5EILA

Computational design of a high-affinity metalloprotein homotrimer containing a metal chelating non-canonical amino acid
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
157
Chain Sequence
b'MSKLGEMLIAVLIGSKEAVKVLLDLGADPNASDEDGLTPLHAAAMAGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNTSDSDGRTPLDLAREHGNEEIVKLLEKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRI-05
publication title Computational design of a homotrimeric metalloprotein with a trisbipyridyl core.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 54
structure length 157
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5eilA00
1AP7A 2RFMA 4J7WA 4QQIA 5HRYA 1OT8A 3B95A 3T8KA 3J5PA 2NYJA 3JXJA 5AQBA 4DX7D 3AAAC 4O60A 5CECB 1AWCB 4O1PA 4CYMD 3TWRA 4DX5D 3V79K 3TWUA 2AJAA 1TR4A 2BKKB 2HE0A 4NIKA 4HRMB 1BD8A 1DC2A 4Z68A 2ZGGA 2XENA 3D9HA 4HI9A 1BI8B 4U96D 1D9SA 5BXOA 4OAUC 4JB8P 5ENRD 4ZHBA 4G8KA 4UUCA 2F8XK 5ENTD 5ENPD 4HNAD 4G8LA 2F8YA 3EHQA 3TWWA 1MX6A 3EHRA 2DWZA 5AQAA 1YCSB 1WDYA 5FIOA 1YYHA 4K5AB 3SO8A 3NOCD 2ETCA 4ZFHA 3KEAA 4K5BA 4LG6A 4DX6D 5FINA 5KNHD 5CBOA 3V30A 3TWTA 1MYOA 5HS0A 1K3ZD 3HRAA 2XZDG 3J5QB 3UXGA 1BI7B 1N0QA 2KBXA 2J8SD 3TWVA 5D66A 3DEPA 2QC9A 4U8YD 4HLLA 4BERA 3TWSA 5KWDA 2XEEA 4YDWA 3ZU7B 1K1AA 2KXPC 3DEOA 2BKGA 4YDYA 4F6RD 5EYPF 3NBNB 4TUMA 3JXIA 5ENQD 3B7BA 4OAVB 3LJNA 1A5EA 4U8VD 4HRLA 5AARA 5AQ9A 2JABA 5EILA 2ETAA 2F37A 3UTMA 4F1PA 2FO1E 1MJ0A 3V2OA 1G3NB 4HBDA 2L6BA 1N0RA 3UI2A 4HB5A 3AJIA 4DUIA 2Y0BG 1BLXB 1SW6A 4HI8A 2VGEA 5EN5D 3ZUVB 1DCQA 2ZGDA 3JUEA 5CEAA 1WG0A 2V4HC 2DZOA 2XZTG 1NFIE 4HQDA 1IHBA 1YMPA 4DRXE 2V5QC 4LNUD 1BU9A 2RFAA 3Q9UC 5AQ7A 4O1OA 1IXVA 3F6QA 5ENOD 5ITZF 5KBAA 3IXEA 4BEPA 4CZ2D 1SVXA 2MYOA 1S70B 2Y1LE 4DX1A 3C5RA 4BSZB 5EYLA 4U95D 4DX2A 2A5EA 2P2CP 1N11A 4HRNA 5CEDB 2QYJA 5JMND 3W9GA 4K5CA 4LSZE 3V31A 3ZNGA 4QFVA 4A63B 4GPMA 4C48B 5AAOA 3ZKJA 1MX4A 4GMRA 3TWQA 1UOHA 5CBNA 2XEHA 4J8YA 3TWXA 3W9FA 4B93B 5AN8A 2B0OE 4N5QA 1MX2A 5EIDA 3V2XA 4ATZD 5JA4D 1OY3D 1K1BA 3NOGD 2PNNA 5ENSD 4BESA 5HKPA 3T9KA 3EU9A 5EIBE 5BXUA 2DZNA 3HG0D 4BETA 2ETBA 4RLYA 5KNGA 3Q9NC 5CERB 1IKND 1QYMA 2DVWA
chains in the Genus database with same CATH superfamily
3JXJA 2H6FA 5LX8A 4MRUA 3TWUA 2HE0A 1U3CA 2GRMA 4TXPA 4XI0A 1IQUA 3CVNA 3CR3A 4UQZA 2M63A 3UT4A 5AJDA 4XKBA 4EZJA 3HXFA 3QNKA 3AS4A 4GYYA 3FUHA 1H6PA 5HS0A 4KZ0A 2XHEA 2LUHA 4YVOA 2GRLA 2PM7A 2EILE 3BU8A 4DPRA 4TUMA 3MZLB 5KJLA 3FFLA 2CFZA 3D9NA 2R05A 4GA0A 4G25A 5JHAA 4HB5A 1SW6A 2RD0A 4CT4A 2XZTG 1WY6A 2LNIA 1BU9A 1H2TC 3EDTB 3U9WA 2XCBA 2L0IA 4JPSA 1TNBA 3B7TA 1S63A 3QC1A 4GPKA 2PL2A 4GMRA 4LNGA 3SQVA 4GA1A 5E75A 4ATGA 1JCSA 3T9KA 4PUCA 2QYUA 3CVQA 4RLYA 3ZRHA 3HXDA 4B8AA 3CHRA 2NYJA 3JUIA 3APCA 4OYSA 3HXCA 2BKKB 3LY9A 4HRMB 3D9IA 4NACA 4OVVA 4HFGA 3SBSA 1INZA 4WNGA 1D8EA 3L22A 1HZ4A 3SI5A 4GZCA 2F0YA 5JHBA 4XEIG 1TNUA 2XEEA 3LVRE 2I9CA 3JXIA 3DPYA 3B7SA 2GROB 4HRLA 1BPOA 5FZRA 3MX3A 5CCLA 2XGSA 3FTXA 2KCLA 3PNTB 4HBDA 2WB2A 3TJPA 3SFZA 1IYGA 3SFYA 1WG0A 3D9KA 3ULQA 4I6JA 4DRXE 2XEVA 1TN6A 1IXVA 3EIQC 5ENOD 3L08A 3AU5A 5G55A 1LF8A 2P9SG 4Q94A 5T4YA 2VQ2A 2FO7A 4HRNA 2R59A 4FA6A 3ZNGA 3URZA 1N4QA 2IO3C 3V2XA 2EIJE 5FQ7A 1JPLA 5T3RA 3PZ3A 3OXFA 1AP7A 4CDNA 1JWFA 4ZHBA 3TXNA 4KVOA 5ARGA 3CHQA 5D0OD 3APDA 4GU5A 4GTVA 2XENA 1A17A 5KJKA 5ENRD 3ML8A 3T8MA 3GZ2A 3MYVA 5JJTA 2GW1A 4BY6A 4KT6B 1WDYA 3VTXA 4UWFA 2XS1A 2WXNA 3EUVA 4PS3A 5EDSA 2EINE 1MHQA 2GGFA 2AXVA 1Y6IA 2X6KA 1SA4A 4DLQA 2L6JA 5FQ8A 4KVMA 1N54A 1OCCE 1FT1A 2GRRB 2V5FA 3RRNB 1LTXA 3JQ0A 2VGYA 2MRIA 3FUNA 4KXKB 3FH8A 3HDXA 5AARA 3E37A 4RG6A 1OCOE 4ACKA 1BLXB 4OVUA 2ZGDA 2R03A 4F3VA 3ISMC 3Q9UC 5ITZF 3FTYA 2YHCA 3ESLA 1E7UA 3RRUA 2FULA 5H7PA 3TWQA 1JCQA 3IKOB 4AY6A 3MCXA 2R2LA 5FZQA 2ZU6B 4BT8A 3Q9NC 3PUKA 2KATA 5AJLA 3CVVA 