5EILA

Computational design of a high-affinity metalloprotein homotrimer containing a metal chelating non-canonical amino acid
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
157
Chain Sequence
MSKLGEMLIAVLIGSKEAVKVLLDLGADPNASDEDGLTPLHAAAMAGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNTSDSDGRTPLDLAREHGNEEIVKLLEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords TRI-05
publication title Computational design of a homotrimeric metalloprotein with a trisbipyridyl core.
pubmed doi rcsb
source organism Synthetic construct
total genus 54
structure length 157
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5eilA00
3V2XA 5ENSD 5CBNA 4DX6D 1YYHA 2XZTG 4G8LA 2KXPC 4HNAD 3TWUA 1N11A 2Y0BG 2Y1LE 3B7BA 5AQBA 2DVWA 1DCQA 4BSZB 3TWVA 2DZNA 1OY3D 4NIKA 3V2OA 5CBOA 2JABA 4GMRA 5KBAA 3TWTA 3IXEA 3D9HA 3UTMA 5KWDA 4BETA 1D9SA 1MX4A 2B0OE 2BKGA 1K3ZD 5JA4D 4DX1A 2XEHA 4DUIA 4LG6A 2F8YA 4GPMA 5JMND 2RFMA 4ATZD 3NBNB 1DC2A 1IHBA 5AN8A 1TR4A 4U8VD 3TWRA 3HG0D 5BXUA 2F37A 1N0QA 1MX2A 4F1PA 2QYJA 1IXVA 2FO1E 1UOHA 4TUMA 1WG0A 5AQ7A 1A5EA 1NFIE 4K5AB 3W9GA 4HRNA 1IKND 4JB8P 1YCSB 4CYMD 4BESA 3AJIA 3JXIA 3C5RA 2J8SD 2ZGGA 1K1AA 1N0RA 4HLLA 4J8YA 3T8KA 1BD8A 5EN5D 3EHQA 3TWSA 5ENRD 3B95A 1AP7A 4Z68A 4DX2A 2P2CP 4QQIA 3V79K 4K5BA 3EHRA 2F8XK 3V31A 1SVXA 5CECB 2MYOA 4YDYA 3ZUVB 2A5EA 5ENTD 3W9FA 2VGEA 3JXJA 4J7WA 5HRYA 3Q9UC 5AARA 5AAOA 4N5QA 2DZOA 4HRLA 5AQ9A 1G3NB 2BKKB 3JUEA 1MYOA 5ENOD 4DRXE 4CZ2D 3TWXA 5FINA 4QFVA 5D66A 4HI8A 4HQDA 2XZDG 5ENPD 1SW6A 3V30A 4B93B 4ZHBA 2XENA 3DEOA 1YMPA 3J5PA 3Q9NC 5EYLA 5ENQD 5FIOA 2V4HC 4F6RD 2ETCA 2RFAA 2V5QC 5EIDA 1K1BA 3UI2A 4U8YD 2DWZA 3LJNA 4BEPA 4DX5D 5BXOA 3ZU7B 1BI8B 2AJAA 3TWQA 2ETBA 4G8KA 5CEDB 5EIBE 4DX7D 4K5CA 1BLXB 3DEPA 5HKPA 5EILA 4C48B 1BI7B 1MJ0A 5AQAA 3SO8A 1QYMA 2NYJA 3UXGA 4ZFHA 4U95D 1BU9A 3J5QB 5KNGA 2XEEA 4HBDA 1WDYA 5ITZF 2PNNA 4HRMB 5KNHD 4LNUD 4RLYA 3ZKJA 3HRAA 4O1PA 4U96D 5CERB 4LSZE 4O60A 1MX6A 1OT8A 2KBXA 3NOCD 4UUCA 4YDWA 5EYPF 4BERA 2HE0A 3T9KA 3TWWA 2ZGDA 3KEAA 1AWCB 2L6BA 5CEAA 2ETAA 4HI9A 4A63B 5HS0A 4HB5A 2QC9A 3F6QA 4O1OA 3ZNGA 1S70B 4OAVB 3NOGD 3AAAC 3EU9A 4OAUC
chains in the Genus database with same CATH superfamily
2R03A 4BT8A 1UN9A 5H7PA 1ZB1A 2X38A 1N11A 4XEIG 4DLOA 3Q7AA 3WG7E 3RRNB 4ACLA 4DUIA 4LG6A 2IOLA 4ATZD 2VSNA 3CEQA 4OVVA 1O1SA 5ANRA 2MRIA 3ULQA 1UOHA 1WG0A 2P9NG 5HI7A 1OWOA 2EIME 4L2LA 3OXGA 3HIZA 2EQXA 2IFUA 3T8KA 1FT2A 3UKUG 4AIFA 1UN8A 2XQ0A 4HOTA 1KT0A 4DX2A 1OCZE 2C0LA 4GTMA 4URKA 4CRWA 2MYOA 4MRUA 5HRYA 5AAOA 5AQ9A 3TL5A 2VJ8A 2FO7A 4J8SA 4XE0A 1FCHA 4GYYA 3LYAA 2V5QC 2XPZA 4IYPA 3PE3A 3PEUB 3LJNA 3BG0B 2L6JA 3VTYA 3LY7A 3PZ4A 3B13A 3O48A 4FP7A 2VGYA 1SA5A 4GZ3A 1E7UA 4LNUD 4RLYA 3TJPA 4AXHA 2VTBB 2KM4A 2P9UG 1OWNA 2QC9A 1WM5A 3L6AA 3EDTB 4WUYA 1NZNA 3FEXA 3ESKA 3HVEB 4DI3A 5AJLA 1E7VA 1HZ4A 4KBQA 3SFXA 3SI5A 4JZYA 4G26A 5KWDA 3FUHA 2PQNA 4UWHA 5AYWD 2YHCA 2QYJA 5C1DA 2XGOA 4U04A 2WXQA 1HS6A 3JXIA 2CHXA 2WMOA 3HXFA 4PUCA 3PZ1A 2WXLA 5BNWA 4YVOA 3DSSA 3AG2E 2BUGA 2I1KA 3DSXA 4D10C 4L23A 5ARGA 2QFCA 5FINA 2H6HA 4RQIA 2CHWA 4I2ZA 3JUIA 4GA0A 3J5PA 3QK0A 2R5SA 4F6RD 4PS7A 5CMWA 1GW6A 3UQ3A 5HQ8A 3EU5A 4Y6WA 3ZEFA 3FUKA 5EDSA 4U0ZA 3FFLA 3SY2A 4JXTA 4OYSA 4O60A 5KJNA 2WPVA 3PS6A 1N54A 4LEUA 5CCMA 3D9PA 1TN8A 2AXUA 4OAUC 1FPPA 4I6EA 3V2XA 3DSUA 1OWLA 2KXPC 1JCQA 1KPSB 2B6CA 3QC1A 3TXMA 5FWQA 3FU6A 1RW2A 1D9SA 3EIJA 5FZSA 2F8YA 4GPMA 3PE4A 4XIFA 5BXUA 3CHOA 3CVQA 5KCMA 4FU3A 3FULA 3PZ3A 2HR2A 2P9IG 3AJIA 4LRZA 2GRQB 2J9QA 4EZKA 4DPRA 1DVPA 2KCKA 1KZOA 2OCCE 2FBNA 2VSYA 3CIAA 1SVXA 4JEUA 4RG6A 4F1SA 2WQ6A 1TNZA 2H6IA 4DRXE 3CKBA 3UINC 3S7DA 2R59A 1EDUA 3DEOA 4U7EB 2AW6A 3LY8A 2C0MA 3SFYA 5EIDA 2OOEA 2DWZA 1BI8B 5EIBE 4B89A 1BI7B 1IHGA 2DCPA 4EHMA 3FEYA 3FU3A 2V4LA 1MQSA 