2WMNA

Structure of the complex between dock9 and cdc42-gdp.
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
423
structure length
403
Chain Sequence
b'STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEAHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 152
structure length 403
sequence length 423
ec nomenclature
pdb deposition date 2009-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wmnA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wmnA01
2WMOA 2WM9A 2WMNA 3VHLA 3B13A 2YINA
chains in the Genus database with same CATH superfamily
4A5XA 3EVYA 2K5BB 4A3VA 4CT4A 4J8EA 3UUXA 5BXUA 2ZM6T 1KNPA 4F7AA 5ENOD 3LBXA 4AQFA 3AE3A 1N94A 2IC9A 3FTXA 5F5WA 2OEWA 4BFRA 2N2NA 4DPRA 3UUNA 2LEHA 3CVPA 3EABA 3ZEFA 3R6NA 3PUWF 5HXHA 4I6GA 2FJBA 1XNQT 3SFEA 4Z91A 3E33A 2LSIA 3UU6A 2WXGA 4KVOA 4P29A 5EIDA 2XAHB 4YSXA 4URKA 1D8DA 4HLLA 2XGMA 3FUIA 5FVKA 5D0QD 3ONXA 2CLYC 3ZXSA 3L22A 4I6JA 5BMVE 3AE7A 2D5UA 5FL1A 3RLFF 4RQIA 3DP7A 4GTOA 3L3PA 4AQFC 3FUDA 2VSNA 4HN9A 2FO7A 4UEMA 3DTOA 4HFGA 4CGVA 3V2OA 5FT9A 4WNEA 1ZKEA 1SQMA 3EHQA 3EU5A 4HOQA 2W2UA 4CXYA 1IQUA 2W67A 2OEVA 2J9QA 3SBSA 4KP3C 4HLEA 2B76A 2KWHA 3T9KA 3D9MA 4UF0A 2V5FA 1U3DA 5FZQA 3WG7E 4ISSA 3PUSA 2ZISA 1YW0A 3D9JA 2BG9B 3LK2B 4CI1B 4DR1T 4KT6B 3QUJA 2VKDA 4LF4T 1W09A 3T5XA 2V7LA 3C4WA 3RYCE 3P1UA 3RO2A 1LD8A 2ODVA 1OWAA 3JQ0A 3UM3A 2NR4A 2CBIA 3D9KA 4Y6WA 2XHEA 3IKOB 2R59A 2XGSA 5KJNA 5AARA 4CDMA 4M3OA 3RRCA 3AAEB 3ZN1B 3MV3B 5ARFA 3P8CD 2WWVA 3NZSA 1IHBA 1J1JA 3C5RA 5FWQA 4IIJE 4ATGA 1R8IA 5IY5E 2Y1LE 2HR2A 2EIKE 2WZIA 2VVSA 2ZLYA 1QLBA 3F2EA 3TL5A 5EDSA 3P4RA 4B8CB 3FUFA 4LNBA 2XAJB 4L0RA 4O2AE 4UELA 2J4DA 4CI2B 1WCRA 2PG8A 3NRYA 3ABKE 4H9PC 1UUSA 3IHYA 3Q5DA 2WS3A 3F57A 1DVPA 4PK5A 2WXOA 1LVFA 2RPAA 3NWIA 5ABEA 3ONJA 5AQIB 4M1PA 3HI2A 3JC6D 3RQWA 2A72A 2DYRE 3PUXF 1PC2A 2BUGA 4DR4T 3KBUA 2XS8A 5FIOA 2Q9QB 2XSAA 4L5GA 3CK9A 1YCSB 2BDEA 2KM4A 3RIFA 4IULA 1CUNA 2L8KA 4MLKA 2A5EA 4DV7T 4JVSA 5EYLA 4CQIA 2H6FA 3AXJA 4IYPA 5LFAA 1HCIA 2PNNA 4GA0A 4I1OB 3JC6C 1HNWT 1FVHA 4J8YA 2HE0A 2VSXE 2HH7A 3S7FA 4EZJA 1UG3A 4BEPA 2I6HA 4BY6A 3ANWA 5M4YA 3ASFA 4AI6A 2XQ5A 2E2AA 3RYHE 4WNFA 1LRZA 4YFSA 5DABA 3D9PA 4LEUA 3V5SA 2WXLA 5KJKA 4HB5A 4TV8E 3RU0A 2KC7A 1TNYA 3CK8A 4B3ST 1KK7A 2VL8A 2ZM0A 5B1AE 3CHSA 3O1JA 3AAAB 4NIQA 1EDUA 1N9AA 2RKKA 5LJMA 2WQHA 1H19A 3B7UX 2CEAA 3HHMA 5G55A 2R03A 2B0OE 3I4RB 5ETWA 3N9LA 3UIOC 3I9WA 5FVLA 1HS7A 3OKQA 4YSYA 2V4LA 4I50E 5FP3A 1NFIE 3KD7A 3CHOA 3CLJA 5KJLA 3PVLA 3EIJA 2MBGA 3MACA 5FQ7A 4GZDA 5LCWC 4H9QC 2V6XA 2IW5B 3OXLA 3UMVA 4HWDA 3ZMSB 3LK3B 1V9DA 2ZMAA 4HFEA 4DUIA 3TXNA 3MKDA 1U3CA 4UQYA 1XMOT 3FUHA 5AQNB 3N9QA 1W0BA 3PZ3A 3CK7A 2X6FA 4BJMA 4UWFA 3SFYA 3U3IA 5FY7A 2J4GA 1N0QA 3CHPA 1GW6A 3AS4A 2XQ7A 1JNZA 1H0AA 2CWOA 3NZQA 2OLTA 4U0SA 1MNEA 3TLSA 5LCWJ 3ZSTA 2Y69E 1UGOA 2OCCE 5HXEA 3ZYQA 2W66A 2PM6A 2KZTB 3SQVA 4HRNA 2XZEA 3PURA 2LJLA 1YKHB 4PJMA 4IGUA 5ADXL 5JR9B 5EK4A 2HO1A 2UXCT 5HEGA 3GZSA 3JAEA 4IE4A 1ELKA 4DBRA 1WG0A 3RGLA 2J1DG 4E7ZA 3KVBA 5AQTB 2QYJA 2X9YA 2XPIA 3LVRE 4GTPA 1TYQG 2WQ6A 1FEWA 3JAFA 3DSXA 5ABFA 2X6KA 4RG9A 1NA0A 3RYIE 3F31A 1QNFA 4UV9B 3FZFB 3CQXC 1W0AA 2GRRB 4QXCB 5KX5E 3J7Yq 1TNZA 4ISTA 3JUIA 4TNVA 1XNRT 3PZDA 2Y8DA 3EUHA 4JA7A 2UY1B 2C0LA 4TXPA 4PNIA 3BUAA 3FZHB 5AQ9A 5L3CB 2CWYA 3GMIA 2DCPA 3RRNB 1HG2A 4AXPA 3QK0A 3IHRA 4LFBT 5A7DB 3UT8A 3CGHA 2DI4A 2EHOA 4Q94A 4A56A 2FI7A 2CHZA 3ZXPA 5AQQB 4JI4T 2H88A 2MRIA 3TLTA 4YDOA 1IJ5A 3HXEA 3V30A 5AQSB 4ATZD 4AOFA 4G8KA 2IU1A 1BI7B 2CHOA 2I1KA 1KZPA 2EHOD 3FTYA 4RG6A 2X9HA 2DCFA 2XQYA 5BNWA 3PH0C 4KVMA 2BBHA 2HPLA 3FUEA 4JLEA 2VGXB 4JA9A 4DX6D 5LHHB 3K3QC 2UU9T 2E9XA 2ES0A 2WQYA 1GQEA 3OBVE 1I94T 4E6HA 1A17A 4EBAG 3FULA 2LLYA 2PQNA 4AV7A 2E9XD 2YU2A 4OAUC 2EHOC 3APFA 4Q69A 4QX7B 3DBSA 3C4XA 3PDNA 5KNGA 2WVIA 4HEAA 2LOSA 4X1YE 1XWMA 4DRXE 4C9BB 3ZHEA 1E7UA 3QWWA 4BWRA 5CERB 3UT4A 3VLFA 4JEUA 2WY2A 4IDQA 5DQWA 1MJ0A 3FBZA 3CVNA 4U8YD 4YDEA 4DMVA 2GK9A 4H9OC 5T3RA 3IA3A 3FEXA 2WXNA 3NF1A 4MRUA 1S64A 5H6QB 2JQQA 2L0IA 2J49A 2VGYA 4FA6A 4YT0A 1YKEB 4TRQA 5FL0A 2G0UA 3QB5A 4UVBB 1HO8A 1BR1A 3MV2B 1S70B 4N2SA 5ITZF 4Z90A 1S35A 3SY2A 4ZI2C 2WM9A 1H6PA 4IE6A 3RH3A 4AEZC 4PAGA 4V3IA 2X0YA 3UPVA 2D0UA 4UWGA 4TUYE 1JCQA 4IE0A 2NW9A 4ACKA 5J90A 3K1SA 3M3ZB 4TWHA 4K5CA 3SBTB 3FB2A 5LX8A 3LJ3A 2XPYA 2P9SG 3QNKA 4H7YA 2OV8A 2K9AA 5JJ7A 2VK9A 3QC9A 4K5AB 3AECA 4EYUA 5FQ4A 4NIKA 1D0YA 3MKQB 1W3BA 