2WMNA

Structure of the complex between dock9 and cdc42-gdp.
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
423
structure length
403
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEAHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
total genus 152
structure length 403
sequence length 423
ec nomenclature
pdb deposition date 2009-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wmnA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wmnA01
3VHLA 2WM9A 2YINA 3B13A 2WMOA 2WMNA
chains in the Genus database with same CATH superfamily
2MYSA 4YTPA 4U72A 1K8KG 3NBNB 4BTAA 1HO8A 5B1AE 4DI3A 5AQNB 4YT0A 3NB2A 4YXDA 3I5PA 5FXXA 1NL4A 3D9LA 2GW1A 5L3FB 3LFMA 2OOEA 4WNKA 2P2CP 3CKDA 4LSZE 2IY0C 5D2MC 1LVKA 3UI2A 5AFUL 3UFGA 2J09A 3HXDA 1LTXA 2NW8A 1VOMA 4XBFB 4DUYT 3TXNA 3ZT7A 3IHRA 4LFCT 3KVAA 1MQSA 4JZYA 3AB3B 3UTKA 1UUSA 3RRCA 1MJ0A 3B5MA 2XRYA 3MJXA 3EHRA 3B7BA 3WXXA 2AE9A 3R7RA 3AS4A 1HS6A 2WDRA 4I43A 1HE8A 5LBMA 4AVXA 1FPPA 2CPTA 4GMLA 4JI5T 2XZTG 5LXTE 3Q4AB 3SFXA 4TWHA 1OEDE 4GYSA 5LBQB 2MHKA 3AS5A 5LX8A 3TJPA 2WSSV 2LOSA 1IBKT 1OEDA 3MKDA 2KMFA 4COFA 3V31A 4HKAA 3AG1E 4KBQA 4APOA 4KXKB 2OCCE 2LSJA 3ABME 4CGWA 4HRLA 2XQ7A 4EB6E 3M3ZB 2NWBA 3ZCIA 2GRPB 3MX3A 4GCNA 1H2UA 1UJKA 4AKGA 2WM9A 3ZMVB 2DCFA 3VU7H 3W9GA 2WVIA 5AQPB 2XASB 4A55A 3AA7B 3D9PA 2JRKA 4FJOA 3G2WA 3FDHA 5IHYA 4J8FA 2V1DB 3EUHA 1FVHA 3SNXA 1N9AA 1S0PA 1T8BA 3K1SA 2IIUA 3KD7A 2CBJA 4BJMA 3ZGQA 3ZMUB 3L8RA 4EOZB 2WS3A 3Q9DA 4ASKA 4ZI7E 3KAEA 2BKNA 2BEDA 4QH1A 3TLSA 5LCWJ 2BDEA 2X9HA 1N4RA 3ZYMA 4TXQA 4TV3A 1EYHA 4CI3B 2OLTA 1UX5A 5EX0A 2A72A 4BETA 4XKCA 3UM0A 2CE7A 2XTLA 1N33T 4Q96A 2WB5A 5LP6E 4UQZA 1J1JA 4JHKA 1FMWA 3L17A 2WXMA 3N2GE 2IC9A 2C5KT 3AXJA 3T8OA 4LF9T 1SA4A 4GZ3A 1UW4B 4JVSA 3RX6A 2M67A 2IOLA 3FWVA 4M1PA 2HN2A 3ZSTA 3HVEA 4LFBT 1JCQA 4RVBA 5ENTD 5LGNB 4CT0A 2UXDT 2V0PA 3N9QA 1HNZT 4DR7T 4YSYA 5HXEA 1N54A 3X2QE 5BXOA 4O4HE 4FULA 1O3XA 4C0EA 2E5VA 4BAYB 2VQET 3TLVA 4RQIA 4AOFA 4O2AE 1G8XA 3G2VA 1SUMB 2P9KG 4AP2A 4B0ZA 5CHEE 3EHQA 3OYZA 4L9PA 2AWIA 3KEAA 2J1DG 1BI8B 4HLEA 3ZPOA 1NI1A 5CMWA 1G73A 3CK8A 1U4QA 3HRAA 3CVXA 3DP7A 3S7FA 4DI4A 2W2UA 1HNXT 3ZHEB 4CGVA 4F3VA 3ML8A 4AY5A 4G2AA 5HRYA 4B3RT 3AAIA 4EEDA 2B76A 5FY0A 1E7VA 3P4WA 4OVUA 3QOFA 4PS8A 5FJYA 3OXFA 2VQFT 3RIFA 3SBTB 1XMQT 5KNGA 2VGEA 3FTWA 3GYZA 3AE3A 3W9FA 3FUNA 2BG9A 3PUKA 4K5CA 3AECA 3IEEA 4GK0E 4GOUA 2JPFA 4IE4A 2UXCT 4HWHA 3MZKB 2UUAT 2W00A 3U3WA 4E6HA 2OVBA 3EIQC 4I9CA 3ISMC 2LNIA 2JQKA 5BV0A 4L0RA 2W4XA 3RYIE 2LAHA 4DV1T 3ML9A 4YY3T 3VLFA 3NF1A 1O1RA 1ELRA 5AQIB 3Q5XA 5T3RA 2HM8A 4YDEA 3AVRA 3C50A 4BEPA 4AIFA 4JEUA 3FZLB 4N5QA 3DPDA 1YA0A 3PREA 4UWHA 4H9QC 3D9NA 1NA3A 3RKVA 3E08A 2F37A 2NC9A 3FTSA 3PJAJ 2QA7A 4DUZT 1BR2A 1MIWA 2IC6A 1RZ4A 4JHRA 4D10C 4Q69A 2DWKA 4UEMA 2V5DA 2ETAA 2JABA 4I2ZA 1J5WA 5B1BE 2RKKA 4PDXA 3JAEA 3SWHA 2V8SV 3NZQA 5AQSB 2WU2A 2XJ7A 1OWNA 3CHOA 2LSYA 4QHOA 3V79K 4NACA 1D9SA 2XAHB 4LNGA 2P9PG 3CX7B 3FH8A 3ONXA 3TLUA 1TJFA 3GZSA 4MLPA 2W62A 3D9OA 2J8SD 3CVNA 3N9NA 4YTMA 3DXMG 3Q75A 4J8YA 4O6FA 2WDQA 3D9IA 3KSQA 1JPLA 5DQWA 4KVOA 2XZEA 1Z3XA 4H7YA 4LNUD 2N1GA 2VTBB 5JDHA 2IMLA 2X0LB 2L9BA 3F57A 5HCJA 4U31A 4J8DA 3ZIMA 2LSKA 4PW8A 4JPSA 2FO7A 2J07A 3QKYA 3ZRHA 3RIUA 3IF8B 2LOPA 3ZNGA 4N3CA 2XAJB 3RIAA 3ZHEA 4NRHB 3FUJA 2CRBA 2HO1A 5KX5E 1PAQA 3PS6A 4JA9A 3DWLG 5CGMA 2ZM6T 3MGBA 3CHQA 2XAFB 2XENA 3DSSA 2H3RA 4ATGA 3ZFWA 3TAXA 2K48A 4IDOA 1AJ3A 3HKBE 5FIOA 2PZIA 2V7IA 4ME2A 3TWRA 4O2BE 1W0AA 5JREA 3PH0C 1JNRA 2XM1A 1WRDA 3IBPA 4L1BA 4NUVA 4U0UA 2MTQA 4J2CA 2WXIA 4FHKA 3JUIA 1LVFA 5FZQA 2WZHA 3MACA 4QX8B 2YU2A 2LXLA 1MHQA 2XQ5A 1KT1A 3EDVA 3ZC1A 4GA0A 3UKUG 3U66A 5JDNA 3LEWA 3SHFA 1QQEA 4DR3T 2YKSA 4J7WA 5ENPD 3ZU7B 4CI2B 2V8SE 4TXRA 4U0ZA 4JD2G 4YSXA 2BKGA 3RU0A 3PE0A 4DX7D 3CEQA 3H37A 4H63H 5EYLA 2R6GF 2DCPA 1YCSB 4J6IA 4UVAB 3PUJA 3EHZA 4GZ6A 3URZA 3MV3B 3N9OA 3L9TA 5LG3A 2LLYA 1NEKA 4ILBA 2J4BA 1QNFA 4U8YD 4FC8A 2XCCA 1N11A 3SOLA 1E8YA 2YDQA 2XUEA 2E9XA 2VL8A 4B6XA 3P4RA 3CLJA 2YN6A 4EV6A 3CVWA 5CMYA 3CMLA 2HH7A 2SPCA 4UWFA 4UXNB 1V9DA 3FP3A 2WMOA 4YLHA 4U63A 2LXMA 3NQPA 4DV4T 3J7Yq 3EVYA 2V7LA 4A97A 3D9HA 4GPKA 3AG2E 4LG6A 2XAQB 5KNHD 3KV9A 2A5UA 4ZHBA 1TNYA 1TJCA 4CRWA 4Z91A 4EIWA 1S94A 3J5QB 2FUPA 2VK9A 2YDSA 1N0QA 2C2LA 3B95A 1D8DA 3UINC 1ZP0A 3NKZA 3LSVA 5BT1A 2W63A 3HG0D 5JDLA 2XS1A 3P4SA 4FA6A 2LUHA 4ACKA 2Y3AA 1OCRE 4WWOA 1BU9A 3UM2A 2WXOA 3M65A 3SD5A 5KBAA 1UN8A 2CHXA 2GRMA 3P4PA 3B57A 3KV4A 4APFA 4TN7B 1D1BA 1UGOA 3UKRG 2Y4TA 4DX6D 2EHOD 3VR8A 2FJAA 4OAVB 2CHWA 2J9QA 4FI5A 3RPUA 2XQ9A 1T72A 1U3CA 2ETBA 1OEDC 3QC9A 2XQAA 3PUGA 2ACXA 1TNZA 4I55E 2PQNA 1A17A 4WWNA 2BZBA 2DBAA 3QWVA 1N4PA 2YOEA 2QYWA 1DCQA 4ZI2D 1A5EA 4AIUA 5JDMA 4EYUA 3D9KA 3ASHA 3PZ3A 3TGOA 4CI1B 1WR0A 4AV7A 2GK9A 3IXEA 3FZHB 3PE4A 2VGXA 5LG4A 4U2ZA 4UF0A 4TV8E 2HPJA 3UM1A 4KP3C 4EGWA 1WYBA 1XMOT 3QJZA 3Q9NC 1H2TC 3FTYA 3CKCA 1XWMA 2YHEA 3LY8A 4GA1A 2MOWA 2AXDS 3VHLA 1ZOYA 1MYOA 1UJJA 2H6IA 1N95A 3QWWA 3ANWB 2AXVA 3I1AA 4CDRA 2ZU6B 3IEGA 3NOCD 2KC7A 3H3MA 3MJWA 2XPIA 4F6RD 3OVUA 3HKEE 3FTXA 1WM5A 5FXZA 3Q15A 3QNKA 2AXZA 4Y6CA 5C2TA 4JXTA 1Y64B 1FT1A 3HKDE 2OV9A 4P0BA 5LNKA 2D9DA 2KZTA 2A5EA 3UULA 3HHMA 2BS4A 1MIYA 1HG5A 2FBNA 3T5XA 1JWGA 3ETUA 3JUEA 3ZEFB 2Y48B 3CV0A 4QX7B 5LMNT 4GMJA 4K5AB 1ZV4X 4G23A 3O1IA 5EILA 3T8MA 3R84B 2IONA 1W0BA 2ZXWE 4NURA 2WXJA 3B13A 4X1YE 3FZKB 4GAAA 4C0MA 3K3QC 2PQRA 1WR6A 2WBLA 3KEZA 5EK3A 3O1HA 1IAPA 3R6NA 5BV1A 3UT4A 4IE6A 4BERA 3E34A 3Q49B 4LMLA 5ITZF 4PJNA 4N2QA 2BG9E 4CXWA 5CJ5A 3ZN0B 2R2LA 3F6QA 3PNTB 4F53A 1WFDA 1H7CA 5FKYA 4AQGA 4YHHT 2G0UA 3OTNA 3LXUX 5IYZE 5LYJE 3NVOA 3DSWA 4HBDA 2YU1A 5AQFB 5LOZA 3B7UX 1MMNA 5ENOD 4RSYA 3UT7A 4IGUA 3AJIA 5HEHA 5HAXA 2L0IA 1YYHA 3BQKA 2ZM8A 2N9DA 4W9RA 3ZYQA 3PZ2A 2X51A 2E0IA 4JA7A 1NA0A 4I0UA 1RW2A 2NR4A 1EDUA 4U96D 3PEVB 5LJNA 2AVPA 4HOSA 3MKQB 3PU8A 3O4XE 1KLXA 3NZPA 3PRZA 5ANRA 4DIDB 1MX6A 1B89A 4FJYA 2I59A 4CT4A 4EECA 4A98A 3A7MA 2CM0A 4QWNB 1FVFA 5CBOA 2JQQA 3D0TA 4HFCA 1BLXB 3C4ZA 5HEJA 4HWIB 3AEAA 2XQ4A 4JUYA 3Q5DA 2X6KA 2BVLA 3R9MA 4ANXA 5DBKA 3ZXSA 1E7UA 5LA6E 5CERB 3SRZA 1E2AA 2OA5A 1JCSA 2CWYA 1O5MA 3Q79A 5ABEA 5ABHA 3UU3A 3TWXA 3UUNA 4HOQA 2RFMA 1IJ5A 1MMAA 4TUYE 5BR8T 4MALA 4ISTA 5DABA 2XQ8A 4DLOA 4Z68A 3GA8A 1ZB1A 1O1SA 1U2VG 3AEFA 4DJAA 4DO0A 4LCTA 3ZEFA 3R9AB 3AXJB 4ILGA 2LRLA 3L22A 3CR3A 2LSIA 3L3PA 3OTOT 4KVMA 5T8IA 2OV8A 5JR9B 2J4GA 4N3BA 2LAIA 3PJAA 5L2LA 3AE1A 4Z90A 2A2FX 3AE7A 4U0SA 3QARA 3EUVA 2WPVA 5JJ7A 4DV0T 4V3IA 3CPZA 3NAWA 5JRCB 3J5PA 2XM2A 1T7SA 2P9IG 4HFGA 4OYSA 5JJ6A 3HL6A 2K5BB 5CEDB 4LNBA 1DC2A 2RPAA 2DLRA 3EAMA 4WW0A 2WY2A 2WXKA 4F8HA 4DR2T 1H19A 4F1SA 4LFAT 5LFAA 1HF8A 3CVRA 4IIJE 1SZAA 4GCOA 1YW0A 2K24A 2ZGGA 2VVSA 4HFEA 2IF4A 2R03A 5CECB 2LHRA 3JYSA 3CVVA 3ZSSA 3T5VA 3Q73A 2DZNA 3ZT5A 1ZKEA 2R02A 3ZMZB 2NYJA 4OAUC 1TN8A 3KV5A 2J47A 1LKXA 4CQIA 3TL5A 4HFVA 3UU4A 5EZYE 1U5PA 3SS1A 4DLQA 2BG9B 5LHGB 4PJLA 3GW4A 4GMRA 4PFPA 3CKBA 3ASDA 5CA1E 2IAKA 3FHNA 3TLWA 4E7ZA 5ARGA 2XS8A 4N39A 4I6EA 2DWZA 2X3MA 4PK5A 1IQRA 3RHWA 4YNDA 2EHOC 4U7IA 1OCZE 3C3OA 3PUQA 4P29A 2WXPA 5AQKB 3DSUA 2KSRA 3RKOA 3ASOE 4K0UA 4Q94A 4AKRB 1S70B 2KZ7B 4MRUA 5AAOA 2ETCA 4I1AA 1EPUA 2JQ9A 3I0OA 4UQXA 3CK6A 4I6GA 2NW9A 4EZ4A 4KUMB 4MLKA 3A8YC 4TXPA 3GZ1A 4PAGA 5EKQD 4EBAA 1I6ZA 2DHRA 1B7TA 3ZMSB 2WQYA 2R17C 5ENSD 4AQFA 2CG3A 4GYYA 4KI0F 1OWMA 2VSYA 5CRVA 4KHZF 3CHMA 2YQ8A 5ABGA 2FO1E 2N2NA 5H6QB 1SHZC 2X0HA 3PZ1A 5LCWC 2ONDA 3LK3B 5ABFB 1UG3A 5JA4D 3ONLC 4YVQC 4IULA 3UU8A 5AQVB 3FHEA 2XEVA 1I94T 1WG0A 3EDTB 1WY6A 4X8QA 4GA2A 5ENRD 3DXKG 1OWAA 2MRIA 4UWLA 5LMUT 2BUGA 4WUYA 2EIJE 3MA5A 5B3SE 1MZCA 4C91A 1E8XA 2IEJA 3EU5A 1E96B 4PS7A 1UURA 1X9BA 1G3NB 2GRQB 3CK7A 3IKOB 2RP4A 4I1MA 3MA9A 2AW6A 3AA0B 2XQYA 4GB9A 2EILE 5AARA 4AXHA 3FUIA 4MKTA 3ZW3A 4X20E 1X79A 3PV0F 4DV7T 4BFRA 3ENEA 3KSLA 1N0RA 3L09A 4EZKA 4A56A 1FIOA 2A4ZA 3L6AA 3ZT6A 1D0XA 4LF4T 2Y0BG 4YDWA 5FZSA 3C4XA 5FXVA 5FQ4A 3HDXA 3KDSE 4IREA 1YQ4A 3AA6B 5JQGE 3RQUA 3N2OA 2CHZA 5HS0A 1MMGA 2KWIB 4H7XA 1FEWA 2E8IA 2DVWA 1LD7A 3JXIA 4HTEA 2WCAA 3RSEG 5JDQA 3HXBA 4GK5E 4FJZA 4WZXA 4DR5T 3UU5A 3P7IA 4FHJA 4AEZC 3RO3A 2GRRB 3I0QA 3ZYKA 1J5ET 4YSZA 3V5SA 4DPRA 2X9XA 5L3EB 1N32T 4AI6A 5M4YA 2WXGA 4IL9A 5AQLB 4EZJA 4EPZA 2CEAA 5E0OA 1OCCE 4GTVA 5ABFA 2WQ7A 3TWVA 4UUCA 5LGUB 2PNNA 2JMKA 2ODVA 2I2OA 4E7SA 3HA4A 1FJGT 2V5FA 2WAUA 2KBXA 3LKUA 3AAAB 2B6CA 1UK5A 2BKKB 3I3NA 3N5LA 4OYKA 1SQMA 2VWAA 3UQ3A 3FUDA 4EAHA 2I0MA 4A3TA 4PJMA 4AXPA 3DSXA 4TUUA 3RGLA 3T1HT 2GGFA 4HWCA 3MXZA 2ES0A 3BQOA 2ZGDA 3D9MA 4BX9A 2V4HC 2CXDA 2WWVA 5CA0E 3PUZF 3FZFB 3IBEA 2HR2A 3CSTA 2C5IT 5KDMC 3E32A 2UY1B 2PTFA 3Q5MA 4A63B 4BSXA 2KCVA 4G8LA 2F0YA 1TNOA 5C2YA 4DX5D 2XQ0A 3FUEA 1ELKA 3K9IA 3VRBA 3QC1A 5AN8A 5AYWD 5EK4A 2H89A 1W9RA 2FF4A 