3FHEA 2ILRA 2AVPA 4GZ6A 4DK5A 3AG1E 1QZ2A 2BUGA 2IQCA 5FZSA 2PZIA 4L2LA 1D9SA 2XCCA 5FJYA 5AIJA 4AP2A 4UUCA 5BNWA 3R7QA 2JEKA 3DSTA 2AW6A 2VSYA 1YYHA 4G2VA 3PEVB 5FT9A 4CGVA 4ME2A 3ZFWA 5M72A 3V30A 4LCTA 4DLOA 3ZGQA 5FQ6A 3LYAA 4Y6WA 3ZU7B 2P58C 4DI3A 4I1MA 4YDYA 3MEKA 1O1RA 4L2YA 3UI2A 2J49A 3QAQA 1NFIE 2WMNA 4PS7A 2OVFA 1UN8A 4B0ZA 5JJ7A 5EYLA 3CK9A 1JWGA 3K9IA 1QNFA 4GPMA 5C1DA 3RO3A 5CRUA 1DVPA 4B93B 3BG0B 5EIDA 4JZYA 3NOGD 5J08A 3ASDA 2NXPA 2WXJA 4I2ZA 4CGWA 4XKCA 5ARFA 4Q69A 3T8KA 2J09A 3IV0A 3CQGB 3S7JA 2DIWA 4CDRA 4DX5D 3QDNA 3CHPA 3PRZA 3G2VA 4AV7A 2YINA 3GYZA 4HXIA 4U7EB 4HOTA 4BSXA 1PC2A 4L9PA 3FTVA 1H6KA 3SBTB 3MA5A 4FP7A 4N3AA 4ACLA 1BI7B 3PZ4A 5D66A 4BFRA 3DEPA 2KZTB 3ENEA 3DEOA 1NA3A 3X2QE 4ANVA 3D9OA 1LD8A 3GZSA 5IY5E 1NP7A 4WNFA 2ETAA 2F37A 4XI9A 3UTMA 1ELRA 4GTPA 3ZYQA 4J8DA 3E32A 4WWOA 4GYWA 3U66A 4F7AA 2H6HA 1TN7A 2MHKA 5AQ7A 1N94A 3RU0A 1FCHA 2V0PA 4AOFA 2KZTA 4GTOA 3W9GA 3UX4A 3CHSA 2I1JA 2XRZA 4NRHB 2LXMA 2CG3A 5ENSD 4URKA 2OVBA 2XGMA 2Y4TA 4FLHA 1E8ZA 3LS8A 5CERB 4X8QA 2BEDA 4QQIA 3B95A 2XGOA 1AWCB 1JCRA 3DRAA 3V79K 3SFXA 3L9TA 5ANLA 2FBNA 2FF4A 3FU3A 2GRNB 1E90A 4JA7A 4LNBA 2DWZA 1OWNA 2VSOE 2X3MA 4ZFHA 4K5BA 4RVBA 5CBOA 1RW2A 4CT0A 2FEZA 2CHWA 3UXGA 1Y8MA 1N0QA 4KBQA 3TWVA 2V8SE 2C0LA 3PZ1A 1U3DA 5AENA 5LCWC 2CFUA 2BKGA 2FI7A 4F6RD 1DCEA 5G05C 2EQXA 4AY5A 4ANUA 4JHJA 2OOEA 3E4BA 1V54E 4J8EA 4JVSA 3U64A 3NB2A 3U4TA 4G11A 3BUAA 2L6BA 2H6IA 5KJNA 2KM4A 3CGHA 2WXRA 2DZOA 2LSVA 1YMPA 2X6FA 2IEJA 4LEUA 1FVHA 2MYOA 3ASNE 3D9LA 4MBGA 1N11A 2WVIA 3PNLB 4LSZE 3DSWA 4BT9A 4LUNU 3FU5A 3ZKJA 1KLXA 4L1BA 3Q73A 3AU4A 3Q15A 3EIJA 4RQIA 2P9KG 3TXMA 2P9UG 3IHYA 4GB9A 4HOUA 2CG2A 4RG9A 4BETA 4PDXA 4YNDA 2XPIA 3I3NA 4M7CA 3LPZA 4UI9J 5LCWJ 2AJAA 4NQ0A 3SF4A 5G05J 4TXRA 3MGBA 3AS8A 4ABNA 3ULEG 3CIAA 4JC8A 1Z3YA 4HNAD 2F8YA 2XPYA 3NOCD 3KEAA 5KNHD 2C2LA 2HR2A 2Q7FA 2KC7A 4GZ3A 2J8SD 1KZPA 1SZ9A 1OWOA 4WWPA 1TJCA 4LERA 4BERA 1Z6TA 2HM8A 1P5QA 3SZ7A 3APFA 2Y3AA 4K03A 3QARA 2Y69E 3ZIMA 4ILGA 2X6IA 2JABA 4U07A 4B89A 5CHEE 3CVUA 3V2OA 3T5VA 2Y0BG 2VGEA 1DCQA 5CEAA 4HQDA 5BUZA 1HF8A 3O48A 1MQSA 2AXUA 4EHMA 3C3QA 1NL4A 3QKYA 3WXXA 3VTYA 4U95D 3S7DA 3DXMG 4IYPA 3UIPC 1H19A 3CHOA 2R02A 1OWPA 2H6GA 3C98A 5LOZA 2VSXE 4TV3A 4YVQC 2GRPB 5CMYA 4YDEA 3QWVA 5HKPA 3UM3A 3L17A 2LXLA 5E76A 1UG3A 2WXIA 4O60A 4CDMA 4GA2A 1HXIA 3TWRA 1OWLA 3QK0A 2WMOA 4GMJA 4MLPA 1TNOA 3D9HA 1VDYA 3PREA 4AJWA 4I6GA 3UPVA 2AXZA 5T8IA 3PUJA 1FPPA 1MX6A 3EHRA 3TG5A 2IF4A 4JXTA 1OXJA 3ZYMA 1K3ZD 2UWJG 1IHGA 5DIZA 2KBXA 2KCVA 4I9EA 2PQNA 3KAEA 3CKBA 3ASGA 3AS5A 1ZU2A 3MJWA 2HO1A 2DYSE 3QB2A 3LJNA 3UT8A 4U0SA 4U8VD 3P2BA 4G23A 1OWMA 3UUXA 4ILIA 3RRMB 4F1PA 2RKKA 5EX3A 2NC9A 4I6EA 4BX8A 4ANXA 1QBQA 2V5QC 4UI9K 3CK7A 3OXGA 3UT7A 2DBAA 4DX1A 3C5RA 3E34A 3FUEA 4WWNA 3V31A 1MX4A 3EHNA 3D9PA 3TWXA 3ZXPA 3WG7E 1Q2ZA 1UJJA 3C3RA 2VSNA 2Y4UA 3MV2B 4L7TA 2VGXB 4BTAA 2ZISA 3QJZA 2RFMA 4GCNA 4E85A 2E0IA 3TAXA 4AEZC 1PAQA 2IFUA 4CYMD 5AYWD 3QWPA 1TR4A 5LP0A 3GW4A 3ABKE 3ASOE 3DSSA 2BF0X 4FADA 5EX0A 1YCSB 1H2UA 4FULA 2J4BA 1SA5A 3TWTA 4U63A 2VGXA 3RIBA 4U8YD 3ABLE 4JHKA 2R17C 5ENQD 4AVXA 3B7BA 4HOQA 3TGOA 1PY1A 5D2MC 3OAWA 3ONKA 2WXHA 3ZPJA 3NZUA 3TL5A 3RKVA 1O1SA 4GAAA 4DUIA 3D9MA 3S2AA 2V4HC 4FU3A 2EIME 4LNUD 4O1OA 4UWKA 4K0RA 1TN8A 4EBAG 2WXKA 4EPZA 5CEDB 2LAHA 3CSFA 4A63B 4C48B 3UKRG 4N3BA 5AAOA 3FEYA 3DWLG 5AN8A 3BEEA 1N4SA 3RAUA 1NI1A 3LJ3A 3CQCB 1D8DA 1OCZE 1EF1C 2IU1A 2QY7A 2ETBA 5DBKA 3PDNA 4GTTA 3NAWA 3TG4A 5B3SE 4I1AA 3Q49B 4O1PA 3PE4A 3LDZA 3L54A 2XPZA 1BD8A 2WPVA 1E8XA 3DSXA 2WQHA 1TJFA 4HI9A 3LKUA 3PVLA 3LXUX 1XNFA 2ETCA 4LG6A 4M3OA 4HS2A 2CHXA 1MYOA 3I5PA 3IBEA 3OXLA 5JJ6A 2L0TB 4HLLA 5HQ8A 3Q5MA 1KT0A 4KZCA 4N2QA 4GTRA 4FHJA 4WNDA 1Z3XA 5BT1A 4DI4A 4F53A 4A55A 3R9MA 2ZIRA 2WM9A 3VLEA 3SNXA 