1Z6TA 4JD2G 3JQ1A 1LF8A 4A55A 4HS2A 2A5UA 3NOCD 4AJWA 1WAO1 4L9PA 3ZW3A 3PREA 2GGFA 2QZAA 5CCLA 1O1RA 3IBEA 3V2OA 3K9IA 4N3AA 3RAUA 2P9PG 3LCAA 1K3ZD 5JA4D 4M3OA 3ZVVA 4BT9A 4KMOA 3DRAA 2WXKA 4F1PA 4TXQA 3Q15A 4K5AB 4JEHA 1SA4A 1O5MA 2J8SD 4ANUA 4AY6A 4HLLA 3PUJA 2LXMA 3TWSA 2GRLA 4BTBA 4Z68A 4XX5A 3LKUA 3UM1A 1V55E 1PAQA 3BEEA 4LUNU 3FH5A 3PDNA 2AXVA 3UPVA 4B94A 4HOUA 4F53A 2H6FA 3OXLA 2P9SG 3R7RA 2GRPB 3CK9A 3SNXA 3FWVA 2AVPA 3UT7A 2WXPA 1Z5SC 5HKPA 4Q96A 2IQCA 1QYMA 3ULYA 3CVNA 2E0IA 2J07A 4HBDA 3AG4E 4XKBA 3RSEG 2XS8A 5CERB 4CT0A 3MKRA 3APCA 3TWWA 3BU8A 4AEZC 3S2AA 5CEAA 1H2TC 1S70B 1QNFA 2YQ8A 1JUQA 1H6PA 4DX6D 1QQEA 2DZNA 5CHEE 4YDOA 1ELKA 3ISMC 4ME2A 3FUFA 3OAWA 3G2SA 3UM2A 2WVIA 3UM0A 5BV1A 5AQ7A 1KT1A 4I1AA 3C5RA 2XGSA 1K1AA 4J8YA 1E8XA 2GROB 3SZ7A 1EF1C 1TN7A 1MHQA 4MLPA 2F8XK 3C72A 3ZYLA 1H6OA 3V31A 3D9NA 3I3NA 3NZUA 1K8KG 5ENTD 3R9MA 1N95A 3BG1B 3SFZA 2C2LA 4ZHBA 1YMPA 5EYLA 3CVLA 1LTXA 2V4HC 4N5CA 3RRUA 3D9OA 3ASFA 4XZ4A 2IO2C 2J4DA 2ETBA 2VQ2A 4K5CA 4NACA 3UXGA 2NYJA 5D0QD 4U95D 3FTVA 1IQRA 1H19A 3PZ2A 3FU5A 4GMLA 3TG5A 5KNHD 3MJWA 3PNTB 4IRUA 5DBKA 3ASOE 2KBXA 5J08A 2XHEA 3GZSA 3SHFA 2LSUA 4N2QA 3NB2A 4CGWA 4MKTA 3HHMA 4HOSA 4BFRA 4IN3B 4YNDA 2DVWA 1DCQA 2LUHA 1ELWA 3FDHA 4BETA 3ENEA 3UKRG 3UUXA 5E76A 4FA6A 1HH8A 2R2LA 1H6KA 2OEWA 2UY1B 3P1UA 3EHNA 4BY6A 3QOUA 3SBSA 2CG2A 4KZ0A 4NRHB 2WXJA 4UQZA 4U07A 2YNQA 3LY9A 3KS2A 3UT4A 4H7XA 3CQCB 4TRQA 2XENA 2WXHA 3ONKA 3Q9NC 4ANWA 3X2QE 1VDYA 4A1SA 3UI2A 3R7QA 1OWMA 3Q5MA 5EILA 4C48B 4KZCA 1BU9A 5LOZA 2KCLA 4U0SA 1TNBA 3I5PA 3UM3A 3AG3E 2ZGDA 3KEAA 1EYHA 5A7DB 3SD5A 2ZXWE 1TNYA 4JC8A 3B7SA 1A17A 1N4RA 1UG3A 5JHAA 4WNDA 3CK8A 3G2TA 3L82A 4FHKA 4PH4B 1NP7A 2XCCA 4LERA 2JABA 4Y6CA 4GTSA 4KVMA 4OVUA 5CRUA 5AN8A 4EQFA 1PC2A 1OCRE 4GZ5A 3FUJA 4AY5A 3CK7A 2J4BA 2RD0A 3SQVA 4GPKA 4J8FA 2XGMA 4TXRA 2XPIA 3D9MA 3AS8A 3CHPA 3MGBA 3FTUA 3MV2B 3NF1A 3ULEG 4JL0A 3FTWA 3ZUVB 4EZJA 5G55A 3JUEA 3CHQA 2CG3A 3ZYQA 5B1BE 5D2MC 1TJFA 3RU0A 3VTXA 4XKCA 1E90A 1E8ZA 4DX5D 3S7JA 5T8IA 4YDEA 5CEDB 3EHMA 2VGXB 3UIPC 5EX3A 2WXGA 2PNNA 3C98A 4J0UA 3HXCA 3DSWA 1OT8A 4TV3A 3ZYMA 2ETAA 2CFZA 3PUKA 2V8SE 2VYIA 1ZU2A 2ONDA 3ASHA 3LEWA 4JW1A 3PH0C 4R7LA 4FC8A 3TWVA 4PS3A 3IV0A 3P2BA 5KBAA 3D9HA 3SF4A 1TJCA 4DK5A 4DX1A 4RVBA 4WNGA 2XEHA 3QAQA 4U8VD 5AJDA 2F37A 3WXXA 1EPUA 1X81A 3MYVA 1FT1A 3QWWA 4GTOA 3ABME 3G2WA 2RG8A 1DNPA 2QYUA 2ZGGA 2IOSA 4A3TA 4A1GA 1HO8A 4H7YA 4AP2A 1U2VG 2Q7FA 3GW4A 4N5QA 3LPZA 3DPYA 5G04C 2VTBA 1SZAA 1HE8A 2KCVA 3KSQA 4JPSA 3BUAA 3APDA 3FU0A 5FIOA 4W9RA 5FTPA 3T8MA 2PQRA 2ETCA 3CSTA 3LJ3A 1O1TA 3HVEA 4G8KA 3BQOA 3CR3A 2XEEA 4J6IA 3SBTB 4AVXA 4CCAA 3Q47B 4XI0A 3U64A 2HYZA 3T9KA 4UWGA 5T4YA 4YVQC 4JHRA 2OVFA 5D0OD 4F7AA 3ESLA 3UX4A 5CBNA 2WB2A 4GMJA 5A23A 1Y6IA 2PL2A 4G8LA 3TWUA 2Y1LE 5AQBA 4WNFA 3AS5A 3MKQB 3D9LA 4B8CB 3UTMA 3U3WA 2XPYA 1NA3A 2V0PA 1DC2A 2KZTB 1TR4A 3TWRA 3CKCA 4BSXA 3Q78A 3HXDA 2A4ZA 1HU3A 3AU5A 3W9GA 1IYGA 5JJ6A 2CHZA 2OVBA 1BD8A 5ENRD 5DIZA 3E4BA 3ZRHA 2X6KA 3AS4A 4ATGA 5T3RA 3ZYKA 1N9AA 4X8QA 4L1BA 2FEZA 3ONLA 4U0UA 3W9FA 4JHJA 2BKKB 2WQ7A 4I1MA 2R05A 4HQDA 5ENPD 5E75A 2JEKA 4GCNA 1UW4B 5A6CA 2HM8A 3FTYA 2FULA 2J08A 4B0ZA 3ZPJA 4RG9A 3AU4A 3HYMB 4BEPA 5BXOA 4DLQA 3DEPA 3SO8A 2Y4TA 3DXMG 2GRRB 2KATA 2LNIA 4KXKB 2E2EA 3ZN3A 2DIWA 1NL4A 3UIOC 1OCCE 5LX8A 1W3BA 2HE0A 1TEZA 2H6GA 3AAAC 3EU9A 2Y69E 4V3IA 4JA7A 4GZ6A 4C9BB 4N3CA 2KC7A 2PM6A 3TWTA 3IXEA 4DJAA 5BT1A 3VLEA 3HG0D 3ZIMA 2WXMA 3LS8A 1IXVA 1IKND 4BESA 1SQMA 3LVRE 2NSZA 2PZIA 4HVBA 5EX0A 3E32A 3TXNA 1H0AA 4HOQA 1HG2A 3KD7A 3E33A 4UQYA 4K5BA 3S7FA 3Q79A 1NI1A 3D3MA 5JJ7A 3E34A 1FVFA 3JXJA 4ACKA 3QDNA 1G3NB 3GZ2A 2IY0C 2OEVA 3LDZA 5BV0A 2R17C 5ENQD 3PEVB 1UJKA 2WXIA 2AJAA 4DX7D 1BLXB 2X6IA 4J8EA 2UWJG 2IJGX 3FH7A 2CFUA 4FLHA 4ANVA 4HFGA 