5EILA

Computational design of a high-affinity metalloprotein homotrimer containing a metal chelating non-canonical amino acid
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
157
Chain Sequence
MSKLGEMLIAVLIGSKEAVKVLLDLGADPNASDEDGLTPLHAAAMAGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNTSDSDGRTPLDLAREHGNEEIVKLLEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRI-05
publication title Computational design of a homotrimeric metalloprotein with a trisbipyridyl core.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 54
structure length 157
sequence length 158
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5eilA00
4ZHBA 1S70B 5FINA 1N0QA 3V31A 2JABA 1DCQA 3KEAA 4K5AB 3T9KA 3V79K 5ENTD 1IXVA 3F6QA 2J8SD 3NOGD 2Y0BG 4NIKA 4C48B 2FO1E 5HRYA 3TWUA 2Y1LE 5AQ7A 4HLLA 4G8KA 4LSZE 5EYLA 3DEOA 2VGEA 4HRMB 2L6BA 5HKPA 5AQ9A 1SVXA 4DX5D 2DVWA 4HQDA 4LG6A 5CBNA 3TWSA 1SW6A 4BERA 1BD8A 1UOHA 4CZ2D 2F37A 2NYJA 3ZU7B 3NOCD 3V30A 4DX2A 1A5EA 5KNHD 1K3ZD 5CEDB 5EIDA 4G8LA 4U95D 2MYOA 2ZGDA 5BXOA 1TR4A 5ENPD 3V2OA 1YYHA 4BSZB 3DEPA 3TWRA 4GPMA 5HS0A 1BI7B 1MX2A 4RLYA 4HB5A 4DX7D 3NBNB 5AARA 4K5CA 2ETCA 2P2CP 4OAVB 2AJAA 4HRNA 5KNGA 2DZOA 1K1BA 3TWWA 3IXEA 3EHQA 2ETAA 3EU9A 4HNAD 4O1PA 3J5QB 3TWTA 2BKKB 4DX6D 5AAOA 5KBAA 3AAAC 3T8KA 1AWCB 5BXUA 2DWZA 5KWDA 1IHBA 3W9GA 2KBXA 2PNNA 4YDYA 5CBOA 5JA4D 5EYPF 3B7BA 1MX4A 3UTMA 3W9FA 3JXJA 1OT8A 2A5EA 2XENA 2XEHA 3JUEA 4F1PA 4OAUC 3C5RA 3TWXA 3ZNGA 4U96D 4QQIA 2RFAA 4DX1A 2ZGGA 4J8YA 1OY3D 4DUIA 4YDWA 2DZNA 4U8VD 1MYOA 4HI9A 3SO8A 2BKGA 4F6RD 3V2XA 4LNUD 3UXGA 1NFIE 4J7WA 5AN8A 3TWQA 2QYJA 3LJNA 2XEEA 4GMRA 3HG0D 3J5PA 5JMND 4BEPA 1BI8B 4A63B 4BESA 2F8XK 5CERB 2QC9A 4O60A 4U8YD 5EN5D 1BLXB 5ENSD 4UUCA 5AQBA 5CEAA 1YMPA 1N0RA 1YCSB 3Q9UC 5ENQD 2XZDG 1MX6A 4ZFHA 5D66A 5EILA 4HBDA 1G3NB 3D9HA 1IKND 2ETBA 1MJ0A 4K5BA 5ITZF 2V5QC 4BETA 3TWVA 1WG0A 4HRLA 4Z68A 1WDYA 1AP7A 2V4HC 2XZTG 1BU9A 4O1OA 4B93B 4CYMD 3UI2A 1DC2A 1K1AA 4QFVA 5CECB 3EHRA 5ENOD 5AQAA 5EIBE 1QYMA 4HI8A 4JB8P 1D9SA 1N11A 2F8YA 3JXIA 3ZUVB 4N5QA 3B95A 2KXPC 5FIOA 3Q9NC 2B0OE 3HRAA 3AJIA 4ATZD 2HE0A 5ENRD 4DRXE 4TUMA 3ZKJA 2RFMA
chains in the Genus database with same CATH superfamily
4AM9A 3MCXA 2XPZA 3UM3A 4ZHBA 3MV3B 5AJLA 2WXNA 3ZYLA 4UWFA 1U3CA 4LSZE 2AW6A 4B89A 4L1BA 4FJZA 4UWKA 3ABLE 5FQ8A 3GZ2A 3G2TA 4U95D 5BXOA 1JCQA 3ZN3A 3GZ1A 1Z5SC 2WQ6A 1TN8A 4OAVB 1K1BA 3QWPA 5J90A 3FTUA 2BKKB 3AAAC 3W9GA 3CVQA 4AXHA 5CBOA 1UN8A 3FP3A 3UTMA 2EIME 3SHFA 4JHJA 5IY5E 2IQCA 1DVPA 4HI9A 2OEVA 3R7QA 2YQ8A 3BG0B 3LJNA 4FULA 4I6EA 1N4PA 3LY7A 4UI9J 3FTSA 2LAIA 1YMPA 3RRUA 3EDTB 4EECA 1JUQA 1N4SA 1IKND 3DSSA 1GW6A 4UQXA 4CGWA 1E7UA 3MJWA 5AENA 1E8XA 1NI1A 3PS6A 4EZKA 3KEZA 4UI9K 2R03A 4TXRA 4HI8A 4U7EB 3E33A 3OTNA 2F8YA 4YVOA 4AY5A 3DPDA 5JJTA 2P9UG 2B6CA 3BUAA 4GPKA 2V5FA 3TAXA 5EYLA 5AQ9A 3ASDA 2J49A 3AG4E 3PZ3A 2NYJA 2XGSA 3U3WA 2X6HA 3ESLA 2E2EA 2NXPA 4I2WA 3CK9A 3IKOB 3PREA 3SFZA 3FUFA 3NF1A 3URZA 2CFUA 4DX7D 3NBNB 3HIZA 3PEVB 3QJZA 4K03A 3FDHA 3J5QB 4BTBA 3UIOC 3MA5A 3NAWA 3Q5MA 1NZNA 4GTSA 2ONDA 4XX5A 4CT0A 4JL0A 2A5EA 4GTVA 4F1PA 3X2QE 4L7TA 2X6IA 4ME2A 2Y3AA 1Q2ZA 3OXLA 3BEEA 2XS1A 4UUCA 2WXHA 2VGXA 2YNQA 4U0UA 5EILA 4CGVA 4B8CB 4H7YA 5G55A 4EBAA 5ITZF 4E85A 2HM8A 4HRLA 1PAQA 3ML8A 1UJJA 5T8IA 3O48A 1HO8A 3TXNA 4WNGA 5AIJA 4JB8P 2PZIA 1H6PA 2VTBB 5ENRD 3UM2A 1SA4A 2RFMA 3FH5A 5D0OD 5FINA 3VLEA 3V79K 1H6OA 5FJYA 3CHMA 1HG5A 4TXQA 3SFXA 1FT1A 4GA0A 4ATGA 4KVMA 2Y69E 3PZDA 2I1KA 3TG4A 4LUNU 3MKQA 4EZJA 3BQOA 4JVSA 4A1GA 4CZ2D 5CRVA 2IJGX 4AY6A 4GTMA 2L0TB 3ZXPA 1TNZA 3HXCA 4TRQA 1MX2A 3D9KA 3FEXA 4IN3B 3SQVA 2R05A 1E8YA 3UXGA 4NQ0A 1UN9A 1E8WA 3ZHEB 5B1AE 2F8XK 2OVFA 5CCLA 3C3RA 2BTDA 3PRZA 4F1SA 3RRNB 4K5BA 2YINA 4AEZC 3FUJA 4BETA 2VJ8A 1WG0A 3AU4A 3L08A 