3PUYF 2V8SV 4MBQA 3PE3A 4JBWF 4YVQC 5EIBE 5J08A 2LO6A 4CRWA 1AWCB 4DJAA 3ZVVA 3ZMVB 4MHCA 2R5SA 3N5LA 4H9SE 4HWIB 4IL9A 2XPKA 3RPUA 1E96B 5KCMA 1US7B 3V31A 4BTAA 4ZOLE 5AYWD 1IXVA 2ILRA 3CMLA 3AE8A 4TUMA 1H7CA 4I43A 3CKDA 1JCSA 3TG5A 4AXHA 3NRXA 3FH5A 3CX6B 4GPMA 3NZUA 1N0RA 2NTXA 5HWYA 2OA5A 2B1EA 4QX8B 4JEHA 4ANWA 4HE8A 4K0UA 5B1BE 3QB5K 2CM0A 4MLPA 1RZ4A 3T8OA 1OCOE 2DYSE 2OV9A 2I1JA 1SA0E 3R9AB 3TLUA 4OYKA 3ZMZB 3QKYA 2BZBA 3ASNE 3ZC0A 3PNLB 5T8IA 4DV4T 4PW8A 4JI8T 3DSWA 4OYJA 4FJOA 4WNDA 3J5PA 4ACLA 2CLYB 5J2UE 2C5JA 2V0PA 4N39A 2P9NG 4HKAA 4I1AA 5J1GA 4B0ZA 1LKXA 4ABNA 3EJNA 1D1AA 3UUBA 2L6JA 4O4IE 4KHZF 3L82A 2WSSV 3ZT5A 4E85A 2FBNA 1JPLA 3AE9A 4UWHA 3HKDE 3OTOT 4A1GA 3ZKJA 3C3QA 5HEHA 2CHNA 4I17A 3ULYA 3FTWA 3B13A 4AJWA 4CDRA 1Z0PA 3AE1A 2AJAA 4B3TT 1XMQT 4J7WA 4EXTA 4C0MA 4HVBA 4UI9C 1BR0A 4XE0A 3L08A 2XQ8A 1XDPA 2VASA 3UULA 5ARGA 3DEPA 1HF8A 5HYAA 1HS6A 2YDRA 1D0ZA 4TZ4C 4LRZA 3OTNA 5EYPF 2F4VT 2YU1A 2YDSA 1OY3D 4G11A 4WWNA 1LF8A 5LB7B 1S63A 2YEVC 2CHWA 1BI8B 4GU5A 1EF1C 2P9KG 1OCZE 2FBWA 4XI0A 4UI9K 4OVVA 3O1HA 1V54E 2VL0A 4DUYT 4X62T 3Q2MA 3Q4AB 2CXLA 2X9XA 4UI9J 4DV3T 1DNPA 2WXRA 2KBXA 2LKHA 3DXMG 3I9YA 5LXTE 2WAUA 3ZPOA 4B3MT 3ENEA 3QJZA 1AP7A 5CHEE 2NWBA 3E32A 2WXJA 4FADA 1K8KG 5FMNA 1IHGA 3VKGA 1U2VG 5JJ6A 1NENA 5CA0E 4LCTA 4AVXA 2NXPA 3HKCE 3P4QA 2XHEB 4DI4A 5JTGA 2VTBA 3P50A 1YMPA 3QAQA 2OVBA 4PS7A 3IBEA 2ZU6B 3CHRA 4BA9A 4LG6A 2GRQB 1JUQA 1TR4A 2ZGDA 3MA5A 3PEVB 1Y6IA 2CXDA 3KBTA 3HRAA 5M72A 1SE7A 5BR8T 3HKBE 5JDNA 3I5PA 4HQDA 4U96D 3LY7A 3UM1A 5JJTA 2RA1A 4J8SA 3IBPA 4A55A 3ONLA 2WDVA 3FU0A 3TLVA 2FJAA 3E37A 5ANRA 4HXIA 1UOHA 3U4TA 1OXJA 3CVLA 1D8EA 4KZCA 3ESLA 5T4YA 2X6JA 5HCJA 3NOGD 5CBOA 2MOZA 2BTDA 2BF0X 5ENPD 1WY6A 4ZEYA 4O4JE 2XEVA 4DV2T 4IE7A 1CHUA 3SRZA 2CCQA 3HG0D 3HA4A 2IJGX 2BS2A 4UQXA 2JMHA 1OUVA 2A9UA 4WYVA 3UKRG 3MA9A 3ONLC 3JXJA 3LKUA 3AAIA 3O9XA 4IDNA 2LSGA 1Y64B 4YHHT 1FVFA 3FDHA 3MZLB 4EZKA 1OT8A 2RD0A 3ONKA 4O8SA 4GMJA 3G06A 1O1SA 2WDRA 2MOWA 4ZI3D 4ME2A 2UXBT 3K3OA 1O5MA 1QQEA 4DV6T 1QYMA 2KCLA 3OJAA 3UQ4A 5G04C 3JQ1A 1WRDA 1N95A 4QHOA 3VHLA 5AQFB 4GKKT 2BS3A 1TJFA 4U0UA 1OEDA 4N78D 3K9IA 4Z8XA 1X5BA 3NQPA 3ZW3A 2W4XA 3CX8B 2F37A 2H6GA 4J0UA 1N11A 4NXNT 4EBAA 3O4ZA 4UUCA 1Z6TA 2H89A 1N4SA 3ZT7A 3MJWA 4X1KE 4N3BA 5AQBA 2WXFA 5EK3A 2IO3C 4YJ2E 3SFDA 4GA1A 4XKBA 4WAFA 4XX5A 5G2NA 3RRUA 1S94A 4XZCA 2GRLA 3SWHA 1FT2A 3I0OA 1SHZC 3QWPA 5KBAA 3QARA 5G04J 2YNQA 2LSKA 3KV9A 3Q7FA 3PNTB 2X9WA 4U72A 2NYJA 2LRLA 3B7RL 4ZZBA 1OEDC 2PTFA 3PUVF 3FHEA 1YA0A 2X3MA 2XGOA 3GWHA 4EECA 3UI2A 3UUMA 1IZNB 3RQUA 2V6YB 2EQXA 4U95D 1RW2A 2NSZA 2GRPB 5EZYE 3PS6A 5AQUB 3TWUA 2V8SE 3FTVA 4O2BE 3NVOA 1OWLA 3X1DA 3DPDA 4AM9A 4JI3T 3C98A 1Z8UA 3ZYLA 3UT7A 3QB2A 4IDZA 2XAQB 4HORA 3S4UA 2D0TA 4IRUA 3BK9A 4HFIA 2FULA 4U04A 4DUZT 2WXHA 2XQ6A 2XQAA 4HFCA 3ETUA 3MCXA 3U78A 2H7OA 2BKKB 1E8ZA 1MQSA 2KLQA 5JVDE 3U66A 4QH5A 5JMND 3R7QA 3G2SA 3B7TA 3E4BA 2J07A 2E0IA 3AE4A 3HXFA 3L13A 2A5UA 3N2KE 3IEEA 5TAOA 4U7IA 4G63A 2FO1E 5L2LA 4ILIA 5KWDA 3H37A 3WAKA 2WMOA 2J8SD 5JRCB 3DWLG 3L16A 1EPUA 4OFZA 1NI1A 2W61A 3KS2A 3Q5WA 1HG5A 4HTEA 3KFWX 4WWPA 2KSRA 4G1TA 4QFVA 3CHQA 4Y6CA 4EZ4A 4HRLA 5J2TE 4AP2A 2YK0A 1JCRA 3EHNA 3PRZA 2E2EA 1ZB1A 4AQGA 4WW0A 2E5VA 4QWNB 3AEDA 3RC3A 2AW6A 3CHMA 4XZ4A 5CCMA 2WXKA 4C48B 3PU8A 3FTSA 3GZ1A 4H9NC 1IBLT 2BG9A 1H2VC 4O60A 2LSVA 5D66A 4L23A 2ETBA 2Y0BG 5FQ8A 2KXPB 3NKZA 3P2BA 1TNUA 4B94A 4QKNA 4YVOA 2QA7A 4ILGA 3ZN0B 5CJ5A 3NBNB 2M6BA 4G2AA 2HM8A 3ASHA 2IHR1 2BBJA 2QRXA 4JI7T 1HX8A 2L0TB 3CVVA 2V7JA 1LVKA 3L39A 4J2CA 4ZS3A 3EUVA 3HXDA 5IUXA 3QOUA 4GTTA 2L6BA 1UN8A 5G05C 1PAQA 3DSTA 5AQGB 1T7SA 4B8AA 5LYJE 1Z3YA 3W9FA 3PJAA 1OWMA 3LDQB 2GRMA 4GYRA 4L7TA 3VTXA 2BG9C 3HKEE 4FLBA 2RP4A 3RK6A 3R84B 5AFUL 2JEKA 2UWJG 5KDMC 2ZGGA 4EQFA 3V2XA 2XPZA 3BEEA 4HWCA 4ILAA 4BESA 1IJ6A 5HEOA 1Q2ZA 3HVEB 5HCMA 1N33T 4GZCA 4KI0F 4PK4A 4N5CA 1D0XA 3RAUA 5FQ6A 2W63A 4DK5A 3KEZA 4B89A 2NP9A 1TNBA 3TWWA 3SOLA 5HXCA 2PBIA 2DHRA 3ZHEB 3ZCIA 2L9BA 5HEJA 3J5QB 4QQIA 5G05J 2BVMA 2R6GF 4P0BA 3QK6A 2WXPA 4PDXA 3G2WA 1KFYA 2X68A 4BX9A 1H6OA 5EK2A 3G2VA 4X5TA 5LGUB 1MX2A 5ENTD 3OXFA 5HEUA 3OXGA 3DSSA 1XZYA 2Q9QA 5CEDB 1TEZA 3R9MA 3TKLB 2W62A 1N32T 4NUVA 4GA2A 3UM2A 4GTRA 5HI7A 2LNIA 1NP7A 4I0UA 5HRYA 4ILBA 1Y8MA 4ADZA 2Q9QD 5LCYA 1KF6A 4RLYA 5JHAA 2A3DA 1KZOA 4GTMA 3B7BA 4ANUA 3ULQA 5AQOB 3CVQA 3UIPC 3KV6A 3EHRA 5BPPA 1MZCA 3TWRA 4Q96A 2VKHA 