4WNEA 1X5BA 3O4ZA 1MX6A 3JCKC 2YINA 1AWCB 3I4RB 2L6BA 4FHJA 4HI9A 4A63B 2EIJE 3C3RA 3PVLA 4OAVB 4K0RA 5AIJA 3B7TA 4E6HA 4EBAG 2PM7A 5G2NA 4K03A 3RO2A 3CVWA 3DXKG 4GTPA 1OWPA 1OY3D 2ZISA 2AWIA 3CHSA 3DBSA 2IU1A 3RRMB 1S64A 2RFMA 3NBNB 1U3CA 4I43A 1A5EA 3FUDA 5LP0A 3KAEA 4CYMD 4JB8P 3QB2A 4C0EA 5KJKA 5G05C 4GB9A 5EN5D 2IO3C 3FHEA 4GYWA 3CHMA 4AOFA 2GRNB 5LFAA 2XRYA 1PY1A 2FF4A 3IEGA 2GW1A 4J7WA 3D9KA 1N4QA 3FY4A 2WXOA 1HX8A 3G2UA 1IQUA 5B1AE 4QFVA 3G2VA 4GCOA 4Q94A 2XZDG 1SW6A 1MZCA 3GYZA 5FQ7A 4I9EA 4APOA 4NQ0A 1INZA 3IHVA 4GZCA 1FVHA 3TWQA 3ZXPA 4I1OB 1HFAA 3J5QB 1WDYA 1N4PA 2OV8A 4LCTA 3UMVA 4F3VA 3Q75A 5B3SE 1S63A 4U96D 2J09A 3S7BA 2X6JA 4BERA 3NQPA 4G25A 2QY7A 3E37A 5FQ4A 1QZ2A 4AV7A 3C3OA 1N94A 3DSTA 1YYHA 2I9CA 4DI4A 4HNAD 4G23A 5G04J 5J90A 5CBOA 3UT8A 2BF0X 4ILGA 2WMNA 1MX4A 3ML8A 3CLJA 3EIQC 2Y3AA 1IHBA 1DCEA 1OXJA 1XGWA 4HXIA 4FADA 4TUMA 3T5VA 2YHEA 3TAXA 3RJVA 1RZ4A 1E96B 1TYQG 3QKYA 3CV0A 4HLEA 2V5FA 4LNBA 1D8EA 2VSOE 4B8AA 5AENA 2X3MA 4CDRA 3ZHEA 5AARA 1D8DA 4ILIA 3SGHA 5BUZA 3PZDA 1NA0A 3ASDA 4UQXA 3EJNA 1K1BA 4U8YD 5KJMA 3Q7FA 4UWLA 1OUVA 2LXLA 3ML9A 2L0IA 1KLXA 4KVOA 4ZFHA 5KNGA 3FTZA 5ITZF 2HO1A 4G1TA 4FLBA 1TNOA 3MX3A 4UUCA 5EYPF 4UWFA 2I2OA 4CEMA 5HS0A 5ARFA 3FUNA 4HB5A 4PDXA 1V54E 1HF8A 5ENSD 3MCXA 3R9AB 4BTAA 4KT6B 2XZTG 5KJLA 4GA2A 3DPDA 3CVXA 2UY1A 3PNLB 3FUIA 3ASGA 4GMRA 2L0TB 4KYOB 2B0OE 1S0PA 3FUMA 3OXFA 5JMND 4M7CA 2FI7A 1JPLA 3DSVA 4J8DA 1N0QA 3FP3A 3DWLG 1JCRA 1NFIE 4ILHB 4I17A 2X6FA 3CQGB 4G2VA 2DYRE 3JYSA 4L2YA 2DBAA 4UI9C 2XRZA 4QQIA 1Y8MA 3ZFWA 2XEVA 5CECB 2EINE 2A5EA 4FJYA 2VGEA 3APFA 3U4TA 2LAHA 2ZU6B 1B89A 4A3VA 4BWRA 1L5JA 4JA9A 3AG1E 4N2SA 4WAFA 3C3QA 1LD7A 5FZRA 1HXIA 3PRZA 1UJJA 4GAAA 2RFAA 4L7TA 2LSVA 3FUEA 3ZU7B 3ZGQA 3QJZA 1SZ9A 4HORA 1N4SA 4EBAA 4HRMB 4IULA 4I2WA 3RIBA 3NZSA 4P29A 3VLDA 4CT4A 2XS1A 1ELRA 3IHYA 3HXEA 2VSXE 4GYOA 3MZLB 3L08A 1N0RA 4UWKA 3FTSA 3D9IA 1XNFA 3L17A 5ENNA 4BX9A 3Q73A 4GTQA 5IY5E 3ABKE 2R02A 3B7RL 2LAIA 1Z3XA 1H2UA 2WXFA 2WXNA 5CMYA 4N3BA 1MX2A 3CGHA 4WWNA 5FQ8A 5FQ6A 3MA5A 4GZDA 2NXPA 5CRVA 3HXBA 3B95A 2BTDA 3I4GA 3QWVA 3Q4AB 3L54A 2VGXA 3L22A 3LVQE 5BPPA 3Q9UC 2EILE 5ENOD 4CZ2D 3TWXA 2M63A 2WQHA 3D9JA 5D66A 3V30A 3U9WA 1KZPA 1JWGA 3CHRA 3L13A 5BW8C 3B7UX 3RKVA 1MJ0A 3CSFA 5AQAA 3CVYA 3QARA 4NURA 3TG4A 1E8WA 3QNKA 5G05J 3ZKJA 4U63A 1HG5A 1YA0A 4C0MA 3N71A 4CDNA 1ZBPA 3CVVA 2I1JA 2P58C 2WXRA 4BSZB 3E30A 1N52A 3VLFA 5LCWJ 4UI9K 3Q49B 2WM9A 5EKQD 4U8HA 4TXPA 2XCBA 4MBGA 5FZQA 2LO6A 2RKKA 2GRMA 3EHQA 1AP7A 3KEZA 2P2CP 3V79K 1E8YA 1OCOE 3EHRA 3HDXA 4JVSA 3NAWA 4YDYA 4EECA 4APFA 1WY6A 4CDMA 1QBQA 3ZXSA 2ILRA 2AXZA 4CGVA 4HI8A 5C2YA 4E85A 3ASNE 4B93B 5JJTA 2L9BA 4GTRA 1JCSA 4EZLA 1JWFA 3FH8A 4GA1A 4WWPA 4MS6A 3GZ1A 4WWOA 3MKQA 3URZA 4ABNA 4ANXA 3HRAA 4O1PA 4LSZE 2JLBA 2P9LG 5ANLA 2KZTA 4O1OA 3RO3A 3ZNGA 1LD8A 1H2VC 2J49A 3L9TA 3RK6A 3MEKA 4G11A 4N39A 5JHBA 2IEJA 3OTNA 2Y0BG 3B7BA 2IF4A 4NIKA 4XI9A 4O6FA 3MV3B 3IKOB 2BKGA 5M72A 3LXUX 4GU5A 3CVUA 1P5QA 4I6GA 1U3DA 1TNUA 2FO1E 1Q2ZA 5FT9A 4HRNA 3KSLA 1YCSB 2MOWA 2EIKE 2MHKA 1BPOA 3FTXA 2NC9A 4I9CA 2IONA 2P9KG 2X6HA 4G24A 4TUUA 4RSYA 2F0YA 3EUVA 4Q69A 2BEDA 3ZHEB 2I6HA 3U66A 2DZOA 4HRLA 1MYOA 2Y4UA 1Z3YA 3T5XA 3ABLE 4AM9A 4LNGA 4FJZA 4GTVA 4I6JA 4PS8A 5FJYA 4BX8A 4JHKA 3JQ0A 1TN6A 3QWPA 4FULA 4EPZA 2ZIRA 3TGOA 4YDWA 4UI9J 5LCWC 3F6QA 3CVPA 2DYSE 3L16A 3NOGD 4GTTA
chains in the Genus database with same CATH topology
