2AJA A;  3CGH A;  2XS8 A;  3ULY A;  5LOZ A;  2DYR E;  3QWW A;  3HVE B;  4YND A;  4K0R A;  5JMN D;  2VTB A;  4TUU A;  3MKQ B;  4CDN A;  4F6R D;  3FTV A;  5B1A E;  2VSX E;  5FQ7 A;  3CK9 A;  3DST A;  3B7B A;  4N39 A;  2EIK E;  4UQX A;  5AEN A;  2WXH A;  3L54 A;  3WG7 E;  2A5U A;  5T4Y A;  4DI3 A;  3U4T A;  3ZNG A;  3HYM B;  4ILI A;  1EDU A;  2L0T B;  3JUI A;  5KJM A;  4DX5 D;  3ZN3 A;  3EJN A;  3CVW A;  4QFV A;  3R9A B;  2KBX A;  3ZHE B;  3QWV A;  2DVW A;  3DPY A;  3J5Q B;  3LY8 A;  2UY1 B;  1E7V A;  2KXP C;  1TJF A;  3KEZ A;  3RU0 A;  4A3V A;  1HG5 A;  3LJN A;  4JD2 G;  3FU6 A;  3L17 A;  5BV1 A;  4UI9 K;  4APO A;  3CHQ A;  1SA4 A;  3B7U X;  3WXX A;  1N52 A;  2A4Z A;  2XGO A;  3BG0 B;  2RFA A;  1HXI A;  4JVS A;  1N95 A;  5JJ6 A;  2QYJ A;  4BES A;  3QDN A;  4DX6 D;  3I4G A;  5ANR A;  2RG8 A;  2DYS E;  2YQ8 A;  3SNX A;  1TNU A;  1U2V G;  4I9C A;  5C1D A;  3QOU A;  4WND A;  3GYZ A;  4OYS A;  4GTM A;  4KMO A;  2EQX A;  4GML A;  4PS8 A;  2OV8 A;  3TJP A;  3LEW A;  4BSX A;  5AJL A;  3ZYM A;  3TAX A;  2L9B A;  4H7X A;  3CHS A;  1G3N B;  5JJT A;  2LO6 A;  4HOU A;  4ZFH A;  3ASH A;  4HOT A;  4EZK A;  3VLE A;  4U8Y D;  2I2O A;  3ZYK A;  1NZN A;  4PS3 A;  4C9B B;  1H2T C;  1X5B A;  3SGH A;  2I6H A;  4U95 D;  4A1G A;  2WM9 A;  4TXP A;  2J4D A;  3ZFW A;  2GRM A;  3U66 A;  4A63 B;  4BSZ B;  3TWV A;  3S7F A;  2H6I A;  3TWQ A;  4LCT A;  4PDX A;  4GCO A;  1XNF A;  1MHQ A;  2CHZ A;  1S0P A;  5EID A;  1OWL A;  3JUE A;  2H6G A;  4MS6 A;  3EU5 A;  2CG3 A;  2XZT G;  2OOE A;  3AG3 E;  3CVY A;  3TWW A;  4Q96 A;  3HRA A;  5ENR D;  4HRN A;  3T5X A;  1JUQ A;  1SQM A;  3DEP A;  1WDY A;  5G55 A;  3L9T A;  3CLJ A;  3CQC B;  4HI8 A;  3ML8 A;  5G2N A;  3FTU A;  3FEY A;  2IJG X;  2WXR A;  3FTY A;  2IFU A;  4I6G A;  3NBN B;  3FTZ A;  5EIL A;  4RVB A;  1N54 A;  1IXV A;  3UI2 A;  1TN6 A;  2VGE A;  1V54 E;  3AG2 E;  4YDE A;  4JXT A;  1GW6 A;  1HU3 A;  5J08 A;  5EDS A;  3RRU A;  4UWH A;  4OVU A;  1KZO A;  3NZS A;  3NOC D;  1QBQ A;  4XX5 A;  1TYQ G;  4TV3 A;  1KT1 A;  3EDT B;  1H19 A;  3G2S A;  3FWV A;  1ZBP A;  1YYH A;  2ZIS A;  1OCO E;  1X81 A;  5LCW C;  1EPU A;  1NL4 A;  2ION A;  1U3C A;  2ZU6 B;  4I1A A;  4I43 A;  1N4P A;  3Q4A B;  4FU3 A;  2MYO A;  3OXF A;  2EIM E;  3B7T A;  1JPL A;  3Q79 A;  5A6C A;  1KT0 A;  3IXE A;  1MX2 A;  2P9L G;  4G8L A;  2J8S D;  4F53 A;  4JA9 A;  2OEV A;  3QB2 A;  