5EILA

Computational design of a high-affinity metalloprotein homotrimer containing a metal chelating non-canonical amino acid
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
157
Chain Sequence
MSKLGEMLIAVLIGSKEAVKVLLDLGADPNASDEDGLTPLHAAAMAGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNTSDSDGRTPLDLAREHGNEEIVKLLEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRI-05
publication title Computational design of a homotrimeric metalloprotein with a trisbipyridyl core.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 54
structure length 157
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5eilA00
3JXIA 4J7WA 4HI9A 5EIBE 5AAOA 2MYOA 3B7BA 3Q9UC 1BLXB 4O1PA 3V2XA 3EHRA 2DVWA 2ETBA 4O1OA 2F37A 3IXEA 3TWQA 2KBXA 2F8XK 1MX4A 2Y1LE 4O60A 4QFVA 5D66A 5ENTD 1S70B 1BD8A 2ETAA 1AP7A 4HLLA 1IKND 1DC2A 2V5QC 3J5QB 5CBOA 3T8KA 3TWVA 1K1AA 3JXJA 5EN5D 2V4HC 3DEPA 4YDYA 5ENPD 1K1BA 2J8SD 4LG6A 3W9FA 4U96D 5KNGA 5AQ7A 3TWWA 5KBAA 1NFIE 1BI7B 3HG0D 2AJAA 2RFMA 5KNHD 1SW6A 3C5RA 4U95D 2HE0A 3J5PA 4DX7D 4JB8P 4YDWA 2P2CP 4F6RD 2L6BA 3T9KA 2BKKB 4UUCA 4DX1A 2Y0BG 4HB5A 1OY3D 3Q9NC 4DX5D 3UI2A 4U8YD 4GPMA 2QYJA 5ENOD 4HNAD 1OT8A 3UXGA 4DX6D 5CECB 1SVXA 4TUMA 4OAUC 1G3NB 4K5CA 2XZTG 2XENA 2XZDG 4Z68A 1YCSB 2BKGA 4A63B 5AQ9A 4J8YA 5CBNA 1MX6A 1TR4A 2DZOA 3EU9A 4ATZD 4BESA 3V31A 3V30A 2FO1E 3KEAA 1IXVA 1UOHA 2XEEA 5ENSD 3ZU7B 3V2OA 2XEHA 1D9SA 3ZKJA 4QQIA 4CYMD 5KWDA 4N5QA 1K3ZD 1YYHA 4HBDA 4DUIA 4G8KA 4DRXE 2JABA 5BXOA 5AN8A 5JA4D 2F8YA 2ZGDA 5FINA 2KXPC 3ZUVB 5AQAA 3TWTA 2ZGGA 4C48B 3LJNA 5EYLA 4K5BA 4ZHBA 5HRYA 4DX2A 4HI8A 3TWSA 5AQBA 2DWZA 5ITZF 4G8LA 4ZFHA 1WDYA 1MYOA 4K5AB 2B0OE 4F1PA 3F6QA 1BI8B 4HRNA 2QC9A 1IHBA 4LSZE 1AWCB 2VGEA 3NOCD 4RLYA 2A5EA 4LNUD 5EYPF 3UTMA 4BSZB 5CEDB 1QYMA 3AJIA 5ENQD 1N0RA 5EIDA 5HKPA 1N11A 5JMND 5ENRD 4GMRA 4HRMB 1DCQA 1MX2A 3AAAC 2RFAA 5FIOA 5CERB 3HRAA 5AARA 5EILA 3TWRA 4HRLA 3ZNGA 4BETA 4OAVB 3W9GA 3NBNB 1WG0A 4BERA 3DEOA 2DZNA 2NYJA 3SO8A 3TWUA 5BXUA 4CZ2D 4U8VD 4NIKA 4HQDA 4BEPA 2ETCA 3EHQA 3JUEA 2PNNA 5CEAA 3NOGD 1A5EA 3D9HA 5HS0A 3V79K 1BU9A 3B95A 1MJ0A 4B93B 3TWXA 1YMPA 1N0QA
chains in the Genus database with same CATH superfamily
3L16A 2VSOE 3B13A 2UWJG 4O1PA 3PE4A 1TJCA 3MKQA 1X5BA 3QK0A 4WNFA 3LDZA 3TWVA 1OWPA 1RW2A 2VTBA 3CVYA 4WWPA 1OCOE 4YVQC 3DWLG 3CKCA 4LRZA 3OXGA 3DPDA 3UIPC 3T9KA 1E8XA 3E32A 3QARA 4HNAD 1TJFA 3R7RA 1SA5A 4N2QA 2PQNA 5AQ9A 4L23A 3EU9A 1N4RA 1W3BA 4OVUA 3ENEA 3JCKC 2XEHA 4CGWA 1E8WA 3JYSA 3S7DA 4CYMD 4H7YA 1ELWA 5BNWA 2XGOA 4EQFA 3O4ZA 4KZCA 3FUIA 3E34A 5BW8C 3F6QA 5CMWA 3PH0C 5CERB 3UINC 3HRAA 1HZ4A 5FWQA 3VLFA 1QQEA 4TXQA 4CZ2D 3D9HA 4U63A 4BX8A 5LCWJ 4N3BA 3CHRA 4IRUA 1IQUA 1MX4A 1BD8A 5CBOA 4RSYA 3VLDA 1INZA 2L9BA 3CVWA 1ELRA 2KCKA 4LG6A 2AVPA 2WM9A 3U64A 3KD7A 3GZ1A 2P9KG 3P1UA 2P9SG 4LNGA 4YDEA 1QNFA 5ENOD 1SVXA 4TUMA 1UJJA 4FLBA 4L2YA 2I6HA 1Y8MA 2LXMA 3MEKA 4BESA 3FUHA 2J4DA 3SFZA 2IO2C 2Y69E 4FLHA 2WXFA 2WMNA 3QC1A 2R5SA 1K3ZD 1H19A 2XCCA 3C98A 1YA0A 2OOEA 4GTVA 3HDXA 3LEWA 2XEVA 2HR2A 3AU4A 4WAFA 4HORA 4LSZE 5E76A 3L17A 5T4YA 1X81A 2OVFA 1OWMA 3ASNE 1TNOA 3EIJA 3PE3A 1RZ4A 3N71A 3DSXA 4HQDA 2IOSA 4BEPA 1FPPA 2A5UA 4J8YA 4B93B 3LXUX 2R59A 4PDXA 4B0ZA 3HVEA 1KLXA 2WVIA 1U3DA 5BPPA 2DCPA 5D66A 3TAXA 3Q4AB 1IKND 1LD8A 4JC8A 3SD5A 1JPLA 5ENNA 3ZRHA 4EZLA 2XQ0A 2J8SD 3PDNA 4JVSA 3FH8A 5KNHD 4URKA 3C5RA 4DX7D 1HH8A 4GA1A 4BSXA 4L1BA 2L6BA 4GA0A 3D3MA 3ULQA 4EPZA 1G3NB 2P9LG 3ML8A 1JCSA 3UM0A 4A63B 1N4PA 3L9TA 1OWNA 3ZN3A 4A3VA 2XEEA 3FTYA 5A6CA 4L7TA 2KM4A 5KWDA 4HBDA 3L82A 2FULA 4G8KA 2R05A 3Q78A 4LUNU 1HG2A 2J4BA 3ASGA 1MYOA 2QC9A 3ASDA 2IO3C 3SBSA 3OXFA 4IYPA 2A5EA 4LNUD 1MZCA 3MV3B 2MRIA 2H6GA 3ZHEA 2QFCA 3I5PA 2IONA 4U8VD 3IBEA 3EHQA 4AEZC 3OAWA 4ILIA 3RJVA 2MOWA 2WQHA 3ML9A 1Q2ZA 