3V2XA 5ENSD 5CBNA 4DX6D 1YYHA 2XZTG 4G8LA 2KXPC 4HNAD 3TWUA 1N11A 2Y0BG 2Y1LE 3B7BA 5AQBA 2DVWA 1DCQA 4BSZB 3TWVA 2DZNA 1OY3D 4NIKA 3V2OA 5CBOA 2JABA 4GMRA 5KBAA 3TWTA 3IXEA 3D9HA 3UTMA 5KWDA 4BETA 1D9SA 1MX4A 2B0OE 2BKGA 1K3ZD 5JA4D 4DX1A 2XEHA 4DUIA 4LG6A 2F8YA 4GPMA 5JMND 2RFMA 4ATZD 3NBNB 1DC2A 1IHBA 5AN8A 1TR4A 4U8VD 3TWRA 3HG0D 5BXUA 2F37A 1N0QA 1MX2A 4F1PA 2QYJA 1IXVA 2FO1E 1UOHA 4TUMA 1WG0A 5AQ7A 1A5EA 1NFIE 4K5AB 3W9GA 4HRNA 1IKND 4JB8P 1YCSB 4CYMD 4BESA 3AJIA 3JXIA 3C5RA 2J8SD 2ZGGA 1K1AA 1N0RA 4HLLA 4J8YA 3T8KA 1BD8A 5EN5D 3EHQA 3TWSA 5ENRD 3B95A 1AP7A 4Z68A 4DX2A 2P2CP 4QQIA 3V79K 4K5BA 3EHRA 2F8XK 3V31A 1SVXA 5CECB 2MYOA 4YDYA 3ZUVB 2A5EA 5ENTD 3W9FA 2VGEA 3JXJA 4J7WA 5HRYA 3Q9UC 5AARA 5AAOA 4N5QA 2DZOA 4HRLA 5AQ9A 1G3NB 2BKKB 3JUEA 1MYOA 5ENOD 4DRXE 4CZ2D 3TWXA 5FINA 4QFVA 5D66A 4HI8A 4HQDA 2XZDG 5ENPD 1SW6A 3V30A 4B93B 4ZHBA 2XENA 3DEOA 1YMPA 3J5PA 3Q9NC 5EYLA 5ENQD 5FIOA 2V4HC 4F6RD 2ETCA 2RFAA 2V5QC 5EIDA 1K1BA 3UI2A 4U8YD 2DWZA 3LJNA 4BEPA 4DX5D 5BXOA 3ZU7B 1BI8B 2AJAA 3TWQA 2ETBA 4G8KA 5CEDB 5EIBE 4DX7D 4K5CA 1BLXB 3DEPA 5HKPA 5EILA 4C48B 1BI7B 1MJ0A 5AQAA 3SO8A 1QYMA 2NYJA 3UXGA 4ZFHA 4U95D 1BU9A 3J5QB 5KNGA 2XEEA 4HBDA 1WDYA 5ITZF 2PNNA 4HRMB 5KNHD 4LNUD 4RLYA 3ZKJA 3HRAA 4O1PA 4U96D 5CERB 4LSZE 4O60A 1MX6A 1OT8A 2KBXA 3NOCD 4UUCA 4YDWA 5EYPF 4BERA 2HE0A 3T9KA 3TWWA 2ZGDA 3KEAA 1AWCB 2L6BA 5CEAA 2ETAA 4HI9A 4A63B 5HS0A 4HB5A 2QC9A 3F6QA 4O1OA 3ZNGA 1S70B 4OAVB 3NOGD 3AAAC 3EU9A 4OAUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2X A;  5ENS D;  5CBN A;  4DX6 D;  1YYH A;  2XZT G;  4G8L A;  2KXP C;  4HNA D;  3TWU A;  1N11 A;  2Y0B G;  2Y1L E;  3B7B A;  5AQB A;  2DVW A;  1DCQ A;  4BSZ B;  3TWV A;  2DZN A;  1OY3 D;  4NIK A;  3V2O A;  5CBO A;  2JAB A;  4GMR A;  5KBA A;  3TWT A;  3IXE A;  3D9H A;  3UTM A;  5KWD A;  4BET A;  1D9S A;  1MX4 A;  2B0O E;  2BKG A;  1K3Z D;  5JA4 D;  4DX1 A;  2XEH A;  4DUI A;  4LG6 A;  2F8Y A;  4GPM A;  5JMN D;  2RFM A;  4ATZ D;  3NBN B;  1DC2 A;  1IHB A;  5AN8 A;  1TR4 A;  4U8V D;  3TWR A;  3HG0 D;  5BXU A;  2F37 A;  1N0Q A;  1MX2 A;  4F1P A;  2QYJ A;  1IXV A;  2FO1 E;  1UOH A;  4TUM A;  1WG0 A;  5AQ7 A;  1A5E A;  1NFI E;  4K5A B;  3W9G A;  4HRN A;  1IKN D;  4JB8 P;  1YCS B;  4CYM D;  4BES A;  3AJI A;  3JXI A;  3C5R A;  2J8S D;  2ZGG A;  1K1A A;  1N0R A;  4HLL A;  4J8Y A;  3T8K A;  1BD8 A;  5EN5 D;  3EHQ A;  3TWS A;  5ENR D;  3B95 A;  1AP7 A;  4Z68 A;  4DX2 A;  2P2C P;  4QQI A;  3V79 K;  4K5B A;  3EHR A;  2F8X K;  3V31 A;  1SVX A;  5CEC B;  2MYO A;  4YDY A;  3ZUV B;  2A5E A;  5ENT D;  3W9F A;  2VGE A;  3JXJ A;  4J7W A;  5HRY A;  3Q9U C;  5AAR A;  5AAO A;  4N5Q A;  2DZO A;  4HRL A;  5AQ9 A;  1G3N B;  2BKK B;  3JUE A;  1MYO A;  5ENO D;  4DRX E;  4CZ2 D;  3TWX A;  5FIN A;  4QFV A;  5D66 A;  4HI8 A;  4HQD A;  2XZD G;  5ENP D;  1SW6 A;  3V30 A;  4B93 B;  4ZHB A;  2XEN A;  3DEO A;  1YMP A;  3J5P A;  3Q9N C;  5EYL A;  5ENQ D;  5FIO A;  2V4H C;  4F6R D;  2ETC A;  2RFA A;  2V5Q C;  5EID A;  1K1B A;  3UI2 A;  4U8Y D;  2DWZ A;  3LJN A;  4BEP A;  4DX5 D;  5BXO A;  3ZU7 B;  1BI8 B;  2AJA A;  3TWQ A;  2ETB A;  4G8K A;  5CED B;  5EIB E;  4DX7 D;  4K5C A;  1BLX B;  3DEP A;  5HKP A;  5EIL A;  4C48 B;  1BI7 B;  1MJ0 A;  5AQA A;  3SO8 A;  1QYM A;  2NYJ A;  3UXG A;  4ZFH A;  4U95 D;  1BU9 A;  3J5Q B;  5KNG A;  2XEE A;  4HBD A;  1WDY A;  5ITZ F;  2PNN A;  4HRM B;  5KNH D;  4LNU D;  4RLY A;  3ZKJ A;  3HRA A;  4O1P A;  4U96 D;  5CER B;  4LSZ E;  4O60 A;  1MX6 A;  1OT8 A;  2KBX A;  3NOC D;  4UUC A;  4YDW A;  5EYP F;  4BER A;  2HE0 A;  3T9K A;  3TWW A;  2ZGD A;  3KEA A;  1AWC B;  2L6B A;  5CEA A;  2ETA A;  4HI9 A;  4A63 B;  5HS0 A;  4HB5 A;  2QC9 A;  3F6Q A;  4O1O A;  3ZNG A;  1S70 B;  4OAV B;  3NOG D;  3AAA C;  3EU9 A;  4OAU C; 
#chains in the Genus database with same CATH topology