1OCRE 2LO6A 4N39A 3FU6A 2J9QA 3CHMA 3FTUA 3OTNA 2ONDA 3IXEA 3E33A 2WQ7A 1SVXA 3HVEB 2EIKE 3KS2A 5A7DB 2MOWA 4HLEA 3PH0C 3ZHEB 1KZOA 2UY1B 2IOLA 5JA4D 2RG8A 2OV8A 3O4ZA 4I43A 3ASHA 1HU3A 2OCCE 4L23A 1N95A 1H6OA 4UQYA 5LFAA 4G24A 2VJ8A 4D10C 5AQBA 3QWWA 3AAAC 3U3WA 3L82A 3HVEA 2LSUA 2IO2C 3KSLA 3AG3E 2WXQA 3ZXSA 3ZHEA 1TYQG 2UY1A 3AG2E 4JEHA 5FWQA 4GCOA 4B94A 3L6AA 3HRAA 4V3IA 1V55E 3MV3B 4JD2G 3R9AB 4UWGA 1K1AA 2V4LA 3CVWA 3CV0A 3CLJA 3FTZA 4Q96A 2GRQB 4FHKA 2NSZA 1E7VA 3UM2A 1SQMA 1UJKA 1NA0A 4HORA 1TNYA 5FQ4A 4UI9C 4N2SA 4CZ2D 3PEUB 3CK8A 2Y1LE 4XE0A 1U2VG 3SD5A 5CBNA 1WM5A 4FJZA 1UW4B 4W9RA 3L16A 2B0OE 1K1BA 4IULA 3EU9A 2QFCA 3B13A 3B7UX 3Q47B 5C2YA 4OAVB 4DX7D 4BWRA 4CCAA 4EBAA 3B7RL 4HVBA 3DSVA 3LVQE 1EDUA 3SGHA 3UM0A 4JB8P 3Q7FA 1HG5A 5KCMA 4GZDA 2F8XK 5ENPD 3UQ3A 3EHQA 5A23A 3D9JA 4A3VA 5FIOA 3NQPA 4K5AB 4H7YA 3FTSA 4JL0A 1O1TA 3CKCA 4PH4B 3J5QB 1HX8A 2XZDG 3G2TA 3RO2A 3NF1A 4CEMA 4KMOA 2PQRA 2KXPC 4CRWA 1EYHA 2X6JA 4JEUA 3SY2A 3FH5A 5CCMA 3C3OA 3FUDA 1G3NB 3AJIA 1IQRA 4HI8A 2ZXWE 2IOSA 1IHBA 4PS8A 4E6HA 4J8FA 4C9BB 1Z5SC 2IONA 2PM6A 4DJAA 1S70B 1FT2A 4BSZB 3Q4AB 2X6HA 3ZEFA 5JMND 2WXLA 4K5CA 3FY4A 2QZAA 4AIFA 3QOUA 4J8YA 1EPUA 4N5QA 3E30A 5B1BE 2PNNA 4BESA 3BG1B 3KEZA 5G04C 2I2OA 1L5JA 3FUKA 4TUUA 5KNGA 5BV1A 3MKQB 1IKND 4TRQA 4U8HA 2BTDA 3HIZA 3RJVA 3P1UA 3Q7AA 3LEWA 2XS8A 3R7RA 3DXKG 1OUVA 3JQ1A 1RZ4A 1WAO1 3CEQA 4OAUC 4JHRA 4UWHA 5AQAA 3KD7A 4AM9A 4EECA 4DX6D 2C0MA 5BW8C 5J90A 3EU5A 3MKQA 1N52A 3ULYA 3ZW3A 2QC9A 4A1GA 4YDWA 3VLDA 5ANRA 3RK6A 3CVLA 3ZVVA 1HH8A 3NBNB 3FUIA 2WXFA 4J0UA 1HG2A 2HYZA 4MS6A 1GW6A 1S0PA 1H0AA 1X81A 5G04J 2AWIA 4KYOB 2RFAA 2WXPA 5KBAA 4UWLA 1E8WA 1B89A 2I6HA 2P2CP 2QYJA 2DYRE 3EJNA 1UN9A 5A6CA 4XIFA 2P9IG 4UQXA 3T5XA 5G2NA 3PZDA 4JW1A 3HG0D 3JYSA 4F1SA 4FC8A 3S7FA 1QYMA 2DVWA 1X5BA 2KCKA 1OT8A 3BQOA 3FUMA 4EZKA 4TXQA 3GZ1A 3ESKA 4XX5A 2OEWA 4NIKA 3SHFA 2E2EA 2ZGGA 4NURA 2CHZA 5BXOA 2XQ0A 4J6IA 2P9NG 3IEGA 3D3MA 3UMVA 3Q78A 2LAIA 2WXGA 3N71A 4EQFA 3ZYKA 2XRYA 1HO8A 3FWVA 4P29A 2R5SA 4FJYA 4APOA 4BTBA 4IRUA 4N3CA 3S7BA 3FU0A 1QQEA 4ANWA 1HFAA 3HXBA 1LD7A 4WNEA 1N4RA 5EILA 1MJ0A 3ABME 4A3TA 3FH7A 1K8KG 3JCKC 1HE8A 3FP3A 1KPSB 5HI7A 3F6QA 3AG4E 3Q79A 3ASFA 1ELKA 3FDHA 4U0ZA 2WXOA 2A5EA 3LY7A 3L13A 2A4ZA 4O6FA 1DNPA 5CRVA 4XZ4A 1UOHA 2VYIA 3G2UA 1KT1A 4APFA 2YNQA 3DSUA 4H7XA 4G26A 4R7LA 3ML9A 5BXUA 2DZNA 1N4PA 5EKQD 1E96B 3EHMA 2X38A 1ELWA 3J5PA 1FVFA 2I1KA 3CVXA 3CVYA 3FEXA 2J4DA 4Z68A 3ZYLA 3IHVA 4G1TA 3FTWA 5CMWA 2P9LG 5D0QD 5ENTD 4I17A 4YDOA 2OEVA 3SO8A 3RSEG 3NZSA 4WAFA 3HXEA 1ZBPA 3CVPA 2DCPA 4GYOA 4I9CA 1TNZA 4C0EA 1JUQA 4N5CA 5FTPA 4GTQA 3I4RB 1ZB1A 5BV0A 2WQ6A 2P9PG 3Q75A 3MKRA 3PS6A 4ILHB 2FO1E 1N0RA 1XGWA 3FULA 4GTSA 1S64A 3ZUVB 3CSTA 2YQ8A 4RSYA 4FLBA 4B8CB 3I4GA 3PE3A 3G2WA 2YHEA 4U04A 1HS6A 1O5MA 1TEZA 2XEHA 3W9FA 3DBSA 4ATZD 3DPDA 3UINC 5EIBE 2J07A 4MKTA 4LRZA 2B6CA 4J7WA 4C0MA 5HRYA 5CECB 1N9AA 4HOSA 1W3BA 4GMLA 3ZN3A 1DC2A 3LY8A 4U96D 1BI8B 4Y6CA 2JLBA 1YA0A 4G8KA 3LCAA 4G8LA 3TWWA 1SZAA 4IN3B 5BPPA 5FINA 3KSQA 4AXHA 1E8YA 4GZ5A 3FUJA 3TWSA 5KWDA 3FUFA 3UIOC 1MZCA 3HYMB 5EYPF 3ONLA 4U0UA 3VLFA 1H2VC 1A5EA 5AQ9A 5B1AE 2A5UA 5ENNA 2VTBB 3PZ2A 4I1OB 5EN5D 3JUEA 4WUYA 4BX9A 2IJGX 3G2SA 3UM1A 4A1SA 4I2WA 3UKUG 2J08A 4BEPA 4GTMA 4EZLA 2WXMA 4DX2A 4QFVA 2IY0C 1MX2A 3HHMA 1OY3D 2L9BA 2VTBA 4J8SA 4JA9A 1NZNA 5KJMA 3C72A
chains in the Genus database with same CATH topology