3P4SA 2ETCA 3ZYMA 3ISMC 1DC2A 4GZ6A 4DR5T 4G26A 4QH1A 3E34A 3PJAJ 3CVUA 2X38A 3LY8A 4ANXA 4I6EA 3AB3B 4UQZA 4APFA 5CA1E 2MYOA 3O4XE 2Q9QC 1X9BA 4BJNA 2IF4A 3CIRA 3MK7C 4GTSA 4CN4A 3NAWA 4ZZCA 2LSYA 2VVNA 4OVUA 5A6CA 3IHVA 5LJNA 3EU9A 3CK6A 3UFGA 1T98A 4G8LA 2QYWA 3KV5A 3N9MA 5L3DB 4HRMB 1HNZT 1BR2A 5JDMA 3CVRA 3SS1A 1SUMB 3RYFE 4HI8A 3PTRB 1MIVA 2CXFA 4OAVB 2CBJA 4DX2A 3UFEA 1E90A 3U3WA 3WI3A 3JYSA 1WR6A 1H6KA 3ETVA 4LERA 3TXMA 4EB6E 3BQOA 2WZHA 3E30A 3ZT6A 3MX3A 4EGWA 1G3NB 2Y6XA 2BEDA 5HXRA 5LGNB 5LP6E 1OCRE 3PUKA 1UW4B 4LF9T 1KEYA 1XDOA 2IMLA 3LSVA 4NPPA 3ZMTB 4D10C 1HX1B 4WZXA 3L17A 4BX8A 3T1HT 4WBNE 3P7IA 3RIUA 1DCQA 4F3VA 2F8XK 4UWKA 3ZYKA 2XTLA 2J09A 3EI0A 4FU3A 3QC1A 4NURA 2LE8A 4XBFB 2AXVA 3C3RA 2VKJA 3AAAC 1Z3XA 2KT9A 3C51A 2P58C 2KINB 3ML9A 3SF4A 3RI5A 2E9XC 4GMLA 3KINB 5ENRD 3E08A 4GZ3A 2C0SA 3AEGA 1DCEA 2JQ9A 3LJNA 4MALA 3RKOA 3MYVA 2DL1A 4MS6A 2GROB 3A5XA 3O1IA 4TNWA 4LF8T 3GN5B 2VWAA 4I9CA 5A23A 1YXRA 1SW6A 2AXUA 3JADA 4IT4A 5LHIB 4GK5E 4DMWA 4A98A 4JUYA 3A7MA 3FTZA 2K48A 4PFOA 2KZTA 5CB4E 1WDYA 5FY0A 4M7CA 3BG0B 2XM2A 2CFZA 5AQKB 1XNFA 4WWOA 2XQ9A 4H63V 4FHKA 3AA7B 5JR9A 5A1LA 4JHJA 4E7SA 4DLOA 4DX1A 4FULA 3FZKB 4HNAD 4YDYA 4UIGA 3ZLIA 4JC8A 1H2TC 3H3MA 5FXXA 3AA1B 2ACXA 2V1DB 4CN6A 4KBQA 4CZ2D 2KMFA 2J62A 4MBGA 2P9LG 1QBQA 5DBKA 1ZEEA 2X6IA 2M63A 3V79K 2N1GA 3FU3A 5LBMA 3CV0A 5AQRB 1NEKA 4P0AA 3TWXA 3LK42 4HGAA 2KCVA 4JD2G 2UY1A 3UX4A 2HN2A 1WYBA 3FY4A 4GPKA 4NACA 3T8MA 2XEHA 2J4BA 4U2YA 3ASGA 2K24A 2XENA 4FHJA 2Z6EA 2DWKA 5JR9C 2ACZA 5E75A 4FLHA 5KNHD 4GIWA 3G2TA 1UX5A 1G73A 4AKIA 2P9PG 3BU8A 4G24A 3N71A 2XUEA 2AVPA 1HNXT 2C5KT 3C4ZA 3AG4E 4GMRA 4BSXA 2XQ4A 2ONDA 4I4TE 2DVWA 4B3RT 2LAHA 5D0OD 4N3AA 4N3CA 3BQLA 2AXDS 4JHKA 3ABLE 4X1IE 2VGXA 2XRZA 3MXZA 2XZDG 3CKCA 3AE5A 4KMOA 5BV1A 2XASB 3FWVA 4JI6T 4X20E 1T8BA 2LSUA 2D2SA 4HFVA 2H3RA 3PZ2A 4QXHB 3PEUB 1Z5SC 2UUCT 3D9IA 4U8HA 3ZNGA 4GAAA 4EEBA 1Y01A 4IE5A 4J8DA 3UUXB 2RG8A 2XEEA 3LBXB 5LP0A 3LS8A 4C91A 4HS2A 4LUNU 5KMGP 4KUMB 3AEBA 4PJJA 3CEQA 4O4HE 1S0PA 3TG4A 4PS8A 5C1DA 5AAOA 2CFUA 3ZEFB 2LSJA 3DRAA 4C90A 4CZZB 4LF5T 3LCAA 1V55E 4WNGA 5L4EA 4PJLA 3Q47B 1EYHA 4IN3B 2CG3A 3SNXA 3UKUG 4HWFA 3PUGA 1I6ZA 3FUMA 4U8VD 3CIAA 4HOSA 3AEAA 2EIME 4AY5A 4OYSA 5BUZA 4KXKB 3D3MA 3CVWA 2UXNB 4U33A 3AU4A 1HXIA 4A3TA 2R17C 1AJ3A 1XGWA 2PL2A 4AIFA 2NW7A 3NBXX 3TWVA 3FZLB 2WXMA 2FJEA 4ANVA 5LNKA 3AA0B 4MKTA 4F53A 5CGMA 4LSZE 2QGSA 5HWXA 2VKOA 3ML8A 2XS1A 4GB9A 5LOVE 1OEDE 4G25A 3RC8A 4UF0B 4K5BA 2LHNA 2ZIRA 1G8XA 2PQRA 4TUUA 4O6FA 3UTMA 2WMNA 4Q25A 3MKQA 3VTYA 4JB8P 1E2AA 2IC6A 3ZJ2A 3FU6A 1ELWA 3KDSE 4AISA 1OEDB 5JREA 4I2ZA 4YDWA 3RIBA 2UXDT 1M7KA 1FMVA 3P4PA 3QNUA 2XJ7A 4UVAB 1N54A 2FF4A 5L4HA 1IQRA 1MMAA 4H9RC 4F8HA 5C3JA 2XZTG 3DSVA 2R02A 4C0EA 2X0HA 3RRWA 5LBQB 5LMUT 1BR4A 1PY1A 1W9RA 4U31A 3FFLA 2R05A 4I9EA 3PE0A 4U0ZA 2V26A 1TJCA 2ZM2A 2B6CA 5BXOA 5DIZA 4YLHA 4JL0A 2J47A 4G2VA 5AQAA 1WLXA 2Y48B 1N34T 3Q9NC 5JDHA 4EPZA 4JI5T 3KAEA 2JIWA 2KATA 1WM5A 5FZRA 2MTQA 1O1TA 2F0YA 1K1BA 5ABHA 4DX5D 5CBNA 1BU9A 3LEWA 4GCOA 4YTMA 1U4QA 3DJBA 2ZM8A 4TV9E 3N9PA 3W15B 3RRMB 4EZLA 2BKNA 2YINA 1KT0A 4RVBA 5AQLB 2D9DA 3C98B 4BSZB 3PUAA 1SA5A 3CQGB 2KWIB 1E7PA 4NQ0A 3Q49B 2RFAA 4L2LA 4TXQA 2PFVA 5JHBA 2VSOE 2XQ3A 4U7EB 2JQHA 2JRKA 2XY8B 2M6IA 4LMLA 1UK5A 5LMNT 1IKND 1UN9A 2FEZA 4JW1A 5FNVE 1MX4A 2UXXB 2YHEA 2BS4A 2X0LB 4IDPA 2LM2A 4CGWA 3EAMA 3OPCA 3ZJ1A 5L3BB 1NL4A 4PK6A 2CE7A 2LXMA 1MYOA 2JMKA 4B93B 1ELRA 3M65A 4HFBA 4YTNA 3AXJB 5C8YE 3ESKA 4DR7T 2VQ2A 5KXJA 2XAGB 3FEYA 2LKGA 2VURA 3SFXA 4EIWA 3UINC 4A1SA 1IYGA 2YDQA 4JZYA 5HKPA 4CEMA 3ANWB 3ULEG 5L3FB 4K03A 2YKSA 2ZXWE 1BPOA 3LPZA 3MKRA 3N9OA 1WYCA 5EKQD 2SPCA 4LMJA 1MMDA 2EILE 3TWTA 4J6IA 1VDYA 2DIWA 4PFPA 3AG3E 3L54A 1N52A 3I4GA 2BG9E 2VYIA 3IEGA 3PU3A 4U63A 1HR0T 1FPPA 4ZI3C 3ZUVB 4TWDA 4N5QA 4TWFA 2QZAA 3D9HA 3HXCA 1INZA 3VRAA 2LXLA 3A8YC 3ZC1A 4ZFHA 4LMKA 5AJDA 2C2LA 4LFCT 3LFMA 4ZI7E 3VKHA 4GYOA 3UU8A 3EIQC 4NXMT 3L8RA 3ZSSA 3AEFA 2IO2C 3CR3A 2XSBA 3FH8A 2AE9A 4AKRB 1LD7A 3I3NA 3AS5A 4X8QA 2IUBA 3AVRA 3WXXA 4A63B 3GYZA 2QFCA 3RF1A 1N4PA 3NZPA 3ZPJA 3AG1E 3SGHA 2OVFA 5AQ7A 4YXDA 1L5JA 3RSEG 3Q7AA 2DNXA 2HPJA 4DIDB 3ZGQA 4EEDA 1E1HB 2IY0C 5C2TA 3B7SA 1YQ3A 1WAO1 2JABA 2V5QC 3CWZB 2AXZA 5FY1A 2I59A 2JJ9A 3R7RA 3B95A 2WP9A 5HAXA 4HOUA 4TX5A 2P9IG 5EILA 4EOZB 4DR3T 1VRBA 3JUEA 4P1NA 3VU7H 3ZFWA 1N36T 5ABGA 3QOFA 5AQPB 4DO0A 1FIOA 3D9LA 1A5EA 2LRKA 