2WMNA

Structure of the complex between dock9 and cdc42-gdp.
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
423
structure length
403
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEAHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 152
structure length 403
sequence length 423
ec nomenclature
pdb deposition date 2009-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wmnA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wmnA01
2WMNA 3VHLA 2WMOA 2WM9A 3B13A 2YINA
chains in the Genus database with same CATH superfamily
3DPDA 1UURA 2H6IA 1DC2A 4XBFB 5JDGA 1SUMB 2NW9A 4BX9A 1OEDE 4LNBA 4AIFA 4OAVB 2CHXA 2J07A 3WXXA 4F53A 2OV9A 3RRWA 2J9QA 2XGOA 5AN8A 4I2WA 4TXQA 2WDQA 2ZIRA 5IUXA 4DO0A 4GU5A 2Y6XA 2FBWA 3PZ3A 2HPLA 1D1CA 2L0TB 3BQIA 1FCHA 3P1UA 4HBDA 4HEAA 3QB5K 3CHSA 3VRBA 2E8IA 1OY3D 2R2LA 1AP7A 2DZNA 2LSYA 2P2CP 2X9XA 3PDYA 3A5XA 2UUBT 5IYZE 3TGOA 1Y64B 1LF8A 2WDRA 4H9QC 4DR7T 1IZNB 3ETVA 4QXBB 4JI6T 2LXLA 2XTLA 1PAQA 1P5QA 5EK3A 2YDQA 2WXOA 2X9HA 4UIGA 4HXIA 3LK2B 1BI8B 2JQKA 3ASOE 3W15B 3Q9NC 3AS8A 2XQ0A 3ULYA 5ANRA 4AXHA 2WWVA 2XEVA 4JZYA 3C98B 5A7DB 2YN6A 2MRIA 1W09A 2DI4A 3PE3A 3RRCA 2L6JA 1JWGA 5HYAA 5FZSA 4N3BA 4HRNA 2VVSA 3AE9A 4PS8A 4HWCA 2V8SV 1YKEB 4UELA 2WXLA 2KZ7B 2VL0A 3RK6A 3PUYF 3PUZF 5JR9B 3HKEE 4O6FA 3FUNA 4E6HA 3LJ3A 4QQIA 1S64A 3H3AA 2CLYC 4ZI7E 2WMOA 2XS8A 4G1TA 4APFA 4LF4T 5DBKA 4DI4A 1XMOT 2KC7A 4DLQA 2J62A 4MBGA 5BT1A 4I0UA 4JLEA 5ABHA 2BTDA 4DX6D 4J7WA 4BERA 3KV6A 4PH4B 2WZIA 2X38A 3JYSA 1WR6A 4H9RC 2EIME 1OEDB 4HFHA 4BX8A 2PNNA 2BG9E 3C4XA 2I9CA 2L0IA 2UY1A 2KWIB 3NZQA 4BA9A 4DUIA 4P0AA 4JHKA 2D5UA 3PZ1A 5LA6E 1YQ4A 3I9YA 5HWXA 5EN5D 3QWPA 3JUIA 4DV6T 3JQ1A 2XQ7A 3ZU7B 3DSVA 4AJWA 4AY6A 4OK0A 3HDXA 3ONLC 3P50A 3ZLIA 2X6HA 1N95A 1KNRA 2IOLA 5L3EB 1MMNA 2RG8A 2VGYA 1NAFA 2BS2A 3DEPA 2F0YA 3HL6A 4PS7A 4U96D 5HKPA 3FTUA 3L82A 4XIFA 3QKYA 3V31A 4WW0A 2Y4TA 3U78A 4U8HA 4J8DA 1NWMX 4CZ2D 5KJMA 4NRHB 3MKDA 4AKIA 2BKKB 3FUIA 1U4QA 3RX6A 2DLRA 2FF4A 4XI9A 4B8AA 3PUGA 3ABLE 1HG5A 2V7KA 1UGOA 3IHYA 5HAXA 3UM1A 4EIWA 1V55E 3EHRA 4Y6WA 2XZDG 2X0HA 4M3OA 4RLYA 2F8YA 5LP0A 2FBNA 2J4DA 3E30A 2XZTG 4WBNE 2NTXA 2IO3C 2KCVA 1IJ6A 2C5JA 4KT6B 3O1HA 4C9BB 5KXJA 4V1Av 3J5PA 2ETCA 3CKDA 4O4JE 2LUHA 4B3MT 5CRUA 5JJ6A 2XPKA 1OWNA 2K3WA 4TN7B 2V4LA 4XEIG 4EXTA 3NWIA 2DWZA 5EDSA 1YYHA 4UVAB 4IHJE 3LK3B 4GMLA 3J5QB 2I6HA 4I1AA 2IQCA 4QFVA 3TAXA 1O1TA 2QA7A 2A2FX 3MA5A 4DMVA 2DCPA 2Y4UA 5AJDA 1G3NB 4TV8E 3I3NA 1UJKA 4ADZA 4G2VA 2WXRA 2JQHA 2BG9B 2RPAA 4EB6E 3QOFA 4YTMA 4UWFA 2XQ4A 2JJ9A 1ELWA 4X5TA 1H6OA 3A7MA 1WCRA 3OJAA 1E8ZA 1WAO1 4A55A 4X1KE 4I4TE 4BJNA 2QZAA 2X6JA 2R03A 1H19A 2NR4A 4C0MA 4GPMA 4CQIA 2VQET 2WBLA 2WPVA 2D2SA 1QBQA 2R17C 5AQOB 3TWTA 3K9IA 2ES0A 3UULA 3F2EA 1HNWT 4U04A 2EIJE 3PNTB 5EYPF 2IW5B 3ONXA 4QH4A 2YQ8A 5CJ5A 4ANWA 4JI2T 3SZ7A 4LF6T 3FTYA 3K3QC 2EHOB 4BSZB 2W61A 1MNDA 2B76A 3AEFA 3O1IA 1DCQA 2OVFA 4IE0A 3PZ4A 3S4UA 3CV0A 4JEUB 3R84B 1TEZA 4C91A 5ENQD 3LKUA 5ENSD 4WWOA 3ZT6A 4IE7A 2LRKA 4KZ0A 3FUFA 5ENRD 4P29A 3W9FA 3FTVA 3PU8A 2P9PG 2A5UA 2LSUA 4U07A 4PJMA 4XZ4A 2Z6EA 3TXNA 5KJLA 3UQ3A 3Q2MA 3DXKG 1H6KA 3AAAC 2UXDT 3L13A 4GTOA 2E9XC 3CIRA 4F3VA 4TWDA 2NTYA 1KNPA 1YW0A 5AQSB 5FXWA 3Q7FA 2CFUA 3V2OA 2X3MA 4MHCA 3WI3A 3CPZA 4JI7T 2IDOB 4EBAG 3O4ZA 1U3CA 4P1NA 5DJQC 4YDWA 3KV5A 3N9PA 3C4WA 5FQ6A 3CX6B 2P9LG 4UF0A 3V5UA 5LYJE 2LRLA 2HH7A 1MJ0A 4GPKA 5CMYA 4RSYA 1MNEA 2D0TA 5AQIB 3CQCB 3FZMB 2UXCT 2J08A 5IWAT 4IDQA 3FY4A 1DVPA 5FYMA 5CECB 3IHVA 1ZV4X 3QARA 2LSJA 3OXLA 3UT5E 2XPZA 5KJNA 3FHEA 1Z3YA 3EDVA 3FU5A 2XHEA 4KBMB 3D9KA 4O2BE 4DVDA 4I55E 1IBKT 3EJNA 1N4RA 2OEWA 4A98A 4NXMT 4DV4T 2Q9QA 1S94A 5AQRB 3L39A 3UKUG 4CDRA 3R7RA 2LAIA 2WXKA 1JPLA 2KXPC 3LEWA 1OCOE 4GTVA 1IYGA 4B3ST 5FY7A 1BR4A 4YJ3E 2PJQA 4JI5T 4PJJA 1O1RA 2F8XK 3B7UX 2CRBA 3BQLA 4YTNA 1WG0A 5EK4A 3NOCD 3UU5A 4ZI3C 3FUJA 4W9RA 2VSYA 2ZLYA 2LEHA 2LM2A 4X8QA 2VGXA 2NXPA 3ZSTA 4GYWA 3MA9A 4NIKA 2BUGA 4PFOA 4E7ZA 3MZLB 5JJ7A 5L3FB 5JA4D 1WLXA 2WQHA 3CWZB 1Y8MA 3BK9A 2IY0C 3FULA 4COFA 4UI9J 2QGSA 4WAFA 4PFPA 3URZA 4GYOA 4FJOA 3DSSA 2Y3AA 2CWOA 2FUPA 3HXFA 4LNGA 4X1YE 2HE0A 3IEGA 2WU2A 3IKOB 3AE5A 2IU1A 3VKGA 2LSIA 3FUHA 4WZXA 1QSDA 1OXJA 4PK5A 4GTRA 2LXMA 1TN6A 3CLJA 2VSOE 1HG2A 1YQ3A 2WDVA 3O1JA 4FULA 2ZU6B 2E2EA 2BF0X 5LJMA 3PUSA 4AIUA 3ZPJA 3L8RA 4YSYA 2UY1B 5LHGB 2WAUA 3CK6A 3L54A 1HZ4A 2KBXA 3OTOT 3NZPA 3CVRA 2L3LA 4U8YD 1BR0A 3LSVA 4J8SA 3NZSA 2C0SA 4TX5A 3M65A 2QY7A 1N94A 3G2SA 4PK4A 3FFLA 1YMPA 2WWUA 2C2LA 3UT8A 1UCUA 2NSZA 2LT3A 2XM1A 3SRZA 4AKHA 3EI0A 3MZKB 3HXDA 4GTMA 4MBQA 3RHWA 4NACA 4U7IA 4DBQA 3ZN0B 4F8HA 3ZVVA 2K24A 2F37A 4G26A 4AKRB 3O4XE 5L4EA 4AI6A 2XRZA 4QH5A 2KCKA 5FTPA 2XRYA 4I6JA 3ZXSA 3IEEA 3RRNB 4HWIB 4B0ZA 4CXYA 1Y6IA 3I4RB 4X66T 3RH3A 4WNKA 2CG2A 3GZ1A 4KMOA 2V26A 4O4LE 3ASGA 4MKTA 4U7YA 2D9DA 4UV8B 2AXDS 2GRMA 2NW8A 4IE6A 4U0UA 4EZLA 2W63A 2KWHA 4DX7D 2W67A 1DCEA 1TJCA 3DTOA 2GROB 3PZ2A 2Y1LE 3QWVA 5HXEA 1NFIE 1D8EA 4IDPA 2V6XA 1E2AA 2VQ2A 2HO1A 4G8KA 3JC6D 2H7OA 3RPUA 2XY8B 1LTXA 2KATA 3QOUA 2BKOA 1LVFA 4KVOA 5LGTB 2V7MA 2XPYA 3ZHEA 2X68A 3Q9UC 5LHHB 3DEOA 5IHYA 5AFUL 3M3ZB 1SHZC 1YD8G 5HEJA 5ABGA 3KV4A 4LRZA 5AIJA 3LJCA 1X81A 4L9PA 4UV9B 3HG0D 5KNHD 5LHIB 2VSXE 2C0LA 2KT9A 4KI0F 4TXRA 4ATZD 3RQWA 4ANVA 5KX5E 5JR9C 4ZZCA 2GK9A 5ANLA 1NEKA 3ONKA 3SGHA 4FADA 3WG7E 3W9GA 2DYSE 2XQ8A 4ANUA 4EBAA 3KDSE 1NZNA 2Y69E 2IAKA 3LFMA 1DU2A 2XENA 5AQFB 2CXFA 4A56A 2VSNA 1QQEA 5J0ZA 4HWHA 2PM6A 3L08A 3BU8A 4YDYA 3TWQA 3EAMA 2CHWA 4MLKA 1IKND 4L1BA 3G2TA 1OEDC 4ERRA 4A5XA 4UI9C 4BT9A 2SPCA 3FH5A 2P58C 4ZS2A 2UXBT 3AE3A 5LCYA 1N32T 2RFAA 4IE4A 3FU3A 2CPTA 5G04J 4JC8A 3QDNA 3BUAA 4KBQA 1WM5A 2LHNA 1LD7A 5AQQB 2V0PA 2HN2A 2IHR1 3TLTA 1XNFA 3AG3E 1H2UA 3K3OA 3AJIA 2MOWA 1UX4A 4JD2G 5B1AE 4DUZT 1OXZA 3C72A 2UXXB 3ML9A 3SHFA 1MIWA 1S35A 5CRVA 2BS4A 1EF1C 4H63V 4FA6A 3TLVA 3LK42 3B7RL 3PEVB 2XS1A 3OPCA 2N2NA 4DV5T 4KYOB 1D1BA 3SFDA 2P9UG 1TR4A 3VR9A 4U95D 2I2OA 2VWAA 2D0UA 4L9IA 2VK9A 3FEXA 3ZCIA 4YVQC 1ELKA 3CHRA 4IIJE 3GWHA 4ISSA 2LSKA 3ZMSB 1N34T 5LMUT 3P4PA 4K5BA 3ASFA 1QLBA 4UF0B 4UWHA 5HCMA 4CN4A 2JIWA 5FL0A 2FO7A 1KFYA 4F7AA 3AE1A 2I59A 2L8KA 1G73A 1JCSA 4GA2A 3LVRE 3Q5MA 1FEWA 3P4QA 3VTYA 3CVVA 3DJBA 3UUXA 1BR1A 2QVAA 1CUNA 2KZTA 2E5VA 5CGMA 4O1OA 3RU0A 2XHEB 4U8VD 3AB3B 4QH1A 3NB2A 3C3RA 3CHQA 2BBHA 4J0UA 4A3VA 1BR2A 4CCAA 4HFBA 2YHCA 3EIQC 1ZOYA 4EGWA 5D0QD 3GW4A 2GRQB 4UWKA 3Q49B 2H89A 2X6FA 2XSAA 4X20E 5HRYA 2UU9T 4IN3B 4I43A 3EHQA 1OCRE 4JHRA 3HKBE 3VLEA 2CHNA 1JCRA 3HXBA 3U66A 4HI8A 4O4HE 2BG9C 4B94A 2HM8A 4ZHBA 2YHEA 2VGXB 2OOEA 1HTJF 1X79A 3P2BA 2B6CA 4LF5T 2XQYA 1E7VA 2IONA 3MGBA 4HNAD 5J90A 3FTZA 5KCMA 4DUYT 3LYAA 1UK5A 3HVEA 2X51A 3OYXA 2RD0A 5G55A 1E8XA 2CXLA 4OHFA 1XDPA 3EABA 3PUQA 3AVRA 3O9XA 2M63A 5HCJA 3KAEA 4EYUA 2JPFA 4CGVA 4PW8A 2MBGA 4DMWA 1IQUA 1K3ZD 1BPOA 4L5GA 2LSGA 3PV0F 1NP7A 3AAEB 1HNXT 5FINA 3Q5WA 3B7BA 3C3OA 5FQ7A 2R05A 5C3JA 3L3PA 1N4PA 3RRMB 5L2LA 3N9LA 2NP9A 4DRXE 2IOSA 2EHOC 3U3WA 3QB2A 3RKGA 3AG4E 3S7JA 3I9WA 1VOMA 4J8FA 3KSLA 2CWYA 5LGUB 4N39A 3U3IA 3CK9A 2CE7A 4HGAA 2FULA 4L23A 4XX5A 4AQYT 1FVFA 2E5LT 2XUEA 5EX3A 1AJ3A 5G04C 3Q78A 4G23A 3NQPA 3T5VA 4B89A 4MLPA 3KS2A 3PJAA 3ETUA 3ZN1B 3ZT5A 1KEYA 5JHAA 3DP7A 2VTBA 3L6AA 1HFAA 5JJTA 3G2UA 2XQAA 5BXUA 3ANWA 5JDMA 1V54E 4B6XA 3AA1B 4OVUA 3ZMTB 3FBZA 3UU4A 3EDTB 2UUCT 3PUJA 3NBXX 1TNOA 5FKYA 4FLHA 4Z90A 3D3MA 5AARA 1E1HB 5J08A 4C0EA 3ZNGA 1Z5SC 3JCFA 2X66A 2WU5A 3CVPA 4FLBA 5HXHA 2BBJA 3MCXA 1US7B 4BFRA 3C50A 3EU5A 2HR2A 3AE7A 3PUKA 3SD5A 3OVUA 3UTMA 3PUVF 4FU3A 4UI9K 4AQFA 3VHLA 5FMNA 5C1DA 3RYFE 3HXEA 1B7TA 3HI2A 3RC3A 2JLBA 4AY5A 3MACA 2EIKE 4QWNB 3N9NA 3KEAA 4NUUA 3RIUA 2V4HC 2BVLA 4ZZBA 1HS6A 1HX1B 1UW4B 3D9JA 2JMHA 4U2YA 3V79K 3UU6A 3IXEA 5AQPB 3ZHEB 4L2LA 5B3SE 3T8MA 5M72A 3UFGA 4BETA 3VLDA 3VLFA 2PM7A 3R9MA 3ZIMA 3ZC1A 3OXFA 3HRAA 5T3RA 2DNXA 5DIZA 5LBQB 4DK5A 4TRQA 3TWUA 3TWWA 2JQQA 3E0ZA 4JI1T 3L22A 3P4WA 3NRYA 3AU5A 2AE9A 3PZDA 2LLYA 3AA0B 3CIAA 2CM0A 3ZT7A 3UFEA 2WXGA 3PUWF 5BV1A 4J8YA 4KMCA 4GYSA 5BXOA 3CSTA 1S0PA 1HR0T 4HLLA 5BUZA 2HYZA 4CEMA 1H2TC 2ZXWE 5HXRA 4I6EA 4HFEA 2OEVA 3SS1A 5LNKA 2P9IG 2C5KT 4WNDA 5T4YA 1X5BA 3ASHA 3TWSA 2CFZA 3FH7A 5A6CA 4FC8A 3CHOA 5H7PA 2IEJA 3HYMB 4NURA 4C48B 1ZU2A 2W66A 4GK0E 2QYWA 3Q9DA 4CI3B 5HXCA 3TKLB 5ENPD 3APFA 2AW6A 4LMJA 2WSSV 2XZEA 3DSUA 5KMGP 3J7Yq 5L3CB 3FHNA 5AQNB 1TNZA 4TUUA 1OWLA 3APDA 4LCTA 4DV3T 1NL4A 4CT4A 3C64A 3HXCA 2OLTA 2WY2A 2XJ7A 1S70B 2DZOA 3FUEA 3CVXA 4U0SA 1HO8A 4UQXA 3FZKB 5BNWA 4EPZA 2W2UA 3CX8B 4P0BA 3V5SA 5JTGA 3ZYQA 4BESA 3DXMG 3UKRG 4GA0A 4N2QA 2N9DA 3CR3A 3CVQA 2AXUA 4M1PA 1SW6A 3K8PC 5GONE 2WXPA 4YHHT 4Q25A 2YDSA 2M6IA 4PJNA 4KX6A 3KEZA 4ISTA 5JDFA 4PUCA 5AQBA 3PURA 2ZGGA 3QK0A 5CERB 3RJVA 3UUMA 1QNFA 4ILHB 1E7UA 