4RQIA 5EKQD 2PM7A 4F7AA 4ANUA 2XS8A 4MBGA 2HO1A 3VTYA 5KCMA 2KXPC 3FTZA 4EHMA 2VYIA 3CHQA 4JD2G 4K5AB 3ZW3A 2H6HA 3F6QA 4YVQC 2Y0BG 4LNBA 3TWUA 3RRMB 5HKPA 3O4ZA 4FU3A 3R7RA 2XHEA 3SFYA 1SA5A 2F37A 4PS8A 2J08A 3PNLB 4V3IA 2GRRB 3FULA 4N3BA 5ANLA 1Z3YA 2ZGDA 5LX8A 2IO3C 3KSLA 5D0QD 1JPLA 3QAQA 4ANXA 4K5CA 4XZ4A 2C0LA 3L13A 5FQ4A 5BXUA 4BTAA 5KWDA 1OCCE 3LY9A 2XENA 3TWXA 3N71A 3FUIA 4WNEA 3FUDA 5AN8A 4N2SA 1FVFA 3MX3A 2ILRA 1N52A 1P5QA 3ABKE 1OWOA 5FZRA 3T5VA 4U8YD 2M63A 4FHKA 4DLOA 4IRUA 2J09A 4I43A 3ZIMA 5AYWD 2GROB 4TXPA 2RD0A 1KLXA 4GCOA 2IOSA 4FHJA 1EYHA 1PY1A 4LEUA 3CLJA 3CEQA 4N2QA 4CT4A 3LXUX 3C3QA 4PDXA 3DXKG 1HH8A 3G2UA 1DCQA 2WQ7A 5ENTD 1L5JA 3FWVA 4JC8A 4X8QA 4C48B 4ACLA 4XE0A 3LPZA 5CMWA 4KBQA 5CBNA 1UOHA 2ZISA 2H6FA 3DRAA 2GRQB 3LKUA 3OXFA 4E6HA 1OXJA 5LFAA 4FADA 3DEPA 3CR3A 3U64A 3AS4A 5AARA 3I3NA 2P9PG 4JA9A 2J9QA 2QZAA 4G1TA 3EU9A 3C98A 2VGXB 3FHEA 4I1MA 2XCBA 2WXMA 3CV0A 1WAO1 4DX1A 4QQIA 1LD7A 2HYZA 3MZLB 4BWRA 2GRMA 4GMRA 3HG0D 4BESA 5CERB 2LXLA 5EN5D 4GTTA 1HXIA 2XZDG 4CDMA 2WVIA 4J0UA 4JHRA 3UMVA 4URKA 2ZU6B 3P1UA 4O1OA 5ENNA 4I1OB 4PUCA 2V8SE 1WM5A 2QYUA 3LDZA 4M3OA 3TL5A 2WXGA 5AQAA 2P58C 1S0PA 1LD8A 3KAEA 4TV3A 2CG2A 3MKQB 1OUVA 2LXMA 5FIOA 5FQ7A 2XEVA 3ZYKA 3KSQA 5LOZA 1N54A 4U04A 4K0RA 3SBSA 2X6KA 3R9AB 5AQ7A 4BX8A 1MQSA 2L6BA 2P9NG 3RKVA 4DX5D 3CVYA 2OVBA 3UT4A 3SI5A 3C72A 4HQDA 4L2YA 2AXUA 2EIKE 4EPZA 4DX2A 1ELRA 4GZ5A 4UWLA 1OWLA 3L82A 2P9SG 3CVNA 3JQ1A 1HX8A 4BSZB 3UKUG 1NP7A 5CHEE 3CSFA 3Q78A 1TNUA 3QNKA 4U63A 1HG2A 2KBXA 1ELWA 4R7LA 2VQ2A 3W9FA 3JUEA 3C5RA 3MYVA 1O1RA 3D3MA 4F6RD 1Y6IA 4DJAA 3ASGA 2QYJA 3ONKA 4YDOA 4LCTA 2ZXWE 5FT9A 5BT1A 3FUNA 1NL4A 1MX6A 2Q7FA 1G3NB 1MJ0A 3IHVA 4OYSA 2KM4A 5CRUA 1AP7A 3EIJA 5CMYA 1OCOE 2MHKA 3R9MA 4QFVA 2OV8A 5CECB 2DIWA 3LY8A 4KYOB 3ULQA 2P9KG 3HRAA 4DRXE 3APDA 2DVWA 1B89A 4XIFA 3KEAA 3DBSA 3L16A 4HOSA 1V55E 4G24A 1DCEA 2WXQA 3L6AA 4Q69A 1INZA 1E90A 4YDEA 3V30A 2VSYA 3NB2A 2KATA 5A6CA 2WM9A 5ANRA 5E75A 2GRNB 4LERA 4I1AA 4CRWA 5G04J 1HE8A 1O1TA 2NSZA 5HQ8A 4RVBA 1YA0A 5ARGA 4GYYA 2OOEA 1OWNA 1HU3A 1Z6TA 3CQCB 3K9IA 2DZNA 2LO6A 4XI0A 4WUYA 2LSUA 4LNUD 4JPSA 5JMND 2WXFA 4APOA 4JEUA 1KZOA 3PUJA 3BG1B 4JZYA 3Q79A 4U8HA 3QWVA 2XZTG 3FTYA 3UI2A 3EHMA 5J08A 1QNFA 3D9NA 2WXRA 5EIBE 1TNYA 2L6JA 4C0EA 4C0MA 3ONLA 4ATZD 1HZ4A 3U9WA 3TG5A 3ZGQA 5G05C 5FZSA 2FO1E 4OVVA 3UUXA 2C2LA 3PUKA 2MRIA 3AG2E 4I6GA 1FPPA 5KJLA 3PE3A 4P29A 3FUKA 3L17A 3TWSA 3QC1A 5CEDB 3NZUA 3OAWA 2WXLA 2MYOA 4O6FA 5EX3A 2EINE 2R59A 3T8MA 4RLYA 3TXMA 2P2CP 2KCLA 2AJAA 4GZ3A 3FTXA 3FY4A 4GB9A 3TWTA 4DX6D 2FI7A 1AWCB 3E32A 1FCHA 3LCAA 4AOFA 1RZ4A 2XEHA 3AS8A 4DUIA 3EU5A 5HI7A 4JA7A 3HDXA 2VSNA 3TWQA 4BT8A 1KZPA 4NACA 1YCSB 3HVEB 2I2OA 5LCWJ 3ASNE 4FA6A 1KPSB 2FEZA 4PS7A 1WDYA 1TN6A 2WMOA 1KT1A 4GZCA 2EIJE 4KVOA 1EDUA 3MV2B 3PVLA 1K8KG 2HE0A 3CHOA 3ZYQA 3HXFA 3E34A 2DCPA 2CFZA 3WG7E 4MS6A 3RK6A 2PQNA 4ILHB 3D9JA 3E30A 3B13A 3Q15A 2GW1A 3QKYA 4H7XA 3AS5A 3LS8A 2WQHA 2UY1A 3TWRA 3ASHA 5C2YA 3LYAA 2R2LA 3EHQA 3B7SA 2DWZA 2LUHA 2I6HA 4OAUC 1TNOA 2RFAA 3G2WA 3RJVA 2WXPA 2J07A 3APCA 3UX4A 4G11A 2P9LG 4KT6B 4A63B 3PDNA 3JYSA 5A7DB 2X3MA 3IV0A 3FTVA 3D9HA 4DI4A 5BNWA 3I5PA 1S64A 5G2NA 3PZ4A 3S7DA 3CVUA 2ZIRA 4NURA 3SY2A 4GTRA 3VLFA 4AV7A 4G26A 3QDNA 2R02A 4HS2A 4I9EA 2C0MA 3Q4AB 2VGEA 3FUHA 2L0IA 4GCNA 3UPVA 4Y6CA 3L9TA 4N3CA 4HOQA 4BERA 2IY0C 4IULA 3CIAA 3P2BA 1TR4A 2IOLA 3V2OA 1HF8A 4N5CA 3MEKA 2A5UA 3DXMG 4GA1A 3HXBA 1HS6A 3LVQE 2MOWA 1IQRA 3CVVA 3D9OA 3Q49B 3G2VA 2WPVA 2J4DA 4GTPA 2FO7A 3CVLA 3CQGB 3RIBA 4F53A 3S7FA 2PL2A 5CEAA 5DIZA 3Q9UC 4ANVA 3UINC 2VSOE 3JCKC 2CHXA 3D9IA 2ETBA 5FZQA 3PNTB 1H6KA 3ABME 4A3VA 1WY6A 5B1BE 4HFGA 4JHKA 4J8SA 1IYGA 5ENOD 2GGFA 2XQ0A 3GW4A 1E7VA 5JHBA 3IBEA 2XRYA 4TUMA 3ZKJA 2IONA 2JABA 2R17C 3B7UX 4HLLA 