2WMNA

Structure of the complex between dock9 and cdc42-gdp.
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
423
structure length
403
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEAHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
total genus 152
structure length 403
sequence length 423
ec nomenclature
pdb deposition date 2009-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wmnA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wmnA01
2WMOA 3VHLA 2YINA 2WMNA 3B13A 2WM9A
chains in the Genus database with same CATH superfamily
5HEOA 2ONDA 1TR4A 4DR2T 4B6XA 2KZTB 2CHWA 4GYWA 4O6FA 4UI9J 2NW7A 4WWNA 3ZUVB 2CRBA 3QWVA 2A4ZA 5LGUB 3SHFA 4NXMT 4LSZE 3RYHE 3D9KA 4A3TA 3AE5A 4ZI3C 3W9FA 1M7KA 5FIOA 2V1DB 2NOXA 5HRYA 3BK9A 5AQJB 3TL5A 1N52A 3PNLB 1N94A 1HG5A 2Q9QC 3UUXB 2LRLA 3ZMTB 4OK0A 3LY8A 1N54A 3CVUA 4AOFA 2IY0C 1DC2A 4CQIA 4LG6A 4P0AA 2AJAA 4AVXA 2CPTA 3FTXA 4FADA 3CWZB 1HE8A 1QUUA 4YTNA 2SPCA 2YNQA 4I1MA 1E96B 4N78D 2CEAA 3FU6A 3U4TA 1BR1A 4Z8XA 4CGVA 4HFDA 4CXWA 3OXLA 1NA0A 2JRKA 5KJMA 4XAXB 3BEEA 3DSTA 3LBXA 3AU4A 5EZYE 3ZJ1A 4BFRA 3DXKG 3IF8B 2R59A 2IHR1 3VRAA 5LJNA 2X38A 2IUBA 2VTBB 3D9LA 3LYAA 2X9YA 2IU1A 2XTLA 2BEDA 3L13A 4URKA 3L3PA 3RHWA 2WB5A 5JR9B 3SBSA 3RJVA 1KF6A 5LHGB 1ZEEA 3CX6B 5L2LA 5LG3A 2Y0BG 4PFOA 4H63H 1NZNA 5AQFB 1WG0A 4X64T 2HHHT 4HEAA 4GAAA 3J7Yq 4Q69A 3DSSA 4HOTA 5FT9A 4UELA 2HH7A 3B13A 2EHOD 3RIFA 3FHEA 3ISMC 2VVSA 2V4LA 1EZ3A 3OBVE 2Y4TA 3PZ3A 1QZ2A 2BF0X 5HCJA 4LF7T 3Q9NC 1VCTA 4FP7A 2QYJA 3ZW3A 1MIVA 2KXPB 1Q2ZA 4P0BA 3ZCJA 4IGUA 3ZNGA 4ABNA 3CKDA 3FTSA 4IN3B 1ZOYA 3MV2B 3HXCA 1XDOA 3MV3B 3TJPA 1Z8UA 4BSXA 1IBKT 1VCSA 1KZOA 4KX6A 2CA5A 4JHJA 5FY7A 4DUYT 3FB2A 5EYLA 4WWOA 4QXHB 3HXEA 4HB5A 2F8XK 3HXDA 3SFXA 1OWNA 1NEKA 1D1BA 2H6HA 3ETUA 1VOMA 2CHZA 4PK4A 3PUAA 4WWPA 2XPYA 3FBZA 1A17A 2XQ0A 4GKJT 1VDYA 4I2WA 3C3QA 3ZT6A 4UUCA 3NVOA 4GPKA 3JUEA 2VKDA 3B7BA 1XNRT 2WXJA 2V5CA 4PAGA 4B8AA 3VRBA 5EILA 3N9MA 2BBJA 5IUXA 1T8BA 3FZFB 3UU5A 2QYUA 1O3XA 4GCOA 3VTXA 3EDTB 4ZI2D 3RF1A 4DX6D 3IEGA 3AA1B 1XWMA 3AECA 3DSVA 4AY5A 4G11A 2NTYA 4JI2T 4C0MA 2L6BA 3ZXPA 2D9DA 4H63V 3CIRA 1LF8A 4JBWF 5JVDE 5FJYA 5AQIB 3LXUX 3ULEG 3TWVA 3L82A 4PK5A 1HR0T 2G0UA 3E4BA 4GTQA 3KV6A 3ZRHA 5A1LA 3C98B 2MYSA 3HI2A 4QKNA 4DVDA 4C0EA 2CHNA 2KLQA 3IHVA 3NOGD 5D66A 3TLTA 5LOZA 3ONLC 2E0IA 5BNWA 2V26A 1N9AA 1YQ4A 3GN5B 5CGMA 4EGWA 3GN5A 5KNHD 4JI6T 3JQ1A 2GRRB 3JADA 2KMFA 2VB6A 5CECB 2P9SG 3CVVA 4UEMA 5HCMA 2K24A 2JABA 2CXFA 5F3JA 4PJMA 4I9CA 5FINA 2A2FX 4FULA 3G2WA 2A3DA 2KSRA 3ASHA 4A63B 1DVPA 4BT9A 2EIKE 3ASDA 3UT8A 3O1IA 3ZVVA 4QQIA 3HDXA 5EKQD 3L22A 2XRZA 4GA2A 4O2AE 3S7JA 2A9UA 2N9DA 1U3DA 4HBDA 1T98A 2DIWA 4G2VA 5FY1A 2ETAA 1J5ET 1UURA 3ZC0A 2OVFA 4APFA 4BTBA 2BG9C 2CXDA 2WP9A 3B57A 1TJFA 3BQIA 4O60A 1OWPA 2XASB 3IXEA 3ZN0B 1OEDC 2XEHA 5CMYA 3SOLA 4ZFHA 1ELKA 4QXCB 4OYSA 3O4XE 5LHHB 3MA9A 1UG3A 2ZM8A 4L9IA 4HLEA 3UKRG 1O1RA 2ODUA 5JR9A 2E9XB 3ZHEA 5FVLA 4HOUA 5H7PA 4DRXE 3HHMA 2LXLA 5BXOA 3W9GA 2VVNA 3I4GA 3PUYF 2JMKA 1O1TA 4XKCA 5AN8A 3PUXF 3FUKA 3DP7A 3SO8A 3GWHA 4AP2A 5CJ5A 2UY1B 4HGAA 1D8EA 3N5LA 2PZIA 5AIJA 4IL9A 2FULA 4U04A 2ZGDA 1N4SA 4ATZD 1YW0A 4XEIG 3CK7A 3D9HA 2PNNA 4U96D 2I2OA 1HG2A 2Y3AA 2XZEA 1YD8G 4HRNA 1N0RA 2CLYB 4YJ2E 4EEBA 3L39A 4V1Av 3VR8A 3A8YC 4AKGA 3FWVA 5LBMA 2DHRA 2WZHA 1B7TA 3UM1A 3QK6A 4EYUA 1UJJA 4OYJA 5DQVA 3D3MA 5FXXA 3QNUA 4PNIA 3E22E 3AE2A 3ASOE 4FA6A 2V7MA 2YDRA 5B1BE 4GTRA 2WMOA 2RG8A 4TWHA 4ILIA 3F31A 3RRMB 2JQKA 3KBTA 2X9XA 5LMNT 5CA1E 4HLLA 1OXZA 5LGTB 3QUJA 2GRMA 3HKBE 1N95A 3MGBA 1SZ9A 3AXJA 3FTVA 3JC6D 4C90A 1E1HB 1N32T 1LVKA 3KV5A 5E76A 1N4QA 1OCCE 3LCAA 4UV9B 4GZ6A 4COFA 1WR6A 3U66A 2EIME 2VSXE 5AJLA 4Z91A 4YVOA 4OVUA 3JUIA 3CHQA 5G05J 3UFEA 5ABGA 2IO3C 2X6HA 3RQWA 1IBMT 2WXMA 2WVIA 3VKGA 2M63A 3PEVB 3AE9A 3EHRA 2CG2A 1CHUA 5A6CA 2H6IA 2V7KA 4DV4T 4CXXA 2J07A 1E90A 4TUUA 2BUGA 2CWYA 1P5QA 4FI5A 3L54A 1D0ZA 2H88A 4G26A 1JWGA 1MX4A 2LM2A 2WWVA 5BT1A 2XQ4A 4TUYE 2W2UA 4YLHA 4DR7T 2KINB 1FMVA 4A1GA 4OHFA 1SA5A 2H3RA 3AEAA 3JAEA 3OTOT 1Y6IA 1SUMB 2W0GA 3K8PC 5JDQA 3MZKB 2XRYA 4ZI7E 4DUZT 3JQ0A 2XAFB 2HN1A 3V5SA 3AU5A 2R6GF 2L0TB 2BKKB 4X1YE 3LK2B 5JHAA 3RYIE 3UIOC 4P1NA 4LMJA 3PURA 3AG4E 4JVSA 3PU3A 2ACZA 1E8YA 1JUQA 3HR0A 2X9HA 1JCSA 3KSQA 1ELWA 5CCLA 2UXNB 2DVWA 4L1BA 2VSYA 1WLXA 2XM2A 4A97A 3K3QC 3MK7C 2XY8B 3PUWF 2VGYA 3CVNA 3HL6A 4AIFA 3Q73A 1YCSB 2HR2A 2WZIA 4RVBA 4I43B 2DLRA 3FEYA 4DLQA 3PEUB 4EAHA 4AIUA 2KZ7B 3TKLB 5KBAA 2R17C 2OA5A 5FWQA 4LEUA 3UQ7A 4JI1T 4NXNT 2A5EA 2EQXA 3LS8A 5L3EB 1QLBA 3AEDA 1E7VA 1JWFA 1G3NB 3CKBA 1XNFA 3ZHEB 4Z68A 1HZ4A 4HFGA 2FO7A 2IEJA 4FJYA 3ZMSB 1FT2A 4M7CA 4BJNA 2M6IA 2AWIA 2XQ3A 1OEDA 1K3ZD 4H9QC 3J5QB 2UY1A 2LE8A 1HCIA 4HI8A 3P4SA 2CCQA 2WXGA 3BQLA 3FUHA 3RYCE 5IY5E 3E08A 4DX1A 5CCMA 4IYPA 2IW5B 4TXRA 1FJGT 4AKLA 4YFSA 1DU2A 4RLYA 2QGSA 2IMLA 1H2UA 3CEQA 3D9JA 1NAFA 4ASKA 3E0ZA 2XHEA 4ANUA 2VK9A 3AG2E 3I1AA 5L4EA 2H7OA 5LA6E 2L8KA 5JDHA 3EHZA 3WAJA 3RQUA 4KMOA 2R05A 3JXJA 1IKND 3GZSA 2K3WA 1TNYA 5LG4A 2H89A 3R6NA 2VJ8A 4JEUA 4IREA 3LJNA 4XKBA 4GMJA 3ASGA 2CXLA 1N34T 3FULA 3AEBA 1YYHA 2WU5A 2J09A 1RW2A 2XQ6A 4ATGA 3ML9A 5ABFB 2FO1E 3BG1B 3RGLA 3N2KE 1OCOE 3W15B 2X6JA 2XUEA 1U5PA 1UK5A 3GMIA 2ES0A 3LDZA 3EAMA 4HRMB 4K0RA 3CVQA 2K48A 5EX0A 3Q5MA 3ZEFB 2YK0A 2ZM2A 3FUNA 4DPRA 2XGSA 3DEOA 2XEEA 3GZ2A 3LY9A 3RC3A 4B89A 3HRAA 5G55A 5A7DB 3Q5XA 5GONE 1VRBA 5KJLA 4PW8A 1YQ3A 1NWMX 2RP4A 3CK6A 2WB2A 3ENEA 2X0LB 3IA3A 4DR6T 1BI7B 4XBFB 3OAWA 4DI4A 4J8YA 1KLXA 5D0OD 2PL2A 5ENRD 2ODVA 4JXTA 4LF9T 2C5IT 3PJAJ 5CEAA 4YSZA 1Y8MA 3C4ZA 5FXZA 1QYMA 4PUCA 1SA4A 2XSAA 1DCQA 1UJKA 4EOZB 1B89A 3UQ4A 2BVMA 3O1HA 5AARA 2J1DG 5JDMA 3OYZA 4FLBA 4UQYA 2HYZA 4QH4A 2LJLA 5HEHA 2LM9A 3D9PA 3HXBA 5JDLA 5HEUA 1FVHA 3ULYA 2CE7A 2V7JA 3CVRA 1D1CA 2RA1A 2DNXA 4DR3T 5L4HA 3P4WA 4TNWA 2IO2C 3Q5EA 4GYSA 1HTJF 4MHCA 2FEZA 2C5KT 4JV5T 4OVVA 4V3IA 3UUMA 2C0SA 1UW4B 3SGHA 3I9YA 3UTKA 3ZC1A 2KWHA 3ABVA 3HKCE 1HU3A 4QFVA 4KUMB 1Y64B 4AKHA 3I0OA 3C98A 1H2VC 2UXXB 5AQQB 1X9BA 3FBLA 3ZMVB 4HORA 1A5EA 4EV6A 3S7FA 4JHRA 1IAPA 4F3VA 3ZMZB 1OUVA 2DYRE 2K9AA 2IQCA 2B0OE 5B3SE 4DMVA 4HOSA 3HXFA 5F8PA 3B7RL 2IAKA 2WXIA 3TXNA 3N71A 4DV5T 2F4VT 1XMOT 2DWKA 3UPVA 4G63A 4DO0A 2YDSA 1D1AA 2DWGA 2ZGGA 3ZN1B 3FUDA 2I59A 4K5BA 1OY3D 1MMDA 4YVQC 4TV9E 2CBIA 3X1DA 2PG8A 4BAYB 2NWBA 4TX5A 1XMQT 3RRNB 4DX5D 4NQ0A 3D0TA 3FU5A 3P50A 4GTTA 4B3TT 3N9PA 4X62T 1KPSB 4AQGA 5ADXL 1BLXB 1TNOA 2ETCA 3PDNA 4UWKA 2XHEB 1BPOA 3RO3A 2DI4A 3CVLA 4NIQA 3AEFA 5KWDA 4GMLA 3FZHB 1NFIE 2XM1A 2OEWA 2Q9QA 3RRUA 2JMHA 1O5MA 2LSUA 2WXLA 2VKJA 4AQFC 1LVFA 4I17A 2FBWA 4HFVA 3SBTB 2JPFA 2XPIA 4HQDA 5F5WA 3AS4A 2E9XC 5AQ9A 3UU3A 4OAUC 2V6YB 2Y8DA 4U8HA 2QC9A 2R5SA 1ZU2A 4Z90A 4U2YA 2MHKA 4NIKA 3UU6A 4UVBB 3DRAA 4FJOA 3NBNB 2NP9A 1HX8A 4KZ0A 3MX3A 3LK3B 2NC9A 1OXJA 2IC6A 1UX5A 4DV6T 4KP3C 2X66A 4LFCT 1Z3YA 2L0IA 3TLUA 3Q49B 2X51A 4UWGA 2WS3A 3MYVA 3LK42 4B3ST 1OEDE 4LNBA 4HFEA 4LNGA 1FIOA 4G8KA 1H6OA 3SFZA 2VSOE 3ZU7B 5FVKA 5G05C 2XAGB 3FUMA 4B94A 2ZU6B 3APFA 4HXIA 3D9OA 3TWUA 3KVBA 2W00A 5DABA 4HRLA 3OTNA 2KCLA 4BA9A 2BKPA 5HXRA 2V5FA 3C3OA 4R7LA 4OFZA 1H6PA 1K1BA 1MIWA 2F37A 2RD0A 1N11A 4F53A 1Y01A 4N5QA 2KZTA 4BEPA 2P9KG 4GU5A 3ESLA 4F1SA 3PTRB 3P4QA 3RRWA 3RKVA 3L08A 3J9X1 2L9BA 4O4LE 2K5BB 4ACKA 5LCWC 1KK7A 1HX1B 4FJZA 4EHMA 4B0ZA 4C91A 4NRHB 1UX4A 4I6EA 5LMUT 3CVPA 3ZFWA 3WI3A 4HTEA 3FFLA 3SFYA 3DTOA 2UXCT 4UVCB 4B8CB 2XEVA 2NXPA 3EHNA 1YMPA 2V5QC 2YU1A 3G06A 5C1DA 3LJCA 1KNRA 3P8CD 1SVXA 3UKUG 3X2QE 4CZ2D 4HVBA 3NQPA 2WXQA 2YKSA 4DUIA 3KVAA 4F6RC 2YU2A 2VYIA 1HNWT 2XGMA 2WXFA 4QX7B 5BUZA 3VHLA 4AV7A 3HVEB 4IL4A 5M72A 3AA6B 4NPPA 3PZ1A 5FZQA 3KSLA 1QNFA 2EHOA 2BBHA 3T1HT 4K0UA 4QH1A 3HA4A 3R9MA 2LSYA 3G2VA 4BTAA 5ENSD 2KCKA 4F1PA 2VTBA 4U63A 4L23A 5ETWA 4XZCA 1WR0A 1X81A 1N33T 3EIQC 2QVAA 2E9XA 1SHZC 3ASFA 2AVPA 2YEVC 3QOFA 2LAHA 1EDUA 2DYSE 2XCBA 3UUNA 2OV9A 5AQTB 1BU9A 3QARA 3CHMA 3FUJA 4ZHQE 1MJ0A 2DL1A 4JYAT 4U07A 3ZN3A 3UX4A 3KD7A 5FP3A 3RI5A 1HO8A 2WM9A 3R7QA 3RC8A 4BY6A 3OKQA 2J49A 4QHOA 2YINA 2H6GA 2WU2A 1BR2A 2JIWA 5IYZE 1LD7A 4I50E 4ZS2A 4LFBT 3ML8A 5JREA 1WDYA 3PUQA 4JI5T 5J2TE 4GYYA 4DR4T 4F7AA 1HF8A 2P9BA 3L6AA 3QDNA 1PC2A 2X9WA 3UTMA 2I1KA 2J4GA 4L5GA 4L2LA 3FH7A 4GKKT 3T8KA 4LF8T 3GYZA 3APDA 3UM2A 5KXJA 3UT7A 5CRUA 1FVFA 3V30A 4MLKA 4DR5T 2F8YA 2FI7A 1AJ3A 3SFDA 4XI0A 3L8RA 4DV7T 1UCUA 3HYMB 5LGNB 3CR3A 2ZM0A 5FQ7A 1K8KG 1D8DA 3UINC 4A5XA 1OWLA 3U3WA 3CQGB 5FL0A 4UI9K 5DQWA 4KT6B 3NZSA 4HWHA 5EX3A 1MMNA 4YTPA 4ILGA 4CDNA 2ZISA 1Z6TA 2XQ9A 4G2AA 4X65T 3C72A 5G2NA 4D10C 4JD2G 5BR8T 2WQHA 5FL1A 3Q47B 1V9DA 2UU9T 5HQ8A 4U74A 3N9QA 2QY7A 3LJ3A 3AS5A 4A1SA 1MMGA 2QA7A 2P58C 3Q79A 3UQ3A 2UWJG 1FT1A 3EUHA 2V5DA 5JDGA 3QC1A 2V6XA 2VGXA 3RIAA 5LX8A 4EEDA 5C2YA 2UXDT 4FHJA 