2DCPA

Fully automated nmr structure determination of the enth-vhs domain at3g16270 from arabidopsis thaliana
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
140
structure length
140
Chain Sequence
GSSGSSGESYWRSRMIDAVTSDEDKVAPVYKLEEICDLLRSSHVSIVKEFSEFILKRLDNKSPIVKQKALRLIKYAVGKSGSEFRREMQRNSVAVRNLFHYKGHPDPLKGDALNKAVRETAHETISAIFSEENGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords hypothetical protein (RAFL09-17-B18)
publication title Automated Protein Structure Determination from NMR Spectra
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 40
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2dcpA00
1MHQA 3G2WA 1HG2A 4AVXA 3D9KA 2L0IA 1DVPA 1HF8A 2QY7A 3G2UA 5J08A 2DCPA 1HFAA 3CLJA 3D9MA 1SZ9A 1H0AA 1SZAA 1LF8A 4FLBA 1UJKA 1X5BA 5LP0A 4HFGA 2LO6A 2DIWA 3D9JA 3D9LA 4NACA 3LDZA 1JPLA 3ZYQA 3ZYMA 1JWGA 1HX8A 5CMWA 3ONKA 1VDYA 1EDUA 2BF0X 4FU3A 4Q96A 5CMYA 1JWFA 4GZDA 3D9PA 3ONLA 4Q94A 3G2VA 1UJJA 1EYHA 3D9OA 1PY1A 1ELKA 3G2SA 3D9IA 3ZYLA 1XGWA 2L0TB 1HG5A 2MOWA 3D9NA 2KM4A 2V8SE 3G2TA 1JUQA 5LOZA 4JXTA 4GZCA 3RRUA 1INZA 3ZYKA
chains in the Genus database with same CATH superfamily
5T4YA 4KBQA 2CHWA 3OXFA 3SBSA 1NL4A 3QK0A 5CCLA 1N11A 3ABKE 2HE0A 1UN9A 5D0OD 3SQVA 2V4LA 1IQRA 4G2VA 1BPOA 5FJYA 2J08A 1KZOA 4K5AB 3Q79A 3C3OA 4K5CA 3TG4A 2I1JA 3B7BA 2DIWA 3QC1A 3NB2A 3IKOB 3SFXA 1N4QA 2H6GA 4GTMA 4YVOA 3ZNGA 4C0EA 4KZ0A 4GZCA 4B93B 5KNHD 3DXKG 5FINA 5JJ7A 3CKCA 4N5CA 1WDYA 1UJJA 3TG5A 4B89A 1TN8A 3V2XA 4F1SA 2DYRE 1LF8A 5LP0A 1OCCE 1E8YA 3D9LA 3KEAA 2H6HA 4A55A 2HR2A 3SI5A 2R02A 4Q96A 3G2SA 4N2QA 3SBTB 4HLEA 1SW6A 2BTDA 4YDWA 1MJ0A 2CG2A 3V31A 2GRQB 3NBNB 3FU6A 3SO8A 2LXMA 4M3OA 4GZDA 3HG0D 2FULA 1EYHA 4FULA 3FTUA 1TEZA 3RIBA 3PZ3A 3DSXA 3RO3A 4U63A 3PS6A 3EHMA 3LXUX 4J8DA 5EN5D 2XCCA 3TGOA 1WAO1 3UI2A 4UWHA 2DBAA 4AXHA 2PM7A 2CFUA 2M63A 4A1GA 1SVXA 2IFUA 3AS5A 4TRQA 5CMYA 1E8WA 4CT4A 2WXFA 2EIME 3I4GA 3UKUG 3KSLA 3SNXA 3UT4A 3EJNA 4MBGA 3FTVA 3FEYA 3O4ZA 3FEXA 2A5UA 4HOUA 2AJAA 4PS7A 1Y8MA 2J07A 1ZB1A 5BXUA 3Q7AA 4WAFA 3RO2A 3N71A 2UY1B 1Q2ZA 1INZA 4GTRA 4BTAA 1MZCA 1K1AA 3CLJA 2RD0A 2NYJA 3S7FA 5FWQA 3FUNA 5G04C 2L9BA 4I6EA 2WM9A 1RW2A 3ABME 4X8QA 4B8CB 3VLEA 4B94A 4DLOA 3ISMC 1N0QA 3AG3E 4XEIG 5J08A 4GPMA 4HNAD 3JCKC 4CDNA 3W9FA 5AQ7A 1IQUA 4O6FA 5JHAA 2GRRB 1QBQA 2R05A 3CHQA 1V54E 3CVLA 4E6HA 2NSZA 4G8KA 2V8SE 4HVBA 4KYOB 4U8VD 3ZN3A 3AG2E 3S7JA 4EBAA 3B95A 4UWKA 5JMND 3BEEA 3KS2A 5CBNA 4G24A 4F6RD 3IXEA 2P9LG 3CHMA 4LSZE 3PE4A 3UIPC 5BXOA 1OT8A 2C2LA 2X6FA 4J8YA 3DSTA 3EIJA 3LEWA 1WM5A 1DC2A 3HVEA 4YDEA 3UT7A 1TNYA 4DX6D 3TWTA 1IHGA 4BT8A 3TXNA 3Q4AB 3DSWA 1SA5A 4J6IA 4UI9J 3SY2A 4G1TA 2BKKB 5AQ9A 1JWFA 3ONLA 3TXMA 3FHEA 2DZNA 1HG5A 2GGFA 3RU0A 2KBXA 5JHBA 5CCMA 2CHXA 4MKTA 2XZTG 3RKVA 4FLBA 4GTOA 4BWRA 4RVBA 3CHPA 5BV0A 2R5SA 4JB8P 4ZFHA 3ASFA 2R03A 4JD2G 3UM3A 2ONDA 4WWPA 2XS1A 1MX6A 2L0TB 1YA0A 5BT1A 2X6IA 5LFAA 2LUHA 1OWOA 1SZ9A 3CIAA 2UY1A 4BX9A 3FTZA 4N5QA 3L22A 4I9CA 4HB5A 4BETA 5A6CA 4YDOA 4PS3A 4Z68A 5HI7A 3TAXA 3R7RA 5ENOD 5FQ7A 2ZIRA 5FZRA 4C9BB 2P58C 3EHQA 2LAHA 3VTYA 1BI7B 2Y1LE 5CECB 3VLDA 2BEDA 1D9SA 1E8XA 3FU5A 3FUFA 2WQ7A 1ZU2A 4I2WA 4GTTA 3BUAA 2P9NG 4NQ0A 2IU1A 4A63B 3W9GA 2J4DA 5BPPA 3U64A 2AXVA 1MHQA 1HF8A 5ENTD 4NURA 3R9MA 4HORA 3P1UA 3FUHA 3PE3A 3GZ1A 3MYVA 2QZAA 1K3ZD 3PDNA 3UQ3A 3RRUA 2PQRA 3FU0A 3Q78A 4MLPA 3CV0A 3LY7A 2GRPB 4TUMA 4OVVA 1N94A 1TJCA 5EX0A 4RG6A 2F8XK 2L6JA 4OAUC 3Q73A 4FU3A 5E76A 3G2VA 3IEGA 2VSYA 4JZYA 2CG3A 1X81A 4TXQA 2WMOA 1MX2A 3HXEA 2LSVA 1HZ4A 4BY6A 4BT9A 4J0UA 2ZU6B 5D66A 2A5EA 3APFA 3PVLA 3QKYA 3CVVA 4XI0A 5G55A 4GA2A 4UI9C 4GZ3A 1H6KA 5CMWA 3QWWA 1HS6A 4O60A 3FTXA 3TWQA 4BFRA 3D9IA 2A4ZA 4ILHB 1WY6A 1JUQA 3CVQA 4OAVB 4KZCA 3T9KA 2PL2A 1OCZE 5E75A 4E85A 4N3CA 4QQIA 4HXIA 4HQDA 4U0SA 5KCMA 5EILA 4PUCA 4ACLA 2WXQA 3OTNA 1XGWA 4Q69A 4CT0A 4JXTA 3UXGA 5G05J 4AM9A 3CK7A 1TNUA 3HXDA 2LSUA 5AQBA 3DSVA 3SFYA 2I2OA 4U95D 3NQPA 1NI1A 5D0QD 4KVOA 2XENA 1U2VG 3RRMB 4GAAA 4NIKA 3IV0A 4GA0A 3PZ2A 3UM0A 4AP2A 2P9UG 2EINE 2AXUA 2EIKE 4NACA 2RFAA 4LNBA 1QQEA 2WXLA 4LG6A 3UTMA 2J09A 4IULA 4XE0A 3CK9A 1N9AA 3VTXA 4ME2A 5EYLA 2KATA 4GZ5A 3SF4A 3OXLA 2GRNB 4BEPA 4JHRA 1OCOE 4I9EA 3LYAA 5JJTA 3QOUA 2FO7A 3PUKA 4GTVA 5D2MC 1O5MA 1OUVA 5KJNA 3F6QA 1OWLA 3UKRG 1HXIA 2IOLA 4N3AA 5AN8A 2XHEA 2AWIA 4F3VA 1Z5SC 3CKBA 4ANXA 4F53A 4UQYA 5CEDB 2WXGA 3U9WA 3CVXA 1S63A 1D8EA 3FUIA 4CDRA 2OVFA 3DEPA 4TXRA 2WXOA 4EZKA 4DI3A 2H6FA 4A3VA 4YVQC 2RFMA 3HXBA 1TYQG 4XIFA 3WXXA 3AS8A 2HO1A 5IY5E 4AVXA 4C48B 2WPVA 3G2UA 1N95A 3U66A 3PNLB 3E4BA 3HVEB 5A23A 3NF1A 3TWXA 4HLLA 5EDSA 3RRNB 4JHKA 3E32A 3LKUA 3U3WA 4JPSA 1TNOA 4GYYA 2QFCA 4LERA 4P29A 5ENPD 3PRZA 2ETCA 3UT8A 4APOA 4GMRA 2VSOE 3D9PA 2MYOA 2E2EA 2X6HA 1KLXA 3ZKJA 1NP7A 4U96D 3FP3A 3HRAA 4APFA 2YINA 3TWRA 2KXPC 2Y4UA 3C72A 2Y3AA 2ILRA 3DWLG 1JWGA 