3Q78A 1OCOE 2X6HA 4ANWA 1IQUA 4HGAA 3FU3A 5FNVE 3LS8A 2WXNA 2D0TA 2RD0A 2UU9T 3LY7A 5AJDA 1NENA 3U3IA 2I9CA 3RAUA 2NTXA 3FEXA 3EI0A 4DR6T 4GTSA 4BJNA 4BWRA 3CQCB 3MKRA 4HFHA 4ABNA 3LK42 2JIWA 2X67A 4EYYR 3FU6A 3AU4A 4HXIA 4U04A 4J8EA 4CZ2D 5FQ6A 4BTBA 2ACZA 1EZ3A 4IE7A 5LHHB 3DEOA 2E2EA 5LB7B 2D5UA 3HKCE 3UIPC 3RO2A 1JCRA 1M7KA 4JL0A 4DRXE 2L6JA 4GYWA 2HHHT 1ZBPA 5JHAA 4HQDA 5D0OD 3ZKJA 5ADXL 3FBZA 2WXHA 3ZKRA 2K9AA 2GROB 3FB2A 2XGMA 3S4UA 4JV5T 4NIKA 1Z5SC 5CCMA 2W66A 1E7PA 5D0QD 4MHCA 4OX9T 3P1UA 3SI5A 4C90A 4JLEA 3VKHA 3EDUA 3AEGA 3X1DA 4ANUA 4JEHB 5HEOA 5LJMA 3CHRA 4HWDA 2H6HA 2CBIA 3QAQA 5G04J 2CHNA 5ARFA 2X6FA 3C3RA 3ZLIA 2LM9A 4HFDA 4ZS2A 5FMNA 5AQOB 2VKHA 4O1PA 3UTMA 4V1Av 4ZZCA 1HXIA 3QB5K 4PK6A 3QDNA 3SFZA 2KINB 2CFUA 2BS3A 4G24A 1E8ZA 1GQEA 2XHEB 2XQ3A 4XIFA 4CXYA 3BQIA 2DI4A 5HWXA 2NP9A 4O4JE 2OEVA 4JI6T 1UOHA 2WWUA 5M72A 3AEBA 5AQ7A 3SY2A 4JEHA 5D66A 1H0AA 4HN9A 1U3DA 2E9XC 3KV6A 4TWDA 5JRCA 1KFYA 3J9X1 4WNDA 3PE3A 3WG7E 4HRNA 4BY6A 2BBHA 4H9PC 3UQ7A 2QYJA 4QXCB 4A5XA 4B3ST 1NFIE 2BF0X 1KNZA 3KS2A 4XX5A 4JI8T 1OWOA 3DSTA 1E90A 1JWFA 1HR0T 3TWTA 3CIAA 4MS6A 4XZ4A 2VB6A 2OEWA 4U8HA 4MBGA 5CEAA 4G26A 1VDYA 4CCAA 2VQ2A 1SE7A 2EIKE 5TAOA 5HWYA 3TLTA 4CZZB 5FVKA 3O9XA 3ULQA 4ERRA 3PZDA 1D0ZA 3FU5A 1QYMA 5CB4E 5LOVE 3C64A 4L23A 2P9NG 2MYOA 3Q9UC 5CRUA 2XPKA 1D1AA 3JQ0A 2KWHA 2P58C 3ESKA 3OJAA 4OK0A 3KBTA 3O1JA 3ZVVA 4UI9J 2FJEA 4Y6WA 4K0KT 2LSUA 4HLLA 2V26A 3HXCA 3UXGA 3IHVA 1TN7A 2QC9A 3N71A 2J62A 4FLBA 4JI3T 2I6HA 2WP9A 4IL4A 5DQVA 4GTMA 2BG9C 4ZOLE 5AQBA 3PUYF 4DBQA 4JB8P 3UX4A 4U07A 1HFAA 3LJNA 3CGHA 5ETWA 1HS7A 4LMJA 3BG1B 5HEUA 2W0GA 5LCYA 4H63V 4DMWA 5FYMA 2WQHA 3HXEA 3CVPA 2CG2A 4I50E 3PEUB 4F6RC 3SZ7A 2P9LG 1XDPA 2VL0A 3K3NA 3FTVA 4ZZBA 1H2VC 3DEPA 3RI5A 4G25A 4WNFA 4A3VA 5C1DA 2Q9QA 4CDMA 1XDOA 5AQUB 3EIJA 4JI2T 4K0RA 4YJ2E 3UU6A 4PUCA 3VKGA 2F8YA 2L8KA 3GWHA 3E30A 3JC6D 4HORA 4IDPA 4HOTA 1Q2ZA 4IE5A 1YKHB 4AISA 4C48B 4YVOA 3RYFE 1WAO1 4PS3A 1IXVA 3LYAA 1MNDA 3TG4A 2NXPA 3CX8B 4LRZA 2CXFA 2XHEA 3AEEA 3RH3A 4RG9A 3V30A 1KZOA 1D8EA 4OHFA 2VKOA 2Y4UA 3ZN3A 3EHMA 1US7B 2PBIA 4UIGA 2VJ8A 4DV2T 1JNZA 2LT3A 3GZ2A 3T8KA 2YNQA 2LM2A 2LE8A 3U64A 2YEVC 1D1CA 2UUBT 1HNWT 4HI8A 4MFRA 4TNVA 3FBLA 3OPCA 4LF5T 3O48A 5AQRB 4ADZA 2H88A 1SA0E 2CCQA 3UT5E 1QSDA 1CUNA 4K03A 2LJLA 4ISSA 5AQGB 5L3GB 5J2TE 4B3TT 2M6IA 5JDFA 4B3MT 3E0ZA 5KXJA 5KMGP 4HWFA 5ENNA 5AQAA 4PNIA 2KZTB 3HXFA 4HB5A 5KJMA 2DIWA 5DJQC 2UWJG 3WI3A 4KMCA 3RIBA 3LBXB 5FINA 3AG3E 4HOUA 1MMDA 2L3LA 3E33A 3IA3A 3Q5EA 4GPMA 2HYZA 4U33A 3G2UA 3DRAA 3HIZA 3BK9A 5G05J 4LERA 1O1TA 4ATZD 2V7KA 3AE5A 3CHSA 4BA9A 2IQCA 2XSAA 2XQ6A 3JAFA 2XPZA 4X65T 4EXTA 3ZUVB 1ZHCA 4IYPA 1VRBA 5FQ8A 3RF1A 2FULA 2RG8A 3RIUC 4G2VA 3V2OA 3P2BA 3GN5B 5JVDE 4CN6A 4AQFC 1YKEB 4G1TA 3KVBA 2E9XB 3QK0A 2CMRA 3OXGA 5HXSA 2V7MA 4ACLA 4ILHB 2ZM0A 1TNUA 4U95D 1XNQT 5FVLA 5JDGA 1N52A 3N9LA 3EJNA 3FU0A 4IDNA 5L4HA 5HXRA 1XNFA 4UR9A 2UXBT 5IUXA 1YD8G 4DV5T 4ZI3C 2J49A 4JEUB 2BKOA 3AS8A 3DSVA 4IT4A 3S7DA 5AJLA 3ONJA 2KCLA 2VKDA 2D0UA 3FH5A 5EN5D 3TWWA 2DNXA 4AY6A 3MZLB 5L4EA 2V5QC 4TUMA 1HCIA 3SBSA 5J0ZA 2Q9QD 3AE4A 4MBQA 3JXJA 4LEUA 2I1JA 3UT8A 3NRYA 1KF6A 5FTPA 2R59A 3BU8A 1K1AA 2ZIRA 4KHPT 3CVLA 4JBWF 2V6XA 2WB2A 3DPYA 5EIDA 3PTRB 4ILIA 4E85A 3JC6C 2DL1A 3N2KE 3ABLE 3LY9A 1OXZA 3S2AA 3VRAA 5GONE 1OY3D 3G2TA 1TEZA 4DX2A 3UIOC 5JR9A 4DVDA 3AAAC 4CYMD 2Y8DA 1TYQG 4B8AA 3MCXA 1MIVA 3QOUA 1BR0A 2IHR1 3PUXF 4KMOA 2A3DA 3KFWX 5EX3A 4BT8A 1SW6A 4H9OC 5AQ9A 3APDA 5HQ8A 4KYOB 3ULEG 2C5JA 5A23A 4HS2A 5LP0A 1BR4A 5F8PA 4G63A 1KEYA 3UQ4A 4X1IE 3SO8A 3VLEA 5AENA 1IBMT 4DUIA 5CCLA 1NZNA 2X0YA 2DWGA 4M3OA 3FULA 3I4RB 4OYJA 3LDZA 4X64T 3ZYLA 4YDOA 3RJVA 4XKBA 3TG5A 4BT9A 2J4DA 4M7CA 3IV0A 1LRZA 2EQXA 4UQYA 2QRXA 3NZUA 4X1KE 4XI9A 4U74A 5JHBA 3UUXB 2QZAA 3Q2MA 4K5BA 1E8WA 4TX5A 4WBNE 4OFZA 3PUAA 5AQQB 5AQTB 2XAGB 3KINB 4JYAT 3K8PC 4CEMA 2V5CA 4ILCA 3FTUA 4BSZB 4GTRA 3VTXA 3ONKA 2OVFA 4XE0A 5DIZA 2P9SG 2WMNA 4TZ4C 2JJ9A 3K3OA 4TV9E 4DV6T 2MAWA 3CIRA 1KK7A 3TKLB 1Z0PA 3U78A 3ZCJA 3HYMB 1H6KA 5CBNA 2FJDA 3ZMTB 1OWPA 2LSVA 2B0OE 5BNWA 2GRLA 3B7TA 3UMVA 2X66A 4ILUA 4WBOA 4JI7T 2QVAA 2NTYA 2IW5B 3CHPA 4AKLA 4I6JA 4X5TA 3QB5A 4JC8A 3F31A 4KBMB 4F1PA 1K3ZD 1BR1A 4GTPA 5F3JA 1QBQA 4UVCB 2H7OA 5E75A 3UPVA 4GKKT 1BI7B 3UUXA 5IWAT 4P0AA 1ELWA 2B1EA 2QYUA 2IDOB 2MOZA 3CWZB 4XEIG 3PDYA 1UCUA 3T9KA 4IHJE 1MNEA 3DTOA 4UF0B 3QNUA 5FQ7A 2M6BA 3EHNA 4WAFA 3ABKE 2XPYA 5FY1A 3PUWF 1N36T 2KLQA 3I4GA 5HYAA 3RRUA 4P09A 4UVBB 3N9PA 1OEDB 3UUBA 3WAKA 2IOSA 2MPKA 2ODUA 3UFEA 2JMHA 5EK2A 4J8SA 5JMND 5HCMA 2X6IA 5BXUA 2ZISA 4YJ3E 5L3BB 1W09A 3Q47B 5HXCA 1HG2A 4CXXA 2XEHA 4P1NA 1X5BA 3L08A 1Y8MA 2K3WA 5AQHB 3Q7FA 3LVQE 3JCFA 1H6OA 4IE0A 1UN9A 3FTZA 2X38A 2UY1A 2VURA 3HR0A 4KX6A 3RC8A 3C4WA 3LJCA 3PU3A 1WCRA 4IDQA 1DVPA 4IN3B 4CDNA 4TWFA 3F2EA 2FJBA 4NPPA 3MYVA 1S64A 3AE6A 4NIQA 3FUKA 5J2UE 2BS2A 3G06A 4L2LA 3FEYA 3RKGA 3G2SA 4KZ0A 1W3BA 5L47A 4LF7T 1KNPA 5BMVE 4TRQA 4WNEA 3B7SA 3R7QA 4I43B 2AXUA 4A1SA 2XZDG 4FU3A 1FCHA 4YFSA 3E4BA 5G55A 1S35A 3LK2B 2PL2A 5HEGA 3ASGA 3LBXA 4G11A 3OXLA 2HN1A 1WYCA 4EBAG 2GRNB 5EYPF 1SA5A 4AQYT 3SGHA 5KCMA 2IJGX 5J1GA 4JW1A 4N78D 2NW7A 3JCKC 2BTDA 4CN1A 4LUNU 2UUCT 4HE8A 3VTYA 4IRUA 4AKIA 3RRMB 4L2YA 3N9MA 4NXMT 4HVBA 3I9WA 1WLXA 1X81A 4HRMB 3U9WA 1FMVA 2C0SA 4PH4B 4XAXB 4HNAD 5T4YA 3PUSA 4PK4A 5J08A 3D3MA 5KWDA 2FBWA 4OVVA 4GIWA 2YINA 3CQXC 4U7YA 5JH7E 4TNWA 4JI1T 2RA1A 3RYHE 4ZI2C 3S7BA 3EU9A 3HI2A 3UUMA 4ILAA 1L0VA 3B7RL 2V6YA 1SVXA 3HVEB 2XSBA 2W67A 4QXBB 4QFVA 4ANVA 3L13A 4F7AA 4U7EB 1LD8A 2L9QA 2KT9A 3MV2B 5FP3A 1Z3YA 4QKNA 4C9BB 2A9UA 3ASNE 4XZCA 5J90A 1D0YA 2UXXB 5AQJB 4QH4A 2JLBA 3KBUA 4NXNT 3L54A 2VYIA 3ZJ2A 2LHNA 3ZJ1A 5FL1A 2WXFA 2VGXB 3IHYA 3ONLA 4GZCA 2Q9QB 4CN4A 2R5SA 3U4TA 3I9YA 3L39A 3OBVE 1P5QA 3GMIA 5JR9C 3PZ4A 4N3AA 1DU2A 1N4QA 3LVRE 4L5GA 5EDSA 2LKGA 4BESA 1KZPA 1KNRA 3BG0B 2P9BA 3FUMA 4GTTA 2DZOA 2V7JA 3QK6A 5CFBA 3APCA 5G05C 4NQ0A 3OYXA 4GTQA 4B93B 5H7PA 4GZDA 3RYCE 2M63A 2ZM2A 3FXDB 5C3JA 1INZA 3DBSA 4UV9B 1HH8A 5HXHA 2NSZA 2QY7A 3P4QA 3PUVF 1NP7A 2WXLA 3W15B 4I4TE 3TWSA 1IJ6A 3LPZA 1VCTA 1TN6A 4KT6B 4RG6A 3MK7C 1V55E 3S7JA 4UV8B 2YK0A 5FT9A 5AQMB 4JI0T 3AVSA 3AE2A 5BUZA 4AKHA 2Q7FA 4JI4T 4O4LE 3ESLA 2ZLYA 5FL0A 3MKQA 3SFYA 4A1GA 3C72A 3AG4E 1Y01A 1HZ4A 2WU5A 2BKPA 1BPOA 4GZ5A 4BX8A 3CSFA 4DBRA 5FXWA 2CLYC 4O60A 2VKJA 3P50A 2XEEA 2L0TB 4Q25A 4HEAA 4AM9A 3V2XA 2NOXA 3QWPA 5HKPA 3C98A 1AP7A 2LSGA 3VLDA 3NZSA 2HPLA 1MX2A 5EIBE 2X9WA 2IUBA 2RFAA 3OKQA 4EZHA 4L7TA 1MX4A 1YQ3A 4XI0A 4N2SA 4AJWA 5F5WA 1HU3A 3FUHA 2EHOB 4DNDA 4I2WA 5FY7A 3ZPJA 3O4ZA 3PURA 4DK5A 1UX4A 1IZNB 2DYSE 5L3DB 2PM6A 4WNGA 5H6RB 1YXRA 1XNRT 4NUUA 2KCKA 3BEEA 1GW6A 2CFZA 1AWCB 3ABVA 3LDQB 4LF6T 4I1OB 1R8IA 1CHUA 3A5XA 1VCSA 4O8SA 2E2AA 5ANLA 1NWMX 4QQIA 3DJBA 5A7DB 2VTBA 2CWOA 3SF4A 2FEZA 1KPSB 3ZC0A 4U3CA 4ZXLA 1XGWA 1QLBA 2LO6A 2Y1LE 4B8CB 2MBGA 3TXMA 2IFUA 2FI7A 2Y6XA 4UWGA 4PFOA 1Y6IA 4WWPA 2VSOE 3NRXA 4GKJT 3L82A 4YDYA 4J0UA 4B94A 3CX6B 3AE9A 4UI9C 2ZMAA 3RQWA 1Z6TA 2P9UG 5JJTA 2JEKA 4FLHA 4DV3T 1QUUA 4EHMA 2IU1A 4UWKA 4G8KA 2WDVA 2KM4A 2C0MA 1E1HB 4U2YA 1PC2A 1N94A 2D2SA 3NBXX 3LCAA 4ZI3D 3JQ1A 5BW8C 1H6PA 3E22E 4YHJA 2V4LA 3APFA 5C8YE 3JADA 4LMKA 2QGSA 2X68A 2VSXE 4X66T 4EZLA 2PG8A 2XY8B 4FADA 1DCEA 2Q9QC 2X6JA 5FWQA 4HFBA 3SFEA 4H9RC 3CVUA 2L6BA 2KXPB 1S63A 2VGYA 2Z6EA 4HI9A 5ENQD 1PY1A 2H6GA 4GYRA 1WDYA 3CQGB 4I9EA 2CA5A 4WYVA 4LF8T 3C98B 3AE8A 1TNBA 3Q7AA 2LEHA 1N34T 2J08A 2WZIA 4DR1T 2JQHA 2IO2C 3H3AA 3BQLA 2XCBA 3OAWA 2VSNA 3ZN1B 2WXRA 2BBJA 1KT0A 5LGTB 3FXEB 3FUFA 1IKND 2W61A 1IYGA 4X62T 4YTNA 1HX1B 3CVQA 3TWUA 2WQ6A 1HX8A 4L9IA 4H9NC 3CVYA 2CHOA 3RC3A 5LHIB 5IY5E 3ASFA 2E9XD 5G04C 3NOGD 1ZU2A 2XGOA 4ZHQE 2CLYB 1OWLA 3L16A 3RRNB 2Y69E 2LRKA 3AU5A 3SQVA 1IBLT 1OT8A 3ULYA 1LF8A 4IDZA 1TR4A 2LKHA 1JUQA 3VR9A 3FY4A 3RK6A 2X9YA 3P8CD 1L5JA 1FT2A 5KJKA 1ZEEA 3FFLA 3UM3A 1T98A 3QB2A 3LJ3A 4ANJA 4URKA 2YHCA 4UELA 2E5LT 4UI9K 1M62A 3FZMB 4ZFHA 1OUVA 5BPPA 1IHGA 2DYRE 4B89A 1SZ9A 1XZYA 4N5CA 2H7VC 2QFCA 2PFVA 4JHJA 4DMVA 3GN5A 4O4IE 3PNLB 1K1BA 4RLYA 3ZXPA 2F4VT 5A6CA 4QXHB 5FZRA 3ETVA 3D9JA 4O1OA 2VVNA 4ZEYA 1NAFA 3QUJA 4QH5A 4R7LA 2KNDA 4GYOA 4H9SE 5AIJA 3E37A 3EABA 3PVLA 1OXJA 2EHOA 2XGSA 2I1KA 3CK9A 2H6FA 1DNPA 4ZS3A 5L3CB 2R05A 3BUAA 4KZCA 3MEKA 5G2NA 4DR4T 2C0LA 1BD8A 4GTOA 3WAJA 3PDNA 3FH7A 3RRWA 3TWQA 3C51A 5A1LA 2XRZA 1QZ2A 5JTGA 4HFIA 1V54E 1YMPA 5KJLA 4EQFA 1HTJF 2VASA 2YDRA 2EIME 4I17A 2IO3C 2UXNB 5E76A 3ANWA 3C5RA 3V5UA 2CXLA 3C3QA 3T1YT 2PJQA 4DX1A 2HE0A 2ILRA 2BVMA 4GU5A 3AEDA 3LG7A 2AJAA 1Z8UA 1IHBA 4FP7A 3SFDA 2V6YB 3AA1B 3AAEB 3NWIA 4Z8XA 5HI7A 4EEBA 4PJJA 2F8XK 1EF1C 4U8VD 5KJNA 2WXQA 3RLFF 2PM7A 1N4SA 2KXPC 2EINE 3Q5WA 2KATA
chains in the Genus database with same CATH topology