3TAXA 3PUSA 1NL4A 5T4YA 5H6RB 4ILUA 2NW9A 3TXMA 3AAAB 3ZYKA 2J4BA 4UI9C 3S4UA 5E75A 4GTPA 1Z3XA 3TWXA 5BV0A 2LKHA 1M62A 4GK5E 5KMGP 2WXNA 4WW0A 4IE6A 2DZOA 4HOQA 2I6HA 3QAQA 5CBNA 3NZQA 3K1SA 3AAEB 2E5VA 3SRZA 4JW1A 1TN8A 3TLSA 5C2TA 4GZ3A 2VKHA 4L9PA 2RKKA 4CN1A 5AQOB 2P9NG 2XQ7A 3WG7E 2Y6XA 4ZZBA 3KV9A 3NB2A 3PZ2A 3FH5A 2NR4A 2E2AA 4QX8B 2XPKA 4TNVA 2LXMA 3DBSA 3K3OA 4JPSA 5HXHA 2LOPA 3Q75A 5E0OA 3EDUA 3VR9A 3CHOA 1JNZA 4DX7D 1GW6A 4U95D 4E7ZA 4ILCA 3ABME 5HS0A 3P2BA 3AE6A 4ZI3D 4O4HE 1BD8A 4AJWA 3UULA 2CHOA 4CZZB 2MOWA 1LKXA 1MHQA 3UI2A 2PQNA 3MKQA 5FZRA 3G2UA 3ZMUB 3CPZA 2WDRA 4DK5A 2VASA 3LPZA 3PVLA 4K03A 3SWHA 4LCTA 4C9BB 3WXXA 4JI3T 4TWDA 4GPMA 4NUUA 4PFPA 4ZOLE 2GW1A 2WXRA 3RKGA 3VLDA 3ABLE 1BI8B 3ZJ2A 2HPLA 3RH3A 2C0MA 4MS6A 4HWDA 4GA1A 2Q9QD 5FNVE 3IEEA 2IOSA 3AB3B 4HS2A 4UF0A 5AQNB 3FY4A 3JCFA 2LSVA 2WDQA 4P29A 3CX8B 4TWFA 3I3NA 1UN9A 4GTVA 4IULA 5DJQC 4UQZA 4AEZC 4QH5A 2H6FA 5KCMA 2VWAA 1SE7A 5CB4E 2W62A 3URZA 4JUYA 2VGEA 2H7VC 4ERRA 4H7XA 4IIJE 1ZBPA 4DBRA 5JDFA 4HI9A 4U0SA 4PJLA 5L3DB 3JC6C 4E85A 3FXDB 4CGWA 4N39A 2V7IA 2XAJB 1MIYA 3KV4A 3L17A 2X68A 3C5RA 4AXHA 4KMCA 3FEXA 5CMWA 3TG5A 3P4PA 3N2OA 3CVWA 2WXHA 4L0RA 4IE4A 4CI2B 4U8VD 1OEDB 2R02A 2CFZA 3ESKA 4BESA 5CA0E 1LD8A 1E7UA 3QWWA 1MZCA 1L5JA 2X6FA 4X1IE 3EIJA 3V5UA 4WNKA 2D0TA 2BG9B 4WAFA 3TLVA 5JH7E 3MKRA 3E34A 3P1UA 1E7PA 4U33A 4N2QA 3DJBA 5FMNA 1H7CA 3LG7A 1N0QA 3B7UX 1YXRA 1X5BA 5ARGA 3DSWA 1ZP0A 2BTDA 2UXBT 2Y1LE 5AQAA 3ETVA 1OCRE 2L3LA 4FLHA 5ENTD 1R8IA 4H9SE 4H7YA 5C8YE 1ELRA 4AISA 4GMRA 4UXNB 4HFIA 3RAUA 4IDZA 1T7SA 4EZHA 4LF5T 4DMWA 3CQXC 4XIFA 2LUHA 1W0AA 5FY0A 5HXCA 1IQUA 2WPVA 5ITZF 3ZYLA 4KXKB 3LY7A 2YHCA 4G25A 4W9RA 3KEZA 2VL8A 2DZNA 3UM3A 4APOA 2P9IG 4H9RC 3QOUA 4HKAA 4PJNA 5BW8C 4EZLA 1MQSA 4WNDA 2WWUA 4JI8T 4MBQA 4XZ4A 4ACLA 4TXQA 3IBEA 4J2CA 4GIWA 3JXIA 3QK0A 4FC8A 4LUNU 2LKGA 4X20E 4CI1B 3QB2A 4ME2A 3RKOA 4ANWA 3IBPA 3NRYA 4ZEYA 5L3BB 5J90A 3AEGA 5G04J 4TRQA 3NKZA 3V2XA 3DWLG 5LP0A 2V8SE 1RZ4A 2E2EA 2NSZA 1I94T 3MKQB 1TJCA 2XENA 3VLEA 5LBQB 1HNXT 4N2SA 4UR9A 3CX7B 1EPUA 3Q2MA 4NURA 2XAHB 1EF1C 5D0QD 3ZKJA 1WFDA 3AE8A 3HKEE 3ZGQA 2HM8A 2X6IA 3DPYA 1MMAA 3PH0C 5AQ7A 4EZJA 4MFRA 1HNZT 2VQET 1U3CA 4JB8P 2Y4UA 2XQYA 3ZSSA 5AENA 2PJQA 4EYYR 1TN6A 2IOLA 2XQ5A 4I2ZA 3PDYA 3NWIA 2OCCE 4HWCA 1S70B 4CEMA 3B95A 2A72A 5JRCA 3SFEA 2C2LA 4DLOA 5AFUL 3EHQA 5HAXA 3G2TA 4G23A 4XI9A 2FF4A 1HS6A 5EK4A 4GYOA 3HKDE 4ILBA 3NZUA 4WNEA 3UUXA 3L09A 5CBOA 2YDQA 4UF0B 5LB7B 4UWHA 4LFAT 2P9LG 5HI7A 2XZTG 5LP6E 3V31A 5LJMA 3CK9A 3J5PA 1YKEB 3D9MA 2M6BA 4HE8A 3TGOA 4EPZA 1HFAA 4O8SA 1ZKEA 4IDPA 3EVYA 4WZXA 2EILE 4U7EB 4J8SA 2F0YA 3CHRA 5KX5E 2FJAA 3SZ7A 4JEHB 4TV8E 1ZV4X 1TN7A 2MAWA 4JEUB 3RLFF 4BSZB 4YXDA 3MJWA 3OPCA 4JEHA 4YDYA 1J1JA 4KBMB 5HYAA 1EYHA 3BU8A 3M65A 3QWPA 1U2VG 5LCYA 3LEWA 1S94A 2C0LA 1FPPA 5KNGA 2WQ6A 3TWSA 2V8SV 3RIBA 5BV1A 4BETA 5AQVB 3CQCB 4B3MT 2WQYA 5JA4D 5L47A 1SA0E 3FU3A 3SY2A 2V0PA 2MYOA 4YHHT 1W0BA 3GW4A 1UUSA 2W67A 4CCAA 4KZCA 2ACXA 4EZ4A 3CLJA 2R2LA 1D9SA 3SNXA 1WYCA 4U72A 5HWXA 3I4RB 1D0XA 2A5UA 1TNZA 3FTYA 4ZI2C 4LNUD 1QQEA 3T8MA 3RYFE 3Q78A 4RG9A 1BR4A 3CHPA 4WNGA 1NENA 3VKHA 3PUKA 1XZYA 3S7DA 2WY2A 4J8DA 5AQSB 3HIZA 4GZCA 3PZ4A 3VU7H 4LMKA 3LSVA 3AVSA 5HXSA 3FTWA 3PV0F 4J7WA 3F57A 3UU8A 3RIUA 3EJNA 4ZHBA 2I9CA 3AAIA 5AQBA 2AXUA 2XS1A 4O1OA 2PQRA 5HEGA 3PREA 4DIDB 3BQOA 5FYMA 2HPJA 4JI7T 3C4WA 4OX9T 3S2AA 3FZLB 2RFAA 3KEAA 2XQAA 5JJTA 4YDEA 3AE3A 4EQFA 2HO1A 4IDNA 4GK0E 3L9TA 1TEZA 3P7IA 3T5VA 2UUBT 5LCWJ 2ZLYA 4LF6T 3APCA 3FH8A 3AAAC 1KNZA 2GRNB 5AQLB 3PE4A 2BKGA 2YN6A 1S35A 3ANWB 1KFYA 1WRDA 3Q5WA 2GRLA 3AG1E 5JMND 3CGHA 2PM6A 5T8IA 5B1AE 3ANWA 3LBXB 4B93B 1IHBA 1H2TC 3JYSA 2EHOB 4ISTA 2YHEA 3ONXA 4I55E 3IHYA 1MYOA 3IHRA 2VQ2A 2JQQA 3LKUA 4N3AA 3MZLB 4U2ZA 4EIWA 4G8LA 4UIGA 5AQPB 4YNDA 4J0UA 2WCAA 4I4TE 4KBQA 2VKOA 2WSSV 1W3BA 3ZKRA 2KT9A 3RPUA 1IBLT 4MALA 2XCCA 2D5UA 2X67A 3NBXX 2GROB 2KM4A 3HG0D 4Y6WA 4LERA 4BT8A 2IJGX 1XDPA 5JRCB 1KT1A 2P9UG 2XZDG 4EXTA 5BMVE 5HEJA 3ZYMA 1PAQA 3CSTA 3FUFA 3SQVA 3UU4A 4Y6CA 3ABKE 3DSXA 1OWOA 3ONKA 5FXVA 5ABEA 2NW8A 4U8YD 2HE0A 1IHGA 5J1GA 5IHYA 2AW6A 4MKTA 3LVQE 1S0PA 4E6HA 3ZPJA 2OV8A 4EZKA 3KS2A 4EBAA 3CV0A 1HXIA 4JA7A 3CSFA 1E8WA 5FQ4A 3OXFA 2XQ8A 4JC8A 1J5WA 3AVRA 3D9NA 3AE1A 5LNKA 2I0MA 4IDQA 4WNFA 4N3BA 5ABFA 1JPLA 2L9QA 1YA0A 1GQEA 1JCQA 5AQRB 2ZM6T 3EU5A 5JJ7A 5L3GB 3MXZA 4H9OC 4UWFA 2J9QA 4PS7A 1XNQT 3OYXA 5AYWD 1UN8A 3UXGA 3BG0B 3N9OA 3SD5A 5JTGA 3KAEA 5EK2A 3FXEB 2Z6EA 4HFBA 3CVYA 2XGOA 2KC7A 3FDHA 4YSYA 2HN2A 1CUNA 4GZ5A 1KEYA 3E37A 4JHKA 4IT4A 2GGFA 3L16A 4JA9A 4JLEA 3I0QA 1H6KA 1BR0A 5DIZA 2Y48B 4PS3A 2FJBA 3Q7FA 3UM0A 2PBIA 3KINB 1ZB1A 4LF4T 4TV3A 3PE3A 4YHJA 2X0YA 4BERA 4LMLA 2XPZA 2LSJA 3K9IA 1E8ZA 1UOHA 3Q9UC 2XJ7A 4EB6E 5ABHA 2Y69E 1I6ZA 3N2GE 4HN9A 4M3OA 4PK6A 1N4PA 4CT0A 4M1PA 5AQKB 4DI3A 3JAFA 2P9PG 2BDEA 3Q9DA 2FUPA 2J08A 1IXVA 4I1OB 4CYMD 3BUAA 3AE7A 2LSKA 4GTOA 3MKDA 3EHMA 1L0VA 5JHBA 3QB5K 4J8EA 3FP3A 1T72A 4WYVA 3IKOB 4ISSA 3ZPOA 4YY3T 2ILRA 4CN6A 1W9RA 4TN7B 4UV8B 3SI5A 2BZBA 4DV1T 2WXOA 3FZMB 3PUZF 4LRZA 2LHNA 2VL0A 4Q25A 3RIUC 4JZYA 3MEKA 2CFUA 2LSIA 1TYQG 4UQXA 1G8XA 1WAO1 1IJ6A 3VTYA 1LRZA 2LHRA 4QXBB 5FTPA 4H9NC 4I9EA 1NA3A 5KJKA 4RG6A 3UIPC 3TLWA 2FBNA 2AXVA 1TNUA 5ENNA 3OVUA 2EIJE 2BG9E 5JQGE 5LHIB 4HNAD 3R84B 2CBJA 2DBAA 3RSEG 3RK6A 2LRKA 4U0UA 3KDSE 2ETBA 4G1TA 4A3VA 3AA7B 2PTFA 4AQFA 3GA8A 3NZPA 3CKCA 3GZ1A 1AWCB 5EN5D 4K5AB 4O2BE 4IRUA 1IJ5A 4RQIA 4WBNE 3A5XA 3K3NA 3TWQA 2J62A 5ANRA 3T1YT 1DNPA 2OVBA 2IIUA 5FQ8A 5T3RA 2BKOA 5EYPF 2BVLA 2M67A 4WBOA 4DV2T 4GZDA 3FTZA 4CDRA 3MACA 4N3CA 2VSNA 4I1AA 4UWLA 1SW6A 4GTSA 3NAWA 4ANXA 2ZIRA 3M3ZB 4X66T 4DR1T 3FU0A 3PUGA 4GCNA 1IZNB 2FJDA 3DEPA 4I6GA 1U4QA 3ASNE 5A23A 1IQRA 2XAQB 2NYJA 5ENQD 2N1GA 4OYKA 1IYGA 2XSBA 1KNPA 2B1EA 2E8IA 5ENOD 5ENPD 2RFMA 3Q15A 3ZXSA 3MJXA 4KHZF 4CN4A 1HS7A 5C3JA 3U64A 4DJAA 4U7YA 2PM7A 3PU8A 3ZSTA 5JR9C 2VQFT 3N9NA 1YKHB 3DPDA 5HWYA 3PUVF 4ILHB 5ANLA 4PJJA 3TWRA 4X8QA 3C3RA 2CM0A 2E9XD 1MNEA 1UGOA 2Q7FA 3PZDA 3F2EA 3CHSA 3DSUA 4O4IE 2OEVA 1N4RA 4U31A 2CG3A 3FTUA 2FJEA 2N2NA 2KNDA 2V7LA 1OWMA 3S7BA 2JLBA 1QBQA 2W4XA 2J8SD 4EECA 1QSDA 1FMWA 4ZS3A 2DCPA 4BWRA 2WMNA 2QFCA 2BG9A 1KT0A 3O4ZA 4MBGA 4GTMA 1OWAA 3UT5E 2KATA 4MLPA 5BPPA 4FU3A 3CIAA 4J6IA 4QWNB 2DCFA 3B7SA 1WY6A 2AXZA 2IF4A 3PRZA 4GYRA 3KFWX 1JNRA 5FQ6A 2ZXWE 3E33A 4KI0F 3B5MA 3C51A 2KBXA 2L6JA 4IE7A 3NRXA 2X0HA 2LAIA 1MNDA 2QZAA 2D0UA 1NI1A 4Q94A 5CERB 4CI3B 2Q9QB 2WAUA 2BS3A 5J2UE 2VGXB 4A56A 1US7B 3MA5A 3UMVA 5CRVA 1Z5SC 1JCRA 1LTXA 4RSYA 5D2MC 4HWIB 5HXEA 1WYBA 3ZLIA 2JQHA 2KWIB 1H19A 3U9WA 4BJMA 4BX9A 4AKRB 3QC9A 2AXDS 3FUEA 4A55A 1V55E 2MPKA 3CVXA 1E2AA 1G73A 3C50A 4L2YA 3H3AA 1MX2A 2XS8A 2MBGA 3ZT7A 2CWOA 3RX6A 5AQUB 2YOEA 4YSXA 4DX2A 3ZEFA 3JCKC 1INZA 2YQ8A 5KJNA 3O1JA 2OLTA 3CK8A 2JJ9A 3NF1A 4JI0T 3FHNA 5L3CB 4YJ3E 2W63A 3ZCIA 4U7IA 4IDOA 5H6QB 3ZYQA 4ANVA 2W61A 2J4DA 3QJZA 4ZZCA 3LVRE 3KBUA 3HVEA 2IONA 3T9KA 4KYOB 1OCZE 1E8XA 4TZ4C 2KCVA 2MRIA 4OAVB 2B76A 5KDMC 3A7MA 5M4YA 3UT4A 2CMRA 5EIBE 2GRQB 4MRUA 4AY6A 1NP7A 2B6CA 3P4RA 2QRXA 5G04C 3IV0A 3NOCD 2GK9A 2OOEA 3EUVA 4HWFA 2DWZA 3BQKA 3DXMG 3EDVA 4CDMA 2LEHA 3H3MA 3AEEA 1AP7A 2JEKA 3TWTA 2UUCT 4I6JA 3EABA 3QKYA 4UVAB 4KVOA 4K0KT 3WAKA 4I0UA 2BS2A 4HFHA 3Q4AB 2MTQA 3QB5A 3SF4A 3OXGA 3U78A 3LDQB 4H9PC 5J0ZA 1HH8A 2W66A 3PS6A 1N36T 3AS8A 4G24A 4DV3T 4AKIA 2LO6A 1ZHCA 3AA0B 2X6KA 3AG3E 2CLYC 3C4XA 4O4JE 4ADZA 3T8OA 3ZIMA 5LXTE 2WXKA 1SZAA 3PNTB 4EBAG 3ZT5A 4E7SA 4BX8A 5AQMB 4GA0A 2LLYA 3V2OA 3QNKA 4JL0A 5J08A 2BS4A 2QYWA 1X79A 5CFBA 2IFUA 2WDVA 4ZXLA 5LFAA 2PFVA 2EINE 3UFGA 2CHXA 1V54E 1MX6A 2NTXA 1PY1A 1Z0PA 5JJ6A 2V4HC 2WQ7A 4X5TA 3AXJB 3I5PA 4A98A 1SQMA 4C48B 3RRCA 5AQGB 3PUJA 5TAOA 4U3CA 4J8FA 4B3RT 2J47A 5LYJE 3F6QA 4XE0A 4NACA 3EI0A 3LFMA 2KXPC 2LOSA 4TUMA 4YDOA 5EDSA 4WUYA 3ONJA 4U0ZA 2JQ9A 2EHOC 1O1SA 4N5CA 5EK3A 3C64A 1S63A 2LSGA 5JDNA 5EIDA 2WXPA 4GOUA 4YDWA 5DBKA 3R7RA 3AE4A 4JI4T 2AE9A 4ANJA 4DV0T 4DNDA 4ILAA 4NUVA 4Q96A 3ONLA 5CEDB 4O1PA 2IDOB 3RO2A 5FKYA 1D0YA 4TXPA 4L7TA 3PE0A 4YT0A 4YTMA 3E32A 1DCEA 3E30A 5ARFA 4AXPA 5L3FB 2IC9A 4FHKA 3Q5DA 1TNBA 4CRWA 3D9IA 5AJDA 5FZSA 3UUBA 3H37A 3TG4A 3MCXA 4CT4A 3CMLA 3T5XA 3FZKB 4AM9A 4IHJE 2RPAA 2V6YA 2MOZA 3U3IA 2GRPB 2LT3A 4CXYA 1S64A 3ULQA 2X3MA 5HKPA 3O9XA 5AAOA 1H0AA 3TWWA 4P09A 4IE5A 5BXUA 4KHPT 3RU0A 3PJAA 3VLFA 5CHEE 1W09A 2UUAT 1KZPA 3Q7AA 3G2SA 2P2CP 4GB9A 2R03A 3AJIA 2D2SA 4IE0A 2ZMAA 1FCHA 2LNIA 4XX5A 4I43A 3I9WA 4PH4B 4F6RD 3B7TA 2C5JA 3EU9A 3V79K 1FEWA 2I1JA 5LOVE 1WM5A 5AQHB 2E5LT 3R9AB 1K1AA 1OT8A 2WBLA 4X1KE 4F8HA 1WCRA 4K5CA 5IWAT 4AQYT 4KVMA 4PDXA 1XGWA 4PS8A 2BKNA 5FXWA 4DBQA 3FUIA 4AI6A 3O48A 4HFCA 2VURA 3N9LA 3SS1A 3OJAA
chains in the Genus database with same CATH topology