4KZ0A 4PUCA 4ACKA 4A1SA 2LNIA 5EN5D 3VLEA 2V0PA 3CHSA 4MLPA 3VTYA 4GPKA 2P58C 3HG0D 3UQ3A 2OEWA 5B3SE 3MCXA 2GRNB 3CK8A 2EILE 4J8SA 4TXRA 5D2MC 4B8CB 4HB5A 3UMVA 4GZ6A 1Z3YA 1WY6A 2NC9A 4AXHA 5LOZA 2XZTG 2XZDG 1YCSB 3CVUA 1IXVA 4I43A 2J07A 2RD0A 2X6FA 4GTOA 3CVQA 4N5QA 2R02A 3Q5MA 3QWPA 3B7UX 4ATGA 4L2LA 4HI8A 2X3MA 3NF1A 3Q79A 1UN8A 4ZFHA 4AIFA 4X8QA 4BSZB 5HKPA 1U3CA 3EU5A 5EKQD 2RFAA 2FF4A 2IEJA 3W9GA 4BERA 3UM1A 1JCQA 1Z5SC 5EX3A 4FHJA 4NIKA 1DCEA 4C0MA 4F7AA 2ONDA 1A5EA 3TWXA 1YMPA 4GTPA 4IN3B 4KXKB 4GU5A 3Q9UC 2CHXA 2VTBB 3V2XA 3FHEA 3PNLB 4HXIA 2VJ8A 4QFVA 2ZIRA 1S70B 3PVLA 4HLLA 2X6IA 1HS6A 5JHBA 4GTMA 3CSFA 4E85A 3W9FA 4DJAA 3I4RB 1N54A 1ELKA 1IHGA 4FJZA 3PZDA 3LY8A 2CG2A 1HX8A 4ME2A 4F6RD 4WUYA 4UQXA 3Q9NC 4DI4A 2KZTA 4F3VA 1OXJA 3ZYQA 1E7VA 3V30A 3GW4A 2DBAA 5LP0A 1SZ9A 3QWVA 3R9MA 4E6HA 1DNPA 2ILRA 3PZ3A 5FTPA 4FP7A 1E8YA 4EHMA 4ZHBA 3TG5A 1EYHA 1P5QA 5ITZF 3ESLA 1TYQG 3ZYKA 1WG0A 3QDNA 4G24A 3GZ2A 5JJ6A 3SFYA 4ANVA 3FTZA 4U7EB 2MYOA 3B7BA 3Q7FA 3Q15A 3K9IA 3DRAA 1S63A 4APOA 1H0AA 3R7QA 3CR3A 4AY5A 3UT8A 4FC8A 4AOFA 4AV7A 3HXDA 3LVQE 5ENPD 3CIAA 1A17A 2AJAA 4GB9A 1N52A 4F53A 2HE0A 5CMYA 1UG3A 3SNXA 4DLQA 3U9WA 2LAHA 4N2SA 2BKKB 4ILGA 4Y6WA 3ASOE 4DX5D 4FADA 3CVXA 1K8KG 4OAUC 2UY1A 2OV8A 3FUDA 3APDA 4YNDA 4PS7A 1S0PA 3UIOC 3CEQA 4CDNA 2WXNA 4DUIA 3FU0A 1PAQA 3WG7E 3EJNA 1MHQA 4RQIA 2F0YA 3TWSA 2VYIA 4G11A 3NZUA 2EIME 4KMOA 4HRNA 1H6KA 5EYPF 1QYMA 4GZCA 3QKYA 5EIDA 4GMRA 3FP3A 1MX2A 2WXLA 3TWRA 2X6KA 3AS8A 3HVEB 3NBNB 2BF0X 1H6OA 3SO8A 4ABNA 4Q69A 2E0IA 3APCA 1TN6A 1BU9A 4I1OB 1MJ0A 4MRUA 4CDRA 3BG1B 4N3AA 5C1DA 4WNGA 4UWGA 1ZBPA 3ABLE 3UX4A 3CHMA 2X6JA 3G2TA 3S7FA 3J5QB 3FWVA 3JXJA 3AG2E 4UI9K 1NA0A 2WPVA 3L6AA 4U96D 3LCAA 5KNGA 1SA4A 4XE0A 4LNBA 2RFMA 4G23A 2WXGA 1SW6A 3FH5A 4UUCA 3CSTA 4KT6B 4XEIG 5KCMA 2LO6A 3UI2A 2QYJA 3UXGA 2XENA 4WNDA 3KS2A 3BG0B 4HLEA 3HIZA 1VDYA 1FT1A 1D9SA 4RG6A 2Y4TA 1OCCE 4XX5A 3U4TA 5AN8A 5FINA 1U2VG 3L22A 2FO7A 3Q49B 3LJNA 4NQ0A 1N9AA 2IQCA 3CLJA 3DSWA 3PNTB 1HE8A 3ZHEB 4U07A 1WDYA 4WWNA 3HXBA 1OCZE 3ASHA 1IHBA 2B6CA 4CCAA 1B89A 5JMND 5G05C 5H7PA 4DPRA 3FTXA 4AVXA 3SY2A 3ZNGA 2WQ6A 3WXXA 3DEOA 3AG3E 5BXUA 4CDMA 3C3RA 3PUKA 3I4GA 3V79K 3B95A 3D9NA 3RU0A 2RG8A 4I6EA 3URZA 5FZQA 5T3RA 5KJLA 4GTRA 3RK6A 3FTVA 3NQPA 5JHAA 2V5QC 4GTQA 4JW1A 2HO1A 4JHJA 1Z6TA 2V5FA 3PEUB 3SBTB 4APFA 3CQCB 3UT7A 5HI7A 3NB2A 5A23A 2LXLA 4BT8A 3O48A 5JJ7A 4G1TA 5KJKA 4GZDA 4EBAA 4JA9A 3UT4A 1OCRE 1D8EA 3X2QE 2KXPC 2H6HA 4GZ3A 2XPZA 4C9BB 4JL0A 4K5AB 1JUQA 3NZSA 2AWIA 2R2LA 2IFUA 5FIOA 5ARGA 4GTSA 4IULA 2EIJE 3DXKG 3T8MA 3JUIA 2ETCA 5ANRA 3ONKA 3EDTB 2FEZA 1N0QA 3EHMA 4HI9A 3TL5A 3EHRA 5FT9A 2F37A 3Q73A 3UKUG 4K03A 4CEMA 4KVMA 4PH4B 3D9IA 2V4HC 4JHRA 3ZXPA 2FBNA 2KZTB 3TWWA 5E75A 3E4BA 1NZNA 2XGSA 4HVBA 2Y0BG 3RO2A 4GPMA 4FU3A 4ILHB 1NP7A 4WNEA 2I1KA 3B7TA 3VTXA 2VGXB 3PZ1A 1JWGA 4Z68A 1TN8A 2DZOA 1Z3XA 3V31A 1V55E 5IY5E 4GZ5A 5AIJA 3KEZA 2VSYA 3CK7A 4JPSA 4I9CA 5FZRA 2H6FA 3RRMB 5C2YA 3CV0A 3U3WA 2ZISA 4PS3A 5EYLA 1HF8A 1HG5A 4Y6CA 3FY4A 5FQ6A 1XGWA 4FULA 1BI8B 5FQ7A 3KSLA 4NACA 5G2NA 1JWFA 3G2WA 3FTUA 1NL4A 4BETA 2XGMA 2ZU6B 2CG3A 4GCNA 4KVOA 5D0QD 4KYOB 2IJGX 3ONLA 3AS4A 3MGBA 1V54E 3UKRG 3AU5A 4J7WA 3KAEA 1IYGA 4I1AA 5G05J 3KSQA 2WXMA 4O1OA 2GRPB 2F8XK 3TGOA 3ZW3A 5ENTD 4BTBA 4JZYA 4WWOA 3T8KA 5BT1A 3MKQB 2GRMA 3MV2B 1KZPA 3CVNA 2UY1B 3E37A 2P2CP 4LCTA 4EZJA 3ZFWA 1KT0A 4G2VA 1TEZA 3NAWA 4LERA 1FT2A 4DX6D 2IU1A 3D9MA 4I6GA 3MKRA 2Y3AA 3JQ0A 3BEEA 3FTSA 5CBNA 1TR4A 3MYVA 4ATZD 2X6HA 3D9LA 2AW6A 4UWHA 3ZKJA 5J90A 4ANWA 3B7SA 4DRXE 4GAAA 2ZGDA 4DI3A 3MZLB 3SGHA 2FI7A 2Y4UA 4DX2A 3LJ3A 2I9CA 5KJNA 2DWZA 4O6FA 2CHZA 2C2LA 3UM3A 5BUZA 2X38A 4EECA 2VSXE 3L13A 4CGVA 5D0OD 4HRMB 4HRLA 3SHFA 4OAVB 5KJMA 4GTTA 3FEXA 2DZNA 2NYJA 3S7BA 3T5XA 