3LCAA 5AJLA 4LF9T 2B1EA 4DJAA 4K0UA 5FT9A 1WDYA 3RKVA 3S7BA 1NENA 2NW7A 5LOZA 3UUXB 2LSVA 5D0OD 1QYMA 2KZTB 1UOHA 5HQ8A 4EZKA 2FI7A 5L3DB 2Y8DA 4R7LA 3AVSA 1T72A 2FJBA 2P9BA 4N78D 5KBAA 3PTRB 2JABA 2FJEA 4DR3T 1VRBA 3FTSA 2DL1A 4RQIA 1J5WA 3R6NA 2X9WA 4TV3A 2NYJA 1A17A 2RFMA 3KD7A 4X1IE 3BQOA 4JYAT 1OWOA 3AE8A 4I43B 5H6RB 4DV0T 2OCCE 4JW1A 2BS3A 4I17A 3CVWA 4LFBT 1J5ET 1YKHB 1OCCE 1MX6A 2LNIA 5C2TA 1BD8A 4DV7T 2DWGA 4IDOA 2BDEA 4O4IE 4GMRA 2N1GA 3B13A 4JV5T 2E9XD 1I94T 3HVEB 4ILIA 3UXGA 4PDXA 4U0ZA 2CG3A 5CBOA 5CCMA 4IT4A 5JQGE 2WXFA 4U31A 3NF1A 3N2GE 1FPPA 3MV2B 4EAHA 3TG5A 3UM0A 1IJ5A 5L4HA 4ILCA 3JCKC 5J1GA 3FUKA 4YXDA 5ENTD 1D9SA 1KNZA 2J49A 3PREA 5JDQA 1TN7A 5AQUB 3CKBA 2JRKA 2J1DG 4GA1A 4TWHA 1T8BA 3P4RA 1SA4A 3HHMA 4GKJT 4GMJA 1INZA 4RG6A 1QUUA 2XPIA 3ZMUB 4BTBA 5BR8T 5L3BB 5JDLA 5EX0A 1OWMA 3QB5A 1HCIA 1IXVA 2XAJB 4ZOLE 1IHBA 3ENEA 2IMLA 3AS5A 3EUHA 4A3TA 5DABA 4DNDA 1WYBA 3QNKA 3WAKA 4WWNA 4IULA 5ABFA 2VTBB 4UXNB 3Q75A 4Y6CA 2CEAA 1FJGT 3PU3A 3ANWB 3JXJA 5JH7E 3CVNA 2VASA 4IE5A 4HORA 5LGNB 4WYVA 5LX8A 5H6QB 4ZI3D 3KVAA 3RYIE 4WWPA 2IC9A 2VKHA 2QRXA 3WAJA 4LFAT 4OYSA 3ONJA 4BTAA 5CBNA 2MPKA 2PFVA 3VRAA 4I6GA 5IY5E 2XAQB 4X62T 5LOVE 3EIJA 2V7LA 2W0GA 3A8YC 4GCNA 5DQVA 4CDNA 4B3RT 5ENOD 4KZCA 3HKCE 5EK2A 3JXIA 3MKQA 2AWIA 5F8PA 1ELRA 4HQDA 2ONDA 3ZJ1A 1H7CA 3HIZA 4ZXLA 4LG6A 3FBLA 3LG7A 3OBVE 1UN8A 5HS0A 4XKBA 4H63H 2XQ5A 2BZBA 5ARFA 4Z91A 1BLXB 3SY2A 4EZ4A 2LKGA 3T5XA 4G8LA 3ML8A 4QX8B 2Y0BG 3EHMA 4WNGA 4JA9A 3V2XA 5ABEA 3FU6A 4EYYR 3LDZA 5CA0E 3T1HT 2WB5A 2XQ6A 3UI2A 5HI7A 1MX4A 5KWDA 2BVMA 4K0RA 3SWHA 3OKQA 1FMWA 3UIPC 1RZ4A 2UUAT 1MMDA 3FZHB 3ZMZB 2CMRA 3SNXA 3CK7A 3ULEG 2IIUA 5FY0A 4I9CA 4Z8XA 5CCLA 4UQYA 4O8SA 2A5EA 3SQVA 3CK8A 3UUBA 2DCFA 3RIFA 3T8OA 4G11A 4BWRA 1NA0A 3OTNA 1KPSB 4FP7A 4AVXA 5JHBA 5L47A 3D9HA 3ZW3A 4CXWA 2J4BA 3AA7B 4JA7A 3SO8A 4F1PA 4H9NC 3FU0A 5HEOA 3UM2A 5G2NA 3Q47B 3Q5XA 4Q94A 4Q96A 5J2TE 4EZJA 5LG3A 3QK6A 4IL9A 3ABKE 2HPJA 2ACXA 3GZ2A 3N9MA 4WNFA 1X9BA 4DX1A 3AEDA 3DRAA 3RGLA 1SA0E 3ESLA 4J2CA 3ESKA 2V7IA 4EQFA 2JQ9A 4LSZE 1V9DA 4BY6A 2H6HA 5FIOA 3D9LA 2WQ6A 2YINA 1UN9A 2KCLA 3G2WA 1KLXA 4CN1A 2BKPA 3HA4A 3UUNA 4XI0A 3RO2A 3F57A 3FUDA 2ZISA 1TN8A 4YLHA 5F3JA 2WXNA 1O5MA 4AOFA 1E8WA 1VDYA 4O60A 1AWCB 1OWAA 5HEHA 4HWDA 1ZP0A 3ZYMA 2YKSA 4Z68A 3I0QA 2V5QC 4TXPA 4FHKA 5CEDB 2LOPA 3ZMVB 3KVBA 2VL8A 4WNEA 2H3RA 4NIQA 3TG4A 2KSRA 4GYYA 4I2ZA 4HFVA 3R9AB 4AISA 3L09A 4TUMA 1D1AA 1XWMA 1DNPA 4K03A 4EHMA 1EPUA 4KHPT 4DLOA 2H88A 4H9PC 3Q4AB 4ACLA 3RC8A 2PQRA 2XASB 4TNVA 3DBSA 3PE0A 4CN6A 3NKZA 2IUBA 3KINB 1N9AA 3NZUA 4UVBB 3MX3A 4UR9A 2FO1E 2NWBA 4PJLA 2DIWA 2E0IA 1MIVA 3CKCA 3H3MA 1HX8A 1LVKA 5D2MC 4GZDA 5AQAA 3CVYA 4B3TT 3FP3A 2F4VT 2J09A 4YDEA 3ABVA 1UUSA 4JB8P 3TJPA 3RIBA 5ADXL 3RO3A 3FXEB 2E2AA 1SA5A 2WQYA 3Q5EA 4U72A 2QFCA 1QZ2A 2Q7FA 1W0BA 3HKDE 1JNZA 3ZEFA 1T7SA 3CX7B 4K5CA 4JVSA 3TWVA 3Q5DA 3X2QE 2Q9QB 4QX7B 1OT8A 2YDRA 3SBSA 4TNWA 2ODVA 3JAEA 3BEEA 5LXTE 4NXNT 3ZGQA 5AQHB 4ZFHA 3EVYA 2HN1A 3L16A 5L3GB 4JHJA 3B95A 2WCAA 1KT0A 4G25A 5CA1E 1PC2A 1YXRA 2P9SG 2FJDA 3PE4A 1N0QA 4IREA 5LP6E 3CVUA 4CZZB 2XQ9A 1HF8A 3MV3B 2KMFA 3RF1A 3AAIA 1E7PA 1O1SA 5B1BE 1MQSA 3RRUA 2X67A 2A4ZA 2DWKA 4GOUA 3DPYA 3UX4A 4UWGA 3KBTA 3ZXPA 3JAFA 3VKHA 5AQJB 4C90A 4U7EB 5ABFB 4DX2A 4WBOA 3NAWA 5JDHA 4DR6T 1WYCA 5CHEE 4YJ2E 3ZRHA 1W0AA 3E37A 2PQNA 4PNIA 4GKKT 2WVIA 2K9AA 4GIWA 2MOZA 3EDUA 4N5CA 1TNUA 4HVBA 4IL4A 2ZGDA 3U9WA 3ZFWA 2WMNA 5FZRA 1EZ3A 3ONLA 1LKXA 1HU3A 4I1OB 3MK7C 2OVBA 4A1GA 5AQ9A 3SF4A 4YHJA 1PY1A 3PNLB 3AEBA 2YNQA 5FWQA 4JI4T 3MJXA 3ISMC 3MKRA 3V30A 1IBLT 3FZFB 1HH8A 2H6GA 2FJAA 4AQGA 4CI1B 1OUVA 4GZ6A 3LDQB 3SFYA 2H7VC 4ILGA 3MKQB 3OYZA 5AQVB 2LHRA 3AEGA 3Q7AA 3PVLA 1WY6A 2EHOD 4AKGA 1RW2A 1D0XA 3JQ0A 1FVHA 2OV8A 5LCWC 4CI2B 3K3NA 1KK7A 4P09A 4U74A 2Y48B 3FTXA 5A23A 3ZCJA 2L9QA 4QXHB 4U33A 2YU2A 4GZCA 4HRMB 4U63A 4E85A 3PUXF 4HLEA 2VGEA 3LVQE 1N36T 1LD8A 4NQ0A 4LNUD 1VCSA 4HFDA 1JCQA 3NOGD 4B93B 3TXMA 2ETBA 3AS4A 2VVNA 2UXNB 4H9OC 2ZM6T 2GRPB 2X6KA 2X9YA 2XCCA 2VB6A 3B5MA 4H7YA 5CEAA 1A5EA 2P9NG 3OXGA 3RKOA 3SOLA 4EEBA 3SI5A 3SBTB 1CHUA 4FJZA 3EHZA 4AXPA 1MYOA 3CGHA 1HXIA 1XMQT 5BV0A 2XSBA 2XQ3A 3ZYKA 2AJAA 1T98A 2XEEA 3ULQA 2YK0A 2EINE 3T9KA 2WB2A 2GGFA 3FB2A 3UINC 5FP3A 1TNYA 2K48A 5JVDE 4HOUA 2LJLA 3FXDB 2KM4A 5JREA 4JXTA 2CHZA 3CQGB 1U2VG 3CVLA 4DR1T 3GYZA 3FZLB 5LB7B 1Y01A 3NRXA 4OYJA 1KZOA 5CB4E 3I1AA 3SFZA 1J1JA 1HS7A 5C8YE 4HB5A 4LMLA 4LEUA 4GTPA 3AE4A 4AP2A 3Q15A 3MEKA 2CXDA 4YTPA 4GZ3A 2VJ8A 3PS6A 1KZPA 3AEAA 3GN5A 4X64T 5BW8C 3RYHE 4GYRA 1U3DA 3CHMA 3B7TA 1SZAA 1D0ZA 2XGMA 4MRUA 3C51A 4GTSA 4LUNU 3FWVA 3CMLA 3PEUB 2W62A 2J47A 5AAOA 4MS6A 2I1JA 4QKNA 3E34A 4BSXA 4GAAA 3LY7A 3B7SA 1O3XA 4UWLA 1HE8A 2CCQA 4GB9A 2BKGA 4ABNA 5AQ7A 2LE8A 3UQ4A 4AEZC 4I9EA 3E32A 4N5QA 2E9XA 4JUYA 4WUYA 3S2AA 5FZQA 3AEEA 1K1AA 4JL0A 4YDOA 4AQFC 3C4ZA 4DI3A 1Z6TA 2LM9A 5FVLA 3ZSSA 5JRCA 2YOEA 3T1YT 4HOQA 1E96B 3D0TA 4BT8A 4NPPA 4UQZA 3RIUC 3FEYA 3L9TA 2P9KG 2DYRE 4TUYE 4GCOA 4JEHA 4XAXB 2YEVC 2XEHA 3ZN3A 5FQ8A 2WZHA 3CQXC 4UVCB 3P8CD 3MJWA 5C2YA 1D0YA 3ASNE 2CBIA 3ZYLA 4H9SE 3TL5A 2R02A 1H6PA 3I4GA 2R59A 3B57A 3DWLG 4K5AB 4AV7A 3KSQA 2FEZA 5FJYA 5AQMB 2VKJA 1MMAA 2W00A 5AQLB 2WXMA 3LBXA 3APCA 4MFRA 2BEDA 4MALA 3PRZA 5F5WA 3F6QA 4ZI2C 4EOZB 2V8SE 3UPVA 3UTKA 2V6YA 3N71A 1JWFA 1SQMA 2B0OE 3E4BA 4YSXA 2LKHA 1JUQA 2RP4A 3ZEFB 5E75A 3DSTA 5AQGB 4E7SA 4K0KT 3TWRA 3RLFF 3P4SA 5AENA 1R8IA 4KUMB 1G8XA 5AQTB 1IHGA 3G06A 2VYIA 3IV0A 1KF6A 3UMVA 4J8EA 2V7JA 4GTQA 1E90A 4UUCA 3N5LA 4HKAA 5KDMC 4PK6A 4DR4T 5HEUA 1I6ZA 2IC6A 4IDZA 5LG4A 5LMNT 4DR5T 1XNRT 4A1SA 5LBMA 4X65T 2CLYB 1SZ9A 2VQFT 3MYVA 3H37A 4ZI2D 4LF7T 2BKNA 3QNUA 2GRRB 3IBPA 2WXIA 3P7IA 3UT7A 3KFWX 5LJNA 4CYMD 2WXQA 3AG2E 5EYLA 4PS3A 3TLWA 2V5DA 3ZUVB 2L9BA 4YNDA 4HOSA 3IBEA 4L2YA 2IO2C 2CHOA 1ZEEA 2WP9A 4EZHA 3N9QA 3UT4A 1NA3A 4O1PA 2JMKA 1M7KA 4G24A 2EILE 3SFEA 3MXZA 1E8YA 2JEKA 3Q73A 5JMND 3FH8A 3SFXA 2ETAA 3ZKJA 5DQWA 4JI0T 2VKOA 3RI5A 4B8CB 3C5RA 3BG0B 4HE8A 2HHHT 1ZKEA 5HWYA 2LOSA 4ME2A 4U3CA 3AXJA 4ATGA 4TWFA 1OWPA 4URKA 4XZCA 4Q69A 4DX5D 4I50E 4V3IA 1KT1A 4N2SA 4ZS3A 2V5FA 5J2UE 3RSEG 2MYSA 2DBAA 1VCTA 2LO6A 1N4QA 1S63A 3EUVA 5KNGA 2CBJA 3RIAA 4HN9A 3TLUA 2ZM0A 2X6IA 4RG9A 3VU7H 4IGUA 4CGWA 2WM9A 1D8DA 5FL1A 2DHRA 3N2OA 3IF8B 3RQUA 2C5IT 5A1LA 4FHJA 2ZM2A 3X1DA 4ZHQE 5FXZA 2M67A 3IA3A 1TJFA 3VTXA 4HFCA 2CA5A 3AE2A 1K8KG 5M4YA 3GZSA 3BQKA 3DSXA 1Z3XA 1U5PA 4G2AA 4AKLA 2A3DA 2RKKA 4ILAA 3OAWA 4HFGA 1FT2A 1JNRA 2GRLA 4KVMA 2KNDA 3AG1E 4L7TA 2EQXA 1FMVA 2VURA 1N4SA 2ZMAA 3HR0A 4BJMA 2IJGX 4DR2T 4FI5A 2IF4A 3LY8A 5FVKA 2H6FA 3EHNA 3UU3A 5CFBA 4HI9A 2UWJG 3C98A 2Q9QC 5G05J 3R7QA 1OCZE 2DVWA 1N0RA 1SE7A 4LERA 5EIBE 2LAHA 4PAGA 2AXZA 1BU9A 3ZC0A 2A72A 1YCSB 4GZ5A 2V5CA 5JR9A 2J4GA 1N33T 1Z8UA 2J8SD 1MX2A 4EEDA 3E33A 1MMGA 1Q2ZA 4DV1T 4U2ZA 3QC1A 2I0MA 4YVOA 4OFZA 4LMKA 4OYKA 4XKCA 4LFCT 2I1KA 1WRDA 2WS3A 1H0AA 2ACZA 3UM3A 4CDMA 2Q9QD 3QUJA 2WQ7A 4YT0A 1OEDA 3JC6C 4M7CA 5FXVA 2QC9A 5D66A 4QHOA 3CEQA 1ZBPA 3GN5B 4DPRA 4FJYA 2OA5A 1UX5A 4IRUA 4XE0A 3CSFA 3ZKRA 2ODUA 4DIDB 3LPZA 2W4XA 5HEGA 4YY3T 5HXSA 1M62A 2ZM8A 4GTTA 3ZJ2A 1NI1A 4RVBA 3NBNB 3JUEA 3LJNA 2XAFB 4L0RA 5FNVE 5FQ4A 2R6GF 4DV2T 2WXHA 5AQKB 1UJJA 2XCBA 3CHPA 3T8KA 4ANXA 4NUVA 3AAAB 4CT0A 3Q79A 2E9XB 2PBIA 1H2VC 4HFIA 4F6RC 1N11A 2IFUA 4GK5E 2XAGB 1EDUA 3TLSA 5KJKA 1XDOA 1XNQT 4KXKB 4HOTA 1ZHCA 3F31A 4KP3C 3AECA 2MTQA 3N9OA 2NOXA 5ARGA 5JRCB 3PDNA 3I0OA 4D10C 4A63B 2VKDA 2K5BB 5FY1A 1WFDA 4EECA 4HS2A 2QYUA 3AU4A 3KV9A 4QXCB 4DBRA 3LXUX 3PH0C 4IDNA 5ETWA 4JEHB 1YA0A 3D9OA 1K1BA 4ZEYA 2M6BA 4N3CA 3G2VA 2ILRA 3LS8A 5BPPA 3S7DA 4HWFA 1L0VA 4G63A 3PUAA 4F6RD 2XM2A 3QWWA 4HRLA 3BG1B 4OAUC 3IHRA 5T8IA 4EV6A 2PG8A 3AE6A 3D9IA 5E0OA 2KLQA 1HNZT 3JADA 1Z0PA 3GMIA 2KXPB 3LBXB 3VR8A 4OX9T 5E76A 3J9X1 3EU9A 3KBUA 3FDHA 4BAYB 3U64A 2AXVA 1GQEA 2MHKA 2V6YB 5LCWJ 2YU1A 4TZ4C 5ITZF 4O2AE 1TNBA 1W3BA 3ABME 1TYQG 2PTFA 2L6BA 4JPSA 1B89A 2PL2A 4JI8T 4ILUA 3D9NA 2BG9A 3QC9A 4APOA 3O48A 3FUMA 4YSZA 4ACKA 4KHZF 3L17A 4HTEA 4ASKA 1MIYA 4ANJA 4I1MA 5ENNA 2KINB 5G05C 4CRWA 3RYCE 4H7XA 4ILBA 4N3AA 3N2KE 5TAOA 1ZB1A 2X0LB 2XAHB 2GW1A 1FIOA 5EKQD 1XGWA 2QYJA 2G0UA 1IQRA 3TWXA 4TV9E 3S7FA 2RA1A 1FT1A 4BEPA 2GRNB 3D9PA 3UIOC 3I5PA 4A97A 4LF8T 1UG3A 3FTWA 5FXXA 2C0MA 5EZYE 2R5SA 3U4TA 3NVOA 1MHQA 3QAQA 3K1SA 4CXXA 4J6IA 4UEMA 2AVPA 3QJZA 3D9MA 3E08A 1BI7B 4AM9A 2EHOA 2WXJA 1IAPA 5EIDA 3E22E 3UU8A 2X0YA 4JEUA 1MZCA 3GA8A 2A9UA 5CMWA 1L5JA 3LY9A 5EILA 1W9RA 2MAWA 2PZIA 3DSWA 2MYOA 5LFAA 4JI3T 3C3QA 3ASDA 4F1SA 3RAUA 5JDNA 4YFSA 1IBMT 3AA6B 2V1DB 5BMVE 4JBWF 1EYHA 1N52A 4IYPA 2XGSA 4OVVA 3PJAJ 1GW6A 1XZYA 2NC9A 1LRZA 3ZPOA 1SVXA 1N54A 1WR0A 5AYWD 3UQ7A 3AXJB
chains in the Genus database with same CATH topology