 2R03 A;  4BT8 A;  1UN9 A;  5H7P A;  1ZB1 A;  2X38 A;  1N11 A;  4XEI G;  4DLO A;  3Q7A A;  3WG7 E;  3RRN B;  4ACL A;  4DUI A;  4LG6 A;  2IOL A;  4ATZ D;  2VSN A;  3CEQ A;  4OVV A;  1O1S A;  5ANR A;  2MRI A;  3ULQ A;  1UOH A;  1WG0 A;  2P9N G;  5HI7 A;  1OWO A;  2EIM E;  4L2L A;  3OXG A;  3HIZ A;  2EQX A;  2IFU A;  3T8K A;  1FT2 A;  3UKU G;  4AIF A;  1UN8 A;  2XQ0 A;  4HOT A;  1KT0 A;  4DX2 A;  1OCZ E;  2C0L A;  4GTM A;  4URK A;  4CRW A;  2MYO A;  4MRU A;  5HRY A;  5AAO A;  5AQ9 A;  3TL5 A;  2VJ8 A;  2FO7 A;  4J8S A;  4XE0 A;  1FCH A;  4GYY A;  3LYA A;  2V5Q C;  2XPZ A;  4IYP A;  3PE3 A;  3PEU B;  3LJN A;  3BG0 B;  2L6J A;  3VTY A;  3LY7 A;  3PZ4 A;  3B13 A;  3O48 A;  4FP7 A;  2VGY A;  1SA5 A;  4GZ3 A;  1E7U A;  4LNU D;  4RLY A;  3TJP A;  4AXH A;  2VTB B;  2KM4 A;  2P9U G;  1OWN A;  2QC9 A;  1WM5 A;  3L6A A;  3EDT B;  4WUY A;  1NZN A;  3FEX A;  3ESK A;  3HVE B;  4DI3 A;  5AJL A;  1E7V A;  1HZ4 A;  4KBQ A;  3SFX A;  3SI5 A;  4JZY A;  4G26 A;  5KWD A;  3FUH A;  2PQN A;  4UWH A;  5AYW D;  2YHC A;  2QYJ A;  5C1D A;  2XGO A;  4U04 A;  2WXQ A;  1HS6 A;  3JXI A;  2CHX A;  2WMO A;  3HXF A;  4PUC A;  3PZ1 A;  2WXL A;  5BNW A;  4YVO A;  3DSS A;  3AG2 E;  2BUG A;  2I1K A;  3DSX A;  4D10 C;  4L23 A;  5ARG A;  2QFC A;  5FIN A;  2H6H A;  4RQI A;  2CHW A;  4I2Z A;  3JUI A;  4GA0 A;  3J5P A;  3QK0 A;  2R5S A;  4F6R D;  4PS7 A;  5CMW A;  1GW6 A;  3UQ3 A;  5HQ8 A;  3EU5 A;  4Y6W A;  3ZEF A;  3FUK A;  5EDS A;  4U0Z A;  3FFL A;  3SY2 A;  4JXT A;  4OYS A;  4O60 A;  5KJN A;  2WPV A;  3PS6 A;  1N54 A;  4LEU A;  5CCM A;  3D9P A;  1TN8 A;  2AXU A;  4OAU C;  1FPP A;  4I6E A;  3V2X A;  3DSU A;  1OWL A;  2KXP C;  1JCQ A;  1KPS B;  2B6C A;  3QC1 A;  3TXM A;  5FWQ A;  3FU6 A;  1RW2 A;  1D9S A;  3EIJ A;  5FZS A;  2F8Y A;  4GPM A;  3PE4 A;  4XIF A;  5BXU A;  3CHO A;  3CVQ A;  5KCM A;  4FU3 A;  3FUL A;  3PZ3 A;  2HR2 A;  2P9I G;  3AJI A;  4LRZ A;  2GRQ B;  2J9Q A;  4EZK A;  4DPR A;  1DVP A;  2KCK A;  1KZO A;  2OCC E;  2FBN A;  2VSY A;  3CIA A;  1SVX A;  4JEU A;  4RG6 A;  4F1S A;  2WQ6 A;  1TNZ A;  2H6I A;  4DRX E;  3CKB A;  3UIN C;  3S7D A;  2R59 A;  1EDU A;  3DEO A;  4U7E B;  2AW6 A;  3LY8 A;  2C0M A;  3SFY A;  5EID A;  2OOE A;  2DWZ A;  1BI8 B;  5EIB E;  4B89 A;  1BI7 B;  1IHG A;  2DCP A;  4EHM A;  3FEY A;  3FU3 A;  2V4L A;  1MQS A;  1Z6T A;  4JD2 G;  3JQ1 A;  1LF8 A;  4A55 A;  4HS2 A;  2A5U A;  3NOC D;  4AJW A;  1WAO 1;  4L9P A;  3ZW3 A;  3PRE A;  2GGF A;  2QZA A;  5CCL A;  1O1R A;  3IBE A;  3V2O A;  3K9I A;  4N3A A;  3RAU A;  2P9P G;  3LCA A;  1K3Z D;  5JA4 D;  4M3O A;  3ZVV A;  4BT9 A;  4KMO A;  3DRA A;  2WXK A;  4F1P A;  4TXQ A;  3Q15 A;  4K5A B;  4JEH A;  1SA4 A;  1O5M A;  2J8S D;  4ANU A;  4AY6 A;  4HLL A;  3PUJ A;  2LXM A;  3TWS A;  2GRL A;  4BTB A;  4Z68 A;  4XX5 A;  3LKU A;  3UM1 A;  1V55 E;  1PAQ A;  3BEE A;  4LUN U;  3FH5 A;  3PDN A;  2AXV A;  3UPV A;  4B94 A;  4HOU A;  4F53 A;  2H6F A;  3OXL A;  2P9S G;  3R7R A;  2GRP B;  3CK9 A;  3SNX A;  3FWV A;  2AVP A;  3UT7 A;  2WXP A;  1Z5S C;  5HKP A;  4Q96 A;  2IQC A;  1QYM A;  3ULY A;  3CVN A;  2E0I A;  2J07 A;  4HBD A;  3AG4 E;  4XKB A;  3RSE G;  2XS8 A;  5CER B;  4CT0 A;  3MKR A;  3APC A;  3TWW A;  3BU8 A;  4AEZ C;  3S2A A;  5CEA A;  1H2T C;  1S70 B;  1QNF A;  2YQ8 A;  1JUQ A;  1H6P A;  4DX6 D;  1QQE A;  2DZN A;  5CHE E;  4YDO A;  1ELK A;  3ISM C;  4ME2 A;  3FUF A;  3OAW A;  3G2S A;  3UM2 A;  2WVI A;  3UM0 A;  5BV1 A;  5AQ7 A;  1KT1 A;  4I1A A;  3C5R A;  2XGS A;  1K1A A;  4J8Y A;  1E8X A;  2GRO B;  3SZ7 A;  1EF1 C;  1TN7 A;  1MHQ A;  4MLP A;  2F8X K;  3C72 A;  3ZYL A;  1H6O A;  3V31 A;  3D9N A;  3I3N A;  3NZU A;  1K8K G;  5ENT D;  3R9M A;  1N95 A;  3BG1 B;  3SFZ A;  2C2L A;  4ZHB A;  1YMP A;  5EYL A;  3CVL A;  1LTX A;  2V4H C;  4N5C A;  3RRU A;  3D9O A;  3ASF A;  4XZ4 A;  2IO2 C;  2J4D A;  2ETB A;  2VQ2 A;  4K5C A;  4NAC A;  3UXG A;  2NYJ A;  5D0Q D;  4U95 D;  3FTV A;  1IQR A;  1H19 A;  3PZ2 A;  3FU5 A;  4GML A;  3TG5 A;  5KNH D;  3MJW A;  3PNT B;  4IRU A;  5DBK A;  3ASO E;  2KBX A;  5J08 A;  2XHE A;  3GZS