2ONDA 4B6XA 2KZTB 2CHWA 4GYWA 4O6FA 4UI9J 2NW7A 4WWNA 3QWVA 2A4ZA 5LGUB 3SHFA 3RYHE 3D9KA 4A3TA 4ZI3C 2V1DB 2NOXA 3BK9A 3TL5A 1N52A 3PNLB 1HG5A 2Q9QC 3UUXB 3ZMTB 4OK0A 3LY8A 1N54A 3CVUA 4AOFA 4CQIA 4P0AA 4AVXA 3FTXA 4FADA 3CWZB 1HE8A 1QUUA 4I1MA 2SPCA 2YNQA 1E96B 4N78D 2CEAA 3FU6A 3U4TA 1BR1A 4Z8XA 4CGVA 4CXWA 3OXLA 1NA0A 2JRKA 5KJMA 4XAXB 3BEEA 3LBXA 3AU4A 5EZYE 3ZJ1A 4BFRA 3IF8B 2R59A 5LJNA 2X38A 2VTBB 3D9LA 3LYAA 2X9YA 2IU1A 2XTLA 4URKA 3L13A 3L3PA 5JR9B 3SBSA 3RJVA 5LHGB 1ZEEA 3CX6B 5L2LA 4PFOA 4H63H 1NZNA 4HEAA 4GAAA 3J7Yq 4Q69A 4HOTA 5FT9A 4UELA 2HH7A 3B13A 2EHOD 3FHEA 2V4LA 1EZ3A 3OBVE 2Y4TA 1QZ2A 2BF0X 4FP7A 3ZW3A 1MIVA 2KXPB 4P0BA 3ZCJA 4IGUA 4ABNA 3CKDA 3FTSA 4IN3B 3MV2B 3MV3B 3TJPA 4BSXA 2CA5A 4JHJA 5FY7A 3FB2A 4WWOA 4QXHB 1OWNA 1D1BA 3ETUA 1VOMA 2CHZA 4PK4A 3PUAA 4WWPA 2XPYA 3FBZA 1A17A 2XQ0A 1VDYA 4I2WA 4GPKA 2VKDA 2WXJA 4PAGA 4B8AA 3N9MA 1O3XA 4GCOA 3VTXA 3EDTB 4ZI2D 3IEGA 3AA1B 4AY5A 4G11A 2NTYA 4C0MA 4H63V 1LF8A 5JVDE 5FJYA 3LXUX 4PK5A 2G0UA 3E4BA 3KV6A 3ZRHA 5A1LA 3C98B 2MYSA 3HI2A 4QKNA 4DVDA 4C0EA 3IHVA 2KLQA 5LOZA 2E0IA 5BNWA 2V26A 3GN5B 3GN5A 3JQ1A 2KMFA 2VB6A 3CVVA 4UEMA 2K24A 2CXFA 5F3JA 4PJMA 4I9CA 2A2FX 4FULA 3G2WA 2A3DA 3ASHA 1DVPA 4BT9A 3ASDA 3UT8A 3O1IA 3ZVVA 3HDXA 5EKQD 3L22A 2XRZA 4GA2A 4O2AE 3S7JA 2N9DA 1U3DA 1T98A 2DIWA 4G2VA 5FY1A 3ZC0A 2OVFA 4APFA 4BTBA 2CXDA 3B57A 1TJFA 3BQIA 1OWPA 2XASB 3ZN0B 5CMYA 3SOLA 1ELKA 4QXCB 4OYSA 3O4XE 5LHHB 3MA9A 1UG3A 2ZM8A 4L9IA 4HLEA 2ODUA 5JR9A 2E9XB 3ZHEA 4HOUA 3HHMA 3I4GA 2JMKA 4XKCA 3FUKA 3DP7A 4AP2A 3GWHA 2UY1B 4HGAA 3N5LA 2PZIA 5AIJA 2FULA 4U04A 1YW0A 3CK7A 2I2OA 1HG2A 2Y3AA 1YD8G 2CLYB 4YJ2E 4V1Av 4AKGA 3FWVA 5LBMA 2DHRA 1B7TA 3QK6A 4EYUA 1UJJA 4OYJA 5DQVA 3D3MA 5FXXA 4PNIA 3E22E 4FA6A 2V7MA 2WMOA 2RG8A 4ILIA 3F31A 3RRMB 3KBTA 2X9XA 5CA1E 1OXZA 5LGTB 3QUJA 2GRMA 3HKBE 3MGBA 1SZ9A 3FTVA 3JC6D 4C90A 1E1HB 1LVKA 3KV5A 5E76A 3LCAA 4UV9B 4GZ6A 1WR6A 3U66A 2VSXE 5AJLA 4YVOA 4OVUA 3JUIA 3CHQA 5G05J 3UFEA 2X6HA 2WXMA 2WVIA 3VKGA 2M63A 3PEVB 2CG2A 5A6CA 2V7KA 4CXXA 2J07A 1E90A 4TUUA 2BUGA 2CWYA 1P5QA 4FI5A 3L54A 1D0ZA 4G26A 1JWGA 5BT1A 4TUYE 4YLHA 2KINB 1FMVA 4A1GA 4OHFA 2H3RA 1Y6IA 2W0GA 3K8PC 5JDQA 3MZKB 2XRYA 4ZI7E 3JQ0A 2XAFB 3V5SA 3AU5A 2L0TB 4X1YE 3LK2B 5JHAA 3RYIE 3PURA 4JVSA 3PU3A 1E8YA 1JUQA 3HR0A 2X9HA 1ELWA 5CCLA 2UXNB 4L1BA 2VSYA 1WLXA 3K3QC 3MK7C 2VGYA 3CVNA 4AIFA 3HL6A 2HR2A 4RVBA 4I43B 2DLRA 3FEYA 4DLQA 3PEUB 4EAHA 2KZ7B 3TKLB 2R17C 2OA5A 5FWQA 4LEUA 2EQXA 3LS8A 5L3EB 1E7VA 1JWFA 3CKBA 1XNFA 3ZHEB 1HZ4A 4HFGA 2FO7A 4FJYA 3ZMSB 4BJNA 2AWIA 4H9QC 2UY1A 2LE8A 1HCIA 2WXGA 2CCQA 3FUHA 3BQLA 3RYCE 3E08A 5CCMA 4IYPA 2IW5B 4AKLA 4YFSA 2QGSA 1H2UA 3CEQA 3D9JA 1NAFA 4ASKA 3E0ZA 2XHEA 4ANUA 2VK9A 3I1AA 2H7OA 5LA6E 2L8KA 5JDHA 3WAJA 4KMOA 3GZSA 5LG4A 3R6NA 2VJ8A 4JEUA 4XKBA 4GMJA 3ASGA 2CXLA 3FULA 2J09A 4ATGA 3ML9A 3BG1B 3N2KE 3W15B 2X6JA 2XUEA 1U5PA 3GMIA 2ES0A 3LDZA 4K0RA 3CVQA 2K48A 5EX0A 3Q5MA 3ZEFB 2YK0A 2ZM2A 3FUNA 4DPRA 2XGSA 3GZ2A 3LY9A 3RC3A 4B89A 5G55A 5A7DB 3Q5XA 5GONE 1VRBA 5KJLA 4PW8A 1NWMX 2RP4A 2WB2A 3ENEA 2X0LB 4XBFB 3OAWA 4DI4A 1KLXA 5D0OD 2PL2A 2ODVA 4JXTA 2C5IT 1Y8MA 3C4ZA 5FXZA 4PUCA 1UJKA 4EOZB 1B89A 2BVMA 3O1HA 2J1DG 5JDMA 3OYZA 4FLBA 4UQYA 2HYZA 2LJLA 2LM9A 3D9PA 5JDLA 1FVHA 2CE7A 3CVRA 2V7JA 1D1CA 2RA1A 2DNXA 4GYSA 1HTJF 4MHCA 2FEZA 2C5KT 4OVVA 4V3IA 3UUMA 2C0SA 1UW4B 3SGHA 3I9YA 3UTKA 3ZC1A 2KWHA 3HKCE 1HU3A 4QFVA 4KUMB 1Y64B 4AKHA 3I0OA 3C98A 1H2VC 2UXXB 3FBLA 3ZMVB 4HORA 3S7FA 4JHRA 1IAPA 4F3VA 3ZMZB 1OUVA 2K9AA 2IQCA 4DMVA 4HOSA 5F8PA 3B7RL 2IAKA 2WXIA 3TXNA 3N71A 2DWKA 3UPVA 4G63A 4DO0A 1D1AA 2DWGA 3ZN1B 3FUDA 2I59A 1MMDA 4YVQC 4TV9E 2PG8A 4BAYB 2NWBA 4TX5A 3RRNB 4NQ0A 3D0TA 3FU5A 3N9PA 4AQGA 5ADXL 3PDNA 4UWKA 2XHEB 1BPOA 3RO3A 2DI4A 3CVLA 4GMLA 2Q9QA 3RRUA 2JMHA 2LSUA 2WXLA 2VKJA 4AQFC 1LVFA 4I17A 4HFVA 3SBTB 2JPFA 2XPIA 3AS4A 2E9XC 2Y8DA 4U8HA 2R5SA 1ZU2A 2MHKA 4UVBB 4FJOA 2NP9A 1HX8A 4KZ0A 3MX3A 3LK3B 2NC9A 2IC6A 1UX5A 2L0IA 4KP3C 2X66A 3Q49B 1Z3YA 2X51A 4UWGA 3MYVA 3LK42 1FIOA 3SFZA 2VSOE 5G05C 2XAGB 3FUMA 4B94A 2ZU6B 3APFA 4HXIA 3D9OA 3KVBA 2W00A 5DABA 3OTNA 2KCLA 4BA9A 2V5FA 5HXRA 4R7LA 4OFZA 1MIWA 2RD0A 4F53A 2KZTA 4GU5A 3ESLA 4F1SA 3PTRB 3RRWA 3RKVA 3L08A 3J9X1 2L9BA 4O4LE 2K5BB 4ACKA 5LCWC 1KK7A 4FJZA 4B0ZA 4C91A 4NRHB 1UX4A 4I6EA 3CVPA 3ZFWA 3WI3A 4HTEA 3FFLA 3DTOA 4UVCB 4B8CB 2XEVA 2NXPA 3EHNA 2YU1A 5C1DA 3LJCA 3P8CD 4HVBA 3NQPA 2WXQA 3KVAA 4F6RC 2YU2A 2VYIA 2XGMA 2WXFA 4QX7B 5BUZA 3VHLA 4AV7A 3HVEB 5M72A 3AA6B 5FZQA 1QNFA 2EHOA 4K0UA 3HA4A 2LSYA 3G2VA 4BTAA 2VTBA 2KCKA 4U63A 4L23A 5ETWA 4XZCA 3EIQC 2E9XA 1SHZC 3ASFA 2AVPA 2YEVC 2LAHA 1EDUA 2XCBA 3UUNA 3QARA 3CHMA 3FUJA 4ZHQE 4U07A 3ZN3A 3UX4A 3KD7A 5FP3A 1HO8A 2WM9A 3R7QA 3RC8A 4BY6A 3OKQA 2J49A 4QHOA 2YINA 1BR2A 5IYZE 4I50E 4ZS2A 3ML8A 5JREA 3PUQA 5J2TE 4GYYA 4F7AA 1HF8A 2P9BA 3L6AA 3QDNA 1PC2A 2X9WA 2I1KA 4L5GA 4L2LA 3FH7A 3GYZA 3APDA 3UT7A 1FVFA 4MLKA 2FI7A 1AJ3A 4XI0A 1UCUA 3HYMB 5LGNB 3CR3A 2ZM0A 5FQ7A 1OWLA 3U3WA 3CQGB 4UI9K 5DQWA 4KT6B 3NZSA 5EX3A 1MMNA 4ILGA 4CDNA 1Z6TA 4G2AA 5G2NA 4D10C 2WQHA 3Q47B 1V9DA 5HQ8A 4U74A 3N9QA 2QY7A 3LJ3A 3AS5A 4A1SA 1MMGA 2QA7A 2P58C 3UQ3A 2UWJG 3EUHA 5JDGA 3QC1A 2VGXA 5LX8A 5C2YA 4FHJA 3TAXA 3PUSA 5T4YA 5H6RB 4ILUA 2NW9A 3TXMA 3AAAB 3ZYKA 2J4BA 4UI9C 3S4UA 5E75A 1Z3XA 5BV0A 4GK5E 5KMGP 2WXNA 4WW0A 4IE6A 4HOQA 2I6HA 3QAQA 3NZQA 4JW1A 3AAEB 3SRZA 4GZ3A 2VKHA 2Y6XA 3KV9A 3FH5A 4QX8B 3DBSA 3K3OA 4JPSA 5HXHA 2LOPA 5E0OA 3EDUA 3CHOA 1GW6A 4E7ZA 3P2BA 4ZI3D 4O4HE 4AJWA 3UULA 4CZZB 2MOWA 1LKXA 1MHQA 2PQNA 3MKQA 5FZRA 3G2UA 3ZMUB 3CPZA 4DK5A 2VASA 3LPZA 3PVLA 4K03A 3SWHA 4LCTA 4C9BB 3WXXA 4NUUA 4PFPA 4ZOLE 2GW1A 2WXRA 3VLDA 3ZJ2A 2HPLA 3RH3A 2C0MA 4MS6A 4GA1A 2Q9QD 5FNVE 3IEEA 2IOSA 3AB3B 4HS2A 4UF0A 3FY4A 2LSVA 4P29A 3CX8B 3I3NA 1UN9A 4IULA 5DJQC 4UQZA 4AEZC 5KCMA 2VWAA 5CB4E 2W62A 3URZA 4JUYA 2H7VC 4ERRA 4H7XA 4IIJE 1ZBPA 4DBRA 5JDFA 4U0SA 4PJLA 5L3DB 3JC6C 4E85A 3FXDB 4CGWA 4N39A 2V7IA 2XAJB 1MIYA 3KV4A 3L17A 2X68A 4AXHA 4KMCA 3FEXA 5CMWA 3TG5A 3N2OA 3CVWA 2WXHA 4L0RA 4IE4A 4CI2B 2CFZA 3ESKA 5CA0E 1E7UA 3QWWA 1L5JA 2X6FA 4X1IE 3EIJA 3V5UA 4WNKA 2D0TA 4WAFA 5JH7E 3MKRA 3P1UA 4N2QA 3DJBA 5FMNA 1H7CA 3LG7A 3B7UX 1X5BA 5ARGA 2BTDA 3ETVA 2L3LA 4FLHA 4H9SE 4H7YA 5C8YE 1ELRA 4UXNB 4IDZA 4EZHA 4DMWA 3CQXC 4XIFA 5FY0A 5HXCA 1IQUA 2WPVA 3ZYLA 4KXKB 3LY7A 2YHCA 4G25A 4W9RA 3KEZA 2VL8A 4APOA 4H9RC 3QOUA 4HKAA 4PJNA 5BW8C 4EZLA 1MQSA 4WNDA 2WWUA 4MBQA 4XZ4A 4ACLA 3IBEA 4J2CA 4GIWA 3QK0A 4FC8A 4LUNU 4X20E 4CI1B 3QB2A 4ME2A 3RKOA 4ANWA 3IBPA 3NRYA 5L3BB 5J90A 5G04J 4TRQA 5LP0A 2V8SE 2E2EA 2NSZA 3MKQB 1TJCA 3VLEA 5LBQB 4N2SA 3CX7B 1EPUA 3Q2MA 4NURA 2XAHB 1EF1C 5D0QD 3HKEE 3ZGQA 2HM8A 2X6IA 1MMAA 3PH0C 4EZJA 4MFRA 1U3CA 2Y4UA 2XQYA 5AENA 2PJQA 4EYYR 4I2ZA 2IOLA 3PDYA 4CEMA 2A72A 5JRCA 2C2LA 4DLOA 5AFUL 3G2TA 5HAXA 4G23A 4XI9A 2FF4A 1HS6A 5EK4A 4GYOA 3HKDE 3UUXA 3NZUA 4WNEA 3L09A 4UF0B 4UWHA 5HI7A 5LP6E 5LJMA 3CK9A 1YKEB 3D9MA 4HE8A 3TGOA 4EPZA 1HFAA 4O8SA 1ZKEA 3EVYA 4J8SA 3CHRA 5KX5E 3SZ7A 4JEHB 4TV8E 1ZV4X 4JEUB 3MJWA 4JEHA 4KBMB 5HYAA 1EYHA 3M65A 3QWPA 5LCYA 3LEWA 1S94A 2C0LA 2WQ6A 3RIBA 5BV1A 3CQCB 1SA0E 3FU3A 2V0PA 3GW4A 4CCAA 4KZCA 2ACXA 4EZ4A 3CLJA 3SNXA 1WYCA 4U72A 5HWXA 3I4RB 1D0XA 2A5UA 3FTYA 4ZI2C 3T8MA 1QQEA 3RYFE 4RG9A 1BR4A 3CHPA 4WNGA 3VKHA 3PUKA 3S7DA 4J8DA 3HIZA 4GZCA 3VU7H 5HXSA 3AVSA 3FTWA 3F57A 3EJNA 2I9CA 3AAIA 2AXUA 2PQRA 3PREA 5FYMA 2HPJA 3C4WA 3S2AA 5JJTA 4EQFA 2HO1A 4GK0E 1TEZA 3P7IA 3T5VA 5LCWJ 2ZLYA 3APCA 3FH8A 1KNZA 3PE4A 1S35A 3ANWB 1WRDA 3Q5WA 2GRLA 3CGHA 2PM6A 5T8IA 3ANWA 3LBXB 1H2TC 3JYSA 2EHOB 4ISTA 2YHEA 3ONXA 3IHYA 4I55E 3IHRA 2VQ2A 2JQQA 3LKUA 4N3AA 3MZLB 4EIWA 4UIGA 4YNDA 4J0UA 4I4TE 4KBQA 2VKOA 2WSSV 1W3BA 2KT9A 3RPUA 4MALA 2XCCA 2D5UA 2X67A 3NBXX 2KM4A 4Y6WA 4LERA 4BT8A 2IJGX 5JRCB 1KT1A 4EXTA 5BMVE 3ZYMA 1PAQA 3CSTA 3FUFA 4Y6CA 1OWOA 3ONKA 5FXVA 2NW8A 1IHGA 5J1GA 5IHYA 2AW6A 4MKTA 3LVQE 1S0PA 4E6HA 3ZPJA 2OV8A 4EZKA 3KS2A 4EBAA 3CV0A 1HXIA 4JA7A 3CSFA 1E8WA 5FQ4A 3OXFA 4JC8A 3AVRA 3D9NA 5LNKA 4WNFA 4N3BA 1JPLA 2L9QA 1YA0A 5JJ7A 5L3GB 3MXZA 4H9OC 4UWFA 2J9QA 4PS7A 5AYWD 3OYXA 1UN8A 3BG0B 3N9OA 3SD5A 3KAEA 5EK2A 3FXEB 2Z6EA 3CVYA 2XGOA 2KC7A 3FDHA 4GZ5A 1CUNA 4JHKA 2GGFA 3L16A 4JA9A 4JLEA 3I0QA 1H6KA 1BR0A 5DIZA 2Y48B 4PS3A 2PBIA 3KINB 4TV3A 3PE3A 4YHJA 2XPZA 2LSJA 3K9IA 1E8ZA 4EB6E 3N2GE 4HN9A 4M3OA 4PK6A 4CT0A 4M1PA 4DI3A 2BDEA 3Q9DA 2J08A 4I1OB 2LSKA 3MKDA 3EHMA 5JHBA 4J8EA 3FP3A 3IKOB 4ISSA 3ZPOA 2ILRA 4TN7B 4UV8B 3SI5A 2BZBA 2WXOA 4LRZA 2LHNA 4JZYA 3MEKA 2CFUA 2LSIA 4UQXA 1G8XA 1WAO1 1IJ6A 3VTYA 1LRZA 2LHRA 4QXBB 5FTPA 4H9NC 4I9EA 1NA3A 5KJKA 4RG6A 2FBNA 2AXVA 5ENNA 5LHIB 5JQGE 3R84B 2DBAA 3RK6A 4U0UA 3KDSE 4G1TA 4A3VA 3AA7B 4AQFA 3GA8A 3NZPA 3CKCA 3GZ1A 4O2BE 