2DCPA

Fully automated nmr structure determination of the enth-vhs domain at3g16270 from arabidopsis thaliana
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
140
structure length
140
Chain Sequence
GSSGSSGESYWRSRMIDAVTSDEDKVAPVYKLEEICDLLRSSHVSIVKEFSEFILKRLDNKSPIVKQKALRLIKYAVGKSGSEFRREMQRNSVAVRNLFHYKGHPDPLKGDALNKAVRETAHETISAIFSEENGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Automated Protein Structure Determination from NMR Spectra
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Unknown function
molecule keywords hypothetical protein (RAFL09-17-B18)
total genus 40
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2006-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2dcpA00
4FU3A 1ELKA 2KM4A 2LO6A 3D9NA 3G2SA 3ONLA 1UJKA 4GZCA 1EYHA 2L0IA 3ZYMA 1INZA 1HG5A 3G2UA 3LDZA 4HFGA 3D9PA 1XGWA 3ZYLA 3D9OA 3ONKA 1JUQA 4JXTA 1VDYA 1UJJA 3G2WA 3ZYQA 4AVXA 1HX8A 1PY1A 3CLJA 3D9LA 4GZDA 4NACA 4Q96A 3D9KA 5LOZA 5J08A 1SZ9A 1HFAA 1EDUA 1LF8A 3D9JA 3ZYKA 5LP0A 3G2VA 1X5BA 2L0TB 1JWFA 1JWGA 1JPLA 2MOWA 1DVPA 1HG2A 3D9MA 1H0AA 4Q94A 3RRUA 1SZAA 2V8SE 2QY7A 4FLBA 3G2TA 5CMWA 1MHQA 2DCPA 3D9IA 5CMYA 2BF0X 2DIWA 1HF8A
chains in the Genus database with same CATH superfamily
1PAQA 2GRRB 4Y6CA 3WXXA 3FU5A 4WUYA 4U07A 3S7JA 3GW4A 3CQCB 2XCBA 2WXLA 5G04J 4FP7A 2R02A 1EPUA 2M63A 3KEAA 2LSUA 5CMWA 2DYSE 3NF1A 4I6EA 3IEGA 3HRAA 2CHXA 3ASNE 2WXKA 4UQXA 3T8MA 2HO1A 3D9HA 1AP7A 3ASOE 4YDOA 2WXPA 1NFIE 2KXPC 3FTZA 1UG3A 1NL4A 4I43A 3B7BA 3E33A 4UQYA 1YYHA 2J9QA 4O1OA 3TL5A 3UIOC 4D10C 4PS3A 2OVBA 2QY7A 4GTTA 3Q78A 3UI2A 2QYJA 3EU5A 2LXMA 3EDTB 4U0UA 3TWUA 3ONKA 4B8CB 3RIBA 4C0MA 4NACA 4PH4B 2J8SD 3E37A 3Q15A 5LCWC 2MHKA 3SGHA 4RLYA 3SQVA 4WWNA 4HI8A 4CGVA 1KLXA 1BU9A 3O4ZA 5BV0A 4ME2A 4UI9C 5FQ7A 5LOZA 4FJZA 3UKRG 4YNDA 5HKPA 3QOUA 3ZGQA 4FJYA 1WDYA 3GYZA 4AP2A 2P9UG 4XIFA 4K5BA 2XRZA 4GTQA 1FCHA 2HM8A 3TWXA 3U64A 1TN7A 4Y6WA 2LO6A 4CDMA 4HLLA 3ASHA 2F8XK 3RJVA 4M7CA 1HE8A 3FTVA 3UM0A 4AM9A 3RKVA 4HOTA 3ZN3A 4B94A 2WXJA 2EIME 5BXUA 3VLDA 4WWPA 3U9WA 3PE4A 4EZLA 2IO2C 3W9FA 1ZU2A 2VTBA 2J08A 3ZXSA 5LX8A 1INZA 3O48A 3DSXA 3EIQC 2X6KA 2WXHA 5HQ8A 1UW4B 4DLOA 5AYWD 1JWFA 3N71A 2OOEA 3CK8A 4YDYA 3DSVA 4BT8A 4A55A 4IULA 4A63B 3V30A 1N0RA 5EIBE 3HXCA 4EZKA 4XI0A 3G2UA 3LPZA 4B93B 3T5VA 3D3MA 5A7DB 1E7UA 3L9TA 1PC2A 2B6CA 4XE0A 1WAO1 2Q7FA 4GA1A 1HH8A 4JB8P 3DSWA 1FT1A 1S63A 1TJCA 5JHAA 3EU9A 2DVWA 4U8VD 4U8HA 4LSZE 1TR4A 4J0UA 2WVIA 4JHKA 3TWVA 5FZRA 1H6KA 2EQXA 4PUCA 2PNNA 3NBNB 3AS8A 3RRNB 3I4RB 4KVOA 3ISMC 3C5RA 1U2VG 3ESLA 1E7VA 2P9LG 4GCNA 3ZYQA 4WAFA 3CLJA 1XNFA 3LVRE 2RKKA 4KZ0A 4OYSA 1TNZA 2C2LA 4W9RA 1Z6TA 2WQHA 3ZHEB 3TWSA 3QK0A 3FEYA 1HO8A 2WMOA 1Z5SC 4KYOB 5JMND 4FHJA 3ZYLA 3TAXA 1IQUA 1KT1A 4FA6A 4DPRA 1K3ZD 2CG2A 2VSOE 4KZCA 4XI9A 4N5QA 4OAVB 4JEUA 4J8FA 1OCOE 5BXOA 3PEUB 2ZGGA 4APFA 5CHEE 4AY6A 5BT1A 5FZSA 1TNOA 2IQCA 1A17A 4LERA 4G8LA 5CRUA 2XPIA 3EIJA 2QZAA 3CGHA 1DNPA 4CYMD 5KJLA 3SHFA 3CVQA 2V8SE 3PUJA 3QC1A 4HVBA 5FTPA 2OCCE 5J90A 3PVLA 3LDZA 3FTXA 1TYQG 4BETA 2KZTA 3B7UX 4BT9A 1DVPA 1O1TA 4F7AA 5KJMA 1YCSB 3FHEA 1E90A 2EILE 2Y3AA 1IQRA 1HG5A 1HXIA 3SFZA 3AG2E 4K0RA 5HS0A 4AEZC 2FF4A 1O1SA 2GRMA 5CRVA 3ZXPA 3Q75A 4LRZA 1N11A 4BX9A 3RU0A 5LCWJ 1H19A 3DSTA 3SF4A 1OY3D 3MKQB 4J8DA 3EHQA 1IHBA 3UT7A 3FUMA 3PZ4A 2XPYA 2IEJA 3L6AA 1EDUA 4G8KA 3ML8A 1IYGA 3OXLA 1OWNA 3VLEA 2NSZA 3FUIA 1NP7A 2WQ6A 3LJNA 3LY7A 1WG0A 3HDXA 1TN6A 4GZ3A 3TG5A 2A5EA 4GTVA 3BUAA 2R05A 3ZHEA 1ELWA 3Q79A 1JWGA 4C48B 2R17C 5T4YA 1OCCE 3I3NA 2XRYA 2ZU6B 3D9MA 3VLFA 3RK6A 2XEVA 4U95D 3FDHA 5FINA 4GPMA 4GZ6A 3MGBA 3D9LA 1KZPA 1SW6A 3FUJA 4MKTA 2H6GA 5AENA 3ZVVA 2QYUA 3QJZA 4O60A 4URKA 3JXJA 3CHPA 4OVVA 2V4HC 4YVQC 3QWPA 4I6JA 3L13A 4JA7A 1EYHA 2ETAA 2EIJE 3ULQA 2YINA 2LUHA 4GPKA 3J5QB 4GZ5A 4C9BB 3CHSA 3CR3A 3JQ0A 4RSYA 4DX7D 1IHGA 3HVEB 4UWGA 4RVBA 3E32A 4AIFA 2DZOA 4XEIG 1N54A 4GTPA 4MS6A 4QFVA 4L2LA 5FJYA 3FTUA 3VTXA 3D9JA 1BI8B 2NC9A 2Y4UA 2HE0A 2IY0C 2P9KG 3L22A 5AQ7A 4EHMA 4DI4A 2L6BA 3J5PA 2WXIA 5ENRD 2VQ2A 3LY9A 3APCA 2VGEA 5G05C 4JZYA 4JA9A 4BY6A 4CDRA 3QB2A 4OAUC 3L54A 3PNLB 1H6OA 3MKRA 4LUNU 1D9SA 5CBOA 2UWJG 5AARA 5AJDA 3BU8A 1QYMA 1OWMA 3ZKJA 3PH0C 2OVFA 1H2TC 3K9IA 2X6JA 4DI3A 4I9EA 3IKOB 2E2EA 3BG0B 4E85A 5ENNA 3BEEA 4F6RD 1RZ4A 4Q69A 3DPDA 3AU5A 3LCAA 5ENSD 3CHRA 3CVWA 1S0PA 4UWHA 2MYOA 4EBAA 2I1JA 4I9CA 2CG3A 3CSTA 1OUVA 1E8ZA 2J4DA 1SA5A 5FQ4A 2XZTG 2P2CP 4XKCA 1UJJA 2YHCA 3T5XA 4BTBA 3VTYA 3G2VA 3DWLG 5AIJA 3AAAC 2X6FA 3R7RA 3NB2A 2WXGA 3UM3A 3PUKA 4F53A 4ANVA 3LJ3A 2F37A 3IBEA 3C3OA 2J07A 1TNUA 4G1TA 1XGWA 3T9KA 1D8EA 5EX3A 1MQSA 4WNDA 3Q9UC 1SZ9A 2GRPB 4JVSA 3FUDA 1N9AA 1MJ0A 3LS8A 2DCPA 4AJWA 3QWWA 1ELKA 4B8AA 3SD5A 3UMVA 4DK5A 1MX6A 2XHEA 3UXGA 3EHRA 3PZ2A 2B0OE 5KWDA 4GTMA 3NOCD 4L9PA 4AXHA 3CK9A 3AG1E 1E8XA 4TXPA 3E34A 4BEPA 2WPVA 4K5AB 5E76A 