2MYSA 4U72A 4BTAA 1HO8A 4DI3A 3I5PA 5FXXA 3D9LA 2GW1A 5L3FB 3LFMA 2OOEA 4WNKA 3CKDA 1LVKA 5AFUL 2J09A 2NW8A 1VOMA 4XBFB 3TXNA 3IHRA 3KVAA 1MQSA 4JZYA 3AB3B 3UTKA 3RRCA 2XRYA 3MJXA 3WXXA 3R7RA 3AS4A 1HS6A 4I43A 1HE8A 5LBMA 4AVXA 4GMLA 3Q4AB 5LXTE 4GYSA 5LBQB 2MHKA 3AS5A 5LX8A 3TJPA 2WSSV 2LOSA 3MKDA 2KMFA 4HKAA 4KBQA 4APOA 4KXKB 2LSJA 4CGWA 4EB6E 2NWBA 3ZCIA 3MX3A 4GCNA 1H2UA 1UJKA 4AKGA 2WM9A 3ZMVB 2DCFA 3VU7H 2WVIA 4A55A 2XASB 3AA7B 3D9PA 2JRKA 4FJOA 3G2WA 3FDHA 5IHYA 4J8FA 2V1DB 3EUHA 1FVHA 3SNXA 1S0PA 3KD7A 4BJMA 3ZGQA 3ZMUB 4EOZB 3Q9DA 4ASKA 4ZI7E 3KAEA 5LCWJ 2BDEA 2X9HA 3ZYMA 4TV3A 1EYHA 4CI3B 1UX5A 5EX0A 2A72A 4XKCA 2CE7A 2XTLA 4Q96A 5LP6E 4UQZA 4JHKA 1FMWA 3L17A 2WXMA 3N2GE 2IC9A 2C5KT 3T8OA 4GZ3A 1UW4B 4JVSA 3RX6A 2M67A 2IOLA 3FWVA 4M1PA 3HVEA 4RVBA 5LGNB 4CT0A 2V0PA 3N9QA 1N54A 5HXEA 4O4HE 4FULA 1O3XA 4C0EA 4BAYB 4AOFA 4O2AE 1G8XA 3G2VA 4AP2A 4B0ZA 5CHEE 3OYZA 2AWIA 2J1DG 4HLEA 3ZPOA 5CMWA 1G73A 3CK8A 1U4QA 3CVXA 3DP7A 3S7FA 4DI4A 3ZHEB 4CGVA 4F3VA 3ML8A 4AY5A 4G2AA 3AAIA 5FY0A 1E7VA 4OVUA 4PS8A 5FJYA 3OXFA 3SBTB 3FTWA 3GYZA 3FUNA 3PUKA 3IEEA 4GK0E 4GOUA 2JPFA 4IE4A 3MZKB 2W00A 3U3WA 4E6HA 2OVBA 3EIQC 4I9CA 2LNIA 5BV0A 4L0RA 3RYIE 2LAHA 3VLFA 3ML9A 3NF1A 1ELRA 3Q5XA 5T3RA 2HM8A 3AVRA 3C50A 4AIFA 4JEUA 3DPDA 1YA0A 3PREA 4UWHA 4H9QC 3D9NA 1NA3A 3RKVA 3E08A 2NC9A 3FTSA 2QA7A 1BR2A 1MIWA 2IC6A 4JHRA 4D10C 4Q69A 2DWKA 4UEMA 4I2ZA 4PDXA 3SWHA 3NZQA 1OWNA 3CHOA 2LSYA 4QHOA 4NACA 2XAHB 3CX7B 3FH8A 3ONXA 1TJFA 3GZSA 4MLPA 2W62A 3D9OA 3CVNA 3N9NA 4O6FA 3D9IA 1JPLA 5DQWA 4KVOA 1Z3XA 4H7YA 2N1GA 2VTBB 5JDHA 2X0LB 2L9BA 3F57A 4J8DA 3ZIMA 2LSKA 4PW8A 4JPSA 2FO7A 2J07A 3QKYA 3ZRHA 3IF8B 2LOPA 4N3CA 2XAJB 3ZHEA 4NRHB 3FUJA 2HO1A 5KX5E 1PAQA 3PS6A 4JA9A 3MGBA 3CHQA 2XAFB 2H3RA 4ATGA 3ZFWA 3TAXA 2K48A 1AJ3A 3HKBE 2PZIA 2V7IA 4ME2A 4O2BE 5JREA 3PH0C 1WRDA 3IBPA 4L1BA 4NUVA 4U0UA 2MTQA 4J2CA 2WXIA 4FHKA 3JUIA 1LVFA 5FZQA 3MACA 4QX8B 2YU2A 1MHQA 1KT1A 3EDVA 3ZC1A 4GA0A 3U66A 5JDNA 3LEWA 3SHFA 1QQEA 4CI2B 2V8SE 4U0ZA 3RU0A 3PE0A 3CEQA 3H37A 4H63H 2DCPA 4J6IA 4UVAB 3PUJA 4GZ6A 3URZA 3MV3B 3N9OA 2J4BA 1QNFA 4FC8A 2XCCA 3SOLA 1E8YA 2XUEA 2E9XA 2VL8A 4B6XA 3CLJA 3CVWA 5CMYA 3CMLA 2HH7A 2SPCA 4UWFA 4UXNB 1V9DA 3FP3A 2WMOA 4YLHA 4U63A 3NQPA 3J7Yq 3EVYA 2V7LA 4GPKA 2XAQB 3KV9A 2A5UA 1TJCA 4CRWA 4EIWA 1S94A 2VK9A 2C2LA 5BT1A 2W63A 5JDLA 4FA6A 4ACKA 2Y3AA 4WWOA 2WXOA 3M65A 3SD5A 1UN8A 2CHXA 2GRMA 3B57A 3KV4A 4APFA 4TN7B 1D1BA 2Y4TA 2EHOD 2CHWA 2J9QA 4FI5A 3RPUA 1U3CA 3QC9A 3PUGA 2ACXA 4I55E 2PQNA 1A17A 4WWNA 2BZBA 3QWVA 2DBAA 4ZI2D 5JDMA 3D9KA 4EYUA 3ASHA 3TGOA 4CI1B 4AV7A 2GK9A 3PE4A 2VGXA 5LG4A 4UF0A 4TV8E 2HPJA 4KP3C 1WYBA 3QJZA 1H2TC 3FTYA 3CKCA 2YHEA 3LY8A 4GA1A 2MOWA 3VHLA 1UJJA 3QWWA 3ANWB 2AXVA 3I1AA 4CDRA 2ZU6B 3IEGA 2KC7A 3MJWA 2XPIA 3HKEE 3FTXA 1WM5A 5FXZA 3Q15A 3QNKA 2AXZA 4Y6CA 4JXTA 1Y64B 3HKDE 4P0BA 5LNKA 2KZTA 3UULA 3HHMA 1MIYA 1HG5A 2FBNA 3T5XA 1JWGA 3ETUA 3ZEFB 2Y48B 3CV0A 4QX7B 4GMJA 1ZV4X 4G23A 3O1IA 3T8MA 3R84B 2IONA 4NURA 2WXJA 3B13A 4X1YE 4GAAA 4C0MA 3K3QC 2PQRA 1WR6A 2WBLA 3KEZA 5EK3A 3O1HA 1IAPA 3R6NA 5BV1A 3UT4A 4IE6A 3Q49B 4PJNA 4N2QA 4CXWA 3ZN0B 3PNTB 4F53A 1H7CA 4AQGA 2G0UA 3OTNA 3LXUX 5IYZE 5LYJE 2YU1A 5LOZA 3B7UX 1MMNA 4RSYA 3UT7A 4IGUA 5HAXA 2L0IA 3BQKA 2ZM8A 2N9DA 4W9RA 3ZYQA 2X51A 2E0IA 4JA7A 1NA0A 1EDUA 3PEVB 5LJNA 2AVPA 4HOSA 3MKQB 3PU8A 3O4XE 1KLXA 3NZPA 3PRZA 5ANRA 4FJYA 1B89A 2I59A 4CT4A 4EECA 2CM0A 4QWNB 1FVFA 2JQQA 3D0TA 3C4ZA 4JUYA 2X6KA 2BVLA 4ANXA 5DBKA 3ZXSA 1E7UA 5LA6E 3SRZA 2OA5A 2CWYA 3UUNA 4HOQA 1IJ5A 1MMAA 4TUYE 4MALA 4ISTA 5DABA 4DLOA 3GA8A 4DJAA 4DO0A 4LCTA 3ZEFA 3R9AB 4ILGA 3L22A 3CR3A 2LSIA 3L3PA 4KVMA 5T8IA 2OV8A 5JR9B 4N3BA 2LAIA 5L2LA 2A2FX 4U0SA 3QARA 2WPVA 5JJ7A 4V3IA 3CPZA 5JRCB 4HFGA 4OYSA 5JJ6A 3HL6A 2K5BB 2DLRA 4WW0A 2WXKA 1H19A 4F1SA 5LFAA 1HF8A 3CVRA 4IIJE 1SZAA 4GCOA 1YW0A 2K24A 2IF4A 2LHRA 3JYSA 3CVVA 3T5VA 1ZKEA 3ZMZB 3KV5A 4CQIA 1LKXA 3TL5A 4HFVA 5EZYE 1U5PA 3SS1A 4DLQA 5LHGB 4PJLA 3GW4A 4PFPA 3CKBA 3ASDA 5CA1E 2IAKA 3FHNA 4E7ZA 5ARGA 4N39A 4I6EA 2X3MA 4PK5A 1IQRA 4YNDA 2EHOC 3PUQA 4P29A 2WXPA 3RKOA 4K0UA 4Q94A 4AKRB 2KZ7B 4MRUA 4I1AA 1EPUA 3I0OA 4UQXA 4I6GA 2NW9A 4EZ4A 4KUMB 4MLKA 3GZ1A 4PAGA 5EKQD 4EBAA 2DHRA 1B7TA 3ZMSB 2R17C 4AQFA 2CG3A 4GYYA 1OWMA 2VSYA 3CHMA 2YQ8A 2N2NA 5H6QB 1SHZC 5LCWC 2ONDA 3LK3B 1UG3A 4YVQC 4IULA 3FHEA 2XEVA 3EDTB 1WY6A 4GA2A 1OWAA 2MRIA 4UWLA 2BUGA 4WUYA 3MA5A 4C91A 1E8XA 1E96B 4PS7A 3CK7A 3IKOB 2RP4A 4I1MA 3MA9A 2AW6A 3AA0B 2XQYA 4GB9A 4AXHA 3FUIA 4MKTA 3ZW3A 4X20E 1X79A 4BFRA 3ENEA 3L09A 4EZKA 4A56A 1FIOA 2A4ZA 3L6AA 1D0XA 5FZSA 3C4XA 5FXVA 5FQ4A 3HDXA 3KDSE 3AA6B 5JQGE 2CHZA 3N2OA 1MMGA 2KWIB 4H7XA 1FEWA 2E8IA 4HTEA 5JDQA 4GK5E 4FJZA 3P7IA 4FHJA 4AEZC 3RO3A 3I0QA 3ZYKA 3V5SA 4DPRA 2X9XA 5L3EB 5M4YA 4AI6A 2WXGA 4EZJA 4EPZA 2CEAA 5E0OA 2WQ7A 5LGUB 2JMKA 2ODVA 2I2OA 4E7SA 3HA4A 2V5FA 2WAUA 3LKUA 3AAAB 3I3NA 3N5LA 4OYKA 1SQMA 2VWAA 3UQ3A 3FUDA 4EAHA 4A3TA 4PJMA 4AXPA 4TUUA 2GGFA 3MXZA 2ES0A 3D9MA 4BX9A 2CXDA 5CA0E 3IBEA 2HR2A 3CSTA 2C5IT 5KDMC 2UY1B 3Q5MA 4BSXA 2KCVA 5C2YA 2XQ0A 3FUEA 1ELKA 3K9IA 3QC1A 5AYWD 5EK4A 2FF4A 2X6HA 4ANWA 1IQUA 4HGAA 3FU3A 5FNVE 3LS8A 2WXNA 2D0TA 2RD0A 3LY7A 5AJDA 3U3IA 2I9CA 2NTXA 3FEXA 4BJNA 4BWRA 3CQCB 3MKRA 4ABNA 3LK42 2X67A 4EYYR 3FU6A 3AU4A 4HXIA 4U04A 4J8EA 5FQ6A 4BTBA 1EZ3A 4IE7A 5LHHB 2E2EA 2D5UA 3HKCE 3RO2A 4JL0A 2L6JA 4GYWA 1ZBPA 5JHAA 5D0OD 5ADXL 3FBZA 2WXHA 2K9AA 3FB2A 2XGMA 3S4UA 5CCMA 5D0QD 4MHCA 3P1UA 3SI5A 4C90A 4JLEA 3VKHA 3EDUA 4ANUA 4JEHB 5LJMA 3CHRA 3QAQA 5G04J 5ARFA 2X6FA 3ZLIA 2LM9A 4ZS2A 5FMNA 2VKHA 4V1Av 1HXIA 3QDNA 4PK6A 3SFZA 2KINB 2CFUA 4G24A 1E8ZA 2XHEB 4XIFA 4CXYA 3BQIA 2DI4A 5HWXA 2NP9A 4O4JE 2WWUA 5M72A 4JEHA 1H0AA 4HN9A 1U3DA 2E9XC 3KV6A 5JRCA 3J9X1 4WNDA 3PE3A 4BY6A 4H9PC 4QXCB 2BF0X 1KNZA 3KS2A 4XX5A 1OWOA 1E90A 1JWFA 3CIAA 4MS6A 4XZ4A 2VB6A 4U8HA 4G26A 1VDYA 4CCAA 2VQ2A 5TAOA 5HWYA 4CZZB 3ULQA 3O9XA 4ERRA 3PZDA 1D0ZA 3FU5A 5CB4E 5LOVE 3C64A 4L23A 1D1AA 3JQ0A 2KWHA 2P58C 3ESKA 3OJAA 4OK0A 3KBTA 3O1JA 3ZVVA 4UI9J 4Y6WA 2LSUA 2V26A 3IHVA 3N71A 4FLBA 2I6HA 5DQVA 4ZOLE 4DBQA 3UX4A 4U07A 1HFAA 3CGHA 5ETWA 1HS7A 3BG1B 2W0GA 5LCYA 4H63V 4DMWA 5FYMA 2WQHA 3CVPA 2CG2A 4I50E 3PEUB 4F6RC 3SZ7A 3K3NA 3FTVA 4WNFA 1H2VC 4G25A 4A3VA 5C1DA 2Q9QA 4CDMA 3EIJA 4K0RA 4YJ2E 4PUCA 3VKGA 2L8KA 3GWHA 3JC6D 4HORA 4HOTA 4IE5A 1YKHB 4YVOA 3RYFE 1WAO1 4PS3A 3LYAA 1MNDA 3TG4A 2NXPA 3CX8B 4LRZA 2CXFA 2XHEA 3RH3A 4RG9A 4OHFA 2VKOA 2Y4UA 3ZN3A 3EHMA 1US7B 2PBIA 4UIGA 2VJ8A 2LT3A 3GZ2A 2YNQA 2LE8A 3U64A 2YEVC 1D1CA 4MFRA 3FBLA 3O48A 4ADZA 1SA0E 2CCQA 3UT5E 1QSDA 1CUNA 4K03A 2LJLA 4ISSA 5L3GB 5J2TE 5JDFA 3E0ZA 5KMGP 5ENNA 4PNIA 2KZTB 5KJMA 2DIWA 5DJQC 2UWJG 3WI3A 4KMCA 3RIBA 3LBXB 4HOUA 1MMDA 2L3LA 2HYZA 3G2UA 3HIZA 3BK9A 5G05J 4LERA 2V7KA 3CHSA 4BA9A 2IQCA 2XPZA 4EXTA 1ZHCA 4IYPA 1VRBA 5FQ8A 2FULA 2RG8A 4G2VA 3P2BA 3GN5B 5JVDE 4AQFC 1YKEB 4G1TA 3KVBA 2E9XB 3QK0A 2CMRA 3OXGA 5HXSA 2V7MA 4ACLA 4ILHB 2ZM0A 5JDGA 1N52A 3N9LA 3EJNA 3FU0A 5HXRA 1XNFA 1YD8G 4ZI3C 2J49A 4JEUB 3AS8A 3S7DA 5AJLA 2KCLA 2VKDA 2D0UA 3FH5A 2DNXA 4AY6A 3MZLB 1HCIA 3SBSA 2Q9QD 4MBQA 4LEUA 2I1JA 3UT8A 3NRYA 5FTPA 2R59A 3CVLA 2WB2A 3PTRB 4ILIA 4E85A 3JC6C 3N2KE 3LY9A 1OXZA 3S2AA 5GONE 3G2TA 1TEZA 5JR9A 4DVDA 2Y8DA 4B8AA 3MCXA 1MIVA 3QOUA 1BR0A 5EX3A 4BT8A 4KMOA 2A3DA 3KFWX 4H9OC 3APDA 5HQ8A 4KYOB 2C5JA 5A23A 4HS2A 5LP0A 1BR4A 5F8PA 4G63A 3VLEA 4X1IE 5AENA 5CCLA 1NZNA 2DWGA 4M3OA 3FULA 3I4RB 4OYJA 3LDZA 3ZYLA 3RJVA 4XKBA 3TG5A 4BT9A 2J4DA 3IV0A 1LRZA 2EQXA 4UQYA 3NZUA 4X1KE 4XI9A 4U74A 5JHBA 3UUXB 3Q2MA 1E8WA 4TX5A 4WBNE 4OFZA 3PUAA 2XAGB 3KINB 3K8PC 4CEMA 3FTUA 3VTXA 3ONKA 2OVFA 4XE0A 5DIZA 2WMNA 4TZ4C 2JJ9A 3K3OA 4TV9E 3HYMB 1KK7A 3TKLB 1Z0PA 3U78A 3ZCJA 1H6KA 3ZMTB 1OWPA 2LSVA 5BNWA 2GRLA 3B7TA 3UMVA 2X66A 4ILUA 4WBOA 2NTYA 2IW5B 3CHPA 4AKLA 4I6JA 4JC8A 3F31A 4KBMB 1BR1A 5F3JA 4UVCB 2H7OA 5E75A 3UPVA 3UUXA 4P0AA 1ELWA 2B1EA 2MOZA 3CWZB 3PDYA 1UCUA 4IHJE 1MNEA 3DTOA 4UF0B 5FQ7A 3EHNA 4WAFA 2XPYA 5FY1A 2KLQA 3I4GA 5HYAA 3RRUA 4P09A 4UVBB 3N9PA 3WAKA 2IOSA 2ODUA 3UFEA 2JMHA 5EK2A 4J8SA 2X6IA 4YJ3E 5L3BB 3Q47B 5HXCA 1HG2A 4CXXA 1X5BA 3L08A 1Y8MA 3LVQE 3FTZA 4IE0A 1UN9A 2X38A 2UY1A 3HR0A 3RC8A 3C4WA 3LJCA 3PU3A 1DVPA 4IN3B 4CDNA 3F2EA 3MYVA 3FUKA 5J2UE 4L2LA 3FEYA 3G2SA 4KZ0A 1W3BA 5BMVE 4TRQA 4WNEA 3B7SA 3R7QA 4I43B 2AXUA 4A1SA 4FU3A 1FCHA 4YFSA 3E4BA 5G55A 1S35A 3LK2B 2PL2A 3ASGA 4G11A 3LBXA 3OXLA 1WYCA 4EBAG 3SGHA 5KCMA 2IJGX 5J1GA 4JW1A 4N78D 2NW7A 3JCKC 2BTDA 4LUNU 3VTYA 4HE8A 4IRUA 4AKIA 3RRMB 4L2YA 3N9MA 4HVBA 3I9WA 1WLXA 3U9WA 1FMVA 2C0SA 4PH4B 4XAXB 5T4YA 3PUSA 4PK4A 5J08A 3D3MA 4OVVA 4GIWA 2YINA 3CQXC 3S7BA 5JH7E 2RA1A 3RYHE 4ZI2C 3HI2A 3UUMA 3B7RL 3HVEB 4QXBB 4QFVA 4ANVA 3L13A 4F7AA 2L9QA 2KT9A 