4IRUA 1IJ5A 4WBNE 3A5XA 3K3NA 5ANRA 1DNPA 2OVBA 5T3RA 5FQ8A 2BVLA 2M67A 4WBOA 4GZDA 3FTZA 4CDRA 3MACA 4N3CA 2VSNA 4I1AA 4UWLA 4ANXA 3FU0A 3PUGA 4GCNA 1IZNB 4I6GA 1U4QA 5A23A 1IQRA 2XAQB 2N1GA 4OYKA 1IYGA 2B1EA 2E8IA 3Q15A 3ZXSA 3MJXA 1HS7A 3U64A 4DJAA 2PM7A 3PU8A 5JR9C 3N9NA 1YKHB 3DPDA 5HWYA 4ILHB 5ANLA 4PJJA 2CM0A 2E9XD 1MNEA 2Q7FA 3PZDA 3F2EA 3CHSA 4O4IE 2CG3A 3FTUA 2N2NA 2KNDA 2V7LA 1OWMA 3S7BA 2JLBA 4EECA 1QSDA 1FMWA 4ZS3A 2DCPA 4BWRA 2WMNA 2QFCA 1KT0A 3O4ZA 1OWAA 3UT5E 2KATA 4MLPA 5BPPA 4FU3A 3CIAA 4J6IA 4QWNB 2DCFA 3B7SA 1WY6A 2AXZA 2IF4A 3PRZA 4GYRA 3KFWX 5FQ6A 3C51A 2L6JA 4IE7A 3NRXA 2LAIA 1MNDA 2D0UA 4Q94A 4CI3B 2Q9QB 2WAUA 5J2UE 2VGXB 4A56A 1US7B 3MA5A 3UMVA 4RSYA 5HXEA 1WYBA 3ZLIA 2KWIB 1H19A 3U9WA 4BJMA 4BX9A 4AKRB 3QC9A 3FUEA 4A55A 3CVXA 1G73A 3C50A 4L2YA 3H3AA 2MBGA 2CWOA 3RX6A 3ZEFA 3JCKC 1INZA 2YQ8A 5KJNA 3O1JA 3CK8A 2JJ9A 3NF1A 3FHNA 5L3CB 4YJ3E 2W63A 3ZCIA 5H6QB 3ZYQA 4ANVA 2W61A 2J4DA 3QJZA 3LVRE 3KBUA 3HVEA 2IONA 4KYOB 1E8XA 4TZ4C 2KCVA 2MRIA 5KDMC 5M4YA 3UT4A 2CMRA 4MRUA 4AY6A 1NP7A 5G04C 3IV0A 2GK9A 2OOEA 3BQKA 3EDVA 4CDMA 2LEHA 2JEKA 4I6JA 3QKYA 4UVAB 4KVOA 3WAKA 3Q4AB 2MTQA 3SF4A 3OXGA 3U78A 4H9PC 1HH8A 3PS6A 3AS8A 4G24A 4AKIA 2LO6A 1ZHCA 3AA0B 2X6KA 2CLYC 3C4XA 4O4JE 4ADZA 3T8OA 3ZIMA 5LXTE 2WXKA 1SZAA 3PNTB 4EBAG 4E7SA 4BX8A 4GA0A 4JL0A 3QNKA 5J08A 1X79A 2IFUA 5LFAA 2PFVA 2CHXA 2NTXA 1PY1A 1Z0PA 5JJ6A 2WQ7A 3I5PA 1SQMA 3RRCA 3PUJA 5TAOA 4J8FA 5LYJE 4XE0A 4NACA 3LFMA 5EDSA 2LOSA 4WUYA 4U0ZA 2EHOC 4N5CA 5EK3A 3C64A 2LSGA 5JDNA 2WXPA 4GOUA 5DBKA 3R7RA 4ANJA 4DNDA 4NUVA 4Q96A 3ONLA 3RO2A 1D0YA 4L7TA 3PE0A 5ARFA 4AXPA 5L3FB 2IC9A 4FHKA 4CRWA 3D9IA 5AJDA 5FZSA 3H37A 3TG4A 3MCXA 4CT4A 3CMLA 3T5XA 4AM9A 4IHJE 2MOZA 3U3IA 2LT3A 4CXYA 3ULQA 2X3MA 3O9XA 1H0AA 4P09A 4IE5A 3RU0A 3VLFA 5CHEE 3G2SA 4GB9A 2D2SA 4IE0A 2ZMAA 1FCHA 2LNIA 4XX5A 4I43A 3I9WA 4PH4B 3B7TA 2C5JA 1FEWA 2I1JA 5LOVE 1WM5A 3R9AB 2WBLA 4X1KE 4KVMA 4PDXA 1XGWA 4PS8A 5FXWA 4DBQA 3FUIA 4AI6A 3O48A 3N9LA 3SS1A 3OJAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMO A;  3VHL A;  2YIN A;  2WMN A;  3B13 A;  2WM9 A; 
#chains in the Genus database with same CATH topology
 5HEO A;  2OND A;  1TR4 A;  4DR2 T;  4B6X A;  2KZT B;  2CHW A;  4GYW A;  4O6F A;  4UI9 J;  2NW7 A;  4WWN A;  3ZUV B;  2CRB A;  3QWV A;  2A4Z A;  5LGU B;  3SHF A;  4NXM T;  4LSZ E;  3RYH E;  3D9K A;  4A3T A;  3AE5 A;  4ZI3 C;  3W9F A;  1M7K A;  5FIO A;  2V1D B;  2NOX A;  5HRY A;  3BK9 A;  5AQJ B;  3TL5 A;  1N52 A;  3PNL B;  1N94 A;  1HG5 A;  2Q9Q C;  3UUX B;  2LRL A;  3ZMT B;  4OK0 A;  3LY8 A;  1N54 A;  3CVU A;  4AOF A;  2IY0 C;  1DC2 A;  4CQI A;  4LG6 A;  4P0A A;  2AJA A;  4AVX A;  2CPT A;  3FTX A;  4FAD A;  3CWZ B;  1HE8 A;  1QUU A;  4YTN A;  2SPC A;  2YNQ A;  4I1M A;  1E96 B;  4N78 D;  2CEA A;  3FU6 A;  3U4T A;  1BR1 A;  4Z8X A;  4CGV A;  4HFD A;  4CXW A;  3OXL A;  1NA0 A;  2JRK A;  5KJM A;  4XAX B;  3BEE A;  3DST A;  3LBX A;  3AU4 A;  5EZY E;  3ZJ1 A;  4BFR A;  3DXK G;  3IF8 B;  2R59 A;  2IHR 1;  3VRA A;  5LJN A;  2X38 A;  2IUB A;  2VTB B;  3D9L A;  3LYA A;  2X9Y A;  2IU1 A;  2XTL A;  2BED A;  3L13 A;  4URK A;  3L3P A;  3RHW A;  2WB5 A;  5JR9 B;  3SBS A;  3RJV A;  1KF6 A;  5LHG B;  1ZEE A;  3CX6 B;  5L2L A;  5LG3 A;  2Y0B G;  4PFO A;  4H63 H;  1NZN A;  5AQF B;  1WG0 A;  4X64 T;  2HHH T;  4HEA A;  4GAA A;  3J7Y q;  4Q69 A;  3DSS A;  4HOT A;  5FT9 A;  4UEL A;  2HH7 A;  3B13 A;  2EHO D;  3RIF A;  3FHE A;  3ISM C;  2VVS A;  2V4L A;  1EZ3 A;  3OBV E;  2Y4T A;  3PZ3 A;  1QZ2 A;  2BF0 X;  5HCJ A;  4LF7 T;  3Q9N C;  1VCT A;  4FP7 A;  2QYJ A;  3ZW3 A;  1MIV A;  2KXP B;  1Q2Z A;  4P0B A;  3ZCJ A;  4IGU A;  3ZNG A;  4ABN A;  3CKD A;  3FTS A;  4IN3 B;  1ZOY A;  3MV2 B;  3HXC A;  1XDO A;  3MV3 B;  3TJP A;  1Z8U A;  4BSX A;  1IBK T;  1VCS A;  1KZO A;  4KX6 A;  2CA5 A;  4JHJ A;  5FY7 A;  4DUY T;  3FB2 A;  5EYL A;  4WWO A;  4QXH B;  3HXE A;  4HB5 A;  2F8X K;  3HXD A;  3SFX A;  1OWN A;  1NEK A;  1D1B A;  2H6H A;  3ETU A;  1VOM A;  2CHZ A;  4PK4 A;  3PUA A;  4WWP A;  2XPY A;  3FBZ A;  1A17 A;  2XQ0 A;  4GKJ T;  1VDY A;  4I2W A;  3C3Q A;  3ZT6 A;  4UUC A;  3NVO A;  4GPK A;  3JUE A;  2VKD A;  3B7B A;  1XNR T;  2WXJ A;  2V5C A;  4PAG A;  4B8A A;  3VRB A;  5EIL A;  3N9M A;  2BBJ A;  5IUX A;  1T8B A;  3FZF B;  3UU5 A;  2QYU A;  1O3X A;  4GCO A;  3VTX A;  3EDT B;  4ZI2 D;  3RF1 A;  4DX6 D;  3IEG A;  3AA1 B;  1XWM A;  3AEC A;  3DSV A;  4AY5 A;  4G11 A;  2NTY A;  4JI2 T;  4C0M A;  2L6B A;  3ZXP A;  2D9D A;  4H63 V;  3CIR A;  1LF8 A;  4JBW F;  5JVD E;  5FJY A;  5AQI B;  3LXU X;  3ULE G;  3TWV A;  3L82 A;  4PK5 A;  1HR0 T;  2G0U A;  3E4B A;  4GTQ A;  3KV6 A;  3ZRH A;  5A1L A;  3C98 B;  2MYS A;  3HI2 A;  4QKN A;  4DVD A;  4C0E A;  2CHN A;  2KLQ A;  3IHV A;  3NOG D;  5D66 A;  3TLT A;  5LOZ A;  3ONL C;  2E0I A;  5BNW A;  2V26 A;  1N9A A;  1YQ4 A;  3GN5 B;  5CGM A;  4EGW A;  3GN5 A;  5KNH D;  4JI6 T;  3JQ1 A;  2GRR B;  3JAD A;  2KMF A;  2VB6 A;  5CEC B;  2P9S G;  3CVV A;  4UEM A;  5HCM A;  2K24 A;  2JAB A;  2CXF A;  5F3J A;  4PJM A;  4I9C A;  5FIN A;  2A2F X;  4FUL A;  3G2W A;  2A3D A;  2KSR A;  3ASH A;  4A63 B;  1DVP A;  4BT9 A;  2EIK E;  3ASD A;  3UT8 A;  3O1I A;  3ZVV A;  4QQI A;  3HDX A;  5EKQ D;  3L22 A;  2XRZ A;  4GA2 A;  4O2A E;  3S7J A;  2A9U A;  2N9D A;  1U3D A;  4HBD A;  1T98 A;  2DIW A;  4G2V A;  5FY1 A;  2ETA A;  1J5E T;  1UUR A;  3ZC0 A;  2OVF A;  4APF A;  4BTB A;  2BG9 C;  2CXD A;  2WP9 A;  3B57 A;  1TJF A;  3BQI A;  4O60 A;  1OWP A;  2XAS B;  3IXE A;  3ZN0 B;  1OED C;  2XEH A;  5CMY A;  3SOL A;  4ZFH A;  1ELK A;  4QXC B;  4OYS A;  3O4X E;  5LHH B;  3MA9 A;  1UG3 A;  2ZM8 A;  4L9I A;  4HLE A;  3UKR G;  1O1R A;  2ODU A;  5JR9 A;  2E9X B;  3ZHE A;  5FVL A;  4HOU A;  5H7P A;  4DRX E;  3HHM A;  2LXL A;  5BXO A;  3W9G A;  2VVN A;  3I4G A;  3PUY F;  2JMK A;  1O1T A;  4XKC A;  5AN8 A;  3PUX F;  3FUK A;  3DP7 A;  3SO8 A;  3GWH A;  4AP2 A;  5CJ5 A;  2UY1 B;  4HGA A;  1D8E A;  3N5L A;  2PZI A;  5AIJ A;  4IL9 A;  2FUL A;  4U04 A;  2ZGD A;  1N4S A;  4ATZ D;  1YW0 A;  4XEI G;  3CK7 A;  3D9H A;  2PNN A;  4U96 D;  2I2O A;  1HG2 A;  2Y3A A;  2XZE A;  1YD8 G;  4HRN A;  1N0R A;  2CLY B;  4YJ2 E;  4EEB A;  3L39 A;  4V1A v;  3VR8 A;  3A8Y C;  4AKG A;  3FWV A;  5LBM A;  2DHR A;  2WZH A;  1B7T A;  3UM1 A;  3QK6 A;  4EYU A;  1UJJ A;  4OYJ A;  5DQV A;  3D3M A;  5FXX A;  3QNU A;  4PNI A;  3E22 E;  3AE2 A;  3ASO E;  4FA6 A;  2V7M A;  2YDR A;  5B1B E;  4GTR A;  2WMO A;  2RG8 A;  4TWH A;  4ILI A;  3F31 A;  3RRM B;  2JQK A;  3KBT A;  2X9X A;  5LMN T;  5CA1 E;  4HLL A;  1OXZ A;  5LGT B;  3QUJ A;  2GRM A;  3HKB E;  1N95 A;  3MGB A;  1SZ9 A;  3AXJ A;  3FTV A;  3JC6 D;  4C90 A;  1E1H B;  1N32 T;  1LVK A;  3KV5 A;  5E76 A;  1N4Q A;  1OCC E;  3LCA A;  4UV9 B;  4GZ6 A;  4COF A;  1WR6 A;  3U66 A;  2EIM E;  2VSX E;  5AJL A;  4Z91 A;  4YVO A;  4OVU A;  3JUI A;  3CHQ A;  5G05 J;  3UFE A;  5ABG A;  2IO3 C;  2X6H A;  3RQW A;  1IBM T;  2WXM A;  2WVI A;  3VKG A;  2M63 A;  3PEV B;  3AE9 A;  3EHR A;  2CG2 A;  1CHU A;  5A6C A;  2H6I A;  2V7K A;  4DV4 T;  4CXX A;  2J07 A;  1E90 A;  4TUU A;  2BUG A;  2CWY A;  1P5Q A;  4FI5 A;  3L54 A;  1D0Z A;  2H88 A;  4G26 A;  1JWG A;  1MX4 A;  2LM2 A;  2WWV A;  5BT1 A;  2XQ4 A;  4TUY E;  2W2U A;  4YLH A;  4DR7 T;  2KIN B;  1FMV A;  4A1G A;  4OHF A;  1SA5 A;  2H3R A;  3AEA A;  3JAE A;  3OTO T;  1Y6I A;  1SUM B;  2W0G A;  3K8P C;  5JDQ A;  3MZK B;  2XRY A;  4ZI7 E;  4DUZ T;  3JQ0 A;  2XAF B;  2HN1 A;  3V5S A;  3AU5 A;  2R6G F;  2L0T B;  2BKK B;  4X1Y E;  3LK2 B;  5JHA A;  3RYI E;  3UIO C;  4P1N A;  4LMJ A;  3PUR A;  3AG4 E;  4JVS A;  3PU3 A;  2ACZ A;  1E8Y A;  1JUQ A;  3HR0 A;  2X9H A;  1JCS A;  3KSQ A;  1ELW A;  5CCL A;  2UXN B;  2DVW A;  4L1B A;  2VSY A;  1WLX A;  2XM2 A;  4A97 A;  3K3Q C;  3MK7 C;  2XY8 B;  3PUW F;  2VGY A;  3CVN A;  3HL6 A;  4AIF A;  3Q73 A;  1YCS B;  2HR2 A;  2WZI A;  4RVB A;  4I43 B;  2DLR A;  3FEY A;  4DLQ A;  3PEU B;  4EAH A;  4AIU A;  2KZ7 B;  3TKL B;  5KBA A;  2R17 C;  2OA5 A;  5FWQ A;  4LEU A;  3UQ7 A;  4JI1 T;  4NXN T;  2A5E A;  2EQX A;  3LS8 A;  5L3E B;  1QLB A;  3AED A;  1E7V A;  1JWF A;  1G3N B;  3CKB A;  1XNF A;  3ZHE B;  4Z68 A;  1HZ4 A;  4HFG A;  2FO7 A;  2IEJ A;  4FJY A;  3ZMS B;  1FT2 A;  4M7C A;  4BJN A;  2M6I A;  2AWI A;  2XQ3 A;  1OED A;  1K3Z D;  4H9Q C;  3J5Q B;  2UY1 A;  2LE8 A;  1HCI A;  4HI8 A;  3P4S A;  2CCQ A;  2WXG A;  3BQL A;  3FUH A;  3RYC E;  5IY5 E;  3E08 A;  4DX1 A;  5CCM A;  4IYP A;  2IW5 B;  4TXR A;  1FJG T;  4AKL A;  4YFS A;  1DU2 A;  4RLY A;  2QGS A;  2IML A;  1H2U A;  3CEQ A;  3D9J A;  1NAF A;  4ASK A;  3E0Z A;  2XHE A;  4ANU A;  2VK9 A;  3AG2 E;  3I1A A;  5L4E A;  2H7O A;  5LA6 E;  2L8K A;  5JDH A;  3EHZ A;  