3DPDA 4XBFB 5JDGA 2NW9A 4BX9A 4AIFA 2CHXA 2J07A 3WXXA 4F53A 3RRWA 2J9QA 2XGOA 4I2WA 4DO0A 4GU5A 2Y6XA 2HPLA 1D1CA 2L0TB 3BQIA 1FCHA 3P1UA 4HEAA 3CHSA 2E8IA 2LSYA 2X9XA 3PDYA 3A5XA 5IYZE 3TGOA 1Y64B 1LF8A 4H9QC 1IZNB 3ETVA 4QXBB 2XTLA 1PAQA 1P5QA 5EK3A 2WXOA 4HXIA 2X9HA 4UIGA 3LK2B 3W15B 3AS8A 2XQ0A 5ANRA 4AXHA 2XEVA 4JZYA 3C98B 5A7DB 2MRIA 2DI4A 3PE3A 3RRCA 2L6JA 1JWGA 5HYAA 5FZSA 4N3BA 4PS8A 1YKEB 4UELA 2WXLA 2KZ7B 3RK6A 5JR9B 3HKEE 4O6FA 3FUNA 4E6HA 3LJ3A 3H3AA 2CLYC 4ZI7E 2WMOA 4G1TA 4APFA 5DBKA 4DI4A 2KC7A 4DLQA 5BT1A 4JLEA 2BTDA 3KV6A 4PH4B 2X38A 3JYSA 1WR6A 4H9RC 4BX8A 3C4XA 2I9CA 2L0IA 2UY1A 2KWIB 3NZQA 4BA9A 4P0AA 4JHKA 2D5UA 5LA6E 3I9YA 5HWXA 3QWPA 3JUIA 3JQ1A 4AJWA 4AY6A 4OK0A 3HDXA 3ZLIA 2X6HA 2IOLA 5L3EB 1MMNA 2RG8A 2VGYA 1NAFA 3HL6A 4PS7A 3FTUA 4XIFA 3QKYA 4WW0A 2Y4TA 3U78A 4U8HA 4J8DA 1NWMX 5KJMA 4NRHB 3MKDA 4AKIA 3FUIA 1U4QA 3RX6A 2DLRA 2FF4A 4XI9A 4B8AA 3PUGA 1HG5A 2V7KA 3IHYA 5HAXA 4EIWA 4Y6WA 4M3OA 5LP0A 2FBNA 2J4DA 4WBNE 2NTXA 2KCVA 1IJ6A 2C5JA 4KT6B 3O1HA 4C9BB 4V1Av 3CKDA 4O4JE 5JJ6A 1OWNA 4TN7B 2V4LA 4EXTA 5EDSA 4UVAB 4IHJE 3LK3B 4GMLA 2I6HA 4I1AA 2IQCA 4QFVA 3TAXA 2QA7A 2A2FX 3MA5A 4DMVA 2DCPA 2Y4UA 5AJDA 4TV8E 3I3NA 1UJKA 4ADZA 4G2VA 2WXRA 4EB6E 4UWFA 2JJ9A 1ELWA 3OJAA 1E8ZA 1WAO1 4A55A 4X1KE 4I4TE 4BJNA 2X6JA 1H19A 4C0MA 4CQIA 2WBLA 2WPVA 2D2SA 2R17C 3K9IA 2ES0A 3UULA 3F2EA 4U04A 3PNTB 2IW5B 3ONXA 2YQ8A 4ANWA 3SZ7A 3FTYA 3K3QC 2EHOB 2W61A 1MNDA 3O1IA 2OVFA 4IE0A 3S4UA 3CV0A 4JEUB 3R84B 1TEZA 4C91A 3LKUA 4WWOA 4IE7A 4KZ0A 3FUFA 4P29A 3FTVA 3PU8A 2A5UA 2LSUA 4U07A 4PJMA 4XZ4A 2Z6EA 3TXNA 5KJLA 3UQ3A 3Q2MA 1H6KA 3L13A 2E9XC 4F3VA 2NTYA 5FXWA 1YW0A 2CFUA 2X3MA 4MHCA 3WI3A 3CPZA 4EBAG 3O4ZA 1U3CA 5DJQC 3KV5A 3N9PA 3C4WA 5FQ6A 3CX6B 4UF0A 3V5UA 5LYJE 2HH7A 4GPKA 5CMYA 4RSYA 1MNEA 2D0TA 3CQCB 2J08A 3FY4A 1DVPA 5FYMA 3IHVA 1ZV4X 3QARA 2LSJA 3OXLA 3UT5E 2XPZA 5KJNA 3FHEA 1Z3YA 3EDVA 3FU5A 2XHEA 4KBMB 3D9KA 4O2BE 4DVDA 4I55E 3EJNA 2Q9QA 1S94A 4CDRA 3R7RA 2LAIA 2WXKA 3LEWA 1JPLA 1IYGA 5FY7A 1BR4A 4YJ3E 2PJQA 4PJJA 3B7UX 3BQLA 5EK4A 4ZI3C 3FUJA 4W9RA 2VSYA 2ZLYA 2LEHA 2VGXA 2NXPA 4GYWA 3MA9A 2BUGA 4PFOA 4E7ZA 3MZLB 5JJ7A 5L3FB 1WLXA 2WQHA 3CWZB 1Y8MA 3BK9A 3FULA 4UI9J 2QGSA 4WAFA 4PFPA 3URZA 4GYOA 4FJOA 2Y3AA 2CWOA 4X1YE 3IEGA 3IKOB 2IU1A 3VKGA 2LSIA 3FUHA 1QSDA 4PK5A 3CLJA 2VSOE 1HG2A 3O1JA 4FULA 2ZU6B 2E2EA 2BF0X 5LJMA 3PUSA 3ZPJA 2UY1B 5LHGB 2WAUA 3L54A 1HZ4A 3NZPA 3CVRA 2L3LA 1BR0A 4J8SA 3NZSA 2C0SA 4TX5A 3M65A 2QY7A 3G2SA 4PK4A 3FFLA 2WWUA 2C2LA 3UT8A 1UCUA 2NSZA 2LT3A 3SRZA 4AKHA 3MZKB 4MBQA 4NACA 4DBQA 3ZN0B 3ZVVA 2K24A 4G26A 4AKRB 3O4XE 4AI6A 2XRZA 2KCKA 5FTPA 2XRYA 4I6JA 3ZXSA 3IEEA 3RRNB 4B0ZA 4CXYA 1Y6IA 3I4RB 3RH3A 4WNKA 2CG2A 3GZ1A 4KMOA 2V26A 4O4LE 3ASGA 4MKTA 4UV8B 2GRMA 2NW8A 4IE6A 4U0UA 4EZLA 2W63A 2KWHA 1TJCA 3DTOA 3QWVA 5HXEA 2VQ2A 2HO1A 3JC6D 2H7OA 3RPUA 2KATA 3QOUA 1LVFA 4KVOA 5LGTB 2V7MA 2XPYA 3ZHEA 2X68A 5LHHB 5IHYA 5AFUL 1SHZC 1YD8G 3KV4A 4LRZA 5AIJA 3LJCA 4UV9B 5LHIB 2VSXE 2C0LA 2KT9A 4ANVA 5KX5E 5JR9C 2GK9A 5ANLA 3ONKA 3SGHA 4FADA 4ANUA 4EBAA 3KDSE 1NZNA 2IAKA 3LFMA 2CXFA 4A56A 2VSNA 1QQEA 2PM6A 3L08A 2CHWA 4MLKA 4L1BA 3G2TA 4ERRA 4UI9C 4BT9A 2SPCA 3FH5A 2P58C 4ZS2A 5LCYA 3FU3A 4IE4A 5G04J 4JC8A 3QDNA 4KBQA 1WM5A 2LHNA 2V0PA 1XNFA 1H2UA 3K3OA 2MOWA 1UX4A 1OXZA 2UXXB 3ML9A 3SHFA 1MIWA 1S35A 1EF1C 4H63V 4FA6A 3LK42 3B7RL 3PEVB 2N2NA 4KYOB 1D1BA 2I2OA 2VWAA 2D0UA 4L9IA 2VK9A 3FEXA 3ZCIA 4YVQC 1ELKA 3CHRA 4IIJE 3GWHA 4ISSA 2LSKA 3ZMSB 3ASFA 4UF0B 4UWHA 2FO7A 4F7AA 2I59A 2L8KA 1G73A 4GA2A 3LVRE 3Q5MA 1FEWA 3VTYA 3CVVA 3DJBA 3UUXA 1BR1A 1CUNA 2KZTA 3RU0A 2XHEB 3AB3B 3CHQA 4A3VA 4J0UA 1BR2A 4CCAA 2YHCA 3EIQC 5D0QD 3GW4A 4UWKA 3Q49B 2X6FA 4X20E 4IN3B 4I43A 4JHRA 3HKBE 3VLEA 3U66A 4O4HE 4B94A 2HM8A 2YHEA 2VGXB 2OOEA 1HTJF 1X79A 3P2BA 2XQYA 1E7VA 2IONA 3MGBA 5J90A 3FTZA 5KCMA 3LYAA 5G55A 3HVEA 2X51A 3OYXA 2RD0A 1E8XA 2CXLA 4OHFA 3PUQA 3AVRA 3O9XA 2M63A 3KAEA 4EYUA 2JPFA 4CGVA 4PW8A 2MBGA 4DMWA 1IQUA 1BPOA 4L5GA 2LSGA 1NP7A 3AAEB 5FQ7A 3Q5WA 3L3PA 3RRMB 5L2LA 3N9LA 2NP9A 2IOSA 2EHOC 3U3WA 3QB2A 3S7JA 3I9WA 1VOMA 4J8FA 2CWYA 5LGUB 4N39A 3U3IA 3CK9A 2CE7A 4HGAA 2FULA 4L23A 4XX5A 1FVFA 2XUEA 5EX3A 1AJ3A 5G04C 4G23A 3NQPA 3T5VA 4B89A 4MLPA 3KS2A 3ETUA 3ZN1B 5JHAA 3DP7A 2VTBA 3L6AA 1HFAA 5JJTA 3G2UA 3ANWA 5JDMA 4B6XA 3AA1B 4OVUA 3ZMTB 3FBZA 3EDTB 3PUJA 3NBXX 4FLHA 3D3MA 1E1HB 5J08A 4C0EA 2X66A 3CVPA 4FLBA 5HXHA 3MCXA 1US7B 4BFRA 3C50A 2HR2A 3PUKA 3SD5A 4FU3A 4UI9K 4AQFA 3VHLA 5FMNA 5C1DA 3RYFE 1B7TA 3HI2A 3RC3A 2JLBA 4AY5A 3MACA 4QWNB 3N9NA 4NUUA 2BVLA 1HS6A 1UW4B 3D9JA 2JMHA 3ZHEB 4L2LA 5M72A 3T8MA 3VLDA 3VLFA 2PM7A 3ZIMA 3ZC1A 3OXFA 5T3RA 2DNXA 5DIZA 5LBQB 4DK5A 4TRQA 2JQQA 3E0ZA 3L22A 3NRYA 3AU5A 3PZDA 3CIAA 3AA0B 2CM0A 3UFEA 2WXGA 5BV1A 4KMCA 4GYSA 3CSTA 1S0PA 5BUZA 2HYZA 4CEMA 1H2TC 5HXRA 4I6EA 3SS1A 5LNKA 2C5KT 4WNDA 5T4YA 1X5BA 3ASHA 2CFZA 3FH7A 5A6CA 4FC8A 3CHOA 3HYMB 4NURA 1ZU2A 4GK0E 3Q9DA 4CI3B 5HXCA 3TKLB 3APFA 2AW6A 2WSSV 5KMGP 3J7Yq 5L3CB 3FHNA 4TUUA 1OWLA 3APDA 4LCTA 4CT4A 3C64A 3FUEA 3CVXA 4U0SA 1HO8A 4UQXA 5BNWA 4EPZA 3CX8B 4P0BA 3V5SA 3ZYQA 4GA0A 4N2QA 2N9DA 3CR3A 3CVQA 2AXUA 4M1PA 3K8PC 5GONE 2WXPA 4PJNA 3KEZA 4ISTA 5JDFA 4PUCA 3PURA 3QK0A 3RJVA 3UUMA 1QNFA 4ILHB 3LCAA 1E7UA 5AJLA 2B1EA 4DJAA 4K0UA 5FT9A 3RKVA 3S7BA 2NW7A 5LOZA 3UUXB 2LSVA 5D0OD 2KZTB 5HQ8A 4EZKA 2FI7A 5L3DB 2Y8DA 4R7LA 3AVSA 2P9BA 4N78D 3PTRB 1VRBA 3FTSA 3R6NA 2X9WA 4TV3A 1A17A 3KD7A 4X1IE 1OWOA 4I43B 5H6RB 4JW1A 4I17A 3CVWA 1YKHB 2LNIA 2DWGA 2BDEA 4O4IE 2N1GA 3B13A 2E9XD 3HVEB 4ILIA 4PDXA 4U0ZA 2CG3A 5CCMA 5JQGE 2WXFA 3NF1A 3N2GE 3MV2B 4EAHA 3TG5A 1IJ5A 3JCKC 5J1GA 3FUKA 1KNZA 2J49A 3PREA 5JDQA 3CKBA 2JRKA 2J1DG 4GA1A 3HHMA 4GMJA 1INZA 4RG6A 1QUUA 2XPIA 3ZMUB 4BTBA 5L3BB 5JDLA 5EX0A 1OWMA 1HCIA 2XAJB 4ZOLE 3ENEA 3AS5A 3EUHA 4A3TA 5DABA 4DNDA 1WYBA 3QNKA 3WAKA 4WWNA 4IULA 2VTBB 4UXNB 4Y6CA 2CEAA 3PU3A 3ANWB 5JH7E 3CVNA 2VASA 4IE5A 4HORA 5LGNB 5LX8A 5H6QB 4ZI3D 3KVAA 3RYIE 4WWPA 2IC9A 2VKHA 3WAJA 4OYSA 4BTAA 2PFVA 4I6GA 2XAQB 5LOVE 3EIJA 2V7LA 2W0GA 4GCNA 5DQVA 4CDNA 4KZCA 3HKCE 5EK2A 3MKQA 2AWIA 5F8PA 1ELRA 2ONDA 3ZJ1A 1H7CA 3HIZA 3FBLA 3LG7A 3OBVE 1UN8A 4XKBA 4H63H 2BZBA 5ARFA 4EZ4A 3T5XA 3ML8A 4QX8B 3EHMA 4WNGA 4JA9A 3FU6A 4EYYR 3LDZA 5CA0E 5HI7A 2BVMA 4K0RA 3SWHA 3OKQA 1FMWA 1MMDA 3ZMZB 2CMRA 3SNXA 3CK7A 5FY0A 4I9CA 4Z8XA 5CCLA 4UQYA 4O8SA 3CK8A 2DCFA 3T8OA 4G11A 4BWRA 1NA0A 3OTNA 4FP7A 4AVXA 5JHBA 3ZW3A 4CXWA 2J4BA 3AA7B 4JA7A 4H9NC 3FU0A 5G2NA 3Q47B 3Q5XA 4Q94A 4Q96A 5J2TE 4EZJA 3QK6A 2HPJA 2ACXA 3GZ2A 3N9MA 4WNFA 1SA0E 3ESLA 4J2CA 3ESKA 2V7IA 4EQFA 4BY6A 1V9DA 2WQ6A 3D9LA 2YINA 1UN9A 2KCLA 3G2WA 1KLXA 3RO2A 3UUNA 3HA4A 4XI0A 3F57A 3FUDA 4YLHA 5F3JA 2WXNA 4AOFA 1E8WA 1VDYA 1OWAA 3ZYMA 3I0QA 4FHKA 2LOPA 3ZMVB 3KVBA 2VL8A 4WNEA 2H3RA 3TG4A 4GYYA 4I2ZA 4HFVA 3R9AB 3L09A 1D1AA 1DNPA 4K03A 1EPUA 4DLOA 3Q4AB 4H9PC 4ACLA 3RC8A 2PQRA 2XASB 3DBSA 3PE0A 3KINB 3NZUA 4UVBB 3MX3A 2NWBA 4PJLA 2DIWA 2E0IA 1MIVA 3CKCA 1HX8A 1LVKA 4GZDA 3CVYA 3FP3A 2J09A 3TJPA 3RIBA 5ADXL 3RO3A 3FXEB 4U72A 2QFCA 1QZ2A 2Q7FA 3HKDE 3ZEFA 3CX7B 4JVSA 2Q9QB 4QX7B 3SBSA 2ODVA 3BEEA 5LXTE 3ZGQA 3EVYA 3L16A 5L3GB 4JHJA 1KT0A 4G25A 5CA1E 1PC2A 3PE4A 5LP6E 3CVUA 4CZZB 1HF8A 3MV3B 2KMFA 3AAIA 1MQSA 3RRUA 2X67A 2A4ZA 2DWKA 4GOUA 3UX4A 4UWGA 3KBTA 3VKHA 4C90A 4WBOA 5JDHA 5CHEE 1WYCA 4YJ2E 3ZRHA 2PQNA 4PNIA 2WVIA 2K9AA 4GIWA 2MOZA 3EDUA 4N5CA 4HVBA 3ZFWA 3U9WA 2WMNA 5FZRA 1EZ3A 3ONLA 1LKXA 1HU3A 4I1OB 3MK7C 2OVBA 4A1GA 3SF4A 4YHJA 1PY1A 3PNLB 2YNQA 5FWQA 3MJXA 3MKRA 1HH8A 4GZ6A 4AQGA 4CI1B 1OUVA 2H7VC 4ILGA 3MKQB 3OYZA 2LHRA 3PVLA 1WY6A 2EHOD 4AKGA 1D0XA 3JQ0A 1FVHA 2OV8A 5LCWC 4CI2B 3K3NA 1KK7A 4P09A 4U74A 2Y48B 3FTXA 5A23A 3ZCJA 2L9QA 4QXHB 2YU2A 4GZCA 4U63A 4E85A 4HLEA 3LVQE 4NQ0A 3TXMA 3AS4A 2UXNB 4H9OC 2X6KA 4H7YA 2X9YA 2XCCA 2VB6A 3OXGA 3RKOA 3SOLA 3SI5A 3SBTB 4FJZA 4AXPA 3CGHA 1HXIA 5BV0A 3ZYKA 1T98A 3ULQA 2YK0A 2WB2A 2GGFA 3FB2A 5FP3A 2K48A 5JVDE 4HOUA 2LJLA 2KM4A 3FXDB 5JREA 4JXTA 2CHZA 3CQGB 3CVLA 3GYZA 3NRXA 4OYJA 5CB4E 3I1AA 3SFZA 1HS7A 5C8YE 4LEUA 4AP2A 3Q15A 3MEKA 2CXDA 4GZ3A 2VJ8A 3PS6A 3GN5A 5BW8C 3RYHE 4GYRA 1U3DA 3CHMA 3B7TA 1SZAA 1D0ZA 2XGMA 4MRUA 3C51A 4LUNU 3FWVA 3CMLA 3PEUB 2W62A 4MS6A 2I1JA 4QKNA 4BSXA 4GAAA 3LY7A 3B7SA 1O3XA 4UWLA 1HE8A 2CCQA 4GB9A 4ABNA 2LE8A 4AEZC 4I9EA 4WUYA 2E9XA 4JUYA 3S2AA 5FZQA 4JL0A 4AQFC 3C4ZA 4DI3A 1Z6TA 2LM9A 5JRCA 4HOQA 1E96B 3D0TA 4BT8A 4UQZA 3FEYA 4TUYE 4GCOA 4JEHA 4XAXB 2YEVC 3ZN3A 5FQ8A 3CQXC 4UVCB 3P8CD 3MJWA 5C2YA 1D0YA 3ZYLA 4H9SE 3TL5A 3I4GA 2R59A 3B57A 4AV7A 2FEZA 5FJYA 2VKJA 1MMAA 2W00A 2WXMA 3APCA 3LBXA 4MFRA 4MALA 3PRZA 4ZI2C 4EOZB 2V8SE 3UPVA 3UTKA 3N71A 1JWFA 1SQMA 3E4BA 1JUQA 2RP4A 3ZEFB 5E75A 4E7SA 5AENA 4KUMB 1G8XA 1IHGA 2VYIA 3UMVA 3IV0A 4J8EA 