1IQUA 1ZB1A 3APFA 2CG3A 3OXGA 3U66A 1U2VG 4HORA 1SW6A 2H6IA 5ENPD 3SF4A 1N4QA 4I9CA 5EX0A 1FT2A 2DZOA 2XPYA 3T8KA 5T4YA 3ISMC 3RU0A 4AIFA 4AP2A 1MX4A 3HXEA 1MYOA 3S7BA 3V2XA 3MKRA 2JEKA 2A4ZA 4ILIA 3IHYA 4BEPA 3IEGA 3VTXA 4GZ6A 2X38A 5BV0A 3CK7A 4G25A 3GZSA 1QQEA 3FFLA 1E96B 4J8DA 4WNDA 3TGOA 4DLQA 3ZYMA 2V5QC 4M7CA 4Z68A 1DNPA 1TNBA 4B93B 4MRUA 1H2TC 4WNFA 5JHAA 4ANWA 3CVXA 3DSTA 2LSVA 1QYMA 2RG8A 4GAAA 3SNXA 3MGBA 3QARA 1RW2A 1TN7A 2UY1B 2E0IA 2Y1LE 2JLBA 1X5BA 4G8KA 3WXXA 3RO2A 1LTXA 4J6IA 2XGOA 3EIQC 1SVXA 4A55A 3UT7A 4APFA 4LRZA 1A17A 3CGHA 3NOCD 3CHPA 3EUVA 4JXTA 4B8AA 3B7RL 3BU8A 5HS0A 1BI7B 4HB5A 5ARFA 3SGHA 4N3AA 1N95A 2ETAA 5KJNA 4HLEA 5AAOA 3CHRA 4Q94A 2PNNA 5EYPF 3E4BA 1XGWA 4KMOA 3ZNGA 4U96D 4J8YA 1OY3D 1O1SA 3FU0A 4UI9C 3RSEG 3CVPA 3EHNA 3FU3A 4FP7A 4J7WA 5E76A 4I6JA 1OWMA 2I1JA 4EZLA 1OWPA 1BI8B 1TYQG 2RKKA 2QC9A 4G23A 2BEDA 3ZFWA 5ENQD 4GYOA 1E8ZA 4HBDA 3QB2A 1JCRA 1ZBPA 3PH0C 2L9BA 3KS2A 1H0AA 5B3SE 3PZ2A 3SD5A 3S2AA 3ULEG 4C9BB 3S7JA 4RSYA 1UW4B 2Y4TA 4WWPA 1V54E 4OVUA 5EDSA 2BF0X 2IU1A 3ZPJA 5G04C 4N39A 1S70B 3T9KA 3KD7A 4J8FA 4GZDA 2J4BA 4EQFA 4XEIG 2KZTA 5BPPA 4PH4B 5G05J 3G2SA 3LVRE 4WAFA 5D2MC 4I2ZA 4WWOA 3Q47B 4L9PA 2YHCA 4B0ZA 2PQRA 1FVHA 2CHWA 5JJ7A 1JWFA 1YYHA 1VDYA 3L54A 2YHEA 3DSXA 2ETCA 2WXOA 3D9PA 4GTOA 4XKCA 3TWWA 4HNAD 4O1PA 2KCVA 3Q73A 3CVWA 2XGMA 2CHZA 3JXJA 2DYSE 1S63A 3AU5A 3CK8A 4YDWA 4JEHA 1Y8MA 2FULA 2WMNA 1H2VC 2IF4A 1BLXB 3PE4A 5ENSD 5AQBA 1N0RA 4DI3A 4UQYA 5BV1A 1JCSA 5LP0A 2BUGA 5JJ6A 3TWVA 4EBAG 5A23A 1DC2A 2VGYA 3PEUB 5FQ6A 5CCMA 3DPYA 1N11A 2X6FA 4L2LA 4BT9A 3AG3E 4Y6WA 3D9LA 4GMLA 3UT8A 2NC9A 2R5SA 1N0QA 3JUIA 5FWQA 3FH7A 3TJPA 1H19A 2AXZA 2DBAA 1IXVA 2Y4UA 5AJDA 5HRYA 3QWWA 3E37A 4GMJA 5DBKA 3FTWA 4CCAA 4FLHA 3DSWA 4FJYA 3NQPA 4LG6A 1U3DA 3FU6A 3ZU7B 1TJCA 3LEWA 5KNHD 3UQ3A 1O5MA 2V4LA 5EIDA 4DPRA 4G8LA 3C3OA 4GPMA 5LCWC 1NA3A 4BX9A 2WXKA 2GRLA 3CSTA 5KBAA 1OCZE 3ESKA 4YDYA 3HHMA 5H7PA 1MZCA 4A1SA 3CKCA 4TUUA 3FUEA 4U8VD 3SO8A 2BKGA 5C1DA 1KT0A 1HFAA 2DYRE 1NFIE 3ASFA 3QK0A 2XEEA 3J5PA 4O60A 3VLDA 1LF8A 4A3TA 4BY6A 4JW1A 5D66A 4GYWA 1N4RA 3GYZA 4YNDA 4IYPA 3D9MA 2FBNA 1BU9A 2AWIA 2XPIA 3I4RB 1K1AA 1SZAA 4L23A 2KCKA 3EHRA 3RO3A 4U07A 1D9SA 3T5XA 1Z3XA 3QOUA 1W3BA 2IFUA 3ZUVB 3UM0A 3Q9NC 2B0OE 3AJIA 4AJWA 3Q75A 5BW8C 4RG9A 2J8SD 3NOGD 3I4GA 4RG6A 4WWNA 3FEYA 3ZXSA 4KXKB 4I17A 1EF1C 2HR2A 4DK5A 1BD8A 3ULYA 1EPUA 4UQZA 1XNFA 1PC2A 4MKTA 3L22A 2V0PA 2KC7A 1N9AA 2LAHA 2QFCA 1D8DA 4CDNA 4XKBA 2XRZA 4GTQA 2XCCA 4G2VA 3SBTB 2GRPB 2AXVA 4HXIA 2I9CA 1IHBA 5BUZA 1ZU2A 4AVXA 3B7BA 1OT8A 2EQXA 1QZ2A 2IO2C 2ZGGA 1TJFA 4XI9A 2WXJA 3ML9A 4W9RA 3U4TA 2PM6A 4U0SA 1D8EA 5T3RA 3FUMA 4ZFHA 1UG3A 3HYMB 1SZ9A 3ZEFA 1IHGA 4CYMD 1MHQA 2X6JA 2H6GA 3CKBA 2KZTB 4LNGA 4HOTA 3UM1A 3ENEA 1UJKA 3JXIA 4HOUA 4N5QA 4Q96A 4NRHB 1H2UA 4CEMA 5KJMA 5M72A 1QBQA 2EILE 1OCRE 3V31A 1X81A 2LNIA 2QY7A 4KZCA 4NIKA 4UWHA 2UWJG 3PZ1A 3DEOA 4HRMB 2OCCE 3ZVVA 3LJ3A 2VTBA 4KZ0A 4GU5A 3B7TA 1A5EA 1N94A 3HXDA 3AG1E 1K3ZD 4B94A 3SZ7A 4U0ZA 4ILGA 3FH8A 5FTPA 4FLBA 3UIPC 1ELKA 2FF4A 4HRNA 5KNGA 3ZRHA 3IXEA 3DSUA 4MLPA 1SQMA 5JA4D 2AVPA 2F0YA 3Q7FA 4HVBA 2P9IG 3DSVA 4PS3A 4D10C 3ASOE 3FU5A 3Q7AA 4FC8A 3HVEA 4UWGA 2OEWA 1JWGA 3UKRG 2VSXE 2WXIA 1TEZA 4J8EA 2V4HC 1NA0A 2IEJA 4BSXA 2WB2A 4BFRA 3NZSA 3ZHEA 3DWLG 3EJNA 4CDRA 4ABNA 3JQ0A 1BPOA 4GA2A 3B95A 3CHSA 3RAUA 4F3VA 5KJKA 4ACKA
chains in the Genus database with same CATH topology