1AP7A 2RFMA 4J7WA 4QQIA 5HRYA 1OT8A 3B95A 3T8KA 3J5PA 2NYJA 3JXJA 5AQBA 4DX7D 3AAAC 4O60A 5CECB 1AWCB 4O1PA 4CYMD 3TWRA 4DX5D 3V79K 3TWUA 2AJAA 1TR4A 2BKKB 2HE0A 4NIKA 4HRMB 1BD8A 1DC2A 4Z68A 2ZGGA 2XENA 3D9HA 4HI9A 1BI8B 4U96D 1D9SA 5BXOA 4OAUC 4JB8P 5ENRD 4ZHBA 4G8KA 4UUCA 2F8XK 5ENTD 5ENPD 4HNAD 4G8LA 2F8YA 3EHQA 3TWWA 1MX6A 3EHRA 2DWZA 5AQAA 1YCSB 1WDYA 5FIOA 1YYHA 4K5AB 3SO8A 3NOCD 2ETCA 4ZFHA 3KEAA 4K5BA 4LG6A 4DX6D 5FINA 5KNHD 5CBOA 3V30A 3TWTA 1MYOA 5HS0A 1K3ZD 3HRAA 2XZDG 3J5QB 3UXGA 1BI7B 1N0QA 2KBXA 2J8SD 3TWVA 5D66A 3DEPA 2QC9A 4U8YD 4HLLA 4BERA 3TWSA 5KWDA 2XEEA 4YDWA 3ZU7B 1K1AA 2KXPC 3DEOA 2BKGA 4YDYA 4F6RD 5EYPF 3NBNB 4TUMA 3JXIA 5ENQD 3B7BA 4OAVB 3LJNA 1A5EA 4U8VD 4HRLA 5AARA 5AQ9A 2JABA 5EILA 2ETAA 2F37A 3UTMA 4F1PA 2FO1E 1MJ0A 3V2OA 1G3NB 4HBDA 2L6BA 1N0RA 3UI2A 4HB5A 3AJIA 4DUIA 2Y0BG 1BLXB 1SW6A 4HI8A 2VGEA 5EN5D 3ZUVB 1DCQA 2ZGDA 3JUEA 5CEAA 1WG0A 2V4HC 2DZOA 2XZTG 1NFIE 4HQDA 1IHBA 1YMPA 4DRXE 2V5QC 4LNUD 1BU9A 2RFAA 3Q9UC 5AQ7A 4O1OA 1IXVA 3F6QA 5ENOD 5ITZF 5KBAA 3IXEA 4BEPA 4CZ2D 1SVXA 2MYOA 1S70B 2Y1LE 4DX1A 3C5RA 4BSZB 5EYLA 4U95D 4DX2A 2A5EA 2P2CP 1N11A 4HRNA 5CEDB 2QYJA 5JMND 3W9GA 4K5CA 4LSZE 3V31A 3ZNGA 4QFVA 4A63B 4GPMA 4C48B 5AAOA 3ZKJA 1MX4A 4GMRA 3TWQA 1UOHA 5CBNA 2XEHA 4J8YA 3TWXA 3W9FA 4B93B 5AN8A 2B0OE 4N5QA 1MX2A 5EIDA 3V2XA 4ATZD 5JA4D 1OY3D 1K1BA 3NOGD 2PNNA 5ENSD 4BESA 5HKPA 3T9KA 3EU9A 5EIBE 5BXUA 2DZNA 3HG0D 4BETA 2ETBA 4RLYA 5KNGA 3Q9NC 5CERB 1IKND 1QYMA 2DVWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AP7 A;  2RFM A;  4J7W A;  4QQI A;  5HRY A;  1OT8 A;  3B95 A;  3T8K A;  3J5P A;  2NYJ A;  3JXJ A;  5AQB A;  4DX7 D;  3AAA C;  4O60 A;  5CEC B;  1AWC B;  4O1P A;  4CYM D;  3TWR A;  4DX5 D;  3V79 K;  3TWU A;  2AJA A;  1TR4 A;  2BKK B;  2HE0 A;  4NIK A;  4HRM B;  1BD8 A;  1DC2 A;  4Z68 A;  2ZGG A;  2XEN A;  3D9H A;  4HI9 A;  1BI8 B;  4U96 D;  1D9S A;  5BXO A;  4OAU C;  4JB8 P;  5ENR D;  4ZHB A;  4G8K A;  4UUC A;  2F8X K;  5ENT D;  5ENP D;  4HNA D;  4G8L A;  2F8Y A;  3EHQ A;  3TWW A;  1MX6 A;  3EHR A;  2DWZ A;  5AQA A;  1YCS B;  1WDY A;  5FIO A;  1YYH A;  4K5A B;  3SO8 A;  3NOC D;  2ETC A;  4ZFH A;  3KEA A;  4K5B A;  4LG6 A;  4DX6 D;  5FIN A;  5KNH D;  5CBO A;  3V30 A;  3TWT A;  1MYO A;  5HS0 A;  1K3Z D;  3HRA A;  2XZD G;  3J5Q B;  3UXG A;  1BI7 B;  1N0Q A;  2KBX A;  2J8S D;  3TWV A;  5D66 A;  3DEP A;  2QC9 A;  4U8Y D;  4HLL A;  4BER A;  3TWS A;  5KWD A;  2XEE A;  4YDW A;  3ZU7 B;  1K1A A;  2KXP C;  3DEO A;  2BKG A;  4YDY A;  4F6R D;  5EYP F;  3NBN B;  4TUM A;  3JXI A;  5ENQ D;  3B7B A;  4OAV B;  3LJN A;  1A5E A;  4U8V D;  4HRL A;  5AAR A;  5AQ9 A;  2JAB A;  5EIL A;  2ETA A;  2F37 A;  3UTM A;  4F1P A;  2FO1 E;  1MJ0 A;  3V2O A;  1G3N B;  4HBD A;  2L6B A;  1N0R A;  3UI2 A;  4HB5 A;  3AJI A;  4DUI A;  2Y0B G;  1BLX B;  1SW6 A;  4HI8 A;  2VGE A;  5EN5 D;  3ZUV B;  1DCQ A;  2ZGD A;  3JUE A;  5CEA A;  1WG0 A;  2V4H C;  2DZO A;  2XZT G;  1NFI E;  4HQD A;  1IHB A;  1YMP A;  4DRX E;  2V5Q C;  4LNU D;  1BU9 A;  2RFA A;  3Q9U C;  5AQ7 A;  4O1O A;  1IXV A;  3F6Q A;  5ENO D;  5ITZ F;  5KBA A;  3IXE A;  4BEP A;  4CZ2 D;  1SVX A;  2MYO A;  1S70 B;  2Y1L E;  4DX1 A;  3C5R A;  4BSZ B;  5EYL A;  4U95 D;  4DX2 A;  2A5E A;  2P2C P;  1N11 A;  4HRN A;  5CED B;  2QYJ A;  5JMN D;  3W9G A;  4K5C A;  4LSZ E;  3V31 A;  3ZNG A;  4QFV A;  4A63 B;  4GPM A;  4C48 B;  5AAO A;  3ZKJ A;  1MX4 A;  4GMR A;  3TWQ A;  1UOH A;  5CBN A;  2XEH A;  4J8Y A;  3TWX A;  3W9F A;  4B93 B;  5AN8 A;  2B0O E;  4N5Q A;  1MX2 A;  5EID A;  3V2X A;  4ATZ D;  5JA4 D;  1OY3 D;  1K1B A;  3NOG D;  2PNN A;  5ENS D;  4BES A;  5HKP A;  3T9K A;  3EU9 A;  5EIB E;  5BXU A;  2DZN A;  3HG0 D;  4BET A;  2ETB A;  4RLY A;  5KNG A;  3Q9N C;  5CER B;  1IKN D;  1QYM A;  2DVW A; 
#chains in the Genus database with same CATH topology