3DSUA 4UWFA 3RAUA 3CKBA 4ACLA 2AXZA 1OUVA 3JXIA 5BV1A 3DSTA 3BQOA 4MS6A 3E33A 5T8IA 2GW1A 3PZ4A 4MBGA 2KBXA 5A7DB 2WXQA 1N4SA 4O60A 3FDHA 1O1RA 2AXVA 1UJKA 5FJYA 3CVVA 2CHWA 4H7XA 4B94A 5AQ7A 4L9PA 1BI7B 3FH7A 3JQ1A 4I2WA 1KZOA 2NXPA 2P9UG 1OWOA 3SF4A 4A3TA 4XZ4A 1OY3D 3CHOA 4LEUA 4U8YD 3ZYMA 5J08A 3ULEG 1WM5A 2P9PG 4PS8A 2JLBA 3CQGB 4TV3A 3UM2A 3UUXA 3ZPJA 2BKGA 2P9NG 1E7UA 3OTNA 4UWKA 3SZ7A 4XI9A 3KEAA 3ZU7B 3HXEA 2WXIA 2KC7A 5CCMA 2BUGA 2EQXA 2BEDA 5BV0A 4N39A 5G55A 2OEVA 3T5VA 2GRRB 2WMOA 5AQAA 4K5BA 3P2BA 2PQRA 4F1PA 2LSVA 3PUJA 3OXLA 3PREA 1N0RA 1H2UA 5ENRD 3R9AB 5ANLA 1DCQA 3AAAC 3TJPA 2I1JA 5FZSA 3AG4E 2L0IA 3D9JA 3Q7AA 3GYZA 4JXTA 1ZB1A 3TWUA 3LS8A 4NRHB 5CEAA 2NSZA 2I2OA 4U04A 2CFUA 4CT4A 5LX8A 1SQMA 4C0EA 1HO8A 5CRUA 2GGFA 1BPOA 1O1SA 2PZIA 3SI5A 3DSSA 4YDYA 1PY1A 3CHPA 5FQ4A 3QB2A 4U8HA 5FQ8A 4ANUA 3EHNA 4HOSA 4V3IA 2VSNA 3G2VA 4ANXA 4GMLA 4YVOA 5KBAA 3RIBA 3LY9A 2DYRE 3IKOB 3FUNA 4JB8P 4BTAA 3ZVVA 4GYWA 4N5CA 5CCLA 4TXPA 4MKTA 4K0RA 3D9KA 4HFGA 3CVLA 4R7LA 2R17C 1TNZA 2HM8A 2XS8A 2IOLA 5CHEE 3D9OA 3LKUA 4BY6A 4BX9A 4J8FA 4P29A 3HYMB 2JABA 2A4ZA 4JA7A 4U0UA 5AJLA 1WAO1 2ZGGA 5HRYA 2IF4A 1EDUA 3QJZA 4AY6A 2PM6A 5G04C 3ASFA 2B0OE 2WXOA 2VGEA 1N4QA 2M63A 4J8DA 2H6IA 4M3OA 5B1BE 3D9PA 2XHEA 3EUVA 3MX3A 3LPZA 4Q96A 3S7JA 3RSEG 4N3CA 3DXMG 4CRWA 3GZSA 4OYSA 5AAOA 4D10C 4YDOA 1L5JA 4I2ZA 1BLXB 2BTDA 3QNKA 5M72A 3G2UA 3ZEFA 1HFAA 4I17A 4J8EA 4TRQA 2OVBA 2YNQA 1E96B 2LUHA 3DEPA 3CHQA 4BFRA 3DBSA 4BT9A 1NFIE 2Q7FA 2WB2A 4YDWA 2C0LA 5CRVA 1FCHA 1HU3A 3QAQA 1UN9A 3CK9A 2IY0C 1PC2A 5HQ8A 3L54A 3I3NA 1FVFA 5B1AE 2HYZA 1N95A 3TXNA 2FO1E 4GCOA 1UOHA 1TNYA 3IV0A 2VGYA 2DYSE 4QQIA 1QZ2A 4I9EA 5JA4D 3E30A 2DIWA 3LVRE 1IQRA 2XRYA 3UPVA 4B8AA 1H2VC 3Q47B 4XIFA 3RRUA 4UI9C 4J0UA 2XS1A 4G8LA 2WXKA 3FU3A 4EZKA 1SZAA 1H6PA 4FJYA 3NOCD 3UTMA 4U0SA 2WQ7A 3AJIA 5AARA 2ZXWE 2WXJA 1EF1C 3CGHA 4I1MA 5AJDA 3RKVA 3NOGD 3ZXSA 3L08A 2YHEA 2AXUA 2YINA 3BUAA 4XKCA 5EX0A 3IXEA 3TWQA 1TN7A 1MQSA 5EDSA 3DPYA 2R03A 1JCRA 4J6IA 3PEVB 3MA5A 1AP7A 2YHCA 1K1AA 4DK5A 3FUKA 1K1BA 3B7RL 1KT1A 3AS5A 1LD7A 3ISMC 2EINE 2GRQB 3BU8A 2QYUA 2C0MA 1E8ZA 3ZIMA 4UQZA 2QZAA 4HOQA 4NURA 1QBQA 4FHKA 2GROB 5LFAA 3IEGA 4UQYA 3V2OA 2YQ8A 4W9RA 3TG4A 3RRNB 4DLOA 1TNBA 1KPSB 3ZUVB 4C48B 1LF8A 3ULYA 4JEUA 2WXPA 2LAIA 1ZU2A 3U66A 4JEHA 3C3QA 3G2SA 5CEDB 2WXRA 3RO3A 2CFZA 1S64A 3FULA 1NI1A 5G04J 2PNNA 5AENA 3TXMA 4KBQA 3PS6A 5EIBE 4XI0A 1E90A 5ARFA 2ETBA 1LTXA 3HHMA 1O1TA 4HS2A 1OWLA 2J09A 2PL2A 1DC2A 2L6JA 4XKBA 1Y6IA 2XCBA 2MHKA 3FU6A 2JEKA 3SQVA 2V4LA 3EIQC 2J08A 3J5PA 4JHKA 4TUUA 3PZ2A 4DX1A 3FTWA 3AG1E 2P9IG 4K5CA 3ZYLA 1GW6A 2J9QA 2PM7A 4M7CA 3S2AA 4AM9A 5DIZA 4GYOA 2XRZA 3FUEA 2KCVA 4B89A 5BXOA 2F8YA 4JD2G 3FU5A 3APFA 3FUMA 5LCWC 4RLYA 2OCCE 3PRZA 5ENQD 1N11A 4U0ZA 3MJWA 5DBKA 2EIKE 4A55A 2E2EA 4AJWA 4HOTA 4GMJA 4UI9J 2WXHA 3ABME 4Q94A 5HS0A 3JUEA 5AYWD 4GA2A 3CVPA 1XNFA 2DVWA 2QY7A 3QWWA 3C72A 2Y1LE 2LSUA 1N94A 2ETAA 2VQ2A 4RVBA 1O5MA 3IHVA 1NA3A 2J49A 3IHYA 4U95D 3HXCA 4BWRA 2VGXA 1TNUA 4HOUA 4G26A 1UW4B 3ABKE 4GYYA 1OT8A 3SFXA 4RG9A 2GRLA 4EBAG 3FFLA 4OVVA 1MX6A 3LYAA 3C3OA 2RKKA 3FEYA 5ENSD 2XPIA 2KATA 1YYHA 3ESKA 3HXFA 3TWTA 2V8SE 1DVPA 4FA6A 5AQBA 5JJTA 3FUJA 3ZGQA 4G25A 1HXIA 2L0TB 1AWCB 3QOUA 3LY7A 2XPYA 4I6JA 3FUFA 4F1SA 1H2TC 1D8DA 1EPUA 4AP2A 5EILA 4CT0A 2KCLA 3Q75A 4UWLA 1FVHA 4A1GA 5CECB 3DSVA
chains in the Genus database with same CATH topology