3MV2B 5FP3A 1Z3YA 4QKNA 4C9BB 4XZCA 5J90A 1D0YA 2UXXB 2JLBA 3KBUA 3L54A 2VYIA 3ZJ2A 2LHNA 3ZJ1A 2WXFA 2VGXB 3IHYA 3ONLA 4GZCA 2Q9QB 2R5SA 3U4TA 3I9YA 3OBVE 1P5QA 4N3AA 3GMIA 5JR9C 3LVRE 5EDSA 4L5GA 3BG0B 2P9BA 3FUMA 2V7JA 3QK6A 3APCA 5G05C 4NQ0A 3OYXA 4GZDA 3RYCE 2M63A 2ZM2A 3FXDB 1INZA 3DBSA 4UV9B 1HH8A 5HXHA 2NSZA 2QY7A 1NP7A 2WXLA 3W15B 4I4TE 1IJ6A 3LPZA 4KT6B 4RG6A 3MK7C 3S7JA 4UV8B 2YK0A 5FT9A 3AVSA 5BUZA 4AKHA 2Q7FA 4O4LE 3ESLA 2ZLYA 3MKQA 4A1GA 1HZ4A 1BPOA 4GZ5A 4BX8A 3CSFA 4DBRA 5FXWA 2CLYC 2VKJA 2L0TB 4HEAA 4AM9A 2NOXA 3QWPA 3C98A 2LSGA 3VLDA 3NZSA 2HPLA 2X9WA 4L7TA 3OKQA 4EZHA 4N2SA 4XI0A 4AJWA 1HU3A 3FUHA 2EHOB 4DNDA 4I2WA 5FY7A 3ZPJA 3O4ZA 3PURA 4DK5A 1UX4A 1IZNB 5L3DB 2PM6A 4WNGA 5H6RB 4NUUA 2KCKA 3BEEA 1GW6A 2CFZA 4I1OB 3A5XA 4O8SA 5ANLA 1NWMX 5A7DB 3DJBA 2VTBA 2CWOA 3SF4A 2FEZA 3ZC0A 1XGWA 2LO6A 4B8CB 2MBGA 3TXMA 2IFUA 2FI7A 2Y6XA 4UWGA 4PFOA 1Y6IA 4WWPA 2VSOE 3NRXA 4J0UA 4B94A 3CX6B 4UI9C 2ZMAA 1Z6TA 5JJTA 2JEKA 4FLHA 1QUUA 2IU1A 4UWKA 2KM4A 2C0MA 1E1HB 1PC2A 2D2SA 3NBXX 3LCAA 4ZI3D 3JQ1A 5BW8C 3E22E 4YHJA 2V4LA 3APFA 5C8YE 2QGSA 2X68A 2VSXE 4EZLA 2PG8A 4FADA 2Q9QC 2X6JA 5FWQA 4H9RC 3CVUA 2KXPB 2VGYA 2Z6EA 1PY1A 4GYRA 3CQGB 4I9EA 2CA5A 3C98B 2LEHA 2J08A 3H3AA 3BQLA 2XCBA 3OAWA 2VSNA 3ZN1B 2WXRA 1KT0A 5LGTB 3FXEB 3FUFA 2W61A 1IYGA 3CVQA 2WQ6A 1HX8A 4L9IA 4H9NC 3CVYA 3RC3A 5LHIB 3ASFA 2E9XD 5G04C 1ZU2A 2XGOA 4ZHQE 2CLYB 1OWLA 3L16A 3RRNB 3AU5A 1LF8A 4IDZA 1JUQA 3FY4A 3RK6A 2X9YA 3P8CD 1L5JA 5KJKA 1ZEEA 3FFLA 1T98A 3QB2A 3LJ3A 4ANJA 4URKA 2YHCA 4UELA 4UI9K 5BPPA 1OUVA 1IHGA 4B89A 1SZ9A 4N5CA 2H7VC 2QFCA 2PFVA 4JHJA 4DMVA 3GN5A 4O4IE 3PNLB 5A6CA 4QXHB 5FZRA 3ETVA 3D9JA 1NAFA 3QUJA 4R7LA 2KNDA 4GYOA 4H9SE 5AIJA 3PVLA 2EHOA 2XGSA 2I1KA 3CK9A 4ZS3A 5L3CB 1DNPA 4KZCA 3MEKA 5G2NA 2C0LA 3WAJA 3PDNA 3FH7A 3RRWA 3C51A 5A1LA 2XRZA 1QZ2A 5KJLA 4EQFA 1HTJF 2VASA 4I17A 2UXNB 5E76A 3ANWA 3V5UA 2CXLA 2PJQA 2ILRA 2BVMA 4GU5A 3LG7A 4FP7A 3AAEB 3AA1B 4Z8XA 5HI7A 4PJJA 1EF1C 5KJNA 2WXQA 2PM7A 3Q5WA 2KATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHL A;  2WM9 A;  2YIN A;  3B13 A;  2WMO A;  2WMN A; 
#chains in the Genus database with same CATH topology
 2MYS A;  4YTP A;  4U72 A;  1K8K G;  3NBN B;  4BTA A;  1HO8 A;  5B1A E;  4DI3 A;  5AQN B;  4YT0 A;  3NB2 A;  4YXD A;  3I5P A;  5FXX A;  1NL4 A;  3D9L A;  2GW1 A;  5L3F B;  3LFM A;  2OOE A;  4WNK A;  2P2C P;  3CKD A;  4LSZ E;  2IY0 C;  5D2M C;  1LVK A;  3UI2 A;  5AFU L;  3UFG A;  2J09 A;  3HXD A;  1LTX A;  2NW8 A;  1VOM A;  4XBF B;  4DUY T;  3TXN A;  3ZT7 A;  3IHR A;  4LFC T;  3KVA A;  1MQS A;  4JZY A;  3AB3 B;  3UTK A;  1UUS A;  3RRC A;  1MJ0 A;  3B5M A;  2XRY A;  3MJX A;  3EHR A;  3B7B A;  3WXX A;  2AE9 A;  3R7R A;  3AS4 A;  1HS6 A;  2WDR A;  4I43 A;  1HE8 A;  5LBM A;  4AVX A;  1FPP A;  2CPT A;  4GML A;  4JI5 T;  2XZT G;  5LXT E;  3Q4A B;  3SFX A;  4TWH A;  1OED E;  4GYS A;  5LBQ B;  2MHK A;  3AS5 A;  5LX8 A;  3TJP A;  2WSS V;  2LOS A;  1IBK T;  1OED A;  3MKD A;  2KMF A;  4COF A;  3V31 A;  4HKA A;  3AG1 E;  4KBQ A;  4APO A;  4KXK B;  2OCC E;  2LSJ A;  3ABM E;  4CGW A;  4HRL A;  2XQ7 A;  4EB6 E;  3M3Z B;  2NWB A;  3ZCI A;  2GRP B;  3MX3 A;  4GCN A;  1H2U A;  1UJK A;  4AKG A;  2WM9 A;  3ZMV B;  2DCF A;  3VU7 H;  3W9G A;  2WVI A;  5AQP B;  2XAS B;  4A55 A;  3AA7 B;  3D9P A;  2JRK A;  4FJO A;  3G2W A;  3FDH A;  5IHY A;  4J8F A;  2V1D B;  3EUH A;  1FVH A;  3SNX A;  1N9A A;  1S0P A;  1T8B A;  3K1S A;  2IIU A;  3KD7 A;  2CBJ A;  4BJM A;  3ZGQ A;  3ZMU B;  3L8R A;  4EOZ B;  2WS3 A;  3Q9D A;  4ASK A;  4ZI7 E;  3KAE A;  2BKN A;  2BED A;  4QH1 A;  3TLS A;  5LCW J;  2BDE A;  2X9H A;  1N4R A;  3ZYM A;  4TXQ A;  4TV3 A;  1EYH A;  4CI3 B;  2OLT A;  1UX5 A;  5EX0 A;  2A72 A;  4BET A;  4XKC A;  3UM0 A;  2CE7 A;  2XTL A;  1N33 T;  4Q96 A;  2WB5 A;  5LP6 E;  4UQZ A;  1J1J A;  4JHK A;  1FMW A;  3L17 A;  2WXM A;  3N2G E;  2IC9 A;  2C5K T;  3AXJ A;  3T8O A;  4LF9 T;  1SA4 A;  4GZ3 A;  1UW4 B;  4JVS A;  3RX6 A;  2M67 A;  2IOL A;  3FWV A;  4M1P A;  2HN2 A;  3ZST A;  3HVE A;  4LFB T;  1JCQ A;  4RVB A;  5ENT D;  5LGN B;  4CT0 A;  2UXD T;  2V0P A;  3N9Q A;  1HNZ T;  4DR7 T;  4YSY A;  5HXE A;  1N54 A;  3X2Q E;  5BXO A;  4O4H E;  4FUL A;  1O3X A;  4C0E A;  2E5V A;  4BAY B;  2VQE T;  3TLV A;  4RQI A;  4AOF A;  4O2A E;  1G8X A;  3G2V A;  1SUM B;  2P9K G;  4AP2 A;  4B0Z A;  5CHE E;  3EHQ A;  3OYZ A;  4L9P A;  2AWI A;  3KEA A;  2J1D G;  1BI8 B;  4HLE A;  3ZPO A;  1NI1 A;  5CMW A;  1G73 A;  3CK8 A;  1U4Q A;  3HRA A;  3CVX A;  3DP7 A;  3S7F A;  4DI4 A;  2W2U A;  1HNX T;  3ZHE B;  4CGV A;  4F3V A;  3ML8 A;  4AY5 A;  4G2A A;  5HRY A;  4B3R T;  3AAI A;  4EED A;  2B76 A;  5FY0 A;  1E7V A;  3P4W A;  4OVU A;  3QOF A;  4PS8 A;  5FJY A;  3OXF A;  2VQF T;  3RIF A;  3SBT B;  1XMQ T;  5KNG A;  2VGE A;  3FTW A;  3GYZ A;  3AE3 A;  3W9F A;  3FUN A;  2BG9 A;  3PUK A;  4K5C A;  3AEC A;  3IEE A;  4GK0 E;  4GOU A;  2JPF A;  4IE4 A;  2UXC T;  4HWH A;  3MZK B;  2UUA T;  2W00 A;  3U3W A;  4E6H A;  2OVB A;  3EIQ C;  4I9C A;  3ISM C;  2LNI A;  2JQK A;  5BV0 A;  4L0R A;  2W4X A;  3RYI E;  2LAH A;  4DV1 T;  3ML9 A;  4YY3 T;  3VLF A;  3NF1 A;  1O1R A;  1ELR A;  5AQI B;  3Q5X A;  5T3R A;  2HM8 A;  4YDE A;  3AVR A;  3C50 A;  4BEP A;  4AIF A;  4JEU A;  3FZL B;  4N5Q A;  3DPD A;  1YA0 A;  3PRE A;  4UWH A;  4H9Q C;  3D9N A;  1NA3 A;  3RKV A;  3E08 A;  2F37 A;  2NC9 A;  3FTS A;  3PJA J;  2QA7 A;  4DUZ T;  1BR2 A;  1MIW A;  2IC6 A;  1RZ4 A;  4JHR A;  4D10 C;  4Q69 A;  2DWK A;  4UEM A;  2V5D A;  2ETA A;  2JAB A;  4I2Z A;  1J5W A;  5B1B E;  2RKK A;  4PDX A;  3JAE A;  3SWH A;  2V8S V;  3NZQ A;  5AQS B;  2WU2 A;  2XJ7 A;  1OWN A;  3CHO A;  2LSY A;  4QHO A;  3V79 K;  4NAC A;  1D9S A;  2XAH B;  4LNG A;  2P9P G;  3CX7 B;  3FH8 A;  3ONX A;  3TLU A;  1TJF A;  3GZS A;  4MLP A;  2W62 A;  3D9O A;  2J8S D;  3CVN A;  3N9N A;  4YTM A;  3DXM G;  3Q75 A;  4J8Y A;  4O6F A;  2WDQ A;  3D9I A;  3KSQ A;  1JPL A;  5DQW A;  4KVO A;  2XZE A;  1Z3X A;  4H7Y A;  4LNU D;  2N1G A;  2VTB B;  5JDH A;  2IML A;  2X0L B;  2L9B A;  3F57 A;  5HCJ A;  4U31 A;  4J8D A;  3ZIM A;  2LSK A;  4PW8 A;  4JPS A;  2FO7 A;  2J07 A;  3QKY A;  3ZRH A;  3RIU A;  3IF8 B;  2LOP A;  3ZNG A;  4N3C A;  2XAJ B;  3RIA A;  3ZHE A;  4NRH B;  3FUJ A;  2CRB A;  2HO1 A;  5KX5 E;  1PAQ A;  3PS6 A;  4JA9 A;  3DWL G;  5CGM A;  2ZM6 T;  3MGB A;  3CHQ A;  2XAF B;  2XEN A;  3DSS A;  2H3R A;  4ATG A;  3ZFW A;  3TAX A;  2K48 A;  4IDO A;  1AJ3 A;  3HKB E;  5FIO A;  2PZI A;  2V7I A;  4ME2 A;  3TWR A;  4O2B E;  1W0A A;  5JRE A;  3PH0 C;  1JNR A;  2XM1 A;  1WRD A;  3IBP A;  4L1B A;  4NUV A;  4U0U A;  2MTQ A;  4J2C A;  2WXI A;  4FHK A;  3JUI A;  1LVF A;  5FZQ A;  2WZH A;  3MAC A;  4QX8 B;  2YU2 A;  2LXL A;  1MHQ A;  2XQ5 A;  1KT1 A;  3EDV A;  3ZC1 A;  4GA0 A;  3UKU G;  3U66 A;  5JDN A;  3LEW A;  3SHF A;  1QQE A;  4DR3 T;  2YKS A;  4J7W A;  5ENP D;  3ZU7 B;  4CI2 B;  2V8S E;  4TXR A;  4U0Z A;  4JD2 G;  4YSX A;  2BKG A;  3RU0 A;  3PE0 A;  4DX7 D;  3CEQ A;  3H37 A;  4H63 H;  5EYL A;  2R6G F;  2DCP A;  1YCS B;  4J6I A;  4UVA B;  3PUJ A;  3EHZ A;  4GZ6 A;  3URZ A;  3MV3 B;  3N9O A;  3L9T A;  5LG3 A;  2LLY A;  1NEK A;  4ILB A;  2J4B A;  1QNF A;  4U8Y D;  4FC8 A;  2XCC A;  1N11 A;  3SOL A;  1E8Y A;  2YDQ A;  2XUE A;  2E9X A;  2VL8 A;  4B6X A;  3P4R A;  3CLJ A;  2YN6 A;  4EV6 A;  3CVW A;  5CMY A;  3CML A;  2HH7 A;  2SPC A;  4UWF A;  4UXN B;  1V9D A;  3FP3 A;  2WMO A;  4YLH A;  4U63 A;  2LXM A;  3NQP A;  4DV4 T;  3J7Y q;  3EVY A;  2V7L A;  4A97 A;  3D9H A;  4GPK A;  3AG2 E;  4LG6 A;  2XAQ B;  5KNH D;  3KV9 A;  2A5U A;  4ZHB A;  1TNY A;  1TJC A;  4CRW A;  4Z91 A;  4EIW A;  1S94 A;  3J5Q B;  2FUP A;  2VK9 A;  2YDS A;  1N0Q A;  2C2L A;  3B95 A;  1D8D A;  3UIN C;  1ZP0 A;  3NKZ A;  3LSV A;  5BT1 A;  2W63 A;  3HG0 D;  5JDL A;  2XS1 A;  3P4S A;  4FA6 A;  2LUH A;  4ACK A;  2Y3A A;  1OCR E;  4WWO A;  1BU9 A;  3UM2 A;  2WXO A;  3M65 A;  3SD5 A;  5KBA A;  1UN8 A;  2CHX A;  2GRM A;  3P4P A;  3B57 A;  3KV4 A;  4APF A;  4TN7 B;  1D1B A;  1UGO A;  3UKR G;  2Y4T A;  4DX6 D;  2EHO D;  3VR8 A;  2FJA A;  4OAV B;  2CHW A;  2J9Q A;  4FI5 A;  3RPU A;  2XQ9 A;  1T72 A;  1U3C A;  2ETB A;  1OED C;  3QC9 A;  2XQA A;  3PUG A;  2ACX A;  1TNZ A;  4I55 E;  2PQN A;  1A17 A;  4WWN A;  2BZB A;  2DBA A;  3QWV A;  1N4P A;  2YOE A;  2QYW A;  1DCQ A;  4ZI2 D;  1A5E A;  4AIU A;  5JDM A;  4EYU A;  3D9K A;  3ASH A;  3PZ3 A;  3TGO A;  4CI1 B;  1WR0 A;  4AV7 A;  2GK9 A;  3IXE A;  3FZH B;  3PE4 A;  2VGX A;  5LG4 A;  4U2Z A;  4UF0 A;  4TV8 E;  2HPJ A;  3UM1 A;  4KP3 C;  4EGW A;  1WYB A;  1XMO T;  3QJZ A;  3Q9N C;  1H2T C;  3FTY A;  3CKC A;  1XWM A;  2YHE A;  3LY8 A;  4GA1 A;  2MOW A;  2AXD S;  3VHL A;  1ZOY A;  1MYO A;  1UJJ A;  