A;  3SHF A;  2LSU A;  4N2Q A;  3NB2 A;  4CGW A;  4MKT A;  3HHM A;  4HOS A;  4BFR A;  4IN3 B;  4YND A;  2DVW A;  1DCQ A;  2LUH A;  1ELW A;  3FDH A;  4BET A;  3ENE A;  3UKR G;  3UUX A;  5E76 A;  4FA6 A;  1HH8 A;  2R2L A;  1H6K A;  2OEW A;  2UY1 B;  3P1U A;  3EHN A;  4BY6 A;  3QOU A;  3SBS A;  2CG2 A;  4KZ0 A;  4NRH B;  2WXJ A;  4UQZ A;  4U07 A;  2YNQ A;  3LY9 A;  3KS2 A;  3UT4 A;  4H7X A;  3CQC B;  4TRQ A;  2XEN A;  2WXH A;  3ONK A;  3Q9N C;  4ANW A;  3X2Q E;  1VDY A;  4A1S A;  3UI2 A;  3R7Q A;  1OWM A;  3Q5M A;  5EIL A;  4C48 B;  4KZC A;  1BU9 A;  5LOZ A;  2KCL A;  4U0S A;  1TNB A;  3I5P A;  3UM3 A;  3AG3 E;  2ZGD A;  3KEA A;  1EYH A;  5A7D B;  3SD5 A;  2ZXW E;  1TNY A;  4JC8 A;  3B7S A;  1A17 A;  1N4R A;  1UG3 A;  5JHA A;  4WND A;  3CK8 A;  3G2T A;  3L82 A;  4FHK A;  4PH4 B;  1NP7 A;  2XCC A;  4LER A;  2JAB A;  4Y6C A;  4GTS A;  4KVM A;  4OVU A;  5CRU A;  5AN8 A;  4EQF A;  1PC2 A;  1OCR E;  4GZ5 A;  3FUJ A;  4AY5 A;  3CK7 A;  2J4B A;  2RD0 A;  3SQV A;  4GPK A;  4J8F A;  2XGM A;  4TXR A;  2XPI A;  3D9M A;  3AS8 A;  3CHP A;  3MGB A;  3FTU A;  3MV2 B;  3NF1 A;  3ULE G;  4JL0 A;  3FTW A;  3ZUV B;  4EZJ A;  5G55 A;  3JUE A;  3CHQ A;  2CG3 A;  3ZYQ A;  5B1B E;  5D2M C;  1TJF A;  3RU0 A;  3VTX A;  4XKC A;  1E90 A;  1E8Z A;  4DX5 D;  3S7J A;  5T8I A;  4YDE A;  5CED B;  3EHM A;  2VGX B;  3UIP C;  5EX3 A;  2WXG A;  2PNN A;  3C98 A;  4J0U A;  3HXC A;  3DSW A;  1OT8 A;  4TV3 A;  3ZYM A;  2ETA A;  2CFZ A;  3PUK A;  2V8S E;  2VYI A;  1ZU2 A;  2OND A;  3ASH A;  3LEW A;  4JW1 A;  3PH0 C;  4R7L A;  4FC8 A;  3TWV A;  4PS3 A;  3IV0 A;  3P2B A;  5KBA A;  3D9H A;  3SF4 A;  1TJC A;  4DK5 A;  4DX1 A;  4RVB A;  4WNG A;  2XEH A;  3QAQ A;  4U8V D;  5AJD A;  2F37 A;  3WXX A;  1EPU A;  1X81 A;  3MYV A;  1FT1 A;  3QWW A;  4GTO A;  3ABM E;  3G2W A;  2RG8 A;  1DNP A;  2QYU A;  2ZGG A;  2IOS A;  4A3T A;  4A1G A;  1HO8 A;  4H7Y A;  4AP2 A;  1U2V G;  2Q7F A;  3GW4 A;  4N5Q A;  3LPZ A;  3DPY A;  5G04 C;  2VTB A;  1SZA A;  1HE8 A;  2KCV A;  3KSQ A;  4JPS A;  3BUA A;  3APD A;  3FU0 A;  5FIO A;  4W9R A;  5FTP A;  3T8M A;  2PQR A;  2ETC A;  3CST A;  3LJ3 A;  1O1T A;  3HVE A;  4G8K A;  3BQO A;  3CR3 A;  2XEE A;  4J6I A;  3SBT B;  4AVX A;  4CCA A;  3Q47 B;  4XI0 A;  3U64 A;  2HYZ A;  3T9K A;  4UWG A;  5T4Y A;  4YVQ C;  4JHR A;  2OVF A;  5D0O D;  4F7A A;  3ESL A;  3UX4 A;  5CBN A;  2WB2 A;  4GMJ A;  5A23 A;  1Y6I A;  2PL2 A;  4G8L A;  3TWU A;  2Y1L E;  5AQB A;  4WNF A;  3AS5 A;  3MKQ B;  3D9L A;  4B8C B;  3UTM A;  3U3W A;  2XPY A;  1NA3 A;  2V0P A;  1DC2 A;  2KZT B;  1TR4 A;  3TWR A;  3CKC A;  4BSX A;  3Q78 A;  3HXD A;  2A4Z A;  1HU3 A;  3AU5 A;  3W9G A;  1IYG A;  5JJ6 A;  2CHZ A;  2OVB A;  1BD8 A;  5ENR D;  5DIZ A;  3E4B A;  3ZRH A;  2X6K A;  3AS4 A;  4ATG A;  5T3R A;  3ZYK A;  1N9A A;  4X8Q A;  4L1B A;  2FEZ A;  3ONL A;  4U0U A;  3W9F A;  4JHJ A;  2BKK B;  2WQ7 A;  4I1M A;  2R05 A;  4HQD A;  5ENP D;  5E75 A;  2JEK A;  4GCN A;  1UW4 B;  5A6C A;  2HM8 A;  3FTY A;  2FUL A;  2J08 A;  4B0Z A;  3ZPJ A;  4RG9 A;  3AU4 A;  3HYM B;  4BEP A;  5BXO A;  4DLQ A;  3DEP A;  3SO8 A;  2Y4T A;  3DXM G;  2GRR B;  2KAT A;  2LNI A;  4KXK B;  2E2E A;  3ZN3 A;  2DIW A;  1NL4 A;  3UIO C;  1OCC E;  5LX8 A;  1W3B A;  2HE0 A;  1TEZ A;  2H6G A;  3AAA C;  3EU9 A;  2Y69 E;  4V3I A;  4JA7 A;  4GZ6 A;  4C9B B;  4N3C A;  2KC7 A;  2PM6 A;  3TWT A;  3IXE A;  4DJA A;  5BT1 A;  3VLE A;  3HG0 D;  3ZIM A;  2WXM A;  3LS8 A;  1IXV A;  1IKN D;  4BES A;  1SQM A;  3LVR E;  2NSZ A;  2PZI A;  4HVB A;  5EX0 A;  3E32 A;  3TXN A;  1H0A A;  4HOQ A;  1HG2 A;  3KD7 A;  3E33 A;  4UQY A;  4K5B A;  3S7F A;  3Q79 A;  1NI1 A;  3D3M A;  5JJ7 A;  3E34 A;  1FVF A;  3JXJ A;  4ACK A;  3QDN A;  1G3N B;  3GZ2 A;  2IY0 C;  2OEV A;  3LDZ A;  5BV0 A;  2R17 