4ZHBA 1S70B 5FINA 1N0QA 3V31A 2JABA 1DCQA 3KEAA 4K5AB 3T9KA 3V79K 5ENTD 1IXVA 3F6QA 2J8SD 3NOGD 2Y0BG 4NIKA 4C48B 2FO1E 5HRYA 3TWUA 2Y1LE 5AQ7A 4HLLA 4G8KA 4LSZE 5EYLA 3DEOA 2VGEA 4HRMB 2L6BA 5HKPA 5AQ9A 1SVXA 4DX5D 2DVWA 4HQDA 4LG6A 5CBNA 3TWSA 1SW6A 4BERA 1BD8A 1UOHA 4CZ2D 2F37A 2NYJA 3ZU7B 3NOCD 3V30A 4DX2A 1A5EA 5KNHD 1K3ZD 5CEDB 5EIDA 4G8LA 4U95D 2MYOA 2ZGDA 5BXOA 1TR4A 5ENPD 3V2OA 1YYHA 4BSZB 3DEPA 3TWRA 4GPMA 5HS0A 1BI7B 1MX2A 4RLYA 4HB5A 4DX7D 3NBNB 5AARA 4K5CA 2ETCA 2P2CP 4OAVB 2AJAA 4HRNA 5KNGA 2DZOA 1K1BA 3TWWA 3IXEA 3EHQA 2ETAA 3EU9A 4HNAD 4O1PA 3J5QB 3TWTA 2BKKB 4DX6D 5AAOA 5KBAA 3AAAC 3T8KA 1AWCB 5BXUA 2DWZA 5KWDA 1IHBA 3W9GA 2KBXA 2PNNA 4YDYA 5CBOA 5JA4D 5EYPF 3B7BA 1MX4A 3UTMA 3W9FA 3JXJA 1OT8A 2A5EA 2XENA 2XEHA 3JUEA 4F1PA 4OAUC 3C5RA 3TWXA 3ZNGA 4U96D 4QQIA 2RFAA 4DX1A 2ZGGA 4J8YA 1OY3D 4DUIA 4YDWA 2DZNA 4U8VD 1MYOA 4HI9A 3SO8A 2BKGA 4F6RD 3V2XA 4LNUD 3UXGA 1NFIE 4J7WA 5AN8A 3TWQA 2QYJA 3LJNA 2XEEA 4GMRA 3HG0D 3J5PA 5JMND 4BEPA 1BI8B 4A63B 4BESA 2F8XK 5CERB 2QC9A 4O60A 4U8YD 5EN5D 1BLXB 5ENSD 4UUCA 5AQBA 5CEAA 1YMPA 1N0RA 1YCSB 3Q9UC 5ENQD 2XZDG 1MX6A 4ZFHA 5D66A 5EILA 4HBDA 1G3NB 3D9HA 1IKND 2ETBA 1MJ0A 4K5BA 5ITZF 2V5QC 4BETA 3TWVA 1WG0A 4HRLA 4Z68A 1WDYA 1AP7A 2V4HC 2XZTG 1BU9A 4O1OA 4B93B 4CYMD 3UI2A 1DC2A 1K1AA 4QFVA 5CECB 3EHRA 5ENOD 5AQAA 5EIBE 1QYMA 4HI8A 4JB8P 1D9SA 1N11A 2F8YA 3JXIA 3ZUVB 4N5QA 3B95A 2KXPC 5FIOA 3Q9NC 2B0OE 3HRAA 3AJIA 4ATZD 2HE0A 5ENRD 4DRXE 4TUMA 3ZKJA 2RFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZHB A;  1S70 B;  5FIN A;  1N0Q A;  3V31 A;  2JAB A;  1DCQ A;  3KEA A;  4K5A B;  3T9K A;  3V79 K;  5ENT D;  1IXV A;  3F6Q A;  2J8S D;  3NOG D;  2Y0B G;  4NIK A;  4C48 B;  2FO1 E;  5HRY A;  3TWU A;  2Y1L E;  5AQ7 A;  4HLL A;  4G8K A;  4LSZ E;  5EYL A;  3DEO A;  2VGE A;  4HRM B;  2L6B A;  5HKP A;  5AQ9 A;  1SVX A;  4DX5 D;  2DVW A;  4HQD A;  4LG6 A;  5CBN A;  3TWS A;  1SW6 A;  4BER A;  1BD8 A;  1UOH A;  4CZ2 D;  2F37 A;  2NYJ A;  3ZU7 B;  3NOC D;  3V30 A;  4DX2 A;  1A5E A;  5KNH D;  1K3Z D;  5CED B;  5EID A;  4G8L A;  4U95 D;  2MYO A;  2ZGD A;  5BXO A;  1TR4 A;  5ENP D;  3V2O A;  1YYH A;  4BSZ B;  3DEP A;  3TWR A;  4GPM A;  5HS0 A;  1BI7 B;  1MX2 A;  4RLY A;  4HB5 A;  4DX7 D;  3NBN B;  5AAR A;  4K5C A;  2ETC A;  2P2C P;  4OAV B;  2AJA A;  4HRN A;  5KNG A;  2DZO A;  1K1B A;  3TWW A;  3IXE A;  3EHQ A;  2ETA A;  3EU9 A;  4HNA D;  4O1P A;  3J5Q B;  3TWT A;  2BKK B;  4DX6 D;  5AAO A;  5KBA A;  3AAA C;  3T8K A;  1AWC B;  5BXU A;  2DWZ A;  5KWD A;  1IHB A;  3W9G A;  2KBX A;  2PNN A;  4YDY A;  5CBO A;  5JA4 D;  5EYP F;  3B7B A;  1MX4 A;  3UTM A;  3W9F A;  3JXJ A;  1OT8 A;  2A5E A;  2XEN A;  2XEH A;  3JUE A;  4F1P A;  4OAU C;  3C5R A;  3TWX A;  3ZNG A;  4U96 D;  4QQI A;  2RFA A;  4DX1 A;  2ZGG A;  4J8Y A;  1OY3 D;  4DUI A;  4YDW A;  2DZN A;  4U8V D;  1MYO A;  4HI9 A;  3SO8 A;  2BKG A;  4F6R D;  3V2X A;  4LNU D;  3UXG A;  1NFI E;  4J7W A;  5AN8 A;  3TWQ A;  2QYJ A;  3LJN A;  2XEE A;  4GMR A;  3HG0 D;  3J5P A;  5JMN D;  4BEP A;  1BI8 B;  4A63 B;  4BES A;  2F8X K;  5CER B;  2QC9 A;  4O60 A;  4U8Y D;  5EN5 D;  1BLX B;  5ENS D;  4UUC A;  5AQB A;  5CEA A;  1YMP A;  1N0R A;  1YCS B;  3Q9U C;  5ENQ D;  2XZD G;  1MX6 A;  4ZFH A;  5D66 A;  5EIL A;  4HBD A;  1G3N B;  3D9H A;  1IKN D;  2ETB A;  1MJ0 A;  4K5B A;  5ITZ F;  2V5Q C;  4BET A;  3TWV A;  1WG0 A;  4HRL A;  4Z68 A;  1WDY A;  1AP7 A;  2V4H C;  2XZT G;  1BU9 A;  4O1O A;  4B93 B;  4CYM D;  3UI2 A;  1DC2 A;  1K1A A;  4QFV A;  5CEC B;  3EHR A;  5ENO D;  5AQA A;  5EIB E;  1QYM A;  4HI8 A;  4JB8 P;  1D9S A;  1N11 A;  2F8Y A;  3JXI A;  3ZUV B;  4N5Q A;  3B95 A;  2KXP C;  5FIO A;  3Q9N C;  2B0O E;  3HRA A;  3AJI A;  4ATZ D;  2HE0 A;  5ENR D;  4DRX E;  4TUM A;  3ZKJ A;  2RFM A; 
#chains in the Genus database with same CATH topology