1T72A 3TAXA 3FUJA 3C50A 5AQJB 3B5MA 2MPKA 2YN6A 1MMNA 4GYSA 3JXIA 2LHRA 4CXXA 1HH8A 4F1PA 2LOPA 2NC9A 3FH7A 2XM1A 4WBOA 3PE4A 3Q5MA 2AWIA 2LM9A 1WR0A 4ILHB 2HN1A 2X66A 3MGBA 5JDFA 3HIZA 4R7LA 3AS8A 4LFAT 5E76A 1SA4A 3RKVA 3HXBA 5FJYA 2J08A 3T8KA 1U5PA 5ABFB 5ENNA 2YHCA 4HFHA 1KNRA 3VRBA 2K3WA 4GOUA 1BLXB 3FXEB 4FI5A 1L0VA 5FZSA 5H7PA 2WWUA 4KHPT 4BT9A 5FKYA 5E0OA 2BKPA 3BQKA 5CMYA 2EHOB 2V7MA 1FJGT 4U2ZA 2JQKA 2KZ7B 4GKJT 3H3AA 1LTXA 3APCA 4FJYA 2XRYA 3N2OA 2C5IT 3CQCB 5FXWA 3UTKA 2CA5A 3URZA 4CXWA 3KVAA 2E9XB 1MHQA 3Q9UC 4AKLA 3ZN3A 2IAKA 3FXDB 5ENQD 4ASKA 3EDVA 4EZHA 3SZ7A 2VJ8A 4WUYA 2WCAA 2WU5A 2V6YA 3FBLA 3HL6A 3S2AA 4CCAA 5JDQA 3ASOE 1OWPA 1IBKT 2P9BA 1TN6A 4UVCB 3UXGA 2N9DA 1N4QA 1K3ZD 1ZU2A 4I55E 3KEAA 2FJDA 2X6HA 1ZBPA 4HWHA 4JEUB 3W9GA 4F1SA 3U9WA 5H6RB 4I1MA 4EHMA 5KJMA 4K0RA 5LHGB 4H7XA 5IWAT 4CDNA 3PREA 3LVQE 3UU3A 2WB5A 4LNUD 3EDUA 2UUAT 3EDTB 3J9X1 2P9UG 3L6AA 5C2YA 2JPFA 4COFA 2IOSA 2Y4UA 3GW4A 5DQVA 1E7VA 3G2UA 3AE6A 2NW8A 3B57A 1E8WA 2GRNB 2DLRA 4YNDA 3VR9A 5JRCA 2LUHA 2IDOB 4ZXLA 1BD8A 4BETA 5AQMB 2VSYA 2MYSA 4O1OA 3IXEA 2QC9A 1UURA 4XEIG 2VB6A 4IREA 3TLWA 4LF6T 5LG3A 4XI9A 3CVYA 3K8PC 3Q9DA 4DV1T 4IDOA 3O48A 2V4HC 3PDYA 3AJIA 4O4LE 1WFDA 5CRVA 2HHHT 1NZNA 4ZHQE 2VQET 1ZHCA 1MNDA 2L3LA 4ZHBA 2YOEA 3L9TA 4KMCA 5F3JA 2RFMA 2P2CP 5FYMA 4L2YA 5F8PA 4BERA 2DBAA 4BTBA 1O3XA 2LT3A 4UXNB 4TV3A 2WQ7A 5AJLA 2ETAA 3RX6A 2EINE 5HS0A 1D9SA 2PM7A 2EIJE 1JWGA 3LG7A 3PZ4A 4W9RA 3DXKG 3MEKA 4I2WA 2XQ0A 3AU5A 4YHJA 4I43B 3UM0A 3SD5A 3VLEA 2PZIA 3DEOA 1VCSA 1JNRA 4U7YA 2H6IA 4OHFA 2Q7FA 2IIUA 3N9NA 5HQ8A 5LGTB 3Q5XA 4JEHB 1SZ9A 3OYZA 2GGFA 3IF8B 4MFRA 4RSYA 5CECB 2X51A 4NUUA 3FZMB 2KNDA 4BT8A 3RKGA 3CVXA 5ENSD 2BKOA 4IHJE 1JWFA 1SZAA 4LF7T 2M67A 4X66T 1MIYA 3L09A 2CRBA 3E22E 4L1BA 3UU4A 2OOEA 3FP3A 3VLDA 4XAXB 4QXBB 3MZKB 2KXPC 3FUNA 4AKHA 4B6XA 1E8YA 3HVEA 4DV5T 1IAPA 5CMWA 1UX4A 1HU3A 2H7VC 3D9OA 3S7JA 2XCCA 5D2MC 3Q73A 2QY7A 4PS3A 3LDZA 4HI9A 2CG2A 5EX3A 1ZOYA 2BVLA 3OVUA 4UR9A 2IQCA 3UU5A 3DSUA 3CPZA 3FTUA 5CFBA 4FJZA 4ZI2D 1OCCE 5ANLA 3BQIA 3QWVA 2FUPA 4A97A 1HE8A 3RIUC 4GZ5A 2IOLA 3GA8A 5FTPA 5JA4D 2C0MA 4KZ0A 1SVXA 4FP7A 5AIJA 5IHYA 5AENA 1J5ET 4AY6A 3JCKC 3CX7B 5CRUA 1NAFA 4DLQA 1IBMT 4QH4A 4EAHA 3ZKRA 1YD8G 4ERRA 4YY3T 1X81A 4KX6A 5AQVB 4Z68A 4GTVA 5J0ZA 1D1CA 1VCTA 4APOA 4KBMB 2VGEA 4FC8A 3LY9A 2DWZA 3FU5A 2F8YA 3X2QE 4GK0E 5CEAA 1M62A 1NWMX 3NOCD 4U07A 4XKCA 2XCBA 4DNDA 2XAFB 4ANJA 2WU2A 2MHKA 2I0MA 4YJ3E 3RHWA 3AVSA 1KNZA 3DPYA 3CSTA 4GYYA 5BW8C 2CHXA 3FHNA 1X79A 3OAWA 1KT1A 3ZIMA 4V1Av 1B89A 3D0TA 4UV8B 5FXZA 4J8FA 1FMWA 3HDXA 3C3OA 3WAJA 2HYZA 5DJQC 3E0ZA 4JI0T 5LG4A 3TGOA 1B7TA 4PH4B 4G23A 5AQHB 5GONE 2ODUA 1UCUA 2WB2A 3EHMA 1YYHA 4DI3A 2VTBB 4DR2T 4AKGA 3FUKA 3PUQA 1QSDA 3SI5A 3UQ7A 3F6QA 5B3SE 4KYOB 1HTJF 2WXIA 3RJVA 3IV0A 2NTYA 2YQ8A 4HOTA 3S7BA 1OXZA 4P09A 1N4RA 2E8IA 2H6HA 3Q15A 4H63H 2WBLA 1TN8A 4TN7B 4F6RD 2E5LT 1J5WA 1FT1A 3AG2E 4GYWA 3Q78A 4TXRA 4UWLA 5BV0A 2MAWA 5IYZE 3C72A 2KCKA 1KPSB 3T5VA 4HFDA 1UJJA 2W00A 1YQ4A 4EYYR 3RO3A 1MX6A 4LNGA 5EX0A 5CCLA 1E8XA 3VR8A 5FINA 2VQFT 1MIWA 3RIAA 3GN5A 3TWSA 2L9QA 1HFAA 4F6RC 1K1AA 2BKGA 4CYMD 5JDLA 3KSQA 2V5CA 2UUBT 2WXQA 2A2FX 2W0GA 4JI2T 3KV4A 4DR6T 3CKBA 4ZS2A 4K0KT 3LJCA 4PJNA 4OK0A 2V7IA 5HXSA 4L9IA 4DBQA 3C64A 4X64T 3TWQA 3UT5E 4N2QA 3HR0A 5JH7E 1DU2A 5LA6E 1O1RA 4JPSA 4O1PA 4DX7D 1OWOA 2GW1A 4IL4A 3AA6B 2X67A 3OYXA 4CI3B 1TNOA 3ZRHA 2CMRA 4WNKA 4L9PA 3PV0F 4CN1A 4GTQA 1OWNA 3I1AA 2QVAA 1HZ4A 4XIFA 3ABVA 5JQGE 1P5QA 5LOZA 1D1BA 3AE2A 5FXVA 5EN5D 3EHZA 4JYAT 5L3GB 3Q75A 5AN8A 4U3CA 2I2OA 3CSFA 1ZP0A 3AEEA 3Q5EA 4JV5T 4GCNA 3MJXA 4DVDA 2A4ZA 3HYMB 3LXUX 3JCFA 1QZ2A 3T1YT 4U74A 2NOXA 2QYUA 2DZOA 2R2LA 3LYAA 3ZMUB 3PUZF 4OX9T 4AIUA 2IONA 3ZU7B 5JDGA 4ILCA 4JHRA 3P4WA 5L3EB 4YSZA 3SO8A 3SHFA 4DV0T 3BG1B 4CT0A 3I0QA 3ZCJA 2LAIA 3SFZA 3UQ3A 3V5UA 3APDA 2V7KA 2V5DA 4EV6A 4ILUA 3Q79A 3ASDA 3U64A 1H2UA 2DWGA 3GZ2A 3N2GE 3S7DA 1UJKA 2PJQA 5BT1A 2WPVA 4YTPA 1MMGA 3PUJA 3D9NA 2Y3AA 4X65T 4JI1T 1NA3A 1ZV4X 1FCHA 2I9CA 4AQYT 1VOMA 3ABME 1QUUA 5L47A 4BAYB 4HBDA 3QDNA 2Y4TA 2IFUA 2WDQA 4PUCA 3KSLA 4JXTA 3K3NA 2DZNA 3TJPA 2JLBA 4NRHB 2CPTA 1TN7A 1EZ3A 3NB2A 2IEJA 3PZ1A 1KLXA
chains in the Genus database with same CATH topology