3FULA 3DPDA 1FPPA 1Z6TA 4CGWA 3FDHA 5BUZA 1JCQA 2V5QC 3MV3B 4DX1A 3DXMG 2PM6A 4LNGA 4HS2A 2H6IA 4HOQA 3SFZA 2P9SG 2AXZA 2GRLA 2IOSA 4WNEA 2XZDG 2ZISA 1ELKA 2WXMA 2Y0BG 3OXGA 5CRUA 3GZ2A 3FFLA 3J5PA 3RSEG 1P5QA 1B89A 2WQ6A 2VGEA 4J7WA 1H2VC 4K03A 3R7QA 3ASHA 3WG7E 3FUKA 3PREA 4GTSA 4RG9A 4U7EB 2AW6A 4BSXA 4Y6WA 2V5FA 2WXHA 3ZYKA 3DSUA 4LNUD 4AV7A 3DRAA 3NOGD 4J8EA 1DVPA 4U0ZA 1QNFA 2GROB 4DRXE 3MV2B 4G23A 1UW4B 1EDUA 3V2OA 2FO1E 4LUNU 1AWCB 5LCWJ 1PY1A 2F0YA 1OY3D 4TV3A 1E90A 5AENA 1BD8A 5BV1A 3ML9A 3HIZA 3K9IA 2WXPA 3CHOA 3PZ4A 4MS6A 4YDYA 2XGSA 4EZLA 4UI9K 3MJWA 4HRLA 4ANWA 2VGYA 2WQHA 4WNDA 4YNDA 5EYPF 4XZ4A 4HOTA 5AYWD 3IHYA 3FU3A 4GCOA 2JLBA 5ANLA 5KJMA 4J8SA 1O1RA 4LEUA 3APDA 3ZFWA 1XNFA 4HRNA 1QYMA 3QWVA 3D9HA 3TWVA 2R17C 2VSXE 5ENRD 4I6JA 3UINC 1Y6IA 3BG0B 2VGXA 2WMNA 4I1AA 1DCEA 5M72A 3HXFA 4ATZD 3D9KA 2Y4TA 2YNQA 4IYPA 4EZJA 1S0PA 4KXKB 4GTQA 4I1MA 1ELWA 3SD5A 3ML8A 4K0RA 4JEUA 1E8ZA 1NZNA 2XEEA 1LTXA 3FUMA 4BERA 2XGMA 3PZDA 4FP7A 4WWNA 3D9MA 4V3IA 1LD8A 3AU4A 4EQFA 4HFGA 1EPUA 4IRUA 4TUUA 1OWMA 3JUIA 2V0PA 1EF1C 4JC8A 5ARFA 1KZPA 3D9OA 4EBAG 3MEKA 1TNZA 3ZIMA 1Z3XA 4FLHA 4QFVA 4ILIA 3B7RL 2L0IA 3J5QB 4AJWA 1NA3A 2P9KG 4R7LA 1TN6A 3FTSA 3MX3A 3TWWA 3AS4A 3IBEA 3R9AB 5ITZF 2KZTB 5EIBE 2VSNA 3EIQC 4PH4B 4DLQA 4DPRA 3Q7FA 3APCA 3ZVVA 3FTYA 3ZHEB 4UQZA 3ASDA 3MKQA 4U8YD 2NXPA 4CRWA 3JYSA 4EECA 3CHRA 3D9JA 4DK5A 3LDZA 3QNKA 5B1BE 1TJFA 4XKBA 2IO3C 3BQOA 4CEMA 3Q15A 5HRYA 4CZ2D 1HE8A 3ZPJA 4JL0A 2OOEA 5LOZA 3CQCB 1YCSB 3T8MA 1HO8A 2F8YA 3P2BA 1BU9A 1HG2A 5B1AE 3Q47B 4FHJA 1E7UA 4B0ZA 4XKCA 5FIOA 4FJZA 4ATGA 3FH8A 2LAIA 2ETAA 4DX2A 5AAOA 4FJYA 2IO2C 5LCWC 4JA7A 3PEUB 2BKGA 2Q7FA 2EQXA 4C0MA 1KT0A 2VYIA 3AG1E 3RAUA 2WXKA 4W9RA 1JPLA 4NRHB 1ZBPA 4J8FA 1H19A 3X2QE 3NZSA 1D8DA 4TXPA 4XI9A 4L7TA 3CSTA 5ENNA 4I17A 2XPYA 2BUGA 3NZUA 2PQNA 3KAEA 3QB2A 5AIJA 5ENQD 4I2ZA 4O1OA 3C98A 4FA6A 4LRZA 1IHBA 1KT1A 3LJNA 5H7PA 1UOHA 4PS8A 4AIFA 2QYUA 3PEVB 2X6JA 2WB2A 4WUYA 3E34A 2YQ8A 4I1OB 3FUJA 4MRUA 3EU9A 3ZXSA 2VQ2A 2RG8A 3ZUVB 1FT2A 1A5EA 2RKKA 3OAWA 1HU3A 1N4SA 2QY7A 2YHEA 2HYZA 2XS8A 1N4PA 1OWNA 5CRVA 3MZLB 3QDNA 1VDYA 2CFZA 4LCTA 2KZTA 4GB9A 1PC2A 3DPYA 4L9PA 3CSFA 2KCKA 4ANVA 3LY9A 3L6AA 5A7DB 3LCAA 2KCVA 3ZHEA 3ZU7B 1UN8A 2LXLA 5BNWA 1HH8A 1JCSA 2PZIA 4G11A 2XPZA 5HKPA 3S7DA 3ASOE 3GYZA 1H6PA 2CHZA 3AG4E 1DNPA 2Y69E 4I43A 3LJ3A 5HQ8A 3C5RA 5G04J 3ASGA 4EPZA 1KPSB 2OEVA 3CVUA 4HI9A 4G8LA 3JQ1A 2P9PG 2QYJA 3FH7A 3L82A 3Q5MA 3QAQA 4BX8A 4XX5A 1OCRE 4L1BA 2GW1A 3ZW3A 4CCAA 4IN3B 3GZSA 3RJVA 4DX7D 4CDMA 5CEAA 3QARA 2X6KA 3ZEFA 4U04A 5FZSA 1IKND 4ACKA 3SGHA 3QWPA 3DBSA 1E96B 1YYHA 3ESKA 1NFIE 2ETBA 2B6CA 1FVFA 2MHKA 1S70B 4AY5A 3CHSA 4DUIA 3ESLA 5AJDA 5HS0A 3LY8A 3Q49B 2QC9A 5JA4D 4RLYA 2WXIA 4O1PA 4UWFA 3ONKA 1MYOA 2VTBB 3CR3A 4HOSA 1UG3A 3ZYLA 2KC7A 4GPKA 3FUEA 4N39A 2C0LA 3LS8A 5C1DA 3EUVA 2XQ0A 2EIJE 4F1PA 3I5PA 3LPZA 3B7SA 1H2TC 3D9NA 3UM2A 2HM8A 3E33A 3LVQE 2FBNA 5BW8C 3TWUA 2R2LA 2OV8A 3JXJA 3ZYQA 4ZHBA 2VGXB 1E7VA 2MRIA 4U8HA 4EHMA 3L16A 1LD7A 2IONA 5FQ8A 4AOFA 5G05C 5KBAA 3UUXA 3SZ7A 3JXIA 3Q9UC 2P2CP 5FT9A 3FY4A 3I4RB 2YHCA 4JVSA 3L13A 2WXJA 2J49A 3CVPA 3AU5A 3CVWA 3CQGB 3G2WA 4GMJA 4KMOA 4GTPA 3JUEA 2DZOA 3HXCA 3PZ1A 3PNTB 3ZYMA 3L54A 1MX4A 2XRZA 1ELRA 2R59A 4G26A 5EKQD 4GU5A 2V4HC 1AP7A 1N52A 5DIZA 4UWGA 3Q9NC 2XEHA 5KNGA 2IF4A 5ARGA 3MKQB 3URZA 1FT1A 1L5JA 3CVNA 4JEHA 2DWZA 4M7CA 3ASNE 5T3RA 1PAQA 2XEVA 3DSSA 2WXNA 2GRMA 4U07A 1JCRA 5AQAA 3S2AA 5KJLA 3GW4A 5G2NA 3C3RA 1N4RA 4L2YA 3UM1A 3ZGQA 3E37A 3S7BA 4GYOA 3TJPA 1RZ4A 2VTBA 2PNNA 4CYMD 5KWDA 1Z3YA 2IY0C 5JJ6A 3KD7A 2VJ8A 5EIDA 1G3NB 5FTPA 5CHEE 2XCBA 3CEQA 4A3TA 1DCQA 4WNGA 2WVIA 5T8IA 4GMLA 3KEZA 3PH0C 4AY6A 3BU8A 5EX3A 1H2UA 2ZXWE 3EDTB 2UWJG 2F37A 2MOWA 4GYWA 5AJLA 1FVHA 3QJZA 2XRYA 3JQ0A 4GZ6A 4HRMB 2FF4A 4KT6B 5B3SE 4CGVA 3CVYA 3T8KA 3UIOC 1IXVA 4BESA 4GA1A 4WNFA 3U4TA 3NOCD 2I6HA 4B8AA 5C2YA 3RK6A 5DBKA 1WG0A 4I6GA 4BTBA 3FWVA 3NAWA 2KCLA 4FHKA 3ULYA 2P9IG 3ULEG 4A1SA 5LX8A 3AJIA 3EHNA 1IYGA 1N0RA 1S64A 2I9CA 2FI7A 1O1TA 1N54A 1U3DA 4JW1A 2X38A 4FADA 4JA9A 4KVMA 3E30A 3TWSA 2ZGDA 2LNIA 3V79K 4OVUA 4UWLA 3D3MA 1K1BA 2KM4A 2B0OE 3ENEA 4RQIA 4PDXA 3O48A 2I1KA 4DJAA 3IHVA 1SA4A 3MGBA 3UX4A 4HBDA 3T5XA 1TNBA 2AVPA 3HDXA 4UQXA 4L23A 2IJGX 2C0MA 2WXRA 5AARA 5J90A 1H0AA 2E0IA 1K8KG 4H7XA 3ZXPA 3Q75A 1V55E 3FH5A 1BLXB 4Y6CA 2OEWA 5FZQA 2ZGGA 1SQMA 1FCHA 3G2TA 3MCXA 2EILE 3LVRE 4N3BA 4HI8A 3I3NA 4D10C 4FC8A 5CBOA 4H7YA 1UJKA 5CERB 1HX8A 4DX5D 4RSYA 1YMPA 3B7TA 5KJKA 4UUCA 3HYMB 1U3CA 1O1SA 1W3BA 2J9QA 3UPVA 4F7AA 2DCPA 2XPIA 1NA0A 2OVBA 3C3QA 1OXJA 4JHJA 3T5VA 3L08A 3L17A 3L9TA 5ANRA 3PUJA 3V30A 2IEJA 3BG1B 5FQ6A 3ZRHA 3ULQA 3EHRA 4OYSA 3ABLE 1TN7A 2J8SD 1MQSA 1X5BA 4N2SA 4K5BA 3EU5A 1H6OA 2NC9A 3MKRA 1A17A 3B7UX 2DYSE 4DI4A 3TL5A 1OWPA 3SHFA 3DEOA 4AEZC 1TR4A 4G25A 2IQCA 1SZAA 2J4BA 4ANUA 4URKA 4WWOA 3FUDA 3VLFA 1QZ2A 2XGOA 1GW6A 2OCCE 2FEZA 2BF0X 3UMVA 5FQ4A 3B13A 2JABA 2X3MA 5ENSD 1BI8B 4ABNA 2DVWA 1HFAA 2JEKA 4L2LA 3CK8A 2L6BA 2LO6A 3AAAC 4GCNA 3FTWA 3KSQA 4ILGA 3CGHA 4Q94A 3MA5A 4BSZB 3HHMA 4U0UA