2V7JA 1E90A 3N5LA 4HKAA 5KDMC 4PK6A 2IC6A 4IDZA 5LG4A 4A1SA 5LBMA 2CLYB 1SZ9A 3MYVA 3H37A 4ZI2D 3IBPA 2WXIA 3P7IA 3UT7A 3KFWX 5LJNA 2WXQA 4PS3A 2L9BA 4YNDA 4HOSA 3IBEA 4L2YA 4EZHA 1ZEEA 3N9QA 3UT4A 1NA3A 2JMKA 4G24A 3MXZA 1E8YA 2JEKA 3FH8A 5DQWA 2VKOA 4B8CB 3BG0B 4HE8A 1ZKEA 5HWYA 2LOSA 4ME2A 4ATGA 1OWPA 4URKA 4XZCA 4Q69A 4I50E 4V3IA 1KT1A 4N2SA 4ZS3A 2V5FA 5J2UE 2MYSA 2DBAA 2LO6A 4HN9A 2ZM0A 2X6IA 4RG9A 3VU7H 4IGUA 4CGWA 2WM9A 2DHRA 3N2OA 3IF8B 2C5IT 5A1LA 4FHJA 2ZM2A 4ZHQE 5FXZA 2M67A 1TJFA 3VTXA 2CA5A 5M4YA 3GZSA 3BQKA 1Z3XA 1U5PA 4G2AA 4AKLA 2A3DA 3OAWA 4HFGA 2GRLA 4KVMA 2KNDA 4L7TA 2EQXA 1FMVA 2ZMAA 3HR0A 4BJMA 2IJGX 4FI5A 2IF4A 3LY8A 3EHNA 2UWJG 3C98A 2Q9QC 5G05J 3R7QA 4LERA 2LAHA 4PAGA 2AXZA 3ZC0A 2A72A 4GZ5A 5JR9A 1MMGA 3QC1A 4YVOA 4OFZA 4OYKA 4XKCA 2I1KA 1WRDA 1H0AA 4CDMA 2Q9QD 3QUJA 2WQ7A 3JC6C 5FXVA 4QHOA 3CEQA 1ZBPA 3GN5B 4DPRA 4FJYA 2OA5A 1UX5A 4IRUA 4XE0A 3CSFA 2ODUA 3LPZA 5HXSA 2ZM8A 3ZJ2A 4RVBA 2XAFB 4L0RA 5FNVE 5FQ4A 2WXHA 1UJJA 3CHPA 2XCBA 4ANXA 4NUVA 3AAAB 4CT0A 2E9XB 2PBIA 1H2VC 4F6RC 2IFUA 4GK5E 2XAGB 1EDUA 5KJKA 4KXKB 4HOTA 1ZHCA 3F31A 4KP3C 2MTQA 3N9OA 2NOXA 5ARGA 5JRCB 3PDNA 3I0OA 4D10C 2VKDA 2K5BB 5FY1A 4EECA 4HS2A 3AU4A 3KV9A 4QXCB 4DBRA 3LXUX 3PH0C 5ETWA 4JEHB 1YA0A 3D9OA 4N3CA 3G2VA 2ILRA 3LS8A 5BPPA 3S7DA 4G63A 3PUAA 3QWWA 3BG1B 3IHRA 5T8IA 2PG8A 3D9IA 5E0OA 2KLQA 1Z0PA 3GMIA 2KXPB 3LBXB 5E76A 3J9X1 3FDHA 3KBUA 4BAYB 3U64A 2AXVA 2MHKA 5LCWJ 2YU1A 4TZ4C 4O2AE 1W3BA 4JPSA 1B89A 2PL2A 4ILUA 3D9NA 3QC9A 4APOA 3O48A 3FUMA 4ACKA 3L17A 4HTEA 4ASKA 1MIYA 4ANJA 4I1MA 5ENNA 2KINB 5G05C 4CRWA 3RYCE 4H7XA 4N3AA 3N2KE 5TAOA 2X0LB 2XAHB 2GW1A 1FIOA 5EKQD 1XGWA 2G0UA 1IQRA 4TV9E 3S7FA 2RA1A 3D9PA 3I5PA 1UG3A 3FTWA 5FXXA 2C0MA 5EZYE 2R5SA 3U4TA 3QAQA 1MHQA 4CXXA 4J6IA 4UEMA 2AVPA 3QJZA 3D9MA 3E08A 4AM9A 2EHOA 2WXJA 1IAPA 3E22E 4JEUA 3GA8A 5CMWA 1L5JA 3LY9A 2PZIA 5LFAA 3ASDA 4F1SA 5JDNA 4YFSA 3AA6B 2V1DB 5BMVE 1EYHA 1N52A 4IYPA 2XGSA 4OVVA 1GW6A 2NC9A 1LRZA 3ZPOA 1N54A 5AYWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMN A;  3VHL A;  2WMO A;  2WM9 A;  3B13 A;  2YIN A; 
#chains in the Genus database with same CATH topology
 3DPD A;  1UUR A;  2H6I A;  1DC2 A;  4XBF B;  5JDG A;  1SUM B;  2NW9 A;  4BX9 A;  1OED E;  4LNB A;  4AIF A;  4OAV B;  2CHX A;  2J07 A;  3WXX A;  4F53 A;  2OV9 A;  3RRW A;  2J9Q A;  2XGO A;  5AN8 A;  4I2W A;  4TXQ A;  2WDQ A;  2ZIR A;  5IUX A;  4DO0 A;  4GU5 A;  2Y6X A;  2FBW A;  3PZ3 A;  2HPL A;  1D1C A;  2L0T B;  3BQI A;  1FCH A;  3P1U A;  4HBD A;  4HEA A;  3QB5 K;  3CHS A;  3VRB A;  2E8I A;  1OY3 D;  2R2L A;  1AP7 A;  2DZN A;  2LSY A;  2P2C P;  2X9X A;  3PDY A;  3A5X A;  2UUB T;  5IYZ E;  3TGO A;  1Y64 B;  1LF8 A;  2WDR A;  4H9Q C;  4DR7 T;  1IZN B;  3ETV A;  4QXB B;  4JI6 T;  2LXL A;  2XTL A;  1PAQ A;  1P5Q A;  5EK3 A;  2YDQ A;  2WXO A;  2X9H A;  4UIG A;  4HXI A;  3LK2 B;  1BI8 B;  2JQK A;  3ASO E;  3W15 B;  3Q9N C;  3AS8 A;  2XQ0 A;  3ULY A;  5ANR A;  4AXH A;  2WWV A;  2XEV A;  4JZY A;  3C98 B;  5A7D B;  2YN6 A;  2MRI A;  1W09 A;  2DI4 A;  3PE3 A;  3RRC A;  2L6J A;  1JWG A;  5HYA A;  5FZS A;  4N3B A;  4HRN A;  2VVS A;  3AE9 A;  4PS8 A;  4HWC A;  2V8S V;  1YKE B;  4UEL A;  2WXL A;  2KZ7 B;  2VL0 A;  3RK6 A;  3PUY F;  3PUZ F;  5JR9 B;  3HKE E;  4O6F A;  3FUN A;  4E6H A;  3LJ3 A;  4QQI A;  1S64 A;  3H3A A;  2CLY C;  4ZI7 E;  2WMO A;  2XS8 A;  4G1T A;  4APF A;  4LF4 T;  5DBK A;  4DI4 A;  1XMO T;  2KC7 A;  4DLQ A;  2J62 A;  4MBG A;  5BT1 A;  4I0U A;  4JLE A;  5ABH A;  2BTD A;  4DX6 D;  4J7W A;  4BER A;  3KV6 A;  4PH4 B;  2WZI A;  2X38 A;  3JYS A;  1WR6 A;  4H9R C;  2EIM E;  1OED B;  4HFH A;  4BX8 A;  2PNN A;  2BG9 E;  3C4X A;  2I9C A;  2L0I A;  2UY1 A;  2KWI B;  3NZQ A;  4BA9 A;  4DUI A;  4P0A A;  4JHK A;  2D5U A;  3PZ1 A;  5LA6 E;  1YQ4 A;  3I9Y A;  5HWX A;  5EN5 D;  3QWP A;  3JUI A;  4DV6 T;  3JQ1 A;  2XQ7 A;  3ZU7 B;  3DSV A;  4AJW A;  4AY6 A;  4OK0 A;  3HDX A;  3ONL C;  3P50 A;  3ZLI A;  2X6H A;  1N95 A;  1KNR A;  2IOL A;  5L3E B;  1MMN A;  2RG8 A;  2VGY A;  1NAF A;  2BS2 A;  3DEP A;  2F0Y A;  3HL6 A;  4PS7 A;  4U96 D;  5HKP A;  3FTU A;  3L82 A;  4XIF A;  3QKY A;  3V31 A;  4WW0 A;  2Y4T A;  3U78 A;  4U8H A;  4J8D A;  1NWM X;  4CZ2 D;  5KJM A;  4NRH B;  3MKD A;  4AKI A;  2BKK B;  3FUI A;  1U4Q A;  3RX6 A;  2DLR A;  2FF4 A;  4XI9 A;  4B8A A;  3PUG A;  3ABL E;  1HG5 A;  2V7K A;  1UGO A;  3IHY A;  5HAX A;  3UM1 A;  4EIW A;  1V55 E;  3EHR A;  4Y6W A;  2XZD G;  2X0H A;  4M3O A;  4RLY A;  2F8Y A;  5LP0 A;  2FBN A;  2J4D A;  3E30 A;  2XZT G;  4WBN E;  2NTX A;  2IO3 C;  2KCV A;  1IJ6 A;  2C5J A;  4KT6 B;  3O1H A;  4C9B B;  5KXJ A;  4V1A v;  3J5P A;  2ETC A;  3CKD A;  4O4J E;  2LUH A;  4B3M T;  5CRU A;  5JJ6 A;  2XPK A;  1OWN A;  2K3W A;  4TN7 B;  2V4L A;  4XEI G;  4EXT A;  3NWI A;  2DWZ A;  5EDS A;  1YYH A;  4UVA B;  4IHJ E;  3LK3 B;  4GML A;  3J5Q B;  2I6H A;  4I1A A;  2IQC A;  4QFV A;  3TAX A;  1O1T A;  2QA7 A;  2A2F X;  3MA5 A;  4DMV A;  2DCP A;  2Y4U A;  5AJD A;  1G3N B;  4TV8 E;  3I3N A;  1UJK A;  4ADZ A;  4G2V A;  2WXR A;  2JQH A;  2BG9 B;  2RPA A;  4EB6 E;  3QOF A;  4YTM A;  4UWF A;  2XQ4 A;  2JJ9 A;  1ELW A;  4X5T A;  1H6O A;  3A7M A;  1WCR A;  3OJA A;  1E8Z A;  1WAO 1;  4A55 A;  4X1K E;  4I4T E;  4BJN A;  2QZA A;  2X6J A;  2R03 A;  1H19 A;  2NR4 A;  4C0M A;  4GPM A;  4CQI A;  2VQE T;  2WBL A;  2WPV A;  2D2S A;  1QBQ A;  2R17 C;  5AQO B;  3TWT A;  3K9I A;  2ES0 A;  3UUL A;  3F2E A;  1HNW T;  4U04 A;  2EIJ E;  3PNT B;  5EYP F;  2IW5 B;  3ONX A;  4QH4 A;  2YQ8 A;  5CJ5 A;  4ANW A;  4JI2 T;  3SZ7 A;  4LF6 T;  3FTY A;  3K3Q C;  2EHO B;  4BSZ B;  2W61 A;  1MND A;  2B76 A;  3AEF A;  3O1I A;  1DCQ A;  2OVF A;  4IE0 A;  3PZ4 A;  3S4U A;  3CV0 A;  4JEU B;  3R84 B;  1TEZ A;  4C91 A;  5ENQ D;  3LKU A;  5ENS D;  4WWO A;  3ZT6 A;  4IE7 A;  2LRK A;  4KZ0 A;  3FUF A;  5ENR D;  4P29 A;  3W9F A;  3FTV A;  3PU8 A;  2P9P G;  2A5U A;  2LSU A;  4U07 A;  4PJM A;  4XZ4 A;  2Z6E A;  3TXN A;  5KJL A;  3UQ3 A;  3Q2M A;  3DXK G;  1H6K A;  3AAA C;  2UXD T;  3L13 A;  4GTO A;  2E9X C;  3CIR A;  4F3V A;  4TWD A;  2NTY A;  1KNP A;  1YW0 A;  5AQS B;  5FXW A;  3Q7F A;  2CFU A;  3V2O A;  2X3M A;  4MHC A;  3WI3 A;  3CPZ A;  4JI7 T;  2IDO B;  4EBA G;  3O4Z A;  1U3C A;  4P1N A;  5DJQ C;  4YDW A;  3KV5 A;  3N9P A;  3C4W A;  5FQ6 A;  3CX6 B;  2P9L G;  4UF0 A;  3V5U A;  5LYJ E;  2LRL A;  2HH7 A;  1MJ0 A;  4GPK A;  5CMY A;  4RSY A;  1MNE A;  2D0T A;  5AQI B;  3CQC B;  3FZM B;  2UXC T;  2J08 A;  5IWA T;  4IDQ A;  3FY4 A;  1DVP A;  5FYM A;  5CEC B;  3IHV A;  1ZV4 X;  3QAR A;  2LSJ A;  3OXL A;  3UT5 E;  2XPZ A;  5KJN A;  3FHE A;  1Z3Y A;  3EDV A;  3FU5 A;  2XHE A;  4KBM B;  3D9K A;  4O2B E;  4DVD A;  4I55 E;  1IBK T;  3EJN A;  1N4R A;  2OEW A;  4A98 A;  4NXM T;  4DV4 T;  2Q9Q A;  1S94 A;  5AQR B;  3L39 A;  3UKU G;  4CDR A;  3R7R A;  2LAI A;  2WXK A;  1JPL A;  2KXP C;  3LEW A;  1OCO E;  4GTV A;  1IYG A;  4B3S T;  5FY7 A;  1BR4 A;  4YJ3 E;  2PJQ A;  4JI5 T;  4PJJ A;  1O1R A;  2F8X K;  3B7U X;  2CRB A;  3BQL A;  4YTN A;  1WG0 A;  5EK4 A;  3NOC D;  3UU5 A;  4ZI3 C;  3FUJ A;  4W9R A;  2VSY A;  2ZLY A;  2LEH A;  2LM2 A;  4X8Q A;  2VGX A;  2NXP A;  3ZST A;  4GYW A;  3MA9 A;  4NIK A;  2BUG A;  4PFO A;  4E7Z A;  3MZL B;  5JJ7 A;  5L3F B;  5JA4 D;  1WLX A;  2WQH A;  3CWZ B;  1Y8M A;  3BK9 A;  2IY0 C;  3FUL A;  4COF A;  4UI9 J;  2QGS A;  4WAF A;  4PFP A;  3URZ A;  4GYO A;  4FJO A;  3DSS A;  2Y3A A;  2CWO A;  2FUP A;  3HXF A;  4LNG A;  4X1Y E;  2HE0 A;  3IEG A;  2WU2 A;  3IKO B;  3AE5 A;  2IU1 A;  3VKG A;  2LSI A;  3FUH A;  4WZX A;  1QSD A;  1OXJ A;  4PK5 A;  4GTR A;  2LXM A;  1TN6 A;  3CLJ A;  2VSO E;  1HG2 A;  1YQ3 A;  2WDV A;  3O1J A;  4FUL A;  2ZU6 B;  2E2E A;  2BF0 X;  5LJM A;  3PUS A;  4AIU A;  3ZPJ A;  3L8R A;  4YSY A;  2UY1 B;  5LHG B;  2WAU A;  3CK6 A;  3L54 A;  1HZ4 A;  2KBX A;  3OTO T;  3NZP A;  3CVR A;  2L3L A;  4U8Y D;  1BR0 A;  3LSV A;  4J8S A;  3NZS A;  2C0S A;  4TX5 A;  3M65 A;  2QY7 A;  1N94 A;  3G2S A;  4PK4 A;  3FFL A;  1YMP A;  2WWU A;  2C2L A;  3UT8 A;  1UCU A;  2NSZ A;  2LT3 A;  2XM1 A;  3SRZ A;  4AKH A;  3EI0 A;  3MZK B;  3HXD A;  4GTM A;  4MBQ A;  3RHW A;  4NAC A;  4U7I A;  4DBQ A;  3ZN0 B;  4F8H A;  3ZVV A;  2K24 A;  2F37 A;  4G26 A;  4AKR B;  3O4X E;  5L4E A;  4AI6 A;  2XRZ A;  4QH5 A;  2KCK A;  5FTP A;  2XRY A;  4I6J A;  3ZXS A;  3IEE A;  3RRN B;  4HWI B;  4B0Z A;  4CXY A;  1Y6I A;  3I4R B;  4X66 T;  3RH3 A;  4WNK A;  2CG2 A;  3GZ1 A;  4KMO A;  2V26 A;  4O4L E;  3ASG A;  4MKT A;  4U7Y A;  2D9D A;  4UV8 B;  2AXD S;  2GRM A;  2NW8 A;  4IE6 A;  4U0U A;  4EZL A;  2W63 A;  2KWH A;  4DX7 D;  2W67 A;  1DCE A;  1TJC A;  3DTO A;  2GRO B;  3PZ2 A;  2Y1L E;  3QWV A;  5HXE A;  1NFI