3EVYA 2K5BB 4A3VA 4CT4A 4J8EA 3UUXA 4F7AA 3LBXA 4AQFA 2IC9A 3FTXA 4BFRA 2N2NA 4DPRA 3UUNA 2LEHA 3CVPA 3ZEFA 3R6NA 5HXHA 4I6GA 2LSIA 2WXGA 4KVOA 4P29A 2XAHB 4URKA 2XGMA 3FUIA 5D0QD 3ONXA 2CLYC 3ZXSA 3L22A 4I6JA 5BMVE 2D5UA 3DP7A 3L3PA 4AQFC 3FUDA 2VSNA 4HN9A 2FO7A 4UEMA 3DTOA 4HFGA 4CGVA 5FT9A 4WNEA 1ZKEA 1SQMA 4HOQA 4CXYA 1IQUA 3SBSA 2J9QA 4KP3C 4HLEA 2KWHA 3D9MA 4UF0A 2V5FA 1U3DA 5FZQA 4ISSA 3PUSA 1YW0A 3D9JA 3LK2B 4CI1B 4KT6B 3QUJA 2VKDA 3T5XA 2V7LA 3C4WA 3RYCE 3P1UA 3RO2A 2ODVA 1OWAA 3JQ0A 3D9KA 4Y6WA 2XHEA 3IKOB 2R59A 2XGSA 5KJNA 4CDMA 4M3OA 3RRCA 3AAEB 3ZN1B 3MV3B 5ARFA 3P8CD 3NZSA 5FWQA 4ATGA 4IIJE 2HR2A 2ZLYA 3F2EA 3TL5A 5EDSA 4B8CB 3FUFA 2XAJB 4L0RA 4O2AE 4UELA 2J4DA 4CI2B 2PG8A 3NRYA 4H9PC 3IHYA 3F57A 1DVPA 4PK5A 2WXOA 1LVFA 4M1PA 3HI2A 3JC6D 2A72A 1PC2A 2BUGA 3KBUA 2Q9QB 4L5GA 3CK9A 2BDEA 2KM4A 4IULA 1CUNA 2L8KA 4MLKA 4JVSA 4CQIA 4IYPA 5LFAA 1HCIA 4GA0A 4I1OB 3JC6C 1FVHA 2VSXE 2HH7A 3S7FA 4EZJA 1UG3A 2I6HA 4BY6A 3ANWA 5M4YA 3ASFA 4AI6A 3RYHE 4WNFA 1LRZA 4YFSA 5DABA 3D9PA 4LEUA 3V5SA 2WXLA 5KJKA 4TV8E 3RU0A 2KC7A 3CK8A 1KK7A 2VL8A 2ZM0A 3CHSA 3O1JA 3AAAB 1EDUA 5LJMA 2WQHA 1H19A 3B7UX 2CEAA 3HHMA 5G55A 3I4RB 5ETWA 3N9LA 3I9WA 1HS7A 3OKQA 2V4LA 4I50E 5FP3A 3KD7A 3CHOA 3CLJA 5KJLA 3PVLA 3EIJA 2MBGA 3MACA 5FQ7A 4GZDA 5LCWC 4H9QC 2IW5B 3OXLA 3UMVA 3ZMSB 3LK3B 1V9DA 2ZMAA 3TXNA 3MKDA 1U3CA 4UQYA 3FUHA 3N9QA 3CK7A 2X6FA 4BJMA 4UWFA 3U3IA 5FY7A 3CHPA 1GW6A 3AS4A 1H0AA 2CWOA 3NZQA 4U0SA 1MNEA 5LCWJ 5HXEA 3ZYQA 2PM6A 2KZTB 3PURA 2LJLA 1YKHB 4PJMA 4IGUA 5ADXL 5JR9B 5EK4A 2HO1A 3GZSA 4IE4A 1ELKA 4DBRA 2J1DG 4E7ZA 3KVBA 2X9YA 2XPIA 3LVRE 2WQ6A 1FEWA 2X6KA 4RG9A 1NA0A 3RYIE 3F31A 1QNFA 4UV9B 3CQXC 4QXCB 5KX5E 3J7Yq 4ISTA 3JUIA 3PZDA 2Y8DA 3EUHA 4JA7A 2UY1B 2C0LA 4PNIA 5L3CB 2CWYA 3GMIA 2DCPA 3RRNB 1HG2A 4AXPA 3QK0A 3IHRA 5A7DB 3UT8A 3CGHA 2DI4A 2EHOA 4Q94A 4A56A 2FI7A 2CHZA 2MRIA 1IJ5A 4AOFA 2IU1A 2I1KA 2EHOD 3FTYA 4RG6A 2X9HA 2DCFA 2XQYA 5BNWA 3PH0C 4KVMA 2HPLA 3FUEA 4JLEA 2VGXB 4JA9A 5LHHB 3K3QC 2E9XA 2ES0A 3OBVE 4E6HA 1A17A 4EBAG 3FULA 4AV7A 2PQNA 2E9XD 2YU2A 2EHOC 3APFA 4Q69A 4QX7B 3DBSA 3C4XA 3PDNA 2WVIA 4HEAA 2LOSA 4X1YE 4C9BB 3ZHEA 1E7UA 3QWWA 4BWRA 3UT4A 3VLFA 4JEUA 5DQWA 3FBZA 3CVNA 4DMVA 2GK9A 4H9OC 5T3RA 3FEXA 2WXNA 3NF1A 4MRUA 5H6QB 2JQQA 2L0IA 2J49A 2VGYA 4FA6A 1YKEB 4TRQA 2G0UA 4UVBB 1HO8A 1BR1A 3MV2B 4N2SA 1S35A 4ZI2C 2WM9A 4IE6A 3RH3A 4AEZC 4PAGA 4V3IA 3UPVA 2D0UA 4UWGA 4TUYE 4IE0A 2NW9A 4ACKA 5J90A 3SBTB 3FB2A 5LX8A 3LJ3A 2XPYA 3QNKA 4H7YA 2OV8A 2K9AA 5JJ7A 2VK9A 3QC9A 4EYUA 5FQ4A 1D0YA 3MKQB 1W3BA 4MBQA 3PE3A 4YVQC 5J08A 2LO6A 4CRWA 4DJAA 3ZVVA 3ZMVB 4MHCA 2R5SA 3N5LA 4H9SE 3RPUA 1E96B 5KCMA 1US7B 4BTAA 4ZOLE 5AYWD 2ILRA 3CMLA 1H7CA 4I43A 3CKDA 3TG5A 4AXHA 3NRXA 3FH5A 3CX6B 3NZUA 2NTXA 5HWYA 2OA5A 2B1EA 4QX8B 4JEHA 4ANWA 4HE8A 4K0UA 2CM0A 4MLPA 3T8OA 2I1JA 1SA0E 3R9AB 4OYKA 3ZMZB 3QKYA 2BZBA 3ZC0A 3PNLB 5T8IA 4PW8A 4OYJA 4FJOA 4WNDA 4ACLA 2CLYB 5J2UE 2C5JA 2V0PA 4N39A 4HKAA 4I1AA 5J1GA 4B0ZA 1LKXA 4ABNA 3EJNA 1D1AA 2L6JA 4O4IE 2WSSV 4E85A 2FBNA 1JPLA 4UWHA 3HKDE 4A1GA 4I17A 3FTWA 3B13A 4AJWA 4CDRA 1Z0PA 4EXTA 4C0MA 4HVBA 4UI9C 1BR0A 4XE0A 3L08A 2VASA 3UULA 5ARGA 1HF8A 5HYAA 1HS6A 1D0ZA 4TZ4C 4LRZA 3OTNA 2YU1A 4G11A 4WWNA 1LF8A 2YEVC 2CHWA 4GU5A 1EF1C 4XI0A 4UI9K 4OVVA 3O1HA 3Q2MA 3Q4AB 2CXLA 2X9XA 4UI9J 1DNPA 2WXRA 3I9YA 5LXTE 2WAUA 3ZPOA 3ENEA 3QJZA 5CHEE 2NWBA 2WXJA 4FADA 5FMNA 1IHGA 3VKGA 5JJ6A 5CA0E 4LCTA 4AVXA 2NXPA 3HKCE 2XHEB 4DI4A 2VTBA 3QAQA 2OVBA 4PS7A 3IBEA 2ZU6B 3CHRA 4BA9A 1JUQA 3MA5A 3PEVB 1Y6IA 2CXDA 3KBTA 5M72A 3HKBE 5JDNA 3I5PA 3LY7A 5JJTA 2RA1A 4J8SA 3IBPA 4A55A 3ONLA 3FU0A 5ANRA 4HXIA 3U4TA 3CVLA 4KZCA 3ESLA 5T4YA 2X6JA 2MOZA 2BTDA 2BF0X 1WY6A 4O4JE 2XEVA 4IE7A 3SRZA 2CCQA 3HA4A 2IJGX 4UQXA 2JMHA 1OUVA 3MA9A 3LKUA 3AAIA 3O9XA 2LSGA 1Y64B 3MZLB 1FVFA 3FDHA 4EZKA 2RD0A 3ONKA 4O8SA 4GMJA 2MOWA 4ZI3D 4ME2A 3K3OA 1QQEA 2KCLA 3OJAA 5G04C 3JQ1A 1WRDA 4QHOA 3VHLA 1TJFA 4U0UA 4N78D 3K9IA 4Z8XA 1X5BA 3NQPA 3ZW3A 3CX8B 4J0UA 4EBAA 3O4ZA 1Z6TA 3MJWA 4X1KE 4N3BA 2WXFA 5EK3A 4YJ2E 4WAFA 4GA1A 4XKBA 4XX5A 5G2NA 3RRUA 1S94A 4XZCA 2GRLA 3SWHA 3I0OA 1SHZC 3QWPA 3QARA 5G04J 2YNQA 2LSKA 3KV9A 3PNTB 2X9WA 4U72A 3B7RL 3FHEA 1YA0A 2X3MA 2XGOA 3GWHA 4EECA 3UUMA 1IZNB 2EQXA 2NSZA 5EZYE 3PS6A 2V8SE 3FTVA 4O2BE 1OWLA 3DPDA 4AM9A 3C98A 3ZYLA 3UT7A 3QB2A 4IDZA 2XAQB 4HORA 3S4UA 2D0TA 4IRUA 3BK9A 2FULA 4U04A 2WXHA 3ETUA 3MCXA 3U78A 2H7OA 1E8ZA 1MQSA 2KLQA 5JVDE 3U66A 3R7QA 3G2SA 3B7TA 3E4BA 2J07A 2E0IA 3L13A 2A5UA 3N2KE 3IEEA 5TAOA 4G63A 5L2LA 4ILIA 3H37A 3WAKA 2WMOA 5JRCB 3L16A 1EPUA 4OFZA 