5BPPA 5G04C 2P9NG 3S2AA 3P2BA 4N39A 1HG2A 4BFRA 3FU0A 2XPZA 3UQ3A 2PM7A 1MX2A 3U3WA 3DBSA 3DXKG 2X6IA 2XZDG 2KCVA 4L7TA 4L1BA 1N94A 2XQ0A 2CFZA 4H7XA 2I2OA 3PZ1A 2XGMA 1FVHA 2WXMA 5ENTD 3FWVA 1W3BA 4G11A 3OXGA 2WXRA 2IOSA 2E0IA 5ARGA 1KPSB 2YQ8A 2WM9A 2P58C 3CK7A 4TUMA 5D0QD 2CHWA 4DJAA 3UINC 4N3CA 4I2WA 2H6IA 2IO3C 5D0OD 3UKUG 2LAIA 1L5JA 1IXVA 3ZIMA 4ACKA 2MOWA 5CERB 2P9PG 3RSEG 1Z3XA 2L9BA 4A1SA 2V5FA 4F1SA 4ABNA 5CBNA 4EQFA 1N95A 4ILIA 2C0MA 2NXPA 3GZ2A 1LTXA 2BKGA 3CSFA 4N2SA 4UUCA 3SFXA 5ANRA 3T8KA 4KXKB 1SA4A 4KBQA 4CT0A 4X8QA 4HRMB 5ANLA 1JCSA 3PREA 1VDYA 2R59A 3RO3A 3UTMA 2YNQA 2RD0A 4K5CA 1QQEA 2WXQA 1S64A 1LD7A 3S7BA 2ZXWE 5FT9A 2PQRA 2DIWA 4GAAA 5D66A 5FQ8A 4TV3A 3G2SA 2L0IA 3MJWA 3TJPA 3PE3A 3CVVA 4AVXA 4G23A 3DXMG 2FBNA 3CVNA 4I2ZA 3MZLB 2AVPA 4LCTA 2XEEA 1SZAA 4NQ0A 4KT6B 4FU3A 2FULA 1U3DA 5BNWA 2JABA 2P9IG 5ENPD 3HXFA 3BQOA 2X3MA 3P1UA 4Q94A 3QDNA 2I9CA 5HRYA 3B95A 4B0ZA 1S70B 4HRLA 4EPZA 2DWZA 1E8YA 5ENOD 3C98A 4CEMA 3UT8A 1KT0A 1TNBA 3D9KA 5CCMA 2C0LA 5LP0A 2R03A 4DX5D 4HLEA 4HRNA 4XZ4A 3HXDA 3Q4AB 1H6PA 1IKND 4HOUA 2OEVA 3ASFA 4I1MA 4JL0A 3ZRHA 4UI9K 1HX8A 2J49A 3UX4A 4Z68A 4TXRA 1SQMA 3NOGD 4GA2A 3SO8A 3U4TA 3JUEA 5AAOA 3AG3E 3UT4A 2KCKA 5EYLA 2ZGDA 1MHQA 3OXFA 4CGWA 4ACLA 1TJFA 4DX2A 1LD8A 3TWWA 2BUGA 2XS8A 4JXTA 4GZDA 4JHJA 4MBGA 3FH5A 4HBDA 3TGOA 1X81A 4JHRA 2L0TB 1JPLA 1BPOA 4GYOA 3C3QA 4ANXA 3CEQA 5KCMA 3FTYA 4EZJA 3HYMB 2ETCA 3DPYA 4A1GA 3L17A 2GW1A 3U66A 2WB2A 4ATZD 3FUHA 4LG6A 1K1BA 4XKBA 3SBSA 5CEAA 4LNGA 2IU1A 1N4SA 2V0PA 5BW8C 1OWLA 4ATGA 5B1AE 1UOHA 5BUZA 4WNFA 4PS8A 3S7DA 4I1OB 3DEPA 4LNUD 2EIKE 1DCEA 4R7LA 3L08A 2UY1B 3PZDA 5C1DA 5G05J 3FUKA 1N4QA 3HVEA 1PY1A 2WXFA 5G55A 3I4GA 4BX8A 3FUEA 1WY6A 4C0EA 3ZW3A 2FEZA 3SFYA 1E96B 2ONDA 2IFUA 4HOQA 1HF8A 3LVQE 3JYSA 2UY1A 5ITZF 4HFGA 4KVMA 1YA0A 4I17A 2OV8A 3ULYA 4HS2A 3ASGA 3NQPA 2ETBA 5JJTA 2XS1A 3D9PA 5CECB 2IJGX 4GMRA 1B89A 2H6HA 3JCKC 2BEDA 3LXUX 3PS6A 4EECA 2KBXA 3FU6A 2H6FA 3DEOA 1HU3A 2XGOA 4U7EB 2V4LA 4NIKA 3DSSA 2VSYA 1O5MA 1UJKA 3Q9NC 3FULA 3ZPJA 4B89A 2LNIA 3AG4E 4BSXA 4N3AA 2RG8A 4RG9A 1OXJA 1H2VC 2YHEA 5EYPF 3UM2A 1UN9A 4HOSA 5G2NA 3MX3A 2PZIA 5CMYA 2FO7A 4AOFA 1NA3A 3IV0A 3FEXA 2DYRE 1G3NB 3UM1A 1DCQA 4GYWA 2V5QC 4J8EA 5KJNA 3UUXA 3AS4A 3NZUA 2KATA 4G2VA 5FQ6A 5ENQD 4I1AA 4FLHA 3RRMB 3KSLA 3KEZA 4G24A 4EBAG 3L16A 3ONLA 4M3OA 3BG1B 1H2UA 3DRAA 3SZ7A 4DLQA 1TEZA 3L82A 3KSQA 3PZ3A 5A6CA 3D9OA 1JUQA 2ZISA 3EJNA 2Y4TA 5KNHD 5H7PA 5JHBA 3R9MA 4HXIA 2JLBA 3CV0A 4AY5A 2IF4A 3Q73A 1K1AA 2XEHA 4G25A 2GGFA 4HORA 4IN3B 4AV7A 2FO1E 1OCRE 4DUIA 2R2LA 2KM4A 3ENEA 4GCOA 2VTBB 5M72A 2PQNA 3FUFA 4CDNA 5J08A 4WNGA 5AQAA 3QKYA 3EUVA 1JCQA 3Q7FA 3SI5A 4O6FA 4U0ZA 4KMOA 3ZYMA 5EN5D 1V54E 3IHVA 4I6GA 2AXUA 1Z3YA 4H7YA 1NZNA 4GYYA 5KBAA 1RW2A 2WMNA 1TN8A 2A5UA 5HI7A 1K8KG 3QAQA 5AN8A 3IXEA 3QNKA 3QARA 1E8WA 2LAHA 5JA4D 3RO2A 4FHKA 3JXIA 4TUUA 3ZYKA 5EX0A 2AJAA 4U04A 3FTWA 3PRZA 2CHZA 4J8SA 3GZ1A 2VSNA 2A4ZA 2PL2A 5EILA 4GTRA 5B3SE 4U96D 3Q5MA 1FPPA 4BERA 3V31A 3CHQA 4ILGA 4JD2G 1D8DA 3CVPA 3B13A 4JPSA 4UI9J 1GW6A 3LY8A 2KCLA 5FIOA 4HQDA 4GTOA 3MEKA 4JW1A 5EKQD 3SBTB 3G2TA 3Q7AA 4CT4A 3FUNA 4LEUA 4DX1A 5IY5E 2RFMA 2JEKA 3G2WA 2F8YA 4N2QA 1P5QA 1HZ4A 3FTSA 4CRWA 1ELRA 4F3VA 3HXEA 2XENA 4ILHB 5KNGA 3ULEG 4WNEA 2I1KA 3ML9A 4FLBA 4GB9A 3WG7E 2OEWA 3JQ1A 3D9NA 3ZEFA 1QBQA 3GZSA 3LYAA 3TWTA 1ZB1A 4TXQA 1KZOA 3FP3A 3SNXA 4E6HA 2AWIA 4J8YA 4HI9A 3MYVA 1N4PA 4G26A 2WXOA 5DIZA 4RG6A 2ZIRA 2J09A 4HB5A 3AU4A 4GZCA 3APFA 4BTAA 5BV1A 5AQ9A 3PNTB 2DBAA 3FU3A 2IONA 2DZNA 4GMLA 2BKKB 1A5EA 2I6HA 3EHMA 2VGXA 3Q47B 3RRUA 3X2QE 1NI1A 2Y0BG 2XCCA 1FVFA 2X38A 5KJKA 3ABLE 4U8YD 2CFUA 4LNBA 1Y8MA 3DSUA 2VGYA 2FI7A 1MX4A 1TNYA 3RAUA 3V2XA 1N0QA 3B7TA 4U63A 2WQ7A 4BESA 3LKUA 5AJLA 4FULA 3CHOA 2P9SG 1N4RA 4J7WA 1LF8A 2Y1LE 1AWCB 4PS7A 3JUIA 3UIPC 1QNFA 4GTSA 4IRUA 4ANWA 3OAWA 2GRLA 3KD7A 4NURA 3MV2B 4BWRA 5EDSA 1MYOA 3URZA 3B7RL 1N52A 5AQBA 2PM6A 3R7QA 4UWKA 5LFAA 1Y6IA 5T3RA 2WXNA 3V79K 2AXVA 3CKBA 4ZFHA 4GMJA 4L2YA 3FFLA 2KC7A 2RFAA 2XGSA 2NYJA 1FT2A 3CVXA 3E4BA 2GRQB 2HYZA 3HXBA 4RQIA 3FH8A 3ABKE 2GROB 4MLPA 4MRUA 2IOLA 4CZ2D 5A23A 1BLXB 3MV3B 4O1PA 5CEDB 5DBKA 3HHMA 3W9GA 4J6IA 2VGXB 1MZCA 3ZNGA 3CHMA 3TWRA 4JEHA 3ZUVB 4APOA 5D2MC 3TXMA 1BD8A 3CVUA 3ABME 1YMPA 4IYPA 3Q49B 3TG4A 2EINE 3MCXA 3S7FA 4QQIA 1OWOA 1X5BA 2QFCA 5EIDA 3KS2A 4PDXA 2R5SA 4A3TA 1O1RA 2AW6A 3HIZA 4UQZA 5B1BE 4OVUA 5C2YA 1SVXA 1HS6A 4F1PA 3MA5A 2LXLA 2AXZA 3TWQA 5JJ7A 1HFAA 4UWFA 3ZFWA 3EHNA 1JCRA 4DX6D 4GA0A 2KZTB 1Q2ZA 4N5CA 3PEVB 1U3CA 2LSVA 1OCZE 3B7SA 2MRIA 4FC8A 4YVOA 3OTNA 3C72A 4L23A 3CVLA 5JJ6A 5ARFA 3ASDA 3AJIA 3CQGB 3CIAA 3KAEA 4GU5A 1NA0A 2VSXE 5E75A 5CCLA 1UN8A 1OWPA 2J4BA 2GRNB 5T8IA 3D9IA 2BF0X 4WWOA 3PDNA 3CKCA 1ZBPA 3NZSA 5FWQA 3TXNA 4A3VA 5FZQA 4JC8A 4Q96A 4K03A 4CCAA 4FADA 2QC9A 4P29A 3HG0D 1H0AA 4NRHB 3FH7A 2HR2A 4V3IA 3F6QA 3C3RA 1OT8A 1QZ2A 3SY2A 3E30A 3APDA 3ESKA 4TRQA 4UWLA 1WM5A 2ILRA 2Y69E 4YDWA 4ANUA 4N3BA 2X6HA 1DC2A 3CVYA 4YDEA 3UPVA 3AS5A 2BTDA 3FY4A 3IHYA 1BI7B 4DRXE 1V55E 3R9AB 2VYIA 4BSZB 3MKQA 4HNAD 4U0SA 3ZU7B 3LEWA 3V2OA 4ZHBA 2F0YA 3QWVA 3NAWA 2VJ8A 3I5PA 2L6JA 4XX5A 1EF1C