2YNQ A;  1UOH A;  4XIF A;  5FWQ A;  1E7U A;  2PZI A;  1JWF A;  5FIN A;  2PM6 A;  5JA4 D;  4G24 A;  2L6J A;  3I3N A;  3HIZ A;  4JEH A;  2RD0 A;  4XEI G;  1UJK A;  5CBO A;  3UM2 A;  3Q5M A;  3ZEF A;  4GTQ A;  4QQI A;  2HR2 A;  1TNO A;  4GU5 A;  4L9P A;  3PDN A;  2F0Y A;  5ENT D;  1JWG A;  1P5Q A;  5E76 A;  2AXZ A;  4FJY A;  1SVX A;  3LJ3 A;  3E32 A;  4UI9 J;  2FUL A;  3FEX A;  3T9K A;  1N0Q A;  4E6H A;  2AVP A;  2WQ7 A;  2XEE A;  2EIN E;  1IHB A;  1WG0 A;  2WXF A;  3EIQ C;  2P9I G;  4ANU A;  4GMR A;  5J90 A;  5CRU A;  4XKC A;  4EZJ A;  5FQ4 A;  4F7A A;  1FCH A;  4JHJ A;  3B7R L;  3DBS A;  3G2W A;  1WY6 A;  3B13 A;  1DCE A;  1N4R A;  3T5V A;  4J7W A;  4I2Z A;  4KBQ A;  2FEZ A;  2V0P A;  4EQF A;  4NRH B;  4B8A A;  4YVQ C;  3CHP A;  1LD7 A;  1DC2 A;  3GZ2 A;  3ZXS A;  1YA0 A;  2KCK A;  5EKQ D;  5CRV A;  2C2L A;  4GA2 A;  1QNF A;  3FHE A;  2RFM A;  1L5J A;  1HF8 A;  1XGW A;  1HE8 A;  3UM1 A;  5FJY A;  4AV7 A;  5CER B;  3MJW A;  4GB9 A;  4V3I A;  3S7D A;  5FTP A;  3MCX A;  3D9I A;  2J07 A;  3T8M A;  2WB2 A;  3APD A;  3EIJ A;  2CG2 A;  4HVB A;  4LER A;  3CVU A;  2LAH A;  5KNG A;  3G2T A;  1S63 A;  4I1M A;  1UN9 A;  2LSU A;  4UWL A;  2PL2 A;  2X6I A;  2MRI A;  3SFZ A;  4CT4 A;  5D2M C;  3RO3 A;  3UX4 A;  2XGS A;  1SZA A;  3UT8 A;  2JLB A;  3V79 K;  4APF A;  2XCB A;  4EEC A;  3QC1 A;  1NFI E;  2GRR B;  3RAU A;  4BET A;  2VSY A;  3TL5 A;  1HX8 A;  4HXI A;  3AS8 A;  2MHK A;  3F6Q A;  4JW1 A;  3IEG A;  3SBT B;  1ELK A;  5LCW J;  3ASO E;  4BTA A;  3HXD A;  3KAE A;  1IKN D;  1K8K G;  1LD8 A;  1E8Z A;  5G05 C;  2NC9 A;  1WAO 1;  2VQ2 A;  4BTB A;  2WXM A;  2I1J A;  3LVQ E;  2RKK A;  2Y0B G;  4L7T A;  4GTT A;  1SA5 A;  3C72 A;  1OY3 D;  3C5R A;  3PEU B;  4DK5 A;  2XEN A;  4I6J A;  3JXI A;  3CK7 A;  1ZB1 A;  3FU0 A;  2J09 A;  2I9C A;  5EN5 D;  4GYY A;  2X38 A;  2X6J A;  3DSV A;  3JXJ A;  2DWZ A;  4DX2 A;  4UQZ A;  1EF1 C;  1YMP A;  3ZYL A;  1PY1 A;  3CKB A;  2AXV A;  3E37 A;  4A3T A;  2VGY A;  5H7P A;  1O1S A;  2R05 A;  3NF1 A;  1UJJ A;  3MGB A;  4ANX A;  5T8I A;  4IN3 B;  4BX8 A;  3NZU A;  3ZUV B;  5JHA A;  1KPS B;  5KJK A;  1W3B A;  2E2E A;  2VGX A;  3UIN C;  3L22 A;  4KYO B;  2NXP A;  4W9R A;  1BPO A;  2P9N G;  4J8S A;  2QC9 A;  2C0M A;  2XCC A;  5AQA A;  3IHV A;  1MX4 A;  4JL0 A;  5E75 A;  1Y8M A;  3I5P A;  3JYS A;  3DXK G;  4C0M A;  4G1T A;  1IQU A;  5D0Q D;  3LCA A;  3K9I A;  5ENO D;  1WM5 A;  3ZYQ A;  3FUJ A;  2VSO E; 