chains in the Genus database with same CATH topology
3FU0A 5ANLA 5T4YA 4AOFA 4KBQA 5KJMA 4MLPA 4J8SA 2CHWA 3OXFA 5G05C 3SBSA 3CV0A 3LY7A 4LEUA 3APDA 3QK0A 4OVVA 3ZFWA 3UUXA 1XNFA 1TJCA 5EX0A 5CCLA 3SZ7A 5FT9A 3FY4A 3I4RB 2YHCA 4RG6A 2L6JA 3QWVA 4JVSA 1UN9A 2R17C 2VSXE 4I6JA 3L13A 4FU3A 5E76A 5D0OD 2WXJA 3G2VA 3IEGA 1Y6IA 3BG0B 2VSYA 2VGXA 2J49A 2V4LA 1IQRA 2WMNA 4JZYA 4I1AA 2CG3A 4G2VA 3CVPA 3AU5A 1BPOA 5M72A 5FJYA 2J08A 3CVWA 3CQGB 3G2WA 2WMOA 4GMJA 4KMOA 3D9KA 2Y4TA 3TG4A 2YNQA 4IYPA 4EZJA 1S0PA 2I1JA 4KXKB 4I1MA 1ELWA 3PNTB 3SD5A 2DIWA 2LSVA 3ML8A 3QC1A 4K0RA 1HZ4A 4JEUA 3ZYMA 3L54A 4BY6A 2XRZA 4BT9A 3IKOB 2ZU6B 4J0UA 1ELRA 2R59A 4G26A 1E8ZA 5EKQD 1NZNA 4GU5A 3APFA 4YVOA 3PVLA 4C0EA 4KZ0A 4GZCA 3FUMA 3QKYA 2XGMA 3PZDA 1N52A 4FP7A 5DIZA 4UWGA 4WWNA 2IF4A 3D9MA 4V3IA 3AU4A 3CVVA 4XI0A 4HFGA 5G55A 4EQFA 4GA2A 4UI9C 1EPUA 4IRUA 4GZ3A 1H6KA 1OWMA 4TUUA 3JUIA 2V0PA 5CMWA 5JJ7A 1EF1C 3CKCA 3QWWA 4JC8A 4N5CA 1HS6A 5ARGA 5ARFA 3FTXA 1UJJA 3MKQB 3D9OA 4EBAG 3MEKA 3URZA 4BFRA 3CVNA 1L5JA 3D9IA 2A4ZA 4JEHA 3ZIMA 3TG5A 4ILHB 1Z3XA 4B89A 1WY6A 1JUQA 4FLHA 4QFVA 3CVQA 1PAQA 5T3RA 4ILIA 2XEVA 3B7RL 4KZCA 2L0IA 4AJWA 4F1SA 1NA3A 2WXNA 2GRMA 2PL2A 4R7LA 5E75A 3FTSA 1LF8A 4U07A 3MX3A 5LP0A 1E8YA 3S2AA 5KJLA 4E85A 3D9LA 3AS4A 3GW4A 3IBEA 5G2NA 3R9AB 4A55A 2HR2A 4N3CA 2KZTB 2VSNA 4HXIA 3SI5A 3EIQC 4PH4B 4DLQA 4U0SA 4Q96A 5KCMA 4DPRA 4PUCA 4ACLA 2WXQA 3APCA 3G2SA 4L2YA 3ZVVA 4N2QA 3ZGQA 3SBTB 3OTNA 1XGWA 3FTYA 4Q69A 4CT0A 4HLEA 3S7BA 4GYOA 2BTDA 3ZHEB 4UQZA 3ASDA 4JXTA 3TJPA 2VTBA 3MKQA 5G05J 4AM9A 3CK7A 2NXPA 2LSUA 2CG2A 4CRWA 3JYSA 1Z3YA 4EECA 3CHRA 3D9JA 3FU6A 4DK5A 3LDZA 5JJ6A 3QNKA 2I2OA 1TJFA 4XKBA 3NQPA 4M3OA 4CEMA 5D0QD 4GZDA 2FULA 3Q15A 1EYHA 4FULA 1HE8A 3FTUA 4KVOA 3KD7A 4JL0A 2VJ8A 3ZPJA 1TEZA 3RIBA 4GAAA 3RRMB 2OOEA 5LOZA 3CQCB 5FTPA 5CHEE 3RO3A 3T8MA 4U63A 2XCBA 3IV0A 1HO8A 3PS6A 4GA0A 3EHMA 3LXUX 3P2BA 1HG2A 3CEQA 4J8DA 4AP2A 2XCCA 4A3TA 4WNGA 3Q47B 3TGOA 1WAO1 2AXUA 2WVIA 4UWHA 2DBAA 4FHJA 4AXHA 1E7UA 4NACA 4GMLA 5T8IA 2PM7A 1QQEA 2CFUA 3KEZA 4XKCA 4FJZA 4B0ZA 3PH0C 4ATGA 2WXLA 2M63A 3FH8A 4A1GA 4AY6A 2LAIA 5EX3A 2IFUA 3AS5A 4FJYA 4TRQA 5CMYA 1H2UA 1E8WA 4CT4A 5LCWC 4JA7A 2WXFA 2J09A 3EDTB 4IULA 3PEUB 3CK9A 2UWJG 4XE0A 3VTXA 2Q7FA 2EQXA 3I4GA 4ME2A 2MOWA 4C0MA 3HHMA 4GYWA 1KT0A 2KATA 3SNXA 4GZ5A 5AJLA 3SF4A 3UT4A 1FVHA 2VYIA 3EJNA 3OXLA 3QJZA 3FTVA 2WXKA 2XRYA 3FEYA 3JQ0A 4GZ6A 3O4ZA 4JHRA 4W9RA 4I9EA 2FF4A 3LYAA 3FEXA 1JPLA 4KT6B 4NRHB 5JJTA 2A5UA 4CGVA 1ZBPA 4HOUA 4J8FA 3CVYA 1H19A 3QOUA 3NZSA 4PS7A 2FO7A 1Y8MA 4XI9A 4L7TA 2J07A 3CSTA 5ENNA 3PUKA 4GA1A 4WAFA 3RO2A 4I17A 3N71A 1OUVA 2XPYA 2UY1B 2BUGA 4WNFA 1OWLA 3NZUA 3U4TA 5KJNA 1INZA 2I6HA 2PQNA 3KAEA 3QB2A 4B8AA 4BTAA 5AIJA 5C2YA 1HXIA 2IOLA 3CLJA 3RK6A 4I2ZA 5DBKA 2RD0A 4N3AA 3S7FA 2XHEA 3C98A 5FWQA 4FA6A 4LRZA 3FUNA 4I6GA 2AWIA 3FWVA 5G04C 4BTBA 2L9BA 4F3VA 4I6EA 2WM9A 2KCLA 3CKBA 1KT1A 4ANXA 4F53A 4FHKA 4UQYA 4A1SA 4PS8A 5LX8A 4B8CB 2WXGA 4AIFA 3U9WA 3CVXA 3PEVB 3VLEA 3EHNA 4B94A 4DLOA 1IYGA 2X6JA 3FUIA 4CDRA 2OVFA 5J08A 2I9CA 2WXOA 2WB2A 3JCKC 4CDNA 2FI7A 4WUYA 1IQUA 4O6FA 2YQ8A 4EZKA 1N54A 4I1OB 1U3DA 3FUJA 4JW1A 5JHAA 4DI3A 2X38A 4FADA 4JA9A 4A3VA 4MRUA 4KVMA 3CHQA 3ZXSA 2LNIA 4OVUA 2VQ2A 2RG8A 3CVLA 4UWLA 4E6HA 3D3MA 4YVQC 2NSZA 2KM4A 2V8SE 3OAWA 4HVBA 4XIFA 4KYOB 1HU3A 3WXXA 3AS8A 2HO1A 3ENEA 4AVXA 2WPVA 3G2UA 2QY7A 4PDXA 3ZN3A 3O48A 2I1KA 3U66A 2YHEA 3PNLB 3S7JA 2HYZA 3E4BA 4DJAA 3IHVA 4EBAA 3HVEB 4UWKA 5A23A 3NF1A 3BEEA 3MGBA 1OWNA 3UX4A 3T5XA 5EDSA 3MZLB 3QDNA 3RRNB 1VDYA 4JHKA 2AVPA 3KS2A 4G24A 3HDXA 3LKUA 3U3WA 2CFZA 4LCTA 4JPSA 2KZTA 4UQXA 4L23A 4GB9A 4GYYA 2IJGX 3CHMA 1PC2A 2QFCA 4LERA 3CSFA 2C0MA 2KCKA 4P29A 2WXRA 4ANVA 3LY9A 3L6AA 3PE4A 5A7DB 3PRZA 5J90A 3LCAA 1H0AA 2E0IA 2KCVA 3ZHEA 1UN8A 2C2LA 2X6FA 4H7XA 5BNWA 1HH8A 3EIJA 3FH5A 3LEWA 2PZIA 4G11A 3UT8A 2XPZA 1WM5A 4APOA 2VSOE 3S7DA 3HVEA 4Y6CA 3D9PA 3UT7A 5FZQA 1SQMA 2E2EA 2X6HA 1FCHA 1KLXA 3G2TA 3GYZA 3MCXA 2CHZA 1NP7A 3FP3A 3LVRE 4N3BA 1DNPA 2YINA 4APFA 4I43A 3I3NA 1IHGA 4D10C 4BT8A 4FC8A 3TXNA 3Q4AB 3LJ3A 4H7YA 1UJKA 5HQ8A 2Y4UA 5G04J 4J6IA 4UI9J 2Y3AA 3ASGA 2ILRA 4EPZA 4G1TA 3CVUA 1JWGA 1HX8A 3FULA 3JQ1A 3DPDA 4RSYA 1Z6TA 1JWFA 3ONLA 3TXMA 4CGWA 3FDHA 3B7TA 3FH7A 5KJKA 5BUZA 3FHEA 3HYMB 3Q5MA 1HG5A 2GGFA 3QAQA 1U3CA 3MV3B 4XX5A 3RU0A 4BX8A 4L1BA 2GW1A 1W3BA 2PM6A 4IN3B 3ZW3A 4CCAA 5JHBA 2J9QA 5CCMA 3GZSA 3UPVA 4HS2A 4F7AA 2CHXA 3RJVA 2DCPA 4MKTA 2XPIA 4CDMA 4HOQA 1NA0A 3SFZA 3RKVA 4FLBA 4BWRA 4RVBA 3CHPA 5BV0A 3RRUA 2OVBA 2R5SA 2AXZA 2X6KA 3QARA 3ZEFA 3ASFA 4JHJA 2GRLA 2IOSA 4U04A 