 4AM9 A;  3MCX A;  2XPZ A;  3UM3 A;  4ZHB A;  3MV3 B;  5AJL A;  2WXN A;  3ZYL A;  4UWF A;  1U3C A;  4LSZ E;  2AW6 A;  4B89 A;  4L1B A;  4FJZ A;  4UWK A;  3ABL E;  5FQ8 A;  3GZ2 A;  3G2T A;  4U95 D;  5BXO A;  1JCQ A;  3ZN3 A;  3GZ1 A;  1Z5S C;  2WQ6 A;  1TN8 A;  4OAV B;  1K1B A;  3QWP A;  5J90 A;  3FTU A;  2BKK B;  3AAA C;  3W9G A;  3CVQ A;  4AXH A;  5CBO A;  1UN8 A;  3FP3 A;  3UTM A;  2EIM E;  3SHF A;  4JHJ A;  5IY5 E;  2IQC A;  1DVP A;  4HI9 A;  2OEV A;  3R7Q A;  2YQ8 A;  3BG0 B;  3LJN A;  4FUL A;  4I6E A;  1N4P A;  3LY7 A;  4UI9 J;  3FTS A;  2LAI A;  1YMP A;  3RRU A;  3EDT B;  4EEC A;  1JUQ A;  1N4S A;  1IKN D;  3DSS A;  1GW6 A;  4UQX A;  4CGW A;  1E7U A;  3MJW A;  5AEN A;  1E8X A;  1NI1 A;  3PS6 A;  4EZK A;  3KEZ A;  4UI9 K;  2R03 A;  4TXR A;  4HI8 A;  4U7E B;  3E33 A;  3OTN A;  2F8Y A;  4YVO A;  4AY5 A;  3DPD A;  5JJT A;  2P9U G;  2B6C A;  3BUA A;  4GPK A;  2V5F A;  3TAX A;  5EYL A;  5AQ9 A;  3ASD A;  2J49 A;  3AG4 E;  3PZ3 A;  2NYJ A;  2XGS A;  3U3W A;  2X6H A;  3ESL A;  2E2E A;  2NXP A;  4I2W A;  3CK9 A;  3IKO B;  3PRE A;  3SFZ A;  3FUF A;  3NF1 A;  3URZ A;  2CFU A;  4DX7 D;  3NBN B;  3HIZ A;  3PEV B;  3QJZ A;  4K03 A;  3FDH A;  3J5Q B;  4BTB A;  3UIO C;  3MA5 A;  3NAW A;  3Q5M A;  1NZN A;  4GTS A;  2OND A;  4XX5 A;  4CT0 A;  4JL0 A;  2A5E A;  4GTV A;  4F1P A;  3X2Q E;  4L7T A;  2X6I A;  4ME2 A;  2Y3A A;  1Q2Z A;  3OXL A;  3BEE A;  2XS1 A;  4UUC A;  2WXH A;  2VGX A;  2YNQ A;  4U0U A;  5EIL A;  4CGV A;  4B8C B;  4H7Y A;  5G55 A;  4EBA A;  5ITZ F;  4E85 A;  2HM8 A;  4HRL A;  1PAQ A;  3ML8 A;  1UJJ A;  5T8I A;  3O48 A;  1HO8 A;  3TXN A;  4WNG A;  5AIJ A;  4JB8 P;  2PZI A;  1H6P A;  2VTB B;  5ENR D;  3UM2 A;  1SA4 A;  2RFM A;  3FH5 A;  5D0O D;  5FIN A;  3VLE A;  3V79 K;  1H6O A;  5FJY A;  3CHM A;  1HG5 A;  4TXQ A;  3SFX A;  1FT1 A;  4GA0 A;  4ATG A;  4KVM A;  2Y69 E;  3PZD A;  2I1K A;  3TG4 A;  4LUN U;  3MKQ A;  4EZJ A;  3BQO A;  4JVS A;  4A1G A;  4CZ2 D;  5CRV A;  2IJG X;  4AY6 A;  4GTM A;  2L0T B;  3ZXP A;  1TNZ A;  3HXC A;  4TRQ A;  1MX2 A;  3D9K A;  3FEX A;  4IN3 B;  3SQV A;  2R05 A;  1E8Y A;  3UXG A;  4NQ0 A;  1UN9 A;  1E8W A;  3ZHE B;  5B1A E;  2F8X K;  2OVF A;  5CCL A;  3C3R A;  2BTD A;  3PRZ A;  4F1S A;  3RRN B;  4K5B A;  2YIN A;  4AEZ C;  3FUJ A;  4BET A;  2VJ8 A;  1WG0 A;  3AU4 A;  3L08 A;  4RQI A;  5EKQ D;  2PM7 A;  4F7A A;  4ANU A;  2XS8 A;  4MBG A;  2HO1 A;  3VTY A;  5KCM A;  2KXP C;  3FTZ A;  4EHM A;  2VYI A;  3CHQ A;  4JD2 G;  4K5A B;  3ZW3 A;  2H6H A;  3F6Q A;  4YVQ C;  2Y0B G;  4LNB A;  3TWU A;  3RRM B;  5HKP A;  3O4Z A;  4FU3 A;  3R7R A;  2XHE A;  3SFY A;  1SA5 A;  2F37 A;  4PS8 A;  2J08 A;  3PNL B;  4V3I A;  2GRR B;  3FUL A;  4N3B A;  5ANL A;  1Z3Y A;  2ZGD A;  5LX8 A;  2IO3 C;  3KSL A;  5D0Q D;  1JPL A;  3QAQ A;  4ANX A;  4K5C A;  4XZ4 A;  2C0L A;  3L13 A;  5FQ4 A;  5BXU A;  4BTA A;  5KWD A;  1OCC E;  3LY9 A;  2XEN A;  3TWX A;  3N71 A;  3FUI A;  4WNE A;  3FUD A;  5AN8 A;  4N2S A;  1FVF A;  3MX3 A;  2ILR A;  1N52 A;  1P5Q A;  3ABK E;  1OWO A;  5FZR A;  3T5V A;  4U8Y D;  2M63 A;  4FHK A;  4DLO A;  4IRU A;  2J09 A;  4I43 A;  3ZIM A;  5AYW D;  2GRO B;  4TXP A;  2RD0 A;  1KLX A;  4GCO A;  2IOS A;  4FHJ A;  1EYH A;  1PY1 A;  4LEU A;  3CLJ A;  3CEQ A;  4N2Q A;  4CT4 A;  3LXU X;  3C3Q A;  4PDX A;  3DXK G;  1HH8 A;  3G2U A;  1DCQ A;  2WQ7 A;  5ENT D;  1L5J A;  3FWV A;  4JC8 A;  4X8Q A;  4C48 B;  4ACL A;  4XE0 A;  3LPZ A;  5CMW A;  4KBQ A;  5CBN A;  1UOH A;  2ZIS A;  2H6F A;  3DRA A;  2GRQ B;  3LKU A;  3OXF A;  4E6H A;  1OXJ A;  5LFA A;  4FAD A;  3DEP A;  3CR3 A;  3U64 A;  3AS4 A;  5AAR A;  3I3N A;  2P9P G;  4JA9 A;  2J9Q A;  2QZA A;  4G1T A;  3EU9 A;  3C98 A;  2VGX B;  3FHE A;  4I1M A;  2XCB A;  2WXM A;  3CV0 A;  1WAO 1;  4DX1 A;  4QQI A;  1LD7 A;  2HYZ A;  3MZL B;  4BWR A;  2GRM A;  4GMR A;  3HG0 D;  4BES A;  5CER B;  2LXL A;  5EN5 D;  4GTT A;  1HXI A;  2XZD G;  4CDM A;  2WVI A;  4J0U A;  4JHR A;  3UMV A;  4URK A;  2ZU6 B;  3P1U A;  4O1O A;  5ENN A;  4I1O B;  4PUC A;  2V8S E;  1WM5 A;  2QYU A;  3LDZ A;  4M3O A;  3TL5 