2H6I A;  1N95 A;  3QWW A;  3ANW B;  2AXV A;  3I1A A;  4CDR A;  2ZU6 B;  3IEG A;  3NOC D;  2KC7 A;  3H3M A;  3MJW A;  2XPI A;  4F6R D;  3OVU A;  3HKE E;  3FTX A;  1WM5 A;  5FXZ A;  3Q15 A;  3QNK A;  2AXZ A;  4Y6C A;  5C2T A;  4JXT A;  1Y64 B;  1FT1 A;  3HKD E;  2OV9 A;  4P0B A;  5LNK A;  2D9D A;  2KZT A;  2A5E A;  3UUL A;  3HHM A;  2BS4 A;  1MIY A;  1HG5 A;  2FBN A;  3T5X A;  1JWG A;  3ETU A;  3JUE A;  3ZEF B;  2Y48 B;  3CV0 A;  4QX7 B;  5LMN T;  4GMJ A;  4K5A B;  1ZV4 X;  4G23 A;  3O1I A;  5EIL A;  3T8M A;  3R84 B;  2ION A;  1W0B A;  2ZXW E;  4NUR A;  2WXJ A;  3B13 A;  4X1Y E;  3FZK B;  4GAA A;  4C0M A;  3K3Q C;  2PQR A;  1WR6 A;  2WBL A;  3KEZ A;  5EK3 A;  3O1H A;  1IAP A;  3R6N A;  5BV1 A;  3UT4 A;  4IE6 A;  4BER A;  3E34 A;  3Q49 B;  4LML A;  5ITZ F;  4PJN A;  4N2Q A;  2BG9 E;  4CXW A;  5CJ5 A;  3ZN0 B;  2R2L A;  3F6Q A;  3PNT B;  4F53 A;  1WFD A;  1H7C A;  5FKY A;  4AQG A;  4YHH T;  2G0U A;  3OTN A;  3LXU X;  5IYZ E;  5LYJ E;  3NVO A;  3DSW A;  4HBD A;  2YU1 A;  5AQF B;  5LOZ A;  3B7U X;  1MMN A;  5ENO D;  4RSY A;  3UT7 A;  4IGU A;  3AJI A;  5HEH A;  5HAX A;  2L0I A;  1YYH A;  3BQK A;  2ZM8 A;  2N9D A;  4W9R A;  3ZYQ A;  3PZ2 A;  2X51 A;  2E0I A;  4JA7 A;  1NA0 A;  4I0U A;  1RW2 A;  2NR4 A;  1EDU A;  4U96 D;  3PEV B;  5LJN A;  2AVP A;  4HOS A;  3MKQ B;  3PU8 A;  3O4X E;  1KLX A;  3NZP A;  3PRZ A;  5ANR A;  4DID B;  1MX6 A;  1B89 A;  4FJY A;  2I59 A;  4CT4 A;  4EEC A;  4A98 A;  3A7M A;  2CM0 A;  4QWN B;  1FVF A;  5CBO A;  2JQQ A;  3D0T A;  4HFC A;  1BLX B;  3C4Z A;  5HEJ A;  4HWI B;  3AEA A;  2XQ4 A;  4JUY A;  3Q5D A;  2X6K A;  2BVL A;  3R9M A;  4ANX A;  5DBK A;  3ZXS A;  1E7U A;  5LA6 E;  5CER B;  3SRZ A;  1E2A A;  2OA5 A;  1JCS A;  2CWY A;  1O5M A;  3Q79 A;  5ABE A;  5ABH A;  3UU3 A;  3TWX A;  3UUN A;  4HOQ A;  2RFM A;  1IJ5 A;  1MMA A;  4TUY E;  5BR8 T;  4MAL A;  4IST A;  5DAB A;  2XQ8 A;  4DLO A;  4Z68 A;  3GA8 A;  1ZB1 A;  1O1S A;  1U2V G;  3AEF A;  4DJA A;  4DO0 A;  4LCT A;  3ZEF A;  3R9A B;  3AXJ B;  4ILG A;  2LRL A;  3L22 A;  3CR3 A;  2LSI A;  3L3P A;  3OTO T;  4KVM A;  5T8I A;  2OV8 A;  5JR9 B;  2J4G A;  4N3B A;  2LAI A;  3PJA A;  5L2L A;  3AE1 A;  4Z90 A;  2A2F X;  3AE7 A;  4U0S A;  3QAR A;  3EUV A;  2WPV A;  5JJ7 A;  4DV0 T;  4V3I A;  3CPZ A;  3NAW A;  5JRC B;  3J5P A;  2XM2 A;  1T7S A;  2P9I G;  4HFG A;  4OYS A;  5JJ6 A;  3HL6 A;  2K5B B;  5CED B;  4LNB A;  1DC2 A;  2RPA A;  2DLR A;  3EAM A;  4WW0 A;  2WY2 A;  2WXK A;  4F8H A;  4DR2 T;  1H19 A;  4F1S A;  4LFA T;  5LFA A;  1HF8 A;  3CVR A;  4IIJ E;  1SZA A;  4GCO A;  1YW0 A;  2K24 A;  2ZGG A;  2VVS A;  4HFE A;  2IF4 A;  2R03 A;  5CEC B;  2LHR A;  3JYS A;  3CVV A;  3ZSS A;  3T5V A;  3Q73 A;  2DZN A;  3ZT5 A;  1ZKE A;  2R02 A;  3ZMZ B;  2NYJ A;  4OAU C;  1TN8 A;  3KV5 A;  2J47 A;  1LKX A;  4CQI A;  3TL5 A;  4HFV A;  3UU4 A;  5EZY E;  1U5P A;  3SS1 A;  4DLQ A;  2BG9 B;  5LHG B;  4PJL A;  3GW4 A;  4GMR A;  4PFP A;  3CKB A;  3ASD A;  5CA1 E;  2IAK A;  3FHN A;  3TLW A;  4E7Z A;  5ARG A;  2XS8 A;  4N39 A;  4I6E A;  2DWZ A;  2X3M A;  4PK5 A;  1IQR A;  3RHW A;  4YND A;  2EHO C;  4U7I A;  1OCZ E;  3C3O A;  3PUQ A;  4P29 A;  2WXP A;  5AQK B;  3DSU A;  2KSR A;  3RKO A;  3ASO E;  4K0U A;  4Q94 A;  4AKR B;  1S70 B;  2KZ7 B;  4MRU A;  5AAO A;  2ETC A;  4I1A A;  1EPU A;  2JQ9 A;  3I0O A;  4UQX A;  3CK6 A;  4I6G A;  2NW9 A;  4EZ4 A;  4KUM B;  4MLK A;  3A8Y C;  4TXP A;  3GZ1 A;  4PAG A;  5EKQ D;  4EBA A;  1I6Z A;  2DHR A;  1B7T A;  3ZMS B;  2WQY A;  2R17 C;  5ENS D;  4AQF A;  2CG3 A;  4GYY A;  4KI0 F;  1OWM A;  2VSY A;  5CRV A;  4KHZ F;  3CHM A;  2YQ8 A;  5ABG A;  2FO1 E;  2N2N A;  5H6Q B;  1SHZ C;  2X0H A;  3PZ1 A;  5LCW C;  2OND A;  3LK3 B;  5ABF B;  1UG3 A;  5JA4 D;  3ONL C;  4YVQ C;  4IUL A;  3UU8 A;  5AQV B;  3FHE A;  2XEV A;  1I94 T;  1WG0 A;  3EDT B;  1WY6 A;  4X8Q A;  4GA2 A;  5ENR D;  3DXK G;  1OWA A;  2MRI A;  4UWL A;  5LMU T;  2BUG A;  4WUY A;  2EIJ E;  3MA5 A;  5B3S E;  1MZC A;  4C91 A;  1E8X A;  2IEJ A;  3EU5 A;  1E96 B;  4PS7 A;  1UUR A;  1X9B A;  1G3N B;  2GRQ B;  3CK7 A;  3IKO B;  2RP4 A;  4I1M A;  3MA9 A;  2AW6 A;  3AA0 B;  2XQY A;  4GB9 A;  2EIL E;  5AAR A;  4AXH A;  3FUI A;  4MKT A;  3ZW3 A;  4X20 E;  1X79 A;  3PV0 F;  4DV7 T;  4BFR A;  3ENE A;  3KSL A;  1N0R A;  3L09 A;  4EZK A;  4A56 A;  1FIO A;  2A4Z A;  3L6A A;  3ZT6 A;  1D0X A;  4LF4 T;  2Y0B G;  4YDW A;  5FZS A;  3C4X A;  5FXV A;  5FQ4 A;  3HDX A;  3KDS E;  4IRE A;  1YQ4 A;  3AA6 B;  5JQG E;  3RQU A;  3N2O A;  2CHZ A;  5HS0 A;  1MMG A;  2KWI B;  4H7X A;  1FEW A;  2E8I A;  2DVW A;  1LD7 A;  3JXI A;  4HTE A;  2WCA A;  3RSE G;  5JDQ A;  3HXB A;  4GK5 E;  4FJZ A;  4WZX A;  4DR5 T;  3UU5 A;  3P7I A;  4FHJ A;  4AEZ C;  3RO3 A;  2GRR B;  3I0Q A;  3ZYK A;  1J5E T;  4YSZ A;  3V5S A;  4DPR A;  2X9X A;  5L3E B;  1N32 T;  4AI6 A;  5M4Y A;  2WXG A;  4IL9 A;  5AQL B;  4EZJ A;  4EPZ A;  2CEA A;  5E0O A;  1OCC E;  4GTV A;  5ABF A;  2WQ7 A;  3TWV A;  4UUC A;  5LGU B;  2PNN A;  2JMK A;  2ODV A;  2I2O A;  4E7S A;  3HA4 A;  1FJG T;  2V5F A;  2WAU A;  2KBX A;  3LKU A;  3AAA B;  2B6C A;  1UK5 A;  2BKK B;  3I3N A;  3N5L A;  4OYK A;  1SQM A;  2VWA A;  3UQ3 A;  3FUD A;  4EAH A;  2I0M A;  4A3T A;  4PJM A;  4AXP A;  3DSX A;  4TUU A;  3RGL A;  3T1H T;  2GGF A;  4HWC A;  3MXZ A;  2ES0 A;  3BQO A;  2ZGD A;  3D9M A;  4BX9 A;  2V4H C;  2CXD A;  2WWV A;  5CA0 E;  3PUZ F;  3FZF B;  3IBE A;  2HR2 A;  3CST A;  2C5I T;  5KDM C;  3E32 A;  2UY1 B;  2PTF A;  3Q5M A;  4A63 B;  4BSX A;  2KCV A;  4G8L A;  2F0Y A;  1TNO A;  5C2Y A;  4DX5 D;  2XQ0 A;  3FUE A;  1ELK A;  3K9I A;  3VRB A;  3QC1 A;  5AN8 A;  5AYW D;  5EK4 A;  2H89 A;  1W9R A;  2FF4 A;  3Q78 A;  1OCO E;  2X6H A;  4ANW A;  1IQU A;  4HGA A;  3FU3 A;  5FNV E;  3LS8 A;  2WXN A;  2D0T A;  2RD0 A;  2UU9 T;  3LY7 A;  5AJD A;  1NEN A;  3U3I A;  2I9C A;  3RAU A;  2NTX A;  3FEX A;  3EI0 A;  4DR6 T;  4GTS A;  4BJN A;  4BWR A;  3CQC B;  3MKR A;  4HFH A;  4ABN A;  3LK4 2;  2JIW A;  2X67 A;  4EYY R;  3FU6 A;  3AU4 A;  4HXI A;  4U04 A;  4J8E A;  4CZ2 D;  5FQ6 A;  4BTB A;  2ACZ A;  1EZ3 A;  4IE7 A;  5LHH B;  3DEO A;  2E2E A;  5LB7 B;  2D5U A;  3HKC E;  3UIP C;  3RO2 A;  1JCR A;  1M7K A;  4JL0 A;  4DRX E;  2L6J A;  4GYW A;  2HHH T;  1ZBP A;  5JHA A;  4HQD A;  5D0O D;  3ZKJ A;  5ADX L;  3FBZ A;  2WXH A;  3ZKR A;  2K9A A;  2GRO B;  3FB2 A;  2XGM A;  3S4U A;  4JV5 T;  4NIK A;  1Z5S C;  5CCM A;  2W66 A;  1E7P A;  5D0Q D;  4MHC A;  4OX9 T;  3P1U A;  3SI5 A;  4C90 A;  4JLE A;  3VKH A;  3EDU A;  3AEG A;  3X1D A;  4ANU A;  4JEH B;  5HEO A;  5LJM A;  3CHR A;  4HWD A;  2H6H A;  2CBI A;  3QAQ A;  5G04 J;  2CHN A;  5ARF A;  2X6F A;  3C3R A;  3ZLI A;  2LM9 A;  4HFD A;  4ZS2 A;  5FMN A;  5AQO B;  2VKH A;  4O1P A;  3UTM A;  4V1A v;  4ZZC A;  1HXI A;  3QB5 K;  4PK6 A;  3QDN A;  3SFZ A;  2KIN B;  2CFU A;  2BS3 A;  4G24 A;  1E8Z A;  1GQE A;  2XHE B;  2XQ3 A;  4XIF A;  4CXY A;  3BQI A;  2DI4 A;  5HWX A;  2NP9 A;  4O4J E;  2OEV A;  4JI6 T;  1UOH A;  2WWU A;  5M72 A;  3AEB A;  5AQ7 A;  3SY2 A;  4JEH A;  5D66 A;  1H0A A;  4HN9 A;  1U3D A;  2E9X C;  3KV6 A;  4TWD A;  5JRC A;  1KFY A;  3J9X 1;  4WND A;  3PE3 A;  3WG7 E;  4HRN A;  4BY6 A;  2BBH A;  4H9P C;  3UQ7 A;  2QYJ A;  4QXC B;  4A5X A;  4B3S T;  1NFI E;  2BF0 X;  1KNZ A;  3KS2 A;  4XX5 A;  4JI8 T;  1OWO A;  3DST A;  1E90 A;  1JWF A;  1HR0 T;  3TWT A;  3CIA A;  4MS6 A;  4XZ4 A;  2VB6 A;  2OEW A;  4U8H A;  4MBG A;  5CEA A;  4G26 A;  1VDY A;  4CCA A;  2VQ2 A;  1SE7 A;  2EIK E;  5TAO A;  5HWY A;  3TLT A;  4CZZ B;  5FVK A;  3O9X A;  3ULQ A;  4ERR A;  3PZD A;  1D0Z A;  3FU5 A;  1QYM A;  5CB4 E;  5LOV E;  3C64 A;  4L23 A;  2P9N G;  2MYO A;  3Q9U C;  5CRU A;  2XPK A;  1D1A A;  3JQ0 A;  2KWH A;  2P58 C;  3ESK A;  3OJA A;  4OK0 A;  3KBT A;  3O1J A;  3ZVV A;  4UI9 J;  2FJE A;  4Y6W A;  4K0K T;  2LSU A;  4HLL A;  2V26 A;  3HXC A;  3UXG A;  3IHV A;  1TN7 A;  2QC9 A;  3N71 A;  2J62 A;  4FLB A;  4JI3 T;  2I6H A;  2WP9 A;  4IL4 A;  5DQV A;  4GTM A;  2BG9 C;  4ZOL E;  5AQB A;  3PUY F;  4DBQ A;  4JB8 P;  3UX4 A;  4U07 A;  1HFA A;  3LJN A;  3CGH A;  5ETW A;  1HS7 A;  4LMJ A;  3BG1 B;  5HEU A;  2W0G A;  5LCY A;  4H63 V;  4DMW A;  5FYM A;  2WQH A;  3HXE A;  3CVP A;  2CG2 A;  4I50 E;  3PEU B;  4F6R C;  3SZ7 A;  2P9L G;  1XDP A;  2VL0 A;  3K3N A;  3FTV A;  4ZZB A;  1H2V C;  3DEP A;  3RI5 A;  4G25 A;  4WNF A;  4A3V A;  5C1D A;  2Q9Q A;  4CDM A;  1XDO A;  5AQU B;  3EIJ A;  4JI2 T;  4K0R A;  4YJ2 E;  3UU6 A;  4PUC A;  3VKG A;  2F8Y A;  2L8K A;  3GWH A;  3E30 A;  3JC6 D;  4HOR A;  4IDP A;  4HOT A;  1Q2Z A;  4IE5 A;  1YKH B;  4AIS A;  4C48 B;  4YVO A;  3RYF E;  1WAO 1;  4PS3 A;  1IXV A;  3LYA A;  1MND A;  3TG4 A;  2NXP A;  3CX8 B;  4LRZ A;  2CXF A;  2XHE A;  