 3JXJ A;  2H6F A;  5LX8 A;  4MRU A;  3TWU A;  2HE0 A;  1U3C A;  2GRM A;  4TXP A;  4XI0 A;  1IQU A;  3CVN A;  3CR3 A;  4UQZ A;  2M63 A;  3UT4 A;  5AJD A;  4XKB A;  4EZJ A;  3HXF A;  3QNK A;  3AS4 A;  4GYY A;  3FUH A;  1H6P A;  5HS0 A;  4KZ0 A;  2XHE A;  2LUH A;  4YVO A;  2GRL A;  2PM7 A;  2EIL E;  3BU8 A;  4DPR A;  4TUM A;  3MZL B;  5KJL A;  3FFL A;  2CFZ A;  3D9N A;  2R05 A;  4GA0 A;  4G25 A;  5JHA A;  4HB5 A;  1SW6 A;  2RD0 A;  4CT4 A;  2XZT G;  1WY6 A;  2LNI A;  1BU9 A;  1H2T C;  3EDT B;  3U9W A;  2XCB A;  2L0I A;  4JPS A;  1TNB A;  3B7T A;  1S63 A;  3QC1 A;  4GPK A;  2PL2 A;  4GMR A;  4LNG A;  3SQV A;  4GA1 A;  5E75 A;  4ATG A;  1JCS A;  3T9K A;  4PUC A;  2QYU A;  3CVQ A;  4RLY A;  3ZRH A;  3HXD A;  4B8A A;  3CHR A;  2NYJ A;  3JUI A;  3APC A;  4OYS A;  3HXC A;  2BKK B;  3LY9 A;  4HRM B;  3D9I A;  4NAC A;  4OVV A;  4HFG A;  3SBS A;  1INZ A;  4WNG A;  1D8E A;  3L22 A;  1HZ4 A;  3SI5 A;  4GZC A;  2F0Y A;  5JHB A;  4XEI G;  1TNU A;  2XEE A;  3LVR E;  2I9C A;  3JXI A;  3DPY A;  3B7S A;  2GRO B;  4HRL A;  1BPO A;  5FZR A;  3MX3 A;  5CCL A;  2XGS A;  3FTX A;  2KCL A;  3PNT B;  4HBD A;  2WB2 A;  3TJP A;  3SFZ A;  1IYG A;  3SFY A;  1WG0 A;  3D9K A;  3ULQ A;  4I6J A;  4DRX E;  2XEV A;  1TN6 A;  1IXV A;  3EIQ C;  5ENO D;  3L08 A;  3AU5 A;  5G55 A;  1LF8 A;  2P9S G;  4Q94 A;  5T4Y A;  2VQ2 A;  2FO7 A;  4HRN A;  2R59 A;  4FA6 A;  3ZNG A;  3URZ A;  1N4Q A;  2IO3 C;  3V2X A;  2EIJ E;  5FQ7 A;  1JPL A;  5T3R A;  3PZ3 A;  3OXF A;  1AP7 A;  4CDN A;  1JWF A;  4ZHB A;  3TXN A;  4KVO A;  5ARG A;  3CHQ A;  5D0O D;  3APD A;  4GU5 A;  4GTV A;  2XEN A;  1A17 A;  5KJK A;  5ENR D;  3ML8 A;  3T8M A;  3GZ2 A;  3MYV A;  5JJT A;  2GW1 A;  4BY6 A;  4KT6 B;  1WDY A;  3VTX A;  4UWF A;  2XS1 A;  2WXN A;  3EUV A;  4PS3 A;  5EDS A;  2EIN E;  1MHQ A;  2GGF A;  2AXV A;  1Y6I A;  2X6K A;  1SA4 A;  4DLQ A;  2L6J A;  5FQ8 A;  4KVM A;  1N54 A;  1OCC E;  1FT1 A;  2GRR B;  2V5F A;  3RRN B;  1LTX A;  3JQ0 A;  2VGY A;  2MRI A;  3FUN A;  4KXK B;  3FH8 A;  3HDX A;  5AAR A;  3E37 A;  4RG6 A;  1OCO E;  4ACK A;  1BLX B;  4OVU A;  2ZGD A;  2R03 A;  4F3V A;  3ISM C;  3Q9U C;  5ITZ F;  3FTY A;  2YHC A;  3ESL A;  1E7U A;  3RRU A;  2FUL A;  5H7P A;  3TWQ A;  1JCQ A;  3IKO B;  4AY6 A;  3MCX A;  2R2L A;  5FZQ A;  2ZU6 B;  4BT8 A;  3Q9N C;  3PUK A;  2KAT A;  5AJL A;  3CVV A;  3FHE A;  2ILR A;  2AVP A;  4GZ6 A;  4DK5 A;  3AG1 E;  1QZ2 A;  2BUG A;  2IQC A;  5FZS A;  2PZI A;  4L2L A;  1D9S A;  2XCC A;  5FJY A;  5AIJ A;  4AP2 A;  4UUC A;  5BNW A;  3R7Q A;  2JEK A;  3DST A;  2AW6 A;  2VSY A;  1YYH A;  4G2V A;  3PEV B;  5FT9 A;  4CGV A;  4ME2 A;  3ZFW A;  5M72 A;  3V30 A;  4LCT A;  4DLO A;  3ZGQ A;  5FQ6 A;  3LYA A;  4Y6W A;  3ZU7 B;  2P58 C;  4DI3 A;  4I1M A;  4YDY A;  3MEK A;  1O1R A;  4L2Y A;  3UI2 A;  2J49 A;  3QAQ A;  1NFI E;  2WMN A;  4PS7 A;  2OVF A;  1UN8 A;  4B0Z A;  5JJ7 A;  5EYL A;  3CK9 A;  1JWG A;  3K9I A;  1QNF A;  4GPM A;  5C1D A;  3RO3 A;  5CRU A;  1DVP A;  4B93 B;  3BG0 B;  5EID A;  4JZY A;  3NOG D;  5J08 A;  3ASD A;  2NXP A;  2WXJ A;  4I2Z A;  4CGW A;  4XKC A;  5ARF A;  4Q69 A;  3T8K A;  2J09 A;  3IV0 A;  3CQG B;  3S7J A;  2DIW A;  4CDR A;  4DX5 D;  3QDN A;  3CHP A;  3PRZ A;  3G2V A;  4AV7 A;  2YIN A;  3GYZ A;  4HXI A;  4U7E B;  4HOT A;  4BSX A;  1PC2 A;  4L9P A;  3FTV A;  1H6K A;  3SBT B;  3MA5 A;  4FP7 A;  4N3A A;  4ACL A;  1BI7 B;  3PZ4 A;  5D66 A;  4BFR A;  3DEP A;  2KZT B;  3ENE A;  3DEO A;  1NA3 A;  3X2Q E;  4ANV A;  3D9O A;  1LD8 A;  3GZS A;  5IY5 E;  1NP7 A;  4WNF A;  2ETA A;  2F37 A;  4XI9 A;  3UTM A;  1ELR A;  4GTP A;  3ZYQ A;  4J8D A;  3E32 A;  4WWO A;  4GYW A;  3U66 A;  4F7A A;  2H6H A;  1TN7 A;  2MHK A;  5AQ7 A;  1N94 A;  3RU0 A;  1FCH A;  2V0P A;  4AOF A;  2KZT A;  4GTO A;  3W9G A;  3UX4 A;  3CHS A;  2I1J A;  2XRZ A;  4NRH B;  2LXM A;  2CG3 A;  5ENS D;  4URK A;  2OVB A;  2XGM A;  2Y4T A;  4FLH A;  1E8Z A;  3LS8 A;  5CER B;  4X8Q A;  2BED A;  4QQI A;  3B95 A;  2XGO A;  1AWC B;  1JCR A;  3DRA A;  3V79 K;  3SFX A;  3L9T A;  5ANL A;  2FBN A;  2FF4 A;  3FU3 A;  2GRN B;  