3WAJ A;  3RQU A;  4KMO A;  2R05 A;  3JXJ A;  1IKN D;  3GZS A;  2K3W A;  1TNY A;  5LG4 A;  2H89 A;  3R6N A;  2VJ8 A;  4JEU A;  4IRE A;  3LJN A;  4XKB A;  4GMJ A;  3ASG A;  2CXL A;  1N34 T;  3FUL A;  3AEB A;  1YYH A;  2WU5 A;  2J09 A;  1RW2 A;  2XQ6 A;  4ATG A;  3ML9 A;  5ABF B;  2FO1 E;  3BG1 B;  3RGL A;  3N2K E;  1OCO E;  3W15 B;  2X6J A;  2XUE A;  1U5P A;  1UK5 A;  3GMI A;  2ES0 A;  3LDZ A;  3EAM A;  4HRM B;  4K0R A;  3CVQ A;  2K48 A;  5EX0 A;  3Q5M A;  3ZEF B;  2YK0 A;  2ZM2 A;  3FUN A;  4DPR A;  2XGS A;  3DEO A;  2XEE A;  3GZ2 A;  3LY9 A;  3RC3 A;  4B89 A;  3HRA A;  5G55 A;  5A7D B;  3Q5X A;  5GON E;  1VRB A;  5KJL A;  4PW8 A;  1YQ3 A;  1NWM X;  2RP4 A;  3CK6 A;  2WB2 A;  3ENE A;  2X0L B;  3IA3 A;  4DR6 T;  1BI7 B;  4XBF B;  3OAW A;  4DI4 A;  4J8Y A;  1KLX A;  5D0O D;  2PL2 A;  5ENR D;  2ODV A;  4JXT A;  4LF9 T;  2C5I T;  3PJA J;  5CEA A;  4YSZ A;  1Y8M A;  3C4Z A;  5FXZ A;  1QYM A;  4PUC A;  1SA4 A;  2XSA A;  1DCQ A;  1UJK A;  4EOZ B;  1B89 A;  3UQ4 A;  2BVM A;  3O1H A;  5AAR A;  2J1D G;  5JDM A;  3OYZ A;  4FLB A;  4UQY A;  2HYZ A;  4QH4 A;  2LJL A;  5HEH A;  2LM9 A;  3D9P A;  3HXB A;  5JDL A;  5HEU A;  1FVH A;  3ULY A;  2CE7 A;  2V7J A;  3CVR A;  1D1C A;  2RA1 A;  2DNX A;  4DR3 T;  5L4H A;  3P4W A;  4TNW A;  2IO2 C;  3Q5E A;  4GYS A;  1HTJ F;  4MHC A;  2FEZ A;  2C5K T;  4JV5 T;  4OVV A;  4V3I A;  3UUM A;  2C0S A;  1UW4 B;  3SGH A;  3I9Y A;  3UTK A;  3ZC1 A;  2KWH A;  3ABV A;  3HKC E;  1HU3 A;  4QFV A;  4KUM B;  1Y64 B;  4AKH A;  3I0O A;  3C98 A;  1H2V C;  2UXX B;  5AQQ B;  1X9B A;  3FBL A;  3ZMV B;  4HOR A;  1A5E A;  4EV6 A;  3S7F A;  4JHR A;  1IAP A;  4F3V A;  3ZMZ B;  1OUV A;  2DYR E;  2K9A A;  2IQC A;  2B0O E;  5B3S E;  4DMV A;  4HOS A;  3HXF A;  5F8P A;  3B7R L;  2IAK A;  2WXI A;  3TXN A;  3N71 A;  4DV5 T;  2F4V T;  1XMO T;  2DWK A;  3UPV A;  4G63 A;  4DO0 A;  2YDS A;  1D1A A;  2DWG A;  2ZGG A;  3ZN1 B;  3FUD A;  2I59 A;  4K5B A;  1OY3 D;  1MMD A;  4YVQ C;  4TV9 E;  2CBI A;  3X1D A;  2PG8 A;  4BAY B;  2NWB A;  4TX5 A;  1XMQ T;  3RRN B;  4DX5 D;  4NQ0 A;  3D0T A;  3FU5 A;  3P50 A;  4GTT A;  4B3T T;  3N9P A;  4X62 T;  1KPS B;  4AQG A;  5ADX L;  1BLX B;  1TNO A;  2ETC A;  3PDN A;  4UWK A;  2XHE B;  1BPO A;  3RO3 A;  2DI4 A;  3CVL A;  4NIQ A;  3AEF A;  5KWD A;  4GML A;  3FZH B;  1NFI E;  2XM1 A;  2OEW A;  2Q9Q A;  3RRU A;  2JMH A;  1O5M A;  2LSU A;  2WXL A;  2VKJ A;  4AQF C;  1LVF A;  4I17 A;  2FBW A;  4HFV A;  3SBT B;  2JPF A;  2XPI A;  4HQD A;  5F5W A;  3AS4 A;  2E9X C;  5AQ9 A;  3UU3 A;  4OAU C;  2V6Y B;  2Y8D A;  4U8H A;  2QC9 A;  2R5S A;  1ZU2 A;  4Z90 A;  4U2Y A;  2MHK A;  4NIK A;  3UU6 A;  4UVB B;  3DRA A;  4FJO A;  3NBN B;  2NP9 A;  1HX8 A;  4KZ0 A;  3MX3 A;  3LK3 B;  2NC9 A;  1OXJ A;  2IC6 A;  1UX5 A;  4DV6 T;  4KP3 C;  2X66 A;  4LFC T;  1Z3Y A;  2L0I A;  3TLU A;  3Q49 B;  2X51 A;  4UWG A;  2WS3 A;  3MYV A;  3LK4 2;  4B3S T;  1OED E;  4LNB A;  4HFE A;  4LNG A;  1FIO A;  4G8K A;  1H6O A;  3SFZ A;  2VSO E;  3ZU7 B;  5FVK A;  5G05 C;  2XAG B;  3FUM A;  4B94 A;  2ZU6 B;  3APF A;  4HXI A;  3D9O A;  3TWU A;  3KVB A;  2W00 A;  5DAB A;  4HRL A;  3OTN A;  2KCL A;  4BA9 A;  2BKP A;  5HXR A;  2V5F A;  3C3O A;  4R7L A;  4OFZ A;  1H6P A;  1K1B A;  1MIW A;  2F37 A;  2RD0 A;  1N11 A;  4F53 A;  1Y01 A;  4N5Q A;  2KZT A;  4BEP A;  2P9K G;  4GU5 A;  3ESL A;  4F1S A;  3PTR B;  3P4Q A;  3RRW A;  3RKV A;  3L08 A;  3J9X 1;  2L9B A;  4O4L E;  2K5B B;  4ACK A;  5LCW C;  1KK7 A;  1HX1 B;  4FJZ A;  4EHM A;  4B0Z A;  4C91 A;  4NRH B;  1UX4 A;  4I6E A;  5LMU T;  3CVP A;  3ZFW A;  3WI3 A;  4HTE A;  3FFL A;  3SFY A;  3DTO A;  2UXC T;  4UVC B;  4B8C B;  2XEV A;  2NXP A;  3EHN A;  1YMP A;  2V5Q C;  2YU1 A;  3G06 A;  5C1D A;  3LJC A;  1KNR A;  3P8C D;  1SVX A;  3UKU G;  3X2Q E;  4CZ2 D;  4HVB A;  3NQP A;  2WXQ A;  2YKS A;  4DUI A;  3KVA A;  4F6R C;  2YU2 A;  2VYI A;  1HNW T;  2XGM A;  2WXF A;  4QX7 B;  5BUZ A;  3VHL A;  4AV7 A;  3HVE B;  4IL4 A;  5M72 A;  3AA6 B;  4NPP A;  3PZ1 A;  5FZQ A;  3KSL A;  1QNF A;  2EHO A;  2BBH A;  3T1H T;  4K0U A;  4QH1 A;  3HA4 A;  3R9M A;  2LSY A;  3G2V A;  4BTA A;  5ENS D;  2KCK A;  4F1P A;  2VTB A;  4U63 A;  4L23 A;  5ETW A;  4XZC A;  1WR0 A;  1X81 A;  1N33 T;  3EIQ C;  2QVA A;  2E9X A;  1SHZ C;  3ASF A;  2AVP A;  2YEV C;  3QOF A;  2LAH A;  1EDU A;  2DYS E;  2XCB A;  3UUN A;  2OV9 A;  5AQT B;  1BU9 A;  3QAR A;  3CHM A;  3FUJ A;  4ZHQ E;  1MJ0 A;  2DL1 A;  4JYA T;  4U07 A;  3ZN3 A;  3UX4 A;  3KD7 A;  5FP3 A;  3RI5 A;  1HO8 A;  2WM9 A;  3R7Q A;  3RC8 A;  4BY6 A;  3OKQ A;  2J49 A;  4QHO A;  2YIN A;  2H6G A;  2WU2 A;  1BR2 A;  2JIW A;  5IYZ E;  1LD7 A;  4I50 E;  4ZS2 A;  4LFB T;  3ML8 A;  5JRE A;  1WDY A;  3PUQ A;  4JI5 T;  5J2T E;  4GYY A;  4DR4 T;  4F7A A;  1HF8 A;  2P9B A;  3L6A A;  3QDN A;  1PC2 A;  2X9W A;  3UTM A;  2I1K A;  2J4G A;  4L5G A;  4L2L A;  3FH7 A;  4GKK T;  3T8K A;  4LF8 T;  3GYZ A;  3APD A;  3UM2 A;  5KXJ A;  3UT7 A;  5CRU A;  1FVF A;  3V30 A;  4MLK A;  4DR5 T;  2F8Y A;  2FI7 A;  1AJ3 A;  3SFD A;  4XI0 A;  3L8R A;  4DV7 T;  1UCU A;  3HYM B;  5LGN B;  3CR3 A;  2ZM0 A;  5FQ7 A;  1K8K G;  1D8D A;  3UIN C;  4A5X A;  1OWL A;  3U3W A;  3CQG B;  5FL0 A;  4UI9 K;  5DQW A;  4KT6 B;  3NZS A;  4HWH A;  5EX3 A;  1MMN A;  4YTP A;  4ILG A;  4CDN A;  2ZIS A;  1Z6T A;  2XQ9 A;  4G2A A;  4X65 T;  3C72 A;  5G2N A;  4D10 C;  4JD2 G;  5BR8 T;  2WQH A;  5FL1 A;  3Q47 B;  1V9D A;  2UU9 T;  5HQ8 A;  4U74 A;  3N9Q A;  2QY7 A;  3LJ3 A;  3AS5 A;  4A1S A;  1MMG A;  2QA7 A;  2P58 C;  3Q79 A;  3UQ3 A;  2UWJ G;  1FT1 A;  3EUH A;  2V5D A;  5JDG A;  3QC1 A;  2V6X A;  2VGX A;  3RIA A;  5LX8 A;  4EED A;  5C2Y A;  2UXD T;  4FHJ A;  3TAX A;  3PUS A;  1NL4 A;  5T4Y A;  5H6R B;  4ILU A;  2NW9 A;  3TXM A;  3AAA B;  3ZYK A;  2J4B A;  4UI9 C;  3S4U A;  5E75 A;  4GTP A;  1Z3X A;  3TWX A;  5BV0 A;  2LKH A;  1M62 A;  4GK5 E;  5KMG P;  2WXN A;  4WW0 A;  4IE6 A;  2DZO A;  4HOQ A;  2I6H A;  3QAQ A;  5CBN A;  3NZQ A;  3K1S A;  3AAE B;  2E5V A;  3SRZ A;  4JW1 A;  1TN8 A;  3TLS A;  5C2T A;  4GZ3 A;  2VKH A;  4L9P A;  2RKK A;  4CN1 A;  5AQO B;  2P9N G;  2XQ7 A;  3WG7 E;  2Y6X A;  4ZZB A;  3KV9 A;  3NB2 A;  3PZ2 A;  3FH5 A;  2NR4 A;  2E2A A;  4QX8 B;  2XPK A;  4TNV A;  2LXM A;  3DBS A;  3K3O A;  4JPS A;  5HXH A;  2LOP A;  3Q75 A;  5E0O A;  3EDU A;  3VR9 A;  3CHO A;  1JNZ A;  4DX7 D;  1GW6 A;  4U95 D;  4E7Z A;  4ILC A;  3ABM E;  5HS0 A;  3P2B A;  3AE6 A;  4ZI3 D;  4O4H E;  1BD8 A;  4AJW A;  3UUL A;  2CHO A;  4CZZ B;  2MOW A;  1LKX A;  1MHQ A;  3UI2 A;  2PQN A;  3MKQ A;  5FZR A;  3G2U A;  3ZMU B;  3CPZ A;  2WDR A;  4DK5 A;  2VAS A;  3LPZ A;  3PVL A;  4K03 A;  3SWH A;  4LCT A;  4C9B B;  3WXX A;  4JI3 T;  4TWD A;  4GPM A;  4NUU A;  4PFP A;  4ZOL E;  2GW1 A;  2WXR A;  3RKG A;  3VLD A;  3ABL E;  1BI8 B;  3ZJ2 A;  2HPL A;  3RH3 A;  2C0M A;  4MS6 A;  4HWD A;  4GA1 A;  2Q9Q D;  5FNV E;  3IEE A;  2IOS A;  3AB3 B;  4HS2 A;  4UF0 A;  5AQN B;  3FY4 A;  3JCF A;  2LSV A;  2WDQ A;  4P29 A;  3CX8 B;  4TWF A;  3I3N A;  1UN9 A;  4GTV A;  4IUL A;  5DJQ C;  4UQZ A;  4AEZ C;  4QH5 A;  2H6F A;  5KCM A;  2VWA A;  1SE7 A;  5CB4 E;  2W62 A;  3URZ A;  4JUY A;  2VGE A;  2H7V C;  4ERR A;  4H7X A;  4IIJ E;  1ZBP A;  4DBR A;  5JDF A;  4HI9 A;  4U0S A;  4PJL A;  5L3D B;  3JC6 C;  4E85 A;  3FXD B;  4CGW A;  4N39 A;  2V7I A;  2XAJ B;  1MIY A;  3KV4 A;  3L17 A;  2X68 A;  3C5R A;  4AXH A;  4KMC A;  3FEX A;  5CMW A;  3TG5 A;  3P4P A;  3N2O A;  3CVW A;  2WXH A;  4L0R A;  4IE4 A;  4CI2 B;  4U8V D;  1OED B;  2R02 A;  2CFZ A;  3ESK A;  4BES A;  5CA0 E;  1LD8 A;  1E7U A;  3QWW A;  1MZC A;  1L5J A;  2X6F A;  4X1I E;  3EIJ A;  3V5U A;  4WNK A;  2D0T A;  2BG9 B;  4WAF A;  3TLV A;  5JH7 E;  3MKR A;  3E34 A;  3P1U A;  1E7P A;  4U33 A;  4N2Q A;  3DJB A;  5FMN A;  1H7C A;  3LG7 A;  1N0Q A;  3B7U X;  1YXR A;  1X5B A;  5ARG A;  3DSW A;  1ZP0 A;  2BTD A;  2UXB T;  2Y1L E;  5AQA A;  3ETV A;  1OCR E;  2L3L A;  4FLH A;  5ENT D;  1R8I A;  4H9S E;  4H7Y A;  5C8Y E;  1ELR A;  4AIS A;  4GMR A;  4UXN B;  4HFI A;  3RAU A;  4IDZ A;  1T7S A;  4EZH A;  4LF5 T;  4DMW A;  3CQX C;  4XIF A;  2LUH A;  1W0A A;  5FY0 A;  5HXC A;  1IQU A;  2WPV A;  5ITZ F;  3ZYL A;  4KXK B;  3LY7 A;  2YHC A;  4G25 A;  4W9R A;  3KEZ A;  2VL8 A;  2DZN A;  3UM3 A;  4APO A;  2P9I G;  4H9R C;  3QOU A;  4HKA A;  4PJN A;  5BW8 C;  4EZL A;  1MQS A;  4WND A;  2WWU A;  4JI8 T;  4MBQ A;  4XZ4 A;  4ACL A;  4TXQ A;  3IBE A;  4J2C A;  4GIW A;  3JXI A;  3QK0 A;  4FC8 A;  4LUN U;  2LKG A;  4X20 E;  4CI1 B;  3QB2 A;  4ME2 A;  3RKO A;  4ANW A;  3IBP A;  3NRY A;  4ZEY A;  5L3B B;  5J90 A;  3AEG A;  5G04 J;  4TRQ A;  3NKZ A;  3V2X A;  3DWL G;  5LP0 A;  2V8S E;  1RZ4 A;  2E2E A;  2NSZ A;  1I94 T;  3MKQ B;  1TJC A;  