2W61A 3KS2A 3Q5WA 1HG5A 4HTEA 3KFWX 4WWPA 4G1TA 4QFVA 3CHQA 4Y6CA 4EZ4A 5J2TE 4AP2A 2YK0A 3EHNA 3PRZA 2E2EA 4AQGA 4WW0A 4QWNB 3RC3A 2AW6A 3CHMA 4XZ4A 5CCMA 2WXKA 3PU8A 3FTSA 3GZ1A 4H9NC 1H2VC 2LSVA 4L23A 5FQ8A 2KXPB 3P2BA 4B94A 4QKNA 4YVOA 2QA7A 4ILGA 3ZN0B 4G2AA 2HM8A 3ASHA 1HX8A 2L0TB 3CVVA 2V7JA 1LVKA 4ZS3A 4J2CA 3QOUA 1UN8A 5G05C 1PAQA 4B8AA 5LYJE 1Z3YA 1OWMA 2GRMA 4GYRA 4L7TA 3VTXA 3HKEE 4FLBA 2RP4A 3RK6A 3R84B 5AFUL 2JEKA 2UWJG 5KDMC 4EQFA 2XPZA 3BEEA 1IJ6A 3HVEB 4GZCA 4N5CA 4PK4A 1D0XA 4DK5A 5FQ6A 2W63A 3KEZA 4B89A 2NP9A 3SOLA 5HXCA 2PBIA 2DHRA 3ZHEB 3ZCIA 2L9BA 5G05J 2BVMA 4P0BA 3QK6A 2WXPA 4PDXA 3G2WA 2X68A 4BX9A 5EK2A 3G2VA 5LGUB 3OXFA 3OXGA 2Q9QA 1TEZA 3TKLB 2W62A 4NUVA 4GA2A 5HI7A 2LNIA 1NP7A 1Y8MA 4ADZA 2Q9QD 5LCYA 5JHAA 2A3DA 4ANUA 3ULQA 3CVQA 3KV6A 5BPPA 4Q96A 2VKHA 3ZYMA 4GZ6A 4G26A 3CVUA 2X38A 3LY8A 4ANXA 4I6EA 3AB3B 4UQZA 4APFA 5CA1E 3O4XE 2Q9QC 4BJNA 2IF4A 3MK7C 2LSYA 4OVUA 5A6CA 3IHVA 5LJNA 1T98A 3KV5A 3N9MA 5L3DB 1BR2A 5JDMA 3CVRA 3SS1A 3RYFE 3PTRB 1MIVA 2CXFA 3UFEA 1E90A 3U3WA 3JYSA 3WI3A 1WR6A 1H6KA 3ETVA 4LERA 3TXMA 4EB6E 3MX3A 2Y6XA 5HXRA 5LGNB 5LP6E 3PUKA 1UW4B 3ZMTB 4D10C 3L17A 4BX8A 4WBNE 3P7IA 4F3VA 4UWKA 3ZYKA 2XTLA 2J09A 4FU3A 3QC1A 4NURA 2LE8A 4XBFB 2AXVA 2VKJA 1Z3XA 2KT9A 3C51A 2P58C 2KINB 3ML9A 3SF4A 2E9XC 4GMLA 3KINB 3E08A 4GZ3A 2C0SA 4MALA 3RKOA 3MYVA 4MS6A 3A5XA 3O1IA 3GN5B 2VWAA 4I9CA 5A23A 2AXUA 5LHIB 4GK5E 4DMWA 4JUYA 3FTZA 2K48A 4PFOA 2KZTA 5CB4E 5FY0A 3BG0B 2CFZA 1XNFA 4WWOA 4H63V 4FHKA 3AA7B 5JR9A 5A1LA 4JHJA 4E7SA 4DLOA 4FULA 4UIGA 3ZLIA 4JC8A 1H2TC 5FXXA 3AA1B 2ACXA 2V1DB 4KBQA 2KMFA 5DBKA 1ZEEA 2X6IA 2M63A 2N1GA 3FU3A 5LBMA 3CV0A 4P0AA 3LK42 4HGAA 2KCVA 3UX4A 2UY1A 1WYBA 3FY4A 4GPKA 4NACA 3T8MA 2J4BA 3ASGA 2K24A 4FHJA 2Z6EA 2DWKA 5JR9C 5E75A 4FLHA 4GIWA 3G2TA 1UX5A 1G73A 4AKIA 4G24A 3N71A 2XUEA 2AVPA 2C5KT 3C4ZA 4BSXA 2ONDA 5D0OD 4I4TE 2LAHA 4N3AA 4N3CA 3BQLA 4JHKA 4X1IE 2VGXA 2XRZA 3MXZA 3CKCA 4KMOA 5BV1A 2XASB 3FWVA 4X20E 2LSUA 2D2SA 4HFVA 2H3RA 4QXHB 3PEUB 3D9IA 4U8HA 4GAAA 4IE5A 4J8DA 3UUXB 2RG8A 3LBXB 5LP0A 3LS8A 4C91A 4HS2A 4LUNU 4KUMB 5KMGP 4PJJA 3CEQA 4O4HE 1S0PA 3TG4A 4PS8A 5C1DA 2CFUA 3ZEFB 2LSJA 3LCAA 4C90A 4CZZB 4WNGA 4PJLA 3Q47B 1EYHA 4IN3B 2CG3A 3SNXA 3PUGA 3FUMA 4HOSA 3CIAA 4AY5A 4OYSA 5BUZA 4KXKB 3D3MA 3CVWA 2UXNB 3AU4A 1HXIA 4A3TA 2R17C 1AJ3A 1XGWA 2PL2A 4AIFA 2NW7A 3NBXX 2WXMA 4ANVA 5LNKA 3AA0B 4MKTA 4F53A 2QGSA 5HWXA 2VKOA 3ML8A 4GB9A 5LOVE 4G25A 3RC8A 4UF0B 2LHNA 1G8XA 2PQRA 4TUUA 4O6FA 2WMNA 3MKQA 3VTYA 2IC6A 3ZJ2A 3FU6A 1ELWA 3KDSE 5JREA 4I2ZA 3RIBA 1FMVA 4UVAB 1N54A 2FF4A 1IQRA 1MMAA 4H9RC 4C0EA 3RRWA 5LBQB 1BR4A 1PY1A 3FFLA 4I9EA 3PE0A 4U0ZA 2V26A 1TJCA 2ZM2A 5DIZA 4YLHA 4JL0A 4G2VA 1WLXA 2Y48B 5JDHA 4EPZA 3KAEA 2KATA 1WM5A 5FZRA 2MTQA 3LEWA 4GCOA 1U4QA 3DJBA 2ZM8A 4TV9E 3N9PA 3W15B 3RRMB 4EZLA 2YINA 1KT0A 4RVBA 3C98B 3PUAA 3CQGB 2KWIB 4NQ0A 3Q49B 4L2LA 5JHBA 2PFVA 2VSOE 2JRKA 2FEZA 1UN9A 4JW1A 5FNVE 2YHEA 2UXXB 2X0LB 4CGWA 3ZJ1A 5L3BB 4PK6A 2CE7A 2JMKA 1ELRA 3M65A 5C8YE 3ESKA 2VQ2A 2XAGB 3FEYA 4EIWA 4A1SA 1IYGA 4JZYA 4CEMA 3ANWB 5L3FB 4K03A 3LPZA 1BPOA 3MKRA 1WYCA 3N9OA 5EKQD 2SPCA 1MMDA 4J6IA 1VDYA 2DIWA 4PFPA 3L54A 1N52A 3I4GA 2VYIA 3IEGA 4U63A 3PU3A 4ZI3C 1INZA 3ZC1A 5AJDA 2C2LA 3LFMA 4ZI7E 3VKHA 4GYOA 3EIQC 3CR3A 3FH8A 4AKRB 3I3NA 3AS5A 3WXXA 3AVRA 3GYZA 2QFCA 3NZPA 3ZPJA 3SGHA 2OVFA 1L5JA 2DNXA 2HPJA 3ZGQA 1E1HB 3B7SA 1WAO1 3CWZB 2AXZA 5FY1A 2I59A 2JJ9A 3R7RA 5HAXA 4HOUA 4TX5A 4EOZB 1VRBA 3VU7H 3ZFWA 4DO0A 1FIOA 3D9LA 3TAXA 3FUJA 3C50A 1MMNA 4GYSA 2LHRA 4CXXA 1HH8A 2LOPA 2NC9A 3FH7A 4WBOA 3PE4A 3Q5MA 2AWIA 2LM9A 4ILHB 2X66A 3MGBA 5JDFA 3HIZA 4R7LA 3AS8A 5E76A 3RKVA 5FJYA 2J08A 1U5PA 5ENNA 2YHCA 4GOUA 3FXEB 4FI5A 5FZSA 2WWUA 4BT9A 5E0OA 3BQKA 5CMYA 2EHOB 2V7MA 2KZ7B 3H3AA 3APCA 4FJYA 2XRYA 3N2OA 2C5IT 3CQCB 5FXWA 3UTKA 2CA5A 3URZA 4CXWA 3KVAA 2E9XB 1MHQA 4AKLA 3ZN3A 2IAKA 3FXDB 4ASKA 3EDVA 4EZHA 3SZ7A 2VJ8A 4WUYA 3FBLA 3HL6A 3S2AA 4CCAA 5JDQA 1OWPA 2P9BA 4UVCB 2N9DA 1ZU2A 4I55E 2X6HA 1ZBPA 4JEUB 4F1SA 3U9WA 5H6RB 4I1MA 5KJMA 4K0RA 5LHGB 4H7XA 4CDNA 3PREA 3LVQE 3EDUA 3EDTB 3J9X1 3L6AA 5C2YA 2JPFA 2IOSA 2Y4UA 3GW4A 5DQVA 1E7VA 3G2UA 2NW8A 3B57A 1E8WA 2DLRA 4YNDA 5JRCA 2VSYA 2MYSA 2VB6A 4XI9A 3CVYA 3K8PC 3Q9DA 3O48A 3PDYA 4O4LE 1NZNA 4ZHQE 1ZHCA 1MNDA 2L3LA 4KMCA 5F3JA 4L2YA 5FYMA 5F8PA 2DBAA 4BTBA 1O3XA 2LT3A 4UXNB 4TV3A 2WQ7A 5AJLA 3RX6A 2PM7A 1JWGA 3LG7A 4W9RA 3MEKA 