#chains in the Genus database with same CATH homology
 4G8K A;  4K5B A;  2F8X K;  2Y0B G;  3DEP A;  5AQ9 A;  5CER B;  1AWC B;  1BI7 B;  1WDY A;  2F37 A;  5KWD A;  4OAV B;  4O60 A;  1K1B A;  3SO8 A;  4BER A;  4J8Y A;  4LSZ E;  2XZD G;  1OY3 D;  3C5R A;  3NOG D;  3T8K A;  3AJI A;  2XEN A;  1K1A A;  3JXI A;  3Q9N C;  4HI8 A;  3V31 A;  5KBA A;  4YDW A;  3ZKJ A;  4F1P A;  1MYO A;  3AAA C;  4CZ2 D;  4HQD A;  2BKG A;  2ETB A;  4N5Q A;  4U96 D;  5EN5 D;  1S70 B;  2V5Q C;  3V2X A;  4C48 B;  1BI8 B;  4B93 B;  3EHQ A;  3EU9 A;  1N11 A;  2AJA A;  2ETA A;  2ETC A;  4HRM B;  5CBO A;  5AQ7 A;  5KNG A;  5HKP A;  3J5P A;  4GPM A;  5EYL A;  3NBN B;  3TWR A;  4HI9 A;  3JXJ A;  2DWZ A;  4QQI A;  4DUI A;  4DX2 A;  5EYP F;  5EIL A;  3V30 A;  1G3N B;  1YMP A;  1OT8 A;  4BES A;  4ZFH A;  3B95 A;  5JMN D;  5HS0 A;  4HLL A;  3Q9U C;  3DEO A;  5AAO A;  1IXV A;  5ENR D;  5ENT D;  4F6R D;  2FO1 E;  2Y1L E;  3UI2 A;  5FIO A;  3EHR A;  4U8Y D;  3TWX A;  2VGE A;  2ZGD A;  1SVX A;  5CEC B;  4DRX E;  1TR4 A;  3T9K A;  1A5E A;  3B7B A;  1N0Q A;  4JB8 P;  3HG0 D;  2XEE A;  4U95 D;  3V79 K;  4NIK A;  2XEH A;  2ZGG A;  1IHB A;  4HBD A;  4LNU D;  1NFI E;  1SW6 A;  1WG0 A;  2A5E A;  3NOC D;  3ZNG A;  4GMR A;  5D66 A;  4LG6 A;  4DX1 A;  4TUM A;  3ZUV B;  4K5C A;  4A63 B;  5HRY A;  4HNA D;  5ENP D;  3TWV A;  4BET A;  4BSZ B;  5KNH D;  4Z68 A;  4U8V D;  4DX5 D;  5CBN A;  3ZU7 B;  4UUC A;  3V2O A;  5BXO A;  4QFV A;  1YYH A;  2DZN A;  3KEA A;  5CED B;  1QYM A;  2KBX A;  3TWQ A;  3F6Q A;  2JAB A;  3TWU A;  2DVW A;  3J5Q B;  3TWS A;  4J7W A;  5ENS D;  2F8Y A;  3UTM A;  2P2C P;  4CYM D;  5ENQ D;  3W9F A;  4O1O A;  2NYJ A;  2QC9 A;  4K5A B;  4HRL A;  4O1P A;  4DX7 D;  2KXP C;  1YCS B;  4ZHB A;  5AQA A;  1MJ0 A;  4RLY A;  5BXU A;  3LJN A;  4YDY A;  2MYO A;  4BEP A;  3TWW A;  1MX4 A;  5EID A;  1D9S A;  2HE0 A;  2PNN A;  2DZO A;  2L6B A;  4DX6 D;  4ATZ D;  1DC2 A;  5CEA A;  3UXG A;  1K3Z D;  1AP7 A;  3IXE A;  1BLX B;  1IKN D;  1MX2 A;  3D9H A;  3JUE A;  4G8L A;  2J8S D;  5AQB A;  4OAU C;  5EIB E;  1BD8 A;  1UOH A;  2RFA A;  3TWT A;  2BKK B;  2XZT G;  2B0O E;  5ENO D;  4HB5 A;  5FIN A;  5ITZ F;  5AAR A;  5JA4 D;  1BU9 A;  2RFM A;  1DCQ A;  5AN8 A;  2QYJ A;  3W9G A;  1MX6 A;  3HRA A;  4HRN A;  2V4H C;  1N0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...