C;  5ENQ D;  3PEV B;  1UJK A;  2WXI A;  2AJA A;  4DX7 D;  1BLX B;  2X6I A;  4J8E A;  2UWJ G;  2IJG X;  3FH7 A;  2CFU A;  4FLH A;  4ANV A;  4HFG A;  4WNE A;  1X5B A;  3O4Z A;  1MX6 A;  3JCK C;  2YIN A;  1AWC B;  3I4R B;  2L6B A;  4FHJ A;  4HI9 A;  4A63 B;  2EIJ E;  3C3R A;  3PVL A;  4OAV B;  4K0R A;  5AIJ A;  3B7T A;  4E6H A;  4EBA G;  2PM7 A;  5G2N A;  4K03 A;  3RO2 A;  3CVW A;  3DXK G;  4GTP A;  1OWP A;  1OY3 D;  2ZIS A;  2AWI A;  3CHS A;  3DBS A;  2IU1 A;  3RRM B;  1S64 A;  2RFM A;  3NBN B;  1U3C A;  4I43 A;  1A5E A;  3FUD A;  5LP0 A;  3KAE A;  4CYM D;  4JB8 P;  3QB2 A;  4C0E A;  5KJK A;  5G05 C;  4GB9 A;  5EN5 D;  2IO3 C;  3FHE A;  4GYW A;  3CHM A;  4AOF A;  2GRN B;  5LFA A;  2XRY A;  1PY1 A;  2FF4 A;  3IEG A;  2GW1 A;  4J7W A;  3D9K A;  1N4Q A;  3FY4 A;  2WXO A;  1HX8 A;  3G2U A;  1IQU A;  5B1A E;  4QFV A;  3G2V A;  4GCO A;  4Q94 A;  2XZD G;  1SW6 A;  1MZC A;  3GYZ A;  5FQ7 A;  4I9E A;  4APO A;  4NQ0 A;  1INZ A;  3IHV A;  4GZC A;  1FVH A;  3TWQ A;  3ZXP A;  4I1O B;  1HFA A;  3J5Q B;  1WDY A;  1N4P A;  2OV8 A;  4LCT A;  3UMV A;  4F3V A;  3Q75 A;  5B3S E;  1S63 A;  4U96 D;  2J09 A;  3S7B A;  2X6J A;  4BER A;  3NQP A;  4G25 A;  2QY7 A;  3E37 A;  5FQ4 A;  1QZ2 A;  4AV7 A;  3C3O A;  1N94 A;  3DST A;  1YYH A;  2I9C A;  4DI4 A;  4HNA D;  4G23 A;  5G04 J;  5J90 A;  5CBO A;  3UT8 A;  2BF0 X;  4ILG A;  2WMN A;  1MX4 A;  3ML8 A;  3CLJ A;  3EIQ C;  2Y3A A;  1IHB A;  1DCE A;  1OXJ A;  1XGW A;  4HXI A;  4FAD A;  4TUM A;  3T5V A;  2YHE A;  3TAX A;  3RJV A;  1RZ4 A;  1E96 B;  1TYQ G;  3QKY A;  3CV0 A;  4HLE A;  2V5F A;  4LNB A;  1D8E A;  2VSO E;  4B8A A;  5AEN A;  2X3M A;  4CDR A;  3ZHE A;  5AAR A;  1D8D A;  4ILI A;  3SGH A;  5BUZ A;  3PZD A;  1NA0 A;  3ASD A;  4UQX A;  3EJN A;  1K1B A;  4U8Y D;  5KJM A;  3Q7F A;  4UWL A;  1OUV A;  2LXL A;  3ML9 A;  2L0I A;  1KLX A;  4KVO A;  4ZFH A;  5KNG A;  3FTZ A;  5ITZ F;  2HO1 A;  4G1T A;  4FLB A;  1TNO A;  3MX3 A;  4UUC A;  5EYP F;  4UWF A;  2I2O A;  4CEM A;  5HS0 A;  5ARF A;  3FUN A;  4HB5 A;  4PDX A;  1V54 E;  1HF8 A;  5ENS D;  3MCX A;  3R9A B;  4BTA A;  4KT6 B;  2XZT G;  5KJL A;  4GA2 A;  3DPD A;  3CVX A;  2UY1 A;  3PNL B;  3FUI A;  3ASG A;  4GMR A;  2L0T B;  4KYO B;  2B0O E;  1S0P A;  3FUM A;  3OXF A;  5JMN D;  4M7C A;  2FI7 A;  1JPL A;  3DSV A;  4J8D A;  1N0Q A;  3FP3 A;  3DWL G;  1JCR A;  1NFI E;  4ILH B;  4I17 A;  2X6F A;  3CQG B;  4G2V A;  2DYR E;  3JYS A;  4L2Y A;  2DBA A;  4UI9 C;  2XRZ A;  4QQI A;  1Y8M A;  3ZFW A;  2XEV A;  5CEC B;  2EIN E;  2A5E A;  4FJY A;  2VGE A;  3APF A;  3U4T A;  2LAH A;  2ZU6 B;  1B89 A;  4A3V A;  4BWR A;  1L5J A;  4JA9 A;  3AG1 E;  4N2S A;  4WAF A;  3C3Q A;  1LD7 A;  5FZR A;  1HXI A;  3PRZ A;  1UJJ A;  4GAA A;  2RFA A;  4L7T A;  2LSV A;  3FUE A;  3ZU7 B;  3ZGQ A;  3QJZ A;  1SZ9 A;  4HOR A;  1N4S A;  4EBA A;  4HRM B;  4IUL A;  4I2W A;  3RIB A;  3NZS A;  4P29 A;  3VLD A;  4CT4 A;  2XS1 A;  1ELR A;  3IHY A;  3HXE A;  2VSX E;  4GYO A;  3MZL B;  3L08 A;  1N0R A;  4UWK A;  3FTS A;  3D9I A;  1XNF A;  3L17 A;  5ENN A;  4BX9 A;  3Q73 A;  4GTQ A;  5IY5 E;  3ABK E;  2R02 A;  3B7R L;  2LAI A;  1Z3X A;  1H2U A;  2WXF A;  2WXN A;  5CMY A;  4N3B A;  1MX2 A;  3CGH A;  4WWN A;  5FQ8 A;  5FQ6 A;  3MA5 A;  4GZD A;  2NXP A;  5CRV A;  3HXB A;  3B95 A;  2BTD A;  3I4G A;  3QWV A;  3Q4A B;  3L54 A;  2VGX A;  3L22 A;  3LVQ E;  5BPP A;  3Q9U C;  2EIL E;  5ENO D;  4CZ2 D;  3TWX A;  2M63 A;  2WQH A;  3D9J A;  5D66 A;  3V30 A;  3U9W A;  1KZP A;  1JWG A;  3CHR A;  3L13 A;  5BW8 C;  3B7U X;  3RKV A;  1MJ0 A;  3CSF A;  5AQA A;  3CVY A;  3QAR A;  4NUR A;  3TG4 A;  1E8W A;  3QNK A;  5G05 J;  3ZKJ A;  4U63 A;  1HG5 A;  1YA0 A;  4C0M A;  3N71 A;  4CDN A;  1ZBP A;  3CVV A;  2I1J A;  2P58 C;  2WXR A;  4BSZ B;  3E30 A;  1N52 