3JXIA 4J7WA 4HI9A 5EIBE 5AAOA 2MYOA 3B7BA 3Q9UC 1BLXB 4O1PA 3V2XA 3EHRA 2DVWA 2ETBA 4O1OA 2F37A 3IXEA 3TWQA 2KBXA 2F8XK 1MX4A 2Y1LE 4O60A 4QFVA 5D66A 5ENTD 1S70B 1BD8A 2ETAA 1AP7A 4HLLA 1IKND 1DC2A 2V5QC 3J5QB 5CBOA 3T8KA 3TWVA 1K1AA 3JXJA 5EN5D 2V4HC 3DEPA 4YDYA 5ENPD 1K1BA 2J8SD 4LG6A 3W9FA 4U96D 5KNGA 5AQ7A 3TWWA 5KBAA 1NFIE 1BI7B 3HG0D 2AJAA 2RFMA 5KNHD 1SW6A 3C5RA 4U95D 2HE0A 3J5PA 4DX7D 4JB8P 4YDWA 2P2CP 4F6RD 2L6BA 3T9KA 2BKKB 4UUCA 4DX1A 2Y0BG 4HB5A 1OY3D 3Q9NC 4DX5D 3UI2A 4U8YD 4GPMA 2QYJA 5ENOD 4HNAD 1OT8A 3UXGA 4DX6D 5CECB 1SVXA 4TUMA 4OAUC 1G3NB 4K5CA 2XZTG 2XENA 2XZDG 4Z68A 1YCSB 2BKGA 4A63B 5AQ9A 4J8YA 5CBNA 1MX6A 1TR4A 2DZOA 3EU9A 4ATZD 4BESA 3V31A 3V30A 2FO1E 3KEAA 1IXVA 1UOHA 2XEEA 5ENSD 3ZU7B 3V2OA 2XEHA 1D9SA 3ZKJA 4QQIA 4CYMD 5KWDA 4N5QA 1K3ZD 1YYHA 4HBDA 4DUIA 4G8KA 4DRXE 2JABA 5BXOA 5AN8A 5JA4D 2F8YA 2ZGDA 5FINA 2KXPC 3ZUVB 5AQAA 3TWTA 2ZGGA 4C48B 3LJNA 5EYLA 4K5BA 4ZHBA 5HRYA 4DX2A 4HI8A 3TWSA 5AQBA 2DWZA 5ITZF 4G8LA 4ZFHA 1WDYA 1MYOA 4K5AB 2B0OE 4F1PA 3F6QA 1BI8B 4HRNA 2QC9A 1IHBA 4LSZE 1AWCB 2VGEA 3NOCD 4RLYA 2A5EA 4LNUD 5EYPF 3UTMA 4BSZB 5CEDB 1QYMA 3AJIA 5ENQD 1N0RA 5EIDA 5HKPA 1N11A 5JMND 5ENRD 4GMRA 4HRMB 1DCQA 1MX2A 3AAAC 2RFAA 5FIOA 5CERB 3HRAA 5AARA 5EILA 3TWRA 4HRLA 3ZNGA 4BETA 4OAVB 3W9GA 3NBNB 1WG0A 4BERA 3DEOA 2DZNA 2NYJA 3SO8A 3TWUA 5BXUA 4CZ2D 4U8VD 4NIKA 4HQDA 4BEPA 2ETCA 3EHQA 3JUEA 2PNNA 5CEAA 3NOGD 1A5EA 3D9HA 5HS0A 3V79K 1BU9A 3B95A 1MJ0A 4B93B 3TWXA 1YMPA 1N0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXI A;  4J7W A;  4HI9 A;  5EIB E;  5AAO A;  2MYO A;  3B7B A;  3Q9U C;  1BLX B;  4O1P A;  3V2X A;  3EHR A;  2DVW A;  2ETB A;  4O1O A;  2F37 A;  3IXE A;  3TWQ A;  2KBX A;  2F8X K;  1MX4 A;  2Y1L E;  4O60 A;  4QFV A;  5D66 A;  5ENT D;  1S70 B;  1BD8 A;  2ETA A;  1AP7 A;  4HLL A;  1IKN D;  1DC2 A;  2V5Q C;  3J5Q B;  5CBO A;  3T8K A;  3TWV A;  1K1A A;  3JXJ A;  5EN5 D;  2V4H C;  3DEP A;  4YDY A;  5ENP D;  1K1B A;  2J8S D;  4LG6 A;  3W9F A;  4U96 D;  5KNG A;  5AQ7 A;  3TWW A;  5KBA A;  1NFI E;  1BI7 B;  3HG0 D;  2AJA A;  2RFM A;  5KNH D;  1SW6 A;  3C5R A;  4U95 D;  2HE0 A;  3J5P A;  4DX7 D;  4JB8 P;  4YDW A;  2P2C P;  4F6R D;  2L6B A;  3T9K A;  2BKK B;  4UUC A;  4DX1 A;  2Y0B G;  4HB5 A;  1OY3 D;  3Q9N C;  4DX5 D;  3UI2 A;  4U8Y D;  4GPM A;  2QYJ A;  5ENO D;  4HNA D;  1OT8 A;  3UXG A;  4DX6 D;  5CEC B;  1SVX A;  4TUM A;  4OAU C;  1G3N B;  4K5C A;  2XZT G;  2XEN A;  2XZD G;  4Z68 A;  1YCS B;  2BKG A;  4A63 B;  5AQ9 A;  4J8Y A;  5CBN A;  1MX6 A;  1TR4 A;  2DZO A;  3EU9 A;  4ATZ D;  4BES A;  3V31 A;  3V30 A;  2FO1 E;  3KEA A;  1IXV A;  1UOH A;  2XEE A;  5ENS D;  3ZU7 B;  3V2O A;  2XEH A;  1D9S A;  3ZKJ A;  4QQI A;  4CYM D;  5KWD A;  4N5Q A;  1K3Z D;  1YYH A;  4HBD A;  4DUI A;  4G8K A;  4DRX E;  2JAB A;  5BXO A;  5AN8 A;  5JA4 D;  2F8Y A;  2ZGD A;  5FIN A;  2KXP C;  3ZUV B;  5AQA A;  3TWT A;  2ZGG A;  4C48 B;  3LJN A;  5EYL A;  4K5B A;  4ZHB A;  5HRY A;  4DX2 A;  4HI8 A;  3TWS A;  5AQB A;  2DWZ A;  5ITZ F;  4G8L A;  4ZFH A;  1WDY A;  1MYO A;  4K5A B;  2B0O E;  4F1P A;  3F6Q A;  1BI8 B;  4HRN A;  2QC9 A;  1IHB A;  4LSZ E;  1AWC B;  2VGE A;  3NOC D;  4RLY A;  2A5E A;  4LNU D;  5EYP F;  3UTM A;  4BSZ B;  5CED B;  1QYM A;  3AJI A;  5ENQ D;  1N0R A;  5EID A;  5HKP A;  1N11 A;  5JMN D;  5ENR D;  4GMR A;  4HRM B;  1DCQ A;  1MX2 A;  3AAA C;  2RFA A;  5FIO A;  5CER B;  3HRA A;  5AAR A;  5EIL A;  3TWR A;  4HRL A;  3ZNG A;  4BET A;  4OAV B;  3W9G A;  3NBN B;  1WG0 A;  4BER A;  3DEO A;  2DZN A;  2NYJ A;  3SO8 A;  3TWU A;  5BXU A;  4CZ2 D;  4U8V D;  4NIK A;  4HQD A;  4BEP A;  2ETC A;  3EHQ A;  3JUE A;  2PNN A;  5CEA A;  3NOG D;  1A5E A;  3D9H A;  5HS0 A;  3V79 K;  1BU9 A;  3B95 A;  1MJ0 A;  4B93 B;  3TWX A;  1YMP A;  1N0Q A; 
#chains in the Genus database with same CATH topology