2XEN A;  3VLE A;  5LBQ B;  1HNX T;  4N2S A;  4UR9 A;  3CX7 B;  1EPU A;  3Q2M A;  4NUR A;  2XAH B;  1EF1 C;  5D0Q D;  3ZKJ A;  1WFD A;  3AE8 A;  3HKE E;  3ZGQ A;  2HM8 A;  2X6I A;  3DPY A;  1MMA A;  3PH0 C;  5AQ7 A;  4EZJ A;  4MFR A;  1HNZ T;  2VQE T;  1U3C A;  4JB8 P;  2Y4U A;  2XQY A;  3ZSS A;  5AEN A;  2PJQ A;  4EYY R;  1TN6 A;  2IOL A;  2XQ5 A;  4I2Z A;  3PDY A;  3NWI A;  2OCC E;  4HWC A;  1S70 B;  4CEM A;  3B95 A;  2A72 A;  5JRC A;  3SFE A;  2C2L A;  4DLO A;  5AFU L;  3EHQ A;  5HAX A;  3G2T A;  4G23 A;  4XI9 A;  2FF4 A;  1HS6 A;  5EK4 A;  4GYO A;  3HKD E;  4ILB A;  3NZU A;  4WNE A;  3UUX A;  3L09 A;  5CBO A;  2YDQ A;  4UF0 B;  5LB7 B;  4UWH A;  4LFA T;  2P9L G;  5HI7 A;  2XZT G;  5LP6 E;  3V31 A;  5LJM A;  3CK9 A;  3J5P A;  1YKE B;  3D9M A;  2M6B A;  4HE8 A;  3TGO A;  4EPZ A;  1HFA A;  4O8S A;  1ZKE A;  4IDP A;  3EVY A;  4WZX A;  2EIL E;  4U7E B;  4J8S A;  2F0Y A;  3CHR A;  5KX5 E;  2FJA A;  3SZ7 A;  4JEH B;  4TV8 E;  1ZV4 X;  1TN7 A;  2MAW A;  4JEU B;  3RLF F;  4BSZ B;  4YXD A;  3MJW A;  3OPC A;  4JEH A;  4YDY A;  1J1J A;  4KBM B;  5HYA A;  1EYH A;  3BU8 A;  3M65 A;  3QWP A;  1U2V G;  5LCY A;  3LEW A;  1S94 A;  2C0L A;  1FPP A;  5KNG A;  2WQ6 A;  3TWS A;  2V8S V;  3RIB A;  5BV1 A;  4BET A;  5AQV B;  3CQC B;  4B3M T;  2WQY A;  5JA4 D;  5L47 A;  1SA0 E;  3FU3 A;  3SY2 A;  2V0P A;  2MYO A;  4YHH T;  1W0B A;  3GW4 A;  1UUS A;  2W67 A;  4CCA A;  4KZC A;  2ACX A;  4EZ4 A;  3CLJ A;  2R2L A;  1D9S A;  3SNX A;  1WYC A;  4U72 A;  5HWX A;  3I4R B;  1D0X A;  2A5U A;  1TNZ A;  3FTY A;  4ZI2 C;  4LNU D;  1QQE A;  3T8M A;  3RYF E;  3Q78 A;  4RG9 A;  1BR4 A;  3CHP A;  4WNG A;  1NEN A;  3VKH A;  3PUK A;  1XZY A;  3S7D A;  2WY2 A;  4J8D A;  5AQS B;  3HIZ A;  4GZC A;  3PZ4 A;  3VU7 H;  4LMK A;  3LSV A;  3AVS A;  5HXS A;  3FTW A;  3PV0 F;  4J7W A;  3F57 A;  3UU8 A;  3RIU A;  3EJN A;  4ZHB A;  2I9C A;  3AAI A;  5AQB A;  2AXU A;  2XS1 A;  4O1O A;  2PQR A;  5HEG A;  3PRE A;  4DID B;  3BQO A;  5FYM A;  2HPJ A;  4JI7 T;  3C4W A;  4OX9 T;  3S2A A;  3FZL B;  2RFA A;  3KEA A;  2XQA A;  5JJT A;  4YDE A;  3AE3 A;  4EQF A;  2HO1 A;  4IDN A;  4GK0 E;  3L9T A;  1TEZ A;  3P7I A;  3T5V A;  2UUB T;  5LCW J;  2ZLY A;  4LF6 T;  3APC A;  3FH8 A;  3AAA C;  1KNZ A;  2GRN B;  5AQL B;  3PE4 A;  2BKG A;  2YN6 A;  1S35 A;  3ANW B;  1KFY A;  1WRD A;  3Q5W A;  2GRL A;  3AG1 E;  5JMN D;  3CGH A;  2PM6 A;  5T8I A;  5B1A E;  3ANW A;  3LBX B;  4B93 B;  1IHB A;  1H2T C;  3JYS A;  2EHO B;  4IST A;  2YHE A;  3ONX A;  4I55 E;  3IHY A;  1MYO A;  3IHR A;  2VQ2 A;  2JQQ A;  3LKU A;  4N3A A;  3MZL B;  4U2Z A;  4EIW A;  4G8L A;  4UIG A;  5AQP B;  4YND A;  4J0U A;  2WCA A;  4I4T E;  4KBQ A;  2VKO A;  2WSS V;  1W3B A;  3ZKR A;  2KT9 A;  3RPU A;  1IBL T;  4MAL A;  2XCC A;  2D5U A;  2X67 A;  3NBX X;  2GRO B;  2KM4 A;  3HG0 D;  4Y6W A;  4LER A;  4BT8 A;  2IJG X;  1XDP A;  5JRC B;  1KT1 A;  2P9U G;  2XZD G;  4EXT A;  5BMV E;  5HEJ A;  3ZYM A;  1PAQ A;  3CST A;  3FUF A;  3SQV A;  3UU4 A;  4Y6C A;  3ABK E;  3DSX A;  1OWO A;  3ONK A;  5FXV A;  5ABE A;  2NW8 A;  4U8Y D;  2HE0 A;  1IHG A;  5J1G A;  5IHY A;  2AW6 A;  4MKT A;  3LVQ E;  1S0P A;  4E6H A;  3ZPJ A;  2OV8 A;  4EZK A;  3KS2 A;  4EBA A;  3CV0 A;  1HXI A;  4JA7 A;  3CSF A;  1E8W A;  5FQ4 A;  3OXF A;  2XQ8 A;  4JC8 A;  1J5W A;  3AVR A;  3D9N A;  3AE1 A;  5LNK A;  2I0M A;  4IDQ A;  4WNF A;  4N3B A;  5ABF A;  1JPL A;  2L9Q A;  1YA0 A;  1GQE A;  1JCQ A;  5AQR B;  2ZM6 T;  3EU5 A;  5JJ7 A;  5L3G B;  3MXZ A;  4H9O C;  4UWF A;  2J9Q A;  4PS7 A;  1XNQ T;  3OYX A;  5AYW D;  1UN8 A;  3UXG A;  3BG0 B;  3N9O A;  3SD5 A;  5JTG A;  3KAE A;  5EK2 A;  3FXE B;  2Z6E A;  4HFB A;  3CVY A;  2XGO A;  2KC7 A;  3FDH A;  4YSY A;  2HN2 A;  1CUN A;  4GZ5 A;  1KEY A;  3E37 A;  4JHK A;  4IT4 A;  2GGF A;  3L16 A;  4JA9 A;  4JLE A;  3I0Q A;  1H6K A;  1BR0 A;  5DIZ A;  2Y48 B;  4PS3 A;  2FJB A;  3Q7F A;  3UM0 A;  2PBI A;  3KIN B;  1ZB1 A;  4LF4 T;  4TV3 A;  3PE3 A;  4YHJ A;  2X0Y A;  4BER A;  4LML A;  2XPZ A;  2LSJ A;  3K9I A;  1E8Z A;  1UOH A;  3Q9U C;  2XJ7 A;  4EB6 E;  5ABH A;  2Y69 E;  1I6Z A;  3N2G E;  4HN9 A;  4M3O A;  4PK6 A;  1N4P A;  4CT0 A;  4M1P A;  5AQK B;  4DI3 A;  3JAF A;  2P9P G;  2BDE A;  3Q9D A;  2FUP A;  2J08 A;  1IXV A;  4I1O B;  4CYM D;  3BUA A;  3AE7 A;  2LSK A;  4GTO A;  3MKD A;  3EHM A;  1L0V A;  5JHB A;  3QB5 K;  4J8E A;  3FP3 A;  1T72 A;  4WYV A;  3IKO B;  4ISS A;  3ZPO A;  4YY3 T;  2ILR A;  4CN6 A;  1W9R A;  4TN7 B;  4UV8 B;  3SI5 A;  2BZB A;  4DV1 T;  2WXO A;  3FZM B;  3PUZ F;  4LRZ A;  2LHN A;  2VL0 A;  4Q25 A;  3RIU C;  4JZY A;  3MEK A;  2CFU A;  2LSI A;  1TYQ G;  4UQX A;  1G8X A;  1WAO 1;  1IJ6 A;  3VTY A;  1LRZ A;  2LHR A;  4QXB B;  5FTP A;  4H9N C;  4I9E A;  1NA3 A;  5KJK A;  4RG6 A;  3UIP C;  3TLW A;  2FBN A;  2AXV A;  1TNU A;  5ENN A;  3OVU A;  2EIJ E;  2BG9 E;  5JQG E;  5LHI B;  4HNA D;  3R84 B;  2CBJ A;  2DBA A;  3RSE G;  3RK6 A;  2LRK A;  4U0U A;  3KDS E;  2ETB A;  4G1T A;  4A3V A;  3AA7 B;  2PTF A;  4AQF A;  3GA8 A;  3NZP A;  3CKC A;  3GZ1 A;  1AWC B;  5EN5 D;  4K5A B;  4O2B E;  4IRU A;  1IJ5 A;  4RQI A;  4WBN E;  3A5X A;  3K3N A;  3TWQ A;  2J62 A;  5ANR A;  3T1Y T;  1DNP A;  2OVB A;  2IIU A;  5FQ8 A;  5T3R A;  2BKO A;  5EYP F;  2BVL A;  2M67 A;  4WBO A;  4DV2 T;  4GZD A;  3FTZ A;  4CDR A;  3MAC A;  4N3C A;  2VSN A;  4I1A A;  4UWL A;  1SW6 A;  4GTS A;  3NAW A;  4ANX A;  2ZIR A;  3M3Z B;  4X66 T;  4DR1 T;  3FU0 A;  3PUG A;  4GCN A;  1IZN B;  2FJD A;  3DEP A;  4I6G A;  1U4Q A;  3ASN E;  5A23 A;  1IQR A;  2XAQ B;  2NYJ A;  5ENQ D;  2N1G A;  4OYK A;  1IYG A;  2XSB A;  1KNP A;  2B1E A;  2E8I A;  5ENO D;  5ENP D;  2RFM A;  3Q15 A;  3ZXS A;  3MJX A;  4KHZ F;  4CN4 A;  1HS7 A;  5C3J A;  3U64 A;  4DJA A;  4U7Y A;  2PM7 A;  3PU8 A;  3ZST A;  5JR9 C;  2VQF T;  3N9N A;  1YKH B;  3DPD A;  5HWY A;  3PUV F;  4ILH B;  5ANL A;  4PJJ A;  3TWR A;  4X8Q A;  3C3R A;  2CM0 A;  2E9X D;  1MNE A;  1UGO A;  2Q7F A;  3PZD A;  3F2E A;  3CHS A;  3DSU A;  4O4I E;  2OEV A;  1N4R A;  4U31 A;  2CG3 A;  3FTU A;  2FJE A;  2N2N A;  2KND A;  2V7L A;  1OWM A;  3S7B A;  2JLB A;  1QBQ A;  2W4X A;  2J8S D;  4EEC A;  1QSD A;  1FMW A;  4ZS3 A;  2DCP A;  4BWR A;  2WMN A;  2QFC A;  2BG9 A;  1KT0 A;  3O4Z A;  4MBG A;  4GTM A;  1OWA A;  3UT5 E;  2KAT A;  4MLP A;  5BPP A;  4FU3 A;  3CIA A;  4J6I A;  4QWN B;  2DCF A;  3B7S A;  1WY6 A;  2AXZ A;  2IF4 A;  3PRZ A;  4GYR A;  3KFW X;  1JNR A;  5FQ6 A;  2ZXW E;  3E33 A;  4KI0 F;  3B5M A;  3C51 A;  2KBX A;  2L6J A;  4IE7 A;  3NRX A;  2X0H A;  2LAI A;  1MND A;  2QZA A;  2D0U A;  1NI1 A;  4Q94 A;  5CER B;  4CI3 B;  2Q9Q B;  2WAU A;  2BS3 A;  5J2U E;  2VGX B;  4A56 A;  1US7 B;  3MA5 A;  3UMV A;  5CRV A;  1Z5S C;  1JCR A;  1LTX A;  4RSY A;  5D2M C;  4HWI B;  5HXE A;  1WYB A;  3ZLI A;  2JQH A;  2KWI B;  1H19 A;  3U9W A;  4BJM A;  4BX9 A;  4AKR B;  3QC9 A;  2AXD S;  3FUE A;  4A55 A;  1V55 E;  2MPK A;  3CVX A;  1E2A A;  1G73 A;  3C50 A;  4L2Y A;  3H3A A;  1MX2 A;  2XS8 A;  2MBG A;  3ZT7 A;  2CWO A;  3RX6 A;  5AQU B;  2YOE A;  4YSX A;  4DX2 A;  3ZEF A;  3JCK C;  1INZ A;  2YQ8 A;  5KJN A;  3O1J A;  2OLT A;  3CK8 A;  2JJ9 A;  3NF1 A;  4JI0 T;  3FHN A;  5L3C B;  4YJ3 E;  2W63 A;  3ZCI A;  4U7I A;  4IDO A;  5H6Q B;  3ZYQ A;  4ANV A;  2W61 A;  2J4D A;  3QJZ A;  4ZZC A;  3LVR E;  3KBU A;  3HVE A;  2ION A;  3T9K A;  4KYO B;  1OCZ E;  1E8X A;  4TZ4 C;  2KCV A;  2MRI A;  4OAV B;  2B76 A;  5KDM C;  3A7M A;  5M4Y A;  3UT4 A;  2CMR A;  5EIB E;  2GRQ B;  4MRU A;  4AY6 A;  1NP7 A;  2B6C A;  3P4R A;  2QRX A;  5G04 C;  3IV0 A;  3NOC D;  2GK9 A;  2OOE A;  3EUV A;  4HWF A;  2DWZ A;  3BQK A;  3DXM G;  3EDV A;  4CDM A;  2LEH A;  3H3M A;  3AEE A;  1AP7 A;  2JEK A;  3TWT A;  2UUC T;  4I6J A;  3EAB A;  3QKY A;  4UVA B;  4KVO A;  4K0K T;  3WAK A;  4I0U A;  2BS2 A;  4HFH A;  3Q4A B;  2MTQ A;  3QB5 A;  3SF4 A;  3OXG A;  3U78 A;  3LDQ B;  4H9P C;  5J0Z A;  1HH8 A;  2W66 A;  3PS6 A;  1N36 T;  3AS8 A;  4G24 A;  4DV3 T;  4AKI A;  2LO6 A;  1ZHC A;  3AA0 B;  2X6K A;  3AG3 E;  2CLY C;  3C4X A;  4O4J E;  4ADZ A;  3T8O A;  3ZIM A;  5LXT E;  2WXK A;  1SZA A;  3PNT B;  4EBA G;  3ZT5 A;  4E7S A;  4BX8 A;  5AQM B;  4GA0 A;  2LLY A;  3V2O A;  3QNK A;  4JL0 A;  5J08 A;  2BS4 A;  2QYW A;  1X79 A;  5CFB A;  2IFU A;  2WDV A;  4ZXL A;  5LFA A;  2PFV A;  2EIN E;  3UFG A;  2CHX A;  1V54 E;  1MX6 A;  2NTX A;  1PY1 A;  1Z0P A;  5JJ6 A;  2V4H C;  2WQ7 A;  4X5T A;  3AXJ B;  3I5P A;  4A98 A;  1SQM A;  4C48 B;  3RRC A;  5AQG B;  3PUJ A;  5TAO A;  4U3C A;  4J8F A;  4B3R T;  2J47 A;  5LYJ E;  3F6Q A;  4XE0 A;  4NAC A;  3EI0 A;  3LFM A;  2KXP C;  2LOS A;  4TUM A;  4YDO A;  5EDS A;  4WUY A;  3ONJ A;  4U0Z A;  2JQ9 A;  2EHO C;  1O1S A;  4N5C A;  5EK3 A;  3C64 A;  1S63 A;  2LSG A;  5JDN A;  5EID A;  2WXP A;  4GOU A;  4YDW A;  5DBK A;  3R7R A;  3AE4 A;  4JI4 T;  2AE9 A;  4ANJ A;  4DV0 T;  4DND A;  4ILA A;  4NUV A;  4Q96 A;  3ONL A;  5CED B;  4O1P A;  2IDO B;  3RO2 A;  5FKY A;  1D0Y A;  4TXP A;  4L7T A;  3PE0 A;  4YT0 A;  4YTM A;  3E32 A;  1DCE A;  3E30 A;  5ARF A;  4AXP A;  5L3F B;  2IC9 A;  4FHK A;  3Q5D A;  1TNB A;  4CRW A;  3D9I A;  5AJD A;  5FZS A;  3UUB A;  3H37 A;  3TG4 A;  3MCX A;  4CT4 A;  3CML A;  3T5X A;  3FZK B;  4AM9 A;  4IHJ E;  2RPA A;  2V6Y A;  2MOZ A;  3U3I A;  2GRP B;  2LT3 A;  4CXY A;  1S64 A;  3ULQ A;  2X3M A;  5HKP A;  3O9X A;  5AAO A;  1H0A A;  3TWW A;  4P09 A;  4IE5 A;  5BXU A;  4KHP T;  3RU0 A;  3PJA A;  3VLF A;  5CHE E;  1W09 A;  2UUA T;  1KZP A;  3Q7A A;  3G2S A;  2P2C P;  4GB9 A;  2R03 A;  3AJI A;  2D2S A;  4IE0 A;  2ZMA A;  1FCH A;  2LNI A;  4XX5 A;  4I43 A;  3I9W A;  4PH4 B;  4F6R D;  3B7T A;  2C5J A;  3EU9 A;  3V79 K;  1FEW A;  2I1J A;  5LOV E;  1WM5 A;  5AQH B;  2E5L T;  3R9A B;  1K1A A;  1OT8 A;  2WBL A;  4X1K E;  4F8H A;  1WCR A;  4K5C A;  5IWA T;  4AQY T;  4KVM A;  4PDX A;  1XGW A;  4PS8 A;  2BKN A;  5FXW A;  4DBQ A;  3FUI A;  4AI6 A;  3O48 A;  4HFC A;  2VUR A;  3N9L A;  3SS1 A;  3OJA A; 