5FZSA 4WNEA 3T5VA 4ACKA 3SGHA 3QWPA 3DBSA 1E96B 2ONDA 3L08A 4WWPA 3L17A 5ANRA 3ESKA 1ELKA 1FVFA 3PUJA 2L0TB 2WXMA 1YA0A 2MHKA 3OXGA 3GZ2A 4AY5A 3FFLA 3CHSA 5BT1A 3BG1B 1P5QA 2X6IA 5FQ6A 3ZRHA 3ULQA 3ESLA 5AJDA 5LFAA 3LY8A 4OYSA 1B89A 2WQ6A 1OWOA 1SZ9A 3CIAA 3Q49B 2UY1A 1MQSA 1X5BA 1H2VC 4BX9A 3FTZA 4K03A 3R7QA 2WXIA 3ASHA 4N2SA 3L22A 4I9CA 5A6CA 4UWFA 3ONKA 3FUKA 4PS3A 2NC9A 3PREA 3MKRA 2VTBB 5HI7A 3TAXA 3CR3A 1A17A 3R7RA 4HOSA 4RG9A 3B7UX 1UG3A 3ZYLA 2AW6A 4BSXA 2KC7A 4Y6WA 2V5FA 4DI4A 2WXHA 3FUEA 4GPKA 5FQ7A 3TL5A 1OWPA 4N39A 2C0LA 3SHFA 3ZYKA 3LS8A 5FZRA 4AV7A 2P58C 4C9BB 4J8EA 4AEZC 5C1DA 1DVPA 2LAHA 4G25A 2IQCA 4U0ZA 1QNFA 3VTYA 1SZAA 3MV2B 2J4BA 4ANUA 4URKA 4WWOA 4G23A 3VLDA 3FUDA 2XQ0A 1E8XA 3FU5A 3FUFA 1UW4B 3VLFA 2WQ7A 1QZ2A 1ZU2A 2XGOA 4I2WA 1GW6A 2FEZA 3I5PA 1EDUA 2BF0X 3UMVA 4LUNU 5FQ4A 3B13A 5LCWJ 1PY1A 3LPZA 4NQ0A 3B7SA 2IU1A 1H2TC 3D9NA 2X3MA 2J4DA 1E90A 2HM8A 4TV3A 5AENA 5BPPA 5BV1A 3U64A 3ML9A 2AXVA 3LVQE 1MHQA 3HIZA 4ABNA 1HF8A 2FBNA 1HFAA 2JEKA 4L2LA 4NURA 5BW8C 3K9IA 3CK8A 2WXPA 3CHOA 4MS6A 2LO6A 2OV8A 2XGSA 4EZLA 3ZYQA 4HORA 4GCNA 2VGXB 4UI9K 3MJWA 3FTWA 1E7VA 3P1UA 4ANWA 2VGYA 2WQHA 3FUHA 3PE3A 3GZ1A 4WNDA 3MYVA 4YNDA 2MRIA 3CGHA 4ILGA 4Q94A 4U8HA 3MA5A 4XZ4A 4HOTA 5AYWD 3IHYA 3L16A 3FU3A 2IONA 4GCOA 3PDNA 2JLBA 3UQ3A 5FQ8A 2PQRA 4U0UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MHQ A;  3G2W A;  1HG2 A;  4AVX A;  3D9K A;  2L0I A;  1DVP A;  1HF8 A;  2QY7 A;  3G2U A;  5J08 A;  2DCP A;  1HFA A;  3CLJ A;  3D9M A;  1SZ9 A;  1H0A A;  1SZA A;  1LF8 A;  4FLB A;  1UJK A;  1X5B A;  5LP0 A;  4HFG A;  2LO6 A;  2DIW A;  3D9J A;  3D9L A;  4NAC A;  3LDZ A;  1JPL A;  3ZYQ A;  3ZYM A;  1JWG A;  1HX8 A;  5CMW A;  3ONK A;  1VDY A;  1EDU A;  2BF0 X;  4FU3 A;  4Q96 A;  5CMY A;  1JWF A;  4GZD A;  3D9P A;  3ONL A;  4Q94 A;  3G2V A;  1UJJ A;  1EYH A;  3D9O A;  1PY1 A;  1ELK A;  3G2S A;  3D9I A;  3ZYL A;  1XGW A;  2L0T B;  1HG5 A;  2MOW A;  3D9N A;  2KM4 A;  2V8S E;  3G2T A;  1JUQ A;  5LOZ A;  4JXT A;  4GZC A;  3RRU A;  1INZ A;  3ZYK A; 
#chains in the Genus database with same CATH topology
 5T4Y A;  4KBQ A;  2CHW A;  3OXF A;  3SBS A;  1NL4 A;  3QK0 A;  5CCL A;  1N11 A;  3ABK E;  2HE0 A;  1UN9 A;  5D0O D;  3SQV A;  2V4L A;  1IQR A;  4G2V A;  1BPO A;  5FJY A;  2J08 A;  1KZO A;  4K5A B;  3Q79 A;  3C3O A;  4K5C A;  3TG4 A;  2I1J A;  3B7B A;  2DIW A;  3QC1 A;  3NB2 A;  3IKO B;  3SFX A;  1N4Q A;  2H6G A;  4GTM A;  4YVO A;  3ZNG A;  4C0E A;  4KZ0 A;  4GZC A;  4B93 B;  5KNH D;  3DXK G;  5FIN A;  5JJ7 A;  3CKC A;  4N5C A;  1WDY A;  1UJJ A;  3TG5 A;  4B89 A;  1TN8 A;  3V2X A;  4F1S A;  2DYR E;  1LF8 A;  5LP0 A;  1OCC E;  1E8Y A;  3D9L A;  3KEA A;  2H6H A;  4A55 A;  2HR2 A;  3SI5 A;  2R02 A;  4Q96 A;  3G2S A;  4N2Q A;  3SBT B;  4HLE A;  1SW6 A;  2BTD A;  4YDW A;  1MJ0 A;  2CG2 A;  3V31 A;  2GRQ B;  3NBN B;  3FU6 A;  3SO8 A;  2LXM A;  4M3O A;  4GZD A;  3HG0 D;  2FUL A;  1EYH A;  4FUL A;  3FTU A;  1TEZ A;  3RIB A;  3PZ3 A;  3DSX A;  3RO3 A;  4U63 A;  3PS6 A;  3EHM A;  3LXU X;  4J8D A;  5EN5 D;  2XCC A;  3TGO A;  1WAO 1;  3UI2 A;  4UWH A;  2DBA A;  4AXH A;  2PM7 A;  2CFU A;  2M63 A;  4A1G A;  1SVX A;  2IFU A;  3AS5 A;  4TRQ A;  5CMY A;  1E8W A;  4CT4 A;  2WXF A;  2EIM E;  3I4G A;  3UKU G;  3KSL A;  3SNX A;  3UT4 A;  3EJN A;  4MBG A;  3FTV A;  3FEY A;  3O4Z A;  3FEX A;  2A5U A;  4HOU A;  2AJA A;  4PS7 A;  1Y8M A;  2J07 A;  1ZB1 A;  5BXU A;  3Q7A A;  4WAF A;  3RO2 A;  3N71 A;  2UY1 B;  1Q2Z A;  1INZ A;  4GTR A;  4BTA A;  1MZC A;  1K1A A;  3CLJ A;  2RD0 A;  2NYJ A;  3S7F A;  5FWQ A;  3FUN A;  5G04 C;  2L9B A;  4I6E A;  2WM9 A;  1RW2 A;  3ABM E;  4X8Q A;  4B8C B;  3VLE A;  4B94 A;  4DLO A;  3ISM C;  1N0Q A;  3AG3 E;  4XEI G;  5J08 A;  4GPM A;  4HNA D;  3JCK C;  4CDN A;  3W9F A;  5AQ7 A;  1IQU A;  4O6F A;  5JHA A;  2GRR B;  1QBQ A;  2R05 A;  3CHQ A;  1V54 E;  3CVL A;  4E6H A;  2NSZ A;  4G8K A;  2V8S E;  4HVB A;  4KYO B;  4U8V D;  3ZN3 A;  3AG2 E;  3S7J A;  4EBA A;  3B95 A;  4UWK A;  5JMN D;  3BEE A;  3KS2 A;  5CBN A;  4G24 A;  4F6R D;  3IXE A;  2P9L G;  3CHM A;  4LSZ E;  3PE4 A;  3UIP C;  5BXO A;  1OT8 A;  2C2L A;  2X6F A;  4J8Y A;  3DST A;  3EIJ A;  3LEW A;  1WM5 A;  1DC2 A;  3HVE A;  4YDE A;  3UT7 A;  1TNY A;  4DX6 D;  3TWT A;  1IHG A;  4BT8 A;  3TXN A;  3Q4A B;  3DSW A;  1SA5 A;  4J6I A;  4UI9 J;  3SY2 A;  4G1T A;  2BKK B;  5AQ9 A;  1JWF A;  3ONL A;  3TXM A;  3FHE A;  2DZN A;  1HG5 A;  2GGF A;  3RU0 A;  2KBX A;  5JHB A;  5CCM A;  2CHX A;  4MKT A;  2XZT G;  3RKV A;  4FLB A;  4GTO A;  4BWR A;  4RVB A;  3CHP A;  5BV0 A;  2R5S A;  4JB8 P;  4ZFH A;  3ASF A;  2R03 A;  4JD2 G;  3UM3 A;  2OND A;  4WWP A;  2XS1 A;  1MX6 A;  2L0T B;  1YA0 A;  5BT1 A;  2X6I A;  5LFA A;  2LUH A;  1OWO A;  1SZ9 A;  3CIA A;  2UY1 A;  4BX9 A;  3FTZ A;  4N5Q A;  3L22 