E;  1D8E A;  4IDP A;  2V6X A;  1E2A A;  2VQ2 A;  2HO1 A;  4G8K A;  3JC6 D;  2H7O A;  3RPU A;  2XY8 B;  1LTX A;  2KAT A;  3QOU A;  2BKO A;  1LVF A;  4KVO A;  5LGT B;  2V7M A;  2XPY A;  3ZHE A;  2X68 A;  3Q9U C;  5LHH B;  3DEO A;  5IHY A;  5AFU L;  3M3Z B;  1SHZ C;  1YD8 G;  5HEJ A;  5ABG A;  3KV4 A;  4LRZ A;  5AIJ A;  3LJC A;  1X81 A;  4L9P A;  4UV9 B;  3HG0 D;  5KNH D;  5LHI B;  2VSX E;  2C0L A;  2KT9 A;  4KI0 F;  4TXR A;  4ATZ D;  3RQW A;  4ANV A;  5KX5 E;  5JR9 C;  4ZZC A;  2GK9 A;  5ANL A;  1NEK A;  3ONK A;  3SGH A;  4FAD A;  3WG7 E;  3W9G A;  2DYS E;  2XQ8 A;  4ANU A;  4EBA A;  3KDS E;  1NZN A;  2Y69 E;  2IAK A;  3LFM A;  1DU2 A;  2XEN A;  5AQF B;  2CXF A;  4A56 A;  2VSN A;  1QQE A;  5J0Z A;  4HWH A;  2PM6 A;  3L08 A;  3BU8 A;  4YDY A;  3TWQ A;  3EAM A;  2CHW A;  4MLK A;  1IKN D;  4L1B A;  3G2T A;  1OED C;  4ERR A;  4A5X A;  4UI9 C;  4BT9 A;  2SPC A;  3FH5 A;  2P58 C;  4ZS2 A;  2UXB T;  3AE3 A;  5LCY A;  1N32 T;  2RFA A;  4IE4 A;  3FU3 A;  2CPT A;  5G04 J;  4JC8 A;  3QDN A;  3BUA A;  4KBQ A;  1WM5 A;  2LHN A;  1LD7 A;  5AQQ B;  2V0P A;  2HN2 A;  2IHR 1;  3TLT A;  1XNF A;  3AG3 E;  1H2U A;  3K3O A;  3AJI A;  2MOW A;  1UX4 A;  4JD2 G;  5B1A E;  4DUZ T;  1OXZ A;  3C72 A;  2UXX B;  3ML9 A;  3SHF A;  1MIW A;  1S35 A;  5CRV A;  2BS4 A;  1EF1 C;  4H63 V;  4FA6 A;  3TLV A;  3LK4 2;  3B7R L;  3PEV B;  2XS1 A;  3OPC A;  2N2N A;  4DV5 T;  4KYO B;  1D1B A;  3SFD A;  2P9U G;  1TR4 A;  3VR9 A;  4U95 D;  2I2O A;  2VWA A;  2D0U A;  4L9I A;  2VK9 A;  3FEX A;  3ZCI A;  4YVQ C;  1ELK A;  3CHR A;  4IIJ E;  3GWH A;  4ISS A;  2LSK A;  3ZMS B;  1N34 T;  5LMU T;  3P4P A;  4K5B A;  3ASF A;  1QLB A;  4UF0 B;  4UWH A;  5HCM A;  4CN4 A;  2JIW A;  5FL0 A;  2FO7 A;  1KFY A;  4F7A A;  3AE1 A;  2I59 A;  2L8K A;  1G73 A;  1JCS A;  4GA2 A;  3LVR E;  3Q5M A;  1FEW A;  3P4Q A;  3VTY A;  3CVV A;  3DJB A;  3UUX A;  1BR1 A;  2QVA A;  1CUN A;  2KZT A;  2E5V A;  5CGM A;  4O1O A;  3RU0 A;  2XHE B;  4U8V D;  3AB3 B;  4QH1 A;  3NB2 A;  3C3R A;  3CHQ A;  2BBH A;  4J0U A;  4A3V A;  1BR2 A;  4CCA A;  4HFB A;  2YHC A;  3EIQ C;  1ZOY A;  4EGW A;  5D0Q D;  3GW4 A;  2GRQ B;  4UWK A;  3Q49 B;  2H89 A;  2X6F A;  2XSA A;  4X20 E;  5HRY A;  2UU9 T;  4IN3 B;  4I43 A;  3EHQ A;  1OCR E;  4JHR A;  3HKB E;  3VLE A;  2CHN A;  1JCR A;  3HXB A;  3U66 A;  4HI8 A;  4O4H E;  2BG9 C;  4B94 A;  2HM8 A;  4ZHB A;  2YHE A;  2VGX B;  2OOE A;  1HTJ F;  1X79 A;  3P2B A;  2B6C A;  4LF5 T;  2XQY A;  1E7V A;  2ION A;  3MGB A;  4HNA D;  5J90 A;  3FTZ A;  5KCM A;  4DUY T;  3LYA A;  1UK5 A;  3HVE A;  2X51 A;  3OYX A;  2RD0 A;  5G55 A;  1E8X A;  2CXL A;  4OHF A;  1XDP A;  3EAB A;  3PUQ A;  3AVR A;  3O9X A;  2M63 A;  5HCJ A;  3KAE A;  4EYU A;  2JPF A;  4CGV A;  4PW8 A;  2MBG A;  4DMW A;  1IQU A;  1K3Z D;  1BPO A;  4L5G A;  2LSG A;  3PV0 F;  1NP7 A;  3AAE B;  1HNX T;  5FIN A;  3Q5W A;  3B7B A;  3C3O A;  5FQ7 A;  2R05 A;  5C3J A;  3L3P A;  1N4P A;  3RRM B;  5L2L A;  3N9L A;  2NP9 A;  4DRX E;  2IOS A;  2EHO C;  3U3W A;  3QB2 A;  3RKG A;  3AG4 E;  3S7J A;  3I9W A;  1VOM A;  4J8F A;  3KSL A;  2CWY A;  5LGU B;  4N39 A;  3U3I A;  3CK9 A;  2CE7 A;  4HGA A;  2FUL A;  4L23 A;  4XX5 A;  4AQY T;  1FVF A;  2E5L T;  2XUE A;  5EX3 A;  1AJ3 A;  5G04 C;  3Q78 A;  4G23 A;  3NQP A;  3T5V A;  4B89 A;  4MLP A;  3KS2 A;  3PJA A;  3ETU A;  3ZN1 B;  3ZT5 A;  1KEY A;  5JHA A;  3DP7 A;  2VTB A;  3L6A A;  1HFA A;  5JJT A;  3G2U A;  2XQA A;  5BXU A;  3ANW A;  5JDM A;  1V54 E;  4B6X A;  3AA1 B;  4OVU A;  3ZMT B;  3FBZ A;  3UU4 A;  3EDT B;  2UUC T;  3PUJ A;  3NBX X;  1TNO A;  5FKY A;  4FLH A;  4Z90 A;  3D3M A;  5AAR A;  1E1H B;  5J08 A;  4C0E A;  3ZNG A;  1Z5S C;  3JCF A;  2X66 A;  2WU5 A;  3CVP A;  4FLB A;  5HXH A;  2BBJ A;  3MCX A;  1US7 B;  4BFR A;  3C50 A;  3EU5 A;  2HR2 A;  3AE7 A;  3PUK A;  3SD5 A;  3OVU A;  3UTM A;  3PUV F;  4FU3 A;  4UI9 K;  4AQF A;  3VHL A;  5FMN A;  5C1D A;  3RYF E;  3HXE A;  1B7T A;  3HI2 A;  3RC3 A;  2JLB A;  4AY5 A;  3MAC A;  2EIK E;  4QWN B;  3N9N A;  3KEA A;  4NUU A;  3RIU A;  2V4H C;  2BVL A;  4ZZB A;  1HS6 A;  1HX1 B;  1UW4 B;  3D9J A;  2JMH A;  4U2Y A;  3V79 K;  3UU6 A;  3IXE A;  5AQP B;  3ZHE B;  4L2L A;  5B3S E;  3T8M A;  5M72 A;  3UFG A;  4BET A;  3VLD A;  3VLF A;  2PM7 A;  3R9M A;  3ZIM A;  3ZC1 A;  3OXF A;  3HRA A;  5T3R A;  2DNX A;  5DIZ A;  5LBQ B;  4DK5 A;  4TRQ A;  3TWU A;  3TWW A;  2JQQ A;  3E0Z A;  4JI1 T;  3L22 A;  3P4W A;  3NRY A;  3AU5 A;  2AE9 A;  3PZD A;  2LLY A;  3AA0 B;  3CIA A;  2CM0 A;  3ZT7 A;  3UFE A;  2WXG A;  3PUW F;  5BV1 A;  4J8Y A;  4KMC A;  4GYS A;  5BXO A;  3CST A;  1S0P A;  1HR0 T;  4HLL A;  5BUZ A;  2HYZ A;  4CEM A;  1H2T C;  2ZXW E;  5HXR A;  4I6E A;  4HFE A;  2OEV A;  3SS1 A;  5LNK A;  2P9I G;  2C5K T;  4WND A;  5T4Y A;  1X5B A;  3ASH A;  3TWS A;  2CFZ A;  3FH7 A;  5A6C A;  4FC8 A;  3CHO A;  5H7P A;  2IEJ A;  3HYM B;  4NUR A;  4C48 B;  1ZU2 A;  2W66 A;  4GK0 E;  2QYW A;  3Q9D A;  4CI3 B;  5HXC A;  3TKL B;  5ENP D;  3APF A;  2AW6 A;  4LMJ A;  2WSS V;  2XZE A;  3DSU A;  5KMG P;  3J7Y q;  5L3C B;  3FHN A;  5AQN B;  1TNZ A;  4TUU A;  1OWL A;  3APD A;  4LCT A;  4DV3 T;  1NL4 A;  4CT4 A;  3C64 A;  3HXC A;  2OLT A;  2WY2 A;  2XJ7 A;  1S70 B;  2DZO A;  3FUE A;  3CVX A;  4U0S A;  1HO8 A;  4UQX A;  3FZK B;  5BNW A;  4EPZ A;  2W2U A;  3CX8 B;  4P0B A;  3V5S A;  5JTG A;  3ZYQ A;  4BES A;  3DXM G;  3UKR G;  4GA0 A;  4N2Q A;  2N9D A;  3CR3 A;  3CVQ A;  2AXU A;  4M1P A;  1SW6 A;  3K8P C;  5GON E;  2WXP A;  4YHH T;  4Q25 A;  2YDS A;  2M6I A;  4PJN A;  4KX6 A;  3KEZ A;  4IST A;  5JDF A;  4PUC A;  5AQB A;  3PUR A;  2ZGG A;  3QK0 A;  5CER B;  3RJV A;  3UUM A;  1QNF A;  4ILH B;  1E7U A;  3LCA A;  5AJL A;  4LF9 T;  2B1E A;  4DJA A;  4K0U A;  5FT9 A;  1WDY A;  3RKV A;  3S7B A;  1NEN A;  2NW7 A;  5LOZ A;  3UUX B;  2LSV A;  5D0O D;  1QYM A;  2KZT B;  1UOH A;  5HQ8 A;  4EZK A;  2FI7 A;  5L3D B;  2Y8D A;  4R7L A;  3AVS A;  1T72 A;  2FJB A;  2P9B A;  4N78 D;  5KBA A;  3PTR B;  2JAB A;  2FJE A;  4DR3 T;  1VRB A;  3FTS A;  2DL1 A;  4RQI A;  1J5W A;  3R6N A;  2X9W A;  4TV3 A;  2NYJ A;  1A17 A;  2RFM A;  3KD7 A;  4X1I E;  3BQO A;  4JYA T;  1OWO A;  3AE8 A;  4I43 B;  5H6R B;  4DV0 T;  2OCC E;  4JW1 A;  2BS3 A;  4I17 A;  3CVW A;  4LFB T;  1J5E T;  1YKH B;  1OCC E;  1MX6 A;  2LNI A;  5C2T A;  1BD8 A;  4DV7 T;  2DWG A;  4IDO A;  2BDE A;  4O4I E;  4GMR A;  2N1G A;  3B13 A;  4JV5 T;  2E9X D;  1I94 T;  3HVE B;  4ILI A;  3UXG A;  4PDX A;  4U0Z A;  2CG3 A;  5CBO A;  5CCM A;  4IT4 A;  5JQG E;  2WXF A;  4U31 A;  3NF1 A;  3N2G E;  1FPP A;  3MV2 B;  4EAH A;  3TG5 A;  3UM0 A;  1IJ5 A;  5L4H A;  4ILC A;  3JCK C;  5J1G A;  3FUK A;  4YXD A;  5ENT D;  1D9S A;  1KNZ A;  2J49 A;  3PRE A;  5JDQ A;  1TN7 A;  5AQU B;  3CKB A;  2JRK A;  2J1D G;  4GA1 A;  4TWH A;  1T8B A;  3P4R A;  1SA4 A;  3HHM A;  4GKJ T;  4GMJ A;  1INZ A;  4RG6 A;  1QUU A;  2XPI A;  3ZMU B;  4BTB A;  5BR8 T;  5L3B B;  5JDL A;  5EX0 A;  1OWM A;  3QB5 A;  1HCI A;  1IXV A;  2XAJ B;  4ZOL E;  1IHB A;  3ENE A;  2IML A;  3AS5 A;  3EUH A;  4A3T A;  5DAB A;  4DND A;  1WYB A;  3QNK A;  3WAK A;  4WWN A;  4IUL A;  5ABF A;  2VTB B;  4UXN B;  3Q75 A;  4Y6C A;  2CEA A;  1FJG T;  3PU3 A;  3ANW B;  3JXJ A;  5JH7 E;  3CVN A;  2VAS A;  4IE5 A;  4HOR A;  5LGN B;  4WYV A;  5LX8 A;  5H6Q B;  4ZI3 D;  3KVA A;  3RYI E;  4WWP A;  2IC9 A;  2VKH A;  2QRX A;  3WAJ A;  4LFA T;  4OYS A;  3ONJ A;  4BTA A;  5CBN A;  2MPK A;  2PFV A;  3VRA A;  4I6G A;  5IY5 E;  2XAQ B;  4X62 T;  5LOV E;  3EIJ A;  2V7L A;  2W0G A;  3A8Y C;  4GCN A;  5DQV A;  4CDN A;  4B3R T;  5ENO D;  4KZC A;  3HKC E;  5EK2 A;  3JXI A;  3MKQ A;  2AWI A;  5F8P A;  1ELR A;  4HQD A;  2OND A;  3ZJ1 A;  1H7C A;  3HIZ A;  4ZXL A;  4LG6 A;  3FBL A;  3LG7 A;  3OBV E;  1UN8 A;  5HS0 A;  4XKB A;  4H63 H;  2XQ5 A;  2BZB A;  5ARF A;  4Z91 A;  1BLX B;  3SY2 A;  4EZ4 A;  2LKG A;  3T5X A;  4G8L A;  3ML8 A;  4QX8 B;  2Y0B G;  3EHM A;  4WNG A;  4JA9 A;  3V2X A;  5ABE A;  3FU6 A;  4EYY R;  3LDZ A;  5CA0 E;  3T1H T;  2WB5 A;  2XQ6 A;  3UI2 A;  5HI7 A;  1MX4 A;  5KWD A;  2BVM A;  4K0R A;  3SWH A;  3OKQ A;  1FMW A;  3UIP C;  1RZ4 A;  2UUA T;  1MMD A;  3FZH B;  3ZMZ B;  2CMR A;  3SNX A;  3CK7 A;  3ULE G;  2IIU A;  5FY0 A;  4I9C A;  4Z8X A;  5CCL A;  4UQY A;  4O8S A;  2A5E A;  3SQV A;  3CK8 A;  3UUB A;  2DCF A;  3RIF A;  3T8O A;  4G11 A;  4BWR A;  1NA0 A;  3OTN A;  1KPS B;  4FP7 A;  4AVX A;  5JHB A;  5L47 A;  3D9H A;  3ZW3 A;  4CXW A;  2J4B A;  3AA7 B;  4JA7 A;  3SO8 A;  4F1P A;  4H9N C;  3FU0 A;  5HEO A;  3UM2 A;  5G2N A;  3Q47 B;  3Q5X A;  4Q94 A;  4Q96 A;  5J2T E;  4EZJ A;  5LG3 A;  3QK6 A;  4IL9 A;  3ABK E;  2HPJ A;  2ACX A;  3GZ2 A;  3N9M A;  4WNF A;  1X9B A;  4DX1 A;  3AED A;  3DRA A;  3RGL