#chains in the Genus database with same CATH homology
 2OND A;  4B6X A;  2KZT B;  2CHW A;  4GYW A;  4O6F A;  4UI9 J;  2NW7 A;  4WWN A;  3QWV A;  2A4Z A;  5LGU B;  3SHF A;  3RYH E;  3D9K A;  4A3T A;  4ZI3 C;  2V1D B;  2NOX A;  3BK9 A;  3TL5 A;  1N52 A;  3PNL B;  1HG5 A;  2Q9Q C;  3UUX B;  3ZMT B;  4OK0 A;  3LY8 A;  1N54 A;  3CVU A;  4AOF A;  4CQI A;  4P0A A;  4AVX A;  3FTX A;  4FAD A;  3CWZ B;  1HE8 A;  1QUU A;  4I1M A;  2SPC A;  2YNQ A;  1E96 B;  4N78 D;  2CEA A;  3FU6 A;  3U4T A;  1BR1 A;  4Z8X A;  4CGV A;  4CXW A;  3OXL A;  1NA0 A;  2JRK A;  5KJM A;  4XAX B;  3BEE A;  3LBX A;  3AU4 A;  5EZY E;  3ZJ1 A;  4BFR A;  3IF8 B;  2R59 A;  5LJN A;  2X38 A;  2VTB B;  3D9L A;  3LYA A;  2X9Y A;  2IU1 A;  2XTL A;  4URK A;  3L13 A;  3L3P A;  5JR9 B;  3SBS A;  3RJV A;  5LHG B;  1ZEE A;  3CX6 B;  5L2L A;  4PFO A;  4H63 H;  1NZN A;  4HEA A;  4GAA A;  3J7Y q;  4Q69 A;  4HOT A;  5FT9 A;  4UEL A;  2HH7 A;  3B13 A;  2EHO D;  3FHE A;  2V4L A;  1EZ3 A;  3OBV E;  2Y4T A;  1QZ2 A;  2BF0 X;  4FP7 A;  3ZW3 A;  1MIV A;  2KXP B;  4P0B A;  3ZCJ A;  4IGU A;  4ABN A;  3CKD A;  3FTS A;  4IN3 B;  3MV2 B;  3MV3 B;  3TJP A;  4BSX A;  2CA5 A;  4JHJ A;  5FY7 A;  3FB2 A;  4WWO A;  4QXH B;  1OWN A;  1D1B A;  3ETU A;  1VOM A;  2CHZ A;  4PK4 A;  3PUA A;  4WWP A;  2XPY A;  3FBZ A;  1A17 A;  2XQ0 A;  1VDY A;  4I2W A;  4GPK A;  2VKD A;  2WXJ A;  4PAG A;  4B8A A;  3N9M A;  1O3X A;  4GCO A;  3VTX A;  3EDT B;  4ZI2 D;  3IEG A;  3AA1 B;  4AY5 A;  4G11 A;  2NTY A;  4C0M A;  4H63 V;  1LF8 A;  5JVD E;  5FJY A;  3LXU X;  4PK5 A;  2G0U A;  3E4B A;  3KV6 A;  3ZRH A;  5A1L A;  3C98 B;  2MYS A;  3HI2 A;  4QKN A;  4DVD A;  4C0E A;  3IHV A;  2KLQ A;  5LOZ A;  2E0I A;  5BNW A;  2V26 A;  3GN5 B;  3GN5 A;  3JQ1 A;  2KMF A;  2VB6 A;  3CVV A;  4UEM A;  2K24 A;  2CXF A;  5F3J A;  4PJM A;  4I9C A;  2A2F X;  4FUL A;  3G2W A;  2A3D A;  3ASH A;  1DVP A;  4BT9 A;  3ASD A;  3UT8 A;  3O1I A;  3ZVV A;  3HDX A;  5EKQ D;  3L22 A;  2XRZ A;  4GA2 A;  4O2A E;  3S7J A;  2N9D A;  1U3D A;  1T98 A;  2DIW A;  4G2V A;  5FY1 A;  3ZC0 A;  2OVF A;  4APF A;  4BTB A;  2CXD A;  3B57 A;  1TJF A;  3BQI A;  1OWP A;  2XAS B;  3ZN0 B;  5CMY A;  3SOL A;  1ELK A;  4QXC B;  4OYS A;  3O4X E;  5LHH B;  3MA9 A;  1UG3 A;  2ZM8 A;  4L9I A;  4HLE A;  2ODU A;  5JR9 A;  2E9X B;  3ZHE A;  4HOU A;  3HHM A;  3I4G A;  2JMK A;  4XKC A;  3FUK A;  3DP7 A;  4AP2 A;  3GWH A;  2UY1 B;  4HGA A;  3N5L A;  2PZI A;  5AIJ A;  2FUL A;  4U04 A;  1YW0 A;  3CK7 A;  2I2O A;  1HG2 A;  2Y3A A;  1YD8 G;  2CLY B;  4YJ2 E;  4V1A v;  4AKG A;  3FWV A;  5LBM A;  2DHR A;  1B7T A;  3QK6 A;  4EYU A;  1UJJ A;  4OYJ A;  5DQV A;  3D3M A;  5FXX A;  4PNI A;  3E22 E;  4FA6 A;  2V7M A;  2WMO A;  2RG8 A;  4ILI A;  3F31 A;  3RRM B;  3KBT A;  2X9X A;  5CA1 E;  1OXZ A;  5LGT B;  3QUJ A;  2GRM A;  3HKB E;  3MGB A;  1SZ9 A;  3FTV A;  3JC6 D;  4C90 A;  1E1H B;  1LVK A;  3KV5 A;  5E76 A;  3LCA A;  4UV9 B;  4GZ6 A;  1WR6 A;  3U66 A;  2VSX E;  5AJL A;  4YVO A;  4OVU A;  3JUI A;  3CHQ A;  5G05 J;  3UFE A;  2X6H A;  2WXM A;  2WVI A;  3VKG A;  2M63 A;  3PEV B;  2CG2 A;  5A6C A;  2V7K A;  4CXX A;  2J07 A;  1E90 A;  4TUU A;  2BUG A;  2CWY A;  1P5Q A;  4FI5 A;  3L54 A;  1D0Z A;  4G26 A;  1JWG A;  5BT1 A;  4TUY E;  4YLH A;  2KIN B;  1FMV A;  4A1G A;  4OHF A;  2H3R A;  1Y6I A;  2W0G A;  3K8P C;  5JDQ A;  3MZK B;  2XRY A;  4ZI7 E;  3JQ0 A;  2XAF B;  3V5S A;  3AU5 A;  2L0T B;  4X1Y E;  3LK2 B;  5JHA A;  3RYI E;  3PUR A;  4JVS A;  3PU3 A;  1E8Y A;  1JUQ A;  3HR0 A;  2X9H A;  1ELW A;  5CCL A;  2UXN B;  4L1B A;  2VSY A;  1WLX A;  3K3Q C;  3MK7 C;  2VGY A;  3CVN A;  4AIF A;  3HL6 A;  2HR2 A;  4RVB A;  4I43 B;  2DLR A;  3FEY A;  4DLQ A;  3PEU B;  4EAH A;  2KZ7 B;  3TKL B;  2R17 C;  2OA5 A;  5FWQ A;  4LEU A;  2EQX A;  3LS8 A;  5L3E B;  1E7V A;  1JWF A;  3CKB A;  1XNF A;  3ZHE B;  1HZ4 A;  4HFG A;  2FO7 A;  4FJY A;  3ZMS B;  4BJN A;  2AWI A;  4H9Q C;  2UY1 A;  2LE8 A;  1HCI A;  2WXG A;  2CCQ A;  3FUH A;  3BQL A;  3RYC E;  3E08 A;  5CCM A;  4IYP A;  2IW5 B;  4AKL A;  4YFS A;  2QGS A;  1H2U A;  3CEQ A;  3D9J A;  1NAF A;  4ASK A;  3E0Z A;  2XHE A;  4ANU A;  2VK9 A;  3I1A A;  2H7O A;  5LA6 E;  2L8K A;  5JDH A;  3WAJ A;  4KMO A;  3GZS A;  5LG4 A;  3R6N A;  2VJ8 A;  4JEU A;  4XKB A;  4GMJ A;  3ASG A;  2CXL A;  3FUL A;  2J09 A;  4ATG A;  3ML9 A;  3BG1 B;  3N2K E;  3W15 B;  2X6J A;  2XUE A;  1U5P A;  3GMI A;  2ES0 A;  3LDZ A;  4K0R A;  3CVQ A;  2K48 A;  5EX0 A;  3Q5M A;  3ZEF B;  2YK0 A;  2ZM2 A;  3FUN A;  4DPR A;  2XGS A;  3GZ2 A;  3LY9 A;  3RC3 A;  4B89 A;  5G55 A;  5A7D B;  3Q5X A;  5GON E;  1VRB A;  5KJL A;  4PW8 A;  1NWM X;  2RP4 A;  2WB2 A;  3ENE A;  2X0L B;  4XBF B;  3OAW A;  4DI4 A;  1KLX A;  5D0O D;  2PL2 A;  2ODV A;  4JXT A;  2C5I T;  1Y8M A;  3C4Z A;  5FXZ A;  4PUC A;  1UJK A;  4EOZ B;  1B89 A;  2BVM A;  3O1H A;  2J1D G;  5JDM A;  3OYZ A;  4FLB A;  4UQY A;  2HYZ A;  2LJL A;  2LM9 A;  3D9P A;  5JDL A;  1FVH A;  2CE7 A;  3CVR A;  2V7J A;  1D1C A;  2RA1 A;  2DNX A;  4GYS A;  1HTJ F;  4MHC A;  2FEZ A;  2C5K T;  4OVV A;  4V3I A;  3UUM A;  2C0S A;  1UW4 B;  3SGH A;  3I9Y A;  3UTK A;  3ZC1 A;  2KWH A;  3HKC E;  1HU3 A;  4QFV A;  4KUM B;  1Y64 B;  4AKH A;  3I0O A;  3C98 A;  1H2V C;  2UXX B;  3FBL A;  3ZMV B;  4HOR A;  3S7F A;  4JHR A;  1IAP A;  4F3V A;  3ZMZ B;  1OUV A;  2K9A A;  2IQC A;  4DMV A;  4HOS A;  5F8P A;  3B7R L;  2IAK A;  2WXI A;  3TXN A;  3N71 A;  2DWK A;  3UPV A;  4G63 A;  4DO0 A;  1D1A A;  2DWG A;  3ZN1 B;  3FUD A;  2I59 A;  1MMD A;  4YVQ C;  4TV9 E;  2PG8 A;  4BAY B;  2NWB A;  4TX5 A;  3RRN B;  4NQ0 A;  3D0T A;  3FU5 A;  3N9P A;  4AQG A;  5ADX L;  3PDN A;  4UWK A;  2XHE B;  1BPO A;  3RO3 A;  2DI4 A;  3CVL A;  4GML A;  2Q9Q A;  3RRU A;  2JMH A;  2LSU A;  2WXL A;  2VKJ A;  4AQF C;  1LVF A;  4I17 A;  4HFV A;  3SBT B;  2JPF A;  2XPI A;  3AS4 A;  2E9X C;  2Y8D A;  4U8H A;  2R5S A;  1ZU2 A;  2MHK A;  4UVB B;  4FJO A;  2NP9 A;  1HX8 A;  4KZ0 A;  3MX3 A;  3LK3 B;  2NC9 A;  2IC6 A;  1UX5 A;  2L0I A;  4KP3 C;  2X66 A;  3Q49 B;  1Z3Y A;  2X51 A;  4UWG A;  3MYV A;  3LK4 2;  1FIO A;  3SFZ A;  2VSO E;  5G05 C;  2XAG B;  3FUM A;  4B94 A;  2ZU6 B;  3APF A;  4HXI A;  3D9O A;  3KVB A;  2W00 A;  5DAB A;  3OTN A;  2KCL A;  4BA9 A;  2V5F A;  5HXR A;  4R7L A;  4OFZ A;  1MIW A;  2RD0 A;  4F53 A;  2KZT A;  4GU5 A;  3ESL A;  4F1S A;  3PTR B;  3RRW A;  3RKV A;  3L08 A;  3J9X 1;  2L9B A;  4O4L E;  2K5B B;  4ACK A;  5LCW C;  1KK7 A;  4FJZ A;  4B0Z A;  4C91 A;  4NRH B;  1UX4 A;  4I6E A;  3CVP A;  3ZFW A;  3WI3 A;  4HTE A;  3FFL A;  3DTO A;  4UVC B;  4B8C B;  2XEV A;  2NXP A;  3EHN A;  2YU1 A;  5C1D A;  3LJC A;  3P8C D;  4HVB A;  3NQP A;  2WXQ A;  3KVA A;  4F6R C;  2YU2 A;  2VYI A;  2XGM A;  2WXF A;  4QX7 B;  5BUZ A;  3VHL A;  4AV7 A;  3HVE B;  5M72 A;  3AA6 B;  5FZQ A;  1QNF A;  2EHO A;  4K0U A;  3HA4 A;  2LSY A;  3G2V A;  4BTA A;  2VTB A;  2KCK A;  4U63 A;  4L23 A;  5ETW A;  4XZC A;  3EIQ C;  2E9X A;  1SHZ C;  3ASF A;  2AVP A;  2YEV C;  2LAH A;  1EDU A;  2XCB A;  3UUN A;  3QAR A;  3CHM A;  3FUJ A;  4ZHQ E;  4U07 A;  3ZN3 A;  3UX4 A;  3KD7 A;  5FP3 A;  1HO8 A;  2WM9 A;  3R7Q A;  3RC8 A;  4BY6 A;  3OKQ A;  2J49 A;  4QHO A;  2YIN A;  1BR2 A;  5IYZ E;  4I50 E;  4ZS2 A;  3ML8 A;  5JRE A;  3PUQ A;  5J2T E;  4GYY A;  4F7A A;  1HF8 A;  2P9B A;  3L6A A;  3QDN A;  1PC2 A;  2X9W A;  2I1K A;  4L5G A;  4L2L A;  3FH7 A;  3GYZ A;  3APD A;  3UT7 A;  1FVF A;  4MLK A;  2FI7 A;  1AJ3 A;  4XI0 A;  1UCU A;  3HYM B;  5LGN