1E90 A;  4JA7 A;  4LNB A;  2DWZ A;  1OWN A;  2VSO E;  2X3M A;  4ZFH A;  4K5B A;  4RVB A;  5CBO A;  1RW2 A;  4CT0 A;  2FEZ A;  2CHW A;  3UXG A;  1Y8M A;  1N0Q A;  4KBQ A;  3TWV A;  2V8S E;  2C0L A;  3PZ1 A;  1U3D A;  5AEN A;  5LCW C;  2CFU A;  2BKG A;  2FI7 A;  4F6R D;  1DCE A;  5G05 C;  2EQX A;  4AY5 A;  4ANU A;  4JHJ A;  2OOE A;  3E4B A;  1V54 E;  4J8E A;  4JVS A;  3U64 A;  3NB2 A;  3U4T A;  4G11 A;  3BUA A;  2L6B A;  2H6I A;  5KJN A;  2KM4 A;  3CGH A;  2WXR A;  2DZO A;  2LSV A;  1YMP A;  2X6F A;  2IEJ A;  4LEU A;  1FVH A;  2MYO A;  3ASN E;  3D9L A;  4MBG A;  1N11 A;  2WVI A;  3PNL B;  4LSZ E;  3DSW A;  4BT9 A;  4LUN U;  3FU5 A;  3ZKJ A;  1KLX A;  4L1B A;  3Q73 A;  3AU4 A;  3Q15 A;  3EIJ A;  4RQI A;  2P9K G;  3TXM A;  2P9U G;  3IHY A;  4GB9 A;  4HOU A;  2CG2 A;  4RG9 A;  4BET A;  4PDX A;  4YND A;  2XPI A;  3I3N A;  4M7C A;  3LPZ A;  4UI9 J;  5LCW J;  2AJA A;  4NQ0 A;  3SF4 A;  5G05 J;  4TXR A;  3MGB A;  3AS8 A;  4ABN A;  3ULE G;  3CIA A;  4JC8 A;  1Z3Y A;  4HNA D;  2F8Y A;  2XPY A;  3NOC D;  3KEA A;  5KNH D;  2C2L A;  2HR2 A;  2Q7F A;  2KC7 A;  4GZ3 A;  2J8S D;  1KZP A;  1SZ9 A;  1OWO A;  4WWP A;  1TJC A;  4LER A;  4BER A;  1Z6T A;  2HM8 A;  1P5Q A;  3SZ7 A;  3APF A;  2Y3A A;  4K03 A;  3QAR A;  2Y69 E;  3ZIM A;  4ILG A;  2X6I A;  2JAB A;  4U07 A;  4B89 A;  5CHE E;  3CVU A;  3V2O A;  3T5V A;  2Y0B G;  2VGE A;  1DCQ A;  5CEA A;  4HQD A;  5BUZ A;  1HF8 A;  3O48 A;  1MQS A;  2AXU A;  4EHM A;  3C3Q A;  1NL4 A;  3QKY A;  3WXX A;  3VTY A;  4U95 D;  3S7D A;  3DXM G;  4IYP A;  3UIP C;  1H19 A;  3CHO A;  2R02 A;  1OWP A;  2H6G A;  3C98 A;  5LOZ A;  2VSX E;  4TV3 A;  4YVQ C;  2GRP B;  5CMY A;  4YDE A;  3QWV A;  5HKP A;  3UM3 A;  3L17 A;  2LXL A;  5E76 A;  1UG3 A;  2WXI A;  4O60 A;  4CDM A;  4GA2 A;  1HXI A;  3TWR A;  1OWL A;  3QK0 A;  2WMO A;  4GMJ A;  4MLP A;  1TNO A;  3D9H A;  1VDY A;  3PRE A;  4AJW A;  4I6G A;  3UPV A;  2AXZ A;  5T8I A;  3PUJ A;  1FPP A;  1MX6 A;  3EHR A;  3TG5 A;  2IF4 A;  4JXT A;  1OXJ A;  3ZYM A;  1K3Z D;  2UWJ G;  1IHG A;  5DIZ A;  2KBX A;  2KCV A;  4I9E A;  2PQN A;  3KAE A;  3CKB A;  3ASG A;  3AS5 A;  1ZU2 A;  3MJW A;  2HO1 A;  2DYS E;  3QB2 A;  3LJN A;  3UT8 A;  4U0S A;  4U8V D;  3P2B A;  4G23 A;  1OWM A;  3UUX A;  4ILI A;  3RRM B;  4F1P A;  2RKK A;  5EX3 A;  2NC9 A;  4I6E A;  4BX8 A;  4ANX A;  1QBQ A;  2V5Q C;  4UI9 K;  3CK7 A;  3OXG A;  3UT7 A;  2DBA A;  4DX1 A;  3C5R A;  3E34 A;  3FUE A;  4WWN A;  3V31 A;  1MX4 A;  3EHN A;  3D9P A;  3TWX A;  3ZXP A;  3WG7 E;  1Q2Z A;  1UJJ A;  3C3R A;  2VSN A;  2Y4U A;  3MV2 B;  4L7T A;  2VGX B;  4BTA A;  2ZIS A;  3QJZ A;  2RFM A;  4GCN A;  4E85 A;  2E0I A;  3TAX A;  4AEZ C;  1PAQ A;  2IFU A;  4CYM D;  5AYW D;  3QWP A;  1TR4 A;  5LP0 A;  3GW4 A;  3ABK E;  3ASO E;  3DSS A;  2BF0 X;  4FAD A;  5EX0 A;  1YCS B;  1H2U A;  4FUL A;  2J4B A;  1SA5 A;  3TWT A;  4U63 A;  2VGX A;  3RIB A;  4U8Y D;  3ABL E;  4JHK A;  2R17 C;  5ENQ D;  4AVX A;  3B7B A;  4HOQ A;  3TGO A;  1PY1 A;  5D2M C;  3OAW A;  3ONK A;  2WXH A;  3ZPJ A;  3NZU A;  3TL5 A;  3RKV A;  1O1S A;  4GAA A;  4DUI A;  3D9M A;  3S2A A;  2V4H C;  4FU3 A;  2EIM E;  4LNU D;  4O1O A;  4UWK A;  4K0R A;  1TN8 A;  4EBA G;  2WXK A;  4EPZ A;  5CED B;  2LAH A;  3CSF A;  4A63 B;  4C48 B;  3UKR G;  4N3B A;  5AAO A;  3FEY A;  3DWL G;  5AN8 A;  3BEE A;  1N4S A;  3RAU A;  1NI1 A;  3LJ3 A;  3CQC B;  1D8D A;  1OCZ E;  1EF1 C;  2IU1 A;  2QY7 A;  2ETB A;  5DBK A;  3PDN A;  4GTT A;  3NAW A;  3TG4 A;  5B3S E;  4I1A A;  3Q49 B;  4O1P A;  3PE4 A;  3LDZ A;  3L54 A;  2XPZ A;  1BD8 A;  2WPV A;  1E8X A;  3DSX A;  2WQH A;  1TJF A;  4HI9 A;  3LKU A;  3PVL A;  3LXU X;  1XNF A;  2ETC A;  4LG6 A;  4M3O A;  4HS2 A;  2CHX A;  1MYO A;  3I5P A;  3IBE A;  3OXL A;  5JJ6 A;  2L0T B;  4HLL A;  