3AEE A;  3RH3 A;  4RG9 A;  3V30 A;  1KZO A;  1D8E A;  4OHF A;  2VKO A;  2Y4U A;  3ZN3 A;  3EHM A;  1US7 B;  2PBI A;  4UIG A;  2VJ8 A;  4DV2 T;  1JNZ A;  2LT3 A;  3GZ2 A;  3T8K A;  2YNQ A;  2LM2 A;  2LE8 A;  3U64 A;  2YEV C;  1D1C A;  2UUB T;  1HNW T;  4HI8 A;  4MFR A;  4TNV A;  3FBL A;  3OPC A;  4LF5 T;  3O48 A;  5AQR B;  4ADZ A;  2H88 A;  1SA0 E;  2CCQ A;  3UT5 E;  1QSD A;  1CUN A;  4K03 A;  2LJL A;  4ISS A;  5AQG B;  5L3G B;  5J2T E;  4B3T T;  2M6I A;  5JDF A;  4B3M T;  3E0Z A;  5KXJ A;  5KMG P;  4HWF A;  5ENN A;  5AQA A;  4PNI A;  2KZT B;  3HXF A;  4HB5 A;  5KJM A;  2DIW A;  5DJQ C;  2UWJ G;  3WI3 A;  4KMC A;  3RIB A;  3LBX B;  5FIN A;  3AG3 E;  4HOU A;  1MMD A;  2L3L A;  3E33 A;  3IA3 A;  3Q5E A;  4GPM A;  2HYZ A;  4U33 A;  3G2U A;  3DRA A;  3HIZ A;  3BK9 A;  5G05 J;  4LER A;  1O1T A;  4ATZ D;  2V7K A;  3AE5 A;  3CHS A;  4BA9 A;  2IQC A;  2XSA A;  2XQ6 A;  3JAF A;  2XPZ A;  4X65 T;  4EXT A;  3ZUV B;  1ZHC A;  4IYP A;  1VRB A;  5FQ8 A;  3RF1 A;  2FUL A;  2RG8 A;  3RIU C;  4G2V A;  3V2O A;  3P2B A;  3GN5 B;  5JVD E;  4CN6 A;  4AQF C;  1YKE B;  4G1T A;  3KVB A;  2E9X B;  3QK0 A;  2CMR A;  3OXG A;  5HXS A;  2V7M A;  4ACL A;  4ILH B;  2ZM0 A;  1TNU A;  4U95 D;  1XNQ T;  5FVL A;  5JDG A;  1N52 A;  3N9L A;  3EJN A;  3FU0 A;  4IDN A;  5L4H A;  5HXR A;  1XNF A;  4UR9 A;  2UXB T;  5IUX A;  1YD8 G;  4DV5 T;  4ZI3 C;  2J49 A;  4JEU B;  2BKO A;  3AS8 A;  3DSV A;  4IT4 A;  3S7D A;  5AJL A;  3ONJ A;  2KCL A;  2VKD A;  2D0U A;  3FH5 A;  5EN5 D;  3TWW A;  2DNX A;  4AY6 A;  3MZL B;  5L4E A;  2V5Q C;  4TUM A;  1HCI A;  3SBS A;  5J0Z A;  2Q9Q D;  3AE4 A;  4MBQ A;  3JXJ A;  4LEU A;  2I1J A;  3UT8 A;  3NRY A;  1KF6 A;  5FTP A;  2R59 A;  3BU8 A;  1K1A A;  2ZIR A;  4KHP T;  3CVL A;  4JBW F;  2V6X A;  2WB2 A;  3DPY A;  5EID A;  3PTR B;  4ILI A;  4E85 A;  3JC6 C;  2DL1 A;  3N2K E;  3ABL E;  3LY9 A;  1OXZ A;  3S2A A;  3VRA A;  5GON E;  1OY3 D;  3G2T A;  1TEZ A;  4DX2 A;  3UIO C;  5JR9 A;  4DVD A;  3AAA C;  4CYM D;  2Y8D A;  1TYQ G;  4B8A A;  3MCX A;  1MIV A;  3QOU A;  1BR0 A;  2IHR 1;  3PUX F;  4KMO A;  2A3D A;  3KFW X;  5EX3 A;  4BT8 A;  1SW6 A;  4H9O C;  5AQ9 A;  3APD A;  5HQ8 A;  4KYO B;  3ULE G;  2C5J A;  5A23 A;  4HS2 A;  5LP0 A;  1BR4 A;  5F8P A;  4G63 A;  1KEY A;  3UQ4 A;  4X1I E;  3SO8 A;  3VLE A;  5AEN A;  1IBM T;  4DUI A;  5CCL A;  1NZN A;  2X0Y A;  2DWG A;  4M3O A;  3FUL A;  3I4R B;  4OYJ A;  3LDZ A;  4X64 T;  3ZYL A;  4YDO A;  3RJV A;  4XKB A;  3TG5 A;  4BT9 A;  2J4D A;  4M7C A;  3IV0 A;  1LRZ A;  2EQX A;  4UQY A;  2QRX A;  3NZU A;  4X1K E;  4XI9 A;  4U74 A;  5JHB A;  3UUX B;  2QZA A;  3Q2M A;  4K5B A;  1E8W A;  4TX5 A;  4WBN E;  4OFZ A;  3PUA A;  5AQQ B;  5AQT B;  2XAG B;  3KIN B;  4JYA T;  3K8P C;  4CEM A;  2V5C A;  4ILC A;  3FTU A;  4BSZ B;  4GTR A;  3VTX A;  3ONK A;  2OVF A;  4XE0 A;  5DIZ A;  2P9S G;  2WMN A;  4TZ4 C;  2JJ9 A;  3K3O A;  4TV9 E;  4DV6 T;  2MAW A;  3CIR A;  1KK7 A;  3TKL B;  1Z0P A;  3U78 A;  3ZCJ A;  3HYM B;  1H6K A;  5CBN A;  2FJD A;  3ZMT B;  1OWP A;  2LSV A;  2B0O E;  5BNW A;  2GRL A;  3B7T A;  3UMV A;  2X66 A;  4ILU A;  4WBO A;  4JI7 T;  2QVA A;  2NTY A;  2IW5 B;  3CHP A;  4AKL A;  4I6J A;  4X5T A;  3QB5 A;  4JC8 A;  3F31 A;  4KBM B;  4F1P A;  1K3Z D;  1BR1 A;  4GTP A;  5F3J A;  1QBQ A;  4UVC B;  2H7O A;  5E75 A;  3UPV A;  4GKK T;  1BI7 B;  3UUX A;  5IWA T;  4P0A A;  1ELW A;  2B1E A;  2QYU A;  2IDO B;  2MOZ A;  3CWZ B;  4XEI G;  3PDY A;  1UCU A;  3T9K A;  4IHJ E;  1MNE A;  3DTO A;  4UF0 B;  3QNU A;  5FQ7 A;  2M6B A;  3EHN A;  4WAF A;  3ABK E;  2XPY A;  5FY1 A;  3PUW F;  1N36 T;  2KLQ A;  3I4G A;  5HYA A;  3RRU A;  4P09 A;  4UVB B;  3N9P A;  1OED B;  3UUB A;  3WAK A;  2IOS A;  2MPK A;  2ODU A;  3UFE A;  2JMH A;  5EK2 A;  4J8S A;  5JMN D;  5HCM A;  2X6I A;  5BXU A;  2ZIS A;  4YJ3 E;  5L3B B;  1W09 A;  3Q47 B;  5HXC A;  1HG2 A;  4CXX A;  2XEH A;  4P1N A;  1X5B A;  3L08 A;  1Y8M A;  2K3W A;  5AQH B;  3Q7F A;  3LVQ E;  3JCF A;  1H6O A;  4IE0 A;  1UN9 A;  3FTZ A;  2X38 A;  2UY1 A;  2VUR A;  3HR0 A;  4KX6 A;  3RC8 A;  3C4W A;  3LJC A;  3PU3 A;  1WCR A;  4IDQ A;  1DVP A;  4IN3 B;  4CDN A;  4TWF A;  3F2E A;  2FJB A;  4NPP A;  3MYV A;  1S64 A;  3AE6 A;  4NIQ A;  3FUK A;  5J2U E;  2BS2 A;  3G06 A;  4L2L A;  3FEY A;  3RKG A;  3G2S A;  4KZ0 A;  1W3B A;  5L47 A;  4LF7 T;  1KNP A;  5BMV E;  4TRQ A;  4WNE A;  3B7S A;  3R7Q A;  4I43 B;  2AXU A;  4A1S A;  2XZD G;  4FU3 A;  1FCH A;  4YFS A;  3E4B A;  5G55 A;  1S35 A;  3LK2 B;  2PL2 A;  5HEG A;  3ASG A;  3LBX A;  4G11 A;  3OXL A;  2HN1 A;  1WYC A;  4EBA G;  2GRN B;  5EYP F;  1SA5 A;  4AQY T;  3SGH A;  5KCM A;  2IJG X;  5J1G A;  4JW1 A;  4N78 D;  2NW7 A;  3JCK C;  2BTD A;  4CN1 A;  4LUN U;  2UUC T;  4HE8 A;  3VTY A;  4IRU A;  4AKI A;  3RRM B;  4L2Y A;  3N9M A;  4NXM T;  4HVB A;  3I9W A;  1WLX A;  1X81 A;  4HRM B;  3U9W A;  1FMV A;  2C0S A;  4PH4 B;  4XAX B;  4HNA D;  5T4Y A;  3PUS A;  4PK4 A;  5J08 A;  3D3M A;  5KWD A;  2FBW A;  4OVV A;  4GIW A;  2YIN A;  3CQX C;  4U7Y A;  5JH7 E;  4TNW A;  4JI1 T;  2RA1 A;  3RYH E;  4ZI2 C;  3S7B A;  3EU9 A;  3HI2 A;  3UUM A;  4ILA A;  1L0V A;  3B7R L;  2V6Y A;  1SVX A;  3HVE B;  2XSB A;  2W67 A;  4QXB B;  4QFV A;  4ANV A;  3L13 A;  4F7A A;  4U7E B;  1LD8 A;  2L9Q A;  2KT9 A;  3MV2 B;  5FP3 A;  1Z3Y A;  4QKN A;  4C9B B;  2A9U A;  3ASN E;  4XZC A;  5J90 A;  1D0Y A;  2UXX B;  5AQJ B;  4QH4 A;  2JLB A;  3KBU A;  4NXN T;  3L54 A;  2VYI A;  3ZJ2 A;  2LHN A;  3ZJ1 A;  5FL1 A;  2WXF A;  2VGX B;  3IHY A;  3ONL A;  4GZC A;  2Q9Q B;  4CN4 A;  2R5S A;  3U4T A;  3I9Y A;  3L39 A;  3OBV E;  1P5Q A;  3GMI A;  5JR9 C;  3PZ4 A;  4N3A A;  1DU2 A;  1N4Q A;  3LVR E;  4L5G A;  5EDS A;  2LKG A;  4BES A;  1KZP A;  1KNR A;  3BG0 B;  2P9B A;  3FUM A;  4GTT A;  2DZO A;  2V7J A;  3QK6 A;  5CFB A;  3APC A;  5G05 C;  4NQ0 A;  3OYX A;  4GTQ A;  4B93 B;  5H7P A;  4GZD A;  3RYC E;  2M63 A;  2ZM2 A;  3FXD B;  5C3J A;  1INZ A;  3DBS A;  4UV9 B;  1HH8 A;  5HXH A;  2NSZ A;  2QY7 A;  3P4Q A;  3PUV F;  1NP7 A;  2WXL A;  3W15 B;  4I4T E;  3TWS A;  1IJ6 A;  3LPZ A;  1VCT A;  1TN6 A;  4KT6 B;  4RG6 A;  3MK7 C;  1V55 E;  3S7J A;  4UV8 B;  2YK0 A;  5FT9 A;  5AQM B;  4JI0 T;  3AVS A;  3AE2 A;  5BUZ A;  4AKH A;  2Q7F A;  4JI4 T;  4O4L E;  3ESL A;  2ZLY A;  5FL0 A;  3MKQ A;  3SFY A;  4A1G A;  3C72 A;  3AG4 E;  1Y01 A;  1HZ4 A;  2WU5 A;  2BKP A;  1BPO A;  4GZ5 A;  4BX8 A;  3CSF A;  4DBR A;  5FXW A;  2CLY C;  4O60 A;  2VKJ A;  3P50 A;  2XEE A;  2L0T B;  4Q25 A;  4HEA A;  4AM9 A;  3V2X A;  2NOX A;  3QWP A;  5HKP A;  3C98 A;  1AP7 A;  2LSG A;  3VLD A;  3NZS A;  2HPL A;  1MX2 A;  5EIB E;  2X9W A;  2IUB A;  2RFA A;  3OKQ A;  4EZH A;  4L7T A;  1MX4 A;  1YQ3 A;  4XI0 A;  4N2S A;  4AJW A;  5F5W A;  1HU3 A;  3FUH A;  2EHO B;  4DND A;  4I2W A;  5FY7 A;  3ZPJ A;  3O4Z A;  3PUR A;  4DK5 A;  1UX4 A;  1IZN B;  2DYS E;  5L3D B;  2PM6 A;  4WNG A;  5H6R B;  1YXR A;  1XNR T;  4NUU A;  2KCK A;  3BEE A;  1GW6 A;  2CFZ A;  1AWC B;  3ABV A;  3LDQ B;  4LF6 T;  4I1O B;  1R8I A;  1CHU A;  3A5X A;  1VCS A;  4O8S A;  2E2A A;  5ANL A;  1NWM X;  4QQI A;  3DJB A;  5A7D B;  2VTB A;  2CWO A;  3SF4 A;  2FEZ A;  1KPS B;  3ZC0 A;  4U3C A;  4ZXL A;  1XGW A;  1QLB A;  2LO6 A;  2Y1L E;  4B8C B;  2MBG A;  3TXM A;  2IFU A;  2FI7 A;  2Y6X A;  4UWG A;  4PFO A;  1Y6I A;  4WWP A;  2VSO E;  3NRX A;  4GKJ T;  3L82 A;  4YDY A;  4J0U A;  4B94 A;  3CX6 B;  3AE9 A;  4UI9 C;  2ZMA A;  3RQW A;  1Z6T A;  2P9U G;  5JJT A;  2JEK A;  4FLH A;  4DV3 T;  1QUU A;  4EHM A;  2IU1 A;  4UWK A;  4G8K A;  2WDV A;  2KM4 A;  2C0M A;  1E1H B;  4U2Y A;  1PC2 A;  1N94 A;  2D2S A;  3NBX X;  3LCA A;  4ZI3 D;  3JQ1 A;  5BW8 C;  1H6P A;  3E22 E;  4YHJ A;  2V4L A;  3APF A;  5C8Y E;  3JAD A;  4LMK A;  2QGS A;  2X68 A;  2VSX E;  4X66 T;  4EZL A;  2PG8 A;  2XY8 B;  4FAD A;  1DCE A;  2Q9Q C;  2X6J A;  5FWQ A;  4HFB A;  3SFE A;  4H9R C;  3CVU A;  2L6B A;  2KXP B;  1S63 A;  2VGY A;  2Z6E A;  4HI9 A;  5ENQ D;  1PY1 A;  2H6G A;  4GYR A;  1WDY A;  3CQG B;  4I9E A;  2CA5 A;  4WYV A;  4LF8 T;  3C98 B;  3AE8 A;  1TNB A;  3Q7A A;  2LEH A;  1N34 T;  2J08 A;  2WZI A;  4DR1 T;  2JQH A;  2IO2 C;  3H3A A;  3BQL A;  2XCB A;  3OAW A;  2VSN A;  3ZN1 B;  2WXR A;  2BBJ A;  1KT0 A;  5LGT B;  3FXE B;  3FUF A;  1IKN D;  2W61 A;  1IYG A;  4X62 T;  4YTN A;  1HX1 B;  3CVQ A;  3TWU A;  2WQ6 A;  1HX8 A;  4L9I A;  4H9N C;  3CVY A;  2CHO A;  3RC3 A;  5LHI B;  5IY5 E;  3ASF A;  2E9X D;  5G04 C;  3NOG D;  1ZU2 A;  2XGO A;  4ZHQ E;  2CLY B;  1OWL A;  3L16 A;  3RRN B;  2Y69 E;  2LRK A;  3AU5 A;  3SQV A;  1IBL T;  1OT8 A;  3ULY A;  1LF8 A;  4IDZ A;  1TR4 A;  2LKH A;  1JUQ A;  3VR9 A;  3FY4 A;  3RK6 A;  2X9Y A;  3P8C D;  1L5J A;  1FT2 A;  5KJK A;  1ZEE A;  3FFL A;  3UM3 A;  1T98 A;  3QB2 A;  3LJ3 A;  4ANJ A;  4URK A;  2YHC A;  4UEL A;  2E5L T;  4UI9 K;  1M62 A;  3FZM B;  4ZFH A;  1OUV A;  5BPP A;  1IHG A;  2DYR E;  4B89 A;  1SZ9 A;  1XZY A;  4N5C A;  2H7V C;  2QFC A;  2PFV A;  4JHJ A;  4DMV A;  3GN5 A;  4O4I E;  3PNL B;  1K1B A;  4RLY A;  3ZXP A;  2F4V T;  5A6C A;  4QXH B;  5FZR A;  3ETV A;  3D9J A;  4O1O A;  2VVN A;  4ZEY A;  1NAF A;  3QUJ A;  4QH5 A;  4R7L A;  2KND A;  4GYO A;  4H9S E;  5AIJ A;  3E37 A;  3EAB A;  3PVL A;  1OXJ A;  2EHO A;  2XGS A;  2I1K A;  3CK9 A;  2H6F A;  1DNP A;  4ZS3 A;  5L3C B;  2R05 A;  3BUA A;  4KZC A;  3MEK A;  5G2N A;  4DR4 T;  2C0L A;  1BD8 A;  4GTO A;  3WAJ A;  3PDN A;  3FH7 A;  3RRW A;  3TWQ A;  3C51 A;  5A1L A;  2XRZ A;  1QZ2 A;  5JTG A;  4HFI A;  1V54 E;  1YMP A;  5KJL A;  4EQF A;  1HTJ F;  2VAS A;  2YDR A;  2EIM E;  4I17 A;  2IO3 C;  2UXN B;  5E76 A;  3ANW A;  3C5R A;  3V5U A;  2CXL A;  3C3Q A;  3T1Y T;  2PJQ A;  4DX1 A;  2HE0 A;  2ILR A;  2BVM A;  4GU5 A;  3AED A;  3LG7 A;  2AJA A;  1Z8U A;  1IHB A;  4FP7 A;  3SFD A;  2V6Y B;  3AA1 B;  3AAE B;  3NWI A;  4Z8X A;  5HI7 A;  4EEB A;  4PJJ A;  2F8X K;  1EF1 C;  4U8V D;  5KJN A;  2WXQ A;  3RLF F;  2PM7 A;  1N4S A;  2KXP C;  2EIN E;  3Q5W A;  2KAT A; 