 3L16 A;  2VSO E;  3B13 A;  2UWJ G;  4O1P A;  3PE4 A;  1TJC A;  3MKQ A;  1X5B A;  3QK0 A;  4WNF A;  3LDZ A;  3TWV A;  1OWP A;  1RW2 A;  2VTB A;  3CVY A;  4WWP A;  1OCO E;  4YVQ C;  3DWL G;  3CKC A;  4LRZ A;  3OXG A;  3DPD A;  3UIP C;  3T9K A;  1E8X A;  3E32 A;  3QAR A;  4HNA D;  1TJF A;  3R7R A;  1SA5 A;  4N2Q A;  2PQN A;  5AQ9 A;  4L23 A;  3EU9 A;  1N4R A;  1W3B A;  4OVU A;  3ENE A;  3JCK C;  2XEH A;  4CGW A;  1E8W A;  3JYS A;  3S7D A;  4CYM D;  4H7Y A;  1ELW A;  5BNW A;  2XGO A;  4EQF A;  3O4Z A;  4KZC A;  3FUI A;  3E34 A;  5BW8 C;  3F6Q A;  5CMW A;  3PH0 C;  5CER B;  3UIN C;  3HRA A;  1HZ4 A;  5FWQ A;  3VLF A;  1QQE A;  4TXQ A;  4CZ2 D;  3D9H A;  4U63 A;  4BX8 A;  5LCW J;  4N3B A;  3CHR A;  4IRU A;  1IQU A;  1MX4 A;  1BD8 A;  5CBO A;  4RSY A;  3VLD A;  1INZ A;  2L9B A;  3CVW A;  1ELR A;  2KCK A;  4LG6 A;  2AVP A;  2WM9 A;  3U64 A;  3KD7 A;  3GZ1 A;  2P9K G;  3P1U A;  2P9S G;  4LNG A;  4YDE A;  1QNF A;  5ENO D;  1SVX A;  4TUM A;  1UJJ A;  4FLB A;  4L2Y A;  2I6H A;  1Y8M A;  2LXM A;  3MEK A;  4BES A;  3FUH A;  2J4D A;  3SFZ A;  2IO2 C;  2Y69 E;  4FLH A;  2WXF A;  2WMN A;  3QC1 A;  2R5S A;  1K3Z D;  1H19 A;  2XCC A;  3C98 A;  1YA0 A;  2OOE A;  4GTV A;  3HDX A;  3LEW A;  2XEV A;  2HR2 A;  3AU4 A;  4WAF A;  4HOR A;  4LSZ E;  5E76 A;  3L17 A;  5T4Y A;  1X81 A;  2OVF A;  1OWM A;  3ASN E;  1TNO A;  3EIJ A;  3PE3 A;  1RZ4 A;  3N71 A;  3DSX A;  4HQD A;  2IOS A;  4BEP A;  1FPP A;  2A5U A;  4J8Y A;  4B93 B;  3LXU X;  2R59 A;  4PDX A;  4B0Z A;  3HVE A;  1KLX A;  2WVI A;  1U3D A;  5BPP A;  2DCP A;  5D66 A;  3TAX A;  3Q4A B;  1IKN D;  1LD8 A;  4JC8 A;  3SD5 A;  1JPL A;  5ENN A;  3ZRH A;  4EZL A;  2XQ0 A;  2J8S D;  3PDN A;  4JVS A;  3FH8 A;  5KNH D;  4URK A;  3C5R A;  4DX7 D;  1HH8 A;  4GA1 A;  4BSX A;  4L1B A;  2L6B A;  4GA0 A;  3D3M A;  3ULQ A;  4EPZ A;  1G3N B;  2P9L G;  3ML8 A;  1JCS A;  3UM0 A;  4A63 B;  1N4P A;  3L9T A;  1OWN A;  3ZN3 A;  4A3V A;  2XEE A;  3FTY A;  5A6C A;  4L7T A;  2KM4 A;  5KWD A;  4HBD A;  3L82 A;  2FUL A;  4G8K A;  2R05 A;  3Q78 A;  4LUN U;  1HG2 A;  2J4B A;  3ASG A;  1MYO A;  2QC9 A;  3ASD A;  2IO3 C;  3SBS A;  3OXF A;  4IYP A;  2A5E A;  4LNU D;  1MZC A;  3MV3 B;  2MRI A;  2H6G A;  3ZHE A;  2QFC A;  3I5P A;  2ION A;  4U8V D;  3IBE A;  3EHQ A;  4AEZ C;  3OAW A;  4ILI A;  3RJV A;  2MOW A;  2WQH A;  3ML9 A;  1Q2Z A;  4KZ0 A;  4PUC A;  4ACK A;  4A1S A;  2LNI A;  5EN5 D;  3VLE A;  2V0P A;  3CHS A;  4MLP A;  3VTY A;  4GPK A;  2P58 C;  3HG0 D;  3UQ3 A;  2OEW A;  5B3S E;  3MCX A;  2GRN B;  3CK8 A;  2EIL E;  4J8S A;  4TXR A;  5D2M C;  4B8C B;  4HB5 A;  3UMV A;  4GZ6 A;  1Z3Y A;  1WY6 A;  2NC9 A;  4AXH A;  5LOZ A;  2XZT G;  2XZD G;  1YCS B;  3CVU A;  1IXV A;  4I43 A;  2J07 A;  2RD0 A;  2X6F A;  4GTO A;  3CVQ A;  4N5Q A;  2R02 A;  3Q5M A;  3QWP A;  3B7U X;  4ATG A;  4L2L A;  4HI8 A;  2X3M A;  3NF1 A;  3Q79 A;  1UN8 A;  4ZFH A;  4AIF A;  4X8Q A;  4BSZ B;  5HKP A;  1U3C A;  3EU5 A;  5EKQ D;  2RFA A;  2FF4 A;  2IEJ A;  3W9G A;  4BER A;  3UM1 A;  1JCQ A;  1Z5S C;  5EX3 A;  4FHJ A;  4NIK A;  1DCE A;  4C0M A;  4F7A A;  2OND A;  1A5E A;  3TWX A;  1YMP A;  4GTP A;  4IN3 B;  4KXK B;  4GU5 A;  3Q9U C;  2CHX A;  2VTB B;  3V2X A;  3FHE A;  3PNL B;  4HXI A;  2VJ8 A;  4QFV A;  2ZIR A;  1S70 B;  3PVL A;  4HLL A;  2X6I A;  1HS6 A;  5JHB A;  4GTM A;  3CSF A;  4E85 A;  3W9F A;  4DJA A;  3I4R B;  1N54 A;  1ELK A;  1IHG A;  4FJZ A;  3PZD A;  3LY8 A;  2CG2 A;  1HX8 A;  4ME2 A;  4F6R D;  4WUY A;  4UQX A;  3Q9N C;  4DI4 A;  2KZT A;  4F3V A;  1OXJ A;  3ZYQ A;  1E7V A;  3V30 A;  3GW4 A;  2DBA A;  5LP0 A;  1SZ9 A;  3QWV A;  3R9M A;  4E6H A;  1DNP A;  2ILR A;  3PZ3 A;  5FTP A;  4FP7 A;  1E8Y A;  4EHM A;  4ZHB A;  3TG5 A;  1EYH A;  1P5Q A;  5ITZ F;  3ESL A;  1TYQ G;  3ZYK A;  1WG0 A;  3QDN A;  4G24 A;  3GZ2 A;  5JJ6 A;  3SFY A;  4ANV A;  3FTZ A;  4U7E B;  2MYO A;  3B7B A;  3Q7F A;  3Q15 A;  3K9I A;  3DRA A;  1S63 A;  4APO A;  1H0A A;  3R7Q A;  3CR3 A;  4AY5 A;  3UT8 A;  4FC8 A;  4AOF A;  4AV7 A;  3HXD A;  3LVQ E;  5ENP D;  3CIA A;  1A17 A;  2AJA A;  4GB9 A;  