chains in the Genus database with same CATH topology
1PAQA 4Y6CA 3CVPA 4FU3A 3B13A 4JPSA 4UI9J 3WXXA 3FU5A 2FULA 3FDHA 1GW6A 4GZ6A 3MGBA 4WUYA 3LY8A 2KCLA 1U3DA 4U07A 3S7JA 3D9LA 4MKTA 3FUJA 3GW4A 5AENA 5BNWA 3ZVVA 3CQCB 2X3MA 2XCBA 3MEKA 2WXLA 3QJZA 4JW1A 4FP7A 5G04J 4URKA 3P1UA 1EPUA 2M63A 5EKQD 4Q94A 3QDNA 3CHPA 2I9CA 3SBTB 2LSUA 5CMWA 3G2TA 3NF1A 4OVVA 4B0ZA 4YVQC 4I6EA 3QWPA 4I6JA 3FUNA 3L13A 4CT4A 3IEGA 4EPZA 4JA7A 1EYHA 1E8YA 4LEUA 3C98A 2CHXA 3ULQA 2JEKA 2YINA 3G2WA 4CEMA 3UT8A 1KT0A 2WXKA 4UQXA 4N2QA 3D9KA 4GPKA 1P5QA 5CCMA 2C0LA 3T8MA 5LP0A 1HZ4A 3FTSA 4CRWA 1ELRA 4F3VA 2HO1A 4GZ5A 4ILHB 4C9BB 4HLEA 3CHSA 3CR3A 3JQ0A 4XZ4A 4WNEA 4RSYA 2I1KA 1IHGA 3ML9A 2WXPA 4FLBA 3HVEB 3Q4AB 4GB9A 4UWGA 3FTZA 4HOUA 4RVBA 4AIFA 3JQ1A 3D9NA 3ZEFA 1UG3A 3ASFA 4I1MA 3GZSA 4I43A 4UQYA 1N54A 4JL0A 3LYAA 4MS6A 4QFVA 4L2LA 3ZRHA 4UI9K 5FJYA 1HX8A 3FTUA 3VTXA 2J49A 3UX4A 2J9QA 3TL5A 3FP3A 3D9JA 1SQMA 4GA2A 2NC9A 2Y4UA 3U4TA 3SNXA 4D10C 4E6HA 2AWIA 3MYVA 3L22A 4PS3A 2OVBA 4G26A 2KCKA 2QY7A 3UT4A 4DI4A 3OXFA 1MHQA 2WXOA 5DIZA 4RG6A 4CGWA 2WXIA 4ACLA 1TJFA 2J09A 3AU4A 4GZCA 3APFA 2VQ2A 3LY9A 4BTAA 5BV1A 2BUGA 3EDTB 3APCA 3PNTB 4U0UA 4JXTA 3ONKA 4B8CB 3RIBA 4C0MA 5G05C 4GZDA 4JHJA 4JZYA 4NACA 2DBAA 3FU3A 3FH5A 2IONA 4PH4B 4GMLA 4JA9A 3TGOA 4JHRA 2L0TB 3Q15A 5LCWC 2MHKA 1JPLA 2I6HA 3SGHA 1BPOA 4BY6A 3EHMA 4GYOA 2VGXA 3Q47B 4CDRA 3RRUA 4WWNA 3QB2A 4CGVA 3L54A 3PNLB 3MKRA 4LUNU 1KLXA 2UWJG 2XCCA 3O4ZA 4ANXA 3CEQA 5AJDA 5BV0A 1FVFA 5KCMA 3FTYA 2X38A 1OWMA 4ME2A 3HYMB 4UI9C 4A1GA 4EZJA 5KJKA 3PH0C 3L17A 5FQ7A 5LOZA 2GW1A 2OVFA 1H2TC 2CFUA 3K9IA 4FJZA 3U66A 1Y8MA 4YNDA 3QOUA 3ZGQA 2WB2A 2X6JA 4FJYA 4DI3A 2VGYA 4I9EA 3FUHA 2FI7A 3GYZA 4AP2A 4XIFA 3IKOB 2XRZA 2E2EA 1FCHA 2HM8A 3B7TA 4U63A 3U64A 3BG0B 4E85A 5ENNA 2WQ7A 3BEEA 4XKBA 4Y6WA 2LO6A 3LKUA 3SBSA 4CDMA 4Q69A 3ASHA 3RJVA 3DPDA 5AJLA 1HE8A 3FTVA 2IU1A 2V0PA 5BW8C 3AU5A 4FULA 4AM9A 3CHOA 1OWLA 4ATGA 3RKVA 4HOTA 3LCAA 3ZN3A 4B94A 2WXJA 1LF8A 5BUZA 3CHRA 3VLDA 4WWPA 4WNFA 3U9WA 3CVWA 4PS8A 3PE4A 4EZLA 4PS7A 3JUIA 1QNFA 3S7DA 1S0PA 4IRUA 4I1OB 4ANWA 4UWHA 3OAWA 2GRLA 4R7LA 3KD7A 4EBAA 2I1JA 4I9CA 2CG3A 3CSTA 3L08A 1ZU2A 2VTBA 2J08A 4NURA 3MV2B 3ZXSA 4BWRA 5LX8A 2UY1B 1OUVA 5EDSA 1E8ZA 1INZA 3PZDA 5C1DA 2J4DA 3O48A 3URZA 5G05J 3B7RL 5FQ4A 3FUKA 3EIQC 3HVEA 4XKCA 2X6KA 1UJJA 2WXHA 2YHCA 1PY1A 1N52A 2WXFA 5HQ8A 5G55A 3I4GA 4BX8A 3T5XA 2PM6A 3R7QA 1UW4B 4UWKA 3VTYA 3FUEA 4BTBA 4DLOA 3G2VA 5LFAA 1Y6IA 5T3RA 1WY6A 2WXNA 4C0EA 5AYWD 1JWFA 5AIJA 3N71A 2OOEA 2X6FA 2FEZA 3CK8A 3ZW3A 2AXVA 3R7RA 4BT8A 4A55A 3CKBA 2WXGA 4IULA 1E96B 4GMJA 2ONDA 4L2YA 2IFUA 3PUKA 4HOQA 1HF8A 4F53A 4ANVA 3LJ3A 3IBEA 3FFLA 3LVQE 2KC7A 3JYSA 2J07A 4EZKA 2UY1A 4XI0A 4G1TA 2XGSA 3G2UA 3LPZA 4HFGA 1XGWA 3T5VA 3D3MA 4KVMA 5A7DB 1E7UA 5EX3A 1YA0A 1MQSA 4WNDA 1PC2A 4I17A 1SZ9A 3CVXA 3E4BA 2OV8A 4XE0A 2HYZA 1WAO1 2Q7FA 4HS2A 3FUDA 4JVSA 3FH8A 4GA1A 4MLPA 4MRUA 1HH8A 2IOLA 3LS8A 2DCPA 5A23A 4AJWA 3ASGA 3MV3B 1TJCA 3QWWA 1ELKA 3NQPA 5JHAA 5DBKA 4B8AA 5JJTA 3HHMA 3D9PA 3SD5A 4U8HA 2IJGX 3UMVA 4DK5A 4J6IA 4J0UA 2WVIA 4JHKA 2VGXB 5FZRA 2XHEA 3CHMA 1H6KA 2EQXA 1B89A 3JCKC 4PUCA 4JEHA 3LXUX 3PS6A 4APOA 4EECA 3TXMA 3FU6A 3CVUA 1HU3A 2XGOA 3AS8A 3RRNB 2V4LA 3I4RB 4KVOA 2VSYA 4AXHA 1UJKA 3CK9A 4IYPA 3ESLA 1E7VA 1E8XA 3FULA 3Q49B 4GCNA 3TG4A 4WAFA 3ZPJA 3ZYQA 4B89A 2LNIA 4BSXA 3CLJA 4N3AA 2RG8A 3MCXA 1XNFA 2WPVA 4RG9A 3S7FA 3LVRE 5E76A 4KZ0A 1OWOA 1X5BA 4OYSA 2QFCA 5G04C 5BPPA 3S2AA 1H2VC 2YHEA 3KS2A 2C2LA 4PDXA 1UN9A 4W9RA 4HOSA 1Z6TA 3P2BA 5G2NA 2WQHA 4N39A 3MX3A 2R5SA 3ZHEB 1HG2A 4A3TA 3HIZA 2AW6A 3QK0A 4BFRA 4UQZA 3FEYA 2PZIA 1HO8A 3FU0A 5CMYA 2FO7A 4OVUA 5C2YA 2WMOA 4AOFA 1NA3A 3IV0A 3FEXA 2XPZA 1HS6A 3UQ3A 2PM7A 4KYOB 3MA5A 4FHJA 4GYWA 3ZYLA 2AXZA 1IQUA 4J8EA 3TAXA 5KJNA 1KT1A 3UUXA 3U3WA 3AS4A 3NZUA 4FA6A 5JJ7A 2KATA 4G2VA 3DBSA 1HFAA 4UWFA 4DPRA 5FQ6A 4I1AA 4FLHA 3RRMB 2X6IA 2CG2A 2VSOE 3ZFWA 3EHNA 4KZCA 4XI9A 4GA0A 2KZTB 2KCVA 3KEZA 4L7TA 4L1BA 4N5CA 3PEVB 1U3CA 4JEUA 4G24A 4EBAG 2XQ0A 4J8FA 2CFZA 4H7XA 3L16A 3ONLA 2LSVA 4M3OA 3BG1B 3PEUB 1H2UA 2I2OA 3SZ7A 3B7SA 2MRIA 4FC8A 4APFA 4DLQA 1TEZA 4YVOA 3OTNA 2XGMA 4L23A 5CHEE 4AY6A 3CVLA 1FVHA 5JJ6A 5A6CA 3D9OA 5BT1A 1JUQA 2IQCA 5FZSA 1A17A 2WXMA 3EJNA 2Y4TA 5ARFA 3ASDA 3FWVA 5JHBA 4LERA 3CQGB 1W3BA 4HXIA 2JLBA 3CIAA 3KAEA 4GU5A 1NA0A 3CV0A 2VSXE 5E75A 4AY5A 2XPIA 4G11A 3OXGA 2IF4A 2WXRA 3EIJA 5CCLA 3CGHA 1UN8A 2IOSA 1DNPA 1OWPA 2E0IA 2J4BA 5ARGA 5KJLA 2YQ8A 4G25A 3SHFA 2GGFA 3CVQA 2WM9A 2V8SE 4HORA 4IN3B 4AV7A 5T8IA 3D9IA 