A;  3VLF A;  5LCW J;  4UI9 K;  3Q49 B;  2WM9 A;  5EKQ D;  4U8H A;  4TXP A;  2XCB A;  4MBG A;  5FZQ A;  2LO6 A;  2RKK A;  2GRM A;  3EHQ A;  1AP7 A;  3KEZ A;  2P2C P;  3V79 K;  1E8Y A;  1OCO E;  3EHR A;  3HDX A;  4JVS A;  3NAW A;  4YDY A;  4EEC A;  4APF A;  1WY6 A;  4CDM A;  1QBQ A;  3ZXS A;  2ILR A;  2AXZ A;  4CGV A;  4HI8 A;  5C2Y A;  4E85 A;  3ASN E;  4B93 B;  5JJT A;  2L9B A;  4GTR A;  1JCS A;  4EZL A;  1JWF A;  3FH8 A;  4GA1 A;  4WWP A;  4MS6 A;  3GZ1 A;  4WWO A;  3MKQ A;  3URZ A;  4ABN A;  4ANX A;  3HRA A;  4O1P A;  4LSZ E;  2JLB A;  2P9L G;  5ANL A;  2KZT A;  4O1O A;  3RO3 A;  3ZNG A;  1LD8 A;  1H2V C;  2J49 A;  3L9T A;  3RK6 A;  3MEK A;  4G11 A;  4N39 A;  5JHB A;  2IEJ A;  3OTN A;  2Y0B G;  3B7B A;  2IF4 A;  4NIK A;  4XI9 A;  4O6F A;  3MV3 B;  3IKO B;  2BKG A;  5M72 A;  3LXU X;  4GU5 A;  3CVU A;  1P5Q A;  4I6G A;  1U3D A;  1TNU A;  2FO1 E;  1Q2Z A;  5FT9 A;  4HRN A;  3KSL A;  1YCS B;  2MOW A;  2EIK E;  2MHK A;  1BPO A;  3FTX A;  2NC9 A;  4I9C A;  2ION A;  2P9K G;  2X6H A;  4G24 A;  4TUU A;  4RSY A;  2F0Y A;  3EUV A;  4Q69 A;  2BED A;  3ZHE B;  2I6H A;  3U66 A;  2DZO A;  4HRL A;  1MYO A;  2Y4U A;  1Z3Y A;  3T5X A;  3ABL E;  4AM9 A;  4LNG A;  4FJZ A;  4GTV A;  4I6J A;  4PS8 A;  5FJY A;  4BX8 A;  4JHK A;  3JQ0 A;  1TN6 A;  3QWP A;  4FUL A;  4EPZ A;  2ZIR A;  3TGO A;  4YDW A;  4UI9 J;  5LCW C;  3F6Q A;  3CVP A;  2DYS E;  3L16 A;  3NOG D;  4GTT A; 
#chains in the Genus database with same CATH homology
 3V2X A;  5ENS D;  5CBN A;  4DX6 D;  1YYH A;  2XZT G;  4G8L A;  2KXP C;  4HNA D;  3TWU A;  1N11 A;  2Y0B G;  2Y1L E;  3B7B A;  5AQB A;  2DVW A;  1DCQ A;  4BSZ B;  3TWV A;  2DZN A;  1OY3 D;  4NIK A;  3V2O A;  5CBO A;  2JAB A;  4GMR A;  5KBA A;  3TWT A;  3IXE A;  3D9H A;  3UTM A;  5KWD A;  4BET A;  1D9S A;  1MX4 A;  2B0O E;  2BKG A;  1K3Z D;  5JA4 D;  4DX1 A;  2XEH A;  4DUI A;  4LG6 A;  2F8Y A;  4GPM A;  5JMN D;  2RFM A;  4ATZ D;  3NBN B;  1DC2 A;  1IHB A;  5AN8 A;  1TR4 A;  4U8V D;  3TWR A;  3HG0 D;  5BXU A;  2F37 A;  1N0Q A;  1MX2 A;  4F1P A;  2QYJ A;  1IXV A;  2FO1 E;  1UOH A;  4TUM A;  1WG0 A;  5AQ7 A;  1A5E A;  1NFI E;  4K5A B;  3W9G A;  4HRN A;  1IKN D;  4JB8 P;  1YCS B;  4CYM D;  4BES A;  3AJI A;  3JXI A;  3C5R A;  2J8S D;  2ZGG A;  1K1A A;  1N0R A;  4HLL A;  4J8Y A;  3T8K A;  1BD8 A;  5EN5 D;  3EHQ A;  3TWS A;  5ENR D;  3B95 A;  1AP7 A;  4Z68 A;  4DX2 A;  2P2C P;  4QQI A;  3V79 K;  4K5B A;  3EHR A;  2F8X K;  3V31 A;  1SVX A;  5CEC B;  2MYO A;  4YDY A;  3ZUV B;  2A5E A;  5ENT D;  3W9F A;  2VGE A;  3JXJ A;  4J7W A;  5HRY A;  3Q9U C;  5AAR A;  5AAO A;  4N5Q A;  2DZO A;  4HRL A;  5AQ9 A;  1G3N B;  2BKK B;  3JUE A;  1MYO A;  5ENO D;  4DRX E;  4CZ2 D;  3TWX A;  5FIN A;  4QFV A;  5D66 A;  4HI8 A;  4HQD A;  2XZD G;  5ENP D;  1SW6 A;  3V30 A;  4B93 B;  4ZHB A;  2XEN A;  3DEO A;  1YMP A;  3J5P A;  3Q9N C;  5EYL A;  5ENQ D;  5FIO A;  2V4H C;  4F6R D;  2ETC A;  2RFA A;  2V5Q C;  5EID A;  1K1B A;  3UI2 A;  4U8Y D;  2DWZ A;  3LJN A;  4BEP A;  4DX5 D;  5BXO A;  3ZU7 B;  1BI8 B;  2AJA A;  3TWQ A;  2ETB A;  4G8K A;  5CED B;  5EIB E;  4DX7 D;  4K5C A;  1BLX B;  3DEP A;  5HKP A;  5EIL A;  4C48 B;  1BI7 B;  1MJ0 A;  5AQA A;  3SO8 A;  1QYM A;  2NYJ A;  3UXG A;  4ZFH A;  4U95 D;  1BU9 A;  3J5Q B;  5KNG A;  2XEE A;  4HBD A;  1WDY A;  5ITZ F;  2PNN A;  4HRM B;  5KNH D;  4LNU D;  4RLY A;  3ZKJ A;  3HRA A;  4O1P A;  4U96 D;  5CER B;  4LSZ E;  4O60 A;  1MX6 A;  1OT8 A;  2KBX A;  3NOC D;  4UUC A;  4YDW A;  5EYP F;  4BER A;  2HE0 A;  3T9K A;  3TWW A;  2ZGD A;  3KEA A;  1AWC B;  2L6B A;  5CEA A;  2ETA A;  4HI9 A;  4A63 B;  5HS0 A;  4HB5 A;  2QC9 A;  3F6Q A;  4O1O A;  3ZNG A;  1S70 B;  4OAV B;  3NOG D;  3AAA C;  3EU9 A;  4OAU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...