A;  4I9C A;  4HB5 A;  4BET A;  5A6C A;  4YDO A;  4PS3 A;  4Z68 A;  5HI7 A;  3TAX A;  3R7R A;  5ENO D;  5FQ7 A;  2ZIR A;  5FZR A;  4C9B B;  2P58 C;  3EHQ A;  2LAH A;  3VTY A;  1BI7 B;  2Y1L E;  5CEC B;  3VLD A;  2BED A;  1D9S A;  1E8X A;  3FU5 A;  3FUF A;  2WQ7 A;  1ZU2 A;  4I2W A;  4GTT A;  3BUA A;  2P9N G;  4NQ0 A;  2IU1 A;  4A63 B;  3W9G A;  2J4D A;  5BPP A;  3U64 A;  2AXV A;  1MHQ A;  1HF8 A;  5ENT D;  4NUR A;  3R9M A;  4HOR A;  3P1U A;  3FUH A;  3PE3 A;  3GZ1 A;  3MYV A;  2QZA A;  1K3Z D;  3PDN A;  3UQ3 A;  3RRU A;  2PQR A;  3FU0 A;  3Q78 A;  4MLP A;  3CV0 A;  3LY7 A;  2GRP B;  4TUM A;  4OVV A;  1N94 A;  1TJC A;  5EX0 A;  4RG6 A;  2F8X K;  2L6J A;  4OAU C;  3Q73 A;  4FU3 A;  5E76 A;  3G2V A;  3IEG A;  2VSY A;  4JZY A;  2CG3 A;  1X81 A;  4TXQ A;  2WMO A;  1MX2 A;  3HXE A;  2LSV A;  1HZ4 A;  4BY6 A;  4BT9 A;  4J0U A;  2ZU6 B;  5D66 A;  2A5E A;  3APF A;  3PVL A;  3QKY A;  3CVV A;  4XI0 A;  5G55 A;  4GA2 A;  4UI9 C;  4GZ3 A;  1H6K A;  5CMW A;  3QWW A;  1HS6 A;  4O60 A;  3FTX A;  3TWQ A;  4BFR A;  3D9I A;  2A4Z A;  4ILH B;  1WY6 A;  1JUQ A;  3CVQ A;  4OAV B;  4KZC A;  3T9K A;  2PL2 A;  1OCZ E;  5E75 A;  4E85 A;  4N3C A;  4QQI A;  4HXI A;  4HQD A;  4U0S A;  5KCM A;  5EIL A;  4PUC A;  4ACL A;  2WXQ A;  3OTN A;  1XGW A;  4Q69 A;  4CT0 A;  4JXT A;  3UXG A;  5G05 J;  4AM9 A;  3CK7 A;  1TNU A;  3HXD A;  2LSU A;  5AQB A;  3DSV A;  3SFY A;  2I2O A;  4U95 D;  3NQP A;  1NI1 A;  5D0Q D;  4KVO A;  2XEN A;  1U2V G;  3RRM B;  4GAA A;  4NIK A;  3IV0 A;  4GA0 A;  3PZ2 A;  3UM0 A;  4AP2 A;  2P9U G;  2EIN E;  2AXU A;  2EIK E;  4NAC A;  2RFA A;  4LNB A;  1QQE A;  2WXL A;  4LG6 A;  3UTM A;  2J09 A;  4IUL A;  4XE0 A;  3CK9 A;  1N9A A;  3VTX A;  4ME2 A;  5EYL A;  2KAT A;  4GZ5 A;  3SF4 A;  3OXL A;  2GRN B;  4BEP A;  4JHR A;  1OCO E;  4I9E A;  3LYA A;  5JJT A;  3QOU A;  2FO7 A;  3PUK A;  4GTV A;  5D2M C;  1O5M A;  1OUV A;  5KJN A;  3F6Q A;  1OWL A;  3UKR G;  1HXI A;  2IOL A;  4N3A A;  5AN8 A;  2XHE A;  2AWI A;  4F3V A;  1Z5S C;  3CKB A;  4ANX A;  4F53 A;  4UQY A;  5CED B;  2WXG A;  3U9W A;  3CVX A;  1S63 A;  1D8E A;  3FUI A;  4CDR A;  2OVF A;  3DEP A;  4TXR A;  2WXO A;  4EZK A;  4DI3 A;  2H6F A;  4A3V A;  4YVQ C;  2RFM A;  3HXB A;  1TYQ G;  4XIF A;  3WXX A;  3AS8 A;  2HO1 A;  5IY5 E;  4AVX A;  4C48 B;  2WPV A;  3G2U A;  1N95 A;  3U66 A;  3PNL B;  3E4B A;  3HVE B;  5A23 A;  3NF1 A;  3TWX A;  4HLL A;  5EDS A;  3RRN B;  4JHK A;  3E32 A;  3LKU A;  3U3W A;  4JPS A;  1TNO A;  4GYY A;  2QFC A;  4LER A;  4P29 A;  5ENP D;  3PRZ A;  2ETC A;  3UT8 A;  4APO A;  4GMR A;  2VSO E;  3D9P A;  2MYO A;  2E2E A;  2X6H A;  1KLX A;  3ZKJ A;  1NP7 A;  4U96 D;  3FP3 A;  3HRA A;  4APF A;  2YIN A;  3TWR A;  2KXP C;  2Y4U A;  3C72 A;  2Y3A A;  2ILR A;  3DWL G;  1JWG A;  3FUL A;  3DPD A;  1FPP A;  1Z6T A;  4CGW A;  3FDH A;  5BUZ A;  1JCQ A;  2V5Q C;  3MV3 B;  4DX1 A;  3DXM G;  2PM6 A;  4LNG A;  4HS2 A;  2H6I A;  4HOQ A;  3SFZ A;  2P9S G;  2AXZ A;  2GRL A;  2IOS A;  4WNE A;  2XZD G;  2ZIS A;  1ELK A;  2WXM A;  2Y0B G;  3OXG A;  5CRU A;  3GZ2 A;  3FFL A;  3J5P A;  3RSE G;  1P5Q A;  1B89 A;  2WQ6 A;  2VGE A;  4J7W A;  1H2V C;  4K03 A;  3R7Q A;  3ASH A;  3WG7 E;  3FUK A;  3PRE A;  4GTS A;  4RG9 A;  4U7E B;  2AW6 A;  4BSX A;  4Y6W A;  2V5F A;  2WXH A;  3ZYK A;  3DSU A;  4LNU D;  4AV7 A;  3DRA A;  3NOG D;  4J8E A;  1DVP A;  4U0Z A;  1QNF A;  2GRO B;  4DRX E;  3MV2 B;  4G23 A;  1UW4 B;  1EDU A;  3V2O A;  2FO1 E;  4LUN U;  1AWC B;  5LCW J;  1PY1 A;  2F0Y A;  1OY3 D;  4TV3 A;  1E90 A;  5AEN A;  1BD8 A;  5BV1 A;  3ML9 A;  3HIZ A;  3K9I A;  2WXP A;  3CHO A;  3PZ4 A;  4MS6 A;  4YDY A;  2XGS A;  4EZL A;  4UI9 K;  3MJW A;  4HRL A;  4ANW A;  2VGY A;  2WQH A;  4WND A;  4YND A;  5EYP F;  4XZ4 A;  4HOT A;  5AYW D;  3IHY A;  3FU3 A;  4GCO A;  2JLB A;  5ANL A;  5KJM A;  4J8S A;  1O1R A;  4LEU A;  3APD A;  3ZFW A;  1XNF A;  4HRN A;  1QYM A;  3QWV A;  3D9H A;  3TWV A;  2R17 C;  2VSX E;  5ENR D;  4I6J A;  3UIN C;  1Y6I A;  3BG0 B;  2VGX A;  2WMN A;  4I1A A;  1DCE A;  5M72 A;  3HXF A;  4ATZ D;  3D9K A;  2Y4T A;  2YNQ A;  4IYP A;  4EZJ A;  1S0P A;  4KXK B;  4GTQ A;  4I1M A;  1ELW A;  3SD5 A;  3ML8 A;  4K0R A;  4JEU A;  1E8Z A;  1NZN A;  2XEE A;  1LTX A;  3FUM A;  4BER A;  2XGM A;  3PZD A;  4FP7 A;  4WWN A;  3D9M A;  4V3I A;  1LD8 A;  3AU4 A;  4EQF A;  4HFG A;  1EPU A;  4IRU A;  4TUU A;  1OWM A;  3JUI A;  2V0P A;  1EF1 C;  4JC8 A;  5ARF A;  1KZP A;  3D9O A;  4EBA G;  3MEK A;  1TNZ A;  3ZIM A;  1Z3X A;  4FLH A;  4QFV A;  4ILI A;  3B7R L;  2L0I A;  3J5Q B;  4AJW A;  1NA3 A;  2P9K G;  4R7L A;  1TN6 A;  3FTS A;  3MX3 A;  3TWW A;  3AS4 A;  3IBE A;  3R9A B;  5ITZ F;  2KZT B;  5EIB E;  2VSN A;  3EIQ C;  4PH4 B;  4DLQ A;  4DPR A;  3Q7F A;  3APC A;  3ZVV A;  3FTY A;  3ZHE B;  4UQZ A;  3ASD A;  3MKQ A;  4U8Y D;  