A;  1SA0 E;  3ESL A;  4J2C A;  3ESK A;  2V7I A;  4EQF A;  2JQ9 A;  4LSZ E;  1V9D A;  4BY6 A;  2H6H A;  5FIO A;  3D9L A;  2WQ6 A;  2YIN A;  1UN9 A;  2KCL A;  3G2W A;  1KLX A;  4CN1 A;  2BKP A;  3HA4 A;  3UUN A;  4XI0 A;  3RO2 A;  3F57 A;  3FUD A;  2ZIS A;  1TN8 A;  4YLH A;  5F3J A;  2WXN A;  1O5M A;  4AOF A;  1E8W A;  1VDY A;  4O60 A;  1AWC B;  1OWA A;  5HEH A;  4HWD A;  1ZP0 A;  3ZYM A;  2YKS A;  4Z68 A;  3I0Q A;  2V5Q C;  4TXP A;  4FHK A;  5CED B;  2LOP A;  3ZMV B;  3KVB A;  2VL8 A;  4WNE A;  2H3R A;  4NIQ A;  3TG4 A;  2KSR A;  4GYY A;  4I2Z A;  4HFV A;  3R9A B;  4AIS A;  3L09 A;  4TUM A;  1D1A A;  1XWM A;  1DNP A;  4K03 A;  4EHM A;  1EPU A;  4KHP T;  4DLO A;  2H88 A;  4H9P C;  3Q4A B;  4ACL A;  3RC8 A;  2PQR A;  2XAS B;  4TNV A;  3DBS A;  3PE0 A;  4CN6 A;  3NKZ A;  2IUB A;  3KIN B;  1N9A A;  3NZU A;  4UVB B;  3MX3 A;  4UR9 A;  2FO1 E;  2NWB A;  4PJL A;  2DIW A;  2E0I A;  1MIV A;  3CKC A;  3H3M A;  1HX8 A;  1LVK A;  5D2M C;  4GZD A;  5AQA A;  3CVY A;  4B3T T;  3FP3 A;  2F4V T;  2J09 A;  4YDE A;  3ABV A;  1UUS A;  4JB8 P;  3TJP A;  3RIB A;  5ADX L;  3RO3 A;  3FXE B;  2E2A A;  1SA5 A;  2WQY A;  3Q5E A;  4U72 A;  2QFC A;  1QZ2 A;  2Q7F A;  1W0B A;  3HKD E;  1JNZ A;  3ZEF A;  1T7S A;  3CX7 B;  4K5C A;  4JVS A;  3TWV A;  3Q5D A;  3X2Q E;  2Q9Q B;  4QX7 B;  1OT8 A;  2YDR A;  3SBS A;  4TNW A;  2ODV A;  3JAE A;  3BEE A;  5LXT E;  4NXN T;  3ZGQ A;  5AQH B;  4ZFH A;  3EVY A;  2HN1 A;  3L16 A;  5L3G B;  4JHJ A;  3B95 A;  2WCA A;  1KT0 A;  4G25 A;  5CA1 E;  1PC2 A;  1YXR A;  2P9S G;  2FJD A;  3PE4 A;  1N0Q A;  4IRE A;  5LP6 E;  3CVU A;  4CZZ B;  2XQ9 A;  1HF8 A;  3MV3 B;  2KMF A;  3RF1 A;  3AAI A;  1E7P A;  1O1S A;  5B1B E;  1MQS A;  3RRU A;  2X67 A;  2A4Z A;  2DWK A;  4GOU A;  3DPY A;  3UX4 A;  4UWG A;  3KBT A;  3ZXP A;  3JAF A;  3VKH A;  5AQJ B;  4C90 A;  4U7E B;  5ABF B;  4DX2 A;  4WBO A;  3NAW A;  5JDH A;  4DR6 T;  1WYC A;  5CHE E;  4YJ2 E;  3ZRH A;  1W0A A;  3E37 A;  2PQN A;  4PNI A;  4GKK T;  2WVI A;  2K9A A;  4GIW A;  2MOZ A;  3EDU A;  4N5C A;  1TNU A;  4HVB A;  4IL4 A;  2ZGD A;  3U9W A;  3ZFW A;  2WMN A;  5FZR A;  1EZ3 A;  3ONL A;  1LKX A;  1HU3 A;  4I1O B;  3MK7 C;  2OVB A;  4A1G A;  5AQ9 A;  3SF4 A;  4YHJ A;  1PY1 A;  3PNL B;  3AEB A;  2YNQ A;  5FWQ A;  4JI4 T;  3MJX A;  3ISM C;  3MKR A;  3V30 A;  1IBL T;  3FZF B;  1HH8 A;  2H6G A;  2FJA A;  4AQG A;  4CI1 B;  1OUV A;  4GZ6 A;  3LDQ B;  3SFY A;  2H7V C;  4ILG A;  3MKQ B;  3OYZ A;  5AQV B;  2LHR A;  3AEG A;  3Q7A A;  3PVL A;  1WY6 A;  2EHO D;  4AKG A;  1RW2 A;  1D0X A;  3JQ0 A;  1FVH A;  2OV8 A;  5LCW C;  4CI2 B;  3K3N A;  1KK7 A;  4P09 A;  4U74 A;  2Y48 B;  3FTX A;  5A23 A;  3ZCJ A;  2L9Q A;  4QXH B;  4U33 A;  2YU2 A;  4GZC A;  4HRM B;  4U63 A;  4E85 A;  3PUX F;  4HLE A;  2VGE A;  3LVQ E;  1N36 T;  1LD8 A;  4NQ0 A;  4LNU D;  1VCS A;  4HFD A;  1JCQ A;  3NOG D;  4B93 B;  3TXM A;  2ETB A;  3AS4 A;  2VVN A;  2UXN B;  4H9O C;  2ZM6 T;  2GRP B;  2X6K A;  2X9Y A;  2XCC A;  2VB6 A;  3B5M A;  4H7Y A;  5CEA A;  1A5E A;  2P9N G;  3OXG A;  3RKO A;  3SOL A;  4EEB A;  3SI5 A;  3SBT B;  1CHU A;  4FJZ A;  3EHZ A;  4AXP A;  1MYO A;  3CGH A;  1HXI A;  1XMQ T;  5BV0 A;  2XSB A;  2XQ3 A;  3ZYK A;  2AJA A;  1T98 A;  2XEE A;  3ULQ A;  2YK0 A;  2EIN E;  3T9K A;  2WB2 A;  2GGF A;  3FB2 A;  3UIN C;  5FP3 A;  1TNY A;  2K48 A;  5JVD E;  4HOU A;  2LJL A;  3FXD B;  2KM4 A;  5JRE A;  4JXT A;  2CHZ A;  3CQG B;  1U2V G;  3CVL A;  4DR1 T;  3GYZ A;  3FZL B;  5LB7 B;  1Y01 A;  3NRX A;  4OYJ A;  1KZO A;  5CB4 E;  3I1A A;  3SFZ A;  1J1J A;  1HS7 A;  5C8Y E;  4HB5 A;  4LML A;  4LEU A;  4GTP A;  3AE4 A;  4AP2 A;  3Q15 A;  3MEK A;  2CXD A;  4YTP A;  4GZ3 A;  2VJ8 A;  3PS6 A;  1KZP A;  3AEA A;  3GN5 A;  4X64 T;  5BW8 C;  3RYH E;  4GYR A;  1U3D A;  3CHM A;  3B7T A;  1SZA A;  1D0Z A;  2XGM A;  4MRU A;  3C51 A;  4GTS A;  4LUN U;  3FWV A;  3CML A;  3PEU B;  2W62 A;  2J47 A;  5AAO A;  4MS6 A;  2I1J A;  4QKN A;  3E34 A;  4BSX A;  4GAA A;  3LY7 A;  3B7S A;  1O3X A;  4UWL A;  1HE8 A;  2CCQ A;  4GB9 A;  2BKG A;  4ABN A;  5AQ7 A;  2LE8 A;  3UQ4 A;  4AEZ C;  4I9E A;  3E32 A;  4N5Q A;  2E9X A;  4JUY A;  4WUY A;  3S2A A;  5FZQ A;  3AEE A;  1K1A A;  4JL0 A;  4YDO A;  4AQF C;  3C4Z A;  4DI3 A;  1Z6T A;  2LM9 A;  5FVL A;  3ZSS A;  5JRC A;  2YOE A;  3T1Y T;  4HOQ A;  1E96 B;  3D0T A;  4BT8 A;  4NPP A;  4UQZ A;  3RIU C;  3FEY A;  3L9T A;  2P9K G;  2DYR E;  4TUY E;  4GCO A;  4JEH A;  4XAX B;  2YEV C;  2XEH A;  3ZN3 A;  5FQ8 A;  2WZH A;  3CQX C;  4UVC B;  3P8C D;  3MJW A;  5C2Y A;  1D0Y A;  3ASN E;  2CBI A;  3ZYL A;  4H9S E;  3TL5 A;  2R02 A;  1H6P A;  3I4G A;  2R59 A;  3B57 A;  3DWL G;  4K5A B;  4AV7 A;  3KSQ A;  2FEZ A;  5FJY A;  5AQM B;  2VKJ A;  1MMA A;  2W00 A;  5AQL B;  2WXM A;  3LBX A;  3APC A;  4MFR A;  2BED A;  4MAL A;  3PRZ A;  5F5W A;  3F6Q A;  4ZI2 C;  4EOZ B;  2V8S E;  3UPV A;  3UTK A;  2V6Y A;  3N71 A;  1JWF A;  1SQM A;  2B0O E;  3E4B A;  4YSX A;  2LKH A;  1JUQ A;  2RP4 A;  3ZEF B;  5E75 A;  3DST A;  5AQG B;  4E7S A;  4K0K T;  3TWR A;  3RLF F;  3P4S A;  5AEN A;  1R8I A;  4KUM B;  1G8X A;  5AQT B;  1IHG A;  3G06 A;  2VYI A;  3IV0 A;  1KF6 A;  3UMV A;  4J8E A;  2V7J A;  4GTQ A;  1E90 A;  4UUC A;  3N5L A;  4HKA A;  5KDM C;  4PK6 A;  4DR4 T;  5HEU A;  1I6Z A;  2IC6 A;  4IDZ A;  5LG4 A;  5LMN T;  4DR5 T;  1XNR T;  4A1S A;  5LBM A;  4X65 T;  2CLY B;  1SZ9 A;  2VQF T;  3MYV A;  3H37 A;  4ZI2 D;  4LF7 T;  2BKN A;  3QNU A;  2GRR B;  3IBP A;  2WXI A;  3P7I A;  3UT7 A;  3KFW X;  5LJN A;  4CYM D;  2WXQ A;  3AG2 E;  5EYL A;  4PS3 A;  3TLW A;  2V5D A;  3ZUV B;  2L9B A;  4YND A;  4HOS A;  3IBE A;  4L2Y A;  2IO2 C;  2CHO A;  1ZEE A;  2WP9 A;  4EZH A;  3N9Q A;  3UT4 A;  1NA3 A;  4O1P A;  2JMK A;  1M7K A;  4G24 A;  2EIL E;  3SFE A;  3MXZ A;  1E8Y A;  2JEK A;  3Q73 A;  5JMN D;  3FH8 A;  3SFX A;  2ETA A;  3ZKJ A;  5DQW A;  4JI0 T;  2VKO A;  3RI5 A;  4B8C B;  3C5R A;  3BG0 B;  4HE8 A;  2HHH T;  1ZKE A;  5HWY A;  2LOS A;  4ME2 A;  4U3C A;  3AXJ A;  4ATG A;  4TWF A;  1OWP A;  4URK A;  4XZC A;  4Q69 A;  4DX5 D;  4I50 E;  4V3I A;  1KT1 A;  4N2S A;  4ZS3 A;  2V5F A;  5J2U E;  3RSE G;  2MYS A;  2DBA A;  1VCT A;  2LO6 A;  1N4Q A;  1S63 A;  3EUV A;  5KNG A;  2CBJ A;  3RIA A;  4HN9 A;  3TLU A;  2ZM0 A;  2X6I A;  4RG9 A;  3VU7 H;  4IGU A;  4CGW A;  2WM9 A;  1D8D A;  5FL1 A;  2DHR A;  3N2O A;  3IF8 B;  3RQU A;  2C5I T;  5A1L A;  4FHJ A;  2ZM2 A;  3X1D A;  4ZHQ E;  5FXZ A;  2M67 A;  3IA3 A;  1TJF A;  3VTX A;  4HFC A;  2CA5 A;  3AE2 A;  1K8K G;  5M4Y A;  3GZS A;  3BQK A;  3DSX A;  1Z3X A;  1U5P A;  4G2A A;  4AKL A;  2A3D A;  2RKK A;  4ILA A;  3OAW A;  4HFG A;  1FT2 A;  1JNR A;  2GRL A;  4KVM A;  2KND A;  3AG1 E;  4L7T A;  2EQX A;  1FMV A;  2VUR A;  1N4S A;  2ZMA A;  3HR0 A;  4BJM A;  2IJG X;  4DR2 T;  4FI5 A;  2IF4 A;  3LY8 A;  5FVK A;  2H6F A;  3EHN A;  3UU3 A;  5CFB A;  4HI9 A;  2UWJ G;  3C98 A;  2Q9Q C;  5G05 J;  3R7Q A;  1OCZ E;  2DVW A;  1N0R A;  1SE7 A;  4LER A;  5EIB E;  2LAH A;  4PAG A;  2AXZ A;  1BU9 A;  3ZC0 A;  2A72 A;  1YCS B;  4GZ5 A;  2V5C A;  5JR9 A;  2J4G A;  1N33 T;  1Z8U A;  2J8S D;  1MX2 A;  4EED A;  3E33 A;  1MMG A;  1Q2Z A;  4DV1 T;  4U2Z A;  3QC1 A;  2I0M A;  4YVO A;  4OFZ A;  4LMK A;  4OYK A;  4XKC A;  4LFC T;  2I1K A;  1WRD A;  2WS3 A;  1H0A A;  2ACZ A;  3UM3 A;  4CDM A;  2Q9Q D;  3QUJ A;  2WQ7 A;  4YT0 A;  1OED A;  3JC6 C;  4M7C A;  5FXV A;  2QC9 A;  5D66 A;  4QHO A;  3CEQ A;  1ZBP A;  3GN5 B;  4DPR A;  4FJY A;  2OA5 A;  1UX5 A;  4IRU A;  4XE0 A;  3CSF A;  3ZKR A;  2ODU A;  4DID B;  3LPZ A;  2W4X A;  5HEG A;  4YY3 T;  5HXS A;  1M62 A;  2ZM8 A;  4GTT A;  3ZJ2 A;  1NI1 A;  4RVB A;  3NBN B;  3JUE A;  3LJN A;  2XAF B;  4L0R A;  5FNV E;  5FQ4 A;  2R6G F;  4DV2 T;  2WXH A;  5AQK B;  1UJJ A;  2XCB A;  3CHP A;  3T8K A;  4ANX A;  4NUV A;  3AAA B;  4CT0 A;  3Q79 A;  2E9X B;  2PBI A;  1H2V C;  4HFI A;  4F6R C;  1N11 A;  2IFU A;  4GK5 E;  2XAG B;  1EDU A;  3TLS A;  5KJK A;  1XDO A;  1XNQ T;  4KXK B;  4HOT A;  1ZHC A;  3F31 A;  4KP3 C;  3AEC A;  2MTQ A;  3N9O A;  2NOX A;  5ARG A;  5JRC B;  3PDN A;  3I0O A;  4D10 C;  4A63 B;  2VKD A;  2K5B B;  5FY1 A;  1WFD A;  4EEC A;  4HS2 A;  2QYU A;  3AU4 A;  3KV9 A;  4QXC B;  4DBR A;  3LXU X;  3PH0 C;  4IDN A;  5ETW A;  4JEH B;  1YA0 A;  3D9O A;  1K1B A;  4ZEY A;  2M6B A;  4N3C A;  3G2V A;  2ILR A;  3LS8 A;  5BPP A;  3S7D A;  4HWF A;  1L0V A;  4G63 A;  3PUA A;  4F6R D;  2XM2 A;  3QWW A;  4HRL A;  3BG1 B;  4OAU C;  3IHR A;  5T8I A;  4EV6 A;  2PG8 A;  3AE6 A;  3D9I A;  5E0O A;  2KLQ A;  1HNZ T;  3JAD A;  1Z0P A;  3GMI A;  2KXP B;  3LBX B;  3VR8 A;  4OX9 T;  5E76 A;  3J9X 1;  3EU9 A;  3KBU A;  3FDH A;  4BAY B;  3U64 A;  2AXV A;  1GQE A;  2MHK A;  2V6Y B;  5LCW J;  2YU1 A;  4TZ4 C;  5ITZ F;  4O2A E;  1TNB A;  1W3B A;  3ABM E;  1TYQ G;  2PTF A;  2L6B A;  4JPS A;  1B89 A;  2PL2 A;  4JI8 T;  4ILU A;  3D9N A;  2BG9 A;  3QC9 A;  4APO A;  3O48 A;  3FUM A;  4YSZ A;  4ACK A;  4KHZ F;  3L17 A;  4HTE A;  4ASK A;  1MIY A;  4ANJ A;  4I1M A;  5ENN A;  2KIN B;  5G05 C;  4CRW A;  3RYC E;  4H7X A;  4ILB A;  4N3A A;  3N2K E;  5TAO A;  1ZB1 A;  2X0L B;  2XAH B;  2GW1 A;  1FIO A;  5EKQ D;  1XGW A;  2QYJ A;  2G0U A;  1IQR A;  3TWX A;  4TV9 E;  3S7F A;  2RA1 A;  1FT1 A;  4BEP A;  2GRN B;  3D9P A;  3UIO C;  3I5P A;  4A97 A;  4LF8 T;  1UG3 A;  3FTW A;  5FXX A;  2C0M A;  5EZY E;  2R5S A;  3U4T A;  3NVO A;  1MHQ A;  3QAQ A;  3K1S A;  4CXX A;  4J6I A;  4UEM A;  2AVP A;  3QJZ A;  3D9M A;  3E08 A;  1BI7 B;  4AM9 A;  2EHO A;  2WXJ A;  1IAP A;  5EID A;  3E22 E;  3UU8 A;  2X0Y A;  4JEU A;  1MZC A;  3GA8 A;  2A9U A;  5CMW A;  1L5J A;  3LY9 A;  5EIL A;  1W9R A;  2MAW A;  2PZI A;  3DSW A;  2MYO A;  5LFA A;  4JI3 T;  3C3Q A;  3ASD A;  4F1S A;  3RAU A;  5JDN A;  4YFS A;  1IBM T;  3AA6 B;  2V1D B;  5BMV E;  4JBW F;  1EYH A;  1N52 A;  4IYP A;  2XGS A;  4OVV A;  3PJA J;  1GW6 A;  1XZY A;  2NC9 A;  1LRZ A;  3ZPO A;  1SVX A;  1N54 A;  1WR0 A;  5AYW D;  3UQ7 A;  3AXJ B; 