A;  2WXG A;  5AQA A;  2P58 C;  1S0P A;  1LD8 A;  3KAE A;  4TV3 A;  2CG2 A;  3MKQ B;  1OUV A;  2LXM A;  5FIO A;  5FQ7 A;  2XEV A;  3ZYK A;  3KSQ A;  5LOZ A;  1N54 A;  4U04 A;  4K0R A;  3SBS A;  2X6K A;  3R9A B;  5AQ7 A;  4BX8 A;  1MQS A;  2L6B A;  2P9N G;  3RKV A;  4DX5 D;  3CVY A;  2OVB A;  3UT4 A;  3SI5 A;  3C72 A;  4HQD A;  4L2Y A;  2AXU A;  2EIK E;  4EPZ A;  4DX2 A;  1ELR A;  4GZ5 A;  4UWL A;  1OWL A;  3L82 A;  2P9S G;  3CVN A;  3JQ1 A;  1HX8 A;  4BSZ B;  3UKU G;  1NP7 A;  5CHE E;  3CSF A;  3Q78 A;  1TNU A;  3QNK A;  4U63 A;  1HG2 A;  2KBX A;  1ELW A;  4R7L A;  2VQ2 A;  3W9F A;  3JUE A;  3C5R A;  3MYV A;  1O1R A;  3D3M A;  4F6R D;  1Y6I A;  4DJA A;  3ASG A;  2QYJ A;  3ONK A;  4YDO A;  4LCT A;  2ZXW E;  5FT9 A;  5BT1 A;  3FUN A;  1NL4 A;  1MX6 A;  2Q7F A;  1G3N B;  1MJ0 A;  3IHV A;  4OYS A;  2KM4 A;  5CRU A;  1AP7 A;  3EIJ A;  5CMY A;  1OCO E;  2MHK A;  3R9M A;  4QFV A;  2OV8 A;  5CEC B;  2DIW A;  3LY8 A;  4KYO B;  3ULQ A;  2P9K G;  3HRA A;  4DRX E;  3APD A;  2DVW A;  1B89 A;  4XIF A;  3KEA A;  3DBS A;  3L16 A;  4HOS A;  1V55 E;  4G24 A;  1DCE A;  2WXQ A;  3L6A A;  4Q69 A;  1INZ A;  1E90 A;  4YDE A;  3V30 A;  2VSY A;  3NB2 A;  2KAT A;  5A6C A;  2WM9 A;  5ANR A;  5E75 A;  2GRN B;  4LER A;  4I1A A;  4CRW A;  5G04 J;  1HE8 A;  1O1T A;  2NSZ A;  5HQ8 A;  4RVB A;  1YA0 A;  5ARG A;  4GYY A;  2OOE A;  1OWN A;  1HU3 A;  1Z6T A;  3CQC B;  3K9I A;  2DZN A;  2LO6 A;  4XI0 A;  4WUY A;  2LSU A;  4LNU D;  4JPS A;  5JMN D;  2WXF A;  4APO A;  4JEU A;  1KZO A;  3PUJ A;  3BG1 B;  4JZY A;  3Q79 A;  4U8H A;  3QWV A;  2XZT G;  3FTY A;  3UI2 A;  3EHM A;  5J08 A;  1QNF A;  3D9N A;  2WXR A;  5EIB E;  1TNY A;  2L6J A;  4C0E A;  4C0M A;  3ONL A;  4ATZ D;  1HZ4 A;  3U9W A;  3TG5 A;  3ZGQ A;  5G05 C;  5FZS A;  2FO1 E;  4OVV A;  3UUX A;  2C2L A;  3PUK A;  2MRI A;  3AG2 E;  4I6G A;  1FPP A;  5KJL A;  3PE3 A;  4P29 A;  3FUK A;  3L17 A;  3TWS A;  3QC1 A;  5CED B;  3NZU A;  3OAW A;  2WXL A;  2MYO A;  4O6F A;  5EX3 A;  2EIN E;  2R59 A;  3T8M A;  4RLY A;  3TXM A;  2P2C P;  2KCL A;  2AJA A;  4GZ3 A;  3FTX A;  3FY4 A;  4GB9 A;  3TWT A;  4DX6 D;  2FI7 A;  1AWC B;  3E32 A;  1FCH A;  3LCA A;  4AOF A;  1RZ4 A;  2XEH A;  3AS8 A;  4DUI A;  3EU5 A;  5HI7 A;  4JA7 A;  3HDX A;  2VSN A;  3TWQ A;  4BT8 A;  1KZP A;  4NAC A;  1YCS B;  3HVE B;  2I2O A;  5LCW J;  3ASN E;  4FA6 A;  1KPS B;  2FEZ A;  4PS7 A;  1WDY A;  1TN6 A;  2WMO A;  1KT1 A;  4GZC A;  2EIJ E;  4KVO A;  1EDU A;  3MV2 B;  3PVL A;  1K8K G;  2HE0 A;  3CHO A;  3ZYQ A;  3HXF A;  3E34 A;  2DCP A;  2CFZ A;  3WG7 E;  4MS6 A;  3RK6 A;  2PQN A;  4ILH B;  3D9J A;  3E30 A;  3B13 A;  3Q15 A;  2GW1 A;  3QKY A;  4H7X A;  3AS5 A;  3LS8 A;  2WQH A;  2UY1 A;  3TWR A;  3ASH A;  5C2Y A;  3LYA A;  2R2L A;  3EHQ A;  3B7S A;  2DWZ A;  2LUH A;  2I6H A;  4OAU C;  1TNO A;  2RFA A;  3G2W A;  3RJV A;  2WXP A;  2J07 A;  3APC A;  3UX4 A;  4G11 A;  2P9L G;  4KT6 B;  4A63 B;  3PDN A;  3JYS A;  5A7D B;  2X3M A;  3IV0 A;  3FTV A;  3D9H A;  4DI4 A;  5BNW A;  3I5P A;  1S64 A;  5G2N A;  3PZ4 A;  3S7D A;  3CVU A;  2ZIR A;  4NUR A;  3SY2 A;  4GTR A;  3VLF A;  4AV7 A;  4G26 A;  3QDN A;  2R02 A;  4HS2 A;  4I9E A;  2C0M A;  3Q4A B;  2VGE A;  3FUH A;  2L0I A;  4GCN A;  3UPV A;  4Y6C A;  3L9T A;  4N3C A;  4HOQ A;  4BER A;  2IY0 C;  4IUL A;  3CIA A;  3P2B A;  1TR4 A;  2IOL A;  3V2O A;  1HF8 A;  4N5C A;  3MEK A;  2A5U A;  3DXM G;  4GA1 A;  3HXB A;  1HS6 A;  3LVQ E;  2MOW A;  1IQR A;  3CVV A;  3D9O A;  3Q49 B;  3G2V A;  2WPV A;  2J4D A;  4GTP A;  2FO7 A;  3CVL A;  3CQG B;  3RIB A;  4F53 A;  3S7F A;  2PL2 A;  5CEA A;  5DIZ A;  3Q9U C;  4ANV A;  3UIN C;  2VSO E;  3JCK C;  2CHX A;  3D9I A;  2ETB A;  5FZQ A;  3PNT B;  1H6K A;  3ABM E;  4A3V A;  1WY6 A;  5B1B E;  4HFG A;  4JHK A;  4J8S