4I2WA 2XQ0A 3AU5A 4YHJA 4I43B 3SD5A 3VLEA 2PZIA 4OHFA 2Q7FA 3N9NA 5HQ8A 5LGTB 3Q5XA 4JEHB 1SZ9A 3OYZA 2GGFA 3IF8B 4MFRA 4RSYA 2X51A 4NUUA 2KNDA 4BT8A 3CVXA 4IHJE 1JWFA 1SZAA 2M67A 1MIYA 3L09A 3E22E 4L1BA 2OOEA 3FP3A 3VLDA 4XAXB 4QXBB 3MZKB 3FUNA 4AKHA 4B6XA 1E8YA 3HVEA 1IAPA 5CMWA 1UX4A 1HU3A 2H7VC 3D9OA 3S7JA 2XCCA 2QY7A 4PS3A 3LDZA 2CG2A 5EX3A 2BVLA 2IQCA 3CPZA 3FTUA 4FJZA 5ANLA 4ZI2D 3BQIA 3QWVA 1HE8A 4GZ5A 2IOLA 3GA8A 5FTPA 2C0MA 4KZ0A 4FP7A 5AIJA 5IHYA 5AENA 4AY6A 3JCKC 3CX7B 1NAFA 4DLQA 4EAHA 1YD8G 4ERRA 1D1CA 4APOA 4KBMB 4FC8A 3LY9A 3FU5A 4GK0E 1NWMX 4U07A 4XKCA 2XCBA 4DNDA 2XAFB 4ANJA 2MHKA 4YJ3E 3AVSA 1KNZA 3CSTA 4GYYA 5BW8C 2CHXA 3FHNA 1X79A 3OAWA 1KT1A 3ZIMA 4V1Av 1B89A 3D0TA 4UV8B 5FXZA 4J8FA 1FMWA 3HDXA 3WAJA 2HYZA 5DJQC 3E0ZA 3TGOA 5LG4A 1B7TA 4PH4B 4G23A 5GONE 2ODUA 1UCUA 2WB2A 3EHMA 4DI3A 2VTBB 4AKGA 3FUKA 3PUQA 1QSDA 3SI5A 4KYOB 1HTJF 2WXIA 3RJVA 3IV0A 2NTYA 2YQ8A 4HOTA 3S7BA 1OXZA 4P09A 2E8IA 3Q15A 4H63H 2WBLA 4TN7B 4GYWA 4UWLA 5BV0A 5IYZE 2KCKA 3T5VA 1UJJA 2W00A 4EYYR 3RO3A 5EX0A 5CCLA 1E8XA 1MIWA 3GN5A 2L9QA 1HFAA 4F6RC 5JDLA 2WXQA 2A2FX 2W0GA 3KV4A 3CKBA 4ZS2A 3LJCA 4PJNA 4OK0A 2V7IA 5HXSA 4L9IA 4DBQA 3C64A 3UT5E 4N2QA 3HR0A 5JH7E 4JPSA 5LA6E 1OWOA 2GW1A 3AA6B 2X67A 3OYXA 4CI3B 3ZRHA 2CMRA 4WNKA 1OWNA 3I1AA 1HZ4A 4XIFA 5JQGE 1P5QA 5LOZA 1D1BA 5FXVA 5L3GB 2I2OA 3CSFA 4GCNA 3MJXA 4DVDA 2A4ZA 3HYMB 3LXUX 1QZ2A 4U74A 2NOXA 3LYAA 3ZMUB 2IONA 5JDGA 4JHRA 5L3EB 3SHFA 3BG1B 4CT0A 3I0QA 3ZCJA 2LAIA 3SFZA 3UQ3A 3V5UA 3APDA 2V7KA 4ILUA 3ASDA 3U64A 1H2UA 2DWGA 3GZ2A 3N2GE 3S7DA 1UJKA 2PJQA 5BT1A 2WPVA 1MMGA 3PUJA 3D9NA 2Y3AA 1NA3A 1ZV4X 1FCHA 2I9CA 1VOMA 1QUUA 4BAYB 3QDNA 2Y4TA 2IFUA 4PUCA 4JXTA 3K3NA 3TJPA 2JLBA 4NRHB 1EZ3A 1KLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMO A;  2WM9 A;  2WMN A;  3VHL A;  3B13 A;  2YIN A; 
#chains in the Genus database with same CATH topology
 4A5X A;  3EVY A;  2K5B B;  4A3V A;  4CT4 A;  4J8E A;  3UUX A;  5BXU A;  2ZM6 T;  1KNP A;  4F7A A;  5ENO D;  3LBX A;  4AQF A;  3AE3 A;  1N94 A;  2IC9 A;  3FTX A;  5F5W A;  2OEW A;  4BFR A;  2N2N A;  4DPR A;  3UUN A;  2LEH A;  3CVP A;  3EAB A;  3ZEF A;  3R6N A;  3PUW F;  5HXH A;  4I6G A;  2FJB A;  1XNQ T;  3SFE A;  4Z91 A;  3E33 A;  2LSI A;  3UU6 A;  2WXG A;  4KVO A;  4P29 A;  5EID A;  2XAH B;  4YSX A;  4URK A;  1D8D A;  4HLL A;  2XGM A;  3FUI A;  5FVK A;  5D0Q D;  3ONX A;  2CLY C;  3ZXS A;  3L22 A;  4I6J A;  5BMV E;  3AE7 A;  2D5U A;  5FL1 A;  3RLF F;  4RQI A;  3DP7 A;  4GTO A;  3L3P A;  4AQF C;  3FUD A;  2VSN A;  4HN9 A;  2FO7 A;  4UEM A;  3DTO A;  4HFG A;  4CGV A;  3V2O A;  5FT9 A;  4WNE A;  1ZKE A;  1SQM A;  3EHQ A;  3EU5 A;  4HOQ A;  2W2U A;  4CXY A;  1IQU A;  2W67 A;  2OEV A;  2J9Q A;  3SBS A;  4KP3 C;  4HLE A;  2B76 A;  2KWH A;  3T9K A;  3D9M A;  4UF0 A;  2V5F A;  1U3D A;  5FZQ A;  3WG7 E;  4ISS A;  3PUS A;  2ZIS A;  1YW0 A;  3D9J A;  2BG9 B;  3LK2 B;  4CI1 B;  4DR1 T;  4KT6 B;  3QUJ A;  2VKD A;  4LF4 T;  1W09 A;  3T5X A;  2V7L A;  3C4W A;  3RYC E;  3P1U A;  3RO2 A;  1LD8 A;  2ODV A;  1OWA A;  3JQ0 A;  3UM3 A;  2NR4 A;  2CBI A;  3D9K A;  4Y6W A;  2XHE A;  3IKO B;  2R59 A;  2XGS A;  5KJN A;  5AAR A;  4CDM A;  4M3O A;  3RRC A;  3AAE B;  3ZN1 B;  3MV3 B;  5ARF A;  3P8C D;  2WWV A;  3NZS A;  1IHB A;  1J1J A;  3C5R A;  5FWQ A;  4IIJ E;  4ATG A;  1R8I A;  5IY5 E;  2Y1L E;  2HR2 A;  2EIK E;  2WZI A;  2VVS A;  2ZLY A;  1QLB A;  3F2E A;  3TL5 A;  5EDS A;  3P4R A;  4B8C B;  3FUF A;  4LNB A;  2XAJ B;  4L0R A;  4O2A E;  4UEL A;  2J4D A;  4CI2 B;  1WCR A;  2PG8 A;  3NRY A;  3ABK E;  4H9P C;  1UUS A;  3IHY A;  3Q5D A;  2WS3 A;  3F57 A;  1DVP A;  4PK5 A;  2WXO A;  1LVF A;  2RPA A;  3NWI A;  5ABE A;  3ONJ A;  5AQI B;  4M1P A;  3HI2 A;  3JC6 D;  3RQW A;  2A72 A;  2DYR E;  3PUX F;  1PC2 A;  2BUG A;  4DR4 T;  3KBU A;  2XS8 A;  5FIO A;  2Q9Q B;  2XSA A;  4L5G A;  3CK9 A;  1YCS B;  2BDE A;  2KM4 A;  3RIF A;  4IUL A;  1CUN A;  2L8K A;  4MLK A;  2A5E A;  4DV7 T;  4JVS A;  5EYL A;  4CQI A;  2H6F A;  3AXJ A;  4IYP A;  5LFA A;  1HCI A;  2PNN A;  4GA0 A;  4I1O B;  3JC6 C;  1HNW T;  1FVH A;  4J8Y A;  2HE0 A;  2VSX E;  2HH7 A;  3S7F A;  4EZJ A;  1UG3 A;  4BEP A;  2I6H A;  4BY6 A;  3ANW A;  5M4Y A;  3ASF A;  4AI6 A;  2XQ5 A;  2E2A A;  3RYH E;  4WNF A;  1LRZ A;  4YFS A;  5DAB A;  3D9P A;  4LEU A;  3V5S A;  2WXL A;  5KJK A;  4HB5 A;  4TV8 E;  3RU0 A;  2KC7 A;  1TNY A;  3CK8 