3PUJA 2P58C 3CK7A 2BF0X 4WWOA 3PDNA 3QC1A 4HVBA 3CKCA 5D0QD 1ZBPA 2CHWA 2KM4A 3ENEA 3NZSA 5FTPA 5FWQA 4GCOA 5J90A 3PVLA 5M72A 3TXNA 2PQNA 3FUFA 4A3VA 3LDZA 5FZQA 4DJAA 2VTBB 4JC8A 4N3CA 3FTXA 4Q96A 4CDNA 5J08A 4I2WA 4WNGA 4K03A 3QKYA 5D0OD 2LAIA 1L5JA 2KZTA 3B7UX 4CCAA 4FADA 3ZIMA 3SI5A 4ACKA 2MOWA 4O6FA 4BT9A 4P29A 1DVPA 4F7AA 5KJMA 1H0AA 1Z3XA 2L9BA 3FHEA 4A1SA 1E90A 3FH7A 4NRHB 4U0ZA 2HR2A 4V3IA 2Y3AA 4KMOA 1IQRA 2V5FA 3ZYMA 4F1SA 1HG5A 1HXIA 4ABNA 3IHVA 4I6GA 4EQFA 2AXUA 4ILIA 3SFZA 1QZ2A 1Z3YA 2C0MA 2NXPA 3GZ2A 3APDA 3ESKA 4H7YA 1NZNA 4GYYA 4TRQA 4UWLA 4K0RA 1WM5A 4AEZC 2ILRA 2FF4A 3CSFA 2WMNA 2GRMA 4N2SA 2A5UA 5HI7A 4ANUA 4LRZA 5ANRA 4KXKB 4N3BA 2X6HA 4BX9A 3RU0A 3QAQA 4KBQA 1H19A 5LCWJ 3SF4A 3MKQB 4J8DA 4CT0A 3QNKA 3QARA 1E8WA 3CVYA 3UT7A 3FUMA 3UPVA 2LAHA 5ANLA 2XPYA 3AS5A 3PREA 1VDYA 3RO2A 2R59A 3RO3A 2BTDA 2YNQA 3FY4A 3L6AA 1EDUA 4FHKA 3ZYKA 2RD0A 4TUUA 1QQEA 5EX0A 4U04A 2WXQA 3ML8A 1IYGA 3IHYA 3FTWA 3PRZA 2CHZA 3OXLA 3S7BA 4J8SA 3GZ1A 1OWNA 5FT9A 2PQRA 2VSNA 2DIWA 2NSZA 4GAAA 3VLEA 5FQ8A 4TV3A 3FUIA 1NP7A 2WQ6A 3G2SA 2L0IA 3R9AB 3MJWA 3LY7A 2VYIA 3TJPA 2A4ZA 3MKQA 3HDXA 2PL2A 3PE3A 3CVVA 4U0SA 4AVXA 4GZ3A 3TG5A 4G23A 3LEWA 2FBNA 3QWVA 3CVNA 4I2ZA 3ZHEA 1ELWA 3MZLB 2AVPA 4LCTA 2VJ8A 1JWGA 2R17C 3I5PA 5T4YA 3Q5MA 3I3NA 2L6JA 4XX5A 2XRYA 2ZU6B 3D9MA 3VLFA 3RK6A 1SZAA 2XEVA 1EF1C 3CHQA 4ILGA 4KT6B 4NQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FU3 A;  1ELK A;  2KM4 A;  2LO6 A;  3D9N A;  3G2S A;  3ONL A;  1UJK A;  4GZC A;  1EYH A;  2L0I A;  3ZYM A;  1INZ A;  1HG5 A;  3G2U A;  3LDZ A;  4HFG A;  3D9P A;  1XGW A;  3ZYL A;  3D9O A;  3ONK A;  1JUQ A;  4JXT A;  1VDY A;  1UJJ A;  3G2W A;  3ZYQ A;  4AVX A;  1HX8 A;  1PY1 A;  3CLJ A;  3D9L A;  4GZD A;  4NAC A;  4Q96 A;  3D9K A;  5LOZ A;  5J08 A;  1SZ9 A;  1HFA A;  1EDU A;  1LF8 A;  3D9J A;  3ZYK A;  5LP0 A;  3G2V A;  1X5B A;  2L0T B;  1JWF A;  1JWG A;  1JPL A;  2MOW A;  1DVP A;  1HG2 A;  3D9M A;  1H0A A;  4Q94 A;  3RRU A;  1SZA A;  2V8S E;  2QY7 A;  4FLB A;  3G2T A;  5CMW A;  1MHQ A;  2DCP A;  3D9I A;  5CMY A;  2BF0 X;  2DIW A;  1HF8 A; 
#chains in the Genus database with same CATH topology
 1PAQ A;  2GRR B;  4Y6C A;  3WXX A;  3FU5 A;  4WUY A;  4U07 A;  3S7J A;  3GW4 A;  3CQC B;  2XCB A;  2WXL A;  5G04 J;  4FP7 A;  2R02 A;  1EPU A;  2M63 A;  3KEA A;  2LSU A;  5CMW A;  2DYS E;  3NF1 A;  4I6E A;  3IEG A;  3HRA A;  2CHX A;  3ASN E;  2WXK A;  4UQX A;  3T8M A;  2HO1 A;  3D9H A;  1AP7 A;  3ASO E;  4YDO A;  2WXP A;  1NFI E;  2KXP C;  3FTZ A;  1UG3 A;  1NL4 A;  4I43 A;  3B7B A;  3E33 A;  4UQY A;  1YYH A;  2J9Q A;  4O1O A;  3TL5 A;  3UIO C;  4D10 C;  4PS3 A;  2OVB A;  2QY7 A;  4GTT A;  3Q78 A;  3UI2 A;  2QYJ A;  3EU5 A;  2LXM A;  3EDT B;  4U0U A;  3TWU A;  3ONK A;  4B8C B;  3RIB A;  4C0M A;  4NAC A;  4PH4 B;  2J8S D;  3E37 A;  3Q15 A;  5LCW C;  2MHK A;  3SGH A;  4RLY A;  3SQV A;  4WWN A;  4HI8 A;  4CGV A;  1KLX A;  1BU9 A;  3O4Z A;  5BV0 A;  4ME2 A;  4UI9 C;  5FQ7 A;  5LOZ A;  4FJZ A;  3UKR G;  4YND A;  5HKP A;  3QOU A;  3ZGQ A;  4FJY A;  1WDY A;  3GYZ A;  4AP2 A;  2P9U G;  4XIF A;  4K5B A;  2XRZ A;  4GTQ A;  1FCH A;  2HM8 A;  3TWX A;  3U64 A;  1TN7 A;  4Y6W A;  2LO6 A;  4CDM A;  4HLL A;  3ASH A;  2F8X K;  3RJV A;  4M7C A;  1HE8 A;  3FTV A;  3UM0 A;  4AM9 A;  3RKV A;  4HOT A;  3ZN3 A;  4B94 A;  2WXJ A;  2EIM E;  5BXU A;  3VLD A;  4WWP A;  3U9W A;  3PE4 A;  4EZL A;  2IO2 C;  3W9F A;  1ZU2 A;  2VTB A;  2J08 A;  3ZXS A;  5LX8 A;  1INZ A;  3O48 A;  3DSX A;  3EIQ C;  2X6K A;  2WXH A;  5HQ8 A;  1UW4 B;  4DLO A;  5AYW D;  1JWF A;  3N71 A;  2OOE A;  3CK8 A;  4YDY A;  3DSV A;  4BT8 A;  4A55 A;  4IUL A;  4A63 B;  3V30 A;  1N0R A;  5EIB E;  3HXC A;  4EZK A;  4XI0 A;  3G2U A;  3LPZ A;  4B93 B;  3T5V A;  3D3M A;  5A7D B;  1E7U A;  3L9T A;  1PC2 A;  2B6C A;  4XE0 A;  1WAO 1;  2Q7F A;  4GA1 A;  1HH8 A;  4JB8 P;  3DSW A;  1FT1 A;  1S63 A;  1TJC A;  5JHA A;  3EU9 A;  2DVW A;  4U8V D;  4U8H A;  4LSZ E;  1TR4 A;  4J0U A;  2WVI A;  4JHK A;  3TWV A;  5FZR A;  1H6K A;  2EQX A;  4PUC A;  2PNN A;  3NBN B;  3AS8 A;  3RRN B;  3I4R B;  4KVO A;  3ISM C;  3C5R A;  1U2V G;  3ESL A;  1E7V A;  2P9L G;  4GCN A;  3ZYQ A;  4WAF A;  3CLJ A;  1XNF A;  3LVR E;  2RKK A;  4KZ0 A;  4OYS A;  1TNZ A;  2C2L A;  4W9R A;  1Z6T A;  2WQH A;  3ZHE B;  3TWS A;  3QK0 A;  3FEY A;  1HO8 A;  2WMO A;  1Z5S C;  4KYO B;  5JMN D;  4FHJ A;  3ZYL A;  3TAX A;  1IQU A;  1KT1 A;  4FA6 A;  4DPR A;  1K3Z D;  2CG2 A;  2VSO E;  4KZC A;  4XI9 A;  4N5Q A;  4OAV B;  4JEU A;  4J8F A;  1OCO E;  5BXO A;  3PEU B;  2ZGG A;  4APF A;  5CHE E;  4AY6 A;  5BT1 A;  5FZS A;  1TNO A;  2IQC A;  1A17 A;  4LER A;  4G8L A;  5CRU A;  2XPI A;  3EIJ A;  2QZA A;  3CGH A;  1DNP A;  4CYM D;  5KJL A;  3SHF A;  3CVQ A;  2V8S E;  3PUJ A;  3QC1 A;  4HVB A;  5FTP A;  2OCC E;  5J90 A;  