B;  3CR3 A;  2ZM0 A;  5FQ7 A;  1OWL A;  3U3W A;  3CQG B;  4UI9 K;  5DQW A;  4KT6 B;  3NZS A;  5EX3 A;  1MMN A;  4ILG A;  4CDN A;  1Z6T A;  4G2A A;  5G2N A;  4D10 C;  2WQH A;  3Q47 B;  1V9D A;  5HQ8 A;  4U74 A;  3N9Q A;  2QY7 A;  3LJ3 A;  3AS5 A;  4A1S A;  1MMG A;  2QA7 A;  2P58 C;  3UQ3 A;  2UWJ G;  3EUH A;  5JDG A;  3QC1 A;  2VGX A;  5LX8 A;  5C2Y A;  4FHJ A;  3TAX A;  3PUS A;  5T4Y A;  5H6R B;  4ILU A;  2NW9 A;  3TXM A;  3AAA B;  3ZYK A;  2J4B A;  4UI9 C;  3S4U A;  5E75 A;  1Z3X A;  5BV0 A;  4GK5 E;  5KMG P;  2WXN A;  4WW0 A;  4IE6 A;  4HOQ A;  2I6H A;  3QAQ A;  3NZQ A;  4JW1 A;  3AAE B;  3SRZ A;  4GZ3 A;  2VKH A;  2Y6X A;  3KV9 A;  3FH5 A;  4QX8 B;  3DBS A;  3K3O A;  4JPS A;  5HXH A;  2LOP A;  5E0O A;  3EDU A;  3CHO A;  1GW6 A;  4E7Z A;  3P2B A;  4ZI3 D;  4O4H E;  4AJW A;  3UUL A;  4CZZ B;  2MOW A;  1LKX A;  1MHQ A;  2PQN A;  3MKQ A;  5FZR A;  3G2U A;  3ZMU B;  3CPZ A;  4DK5 A;  2VAS A;  3LPZ A;  3PVL A;  4K03 A;  3SWH A;  4LCT A;  4C9B B;  3WXX A;  4NUU A;  4PFP A;  4ZOL E;  2GW1 A;  2WXR A;  3VLD A;  3ZJ2 A;  2HPL A;  3RH3 A;  2C0M A;  4MS6 A;  4GA1 A;  2Q9Q D;  5FNV E;  3IEE A;  2IOS A;  3AB3 B;  4HS2 A;  4UF0 A;  3FY4 A;  2LSV A;  4P29 A;  3CX8 B;  3I3N A;  1UN9 A;  4IUL A;  5DJQ C;  4UQZ A;  4AEZ C;  5KCM A;  2VWA A;  5CB4 E;  2W62 A;  3URZ A;  4JUY A;  2H7V C;  4ERR A;  4H7X A;  4IIJ E;  1ZBP A;  4DBR A;  5JDF A;  4U0S A;  4PJL A;  5L3D B;  3JC6 C;  4E85 A;  3FXD B;  4CGW A;  4N39 A;  2V7I A;  2XAJ B;  1MIY A;  3KV4 A;  3L17 A;  2X68 A;  4AXH A;  4KMC A;  3FEX A;  5CMW A;  3TG5 A;  3N2O A;  3CVW A;  2WXH A;  4L0R A;  4IE4 A;  4CI2 B;  2CFZ A;  3ESK A;  5CA0 E;  1E7U A;  3QWW A;  1L5J A;  2X6F A;  4X1I E;  3EIJ A;  3V5U A;  4WNK A;  2D0T A;  4WAF A;  5JH7 E;  3MKR A;  3P1U A;  4N2Q A;  3DJB A;  5FMN A;  1H7C A;  3LG7 A;  3B7U X;  1X5B A;  5ARG A;  2BTD A;  3ETV A;  2L3L A;  4FLH A;  4H9S E;  4H7Y A;  5C8Y E;  1ELR A;  4UXN B;  4IDZ A;  4EZH A;  4DMW A;  3CQX C;  4XIF A;  5FY0 A;  5HXC A;  1IQU A;  2WPV A;  3ZYL A;  4KXK B;  3LY7 A;  2YHC A;  4G25 A;  4W9R A;  3KEZ A;  2VL8 A;  4APO A;  4H9R C;  3QOU A;  4HKA A;  4PJN A;  5BW8 C;  4EZL A;  1MQS A;  4WND A;  2WWU A;  4MBQ A;  4XZ4 A;  4ACL A;  3IBE A;  4J2C A;  4GIW A;  3QK0 A;  4FC8 A;  4LUN U;  4X20 E;  4CI1 B;  3QB2 A;  4ME2 A;  3RKO A;  4ANW A;  3IBP A;  3NRY A;  5L3B B;  5J90 A;  5G04 J;  4TRQ A;  5LP0 A;  2V8S E;  2E2E A;  2NSZ A;  3MKQ B;  1TJC A;  3VLE A;  5LBQ B;  4N2S A;  3CX7 B;  1EPU A;  3Q2M A;  4NUR A;  2XAH B;  1EF1 C;  5D0Q D;  3HKE E;  3ZGQ A;  2HM8 A;  2X6I A;  1MMA A;  3PH0 C;  4EZJ A;  4MFR A;  1U3C A;  2Y4U A;  2XQY A;  5AEN A;  2PJQ A;  4EYY R;  4I2Z A;  2IOL A;  3PDY A;  4CEM A;  2A72 A;  5JRC A;  2C2L A;  4DLO A;  5AFU L;  3G2T A;  5HAX A;  4G23 A;  4XI9 A;  2FF4 A;  1HS6 A;  5EK4 A;  4GYO A;  3HKD E;  3UUX A;  3NZU A;  4WNE A;  3L09 A;  4UF0 B;  4UWH A;  5HI7 A;  5LP6 E;  5LJM A;  3CK9 A;  1YKE B;  3D9M A;  4HE8 A;  3TGO A;  4EPZ A;  1HFA A;  4O8S A;  1ZKE A;  3EVY A;  4J8S A;  3CHR A;  5KX5 E;  3SZ7 A;  4JEH B;  4TV8 E;  1ZV4 X;  4JEU B;  3MJW A;  4JEH A;  4KBM B;  5HYA A;  1EYH A;  3M65 A;  3QWP A;  5LCY A;  3LEW A;  1S94 A;  2C0L A;  2WQ6 A;  3RIB A;  5BV1 A;  3CQC B;  1SA0 E;  3FU3 A;  2V0P A;  3GW4 A;  4CCA A;  4KZC A;  2ACX A;  4EZ4 A;  3CLJ A;  3SNX A;  1WYC A;  4U72 A;  5HWX A;  3I4R B;  1D0X A;  2A5U A;  3FTY A;  4ZI2 C;  3T8M A;  1QQE A;  3RYF E;  4RG9 A;  1BR4 A;  3CHP A;  4WNG A;  3VKH A;  3PUK A;  3S7D A;  4J8D A;  3HIZ A;  4GZC A;  3VU7 H;  5HXS A;  3AVS A;  3FTW A;  3F57 A;  3EJN A;  2I9C A;  3AAI A;  2AXU A;  2PQR A;  3PRE A;  5FYM A;  2HPJ A;  3C4W A;  3S2A A;  5JJT A;  4EQF A;  2HO1 A;  4GK0 E;  1TEZ A;  3P7I A;  3T5V A;  5LCW J;  2ZLY A;  3APC A;  3FH8 A;  1KNZ A;  3PE4 A;  1S35 A;  3ANW B;  1WRD A;  3Q5W A;  2GRL A;  3CGH A;  2PM6 A;  5T8I A;  3ANW A;  3LBX B;  1H2T C;  3JYS A;  2EHO B;  4IST A;  2YHE A;  3ONX A;  3IHY A;  4I55 E;  3IHR A;  2VQ2 A;  2JQQ A;  3LKU A;  4N3A A;  3MZL B;  4EIW A;  4UIG A;  4YND A;  4J0U A;  4I4T E;  4KBQ A;  2VKO A;  2WSS V;  1W3B A;  2KT9 A;  3RPU A;  4MAL A;  2XCC A;  2D5U A;  2X67 A;  3NBX X;  2KM4 A;  4Y6W A;  4LER A;  4BT8 A;  2IJG X;  5JRC B;  1KT1 A;  4EXT A;  5BMV E;  3ZYM A;  1PAQ A;  3CST A;  3FUF A;  4Y6C A;  1OWO A;  3ONK A;  5FXV A;  2NW8 A;  1IHG A;  5J1G A;  5IHY A;  2AW6 A;  4MKT A;  3LVQ E;  1S0P A;  4E6H A;  3ZPJ A;  2OV8 A;  4EZK A;  3KS2 A;  4EBA A;  3CV0 A;  1HXI A;  4JA7 A;  3CSF A;  1E8W A;  5FQ4 A;  3OXF A;  4JC8 A;  3AVR A;  3D9N A;  5LNK A;  4WNF A;  4N3B A;  1JPL A;  2L9Q A;  1YA0 A;  5JJ7 A;  5L3G B;  3MXZ A;  4H9O C;  4UWF A;  2J9Q A;  4PS7 A;  5AYW D;  3OYX A;  1UN8 A;  3BG0 B;  3N9O A;  3SD5 A;  3KAE A;  5EK2 A;  3FXE B;  2Z6E A;  3CVY A;  2XGO A;  2KC7 A;  3FDH A;  4GZ5 A;  1CUN A;  4JHK A;  2GGF A;  3L16 A;  4JA9 A;  4JLE A;  3I0Q A;  1H6K A;  1BR0 A;  5DIZ A;  2Y48 B;  4PS3 A;  2PBI A;  3KIN B;  4TV3 A;  3PE3 A;  4YHJ A;  2XPZ A;  2LSJ A;  3K9I A;  1E8Z A;  4EB6 E;  3N2G E;  4HN9 A;  4M3O A;  4PK6 A;  4CT0 A;  4M1P A;  4DI3 A;  2BDE A;  3Q9D A;  2J08 A;  4I1O B;  2LSK A;  3MKD A;  3EHM A;  5JHB A;  4J8E A;  3FP3 A;  3IKO B;  4ISS A;  3ZPO A;  2ILR A;  4TN7 B;  4UV8 B;  3SI5 A;  2BZB A;  2WXO A;  4LRZ A;  2LHN A;  4JZY A;  3MEK A;  2CFU A;  2LSI A;  4UQX A;  1G8X A;  1WAO 1;  1IJ6 A;  3VTY A;  1LRZ A;  2LHR A;  4QXB B;  5FTP A;  4H9N C;  4I9E A;  1NA3 A;  5KJK A;  4RG6 A;  2FBN A;  2AXV A;  5ENN A;  5LHI B;  5JQG E;  3R84 B;  2DBA A;  3RK6 A;  4U0U A;  3KDS E;  4G1T A;  4A3V A;  3AA7 B;  4AQF A;  3GA8 A;  3NZP A;  3CKC A;  3GZ1 A;  4O2B E;  4IRU A;  1IJ5 A;  4WBN E;  3A5X A;  3K3N A;  5ANR A;  1DNP A;  2OVB A;  5T3R A;  5FQ8 A;  2BVL A;  2M67 A;  4WBO A;  4GZD A;  3FTZ A;  4CDR A;  3MAC A;  4N3C A;  2VSN A;  4I1A A;  4UWL A;  4ANX A;  3FU0 A;  3PUG A;  4GCN A;  1IZN B;  4I6G A;  1U4Q A;  5A23 A;  1IQR A;  2XAQ B;  2N1G A;  4OYK A;  1IYG A;  2B1E A;  2E8I A;  3Q15 A;  3ZXS A;  3MJX A;  1HS7 A;  3U64 A;  4DJA A;  2PM7 A;  3PU8 A;  5JR9 C;  3N9N A;  1YKH B;  3DPD A;  5HWY A;  4ILH B;  5ANL A;  4PJJ A;  2CM0 A;  2E9X D;  1MNE A;  2Q7F A;  3PZD A;  3F2E A;  3CHS A;  4O4I E;  2CG3 A;  3FTU A;  2N2N A;  2KND A;  2V7L A;  1OWM A;  3S7B A;  2JLB A;  4EEC A;  1QSD A;  1FMW A;  4ZS3 A;  2DCP A;  4BWR A;  2WMN A;  2QFC A;  1KT0 A;  3O4Z A;  1OWA A;  3UT5 E;  2KAT A;  4MLP A;  5BPP A;  4FU3 A;  3CIA A;  4J6I A;  4QWN B;  2DCF A;  3B7S A;  1WY6 A;  2AXZ A;  2IF4 A;  3PRZ A;  4GYR A;  3KFW X;  5FQ6 A;  3C51 A;  2L6J A;  4IE7 A;  3NRX A;  2LAI A;  1MND A;  2D0U A;  4Q94 A;  4CI3 B;  2Q9Q B;  2WAU A;  5J2U E;  2VGX B;  4A56 A;  1US7 B;  3MA5 A;  3UMV A;  4RSY A;  5HXE A;  1WYB A;  3ZLI A;  2KWI B;  1H19 A;  3U9W A;  4BJM A;  4BX9 A;  4AKR B;  3QC9 A;  3FUE A;  4A55 A;  3CVX A;  1G73 A;  3C50 A;  4L2Y A;  3H3A A;  2MBG A;  2CWO A;  3RX6 A;  3ZEF A;  3JCK C;  1INZ A;  2YQ8 A;  5KJN A;  3O1J A;  3CK8 A;  2JJ9 A;  3NF1 A;  3FHN A;  5L3C B;  4YJ3 E;  2W63 A;  3ZCI A;  5H6Q B;  3ZYQ A;  4ANV A;  2W61 A;  2J4D A;  3QJZ A;  3LVR E;  3KBU A;  3HVE A;  2ION A;  4KYO B;  1E8X A;  4TZ4 C;  2KCV A;  2MRI A;  5KDM C;  5M4Y A;  3UT4 A;  2CMR A;  4MRU A;  4AY6 A;  1NP7 A;  5G04 C;  3IV0 A;  2GK9 A;  2OOE A;  3BQK A;  3EDV A;  4CDM A;  2LEH A;  2JEK A;  4I6J A;  3QKY A;  4UVA B;  4KVO A;  3WAK A;  3Q4A B;  2MTQ A;  3SF4 A;  3OXG A;  3U78 A;  4H9P C;  1HH8 A;  3PS6 A;  3AS8 A;  4G24 A;  4AKI A;  2LO6 A;  1ZHC A;  3AA0 B;  2X6K A;  2CLY C;  3C4X A;  4O4J E;  4ADZ A;  3T8O A;  3ZIM A;  5LXT E;  2WXK A;  1SZA A;  3PNT B;  4EBA G;  4E7S A;  4BX8 A;  4GA0 A;  4JL0 A;  3QNK A;  5J08 A;  1X79 A;  2IFU A;  5LFA A;  2PFV A;  2CHX A;  2NTX A;  1PY1 A;  1Z0P A;  5JJ6 A;  2WQ7 A;  3I5P A;  1SQM A;  3RRC A;  3PUJ A;  5TAO A;  4J8F A;  5LYJ E;  4XE0 A;  4NAC A;  3LFM A;  5EDS A;  2LOS A;  4WUY A;  4U0Z A;  2EHO C;  4N5C A;  5EK3 A;  3C64 A;  2LSG A;  5JDN A;  2WXP A;  4GOU A;  5DBK A;  3R7R A;  4ANJ A;  4DND A;  4NUV A;  4Q96 A;  3ONL A;  3RO2 A;  1D0Y A;  4L7T A;  3PE0 A;  5ARF A;  4AXP A;  5L3F B;  2IC9 A;  4FHK A;  4CRW A;  3D9I A;  5AJD A;  5FZS A;  3H37 A;  3TG4 A;  3MCX A;  4CT4 A;  3CML A;  3T5X A;  4AM9 A;  4IHJ E;  2MOZ A;  3U3I A;  2LT3 A;  4CXY A;  3ULQ A;  2X3M A;  3O9X A;  1H0A A;  4P09 A;  4IE5 A;  3RU0 A;  3VLF A;  5CHE E;  3G2S A;  4GB9 A;  2D2S A;  4IE0 A;  2ZMA A;  1FCH A;  2LNI A;  4XX5 A;  4I43 A;  3I9W A;  4PH4 B;  3B7T A;  2C5J A;  1FEW A;  2I1J A;  5LOV E;  1WM5 A;  3R9A B;  2WBL A;  4X1K E;  4KVM A;  4PDX A;  1XGW A;  4PS8 A;  5FXW A;  4DBQ A;  3FUI A;  4AI6 A;  3O48 A;  3N9L A;  3SS1 A;  3OJA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...