5HQ8 A;  3Q5M A;  1KT0 A;  4KZC A;  4N2Q A;  4GTR A;  4FHJ A;  4WND A;  1Z3X A;  5BT1 A;  4DI4 A;  4F53 A;  4A55 A;  3R9M A;  2ZIR A;  2WM9 A;  3VLE A;  3SNX A;  1OCR E;  2LO6 A;  4N39 A;  3FU6 A;  2J9Q A;  3CHM A;  3FTU A;  3OTN A;  2OND A;  3IXE A;  3E33 A;  2WQ7 A;  1SVX A;  3HVE B;  2EIK E;  3KS2 A;  5A7D B;  2MOW A;  4HLE A;  3PH0 C;  3ZHE B;  1KZO A;  2UY1 B;  2IOL A;  5JA4 D;  2RG8 A;  2OV8 A;  3O4Z A;  4I43 A;  3ASH A;  1HU3 A;  2OCC E;  4L23 A;  1N95 A;  1H6O A;  4UQY A;  5LFA A;  4G24 A;  2VJ8 A;  4D10 C;  5AQB A;  3QWW A;  3AAA C;  3U3W A;  3L82 A;  3HVE A;  2LSU A;  2IO2 C;  3KSL A;  3AG3 E;  2WXQ A;  3ZXS A;  3ZHE A;  1TYQ G;  2UY1 A;  3AG2 E;  4JEH A;  5FWQ A;  4GCO A;  4B94 A;  3L6A A;  3HRA A;  4V3I A;  1V55 E;  3MV3 B;  4JD2 G;  3R9A B;  4UWG A;  1K1A A;  2V4L A;  3CVW A;  3CV0 A;  3CLJ A;  3FTZ A;  4Q96 A;  2GRQ B;  4FHK A;  2NSZ A;  1E7V A;  3UM2 A;  1SQM A;  1UJK A;  1NA0 A;  4HOR A;  1TNY A;  5FQ4 A;  4UI9 C;  4N2S A;  4CZ2 D;  3PEU B;  3CK8 A;  2Y1L E;  4XE0 A;  1U2V G;  3SD5 A;  5CBN A;  1WM5 A;  4FJZ A;  1UW4 B;  4W9R A;  3L16 A;  2B0O E;  1K1B A;  4IUL A;  3EU9 A;  2QFC A;  3B13 A;  3B7U X;  3Q47 B;  5C2Y A;  4OAV B;  4DX7 D;  4BWR A;  4CCA A;  4EBA A;  3B7R L;  4HVB A;  3DSV A;  3LVQ E;  1EDU A;  3SGH A;  3UM0 A;  4JB8 P;  3Q7F A;  1HG5 A;  5KCM A;  4GZD A;  2F8X K;  5ENP D;  3UQ3 A;  3EHQ A;  5A23 A;  3D9J A;  4A3V A;  5FIO A;  3NQP A;  4K5A B;  4H7Y A;  3FTS A;  4JL0 A;  1O1T A;  3CKC A;  4PH4 B;  3J5Q B;  1HX8 A;  2XZD G;  3G2T A;  3RO2 A;  3NF1 A;  4CEM A;  4KMO A;  2PQR A;  2KXP C;  4CRW A;  1EYH A;  2X6J A;  4JEU A;  3SY2 A;  3FH5 A;  5CCM A;  3C3O A;  3FUD A;  1G3N B;  3AJI A;  1IQR A;  4HI8 A;  2ZXW E;  2IOS A;  1IHB A;  4PS8 A;  4E6H A;  4J8F A;  4C9B B;  1Z5S C;  2ION A;  2PM6 A;  4DJA A;  1S70 B;  1FT2 A;  4BSZ B;  3Q4A B;  2X6H A;  3ZEF A;  5JMN D;  2WXL A;  4K5C A;  3FY4 A;  2QZA A;  4AIF A;  3QOU A;  4J8Y A;  1EPU A;  4N5Q A;  3E30 A;  5B1B E;  2PNN A;  4BES A;  3BG1 B;  3KEZ A;  5G04 C;  2I2O A;  1L5J A;  3FUK A;  4TUU A;  5KNG A;  5BV1 A;  3MKQ B;  1IKN D;  4TRQ A;  4U8H A;  2BTD A;  3HIZ A;  3RJV A;  3P1U A;  3Q7A A;  3LEW A;  2XS8 A;  3R7R A;  3DXK G;  1OUV A;  3JQ1 A;  1RZ4 A;  1WAO 1;  3CEQ A;  4OAU C;  4JHR A;  4UWH A;  5AQA A;  3KD7 A;  4AM9 A;  4EEC A;  4DX6 D;  2C0M A;  5BW8 C;  5J90 A;  3EU5 A;  3MKQ A;  1N52 A;  3ULY A;  3ZW3 A;  2QC9 A;  4A1G A;  4YDW A;  3VLD A;  5ANR A;  3RK6 A;  3CVL A;  3ZVV A;  1HH8 A;  3NBN B;  3FUI A;  2WXF A;  4J0U A;  1HG2 A;  2HYZ A;  4MS6 A;  1GW6 A;  1S0P A;  1H0A A;  1X81 A;  5G04 J;  2AWI A;  4KYO B;  2RFA A;  2WXP A;  5KBA A;  4UWL A;  1E8W A;  1B89 A;  2I6H A;  2P2C P;  2QYJ A;  2DYR E;  3EJN A;  1UN9 A;  5A6C A;  4XIF A;  2P9I G;  4UQX A;  3T5X A;  5G2N A;  3PZD A;  4JW1 A;  3HG0 D;  3JYS A;  4F1S A;  4FC8 A;  3S7F A;  1QYM A;  2DVW A;  1X5B A;  2KCK A;  1OT8 A;  3BQO A;  3FUM A;  4EZK A;  4TXQ A;  3GZ1 A;  3ESK A;  4XX5 A;  2OEW A;  4NIK A;  3SHF A;  2E2E A;  2ZGG A;  4NUR A;  2CHZ A;  5BXO A;  2XQ0 A;  4J6I A;  2P9N G;  3IEG A;  3D3M A;  3UMV A;  3Q78 A;  2LAI A;  2WXG A;  3N71 A;  4EQF A;  3ZYK A;  2XRY A;  1HO8 A;  3FWV A;  4P29 A;  2R5S A;  4FJY A;  4APO A;  4BTB A;  4IRU A;  4N3C A;  3S7B A;  3FU0 A;  1QQE A;  4ANW A;  1HFA A;  3HXB A;  1LD7 A;  4WNE A;  1N4R A;  5EIL A;  1MJ0 A;  3ABM E;  4A3T A;  3FH7 A;  1K8K G;  3JCK C;  1HE8 A;  3FP3 A;  1KPS B;  5HI7 A;  3F6Q A;  3AG4 E;  3Q79 A;  3ASF A;  1ELK A;  3FDH A;  4U0Z A;  2WXO A;  2A5E A;  3LY7 A;  3L13 A;  2A4Z A;  4O6F A;  1DNP A;  5CRV A;  4XZ4 A;  1UOH A;  2VYI A;  3G2U A;  1KT1 A;  4APF A;  2YNQ A;  3DSU A;  4H7X A;  4G26 A;  4R7L A;  3ML9 A;  5BXU A;  2DZN A;  1N4P A;  5EKQ D;  1E96 B;  3EHM A;  2X38 A;  