1N52 A;  4F53 A;  2HE0 A;  5CMY A;  1UG3 A;  3SNX A;  4DLQ A;  3U9W A;  2LAH A;  4N2S A;  2BKK B;  4ILG A;  4Y6W A;  3ASO E;  4DX5 D;  4FAD A;  3CVX A;  1K8K G;  4OAU C;  2UY1 A;  2OV8 A;  3FUD A;  3APD A;  4YND A;  4PS7 A;  1S0P A;  3UIO C;  3CEQ A;  4CDN A;  2WXN A;  4DUI A;  3FU0 A;  1PAQ A;  3WG7 E;  3EJN A;  1MHQ A;  4RQI A;  2F0Y A;  3TWS A;  2VYI A;  4G11 A;  3NZU A;  2EIM E;  4KMO A;  4HRN A;  1H6K A;  5EYP F;  1QYM A;  4GZC A;  3QKY A;  5EID A;  4GMR A;  3FP3 A;  1MX2 A;  2WXL A;  3TWR A;  2X6K A;  3AS8 A;  3HVE B;  3NBN B;  2BF0 X;  1H6O A;  3SO8 A;  4ABN A;  4Q69 A;  2E0I A;  3APC A;  1TN6 A;  1BU9 A;  4I1O B;  1MJ0 A;  4MRU A;  4CDR A;  3BG1 B;  4N3A A;  5C1D A;  4WNG A;  4UWG A;  1ZBP A;  3ABL E;  3UX4 A;  3CHM A;  2X6J A;  3G2T A;  3S7F A;  3J5Q B;  3FWV A;  3JXJ A;  3AG2 E;  4UI9 K;  1NA0 A;  2WPV A;  3L6A A;  4U96 D;  3LCA A;  5KNG A;  1SA4 A;  4XE0 A;  4LNB A;  2RFM A;  4G23 A;  2WXG A;  1SW6 A;  3FH5 A;  4UUC A;  3CST A;  4KT6 B;  4XEI G;  5KCM A;  2LO6 A;  3UI2 A;  2QYJ A;  3UXG A;  2XEN A;  4WND A;  3KS2 A;  3BG0 B;  4HLE A;  3HIZ A;  1VDY A;  1FT1 A;  1D9S A;  4RG6 A;  2Y4T A;  1OCC E;  4XX5 A;  3U4T A;  5AN8 A;  5FIN A;  1U2V G;  3L22 A;  2FO7 A;  3Q49 B;  3LJN A;  4NQ0 A;  1N9A A;  2IQC A;  3CLJ A;  3DSW A;  3PNT B;  1HE8 A;  3ZHE B;  4U07 A;  1WDY A;  4WWN A;  3HXB A;  1OCZ E;  3ASH A;  1IHB A;  2B6C A;  4CCA A;  1B89 A;  5JMN D;  5G05 C;  5H7P A;  4DPR A;  3FTX A;  4AVX A;  3SY2 A;  3ZNG A;  2WQ6 A;  3WXX A;  3DEO A;  3AG3 E;  5BXU A;  4CDM A;  3C3R A;  3PUK A;  3I4G A;  3V79 K;  3B95 A;  3D9N A;  3RU0 A;  2RG8 A;  4I6E A;  3URZ A;  5FZQ A;  5T3R A;  5KJL A;  4GTR A;  3RK6 A;  3FTV A;  3NQP A;  5JHA A;  2V5Q C;  4GTQ A;  4JW1 A;  2HO1 A;  4JHJ A;  1Z6T A;  2V5F A;  3PEU B;  3SBT B;  4APF A;  3CQC B;  3UT7 A;  5HI7 A;  3NB2 A;  5A23 A;  2LXL A;  4BT8 A;  3O48 A;  5JJ7 A;  4G1T A;  5KJK A;  4GZD A;  4EBA A;  4JA9 A;  3UT4 A;  1OCR E;  1D8E A;  3X2Q E;  2KXP C;  2H6H A;  4GZ3 A;  2XPZ A;  4C9B B;  4JL0 A;  4K5A B;  1JUQ A;  3NZS A;  2AWI A;  2R2L A;  2IFU A;  5FIO A;  5ARG A;  4GTS A;  4IUL A;  2EIJ E;  3DXK G;  3T8M A;  3JUI A;  2ETC A;  5ANR A;  3ONK A;  3EDT B;  2FEZ A;  1N0Q A;  3EHM A;  4HI9 A;  3TL5 A;  3EHR A;  5FT9 A;  2F37 A;  3Q73 A;  3UKU G;  4K03 A;  4CEM A;  4KVM A;  4PH4 B;  3D9I A;  2V4H C;  4JHR A;  3ZXP A;  2FBN A;  2KZT B;  3TWW A;  5E75 A;  3E4B A;  1NZN A;  2XGS A;  4HVB A;  2Y0B G;  3RO2 A;  4GPM A;  4FU3 A;  4ILH B;  1NP7 A;  4WNE A;  2I1K A;  3B7T A;  3VTX A;  2VGX B;  3PZ1 A;  1JWG A;  4Z68 A;  1TN8 A;  2DZO A;  1Z3X A;  3V31 A;  1V55 E;  5IY5 E;  4GZ5 A;  5AIJ A;  3KEZ A;  2VSY A;  3CK7 A;  4JPS A;  4I9C A;  5FZR A;  2H6F A;  3RRM B;  5C2Y A;  3CV0 A;  3U3W A;  2ZIS A;  4PS3 A;  5EYL A;  1HF8 A;  1HG5 A;  4Y6C A;  3FY4 A;  5FQ6 A;  1XGW A;  4FUL A;  1BI8 B;  5FQ7 A;  3KSL A;  4NAC A;  5G2N A;  1JWF A;  3G2W A;  3FTU A;  1NL4 A;  4BET A;  2XGM A;  2ZU6 B;  2CG3 A;  4GCN A;  4KVO A;  5D0Q D;  4KYO B;  2IJG X;  3ONL A;  3AS4 A;  3MGB A;  1V54 E;  3UKR G;  3AU5 A;  4J7W A;  3KAE A;  1IYG A;  4I1A A;  5G05 J;  3KSQ A;  2WXM A;  4O1O A;  2GRP B;  2F8X K;  3TGO A;  3ZW3 A;  5ENT D;  4BTB A;  4JZY A;  4WWO A;  3T8K A;  5BT1 A;  3MKQ B;  2GRM A;  3MV2 B;  1KZP A;  3CVN A;  2UY1 B;  3E37 A;  2P2C P;  4LCT A;  4EZJ A;  3ZFW A;  1KT0 A;  4G2V A;  1TEZ A;  3NAW A;  4LER A;  1FT2 A;  4DX6 D;  2IU1 A;  3D9M A;  4I6G A;  3MKR A;  2Y3A A;  3JQ0 A;  3BEE A;  3FTS A;  5CBN A;  1TR4 A;  3MYV A;  4ATZ D;  2X6H A;  3D9L A;  2AW6 A;  4UWH A;  3ZKJ A;  5J90 A;  4ANW A;  3B7S A;  4DRX E;  4GAA A;  2ZGD A;  4DI3 A;  3MZL B;  3SGH A;  2FI7 A;  2Y4U A;  4DX2 A;  3LJ3 A;  2I9C A;  5KJN A;  2DWZ A;  4O6F A;  2CHZ A;  2C2L A;  3UM3 A;  