#chains in the Genus database with same CATH homology
 2MYS A;  4U72 A;  4BTA A;  1HO8 A;  4DI3 A;  3I5P A;  5FXX A;  3D9L A;  2GW1 A;  5L3F B;  3LFM A;  2OOE A;  4WNK A;  3CKD A;  1LVK A;  5AFU L;  2J09 A;  2NW8 A;  1VOM A;  4XBF B;  3TXN A;  3IHR A;  3KVA A;  1MQS A;  4JZY A;  3AB3 B;  3UTK A;  3RRC A;  2XRY A;  3MJX A;  3WXX A;  3R7R A;  3AS4 A;  1HS6 A;  4I43 A;  1HE8 A;  5LBM A;  4AVX A;  4GML A;  3Q4A B;  5LXT E;  4GYS A;  5LBQ B;  2MHK A;  3AS5 A;  5LX8 A;  3TJP A;  2WSS V;  2LOS A;  3MKD A;  2KMF A;  4HKA A;  4KBQ A;  4APO A;  4KXK B;  2LSJ A;  4CGW A;  4EB6 E;  2NWB A;  3ZCI A;  3MX3 A;  4GCN A;  1H2U A;  1UJK A;  4AKG A;  2WM9 A;  3ZMV B;  2DCF A;  3VU7 H;  2WVI A;  4A55 A;  2XAS B;  3AA7 B;  3D9P A;  2JRK A;  4FJO A;  3G2W A;  3FDH A;  5IHY A;  4J8F A;  2V1D B;  3EUH A;  1FVH A;  3SNX A;  1S0P A;  3KD7 A;  4BJM A;  3ZGQ A;  3ZMU B;  4EOZ B;  3Q9D A;  4ASK A;  4ZI7 E;  3KAE A;  5LCW J;  2BDE A;  2X9H A;  3ZYM A;  4TV3 A;  1EYH A;  4CI3 B;  1UX5 A;  5EX0 A;  2A72 A;  4XKC A;  2CE7 A;  2XTL A;  4Q96 A;  5LP6 E;  4UQZ A;  4JHK A;  1FMW A;  3L17 A;  2WXM A;  3N2G E;  2IC9 A;  2C5K T;  3T8O A;  4GZ3 A;  1UW4 B;  4JVS A;  3RX6 A;  2M67 A;  2IOL A;  3FWV A;  4M1P A;  3HVE A;  4RVB A;  5LGN B;  4CT0 A;  2V0P A;  3N9Q A;  1N54 A;  5HXE A;  4O4H E;  4FUL A;  1O3X A;  4C0E A;  4BAY B;  4AOF A;  4O2A E;  1G8X A;  3G2V A;  4AP2 A;  4B0Z A;  5CHE E;  3OYZ A;  2AWI A;  2J1D G;  4HLE A;  3ZPO A;  5CMW A;  1G73 A;  3CK8 A;  1U4Q A;  3CVX A;  3DP7 A;  3S7F A;  4DI4 A;  3ZHE B;  4CGV A;  4F3V A;  3ML8 A;  4AY5 A;  4G2A A;  3AAI A;  5FY0 A;  1E7V A;  4OVU A;  4PS8 A;  5FJY A;  3OXF A;  3SBT B;  3FTW A;  3GYZ A;  3FUN A;  3PUK A;  3IEE A;  4GK0 E;  4GOU A;  2JPF A;  4IE4 A;  3MZK B;  2W00 A;  3U3W A;  4E6H A;  2OVB A;  3EIQ C;  4I9C A;  2LNI A;  5BV0 A;  4L0R A;  3RYI E;  2LAH A;  3VLF A;  3ML9 A;  3NF1 A;  1ELR A;  3Q5X A;  5T3R A;  2HM8 A;  3AVR A;  3C50 A;  4AIF A;  4JEU A;  3DPD A;  1YA0 A;  3PRE A;  4UWH A;  4H9Q C;  3D9N A;  1NA3 A;  3RKV A;  3E08 A;  2NC9 A;  3FTS A;  2QA7 A;  1BR2 A;  1MIW A;  2IC6 A;  4JHR A;  4D10 C;  4Q69 A;  2DWK A;  4UEM A;  4I2Z A;  4PDX A;  3SWH A;  3NZQ A;  1OWN A;  3CHO A;  2LSY A;  4QHO A;  4NAC A;  2XAH B;  3CX7 B;  3FH8 A;  3ONX A;  1TJF A;  3GZS A;  4MLP A;  2W62 A;  3D9O A;  3CVN A;  3N9N A;  4O6F A;  3D9I A;  1JPL A;  5DQW A;  4KVO A;  1Z3X A;  4H7Y A;  2N1G A;  2VTB B;  5JDH A;  2X0L B;  2L9B A;  3F57 A;  4J8D A;  3ZIM A;  2LSK A;  4PW8 A;  4JPS A;  2FO7 A;  2J07 A;  3QKY A;  3ZRH A;  3IF8 B;  2LOP A;  4N3C A;  2XAJ B;  3ZHE A;  4NRH B;  3FUJ A;  2HO1 A;  5KX5 E;  1PAQ A;  3PS6 A;  4JA9 A;  3MGB A;  3CHQ A;  2XAF B;  2H3R A;  4ATG A;  3ZFW A;  3TAX A;  2K48 A;  1AJ3 A;  3HKB E;  2PZI A;  2V7I A;  4ME2 A;  4O2B E;  5JRE A;  3PH0 C;  1WRD A;  3IBP A;  4L1B A;  4NUV A;  4U0U A;  2MTQ A;  4J2C A;  2WXI A;  4FHK A;  3JUI A;  1LVF A;  5FZQ A;  3MAC A;  4QX8 B;  2YU2 A;  1MHQ A;  1KT1 A;  3EDV A;  3ZC1 A;  4GA0 A;  3U66 A;  5JDN A;  3LEW A;  3SHF A;  1QQE A;  4CI2 B;  2V8S E;  4U0Z A;  3RU0 A;  3PE0 A;  3CEQ A;  3H37 A;  4H63 H;  2DCP A;  4J6I A;  4UVA B;  3PUJ A;  4GZ6 A;  3URZ A;  3MV3 B;  3N9O A;  2J4B A;  1QNF A;  4FC8 A;  2XCC A;  3SOL A;  1E8Y A;  2XUE A;  2E9X A;  2VL8 A;  4B6X A;  3CLJ A;  3CVW A;  5CMY A;  3CML A;  2HH7 A;  2SPC A;  4UWF A;  4UXN B;  1V9D A;  3FP3 A;  2WMO A;  4YLH A;  4U63 A;  3NQP A;  3J7Y q;  3EVY A;  2V7L A;  4GPK A;  2XAQ B;  3KV9 A;  2A5U A;  1TJC A;  4CRW A;  4EIW A;  1S94 A;  2VK9 A;  2C2L A;  5BT1 A;  2W63 A;  5JDL A;  4FA6 A;  4ACK A;  2Y3A A;  4WWO A;  2WXO A;  3M65 A;  3SD5 A;  1UN8 A;  2CHX A;  2GRM A;  3B57 A;  3KV4 A;  4APF A;  4TN7 B;  1D1B A;  2Y4T A;  2EHO D;  2CHW A;  2J9Q A;  4FI5 A;  3RPU A;  1U3C A;  3QC9 A;  3PUG A;  2ACX A;  4I55 E;  2PQN A;  1A17 A;  4WWN A;  2BZB A;  3QWV A;  2DBA A;  4ZI2 D;  5JDM A;  3D9K A;  4EYU A;  3ASH A;  3TGO A;  4CI1 B;  4AV7 A;  2GK9 A;  3PE4 A;  2VGX A;  5LG4 A;  4UF0 A;  4TV8 E;  2HPJ A;  4KP3 C;  1WYB A;  3QJZ A;  1H2T C;  3FTY A;  3CKC A;  2YHE A;  3LY8 A;  4GA1 A;  2MOW A;  3VHL A;  1UJJ A;  3QWW A;  3ANW B;  2AXV A;  3I1A A;  4CDR A;  2ZU6 B;  3IEG A;  2KC7 A;  3MJW A;  2XPI A;  3HKE E;  3FTX A;  1WM5 A;  5FXZ A;  3Q15 A;  3QNK A;  2AXZ A;  4Y6C A;  4JXT A;  1Y64 B;  3HKD E;  4P0B A;  5LNK A;  2KZT A;  3UUL A;  3HHM A;  1MIY A;  1HG5 A;  2FBN A;  3T5X A;  1JWG A;  3ETU A;  3ZEF B;  2Y48 B;  3CV0 A;  4QX7 B;  4GMJ A;  1ZV4 X;  4G23 A;  3O1I A;  3T8M A;  3R84 B;  2ION A;  4NUR A;  2WXJ A;  3B13 A;  4X1Y E;  4GAA A;  4C0M A;  3K3Q C;  2PQR A;  1WR6 A;  2WBL A;  3KEZ A;  5EK3 A;  3O1H A;  1IAP A;  3R6N A;  5BV1 A;  3UT4 A;  4IE6 A;  3Q49 B;  4PJN A;  4N2Q A;  4CXW A;  3ZN0 B;  3PNT B;  4F53 A;  1H7C A;  4AQG A;  2G0U A;  3OTN A;  3LXU X;  5IYZ E;  5LYJ E;  2YU1 A;  5LOZ A;  3B7U X;  1MMN A;  4RSY A;  3UT7 A;  4IGU A;  5HAX A;  2L0I A;  3BQK A;  2ZM8 A;  2N9D A;  4W9R A;  3ZYQ A;  2X51 A;  2E0I A;  4JA7 A;  1NA0 A;  1EDU A;  3PEV B;  5LJN A;  2AVP A;  4HOS A;  3MKQ B;  3PU8 A;  3O4X E;  1KLX A;  3NZP A;  3PRZ A;  5ANR A;  4FJY A;  1B89 A;  2I59 A;  4CT4 A;  4EEC A;  2CM0 A;  4QWN B;  1FVF A;  2JQQ A;  3D0T A;  3C4Z A;  4JUY A;  2X6K A;  2BVL A;  4ANX A;  5DBK A;  3ZXS A;  1E7U A;  5LA6 E;  3SRZ A;  2OA5 A;  2CWY A;  3UUN A;  4HOQ A;  1IJ5 A;  1MMA A;  4TUY E;  4MAL A;  4IST A;  5DAB A;  4DLO A;  3GA8 A;  4DJA A;  4DO0 A;  4LCT A;  3ZEF A;  3R9A B;  4ILG A;  3L22 A;  3CR3 A;  2LSI A;  3L3P A;  4KVM A;  5T8I A;  2OV8 A;  5JR9 B;  4N3B A;  2LAI A;  5L2L A;  2A2F X;  4U0S A;  3QAR A;  2WPV A;  5JJ7 A;  4V3I A;  3CPZ A;  5JRC B;  4HFG A;  4OYS A;  5JJ6 A;  3HL6 A;  2K5B B;  2DLR A;  4WW0 A;  2WXK A;  1H19 A;  4F1S A;  5LFA A;  1HF8 A;  3CVR A;  4IIJ E;  1SZA A;  4GCO A;  1YW0 A;  2K24 A;  2IF4 A;  2LHR A;  3JYS A;  3CVV A;  3T5V A;  1ZKE A;  3ZMZ B;  3KV5 A;  4CQI A;  1LKX A;  3TL5 A;  4HFV A;  5EZY E;  1U5P A;  3SS1 A;  4DLQ A;  5LHG B;  4PJL A;  3GW4 A;  4PFP A;  3CKB A;  3ASD A;  5CA1 E;  2IAK A;  3FHN A;  4E7Z A;  5ARG A;  4N39 A;  4I6E A;  2X3M A;  4PK5 A;  1IQR A;  4YND A;  2EHO C;  3PUQ A;  4P29 A;  2WXP A;  3RKO A;  4K0U A;  4Q94 A;  4AKR B;  2KZ7 B;  4MRU A;  4I1A A;  1EPU A;  3I0O A;  4UQX A;  4I6G A;  2NW9 A;  4EZ4 A;  4KUM B;  4MLK A;  3GZ1 A;  4PAG A;  5EKQ D;  4EBA A;  2DHR A;  1B7T A;  3ZMS B;  2R17 C;  4AQF A;  2CG3 A;  4GYY A;  1OWM A;  2VSY A;  3CHM A;  2YQ8 A;  2N2N A;  5H6Q B;  1SHZ C;  5LCW C;  2OND A;  3LK3 B;  1UG3 A;  4YVQ C;  4IUL A;  3FHE A;  2XEV A;  3EDT B;  1WY6 A;  4GA2 A;  1OWA A;  2MRI A;  4UWL A;  2BUG A;  4WUY A;  3MA5 A;  4C91 A;  1E8X A;  1E96 B;  4PS7 A;  3CK7 A;  3IKO B;  2RP4 A;  4I1M A;  3MA9 A;  2AW6 A;  3AA0 B;  2XQY A;  4GB9 A;  4AXH A;  3FUI A;  4MKT A;  3ZW3 A;  4X20 E;  1X79 A;  4BFR A;  3ENE A;  3L09 A;  4EZK A;  4A56 A;  1FIO A;  2A4Z A;  3L6A A;  1D0X A;  5FZS A;  3C4X A;  5FXV A;  5FQ4 A;  3HDX A;  3KDS E;  3AA6 B;  5JQG E;  2CHZ A;  3N2O A;  1MMG A;  2KWI B;  4H7X A;  1FEW A;  2E8I A;  4HTE A;  5JDQ A;  4GK5 E;  4FJZ A;  3P7I A;  4FHJ A;  4AEZ C;  3RO3 A;  3I0Q A;  3ZYK A;  3V5S A;  4DPR A;  2X9X A;  5L3E B;  5M4Y A;  4AI6 A;  2WXG A;  4EZJ A;  4EPZ A;  2CEA A;  5E0O A;  2WQ7 A;  5LGU B;  2JMK A;  2ODV A;  2I2O A;  4E7S A;  3HA4 A;  2V5F A;  2WAU A;  3LKU A;  3AAA B;  3I3N A;  3N5L A;  4OYK A;  1SQM A;  2VWA A;  3UQ3 A;  3FUD A;  4EAH A;  4A3T A;  4PJM A;  4AXP A;  4TUU