A;  1IYG A;  5ENO D;  2GGF A;  2XQ0 A;  3GW4 A;  1E7V A;  5JHB A;  3IBE A;  2XRY A;  4TUM A;  3ZKJ A;  2ION A;  2JAB A;  2R17 C;  3B7U X;  4HLL A;  1IQU A;  1ZB1 A;  3APF A;  2CG3 A;  3OXG A;  3U66 A;  1U2V G;  4HOR A;  1SW6 A;  2H6I A;  5ENP D;  3SF4 A;  1N4Q A;  4I9C A;  5EX0 A;  1FT2 A;  2DZO A;  2XPY A;  3T8K A;  5T4Y A;  3ISM C;  3RU0 A;  4AIF A;  4AP2 A;  1MX4 A;  3HXE A;  1MYO A;  3S7B A;  3V2X A;  3MKR A;  2JEK A;  2A4Z A;  4ILI A;  3IHY A;  4BEP A;  3IEG A;  3VTX A;  4GZ6 A;  2X38 A;  5BV0 A;  3CK7 A;  4G25 A;  3GZS A;  1QQE A;  3FFL A;  1E96 B;  4J8D A;  4WND A;  3TGO A;  4DLQ A;  3ZYM A;  2V5Q C;  4M7C A;  4Z68 A;  1DNP A;  1TNB A;  4B93 B;  4MRU A;  1H2T C;  4WNF A;  5JHA A;  4ANW A;  3CVX A;  3DST A;  2LSV A;  1QYM A;  2RG8 A;  4GAA A;  3SNX A;  3MGB A;  3QAR A;  1RW2 A;  1TN7 A;  2UY1 B;  2E0I A;  2Y1L E;  2JLB A;  1X5B A;  4G8K A;  3WXX A;  3RO2 A;  1LTX A;  4J6I A;  2XGO A;  3EIQ C;  1SVX A;  4A55 A;  3UT7 A;  4APF A;  4LRZ A;  1A17 A;  3CGH A;  3NOC D;  3CHP A;  3EUV A;  4JXT A;  4B8A A;  3B7R L;  3BU8 A;  5HS0 A;  1BI7 B;  4HB5 A;  5ARF A;  3SGH A;  4N3A A;  1N95 A;  2ETA A;  5KJN A;  4HLE A;  5AAO A;  3CHR A;  4Q94 A;  2PNN A;  5EYP F;  3E4B A;  1XGW A;  4KMO A;  3ZNG A;  4U96 D;  4J8Y A;  1OY3 D;  1O1S A;  3FU0 A;  4UI9 C;  3RSE G;  3CVP A;  3EHN A;  3FU3 A;  4FP7 A;  4J7W A;  5E76 A;  4I6J A;  1OWM A;  2I1J A;  4EZL A;  1OWP A;  1BI8 B;  1TYQ G;  2RKK A;  2QC9 A;  4G23 A;  2BED A;  3ZFW A;  5ENQ D;  4GYO A;  1E8Z A;  4HBD A;  3QB2 A;  1JCR A;  1ZBP A;  3PH0 C;  2L9B A;  3KS2 A;  1H0A A;  5B3S E;  3PZ2 A;  3SD5 A;  3S2A A;  3ULE G;  4C9B B;  3S7J A;  4RSY A;  1UW4 B;  2Y4T A;  4WWP A;  1V54 E;  4OVU A;  5EDS A;  2BF0 X;  2IU1 A;  3ZPJ A;  5G04 C;  4N39 A;  1S70 B;  3T9K A;  3KD7 A;  4J8F A;  4GZD A;  2J4B A;  4EQF A;  4XEI G;  2KZT A;  5BPP A;  4PH4 B;  5G05 J;  3G2S A;  3LVR E;  4WAF A;  5D2M C;  4I2Z A;  4WWO A;  3Q47 B;  4L9P A;  2YHC A;  4B0Z A;  2PQR A;  1FVH A;  2CHW A;  5JJ7 A;  1JWF A;  1YYH A;  1VDY A;  3L54 A;  2YHE A;  3DSX A;  2ETC A;  2WXO A;  3D9P A;  4GTO A;  4XKC A;  3TWW A;  4HNA D;  4O1P A;  2KCV A;  3Q73 A;  3CVW A;  2XGM A;  2CHZ A;  3JXJ A;  2DYS E;  1S63 A;  3AU5 A;  3CK8 A;  4YDW A;  4JEH A;  1Y8M A;  2FUL A;  2WMN A;  1H2V C;  2IF4 A;  1BLX B;  3PE4 A;  5ENS D;  5AQB A;  1N0R A;  4DI3 A;  4UQY A;  5BV1 A;  1JCS A;  5LP0 A;  2BUG A;  5JJ6 A;  3TWV A;  4EBA G;  5A23 A;  1DC2 A;  2VGY A;  3PEU B;  5FQ6 A;  5CCM A;  3DPY A;  1N11 A;  2X6F A;  4L2L A;  4BT9 A;  3AG3 E;  4Y6W A;  3D9L A;  4GML A;  3UT8 A;  2NC9 A;  2R5S A;  1N0Q A;  3JUI A;  5FWQ A;  3FH7 A;  3TJP A;  1H19 A;  2AXZ A;  2DBA A;  1IXV A;  2Y4U A;  5AJD A;  5HRY A;  3QWW A;  3E37 A;  4GMJ A;  5DBK A;  3FTW A;  4CCA A;  4FLH A;  3DSW A;  4FJY A;  3NQP A;  4LG6 A;  1U3D A;  3FU6 A;  3ZU7 B;  1TJC A;  3LEW A;  5KNH D;  3UQ3 A;  1O5M A;  2V4L A;  5EID A;  4DPR A;  4G8L A;  3C3O A;  4GPM A;  5LCW C;  1NA3 A;  4BX9 A;  2WXK A;  2GRL A;  3CST A;  5KBA A;  1OCZ E;  3ESK A;  4YDY A;  3HHM A;  5H7P A;  1MZC A;  4A1S A;  3CKC A;  4TUU A;  3FUE A;  4U8V D;  3SO8 A;  2BKG A;  5C1D A;  1KT0 A;  1HFA A;  2DYR E;  1NFI E;  3ASF A;  3QK0 A;  2XEE A;  3J5P A;  4O60 A;  3VLD A;  1LF8 A;  4A3T A;  4BY6 A;  4JW1 A;  5D66 A;  4GYW A;  1N4R A;  3GYZ A;  4YND A;  4IYP A;  3D9M A;  2FBN A;  1BU9 A;  2AWI A;  2XPI A;  3I4R B;  1K1A A;  1SZA A;  4L23 A;  2KCK A;  3EHR A;  3RO3 A;  4U07 A;  1D9S A;  3T5X A;  1Z3X A;  3QOU A;  1W3B A;  2IFU A;  3ZUV B;  3UM0 A;  3Q9N C;  2B0O E;  3AJI A;  4AJW A;  3Q75 A;  5BW8 C;  4RG9 A;  2J8S D;  3NOG D;  3I4G A;  4RG6 A;  4WWN A;  3FEY A;  3ZXS A;  4KXK B;  4I17 A;  1EF1 C;  2HR2 A;  4DK5 A;  1BD8 A;  3ULY A;  1EPU A;  4UQZ A;  1XNF A;  1PC2 