3PVL A;  3LDZ A;  3FTX A;  1TYQ G;  4BET A;  2KZT A;  3B7U X;  4BT9 A;  1DVP A;  1O1T A;  4F7A A;  5KJM A;  1YCS B;  3FHE A;  1E90 A;  2EIL E;  2Y3A A;  1IQR A;  1HG5 A;  1HXI A;  3SFZ A;  3AG2 E;  4K0R A;  5HS0 A;  4AEZ C;  2FF4 A;  1O1S A;  2GRM A;  5CRV A;  3ZXP A;  3Q75 A;  4LRZ A;  1N11 A;  4BX9 A;  3RU0 A;  5LCW J;  1H19 A;  3DST A;  3SF4 A;  1OY3 D;  3MKQ B;  4J8D A;  3EHQ A;  1IHB A;  3UT7 A;  3FUM A;  3PZ4 A;  2XPY A;  2IEJ A;  3L6A A;  1EDU A;  4G8K A;  3ML8 A;  1IYG A;  3OXL A;  1OWN A;  3VLE A;  2NSZ A;  3FUI A;  1NP7 A;  2WQ6 A;  3LJN A;  3LY7 A;  1WG0 A;  3HDX A;  1TN6 A;  4GZ3 A;  3TG5 A;  2A5E A;  4GTV A;  3BUA A;  2R05 A;  3ZHE A;  1ELW A;  3Q79 A;  1JWG A;  4C48 B;  2R17 C;  5T4Y A;  1OCC E;  3I3N A;  2XRY A;  2ZU6 B;  3D9M A;  3VLF A;  3RK6 A;  2XEV A;  4U95 D;  3FDH A;  5FIN A;  4GPM A;  4GZ6 A;  3MGB A;  3D9L A;  1KZP A;  1SW6 A;  3FUJ A;  4MKT A;  2H6G A;  5AEN A;  3ZVV A;  2QYU A;  3QJZ A;  4O60 A;  4URK A;  3JXJ A;  3CHP A;  4OVV A;  2V4H C;  4YVQ C;  3QWP A;  4I6J A;  3L13 A;  4JA7 A;  1EYH A;  2ETA A;  2EIJ E;  3ULQ A;  2YIN A;  2LUH A;  4GPK A;  3J5Q B;  4GZ5 A;  4C9B B;  3CHS A;  3CR3 A;  3JQ0 A;  4RSY A;  4DX7 D;  1IHG A;  3HVE B;  4UWG A;  4RVB A;  3E32 A;  4AIF A;  2DZO A;  4XEI G;  1N54 A;  4GTP A;  4MS6 A;  4QFV A;  4L2L A;  5FJY A;  3FTU A;  3VTX A;  3D9J A;  1BI8 B;  2NC9 A;  2Y4U A;  2HE0 A;  2IY0 C;  2P9K G;  3L22 A;  5AQ7 A;  4EHM A;  4DI4 A;  2L6B A;  3J5P A;  2WXI A;  5ENR D;  2VQ2 A;  3LY9 A;  3APC A;  2VGE A;  5G05 C;  4JZY A;  4JA9 A;  4BY6 A;  4CDR A;  3QB2 A;  4OAU C;  3L54 A;  3PNL B;  1H6O A;  3MKR A;  4LUN U;  1D9S A;  5CBO A;  2UWJ G;  5AAR A;  5AJD A;  3BU8 A;  1QYM A;  1OWM A;  3ZKJ A;  3PH0 C;  2OVF A;  1H2T C;  3K9I A;  2X6J A;  4DI3 A;  4I9E A;  3IKO B;  2E2E A;  3BG0 B;  4E85 A;  5ENN A;  3BEE A;  4F6R D;  1RZ4 A;  4Q69 A;  3DPD A;  3AU5 A;  3LCA A;  5ENS D;  3CHR A;  3CVW A;  1S0P A;  4UWH A;  2MYO A;  4EBA A;  2I1J A;  4I9C A;  2CG3 A;  3CST A;  1OUV A;  1E8Z A;  2J4D A;  1SA5 A;  5FQ4 A;  2XZT G;  2P2C P;  4XKC A;  1UJJ A;  2YHC A;  3T5X A;  4BTB A;  3VTY A;  3G2V A;  3DWL G;  5AIJ A;  3AAA C;  2X6F A;  3R7R A;  3NB2 A;  2WXG A;  3UM3 A;  3PUK A;  4F53 A;  4ANV A;  3LJ3 A;  2F37 A;  3IBE A;  3C3O A;  2J07 A;  1TNU A;  4G1T A;  1XGW A;  3T9K A;  1D8E A;  5EX3 A;  1MQS A;  4WND A;  3Q9U C;  1SZ9 A;  2GRP B;  4JVS A;  3FUD A;  1N9A A;  1MJ0 A;  3LS8 A;  2DCP A;  4AJW A;  3QWW A;  1ELK A;  4B8A A;  3SD5 A;  3UMV A;  4DK5 A;  1MX6 A;  2XHE A;  3UXG A;  3EHR A;  3PZ2 A;  2B0O E;  5KWD A;  4GTM A;  3NOC D;  4L9P A;  4AXH A;  3CK9 A;  3AG1 E;  1E8X A;  4TXP A;  3E34 A;  4BEP A;  2WPV A;  4K5A B;  5E76 A;  5BPP A;  5G04 C;  2P9N G;  3S2A A;  3P2B A;  4N39 A;  1HG2 A;  4BFR A;  3FU0 A;  2XPZ A;  3UQ3 A;  2PM7 A;  1MX2 A;  3U3W A;  3DBS A;  3DXK G;  2X6I A;  2XZD G;  2KCV A;  4L7T A;  4L1B A;  1N94 A;  2XQ0 A;  2CFZ A;  4H7X A;  2I2O A;  3PZ1 A;  2XGM A;  1FVH A;  2WXM A;  5ENT D;  3FWV A;  1W3B A;  4G11 A;  3OXG A;  2WXR A;  2IOS A;  2E0I A;  5ARG A;  1KPS B;  2YQ8 A;  2WM9 A;  2P58 C;  3CK7 A;  4TUM A;  5D0Q D;  2CHW A;  4DJA A;  3UIN C;  4N3C A;  4I2W A;  2H6I A;  2IO3 C;  5D0O D;  3UKU G;  2LAI A;  1L5J A;  1IXV A;  3ZIM A;  4ACK A;  2MOW A;  5CER B;  2P9P G;  3RSE G;  1Z3X A;  2L9B A;  4A1S A;  2V5F A;  4F1S A;  4ABN A;  5CBN A;  4EQF A;  1N95 A;  4ILI A;  2C0M A;  2NXP A;  3GZ2 A;  1LTX A;  2BKG A;  3CSF A;  4N2S A;  4UUC A;  3SFX A;  5ANR A;  3T8K A;  4KXK B;  1SA4 A;  4KBQ A;  4CT0 A;  4X8Q A;  4HRM B;  5ANL A;  1JCS A;  3PRE A;  1VDY A;  2R59 A;  3RO3 A;  3UTM A;  2YNQ A;  2RD0 A;  4K5C A;  1QQE A;  2WXQ A;  1S64 A;  1LD7 A;  3S7B A;  2ZXW E;  5FT9 A;  2PQR A;  2DIW A;  4GAA A;  5D66 A;  5FQ8 A;  4TV3 A;  3G2S A;  2L0I A;  3MJW A;  3TJP A;  3PE3 A;  3CVV A;  4AVX A;  4G23 A;  3DXM G;  2FBN A;  3CVN A;  4I2Z A;  3MZL B;  2AVP A;  4LCT A;  2XEE A;  1SZA A;  4NQ0 A;  4KT6 B;  4FU3 A;  2FUL A;  1U3D A;  5BNW A;  2JAB A;  2P9I G;  5ENP D;  3HXF A;  3BQO A;  2X3M A;  3P1U A;  4Q94 A;  3QDN A;  2I9C A;  5HRY A;  3B95 A;  4B0Z A;  1S70 B;  4HRL A;  4EPZ A;  2DWZ A;  1E8Y A;  5ENO D;  3C98 A;  4CEM A;  3UT8 A;  1KT0 A;  1TNB A;  3D9K A;  5CCM A;  2C0L A;  5LP0 A;  2R03 A;  4DX5 D;  4HLE A;  4HRN A;  4XZ4 A;  3HXD A;  3Q4A B;  1H6P A;  1IKN D;  4HOU A;  2OEV A;  3ASF A;  4I1M A;  4JL0 A;  3ZRH A;  4UI9 K;  1HX8 A;  2J49 A;  3UX4 A;  4Z68 A;  4TXR A;  1SQM A;  3NOG D;  4GA2 A;  3SO8 A;  3U4T A;  3JUE A;  5AAO A;  3AG3 E;  3UT4 A;  2KCK A;  5EYL A;  2ZGD A;  1MHQ A;  3OXF A;  4CGW A;  4ACL A;  1TJF A;  4DX2 A;  1LD8 A;  3TWW A;  2BUG A;  2XS8 A;  4JXT A;  4GZD A;  4JHJ A;  4MBG A;  3FH5 A;  4HBD A;  3TGO A;  1X81 A;  4JHR A;  2L0T B;  1JPL A;  1BPO A;  4GYO A;  3C3Q A;  4ANX A;  3CEQ A;  5KCM