#chains in the Genus database with same CATH homology
 3DPD A;  4XBF B;  5JDG A;  2NW9 A;  4BX9 A;  4AIF A;  2CHX A;  2J07 A;  3WXX A;  4F53 A;  3RRW A;  2J9Q A;  2XGO A;  4I2W A;  4DO0 A;  4GU5 A;  2Y6X A;  2HPL A;  1D1C A;  2L0T B;  3BQI A;  1FCH A;  3P1U A;  4HEA A;  3CHS A;  2E8I A;  2LSY A;  2X9X A;  3PDY A;  3A5X A;  5IYZ E;  3TGO A;  1Y64 B;  1LF8 A;  4H9Q C;  1IZN B;  3ETV A;  4QXB B;  2XTL A;  1PAQ A;  1P5Q A;  5EK3 A;  2WXO A;  4HXI A;  2X9H A;  4UIG A;  3LK2 B;  3W15 B;  3AS8 A;  2XQ0 A;  5ANR A;  4AXH A;  2XEV A;  4JZY A;  3C98 B;  5A7D B;  2MRI A;  2DI4 A;  3PE3 A;  3RRC A;  2L6J A;  1JWG A;  5HYA A;  5FZS A;  4N3B A;  4PS8 A;  1YKE B;  4UEL A;  2WXL A;  2KZ7 B;  3RK6 A;  5JR9 B;  3HKE E;  4O6F A;  3FUN A;  4E6H A;  3LJ3 A;  3H3A A;  2CLY C;  4ZI7 E;  2WMO A;  4G1T A;  4APF A;  5DBK A;  4DI4 A;  2KC7 A;  4DLQ A;  5BT1 A;  4JLE A;  2BTD A;  3KV6 A;  4PH4 B;  2X38 A;  3JYS A;  1WR6 A;  4H9R C;  4BX8 A;  3C4X A;  2I9C A;  2L0I A;  2UY1 A;  2KWI B;  3NZQ A;  4BA9 A;  4P0A A;  4JHK A;  2D5U A;  5LA6 E;  3I9Y A;  5HWX A;  3QWP A;  3JUI A;  3JQ1 A;  4AJW A;  4AY6 A;  4OK0 A;  3HDX A;  3ZLI A;  2X6H A;  2IOL A;  5L3E B;  1MMN A;  2RG8 A;  2VGY A;  1NAF A;  3HL6 A;  4PS7 A;  3FTU A;  4XIF A;  3QKY A;  4WW0 A;  2Y4T A;  3U78 A;  4U8H A;  4J8D A;  1NWM X;  5KJM A;  4NRH B;  3MKD A;  4AKI A;  3FUI A;  1U4Q A;  3RX6 A;  2DLR A;  2FF4 A;  4XI9 A;  4B8A A;  3PUG A;  1HG5 A;  2V7K A;  3IHY A;  5HAX A;  4EIW A;  4Y6W A;  4M3O A;  5LP0 A;  2FBN A;  2J4D A;  4WBN E;  2NTX A;  2KCV A;  1IJ6 A;  2C5J A;  4KT6 B;  3O1H A;  4C9B B;  4V1A v;  3CKD A;  4O4J E;  5JJ6 A;  1OWN A;  4TN7 B;  2V4L A;  4EXT A;  5EDS A;  4UVA B;  4IHJ E;  3LK3 B;  4GML A;  2I6H A;  4I1A A;  2IQC A;  4QFV A;  3TAX A;  2QA7 A;  2A2F X;  3MA5 A;  4DMV A;  2DCP A;  2Y4U A;  5AJD A;  4TV8 E;  3I3N A;  1UJK A;  4ADZ A;  4G2V A;  2WXR A;  4EB6 E;  4UWF A;  2JJ9 A;  1ELW A;  3OJA A;  1E8Z A;  1WAO 1;  4A55 A;  4X1K E;  4I4T E;  4BJN A;  2X6J A;  1H19 A;  4C0M A;  4CQI A;  2WBL A;  2WPV A;  2D2S A;  2R17 C;  3K9I A;  2ES0 A;  3UUL A;  3F2E A;  4U04 A;  3PNT B;  2IW5 B;  3ONX A;  2YQ8 A;  4ANW A;  3SZ7 A;  3FTY A;  3K3Q C;  2EHO B;  2W61 A;  1MND A;  3O1I A;  2OVF A;  4IE0 A;  3S4U A;  3CV0 A;  4JEU B;  3R84 B;  1TEZ A;  4C91 A;  3LKU A;  4WWO A;  4IE7 A;  4KZ0 A;  3FUF A;  4P29 A;  3FTV A;  3PU8 A;  2A5U A;  2LSU A;  4U07 A;  4PJM A;  4XZ4 A;  2Z6E A;  3TXN A;  5KJL A;  3UQ3 A;  3Q2M A;  1H6K A;  3L13 A;  2E9X C;  4F3V A;  2NTY A;  5FXW A;  1YW0 A;  2CFU A;  2X3M A;  4MHC A;  3WI3 A;  3CPZ A;  4EBA G;  3O4Z A;  1U3C A;  5DJQ C;  3KV5 A;  3N9P A;  3C4W A;  5FQ6 A;  3CX6 B;  4UF0 A;  3V5U A;  5LYJ E;  2HH7 A;  4GPK A;  5CMY A;  4RSY A;  1MNE A;  2D0T A;  3CQC B;  2J08 A;  3FY4 A;  1DVP A;  5FYM A;  3IHV A;  1ZV4 X;  3QAR A;  2LSJ A;  3OXL A;  3UT5 E;  2XPZ A;  5KJN A;  3FHE A;  1Z3Y A;  3EDV A;  3FU5 A;  2XHE A;  4KBM B;  3D9K A;  4O2B E;  4DVD A;  4I55 E;  3EJN A;  2Q9Q A;  1S94 A;  4CDR A;  3R7R A;  2LAI A;  2WXK A;  3LEW A;  1JPL A;  1IYG A;  5FY7 A;  1BR4 A;  4YJ3 E;  2PJQ A;  4PJJ A;  3B7U X;  3BQL A;  5EK4 A;  4ZI3 C;  3FUJ A;  4W9R A;  2VSY A;  2ZLY A;  2LEH A;  2VGX A;  2NXP A;  4GYW A;  3MA9 A;  2BUG A;  4PFO A;  4E7Z A;  3MZL B;  5JJ7 A;  5L3F B;  1WLX A;  2WQH A;  3CWZ B;  1Y8M A;  3BK9 A;  3FUL A;  4UI9 J;  2QGS A;  4WAF A;  4PFP A;  3URZ A;  4GYO A;  4FJO A;  2Y3A A;  2CWO A;  4X1Y E;  3IEG A;  3IKO B;  2IU1 A;  3VKG A;  2LSI A;  3FUH A;  1QSD A;  4PK5 A;  3CLJ A;  2VSO E;  1HG2 A;  3O1J A;  4FUL A;  2ZU6 B;  2E2E A;  2BF0 X;  5LJM A;  3PUS A;  3ZPJ A;  2UY1 B;  5LHG B;  2WAU A;  3L54 A;  1HZ4 A;  3NZP A;  3CVR A;  2L3L A;  1BR0 A;  4J8S A;  3NZS A;  2C0S A;  4TX5 A;  3M65 A;  2QY7 A;  3G2S A;  4PK4 A;  3FFL A;  2WWU A;  2C2L A;  3UT8 A;  1UCU A;  2NSZ A;  2LT3 A;  3SRZ A;  4AKH A;  3MZK B;  4MBQ A;  4NAC A;  4DBQ A;  3ZN0 B;  3ZVV A;  2K24 A;  4G26 A;  4AKR B;  3O4X E;  4AI6 A;  2XRZ A;  2KCK A;  5FTP A;  2XRY A;  4I6J A;  3ZXS A;  3IEE A;  3RRN B;  4B0Z A;  4CXY A;  1Y6I A;  3I4R B;  3RH3 A;  4WNK A;  2CG2 A;  3GZ1 A;  4KMO A;  2V26 A;  4O4L E;  3ASG A;  4MKT A;  4UV8 B;  2GRM A;  2NW8 A;  4IE6 A;  4U0U A;  4EZL A;  2W63 A;  2KWH A;  1TJC A;  3DTO A;  3QWV A;  5HXE A;  2VQ2 A;  2HO1 A;  3JC6 D;  2H7O A;  3RPU A;  2KAT A;  3QOU A;  1LVF A;  4KVO A;  5LGT B;  2V7M A;  2XPY A;  3ZHE A;  2X68 A;  5LHH B;  5IHY A;  5AFU L;  1SHZ C;  1YD8 G;  3KV4 A;  4LRZ A;  5AIJ A;  3LJC A;  4UV9 B;  5LHI B;  2VSX E;  2C0L A;  2KT9 A;  4ANV A;  5KX5 E;  5JR9 C;  2GK9 A;  5ANL A;  3ONK A;  3SGH A;  4FAD A;  4ANU A;  4EBA A;  3KDS E;  1NZN A;  2IAK A;  3LFM A;  2CXF A;  4A56 A;  2VSN A;  1QQE A;  2PM6 A;  3L08 A;  2CHW A;  4MLK A;  4L1B A;  3G2T A;  4ERR A;  4UI9 C;  4BT9 A;  2SPC A;  3FH5 A;  2P58 C;  4ZS2 A;  5LCY A;  3FU3 A;  4IE4 A;  5G04 J;  4JC8 A;  3QDN A;  4KBQ A;  1WM5 A;  2LHN A;  2V0P A;  1XNF A;  1H2U A;  3K3O A;  2MOW A;  1UX4 A;  1OXZ A;  2UXX B;  3ML9 A;  3SHF A;  1MIW A;  1S35 A;  1EF1 C;  4H63 V;  4FA6 A;  3LK4 2;  3B7R L;  3PEV B;  2N2N A;  4KYO B;  1D1B A;  2I2O A;  2VWA A;  2D0U A;  4L9I A;  2VK9 A;  3FEX A;  3ZCI A;  4YVQ C;  1ELK A;  3CHR A;  4IIJ E;  3GWH A;  4ISS A;  2LSK A;  3ZMS B;  3ASF A;  4UF0 B;  4UWH A;  2FO7 A;  4F7A A;  2I59 A;  2L8K A;  1G73 A;  4GA2 A;  3LVR E;  3Q5M A;  1FEW A;  3VTY A;  3CVV A;  3DJB A;  3UUX A;  1BR1 A;  1CUN A;  2KZT A;  3RU0 A;  2XHE B;  3AB3 B;  3CHQ A;  4A3V A;  4J0U A;  1BR2 A;  4CCA A;  2YHC A;  3EIQ C;  5D0Q D;  3GW4 A;  4UWK A;  3Q49 B;  2X6F A;  4X20 E;  4IN3 B;  4I43 A;  4JHR A;  3HKB E;  3VLE A;  3U66 A;  4O4H E;  4B94 A;  2HM8 A;  2YHE A;  2VGX B;  2OOE A;  1HTJ F;  1X79 A;  3P2B A;  2XQY A;  1E7V A;  2ION A;  3MGB A;  5J90 A;  3FTZ A;  5KCM A;  3LYA A;  5G55 A;  3HVE A;  2X51 A;  3OYX A;  2RD0 A;  1E8X A;  2CXL A;  4OHF A;  3PUQ A;  3AVR A;  3O9X A;  2M63 A;  3KAE A;  4EYU A;  2JPF A;  4CGV A;  4PW8 A;  2MBG A;  4DMW A;  1IQU A;  1BPO A;  4L5G A;  2LSG A;  1NP7 A;  3AAE B;  5FQ7 A;  3Q5W A;  3L3P A;  3RRM B;  5L2L A;  3N9L A;  2NP9 A;  2IOS A;  2EHO C;  3U3W A;  3QB2 A;  3S7J A;  3I9W A;  1VOM A;  4J8F A;  2CWY A;  5LGU B;  4N39 A;  3U3I A;  3CK9 A;  2CE7 A;  4HGA A;  2FUL A;  4L23 A;  4XX5 A;  1FVF A;  2XUE A;  5EX3 A;  1AJ3 A;  5G04 C;  4G23 A;  3NQP A;  3T5V A;  4B89 A;  4MLP A;  3KS2 A;  3ETU A;  3ZN1 B;  5JHA A;  3DP7 A;  2VTB A;  3L6A A;  1HFA A;  5JJT A;  3G2U A;  3ANW A;  5JDM A;  4B6X A;  3AA1 B;  4OVU A;  3ZMT B;  3FBZ A;  3EDT B;  3PUJ A;  3NBX X;  4FLH A;  3D3M A;  1E1H B;  5J08 A;  4C0E A;  2X66 A;  3CVP A;  4FLB A;  5HXH A;  3MCX A;  1US7 B;  4BFR A;  3C50 A;  2HR2 A;  3PUK A;  3SD5 A;  4FU3 A;  4UI9 K;  4AQF A;  3VHL A;  5FMN A;  5C1D A;  3RYF E;  1B7T A;  3HI2 A;  3RC3 A;  2JLB A;  4AY5 A;  3MAC A;  4QWN B;  3N9N A;  4NUU A;  2BVL A;  1HS6 A;  1UW4 B;  3D9J A;  2JMH A;  3ZHE B;  4L2L A;  5M72 A;  3T8M A;  3VLD A;  3VLF A;  2PM7 A;  3ZIM A;  3ZC1 A;  3OXF A;  5T3R A;  2DNX A;  5DIZ A;  5LBQ B;  4DK5 A;  4TRQ A;  2JQQ A;  3E0Z A;  3L22 A;  3NRY A;  3AU5 A;  3PZD A;  3CIA A;  3AA0 B;  2CM0 A;  3UFE A;  2WXG A;  5BV1 A;  4KMC A;  4GYS A;  3CST A;  1S0P A;  5BUZ A;  2HYZ A;  4CEM A;  1H2T C;  5HXR A;  4I6E A;  3SS1 A;  5LNK A;  2C5K T;  4WND A;  5T4Y A;  1X5B A;  3ASH A;  2CFZ A;  3FH7 A;  5A6C A;  4FC8 A;  3CHO A;  3HYM B;  4NUR A;  1ZU2 A;  4GK0 E;  3Q9D A;  4CI3 B;  5HXC A;  3TKL B;  3APF A;  