A;  4MKT A;  3L22 A;  2V0P A;  2KC7 A;  1N9A A;  2LAH A;  2QFC A;  1D8D A;  4CDN A;  4XKB A;  2XRZ A;  4GTQ A;  2XCC A;  4G2V A;  3SBT B;  2GRP B;  2AXV A;  4HXI A;  2I9C A;  1IHB A;  5BUZ A;  1ZU2 A;  4AVX A;  3B7B A;  1OT8 A;  2EQX A;  1QZ2 A;  2IO2 C;  2ZGG A;  1TJF A;  4XI9 A;  2WXJ A;  3ML9 A;  4W9R A;  3U4T A;  2PM6 A;  4U0S A;  1D8E A;  5T3R A;  3FUM A;  4ZFH A;  1UG3 A;  3HYM B;  1SZ9 A;  3ZEF A;  1IHG A;  4CYM D;  1MHQ A;  2X6J A;  2H6G A;  3CKB A;  2KZT B;  4LNG A;  4HOT A;  3UM1 A;  3ENE A;  1UJK A;  3JXI A;  4HOU A;  4N5Q A;  4Q96 A;  4NRH B;  1H2U A;  4CEM A;  5KJM A;  5M72 A;  1QBQ A;  2EIL E;  1OCR E;  3V31 A;  1X81 A;  2LNI A;  2QY7 A;  4KZC A;  4NIK A;  4UWH A;  2UWJ G;  3PZ1 A;  3DEO A;  4HRM B;  2OCC E;  3ZVV A;  3LJ3 A;  2VTB A;  4KZ0 A;  4GU5 A;  3B7T A;  1A5E A;  1N94 A;  3HXD A;  3AG1 E;  1K3Z D;  4B94 A;  3SZ7 A;  4U0Z A;  4ILG A;  3FH8 A;  5FTP A;  4FLB A;  3UIP C;  1ELK A;  2FF4 A;  4HRN A;  5KNG A;  3ZRH A;  3IXE A;  3DSU A;  4MLP A;  1SQM A;  5JA4 D;  2AVP A;  2F0Y A;  3Q7F A;  4HVB A;  2P9I G;  3DSV A;  4PS3 A;  4D10 C;  3ASO E;  3FU5 A;  3Q7A A;  4FC8 A;  3HVE A;  4UWG A;  2OEW A;  1JWG A;  3UKR G;  2VSX E;  2WXI A;  1TEZ A;  4J8E A;  2V4H C;  1NA0 A;  2IEJ A;  4BSX A;  2WB2 A;  4BFR A;  3NZS A;  3ZHE A;  3DWL G;  3EJN A;  4CDR A;  4ABN A;  3JQ0 A;  1BPO A;  4GA2 A;  3B95 A;  3CHS A;  3RAU A;  4F3V A;  5KJK A;  4ACK A; 
#chains in the Genus database with same CATH homology
 4ZHB A;  1S70 B;  5FIN A;  1N0Q A;  3V31 A;  2JAB A;  1DCQ A;  3KEA A;  4K5A B;  3T9K A;  3V79 K;  5ENT D;  1IXV A;  3F6Q A;  2J8S D;  3NOG D;  2Y0B G;  4NIK A;  4C48 B;  2FO1 E;  5HRY A;  3TWU A;  2Y1L E;  5AQ7 A;  4HLL A;  4G8K A;  4LSZ E;  5EYL A;  3DEO A;  2VGE A;  4HRM B;  2L6B A;  5HKP A;  5AQ9 A;  1SVX A;  4DX5 D;  2DVW A;  4HQD A;  4LG6 A;  5CBN A;  3TWS A;  1SW6 A;  4BER A;  1BD8 A;  1UOH A;  4CZ2 D;  2F37 A;  2NYJ A;  3ZU7 B;  3NOC D;  3V30 A;  4DX2 A;  1A5E A;  5KNH D;  1K3Z D;  5CED B;  5EID A;  4G8L A;  4U95 D;  2MYO A;  2ZGD A;  5BXO A;  1TR4 A;  5ENP D;  3V2O A;  1YYH A;  4BSZ B;  3DEP A;  3TWR A;  4GPM A;  5HS0 A;  1BI7 B;  1MX2 A;  4RLY A;  4HB5 A;  4DX7 D;  3NBN B;  5AAR A;  4K5C A;  2ETC A;  2P2C P;  4OAV B;  2AJA A;  4HRN A;  5KNG A;  2DZO A;  1K1B A;  3TWW A;  3IXE A;  3EHQ A;  2ETA A;  3EU9 A;  4HNA D;  4O1P A;  3J5Q B;  3TWT A;  2BKK B;  4DX6 D;  5AAO A;  5KBA A;  3AAA C;  3T8K A;  1AWC B;  5BXU A;  2DWZ A;  5KWD A;  1IHB A;  3W9G A;  2KBX A;  2PNN A;  4YDY A;  5CBO A;  5JA4 D;  5EYP F;  3B7B A;  1MX4 A;  3UTM A;  3W9F A;  3JXJ A;  1OT8 A;  2A5E A;  2XEN A;  2XEH A;  3JUE A;  4F1P A;  4OAU C;  3C5R A;  3TWX A;  3ZNG A;  4U96 D;  4QQI A;  2RFA A;  4DX1 A;  2ZGG A;  4J8Y A;  1OY3 D;  4DUI A;  4YDW A;  2DZN A;  4U8V D;  1MYO A;  4HI9 A;  3SO8 A;  2BKG A;  4F6R D;  3V2X A;  4LNU D;  3UXG A;  1NFI E;  4J7W A;  5AN8 A;  3TWQ A;  2QYJ A;  3LJN A;  2XEE A;  4GMR A;  3HG0 D;  3J5P A;  5JMN D;  4BEP A;  1BI8 B;  4A63 B;  4BES A;  2F8X K;  5CER B;  2QC9 A;  4O60 A;  4U8Y D;  5EN5 D;  1BLX B;  5ENS D;  4UUC A;  5AQB A;  5CEA A;  1YMP A;  1N0R A;  1YCS B;  3Q9U C;  5ENQ D;  2XZD G;  1MX6 A;  4ZFH A;  5D66 A;  5EIL A;  4HBD A;  1G3N B;  3D9H A;  1IKN D;  2ETB A;  1MJ0 A;  4K5B A;  5ITZ F;  2V5Q C;  4BET A;  3TWV A;  1WG0 A;  4HRL A;  4Z68 A;  1WDY A;  1AP7 A;  2V4H C;  2XZT G;  1BU9 A;  4O1O A;  4B93 B;  4CYM D;  3UI2 A;  1DC2 A;  1K1A A;  4QFV A;  5CEC B;  3EHR A;  5ENO D;  5AQA A;  5EIB E;  1QYM A;  4HI8 A;  4JB8 P;  1D9S A;  1N11 A;  2F8Y A;  3JXI A;  3ZUV B;  4N5Q A;  3B95 A;  2KXP C;  5FIO A;  3Q9N C;  2B0O E;  3HRA A;  3AJI A;  4ATZ D;  2HE0 A;  5ENR D;  4DRX E;  4TUM A;  3ZKJ A;  2RFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...