A;  3FTY A;  4EZJ A;  3HYM B;  2ETC A;  3DPY A;  4A1G A;  3L17 A;  2GW1 A;  3U66 A;  2WB2 A;  4ATZ D;  3FUH A;  4LG6 A;  1K1B A;  4XKB A;  3SBS A;  5CEA A;  4LNG A;  2IU1 A;  1N4S A;  2V0P A;  5BW8 C;  1OWL A;  4ATG A;  5B1A E;  1UOH A;  5BUZ A;  4WNF A;  4PS8 A;  3S7D A;  4I1O B;  3DEP A;  4LNU D;  2EIK E;  1DCE A;  4R7L A;  3L08 A;  2UY1 B;  3PZD A;  5C1D A;  5G05 J;  3FUK A;  1N4Q A;  3HVE A;  1PY1 A;  2WXF A;  5G55 A;  3I4G A;  4BX8 A;  3FUE A;  1WY6 A;  4C0E A;  3ZW3 A;  2FEZ A;  3SFY A;  1E96 B;  2OND A;  2IFU A;  4HOQ A;  1HF8 A;  3LVQ E;  3JYS A;  2UY1 A;  5ITZ F;  4HFG A;  4KVM A;  1YA0 A;  4I17 A;  2OV8 A;  3ULY A;  4HS2 A;  3ASG A;  3NQP A;  2ETB A;  5JJT A;  2XS1 A;  3D9P A;  5CEC B;  2IJG X;  4GMR A;  1B89 A;  2H6H A;  3JCK C;  2BED A;  3LXU X;  3PS6 A;  4EEC A;  2KBX A;  3FU6 A;  2H6F A;  3DEO A;  1HU3 A;  2XGO A;  4U7E B;  2V4L A;  4NIK A;  3DSS A;  2VSY A;  1O5M A;  1UJK A;  3Q9N C;  3FUL A;  3ZPJ A;  4B89 A;  2LNI A;  3AG4 E;  4BSX A;  4N3A A;  2RG8 A;  4RG9 A;  1OXJ A;  1H2V C;  2YHE A;  5EYP F;  3UM2 A;  1UN9 A;  4HOS A;  5G2N A;  3MX3 A;  2PZI A;  5CMY A;  2FO7 A;  4AOF A;  1NA3 A;  3IV0 A;  3FEX A;  2DYR E;  1G3N B;  3UM1 A;  1DCQ A;  4GYW A;  2V5Q C;  4J8E A;  5KJN A;  3UUX A;  3AS4 A;  3NZU A;  2KAT A;  4G2V A;  5FQ6 A;  5ENQ D;  4I1A A;  4FLH A;  3RRM B;  3KSL A;  3KEZ A;  4G24 A;  4EBA G;  3L16 A;  3ONL A;  4M3O A;  3BG1 B;  1H2U A;  3DRA A;  3SZ7 A;  4DLQ A;  1TEZ A;  3L82 A;  3KSQ A;  3PZ3 A;  5A6C A;  3D9O A;  1JUQ A;  2ZIS A;  3EJN A;  2Y4T A;  5KNH D;  5H7P A;  5JHB A;  3R9M A;  4HXI A;  2JLB A;  3CV0 A;  4AY5 A;  2IF4 A;  3Q73 A;  1K1A A;  2XEH A;  4G25 A;  2GGF A;  4HOR A;  4IN3 B;  4AV7 A;  2FO1 E;  1OCR E;  4DUI A;  2R2L A;  2KM4 A;  3ENE A;  4GCO A;  2VTB B;  5M72 A;  2PQN A;  3FUF A;  4CDN A;  5J08 A;  4WNG A;  5AQA A;  3QKY A;  3EUV A;  1JCQ A;  3Q7F A;  3SI5 A;  4O6F A;  4U0Z A;  4KMO A;  3ZYM A;  5EN5 D;  1V54 E;  3IHV A;  4I6G A;  2AXU A;  1Z3Y A;  4H7Y A;  1NZN A;  4GYY A;  5KBA A;  1RW2 A;  2WMN A;  1TN8 A;  2A5U A;  5HI7 A;  1K8K G;  3QAQ A;  5AN8 A;  3IXE A;  3QNK A;  3QAR A;  1E8W A;  2LAH A;  5JA4 D;  3RO2 A;  4FHK A;  3JXI A;  4TUU A;  3ZYK A;  5EX0 A;  2AJA A;  4U04 A;  3FTW A;  3PRZ A;  2CHZ A;  4J8S A;  3GZ1 A;  2VSN A;  2A4Z A;  2PL2 A;  5EIL A;  4GTR A;  5B3S E;  4U96 D;  3Q5M A;  1FPP A;  4BER A;  3V31 A;  3CHQ A;  4ILG A;  4JD2 G;  1D8D A;  3CVP A;  3B13 A;  4JPS A;  4UI9 J;  1GW6 A;  3LY8 A;  2KCL A;  5FIO A;  4HQD A;  4GTO A;  3MEK A;  4JW1 A;  5EKQ D;  3SBT B;  3G2T A;  3Q7A A;  4CT4 A;  3FUN A;  4LEU A;  4DX1 A;  5IY5 E;  2RFM A;  2JEK A;  3G2W A;  2F8Y A;  4N2Q A;  1P5Q A;  1HZ4 A;  3FTS A;  4CRW A;  1ELR A;  4F3V A;  3HXE A;  2XEN A;  4ILH B;  5KNG A;  3ULE G;  4WNE A;  2I1K A;  3ML9 A;  4FLB A;  4GB9 A;  3WG7 E;  2OEW A;  3JQ1 A;  3D9N A;  3ZEF A;  1QBQ A;  3GZS A;  3LYA A;  3TWT A;  1ZB1 A;  4TXQ A;  1KZO A;  3FP3 A;  3SNX A;  4E6H A;  2AWI A;  4J8Y A;  4HI9 A;  3MYV A;  1N4P A;  4G26 A;  2WXO A;  5DIZ A;  4RG6 A;  2ZIR A;  2J09 A;  4HB5 A;  3AU4 A;  4GZC A;  3APF A;  4BTA A;  5BV1 A;  5AQ9 A;  3PNT B;  2DBA A;  3FU3 A;  2ION A;  2DZN A;  4GML A;  2BKK B;  1A5E A;  2I6H A;  3EHM A;  2VGX A;  3Q47 B;  3RRU A;  3X2Q E;  1NI1 A;  2Y0B G;  2XCC A;  1FVF A;  2X38 A;  5KJK A;  3ABL E;  4U8Y D;  2CFU A;  4LNB A;  1Y8M A;  3DSU A;  2VGY A;  2FI7 A;  1MX4 A;  1TNY A;  3RAU A;  3V2X A;  1N0Q A;  3B7T A;  4U63 A;  2WQ7 A;  4BES A;  3LKU A;  5AJL A;  4FUL A;  3CHO A;  2P9S G;  1N4R A;  4J7W A;  1LF8 A;  2Y1L E;  1AWC B;  4PS7 A;  3JUI A;  3UIP C;  1QNF A;  4GTS A;  4IRU A;  4ANW A;  3OAW A;  2GRL A;  3KD7 A;  4NUR A;  3MV2 B;  4BWR A;  5EDS A;  1MYO A;  3URZ A;  3B7R L;  1N52 A;  5AQB A;  2PM6 A;  3R7Q A;  4UWK A;  5LFA A;  1Y6I A;  5T3R A;  2WXN A;  3V79 K;  2AXV A;  3CKB A;  4ZFH A;  4GMJ A;  4L2Y A;  3FFL A;  2KC7 A;  2RFA A;  2XGS A;  2NYJ A;  1FT2 A;  3CVX A;  3E4B A;  2GRQ B;  2HYZ A;  3HXB A;  4RQI A;  3FH8 A;  3ABK E;  2GRO B;  4MLP A;  4MRU A;  2IOL A;  4CZ2 D;  5A23 A;  1BLX B;  3MV3 B;  4O1P A;  5CED B;  5DBK A;  3HHM A;  3W9G A;  4J6I A;  2VGX B;  1MZC A;  3ZNG A;  3CHM A;  3TWR A;  4JEH A;  3ZUV B;  4APO A;  5D2M C;  3TXM A;  1BD8 A;  3CVU A;  3ABM E;  1YMP A;  4IYP A;  3Q49 B;  3TG4 A;  2EIN E;  3MCX A;  3S7F A;  4QQI A;  1OWO A;  1X5B A;  2QFC A;  5EID A;  3KS2 A;  4PDX A;  2R5S A;  4A3T A;  1O1R A;  2AW6 A;  3HIZ A;  4UQZ A;  5B1B E;  4OVU A;  5C2Y A;  1SVX A;  1HS6 A;  4F1P A;  3MA5 A;  2LXL A;  2AXZ A;  3TWQ A;  5JJ7 A;  1HFA A;  4UWF A;  3ZFW A;  3EHN A;  1JCR A;  4DX6 D;  4GA0 A;  2KZT B;  1Q2Z A;  4N5C A;  3PEV B;  1U3C A;  2LSV A;  1OCZ E;  3B7S A;  2MRI A;  4FC8 A;  4YVO A;  3OTN A;  3C72 A;  4L23 A;  3CVL A;  5JJ6 A;  5ARF A;  3ASD A;  3AJI A;  3CQG B;  3CIA A;  3KAE