5BUZ A;  2X38 A;  4EEC A;  2VSX E;  3L13 A;  4CGV A;  5D0O D;  4HRM B;  4HRL A;  3SHF A;  4OAV B;  5KJM A;  4GTT A;  3FEX A;  2DZN A;  2NYJ A;  3S7B A;  3T5X A;  3DSU A;  4UWF A;  3RAU A;  3CKB A;  4ACL A;  2AXZ A;  1OUV A;  3JXI A;  5BV1 A;  3DST A;  3BQO A;  4MS6 A;  3E33 A;  5T8I A;  2GW1 A;  3PZ4 A;  4MBG A;  2KBX A;  5A7D B;  2WXQ A;  1N4S A;  4O60 A;  3FDH A;  1O1R A;  2AXV A;  1UJK A;  5FJY A;  3CVV A;  2CHW A;  4H7X A;  4B94 A;  5AQ7 A;  4L9P A;  1BI7 B;  3FH7 A;  3JQ1 A;  4I2W A;  1KZO A;  2NXP A;  2P9U G;  1OWO A;  3SF4 A;  4A3T A;  4XZ4 A;  1OY3 D;  3CHO A;  4LEU A;  4U8Y D;  3ZYM A;  5J08 A;  3ULE G;  1WM5 A;  2P9P G;  4PS8 A;  2JLB A;  3CQG B;  4TV3 A;  3UM2 A;  3UUX A;  3ZPJ A;  2BKG A;  2P9N G;  1E7U A;  3OTN A;  4UWK A;  3SZ7 A;  4XI9 A;  3KEA A;  3ZU7 B;  3HXE A;  2WXI A;  2KC7 A;  5CCM A;  2BUG A;  2EQX A;  2BED A;  5BV0 A;  4N39 A;  5G55 A;  2OEV A;  3T5V A;  2GRR B;  2WMO A;  5AQA A;  4K5B A;  3P2B A;  2PQR A;  4F1P A;  2LSV A;  3PUJ A;  3OXL A;  3PRE A;  1N0R A;  1H2U A;  5ENR D;  3R9A B;  5ANL A;  1DCQ A;  3AAA C;  3TJP A;  2I1J A;  5FZS A;  3AG4 E;  2L0I A;  3D9J A;  3Q7A A;  3GYZ A;  4JXT A;  1ZB1 A;  3TWU A;  3LS8 A;  4NRH B;  5CEA A;  2NSZ A;  2I2O A;  4U04 A;  2CFU A;  4CT4 A;  5LX8 A;  1SQM A;  4C0E A;  1HO8 A;  5CRU A;  2GGF A;  1BPO A;  1O1S A;  2PZI A;  3SI5 A;  3DSS A;  4YDY A;  1PY1 A;  3CHP A;  5FQ4 A;  3QB2 A;  4U8H A;  5FQ8 A;  4ANU A;  3EHN A;  4HOS A;  4V3I A;  2VSN A;  3G2V A;  4ANX A;  4GML A;  4YVO A;  5KBA A;  3RIB A;  3LY9 A;  2DYR E;  3IKO B;  3FUN A;  4JB8 P;  4BTA A;  3ZVV A;  4GYW A;  4N5C A;  5CCL A;  4TXP A;  4MKT A;  4K0R A;  3D9K A;  4HFG A;  3CVL A;  4R7L A;  2R17 C;  1TNZ A;  2HM8 A;  2XS8 A;  2IOL A;  5CHE E;  3D9O A;  3LKU A;  4BY6 A;  4BX9 A;  4J8F A;  4P29 A;  3HYM B;  2JAB A;  2A4Z A;  4JA7 A;  4U0U A;  5AJL A;  1WAO 1;  2ZGG A;  5HRY A;  2IF4 A;  1EDU A;  3QJZ A;  4AY6 A;  2PM6 A;  5G04 C;  3ASF A;  2B0O E;  2WXO A;  2VGE A;  1N4Q A;  2M63 A;  4J8D A;  2H6I A;  4M3O A;  5B1B E;  3D9P A;  2XHE A;  3EUV A;  3MX3 A;  3LPZ A;  4Q96 A;  3S7J A;  3RSE G;  4N3C A;  3DXM G;  4CRW A;  3GZS A;  4OYS A;  5AAO A;  4D10 C;  4YDO A;  1L5J A;  4I2Z A;  1BLX B;  2BTD A;  3QNK A;  5M72 A;  3G2U A;  3ZEF A;  1HFA A;  4I17 A;  4J8E A;  4TRQ A;  2OVB A;  2YNQ A;  1E96 B;  2LUH A;  3DEP A;  3CHQ A;  4BFR A;  3DBS A;  4BT9 A;  1NFI E;  2Q7F A;  2WB2 A;  4YDW A;  2C0L A;  5CRV A;  1FCH A;  1HU3 A;  3QAQ A;  1UN9 A;  3CK9 A;  2IY0 C;  1PC2 A;  5HQ8 A;  3L54 A;  3I3N A;  1FVF A;  5B1A E;  2HYZ A;  1N95 A;  3TXN A;  2FO1 E;  4GCO A;  1UOH A;  1TNY A;  3IV0 A;  2VGY A;  2DYS E;  4QQI A;  1QZ2 A;  4I9E A;  5JA4 D;  3E30 A;  2DIW A;  3LVR E;  1IQR A;  2XRY A;  3UPV A;  4B8A A;  1H2V C;  3Q47 B;  4XIF A;  3RRU A;  4UI9 C;  4J0U A;  2XS1 A;  4G8L A;  2WXK A;  3FU3 A;  4EZK A;  1SZA A;  1H6P A;  4FJY A;  3NOC D;  3UTM A;  4U0S A;  2WQ7 A;  3AJI A;  5AAR A;  2ZXW E;  2WXJ A;  1EF1 C;  3CGH A;  4I1M A;  5AJD A;  3RKV A;  3NOG D;  3ZXS A;  3L08 A;  2YHE A;  2AXU A;  2YIN A;  3BUA A;  4XKC A;  5EX0 A;  3IXE A;  3TWQ A;  1TN7 A;  1MQS A;  5EDS A;  3DPY A;  2R03 A;  1JCR A;  4J6I A;  3PEV B;  3MA5 A;  1AP7 A;  2YHC A;  1K1A A;  4DK5 A;  3FUK A;  1K1B A;  3B7R L;  1KT1 A;  3AS5 A;  1LD7 A;  3ISM C;  2EIN E;  2GRQ B;  3BU8 A;  2QYU A;  2C0M A;  1E8Z A;  3ZIM A;  4UQZ A;  2QZA A;  4HOQ A;  4NUR A;  1QBQ A;  4FHK A;  2GRO B;  5LFA A;  3IEG A;  4UQY A;  3V2O A;  2YQ8 A;  4W9R A;  3TG4 A;  3RRN B;  4DLO A;  1TNB A;  1KPS B;  3ZUV B;  4C48 B;  1LF8 A;  3ULY A;  4JEU A;  2WXP A;  2LAI A;  1ZU2 A;  3U66 A;  4JEH A;  3C3Q A;  3G2S A;  5CED B;  2WXR A;  3RO3 A;  2CFZ A;  1S64 A;  3FUL A;  1NI1 A;  5G04 J;  2PNN A;  5AEN A;  3TXM A;  4KBQ A;  