2NXP A;  4CRW A;  3JYS A;  4EEC A;  3CHR A;  3D9J A;  4DK5 A;  3LDZ A;  3QNK A;  5B1B E;  1TJF A;  4XKB A;  2IO3 C;  3BQO A;  4CEM A;  3Q15 A;  5HRY A;  4CZ2 D;  1HE8 A;  3ZPJ A;  4JL0 A;  2OOE A;  5LOZ A;  3CQC B;  1YCS B;  3T8M A;  1HO8 A;  2F8Y A;  3P2B A;  1BU9 A;  1HG2 A;  5B1A E;  3Q47 B;  4FHJ A;  1E7U A;  4B0Z A;  4XKC A;  5FIO A;  4FJZ A;  4ATG A;  3FH8 A;  2LAI A;  2ETA A;  4DX2 A;  5AAO A;  4FJY A;  2IO2 C;  5LCW C;  4JA7 A;  3PEU B;  2BKG A;  2Q7F A;  2EQX A;  4C0M A;  1KT0 A;  2VYI A;  3AG1 E;  3RAU A;  2WXK A;  4W9R A;  1JPL A;  4NRH B;  1ZBP A;  4J8F A;  1H19 A;  3X2Q E;  3NZS A;  1D8D A;  4TXP A;  4XI9 A;  4L7T A;  3CST A;  5ENN A;  4I17 A;  2XPY A;  2BUG A;  3NZU A;  2PQN A;  3KAE A;  3QB2 A;  5AIJ A;  5ENQ D;  4I2Z A;  4O1O A;  3C98 A;  4FA6 A;  4LRZ A;  1IHB A;  1KT1 A;  3LJN A;  5H7P A;  1UOH A;  4PS8 A;  4AIF A;  2QYU A;  3PEV B;  2X6J A;  2WB2 A;  4WUY A;  3E34 A;  2YQ8 A;  4I1O B;  3FUJ A;  4MRU A;  3EU9 A;  3ZXS A;  2VQ2 A;  2RG8 A;  3ZUV B;  1FT2 A;  1A5E A;  2RKK A;  3OAW A;  1HU3 A;  1N4S A;  2QY7 A;  2YHE A;  2HYZ A;  2XS8 A;  1N4P A;  1OWN A;  5CRV A;  3MZL B;  3QDN A;  1VDY A;  2CFZ A;  4LCT A;  2KZT A;  4GB9 A;  1PC2 A;  3DPY A;  4L9P A;  3CSF A;  2KCK A;  4ANV A;  3LY9 A;  3L6A A;  5A7D B;  3LCA A;  2KCV A;  3ZHE A;  3ZU7 B;  1UN8 A;  2LXL A;  5BNW A;  1HH8 A;  1JCS A;  2PZI A;  4G11 A;  2XPZ A;  5HKP A;  3S7D A;  3ASO E;  3GYZ A;  1H6P A;  2CHZ A;  3AG4 E;  1DNP A;  2Y69 E;  4I43 A;  3LJ3 A;  5HQ8 A;  3C5R A;  5G04 J;  3ASG A;  4EPZ A;  1KPS B;  2OEV A;  3CVU A;  4HI9 A;  4G8L A;  3JQ1 A;  2P9P G;  2QYJ A;  3FH7 A;  3L82 A;  3Q5M A;  3QAQ A;  4BX8 A;  4XX5 A;  1OCR E;  4L1B A;  2GW1 A;  3ZW3 A;  4CCA A;  4IN3 B;  3GZS A;  3RJV A;  4DX7 D;  4CDM A;  5CEA A;  3QAR A;  2X6K A;  3ZEF A;  4U04 A;  5FZS A;  1IKN D;  4ACK A;  3SGH A;  3QWP A;  3DBS A;  1E96 B;  1YYH A;  3ESK A;  1NFI E;  2ETB A;  2B6C A;  1FVF A;  2MHK A;  1S70 B;  4AY5 A;  3CHS A;  4DUI A;  3ESL A;  5AJD A;  5HS0 A;  3LY8 A;  3Q49 B;  2QC9 A;  5JA4 D;  4RLY A;  2WXI A;  4O1P A;  4UWF A;  3ONK A;  1MYO A;  2VTB B;  3CR3 A;  4HOS A;  1UG3 A;  3ZYL A;  2KC7 A;  4GPK A;  3FUE A;  4N39 A;  2C0L A;  3LS8 A;  5C1D A;  3EUV A;  2XQ0 A;  2EIJ E;  4F1P A;  3I5P A;  3LPZ A;  3B7S A;  1H2T C;  3D9N A;  3UM2 A;  2HM8 A;  3E33 A;  3LVQ E;  2FBN A;  5BW8 C;  3TWU A;  2R2L A;  2OV8 A;  3JXJ A;  3ZYQ A;  4ZHB A;  2VGX B;  1E7V A;  2MRI A;  4U8H A;  4EHM A;  3L16 A;  1LD7 A;  2ION A;  5FQ8 A;  4AOF A;  5G05 C;  5KBA A;  3UUX A;  3SZ7 A;  3JXI A;  3Q9U C;  2P2C P;  5FT9 A;  3FY4 A;  3I4R B;  2YHC A;  4JVS A;  3L13 A;  2WXJ A;  2J49 A;  3CVP A;  3AU5 A;  3CVW A;  3CQG B;  3G2W A;  4GMJ A;  4KMO A;  4GTP A;  3JUE A;  2DZO A;  3HXC A;  3PZ1 A;  3PNT B;  3ZYM A;  3L54 A;  1MX4 A;  2XRZ A;  1ELR A;  2R59 A;  4G26 A;  5EKQ D;  4GU5 A;  2V4H C;  1AP7 A;  1N52 A;  5DIZ A;  4UWG A;  3Q9N C;  2XEH A;  5KNG A;  2IF4 A;  5ARG A;  3MKQ B;  3URZ A;  1FT1 A;  1L5J A;  3CVN A;  4JEH A;  2DWZ A;  4M7C A;  3ASN E;  5T3R A;  1PAQ A;  2XEV A;  3DSS A;  2WXN A;  2GRM A;  4U07 A;  1JCR A;  5AQA A;  3S2A A;  5KJL A;  3GW4 A;  5G2N A;  3C3R A;  1N4R A;  4L2Y A;  3UM1 A;  3ZGQ A;  3E37 A;  3S7B A;  4GYO A;  3TJP A;  1RZ4 A;  2VTB A;  2PNN A;  4CYM D;  5KWD A;  1Z3Y A;  2IY0 C;  5JJ6 A;  3KD7 A;  2VJ8 A;  5EID A;  1G3N B;  5FTP A;  5CHE E;  2XCB A;  3CEQ A;  4A3T A;  1DCQ A;  4WNG A;  2WVI A;  5T8I A;  4GML A;  3KEZ A;  3PH0 C;  4AY6 A;  3BU8 A;  5EX3 A;  1H2U A;  2ZXW E;  3EDT B;  2UWJ G;  2F37 A;  2MOW A;  4GYW A;  5AJL A;  1FVH A;  3QJZ A;  2XRY A;  3JQ0 A;  4GZ6 A;  4HRM B;  2FF4 A;  4KT6 B;  5B3S E;  4CGV A;  3CVY A;  3T8K A;  3UIO C;  1IXV A;  4BES A;  4GA1 A;  4WNF A;  3U4T A;  3NOC D;  2I6H A;  4B8A A;  5C2Y A;  3RK6 A;  5DBK A;  1WG0 A;  4I6G A;  4BTB A;  3FWV A;  3NAW A;  2KCL A;  4FHK A;  3ULY A;  2P9I G;  3ULE G;  4A1S A;  5LX8 A;  3AJI A;  3EHN A;  1IYG A;  1N0R A;  1S64 A;  2I9C A;  2FI7 A;  1O1T A;  1N54 A;  1U3D A;  4JW1 A;  2X38 A;  4FAD A;  4JA9 A;  4KVM A;  3E30 A;  3TWS A;  2ZGD A;  2LNI A;  3V79 K;  4OVU A;  4UWL A;  3D3M A;  1K1B A;  2KM4 A;  2B0O E;  3ENE A;  4RQI A;  4PDX A;  3O48 A;  2I1K A;  4DJA A;  3IHV A;  1SA4 A;  3MGB A;  3UX4 A;  4HBD A;  3T5X A;  1TNB A;  2AVP A;  3HDX A;  4UQX A;  4L23 A;  2IJG X;  2C0M A;  2WXR A;  5AAR A;  5J90 A;  1H0A A;  2E0I A;  1K8K G;  4H7X A;  3ZXP A;  3Q75 A;  1V55 E;  3FH5 A;  1BLX B;  4Y6C A;  2OEW A;  5FZQ A;  2ZGG A;  1SQM A;  1FCH A;  3G2T A;  3MCX A;  2EIL E;  3LVR E;  4N3B A;  4HI8 A;  3I3N A;  4D10 C;  4FC8 A;  5CBO A;  4H7Y A;  1UJK A;  5CER B;  1HX8 A;  4DX5 D;  4RSY A;  1YMP A;  3B7T A;  5KJK A;  4UUC A;  3HYM B;  1U3C A;  1O1S A;  1W3B A;  2J9Q A;  3UPV A;  4F7A A;  2DCP A;  2XPI A;  1NA0 A;  2OVB A;  3C3Q