A;  2GGF A;  3MXZ A;  2ES0 A;  3D9M A;  4BX9 A;  2CXD A;  5CA0 E;  3IBE A;  2HR2 A;  3CST A;  2C5I T;  5KDM C;  2UY1 B;  3Q5M A;  4BSX A;  2KCV A;  5C2Y A;  2XQ0 A;  3FUE A;  1ELK A;  3K9I A;  3QC1 A;  5AYW D;  5EK4 A;  2FF4 A;  2X6H A;  4ANW A;  1IQU A;  4HGA A;  3FU3 A;  5FNV E;  3LS8 A;  2WXN A;  2D0T A;  2RD0 A;  3LY7 A;  5AJD A;  3U3I A;  2I9C A;  2NTX A;  3FEX A;  4BJN A;  4BWR A;  3CQC B;  3MKR A;  4ABN A;  3LK4 2;  2X67 A;  4EYY R;  3FU6 A;  3AU4 A;  4HXI A;  4U04 A;  4J8E A;  5FQ6 A;  4BTB A;  1EZ3 A;  4IE7 A;  5LHH B;  2E2E A;  2D5U A;  3HKC E;  3RO2 A;  4JL0 A;  2L6J A;  4GYW A;  1ZBP A;  5JHA A;  5D0O D;  5ADX L;  3FBZ A;  2WXH A;  2K9A A;  3FB2 A;  2XGM A;  3S4U A;  5CCM A;  5D0Q D;  4MHC A;  3P1U A;  3SI5 A;  4C90 A;  4JLE A;  3VKH A;  3EDU A;  4ANU A;  4JEH B;  5LJM A;  3CHR A;  3QAQ A;  5G04 J;  5ARF A;  2X6F A;  3ZLI A;  2LM9 A;  4ZS2 A;  5FMN A;  2VKH A;  4V1A v;  1HXI A;  3QDN A;  4PK6 A;  3SFZ A;  2KIN B;  2CFU A;  4G24 A;  1E8Z A;  2XHE B;  4XIF A;  4CXY A;  3BQI A;  2DI4 A;  5HWX A;  2NP9 A;  4O4J E;  2WWU A;  5M72 A;  4JEH A;  1H0A A;  4HN9 A;  1U3D A;  2E9X C;  3KV6 A;  5JRC A;  3J9X 1;  4WND A;  3PE3 A;  4BY6 A;  4H9P C;  4QXC B;  2BF0 X;  1KNZ A;  3KS2 A;  4XX5 A;  1OWO A;  1E90 A;  1JWF A;  3CIA A;  4MS6 A;  4XZ4 A;  2VB6 A;  4U8H A;  4G26 A;  1VDY A;  4CCA A;  2VQ2 A;  5TAO A;  5HWY A;  4CZZ B;  3ULQ A;  3O9X A;  4ERR A;  3PZD A;  1D0Z A;  3FU5 A;  5CB4 E;  5LOV E;  3C64 A;  4L23 A;  1D1A A;  3JQ0 A;  2KWH A;  2P58 C;  3ESK A;  3OJA A;  4OK0 A;  3KBT A;  3O1J A;  3ZVV A;  4UI9 J;  4Y6W A;  2LSU A;  2V26 A;  3IHV A;  3N71 A;  4FLB A;  2I6H A;  5DQV A;  4ZOL E;  4DBQ A;  3UX4 A;  4U07 A;  1HFA A;  3CGH A;  5ETW A;  1HS7 A;  3BG1 B;  2W0G A;  5LCY A;  4H63 V;  4DMW A;  5FYM A;  2WQH A;  3CVP A;  2CG2 A;  4I50 E;  3PEU B;  4F6R C;  3SZ7 A;  3K3N A;  3FTV A;  4WNF A;  1H2V C;  4G25 A;  4A3V A;  5C1D A;  2Q9Q A;  4CDM A;  3EIJ A;  4K0R A;  4YJ2 E;  4PUC A;  3VKG A;  2L8K A;  3GWH A;  3JC6 D;  4HOR A;  4HOT A;  4IE5 A;  1YKH B;  4YVO A;  3RYF E;  1WAO 1;  4PS3 A;  3LYA A;  1MND A;  3TG4 A;  2NXP A;  3CX8 B;  4LRZ A;  2CXF A;  2XHE A;  3RH3 A;  4RG9 A;  4OHF A;  2VKO A;  2Y4U A;  3ZN3 A;  3EHM A;  1US7 B;  2PBI A;  4UIG A;  2VJ8 A;  2LT3 A;  3GZ2 A;  2YNQ A;  2LE8 A;  3U64 A;  2YEV C;  1D1C A;  4MFR A;  3FBL A;  3O48 A;  4ADZ A;  1SA0 E;  2CCQ A;  3UT5 E;  1QSD A;  1CUN A;  4K03 A;  2LJL A;  4ISS A;  5L3G B;  5J2T E;  5JDF A;  3E0Z A;  5KMG P;  5ENN A;  4PNI A;  2KZT B;  5KJM A;  2DIW A;  5DJQ C;  2UWJ G;  3WI3 A;  4KMC A;  3RIB A;  3LBX B;  4HOU A;  1MMD A;  2L3L A;  2HYZ A;  3G2U A;  3HIZ A;  3BK9 A;  5G05 J;  4LER A;  2V7K A;  3CHS A;  4BA9 A;  2IQC A;  2XPZ A;  4EXT A;  1ZHC A;  4IYP A;  1VRB A;  5FQ8 A;  2FUL A;  2RG8 A;  4G2V A;  3P2B A;  3GN5 B;  5JVD E;  4AQF C;  1YKE B;  4G1T A;  3KVB A;  2E9X B;  3QK0 A;  2CMR A;  3OXG A;  5HXS A;  2V7M A;  4ACL A;  4ILH B;  2ZM0 A;  5JDG A;  1N52 A;  3N9L A;  3EJN A;  3FU0 A;  5HXR A;  1XNF A;  1YD8 G;  4ZI3 C;  2J49 A;  4JEU B;  3AS8 A;  3S7D A;  5AJL A;  2KCL A;  2VKD A;  2D0U A;  3FH5 A;  2DNX A;  4AY6 A;  3MZL B;  1HCI A;  3SBS A;  2Q9Q D;  4MBQ A;  4LEU A;  2I1J A;  3UT8 A;  3NRY A;  5FTP A;  2R59 A;  3CVL A;  2WB2 A;  3PTR B;  4ILI A;  4E85 A;  3JC6 C;  3N2K E;  3LY9 A;  1OXZ A;  3S2A A;  5GON E;  3G2T A;  1TEZ A;  5JR9 A;  4DVD A;  2Y8D A;  4B8A A;  3MCX A;  1MIV A;  3QOU A;  1BR0 A;  5EX3 A;  4BT8 A;  4KMO A;  2A3D A;  3KFW X;  4H9O C;  3APD A;  5HQ8 A;  4KYO B;  2C5J A;  5A23 A;  4HS2 A;  5LP0 A;  1BR4 A;  5F8P A;  4G63 A;  3VLE A;  4X1I E;  5AEN A;  5CCL A;  1NZN A;  2DWG A;  4M3O A;  3FUL A;  3I4R B;  4OYJ A;  3LDZ A;  3ZYL A;  3RJV A;  4XKB A;  3TG5 A;  4BT9 A;  2J4D A;  3IV0 A;  1LRZ A;  2EQX A;  4UQY A;  3NZU A;  4X1K E;  4XI9 A;  4U74 A;  5JHB A;  3UUX B;  3Q2M A;  1E8W A;  4TX5 A;  4WBN E;  4OFZ A;  3PUA A;  2XAG B;  3KIN B;  3K8P C;  4CEM A;  3FTU A;  3VTX A;  3ONK A;  2OVF A;  4XE0 A;  5DIZ A;  2WMN A;  4TZ4 C;  2JJ9 A;  3K3O A;  4TV9 E;  3HYM B;  1KK7 A;  3TKL B;  1Z0P A;  3U78 A;  3ZCJ A;  1H6K A;  3ZMT B;  1OWP A;  2LSV A;  5BNW A;  2GRL A;  3B7T A;  3UMV A;  2X66 A;  4ILU A;  4WBO A;  2NTY A;  2IW5 B;  3CHP A;  4AKL A;  4I6J A;  4JC8 A;  3F31 A;  4KBM B;  1BR1 A;  5F3J A;  4UVC B;  2H7O A;  5E75 A;  3UPV A;  3UUX A;  4P0A A;  1ELW A;  2B1E A;  2MOZ A;  3CWZ B;  3PDY A;  1UCU A;  4IHJ E;  1MNE A;  3DTO A;  4UF0 B;  5FQ7 A;  3EHN A;  4WAF A;  2XPY A;  5FY1 A;  2KLQ A;  3I4G A;  5HYA A;  3RRU A;  4P09 A;  4UVB B;  3N9P A;  3WAK A;  2IOS A;  2ODU A;  3UFE A;  2JMH A;  5EK2 A;  4J8S A;  2X6I A;  4YJ3 E;  5L3B B;  3Q47 B;  5HXC A;  1HG2 A;  4CXX A;  1X5B A;  3L08 A;  1Y8M A;  3LVQ E;  3FTZ A;  4IE0 A;  1UN9 A;  2X38 A;  2UY1 A;  3HR0 A;  3RC8 A;  3C4W A;  3LJC A;  3PU3 A;  1DVP A;  4IN3 B;  4CDN A;  3F2E A;  3MYV A;  3FUK A;  5J2U E;  4L2L A;  3FEY A;  3G2S A;  4KZ0 A;  1W3B A;  5BMV E;  4TRQ A;  4WNE A;  3B7S A;  3R7Q A;  4I43 B;  2AXU A;  4A1S A;  4FU3 A;  1FCH A;  4YFS A;  3E4B A;  5G55 A;  1S35 A;  3LK2 B;  2PL2 A;  3ASG A;  4G11 A;  3LBX A;  3OXL A;  1WYC A;  4EBA G;  3SGH A;  5KCM A;  2IJG X;  5J1G A;  4JW1 A;  4N78 D;  2NW7 A;  3JCK C;  2BTD A;  4LUN U;  3VTY A;  4HE8 A;  4IRU A;  4AKI A;  3RRM B;  4L2Y A;  3N9M A;  4HVB A;  3I9W A;  1WLX A;  3U9W A;  1FMV A;  2C0S A;  4PH4 B;  4XAX B;  5T4Y A;  3PUS A;  4PK4 A;  5J08 A;  3D3M A;  4OVV A;  4GIW A;  2YIN A;  3CQX C;  3S7B A;  5JH7 E;  2RA1 A;  3RYH E;  4ZI2 C;  3HI2 A;  3UUM A;  3B7R L;  3HVE B;  4QXB B;  4QFV A;  4ANV A;  3L13 A;  4F7A A;  2L9Q A;  2KT9 A;  3MV2 B;  5FP3 A;  1Z3Y A;  4QKN A;  4C9B B;  4XZC A;  5J90 A;  1D0Y A;  2UXX B;  2JLB A;  3KBU A;  3L54 A;  2VYI A;  3ZJ2 A;  2LHN A;  3ZJ1 A;  2WXF A;  2VGX B;  3IHY A;  3ONL A;  4GZC A;  2Q9Q B;  2R5S A;  3U4T A;  3I9Y A;  3OBV E;  1P5Q A;  4N3A A;  3GMI A;  5JR9 C;  3LVR E;  5EDS A;  4L5G A;  3BG0 B;  2P9B A;  3FUM A;  2V7J A;  3QK6 A;  3APC A;  5G05 C;  4NQ0 A;  3OYX A;  4GZD A;  3RYC E;  2M63 A;  2ZM2 A;  3FXD B;  1INZ A;  3DBS A;  4UV9 B;  1HH8 A;  5HXH A;  2NSZ A;  2QY7 A;  1NP7 A;  2WXL A;  3W15 B;  4I4T E;  1IJ6 A;  3LPZ A;  4KT6 B;  4RG6 A;  3MK7 C;  3S7J A;  4UV8 B;  2YK0 A;  5FT9 A;  3AVS A;  5BUZ A;  4AKH A;  2Q7F A;  4O4L E;  3ESL A;  2ZLY A;  3MKQ A;  4A1G A;  1HZ4 A;  1BPO A;  4GZ5 A;  4BX8 A;  3CSF A;  4DBR A;  5FXW A;  2CLY C;  2VKJ A;  2L0T B;  4HEA A;  4AM9 A;  2NOX A;  3QWP A;  3C98 A;  2LSG A;  3VLD A;  3NZS A;  2HPL A;  2X9W A;  4L7T A;  3OKQ A;  4EZH A;  4N2S A;  4XI0 A;  4AJW A;  1HU3 A;  3FUH A;  2EHO B;  4DND A;  4I2W A;  5FY7 A;  3ZPJ A;  3O4Z A;  3PUR A;  4DK5 A;  1UX4 A;  1IZN B;  5L3D B;  2PM6 A;  4WNG A;  5H6R B;  4NUU A;  2KCK A;  3BEE A;  1GW6 A;  2CFZ A;  4I1O B;  3A5X A;  4O8S A;  5ANL A;  1NWM X;  5A7D B;  3DJB A;  2VTB A;  2CWO A;  3SF4 A;  2FEZ A;  3ZC0 A;  1XGW A;  2LO6 A;  4B8C B;  2MBG A;  3TXM A;  2IFU A;  2FI7 A;  2Y6X A;  4UWG A;  4PFO A;  1Y6I A;  4WWP A;  2VSO E;  3NRX A;  4J0U A;  4B94 A;  3CX6 B;  4UI9 C;  2ZMA A;  1Z6T A;  5JJT A;  2JEK A;  4FLH A;  1QUU A;  2IU1 A;  4UWK A;  2KM4 A;  2C0M A;  1E1H B;  1PC2 A;  2D2S A;  3NBX X;  3LCA A;  4ZI3 D;  3JQ1 A;  5BW8 C;  3E22 E;  4YHJ A;  2V4L A;  3APF A;  5C8Y E;  2QGS A;  2X68 A;  2VSX E;  4EZL A;  2PG8 A;  4FAD A;  2Q9Q C;  2X6J A;  5FWQ A;  4H9R C;  3CVU A;  2KXP B;  2VGY A;  2Z6E A;  1PY1 A;  4GYR A;  3CQG B;  4I9E A;  2CA5 A;  3C98 B;  2LEH A;  2J08 A;  3H3A A;  3BQL A;  2XCB A;  3OAW A;  2VSN A;  3ZN1 B;  2WXR A;  1KT0 A;  5LGT B;  3FXE B;  3FUF A;  2W61 A;  1IYG A;  3CVQ A;  2WQ6 A;  1HX8 A;  4L9I A;  4H9N C;  3CVY A;  3RC3 A;  5LHI B;  3ASF A;  2E9X D;  5G04 C;  1ZU2 A;  2XGO A;  4ZHQ E;  2CLY B;  1OWL A;  3L16 A;  3RRN B;  3AU5 A;  1LF8 A;  4IDZ A;  1JUQ A;  3FY4 A;  3RK6 A;  2X9Y A;  3P8C D;  1L5J A;  5KJK A;  1ZEE A;  3FFL A;  1T98 A;  3QB2 A;  3LJ3 A;  4ANJ A;  4URK A;  2YHC A;  4UEL A;  4UI9 K;  5BPP A;  1OUV A;  1IHG A;  4B89 A;  1SZ9 A;  4N5C A;  2H7V C;  2QFC A;  2PFV A;  4JHJ A;  4DMV A;  3GN5 A;  4O4I E;  3PNL B;  5A6C A;  4QXH B;  5FZR A;  3ETV A;  3D9J A;  1NAF A;  3QUJ A;  4R7L A;  2KND A;  4GYO A;  4H9S E;  5AIJ A;  3PVL A;  2EHO A;  2XGS A;  2I1K A;  3CK9 A;  4ZS3 A;  5L3C B;  1DNP A;  4KZC A;  3MEK A;  5G2N A;  2C0L A;  3WAJ A;  3PDN A;  3FH7 A;  3RRW A;  3C51 A;  5A1L A;  2XRZ A;  1QZ2 A;  5KJL A;  4EQF A;  1HTJ F;  2VAS A;  4I17 A;  2UXN B;  5E76 A;  3ANW A;  3V5U A;  2CXL A;  2PJQ A;  2ILR A;  2BVM A;  4GU5 A;  3LG7 A;  4FP7 A;  3AAE B;  3AA1 B;  4Z8X A;  5HI7 A;  4PJJ A;  1EF1 C;  5KJN A;  2WXQ A;  2PM7 A;  3Q5W A;  2KAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...