1ELW A;  3J5P A;  1FVF A;  2I1K A;  3CVX A;  3CVY A;  3FEX A;  2J4D A;  4Z68 A;  3ZYL A;  3IHV A;  4G1T A;  3FTW A;  5CMW A;  2P9L G;  5D0Q D;  5ENT D;  4I17 A;  4YDO A;  2OEV A;  3SO8 A;  3RSE G;  3NZS A;  4WAF A;  3HXE A;  1ZBP A;  3CVP A;  2DCP A;  4GYO A;  4I9C A;  1TNZ A;  4C0E A;  1JUQ A;  4N5C A;  5FTP A;  4GTQ A;  3I4R B;  1ZB1 A;  5BV0 A;  2WQ6 A;  2P9P G;  3Q75 A;  3MKR A;  3PS6 A;  4ILH B;  2FO1 E;  1N0R A;  1XGW A;  3FUL A;  4GTS A;  1S64 A;  3ZUV B;  3CST A;  2YQ8 A;  4RSY A;  4FLB A;  4B8C B;  3I4G A;  3PE3 A;  3G2W A;  2YHE A;  4U04 A;  1HS6 A;  1O5M A;  1TEZ A;  2XEH A;  3W9F A;  3DBS A;  4ATZ D;  3DPD A;  3UIN C;  5EIB E;  2J07 A;  4MKT A;  4LRZ A;  2B6C A;  4J7W A;  4C0M A;  5HRY A;  5CEC B;  1N9A A;  4HOS A;  1W3B A;  4GML A;  3ZN3 A;  1DC2 A;  3LY8 A;  4U96 D;  1BI8 B;  4Y6C A;  2JLB A;  1YA0 A;  4G8K A;  3LCA A;  4G8L A;  3TWW A;  1SZA A;  4IN3 B;  5BPP A;  5FIN A;  3KSQ A;  4AXH A;  1E8Y A;  4GZ5 A;  3FUJ A;  3TWS A;  5KWD A;  3FUF A;  3UIO C;  1MZC A;  3HYM B;  5EYP F;  3ONL A;  4U0U A;  3VLF A;  1H2V C;  1A5E A;  5AQ9 A;  5B1A E;  2A5U A;  5ENN A;  2VTB B;  3PZ2 A;  4I1O B;  5EN5 D;  3JUE A;  4WUY A;  4BX9 A;  2IJG X;  3G2S A;  3UM1 A;  4A1S A;  4I2W A;  3UKU G;  2J08 A;  4BEP A;  4GTM A;  4EZL A;  2WXM A;  4DX2 A;  4QFV A;  2IY0 C;  1MX2 A;  3HHM A;  1OY3 D;  2L9B A;  2VTB A;  4J8S A;  4JA9 A;  1NZN A;  5KJM A;  3C72 A; 
#chains in the Genus database with same CATH homology
 1AP7 A;  2RFM A;  4J7W A;  4QQI A;  5HRY A;  1OT8 A;  3B95 A;  3T8K A;  3J5P A;  2NYJ A;  3JXJ A;  5AQB A;  4DX7 D;  3AAA C;  4O60 A;  5CEC B;  1AWC B;  4O1P A;  4CYM D;  3TWR A;  4DX5 D;  3V79 K;  3TWU A;  2AJA A;  1TR4 A;  2BKK B;  2HE0 A;  4NIK A;  4HRM B;  1BD8 A;  1DC2 A;  4Z68 A;  2ZGG A;  2XEN A;  3D9H A;  4HI9 A;  1BI8 B;  4U96 D;  1D9S A;  5BXO A;  4OAU C;  4JB8 P;  5ENR D;  4ZHB A;  4G8K A;  4UUC A;  2F8X K;  5ENT D;  5ENP D;  4HNA D;  4G8L A;  2F8Y A;  3EHQ A;  3TWW A;  1MX6 A;  3EHR A;  2DWZ A;  5AQA A;  1YCS B;  1WDY A;  5FIO A;  1YYH A;  4K5A B;  3SO8 A;  3NOC D;  2ETC A;  4ZFH A;  3KEA A;  4K5B A;  4LG6 A;  4DX6 D;  5FIN A;  5KNH D;  5CBO A;  3V30 A;  3TWT A;  1MYO A;  5HS0 A;  1K3Z D;  3HRA A;  2XZD G;  3J5Q B;  3UXG A;  1BI7 B;  1N0Q A;  2KBX A;  2J8S D;  3TWV A;  5D66 A;  3DEP A;  2QC9 A;  4U8Y D;  4HLL A;  4BER A;  3TWS A;  5KWD A;  2XEE A;  4YDW A;  3ZU7 B;  1K1A A;  2KXP C;  3DEO A;  2BKG A;  4YDY A;  4F6R D;  5EYP F;  3NBN B;  4TUM A;  3JXI A;  5ENQ D;  3B7B A;  4OAV B;  3LJN A;  1A5E A;  4U8V D;  4HRL A;  5AAR A;  5AQ9 A;  2JAB A;  5EIL A;  2ETA A;  2F37 A;  3UTM A;  4F1P A;  2FO1 E;  1MJ0 A;  3V2O A;  1G3N B;  4HBD A;  2L6B A;  1N0R A;  3UI2 A;  4HB5 A;  3AJI A;  4DUI A;  2Y0B G;  1BLX B;  1SW6 A;  4HI8 A;  2VGE A;  5EN5 D;  3ZUV B;  1DCQ A;  2ZGD A;  3JUE A;  5CEA A;  1WG0 A;  2V4H C;  2DZO A;  2XZT G;  1NFI E;  4HQD A;  1IHB A;  1YMP A;  4DRX E;  2V5Q C;  4LNU D;  1BU9 A;  2RFA A;  3Q9U C;  5AQ7 A;  4O1O A;  1IXV A;  3F6Q A;  5ENO D;  5ITZ F;  5KBA A;  3IXE A;  4BEP A;  4CZ2 D;  1SVX A;  2MYO A;  1S70 B;  2Y1L E;  4DX1 A;  3C5R A;  4BSZ B;  5EYL A;  4U95 D;  4DX2 A;  2A5E A;  2P2C P;  1N11 A;  4HRN A;  5CED B;  2QYJ A;  5JMN D;  3W9G A;  4K5C A;  4LSZ E;  3V31 A;  3ZNG A;  4QFV A;  4A63 B;  4GPM A;  4C48 B;  5AAO A;  3ZKJ A;  1MX4 A;  4GMR A;  3TWQ A;  1UOH A;  5CBN A;  2XEH A;  4J8Y A;  3TWX A;  3W9F A;  4B93 B;  5AN8 A;  2B0O E;  4N5Q A;  1MX2 A;  5EID A;  3V2X A;  4ATZ D;  5JA4 D;  1OY3 D;  1K1B A;  3NOG D;  2PNN A;  5ENS D;  4BES A;  5HKP A;  3T9K A;  3EU9 A;  5EIB E;  5BXU A;  2DZN A;  3HG0 D;  4BET A;  2ETB A;  4RLY A;  5KNG A;  3Q9N C;  5CER B;  1IKN D;  1QYM A;  2DVW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...