A;  4GU5 A;  1NA0 A;  2VSX E;  5E75 A;  5CCL A;  1UN8 A;  1OWP A;  2J4B A;  2GRN B;  5T8I A;  3D9I A;  2BF0 X;  4WWO A;  3PDN A;  3CKC A;  1ZBP A;  3NZS A;  5FWQ A;  3TXN A;  4A3V A;  5FZQ A;  4JC8 A;  4Q96 A;  4K03 A;  4CCA A;  4FAD A;  2QC9 A;  4P29 A;  3HG0 D;  1H0A A;  4NRH B;  3FH7 A;  2HR2 A;  4V3I A;  3F6Q A;  3C3R A;  1OT8 A;  1QZ2 A;  3SY2 A;  3E30 A;  3APD A;  3ESK A;  4TRQ A;  4UWL A;  1WM5 A;  2ILR A;  2Y69 E;  4YDW A;  4ANU A;  4N3B A;  2X6H A;  1DC2 A;  3CVY A;  4YDE A;  3UPV A;  3AS5 A;  2BTD A;  3FY4 A;  3IHY A;  1BI7 B;  4DRX E;  1V55 E;  3R9A B;  2VYI A;  4BSZ B;  3MKQ A;  4HNA D;  4U0S A;  3ZU7 B;  3LEW A;  3V2O A;  4ZHB A;  2F0Y A;  3QWV A;  3NAW A;  2VJ8 A;  3I5P A;  2L6J A;  4XX5 A;  1EF1 C; 
#chains in the Genus database with same CATH homology
 1PAQ A;  4Y6C A;  3CVP A;  4FU3 A;  3B13 A;  4JPS A;  4UI9 J;  3WXX A;  3FU5 A;  2FUL A;  3FDH A;  1GW6 A;  4GZ6 A;  3MGB A;  4WUY A;  3LY8 A;  2KCL A;  1U3D A;  4U07 A;  3S7J A;  3D9L A;  4MKT A;  3FUJ A;  3GW4 A;  5AEN A;  5BNW A;  3ZVV A;  3CQC B;  2X3M A;  2XCB A;  3MEK A;  2WXL A;  3QJZ A;  4JW1 A;  4FP7 A;  5G04 J;  4URK A;  3P1U A;  1EPU A;  2M63 A;  5EKQ D;  4Q94 A;  3QDN A;  3CHP A;  2I9C A;  3SBT B;  2LSU A;  5CMW A;  3G2T A;  3NF1 A;  4OVV A;  4B0Z A;  4YVQ C;  4I6E A;  3QWP A;  4I6J A;  3FUN A;  3L13 A;  4CT4 A;  3IEG A;  4EPZ A;  4JA7 A;  1EYH A;  1E8Y A;  4LEU A;  3C98 A;  2CHX A;  3ULQ A;  2JEK A;  2YIN A;  3G2W A;  4CEM A;  3UT8 A;  1KT0 A;  2WXK A;  4UQX A;  4N2Q A;  3D9K A;  4GPK A;  1P5Q A;  5CCM A;  2C0L A;  3T8M A;  5LP0 A;  1HZ4 A;  3FTS A;  4CRW A;  1ELR A;  4F3V A;  2HO1 A;  4GZ5 A;  4ILH B;  4C9B B;  4HLE A;  3CHS A;  3CR3 A;  3JQ0 A;  4XZ4 A;  4WNE A;  4RSY A;  2I1K A;  1IHG A;  3ML9 A;  2WXP A;  4FLB A;  3HVE B;  3Q4A B;  4GB9 A;  4UWG A;  3FTZ A;  4HOU A;  4RVB A;  4AIF A;  3JQ1 A;  3D9N A;  3ZEF A;  1UG3 A;  3ASF A;  4I1M A;  3GZS A;  4I43 A;  4UQY A;  1N54 A;  4JL0 A;  3LYA A;  4MS6 A;  4QFV A;  4L2L A;  3ZRH A;  4UI9 K;  5FJY A;  1HX8 A;  3FTU A;  3VTX A;  2J49 A;  3UX4 A;  2J9Q A;  3TL5 A;  3FP3 A;  3D9J A;  1SQM A;  4GA2 A;  2NC9 A;  2Y4U A;  3U4T A;  3SNX A;  4D10 C;  4E6H A;  2AWI A;  3MYV A;  3L22 A;  4PS3 A;  2OVB A;  4G26 A;  2KCK A;  2QY7 A;  3UT4 A;  4DI4 A;  3OXF A;  1MHQ A;  2WXO A;  5DIZ A;  4RG6 A;  4CGW A;  2WXI A;  4ACL A;  1TJF A;  2J09 A;  3AU4 A;  4GZC A;  3APF A;  2VQ2 A;  3LY9 A;  4BTA A;  5BV1 A;  2BUG A;  3EDT B;  3APC A;  3PNT B;  4U0U A;  4JXT A;  3ONK A;  4B8C B;  3RIB A;  4C0M A;  5G05 C;  4GZD A;  4JHJ A;  4JZY A;  4NAC A;  2DBA A;  3FU3 A;  3FH5 A;  2ION A;  4PH4 B;  4GML A;  4JA9 A;  3TGO A;  4JHR A;  2L0T B;  3Q15 A;  5LCW C;  2MHK A;  1JPL A;  2I6H A;  3SGH A;  1BPO A;  4BY6 A;  3EHM A;  4GYO A;  2VGX A;  3Q47 B;  4CDR A;  3RRU A;  4WWN A;  3QB2 A;  4CGV A;  3L54 A;  3PNL B;  3MKR A;  4LUN U;  1KLX A;  2UWJ G;  2XCC A;  3O4Z A;  4ANX A;  3CEQ A;  5AJD A;  5BV0 A;  1FVF A;  5KCM A;  3FTY A;  2X38 A;  1OWM A;  4ME2 A;  3HYM B;  4UI9 C;  4A1G A;  4EZJ A;  5KJK A;  3PH0 C;  3L17 A;  5FQ7 A;  5LOZ A;  2GW1 A;  2OVF A;  1H2T C;  2CFU A;  3K9I A;  4FJZ A;  3U66 A;  1Y8M A;  4YND A;  3QOU A;  3ZGQ A;  2WB2 A;  2X6J A;  4FJY A;  4DI3 A;  2VGY A;  4I9E A;  3FUH A;  2FI7 A;  3GYZ A;  4AP2 A;  4XIF A;  3IKO B;  2XRZ A;  2E2E A;  1FCH A;  2HM8 A;  3B7T A;  4U63 A;  3U64 A;  3BG0 B;  4E85 A;  5ENN A;  2WQ7 A;  3BEE A;  4XKB A;  4Y6W A;  2LO6 A;  3LKU A;  3SBS A;  4CDM A;  4Q69 A;  3ASH A;  3RJV A;  3DPD A;  5AJL A;  1HE8 A;  3FTV A;  2IU1 A;  2V0P A;  5BW8 C;  3AU5 A;  4FUL A;  4AM9 A;  3CHO A;  1OWL A;  4ATG A;  3RKV A;  4HOT A;  3LCA A;  3ZN3 A;  4B94 A;  2WXJ A;  1LF8 A;  5BUZ A;  3CHR A;  3VLD A;  4WWP A;  4WNF A;  3U9W A;  3CVW A;  4PS8 A;  3PE4 A;  4EZL A;  4PS7 A;  3JUI A;  1QNF A;  3S7D A;  1S0P A;  4IRU A;  4I1O B;  4ANW A;  4UWH A;  3OAW A;  2GRL A;  4R7L A;  3KD7 A;  4EBA A;  2I1J A;  4I9C A;  2CG3 A;  3CST A;  3L08 A;  1ZU2 A;  2VTB A;  2J08 A;  4NUR A;  3MV2 B;  3ZXS A;  4BWR A;  5LX8 A;  2UY1 B;  1OUV A;  5EDS A;  1E8Z A;  1INZ A;  3PZD A;  5C1D A;  2J4D A;  3O48 A;  3URZ A;  5G05 J;  3B7R L;  5FQ4 A;  3FUK A;  3EIQ C;  3HVE A;  4XKC A;  2X6K A;  1UJJ A;  2WXH A;  2YHC A;  1PY1 A;  1N52 A;  2WXF A;  5HQ8 A;  5G55 A;  3I4G A;  4BX8 A;  3T5X A;  2PM6 A;  3R7Q A;  1UW4 B;  4UWK A;  3VTY A;  3FUE A;  4BTB A;  4DLO A;  3G2V A;  5LFA A;  1Y6I A;  5T3R A;  1WY6 A;  2WXN A;  4C0E A;  5AYW D;  1JWF A;  5AIJ A;  3N71 A;  2OOE A;  2X6F A;  2FEZ A;  3CK8 A;  3ZW3 A;  2AXV A;  3R7R A;  4BT8 A;  4A55 A;  3CKB A;  2WXG A;  4IUL A;  1E96 B;  4GMJ A;  2OND A;  4L2Y A;  2IFU A;  3PUK A;  4HOQ A;  1HF8 A;  4F53 A;  4ANV A;  3LJ3 A;  3IBE A;  3FFL A;  3LVQ E;  2KC7 A;  3JYS A;  2J07 A;  4EZK A;  2UY1 A;  4XI0 A;  4G1T A;  2XGS A;  