A;  1OXJ A;  4JHJ A;  3T5V A;  3L08 A;  3L17 A;  3L9T A;  5ANR A;  3PUJ A;  3V30 A;  2IEJ A;  3BG1 B;  5FQ6 A;  3ZRH A;  3ULQ A;  3EHR A;  4OYS A;  3ABL E;  1TN7 A;  2J8S D;  1MQS A;  1X5B A;  4N2S A;  4K5B A;  3EU5 A;  1H6O A;  2NC9 A;  3MKR A;  1A17 A;  3B7U X;  2DYS E;  4DI4 A;  3TL5 A;  1OWP A;  3SHF A;  3DEO A;  4AEZ C;  1TR4 A;  4G25 A;  2IQC A;  1SZA A;  2J4B A;  4ANU A;  4URK A;  4WWO A;  3FUD A;  3VLF A;  1QZ2 A;  2XGO A;  1GW6 A;  2OCC E;  2FEZ A;  2BF0 X;  3UMV A;  5FQ4 A;  3B13 A;  2JAB A;  2X3M A;  5ENS D;  1BI8 B;  4ABN A;  2DVW A;  1HFA A;  2JEK A;  4L2L A;  3CK8 A;  2L6B A;  2LO6 A;  3AAA C;  4GCN A;  3FTW A;  3KSQ A;  4ILG A;  3CGH A;  4Q94 A;  3MA5 A;  4BSZ B;  3HHM A;  4U0U A; 
#chains in the Genus database with same CATH homology
 3FU0 A;  5ANL A;  5T4Y A;  4AOF A;  4KBQ A;  5KJM A;  4MLP A;  4J8S A;  2CHW A;  3OXF A;  5G05 C;  3SBS A;  3CV0 A;  3LY7 A;  4LEU A;  3APD A;  3QK0 A;  4OVV A;  3ZFW A;  3UUX A;  1XNF A;  1TJC A;  5EX0 A;  5CCL A;  3SZ7 A;  5FT9 A;  3FY4 A;  3I4R B;  2YHC A;  4RG6 A;  2L6J A;  3QWV A;  4JVS A;  1UN9 A;  2R17 C;  2VSX E;  4I6J A;  3L13 A;  4FU3 A;  5E76 A;  5D0O D;  2WXJ A;  3G2V A;  3IEG A;  1Y6I A;  3BG0 B;  2VSY A;  2VGX A;  2J49 A;  2V4L A;  1IQR A;  2WMN A;  4JZY A;  4I1A A;  2CG3 A;  4G2V A;  3CVP A;  3AU5 A;  1BPO A;  5M72 A;  5FJY A;  2J08 A;  3CVW A;  3CQG B;  3G2W A;  2WMO A;  4GMJ A;  4KMO A;  3D9K A;  2Y4T A;  3TG4 A;  2YNQ A;  4IYP A;  4EZJ A;  1S0P A;  2I1J A;  4KXK B;  4I1M A;  1ELW A;  3PNT B;  3SD5 A;  2DIW A;  2LSV A;  3ML8 A;  3QC1 A;  4K0R A;  1HZ4 A;  4JEU A;  3ZYM A;  3L54 A;  4BY6 A;  2XRZ A;  4BT9 A;  3IKO B;  2ZU6 B;  4J0U A;  1ELR A;  2R59 A;  4G26 A;  1E8Z A;  5EKQ D;  1NZN A;  4GU5 A;  3APF A;  4YVO A;  3PVL A;  4C0E A;  4KZ0 A;  4GZC A;  3FUM A;  3QKY A;  2XGM A;  3PZD A;  1N52 A;  4FP7 A;  5DIZ A;  4UWG A;  4WWN A;  2IF4 A;  3D9M A;  4V3I A;  3AU4 A;  3CVV A;  4XI0 A;  4HFG A;  5G55 A;  4EQF A;  4GA2 A;  4UI9 C;  1EPU A;  4IRU A;  4GZ3 A;  1H6K A;  1OWM A;  4TUU A;  3JUI A;  2V0P A;  5CMW A;  5JJ7 A;  1EF1 C;  3CKC A;  3QWW A;  4JC8 A;  4N5C A;  1HS6 A;  5ARG A;  5ARF A;  3FTX A;  1UJJ A;  3MKQ B;  3D9O A;  4EBA G;  3MEK A;  3URZ A;  4BFR A;  3CVN A;  1L5J A;  3D9I A;  2A4Z A;  4JEH A;  3ZIM A;  3TG5 A;  4ILH B;  1Z3X A;  4B89 A;  1WY6 A;  1JUQ A;  4FLH A;  4QFV A;  3CVQ A;  1PAQ A;  5T3R A;  4ILI A;  2XEV A;  3B7R L;  4KZC A;  2L0I A;  4AJW A;  4F1S A;  1NA3 A;  2WXN A;  2GRM A;  2PL2 A;  4R7L A;  5E75 A;  3FTS A;  1LF8 A;  4U07 A;  3MX3 A;  5LP0 A;  1E8Y A;  3S2A A;  5KJL A;  4E85 A;  3D9L A;  3AS4 A;  3GW4 A;  3IBE A;  5G2N A;  3R9A B;  4A55 A;  2HR2 A;  4N3C A;  2KZT B;  2VSN A;  4HXI A;  3SI5 A;  3EIQ C;  4PH4 B;  4DLQ A;  4U0S A;  4Q96 A;  5KCM A;  4DPR A;  4PUC A;  4ACL A;  2WXQ A;  3APC A;  3G2S A;  4L2Y A;  3ZVV A;  4N2Q A;  3ZGQ A;  3SBT B;  3OTN A;  1XGW A;  3FTY A;  4Q69 A;  4CT0 A;  4HLE A;  3S7B A;  4GYO A;  2BTD A;  3ZHE B;  4UQZ A;  3ASD A;  4JXT A;  3TJP A;  2VTB A;  3MKQ A;  5G05 J;  4AM9 A;  3CK7 A;  2NXP A;  2LSU A;  2CG2 A;  4CRW A;  3JYS A;  1Z3Y A;  4EEC A;  3CHR A;  3D9J A;  3FU6 A;  4DK5 A;  3LDZ A;  5JJ6 A;  3QNK A;  2I2O A;  1TJF A;  4XKB A;  3NQP A;  4M3O A;  4CEM A;  5D0Q D;  4GZD A;  2FUL A;  3Q15 A;  1EYH A;  4FUL A;  1HE8 A;  3FTU A;  4KVO A;  3KD7 A;  4JL0 A;  2VJ8 A;  3ZPJ A;  1TEZ A;  3RIB A;  4GAA A;  3RRM B;  2OOE A;  5LOZ A;  3CQC B;  5FTP A;  5CHE E;  3RO3 A;  3T8M A;  4U63 A;  2XCB A;  3IV0 A;  1HO8 A;  3PS6 A;  4GA0 A;  3EHM A;  3LXU X;  3P2B A;  1HG2 A;  3CEQ A;  4J8D A;  4AP2 A;  2XCC A;  4A3T A;  4WNG A;  3Q47 B;  3TGO A;  1WAO 1;  2AXU A;  2WVI A;  4UWH A;  2DBA A;  4FHJ A;  4AXH A;  1E7U A;  4NAC A;  4GML A;  5T8I A;  2PM7 A;  1QQE A;  2CFU A;  3KEZ A;  4XKC A;  4FJZ A;  4B0Z A;  3PH0 C;  4ATG A;  2WXL A;  2M63 A;  3FH8 A;  4A1G A;  4AY6 A;  2LAI A;  5EX3 A;  2IFU A;  3AS5 A;  4FJY A;  4TRQ A;  5CMY A;  1H2U A;  1E8W A;  4CT4 A;  5LCW C;  4JA7 A;  2WXF A;  2J09 A;  3EDT B;  4IUL A;  3PEU B;  3CK9 A;  2UWJ G;  4XE0 A;  3VTX A;  2Q7F A;  2EQX A;  3I4G A;  4ME2 A;  2MOW A;  4C0M A;  3HHM A;  4GYW A;  1KT0 A;  2KAT A;  3SNX A;  4GZ5 A;  5AJL A;  3SF4 A;  3UT4 A;  1FVH A;  2VYI A;  3EJN A;  3OXL A;  3QJZ A;  3FTV A;  2WXK A;  2XRY A;  3FEY A;  3JQ0 A;  4GZ6 A;  3O4Z A;  4JHR A;  4W9R A;  4I9E A;  2FF4 A;  3LYA A;  3FEX A;  1JPL A;  4KT6 B;  4NRH B;  5JJT A;  2A5U A;  4CGV A;  1ZBP A;  4HOU A;  4J8F A;  3CVY A;  1H19 A;  3QOU A;  3NZS A;  4PS7 A;  2FO7 A;  1Y8M A;  4XI9 A;  4L7T A;  2J07 A;  3CST A;  5ENN A;  3PUK A;  4GA1 A;  4WAF A;  3RO2 A;  4I17 A;  3N71 A;  1OUV A;  2XPY A;  2UY1 B;  2BUG A;  4WNF A;  1OWL A;  3NZU A;  3U4T A;  5KJN A;  1INZ A;  2I6H A;  2PQN A;  3KAE A;  3QB2 A;  4B8A A;  4BTA A;  5AIJ A;  