3PS6 A;  5EIB E;  4XI0 A;  1E90 A;  5ARF A;  2ETB A;  1LTX A;  3HHM A;  1O1T A;  4HS2 A;  1OWL A;  2J09 A;  2PL2 A;  1DC2 A;  2L6J A;  4XKB A;  1Y6I A;  2XCB A;  2MHK A;  3FU6 A;  2JEK A;  3SQV A;  2V4L A;  3EIQ C;  2J08 A;  3J5P A;  4JHK A;  4TUU A;  3PZ2 A;  4DX1 A;  3FTW A;  3AG1 E;  2P9I G;  4K5C A;  3ZYL A;  1GW6 A;  2J9Q A;  2PM7 A;  4M7C A;  3S2A A;  4AM9 A;  5DIZ A;  4GYO A;  2XRZ A;  3FUE A;  2KCV A;  4B89 A;  5BXO A;  2F8Y A;  4JD2 G;  3FU5 A;  3APF A;  3FUM A;  5LCW C;  4RLY A;  2OCC E;  3PRZ A;  5ENQ D;  1N11 A;  4U0Z A;  3MJW A;  5DBK A;  2EIK E;  4A55 A;  2E2E A;  4AJW A;  4HOT A;  4GMJ A;  4UI9 J;  2WXH A;  3ABM E;  4Q94 A;  5HS0 A;  3JUE A;  5AYW D;  4GA2 A;  3CVP A;  1XNF A;  2DVW A;  2QY7 A;  3QWW A;  3C72 A;  2Y1L E;  2LSU A;  1N94 A;  2ETA A;  2VQ2 A;  4RVB A;  1O5M A;  3IHV A;  1NA3 A;  2J49 A;  3IHY A;  4U95 D;  3HXC A;  4BWR A;  2VGX A;  1TNU A;  4HOU A;  4G26 A;  1UW4 B;  3ABK E;  4GYY A;  1OT8 A;  3SFX A;  4RG9 A;  2GRL A;  4EBA G;  3FFL A;  4OVV A;  1MX6 A;  3LYA A;  3C3O A;  2RKK A;  3FEY A;  5ENS D;  2XPI A;  2KAT A;  1YYH A;  3ESK A;  3HXF A;  3TWT A;  2V8S E;  1DVP A;  4FA6 A;  5AQB A;  5JJT A;  3FUJ A;  3ZGQ A;  4G25 A;  1HXI A;  2L0T B;  1AWC B;  3QOU A;  3LY7 A;  2XPY A;  4I6J A;  3FUF A;  4F1S A;  1H2T C;  1D8D A;  1EPU A;  4AP2 A;  5EIL A;  4CT0 A;  2KCL A;  3Q75 A;  4UWL A;  1FVH A;  4A1G A;  5CEC B;  3DSV A; 
#chains in the Genus database with same CATH homology
 3JXI A;  4J7W A;  4HI9 A;  5EIB E;  5AAO A;  2MYO A;  3B7B A;  3Q9U C;  1BLX B;  4O1P A;  3V2X A;  3EHR A;  2DVW A;  2ETB A;  4O1O A;  2F37 A;  3IXE A;  3TWQ A;  2KBX A;  2F8X K;  1MX4 A;  2Y1L E;  4O60 A;  4QFV A;  5D66 A;  5ENT D;  1S70 B;  1BD8 A;  2ETA A;  1AP7 A;  4HLL A;  1IKN D;  1DC2 A;  2V5Q C;  3J5Q B;  5CBO A;  3T8K A;  3TWV A;  1K1A A;  3JXJ A;  5EN5 D;  2V4H C;  3DEP A;  4YDY A;  5ENP D;  1K1B A;  2J8S D;  4LG6 A;  3W9F A;  4U96 D;  5KNG A;  5AQ7 A;  3TWW A;  5KBA A;  1NFI E;  1BI7 B;  3HG0 D;  2AJA A;  2RFM A;  5KNH D;  1SW6 A;  3C5R A;  4U95 D;  2HE0 A;  3J5P A;  4DX7 D;  4JB8 P;  4YDW A;  2P2C P;  4F6R D;  2L6B A;  3T9K A;  2BKK B;  4UUC A;  4DX1 A;  2Y0B G;  4HB5 A;  1OY3 D;  3Q9N C;  4DX5 D;  3UI2 A;  4U8Y D;  4GPM A;  2QYJ A;  5ENO D;  4HNA D;  1OT8 A;  3UXG A;  4DX6 D;  5CEC B;  1SVX A;  4TUM A;  4OAU C;  1G3N B;  4K5C A;  2XZT G;  2XEN A;  2XZD G;  4Z68 A;  1YCS B;  2BKG A;  4A63 B;  5AQ9 A;  4J8Y A;  5CBN A;  1MX6 A;  1TR4 A;  2DZO A;  3EU9 A;  4ATZ D;  4BES A;  3V31 A;  3V30 A;  2FO1 E;  3KEA A;  1IXV A;  1UOH A;  2XEE A;  5ENS D;  3ZU7 B;  3V2O A;  2XEH A;  1D9S A;  3ZKJ A;  4QQI A;  4CYM D;  5KWD A;  4N5Q A;  1K3Z D;  1YYH A;  4HBD A;  4DUI A;  4G8K A;  4DRX E;  2JAB A;  5BXO A;  5AN8 A;  5JA4 D;  2F8Y A;  2ZGD A;  5FIN A;  2KXP C;  3ZUV B;  5AQA A;  3TWT A;  2ZGG A;  4C48 B;  3LJN A;  5EYL A;  4K5B A;  4ZHB A;  5HRY A;  4DX2 A;  4HI8 A;  3TWS A;  5AQB A;  2DWZ A;  5ITZ F;  4G8L A;  4ZFH A;  1WDY A;  1MYO A;  4K5A B;  2B0O E;  4F1P A;  3F6Q A;  1BI8 B;  4HRN A;  2QC9 A;  1IHB A;  4LSZ E;  1AWC B;  2VGE A;  3NOC D;  4RLY A;  2A5E A;  4LNU D;  5EYP F;  3UTM A;  4BSZ B;  5CED B;  1QYM A;  3AJI A;  5ENQ D;  1N0R A;  5EID A;  5HKP A;  1N11 A;  5JMN D;  5ENR D;  4GMR A;  4HRM B;  1DCQ A;  1MX2 A;  3AAA C;  2RFA A;  5FIO A;  5CER B;  3HRA A;  5AAR A;  5EIL A;  3TWR A;  4HRL A;  3ZNG A;  4BET A;  4OAV B;  3W9G A;  3NBN B;  1WG0 A;  4BER A;  3DEO A;  2DZN A;  2NYJ A;  3SO8 A;  3TWU A;  5BXU A;  4CZ2 D;  4U8V D;  4NIK A;  4HQD A;  4BEP A;  2ETC A;  3EHQ A;  3JUE A;  2PNN A;  5CEA A;  3NOG D;  1A5E A;  3D9H A;  5HS0 A;  3V79 K;  1BU9 A;  3B95 A;  1MJ0 A;  4B93 B;  3TWX A;  1YMP A;  1N0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...