2AW6 A;  2WSS V;  5KMG P;  3J7Y q;  5L3C B;  3FHN A;  4TUU A;  1OWL A;  3APD A;  4LCT A;  4CT4 A;  3C64 A;  3FUE A;  3CVX A;  4U0S A;  1HO8 A;  4UQX A;  5BNW A;  4EPZ A;  3CX8 B;  4P0B A;  3V5S A;  3ZYQ A;  4GA0 A;  4N2Q A;  2N9D A;  3CR3 A;  3CVQ A;  2AXU A;  4M1P A;  3K8P C;  5GON E;  2WXP A;  4PJN A;  3KEZ A;  4IST A;  5JDF A;  4PUC A;  3PUR A;  3QK0 A;  3RJV A;  3UUM A;  1QNF A;  4ILH B;  3LCA A;  1E7U A;  5AJL A;  2B1E A;  4DJA A;  4K0U A;  5FT9 A;  3RKV A;  3S7B A;  2NW7 A;  5LOZ A;  3UUX B;  2LSV A;  5D0O D;  2KZT B;  5HQ8 A;  4EZK A;  2FI7 A;  5L3D B;  2Y8D A;  4R7L A;  3AVS A;  2P9B A;  4N78 D;  3PTR B;  1VRB A;  3FTS A;  3R6N A;  2X9W A;  4TV3 A;  1A17 A;  3KD7 A;  4X1I E;  1OWO A;  4I43 B;  5H6R B;  4JW1 A;  4I17 A;  3CVW A;  1YKH B;  2LNI A;  2DWG A;  2BDE A;  4O4I E;  2N1G A;  3B13 A;  2E9X D;  3HVE B;  4ILI A;  4PDX A;  4U0Z A;  2CG3 A;  5CCM A;  5JQG E;  2WXF A;  3NF1 A;  3N2G E;  3MV2 B;  4EAH A;  3TG5 A;  1IJ5 A;  3JCK C;  5J1G A;  3FUK A;  1KNZ A;  2J49 A;  3PRE A;  5JDQ A;  3CKB A;  2JRK A;  2J1D G;  4GA1 A;  3HHM A;  4GMJ A;  1INZ A;  4RG6 A;  1QUU A;  2XPI A;  3ZMU B;  4BTB A;  5L3B B;  5JDL A;  5EX0 A;  1OWM A;  1HCI A;  2XAJ B;  4ZOL E;  3ENE A;  3AS5 A;  3EUH A;  4A3T A;  5DAB A;  4DND A;  1WYB A;  3QNK A;  3WAK A;  4WWN A;  4IUL A;  2VTB B;  4UXN B;  4Y6C A;  2CEA A;  3PU3 A;  3ANW B;  5JH7 E;  3CVN A;  2VAS A;  4IE5 A;  4HOR A;  5LGN B;  5LX8 A;  5H6Q B;  4ZI3 D;  3KVA A;  3RYI E;  4WWP A;  2IC9 A;  2VKH A;  3WAJ A;  4OYS A;  4BTA A;  2PFV A;  4I6G A;  2XAQ B;  5LOV E;  3EIJ A;  2V7L A;  2W0G A;  4GCN A;  5DQV A;  4CDN A;  4KZC A;  3HKC E;  5EK2 A;  3MKQ A;  2AWI A;  5F8P A;  1ELR A;  2OND A;  3ZJ1 A;  1H7C A;  3HIZ A;  3FBL A;  3LG7 A;  3OBV E;  1UN8 A;  4XKB A;  4H63 H;  2BZB A;  5ARF A;  4EZ4 A;  3T5X A;  3ML8 A;  4QX8 B;  3EHM A;  4WNG A;  4JA9 A;  3FU6 A;  4EYY R;  3LDZ A;  5CA0 E;  5HI7 A;  2BVM A;  4K0R A;  3SWH A;  3OKQ A;  1FMW A;  1MMD A;  3ZMZ B;  2CMR A;  3SNX A;  3CK7 A;  5FY0 A;  4I9C A;  4Z8X A;  5CCL A;  4UQY A;  4O8S A;  3CK8 A;  2DCF A;  3T8O A;  4G11 A;  4BWR A;  1NA0 A;  3OTN A;  4FP7 A;  4AVX A;  5JHB A;  3ZW3 A;  4CXW A;  2J4B A;  3AA7 B;  4JA7 A;  4H9N C;  3FU0 A;  5G2N A;  3Q47 B;  3Q5X A;  4Q94 A;  4Q96 A;  5J2T E;  4EZJ A;  3QK6 A;  2HPJ A;  2ACX A;  3GZ2 A;  3N9M A;  4WNF A;  1SA0 E;  3ESL A;  4J2C A;  3ESK A;  2V7I A;  4EQF A;  4BY6 A;  1V9D A;  2WQ6 A;  3D9L A;  2YIN A;  1UN9 A;  2KCL A;  3G2W A;  1KLX A;  3RO2 A;  3UUN A;  3HA4 A;  4XI0 A;  3F57 A;  3FUD A;  4YLH A;  5F3J A;  2WXN A;  4AOF A;  1E8W A;  1VDY A;  1OWA A;  3ZYM A;  3I0Q A;  4FHK A;  2LOP A;  3ZMV B;  3KVB A;  2VL8 A;  4WNE A;  2H3R A;  3TG4 A;  4GYY A;  4I2Z A;  4HFV A;  3R9A B;  3L09 A;  1D1A A;  1DNP A;  4K03 A;  1EPU A;  4DLO A;  3Q4A B;  4H9P C;  4ACL A;  3RC8 A;  2PQR A;  2XAS B;  3DBS A;  3PE0 A;  3KIN B;  3NZU A;  4UVB B;  3MX3 A;  2NWB A;  4PJL A;  2DIW A;  2E0I A;  1MIV A;  3CKC A;  1HX8 A;  1LVK A;  4GZD A;  3CVY A;  3FP3 A;  2J09 A;  3TJP A;  3RIB A;  5ADX L;  3RO3 A;  3FXE B;  4U72 A;  2QFC A;  1QZ2 A;  2Q7F A;  3HKD E;  3ZEF A;  3CX7 B;  4JVS A;  2Q9Q B;  4QX7 B;  3SBS A;  2ODV A;  3BEE A;  5LXT E;  3ZGQ A;  3EVY A;  3L16 A;  5L3G B;  4JHJ A;  1KT0 A;  4G25 A;  5CA1 E;  1PC2 A;  3PE4 A;  5LP6 E;  3CVU A;  4CZZ B;  1HF8 A;  3MV3 B;  2KMF A;  3AAI A;  1MQS A;  3RRU A;  2X67 A;  2A4Z A;  2DWK A;  4GOU A;  3UX4 A;  4UWG A;  3KBT A;  3VKH A;  4C90 A;  4WBO A;  5JDH A;  5CHE E;  1WYC A;  4YJ2 E;  3ZRH A;  2PQN A;  4PNI A;  2WVI A;  2K9A A;  4GIW A;  2MOZ A;  3EDU A;  4N5C A;  4HVB A;  3ZFW A;  3U9W A;  2WMN A;  5FZR A;  1EZ3 A;  3ONL A;  1LKX A;  1HU3 A;  4I1O B;  3MK7 C;  2OVB A;  4A1G A;  3SF4 A;  4YHJ A;  1PY1 A;  3PNL B;  2YNQ A;  5FWQ A;  3MJX A;  3MKR A;  1HH8 A;  4GZ6 A;  4AQG A;  4CI1 B;  1OUV A;  2H7V C;  4ILG A;  3MKQ B;  3OYZ A;  2LHR A;  3PVL A;  1WY6 A;  2EHO D;  4AKG A;  1D0X A;  3JQ0 A;  1FVH A;  2OV8 A;  5LCW C;  4CI2 B;  3K3N A;  1KK7 A;  4P09 A;  4U74 A;  2Y48 B;  3FTX A;  5A23 A;  3ZCJ A;  2L9Q A;  4QXH B;  2YU2 A;  4GZC A;  4U63 A;  4E85 A;  4HLE A;  3LVQ E;  4NQ0 A;  3TXM A;  3AS4 A;  2UXN B;  4H9O C;  2X6K A;  4H7Y A;  2X9Y A;  2XCC A;  2VB6 A;  3OXG A;  3RKO A;  3SOL A;  3SI5 A;  3SBT B;  4FJZ A;  4AXP A;  3CGH A;  1HXI A;  5BV0 A;  3ZYK A;  1T98 A;  3ULQ A;  2YK0 A;  2WB2 A;  2GGF A;  3FB2 A;  5FP3 A;  2K48 A;  5JVD E;  4HOU A;  2LJL A;  2KM4 A;  3FXD B;  5JRE A;  4JXT A;  2CHZ A;  3CQG B;  3CVL A;  3GYZ A;  3NRX A;  4OYJ A;  5CB4 E;  3I1A A;  3SFZ A;  1HS7 A;  5C8Y E;  4LEU A;  4AP2 A;  3Q15 A;  3MEK A;  2CXD A;  4GZ3 A;  2VJ8 A;  3PS6 A;  3GN5 A;  5BW8 C;  3RYH E;  4GYR A;  1U3D A;  3CHM A;  3B7T A;  1SZA A;  1D0Z A;  2XGM A;  4MRU A;  3C51 A;  4LUN U;  3FWV A;  3CML A;  3PEU B;  2W62 A;  4MS6 A;  2I1J A;  4QKN A;  4BSX A;  4GAA A;  3LY7 A;  3B7S A;  1O3X A;  4UWL A;  1HE8 A;  2CCQ A;  4GB9 A;  4ABN A;  2LE8 A;  4AEZ C;  4I9E A;  4WUY A;  2E9X A;  4JUY A;  3S2A A;  5FZQ A;  4JL0 A;  4AQF C;  3C4Z A;  4DI3 A;  1Z6T A;  2LM9 A;  5JRC A;  4HOQ A;  1E96 B;  3D0T A;  4BT8 A;  4UQZ A;  3FEY A;  4TUY E;  4GCO A;  4JEH A;  4XAX B;  2YEV C;  3ZN3 A;  5FQ8 A;  3CQX C;  4UVC B;  3P8C D;  3MJW A;  5C2Y A;  1D0Y A;  3ZYL A;  4H9S E;  3TL5 A;  3I4G A;  2R59 A;  3B57 A;  4AV7 A;  2FEZ A;  5FJY A;  2VKJ A;  1MMA A;  2W00 A;  2WXM A;  3APC A;  3LBX A;  4MFR A;  4MAL A;  3PRZ A;  4ZI2 C;  4EOZ B;  2V8S E;  3UPV A;  3UTK A;  3N71 A;  1JWF A;  1SQM A;  3E4B A;  1JUQ A;  2RP4 A;  3ZEF B;  5E75 A;  4E7S A;  5AEN A;  4KUM B;  1G8X A;  1IHG A;  2VYI A;  3UMV A;  3IV0 A;  4J8E A;  2V7J A;  1E90 A;  3N5L A;  4HKA A;  5KDM C;  4PK6 A;  2IC6 A;  4IDZ A;  5LG4 A;  4A1S A;  5LBM A;  2CLY B;  1SZ9 A;  3MYV A;  3H37 A;  4ZI2 D;  3IBP A;  2WXI A;  3P7I A;  3UT7 A;  3KFW X;  5LJN A;  2WXQ A;  4PS3 A;  2L9B A;  4YND A;  4HOS A;  3IBE A;  4L2Y A;  4EZH A;  1ZEE A;  3N9Q A;  3UT4 A;  1NA3 A;  2JMK A;  4G24 A;  3MXZ A;  1E8Y A;  2JEK A;  3FH8 A;  5DQW A;  2VKO A;  4B8C B;  3BG0 B;  4HE8 A;  1ZKE A;  5HWY A;  2LOS A;  4ME2 A;  4ATG A;  1OWP A;  4URK A;  4XZC A;  4Q69 A;  4I50 E;  4V3I A;  1KT1 A;  4N2S A;  4ZS3 A;  2V5F A;  5J2U E;  2MYS A;  2DBA A;  2LO6 A;  4HN9 A;  2ZM0 A;  2X6I A;  4RG9 A;  3VU7 H;  4IGU A;  4CGW A;  2WM9 A;  2DHR A;  3N2O A;  3IF8 B;  2C5I T;  5A1L A;  4FHJ A;  2ZM2 A;  4ZHQ E;  5FXZ A;  2M67 A;  1TJF A;  3VTX A;  2CA5 A;  5M4Y A;  3GZS A;  3BQK A;  1Z3X A;  1U5P A;  4G2A A;  4AKL A;  2A3D A;  3OAW A;  4HFG A;  2GRL A;  4KVM A;  2KND A;  4L7T A;  2EQX A;  1FMV A;  2ZMA A;  3HR0 A;  4BJM A;  2IJG X;  4FI5 A;  2IF4 A;  3LY8 A;  3EHN A;  2UWJ G;  3C98 A;  2Q9Q C;  5G05 J;  3R7Q A;  4LER A;  2LAH A;  4PAG A;  2AXZ A;  3ZC0 A;  2A72 A;  4GZ5 A;  5JR9 A;  1MMG A;  3QC1 A;  4YVO A;  4OFZ A;  4OYK A;  4XKC A;  2I1K A;  1WRD A;  1H0A A;  4CDM A;  2Q9Q D;  3QUJ A;  2WQ7 A;  3JC6 C;  5FXV A;  4QHO A;  3CEQ A;  1ZBP A;  3GN5 B;  4DPR A;  4FJY A;  2OA5 A;  1UX5 A;  4IRU A;  4XE0 A;  3CSF A;  2ODU A;  3LPZ A;  5HXS A;  2ZM8 A;  3ZJ2 A;  4RVB A;  2XAF B;  4L0R A;  5FNV E;  5FQ4 A;  2WXH A;  1UJJ A;  3CHP A;  2XCB A;  4ANX A;  4NUV A;  3AAA B;  4CT0 A;  2E9X B;  2PBI A;  1H2V C;  4F6R C;  2IFU A;  4GK5 E;  2XAG B;  1EDU A;  5KJK A;  4KXK B;  4HOT A;  1ZHC A;  3F31 A;  4KP3 C;  2MTQ A;  3N9O A;  2NOX A;  5ARG A;  5JRC B;  3PDN A;  3I0O A;  4D10 C;  2VKD A;  2K5B B;  5FY1 A;  4EEC A;  4HS2 A;  3AU4 A;  3KV9 A;  4QXC B;  4DBR A;  3LXU X;  3PH0 C;  5ETW A;  4JEH B;  1YA0 A;  3D9O A;  4N3C A;  3G2V A;  2ILR A;  3LS8 A;  5BPP A;  3S7D A;  4G63 A;  3PUA A;  3QWW A;  3BG1 B;  3IHR A;  5T8I A;  2PG8 A;  3D9I A;  5E0O A;  2KLQ A;  1Z0P A;  3GMI A;  2KXP B;  3LBX B;  5E76 A;  3J9X 1;  3FDH A;  3KBU A;  4BAY B;  3U64 A;  2AXV A;  2MHK A;  5LCW J;  2YU1 A;  4TZ4 C;  4O2A E;  1W3B A;  4JPS A;  1B89 A;  2PL2 A;  4ILU A;  3D9N A;  3QC9 A;  4APO A;  3O48 A;  3FUM A;  4ACK A;  3L17 A;  4HTE A;  4ASK A;  1MIY A;  4ANJ A;  4I1M A;  5ENN A;  2KIN B;  5G05 C;  4CRW A;  3RYC E;  4H7X A;  4N3A A;  3N2K E;  5TAO A;  2X0L B;  2XAH B;  2GW1 A;  1FIO A;  5EKQ D;  1XGW A;  2G0U A;  1IQR A;  4TV9 E;  3S7F A;  2RA1 A;  3D9P A;  3I5P A;  1UG3 A;  3FTW A;  5FXX A;  2C0M A;  5EZY E;  2R5S A;  3U4T A;  3QAQ A;  1MHQ A;  4CXX A;  4J6I A;  4UEM A;  2AVP A;  3QJZ A;  3D9M A;  3E08 A;  4AM9 A;  2EHO A;  2WXJ A;  1IAP A;  3E22 E;  4JEU A;  3GA8 A;  5CMW A;  1L5J A;  3LY9 A;  2PZI A;  5LFA A;  3ASD A;  4F1S A;  5JDN A;  4YFS A;  3AA6 B;  2V1D B;  5BMV E;  1EYH A;  1N52 A;  4IYP A;  2XGS A;  4OVV A;  1GW6 A;  2NC9 A;  1LRZ A;  3ZPO A;  1N54 A;  5AYW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...