3G2U A;  3LPZ A;  4HFG A;  1XGW A;  3T5V A;  3D3M A;  4KVM A;  5A7D B;  1E7U A;  5EX3 A;  1YA0 A;  1MQS A;  4WND A;  1PC2 A;  4I17 A;  1SZ9 A;  3CVX A;  3E4B A;  2OV8 A;  4XE0 A;  2HYZ A;  1WAO 1;  2Q7F A;  4HS2 A;  3FUD A;  4JVS A;  3FH8 A;  4GA1 A;  4MLP A;  4MRU A;  1HH8 A;  2IOL A;  3LS8 A;  2DCP A;  5A23 A;  4AJW A;  3ASG A;  3MV3 B;  1TJC A;  3QWW A;  1ELK A;  3NQP A;  5JHA A;  5DBK A;  4B8A A;  5JJT A;  3HHM A;  3D9P A;  3SD5 A;  4U8H A;  2IJG X;  3UMV A;  4DK5 A;  4J6I A;  4J0U A;  2WVI A;  4JHK A;  2VGX B;  5FZR A;  2XHE A;  3CHM A;  1H6K A;  2EQX A;  1B89 A;  3JCK C;  4PUC A;  4JEH A;  3LXU X;  3PS6 A;  4APO A;  4EEC A;  3TXM A;  3FU6 A;  3CVU A;  1HU3 A;  2XGO A;  3AS8 A;  3RRN B;  2V4L A;  3I4R B;  4KVO A;  2VSY A;  4AXH A;  1UJK A;  3CK9 A;  4IYP A;  3ESL A;  1E7V A;  1E8X A;  3FUL A;  3Q49 B;  4GCN A;  3TG4 A;  4WAF A;  3ZPJ A;  3ZYQ A;  4B89 A;  2LNI A;  4BSX A;  3CLJ A;  4N3A A;  2RG8 A;  3MCX A;  1XNF A;  2WPV A;  4RG9 A;  3S7F A;  3LVR E;  5E76 A;  4KZ0 A;  1OWO A;  1X5B A;  4OYS A;  2QFC A;  5G04 C;  5BPP A;  3S2A A;  1H2V C;  2YHE A;  3KS2 A;  2C2L A;  4PDX A;  1UN9 A;  4W9R A;  4HOS A;  1Z6T A;  3P2B A;  5G2N A;  2WQH A;  4N39 A;  3MX3 A;  2R5S A;  3ZHE B;  1HG2 A;  4A3T A;  3HIZ A;  2AW6 A;  3QK0 A;  4BFR A;  4UQZ A;  3FEY A;  2PZI A;  1HO8 A;  3FU0 A;  5CMY A;  2FO7 A;  4OVU A;  5C2Y A;  2WMO A;  4AOF A;  1NA3 A;  3IV0 A;  3FEX A;  2XPZ A;  1HS6 A;  3UQ3 A;  2PM7 A;  4KYO B;  3MA5 A;  4FHJ A;  4GYW A;  3ZYL A;  2AXZ A;  1IQU A;  4J8E A;  3TAX A;  5KJN A;  1KT1 A;  3UUX A;  3U3W A;  3AS4 A;  3NZU A;  4FA6 A;  5JJ7 A;  2KAT A;  4G2V A;  3DBS A;  1HFA A;  4UWF A;  4DPR A;  5FQ6 A;  4I1A A;  4FLH A;  3RRM B;  2X6I A;  2CG2 A;  2VSO E;  3ZFW A;  3EHN A;  4KZC A;  4XI9 A;  4GA0 A;  2KZT B;  2KCV A;  3KEZ A;  4L7T A;  4L1B A;  4N5C A;  3PEV B;  1U3C A;  4JEU A;  4G24 A;  4EBA G;  2XQ0 A;  4J8F A;  2CFZ A;  4H7X A;  3L16 A;  3ONL A;  2LSV A;  4M3O A;  3BG1 B;  3PEU B;  1H2U A;  2I2O A;  3SZ7 A;  3B7S A;  2MRI A;  4FC8 A;  4APF A;  4DLQ A;  1TEZ A;  4YVO A;  3OTN A;  2XGM A;  4L23 A;  5CHE E;  4AY6 A;  3CVL A;  1FVH A;  5JJ6 A;  5A6C A;  3D9O A;  5BT1 A;  1JUQ A;  2IQC A;  5FZS A;  1A17 A;  2WXM A;  3EJN A;  2Y4T A;  5ARF A;  3ASD A;  3FWV A;  5JHB A;  4LER A;  3CQG B;  1W3B A;  4HXI A;  2JLB A;  3CIA A;  3KAE A;  4GU5 A;  1NA0 A;  3CV0 A;  2VSX E;  5E75 A;  4AY5 A;  2XPI A;  4G11 A;  3OXG A;  2IF4 A;  2WXR A;  3EIJ A;  5CCL A;  3CGH A;  1UN8 A;  2IOS A;  1DNP A;  1OWP A;  2E0I A;  2J4B A;  5ARG A;  5KJL A;  2YQ8 A;  4G25 A;  3SHF A;  2GGF A;  3CVQ A;  2WM9 A;  2V8S E;  4HOR A;  4IN3 B;  4AV7 A;  5T8I A;  3D9I A;  3PUJ A;  2P58 C;  3CK7 A;  2BF0 X;  4WWO A;  3PDN A;  3QC1 A;  4HVB A;  3CKC A;  5D0Q D;  1ZBP A;  2CHW A;  2KM4 A;  3ENE A;  3NZS A;  5FTP A;  5FWQ A;  4GCO A;  5J90 A;  3PVL A;  5M72 A;  3TXN A;  2PQN A;  3FUF A;  4A3V A;  3LDZ A;  5FZQ A;  4DJA A;  2VTB B;  4JC8 A;  4N3C A;  3FTX A;  4Q96 A;  4CDN A;  5J08 A;  4I2W A;  4WNG A;  4K03 A;  3QKY A;  5D0O D;  2LAI A;  1L5J A;  2KZT A;  3B7U X;  4CCA A;  4FAD A;  3ZIM A;  3SI5 A;  4ACK A;  2MOW A;  4O6F A;  4BT9 A;  4P29 A;  1DVP A;  4F7A A;  5KJM A;  1H0A A;  1Z3X A;  2L9B A;  3FHE A;  4A1S A;  1E90 A;  3FH7 A;  4NRH B;  4U0Z A;  2HR2 A;  4V3I A;  2Y3A A;  4KMO A;  1IQR A;  2V5F A;  3ZYM A;  4F1S A;  1HG5 A;  1HXI A;  4ABN A;  3IHV A;  4I6G A;  4EQF A;  2AXU A;  4ILI A;  3SFZ A;  1QZ2 A;  1Z3Y A;  2C0M A;  2NXP A;  3GZ2 A;  3APD A;  3ESK A;  4H7Y A;  1NZN A;  4GYY A;  4TRQ A;  4UWL A;  4K0R A;  1WM5 A;  4AEZ C;  2ILR A;  2FF4 A;  3CSF A;  2WMN A;  2GRM A;  4N2S A;  2A5U A;  5HI7 A;  4ANU A;  4LRZ A;  5ANR A;  4KXK B;  4N3B A;  2X6H A;  4BX9 A;  3RU0 A;  3QAQ A;  4KBQ A;  1H19 A;  5LCW J;  3SF4 A;  3MKQ B;  4J8D A;  4CT0 A;  3QNK A;  3QAR A;  1E8W A;  3CVY A;  3UT7 A;  3FUM A;  3UPV A;  2LAH A;  5ANL A;  2XPY A;  3AS5 A;  3PRE A;  1VDY A;  3RO2 A;  2R59 A;  3RO3 A;  2BTD A;  2YNQ A;  3FY4 A;  3L6A A;  1EDU A;  4FHK A;  3ZYK A;  2RD0 A;  4TUU A;  1QQE A;  5EX0 A;  4U04 A;  2WXQ A;  3ML8 A;  1IYG A;  3IHY A;  3FTW A;  3PRZ A;  2CHZ A;  3OXL A;  3S7B A;  4J8S A;  3GZ1 A;  1OWN A;  5FT9 A;  2PQR A;  2VSN A;  2DIW A;  2NSZ A;  4GAA A;  3VLE A;  5FQ8 A;  4TV3 A;  3FUI A;  1NP7 A;  2WQ6 A;  3G2S A;  2L0I A;  3R9A B;  3MJW A;  3LY7 A;  2VYI A;  3TJP A;  2A4Z A;  3MKQ A;  3HDX A;  2PL2 A;  3PE3 A;  3CVV A;  4U0S A;  4AVX A;  4GZ3 A;  3TG5 A;  4G23 A;  3LEW A;  2FBN A;  3QWV A;  3CVN A;  4I2Z A;  3ZHE A;  1ELW A;  3MZL B;  2AVP A;  4LCT A;  2VJ8 A;  1JWG A;  2R17 C;  3I5P A;  5T4Y A;  3Q5M A;  3I3N A;  2L6J A;  4XX5 A;  2XRY A;  2ZU6 B;  3D9M A;  3VLF A;  3RK6 A;  1SZA A;  2XEV A;  1EF1 C;  3CHQ A;  4ILG A;  4KT6 B;  4NQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...