5C2Y A;  1HXI A;  2IOL A;  3CLJ A;  3RK6 A;  4I2Z A;  5DBK A;  2RD0 A;  4N3A A;  3S7F A;  2XHE A;  3C98 A;  5FWQ A;  4FA6 A;  4LRZ A;  3FUN A;  4I6G A;  2AWI A;  3FWV A;  5G04 C;  4BTB A;  2L9B A;  4F3V A;  4I6E A;  2WM9 A;  2KCL A;  3CKB A;  1KT1 A;  4ANX A;  4F53 A;  4FHK A;  4UQY A;  4A1S A;  4PS8 A;  5LX8 A;  4B8C B;  2WXG A;  4AIF A;  3U9W A;  3CVX A;  3PEV B;  3VLE A;  3EHN A;  4B94 A;  4DLO A;  1IYG A;  2X6J A;  3FUI A;  4CDR A;  2OVF A;  5J08 A;  2I9C A;  2WXO A;  2WB2 A;  3JCK C;  4CDN A;  2FI7 A;  4WUY A;  1IQU A;  4O6F A;  2YQ8 A;  4EZK A;  1N54 A;  4I1O B;  1U3D A;  3FUJ A;  4JW1 A;  5JHA A;  4DI3 A;  2X38 A;  4FAD A;  4JA9 A;  4A3V A;  4MRU A;  4KVM A;  3CHQ A;  3ZXS A;  2LNI A;  4OVU A;  2VQ2 A;  2RG8 A;  3CVL A;  4UWL A;  4E6H A;  3D3M A;  4YVQ C;  2NSZ A;  2KM4 A;  2V8S E;  3OAW A;  4HVB A;  4XIF A;  4KYO B;  1HU3 A;  3WXX A;  3AS8 A;  2HO1 A;  3ENE A;  4AVX A;  2WPV A;  3G2U A;  2QY7 A;  4PDX A;  3ZN3 A;  3O48 A;  2I1K A;  3U66 A;  2YHE A;  3PNL B;  3S7J A;  2HYZ A;  3E4B A;  4DJA A;  3IHV A;  4EBA A;  3HVE B;  4UWK A;  5A23 A;  3NF1 A;  3BEE A;  3MGB A;  1OWN A;  3UX4 A;  3T5X A;  5EDS A;  3MZL B;  3QDN A;  3RRN B;  1VDY A;  4JHK A;  2AVP A;  3KS2 A;  4G24 A;  3HDX A;  3LKU A;  3U3W A;  2CFZ A;  4LCT A;  4JPS A;  2KZT A;  4UQX A;  4L23 A;  4GB9 A;  4GYY A;  2IJG X;  3CHM A;  1PC2 A;  2QFC A;  4LER A;  3CSF A;  2C0M A;  2KCK A;  4P29 A;  2WXR A;  4ANV A;  3LY9 A;  3L6A A;  3PE4 A;  5A7D B;  3PRZ A;  5J90 A;  3LCA A;  1H0A A;  2E0I A;  2KCV A;  3ZHE A;  1UN8 A;  2C2L A;  2X6F A;  4H7X A;  5BNW A;  1HH8 A;  3EIJ A;  3FH5 A;  3LEW A;  2PZI A;  4G11 A;  3UT8 A;  2XPZ A;  1WM5 A;  4APO A;  2VSO E;  3S7D A;  3HVE A;  4Y6C A;  3D9P A;  3UT7 A;  5FZQ A;  1SQM A;  2E2E A;  2X6H A;  1FCH A;  1KLX A;  3G2T A;  3GYZ A;  3MCX A;  2CHZ A;  1NP7 A;  3FP3 A;  3LVR E;  4N3B A;  1DNP A;  2YIN A;  4APF A;  4I43 A;  3I3N A;  1IHG A;  4D10 C;  4BT8 A;  4FC8 A;  3TXN A;  3Q4A B;  3LJ3 A;  4H7Y A;  1UJK A;  5HQ8 A;  2Y4U A;  5G04 J;  4J6I A;  4UI9 J;  2Y3A A;  3ASG A;  2ILR A;  4EPZ A;  4G1T A;  3CVU A;  1JWG A;  1HX8 A;  3FUL A;  3JQ1 A;  3DPD A;  4RSY A;  1Z6T A;  1JWF A;  3ONL A;  3TXM A;  4CGW A;  3FDH A;  3B7T A;  3FH7 A;  5KJK A;  5BUZ A;  3FHE A;  3HYM B;  3Q5M A;  1HG5 A;  2GGF A;  3QAQ A;  1U3C A;  3MV3 B;  4XX5 A;  3RU0 A;  4BX8 A;  4L1B A;  2GW1 A;  1W3B A;  2PM6 A;  4IN3 B;  3ZW3 A;  4CCA A;  5JHB A;  2J9Q A;  5CCM A;  3GZS A;  3UPV A;  4HS2 A;  4F7A A;  2CHX A;  3RJV A;  2DCP A;  4MKT A;  2XPI A;  4CDM A;  4HOQ A;  1NA0 A;  3SFZ A;  3RKV A;  4FLB A;  4BWR A;  4RVB A;  3CHP A;  5BV0 A;  3RRU A;  2OVB A;  2R5S A;  2AXZ A;  2X6K A;  3QAR A;  3ZEF A;  3ASF A;  4JHJ A;  2GRL A;  2IOS A;  4U04 A;  5FZS A;  4WNE A;  3T5V A;  4ACK A;  3SGH A;  3QWP A;  3DBS A;  1E96 B;  2OND A;  3L08 A;  4WWP A;  3L17 A;  5ANR A;  3ESK A;  1ELK A;  1FVF A;  3PUJ A;  2L0T B;  2WXM A;  1YA0 A;  2MHK A;  3OXG A;  3GZ2 A;  4AY5 A;  3FFL A;  3CHS A;  5BT1 A;  3BG1 B;  1P5Q A;  2X6I A;  5FQ6 A;  3ZRH A;  3ULQ A;  3ESL A;  5AJD A;  5LFA A;  3LY8 A;  4OYS A;  1B89 A;  2WQ6 A;  1OWO A;  1SZ9 A;  3CIA A;  3Q49 B;  2UY1 A;  1MQS A;  1X5B A;  1H2V C;  4BX9 A;  3FTZ A;  4K03 A;  3R7Q A;  2WXI A;  3ASH A;  4N2S A;  3L22 A;  4I9C A;  5A6C A;  4UWF A;  3ONK A;  3FUK A;  4PS3 A;  2NC9 A;  3PRE A;  3MKR A;  2VTB B;  5HI7 A;  3TAX A;  3CR3 A;  1A17 A;  3R7R A;  4HOS A;  4RG9 A;  3B7U X;  1UG3 A;  3ZYL A;  2AW6 A;  4BSX A;  2KC7 A;  4Y6W A;  2V5F A;  4DI4 A;  2WXH A;  3FUE A;  4GPK A;  5FQ7 A;  3TL5 A;  1OWP A;  4N39 A;  2C0L A;  3SHF A;  3ZYK A;  3LS8 A;  5FZR A;  4AV7 A;  2P58 C;  4C9B B;  4J8E A;  4AEZ C;  5C1D A;  1DVP A;  2LAH A;  4G25 A;  2IQC A;  4U0Z A;  1QNF A;  3VTY A;  1SZA A;  3MV2 B;  2J4B A;  4ANU A;  4URK A;  4WWO A;  4G23 A;  3VLD A;  3FUD A;  2XQ0 A;  1E8X A;  3FU5 A;  3FUF A;  1UW4 B;  3VLF A;  2WQ7 A;  1QZ2 A;  1ZU2 A;  2XGO A;  4I2W A;  1GW6 A;  2FEZ A;  3I5P A;  1EDU A;  2BF0 X;  3UMV A;  4LUN U;  5FQ4 A;  3B13 A;  5LCW J;  1PY1 A;  3LPZ A;  4NQ0 A;  3B7S A;  2IU1 A;  1H2T C;  3D9N A;  2X3M A;  2J4D A;  1E90 A;  2HM8 A;  4TV3 A;  5AEN A;  5BPP A;  5BV1 A;  3U64 A;  3ML9 A;  2AXV A;  3LVQ E;  1MHQ A;  3HIZ A;  4ABN A;  1HF8 A;  2FBN A;  1HFA A;  2JEK A;  4L2L A;  4NUR A;  5BW8 C;  3K9I A;  3CK8 A;  2WXP A;  3CHO A;  4MS6 A;  2LO6 A;  2OV8 A;  2XGS A;  4EZL A;  3ZYQ A;  4HOR A;  4GCN A;  2VGX B;  4UI9 K;  3MJW A;  3FTW A;  1E7V A;  3P1U A;  4ANW A;  2VGY A;  2WQH A;  3FUH A;  3PE3 A;  3GZ1 A;  4WND A;  3MYV A;  4YND A;  2MRI A;  3CGH A;  4ILG A;  4Q94 A;  4U8H A;  3MA5 A;  4XZ4 A;  4HOT A;  5AYW D;  3IHY A;  3L16 A;  3FU3 A;  2ION A;  4GCO A;  3PDN A;  2JLB A;  3UQ3 A;  5FQ8 A;  2PQR A;  4U0U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...