A;  4B3S T;  1KK7 A;  2VL8 A;  2ZM0 A;  5B1A E;  3CHS A;  3O1J A;  3AAA B;  4NIQ A;  1EDU A;  1N9A A;  2RKK A;  5LJM A;  2WQH A;  1H19 A;  3B7U X;  2CEA A;  3HHM A;  5G55 A;  2R03 A;  2B0O E;  3I4R B;  5ETW A;  3N9L A;  3UIO C;  3I9W A;  5FVL A;  1HS7 A;  3OKQ A;  4YSY A;  2V4L A;  4I50 E;  5FP3 A;  1NFI E;  3KD7 A;  3CHO A;  3CLJ A;  5KJL A;  3PVL A;  3EIJ A;  2MBG A;  3MAC A;  5FQ7 A;  4GZD A;  5LCW C;  4H9Q C;  2V6X A;  2IW5 B;  3OXL A;  3UMV A;  4HWD A;  3ZMS B;  3LK3 B;  1V9D A;  2ZMA A;  4HFE A;  4DUI A;  3TXN A;  3MKD A;  1U3C A;  4UQY A;  1XMO T;  3FUH A;  5AQN B;  3N9Q A;  1W0B A;  3PZ3 A;  3CK7 A;  2X6F A;  4BJM A;  4UWF A;  3SFY A;  3U3I A;  5FY7 A;  2J4G A;  1N0Q A;  3CHP A;  1GW6 A;  3AS4 A;  2XQ7 A;  1JNZ A;  1H0A A;  2CWO A;  3NZQ A;  2OLT A;  4U0S A;  1MNE A;  3TLS A;  5LCW J;  3ZST A;  2Y69 E;  1UGO A;  2OCC E;  5HXE A;  3ZYQ A;  2W66 A;  2PM6 A;  2KZT B;  3SQV A;  4HRN A;  2XZE A;  3PUR A;  2LJL A;  1YKH B;  4PJM A;  4IGU A;  5ADX L;  5JR9 B;  5EK4 A;  2HO1 A;  2UXC T;  5HEG A;  3GZS A;  3JAE A;  4IE4 A;  1ELK A;  4DBR A;  1WG0 A;  3RGL A;  2J1D G;  4E7Z A;  3KVB A;  5AQT B;  2QYJ A;  2X9Y A;  2XPI A;  3LVR E;  4GTP A;  1TYQ G;  2WQ6 A;  1FEW A;  3JAF A;  3DSX A;  5ABF A;  2X6K A;  4RG9 A;  1NA0 A;  3RYI E;  3F31 A;  1QNF A;  4UV9 B;  3FZF B;  3CQX C;  1W0A A;  2GRR B;  4QXC B;  5KX5 E;  3J7Y q;  1TNZ A;  4IST A;  3JUI A;  4TNV A;  1XNR T;  3PZD A;  2Y8D A;  3EUH A;  4JA7 A;  2UY1 B;  2C0L A;  4TXP A;  4PNI A;  3BUA A;  3FZH B;  5AQ9 A;  5L3C B;  2CWY A;  3GMI A;  2DCP A;  3RRN B;  1HG2 A;  4AXP A;  3QK0 A;  3IHR A;  4LFB T;  5A7D B;  3UT8 A;  3CGH A;  2DI4 A;  2EHO A;  4Q94 A;  4A56 A;  2FI7 A;  2CHZ A;  3ZXP A;  5AQQ B;  4JI4 T;  2H88 A;  2MRI A;  3TLT A;  4YDO A;  1IJ5 A;  3HXE A;  3V30 A;  5AQS B;  4ATZ D;  4AOF A;  4G8K A;  2IU1 A;  1BI7 B;  2CHO A;  2I1K A;  1KZP A;  2EHO D;  3FTY A;  4RG6 A;  2X9H A;  2DCF A;  2XQY A;  5BNW A;  3PH0 C;  4KVM A;  2BBH A;  2HPL A;  3FUE A;  4JLE A;  2VGX B;  4JA9 A;  4DX6 D;  5LHH B;  3K3Q C;  2UU9 T;  2E9X A;  2ES0 A;  2WQY A;  1GQE A;  3OBV E;  1I94 T;  4E6H A;  1A17 A;  4EBA G;  3FUL A;  2LLY A;  2PQN A;  4AV7 A;  2E9X D;  2YU2 A;  4OAU C;  2EHO C;  3APF A;  4Q69 A;  4QX7 B;  3DBS A;  3C4X A;  3PDN A;  5KNG A;  2WVI A;  4HEA A;  2LOS A;  4X1Y E;  1XWM A;  4DRX E;  4C9B B;  3ZHE A;  1E7U A;  3QWW A;  4BWR A;  5CER B;  3UT4 A;  3VLF A;  4JEU A;  2WY2 A;  4IDQ A;  5DQW A;  1MJ0 A;  3FBZ A;  3CVN A;  4U8Y D;  4YDE A;  4DMV A;  2GK9 A;  4H9O C;  5T3R A;  3IA3 A;  3FEX A;  2WXN A;  3NF1 A;  4MRU A;  1S64 A;  5H6Q B;  2JQQ A;  2L0I A;  2J49 A;  2VGY A;  4FA6 A;  4YT0 A;  1YKE B;  4TRQ A;  5FL0 A;  2G0U A;  3QB5 A;  4UVB B;  1HO8 A;  1BR1 A;  3MV2 B;  1S70 B;  4N2S A;  5ITZ F;  4Z90 A;  1S35 A;  3SY2 A;  4ZI2 C;  2WM9 A;  1H6P A;  4IE6 A;  3RH3 A;  4AEZ C;  4PAG A;  4V3I A;  2X0Y A;  3UPV A;  2D0U A;  4UWG A;  4TUY E;  1JCQ A;  4IE0 A;  2NW9 A;  4ACK A;  5J90 A;  3K1S A;  3M3Z B;  4TWH A;  4K5C A;  3SBT B;  3FB2 A;  5LX8 A;  3LJ3 A;  2XPY A;  2P9S G;  3QNK A;  4H7Y A;  2OV8 A;  2K9A A;  5JJ7 A;  2VK9 A;  3QC9 A;  4K5A B;  3AEC A;  4EYU A;  5FQ4 A;  4NIK A;  1D0Y A;  3MKQ B;  1W3B A;  3PUY F;  2V8S V;  4MBQ A;  3PE3 A;  4JBW F;  4YVQ C;  5EIB E;  5J08 A;  2LO6 A;  4CRW A;  1AWC B;  4DJA A;  3ZVV A;  3ZMV B;  4MHC A;  2R5S A;  3N5L A;  4H9S E;  4HWI B;  4IL9 A;  2XPK A;  3RPU A;  1E96 B;  5KCM A;  1US7 B;  3V31 A;  4BTA A;  4ZOL E;  5AYW D;  1IXV A;  2ILR A;  3CML A;  3AE8 A;  4TUM A;  1H7C A;  4I43 A;  3CKD A;  1JCS A;  3TG5 A;  4AXH A;  3NRX A;  3FH5 A;  3CX6 B;  4GPM A;  3NZU A;  1N0R A;  2NTX A;  5HWY A;  2OA5 A;  2B1E A;  4QX8 B;  4JEH A;  4ANW A;  4HE8 A;  4K0U A;  5B1B E;  3QB5 K;  2CM0 A;  4MLP A;  1RZ4 A;  3T8O A;  1OCO E;  2DYS E;  2OV9 A;  2I1J A;  1SA0 E;  3R9A B;  3TLU A;  4OYK A;  3ZMZ B;  3QKY A;  2BZB A;  3ASN E;  3ZC0 A;  3PNL B;  5T8I A;  4DV4 T;  4PW8 A;  4JI8 T;  3DSW A;  4OYJ A;  4FJO A;  4WND A;  3J5P A;  4ACL A;  2CLY B;  5J2U E;  2C5J A;  2V0P A;  4N39 A;  2P9N G;  4HKA A;  4I1A A;  5J1G A;  4B0Z A;  1LKX A;  4ABN A;  3EJN A;  1D1A A;  3UUB A;  2L6J A;  4O4I E;  4KHZ F;  3L82 A;  2WSS V;  3ZT5 A;  4E85 A;  2FBN A;  1JPL A;  3AE9 A;  4UWH A;  3HKD E;  3OTO T;  4A1G A;  3ZKJ A;  3C3Q A;  5HEH A;  2CHN A;  4I17 A;  3ULY A;  3FTW A;  3B13 A;  4AJW A;  4CDR A;  1Z0P A;  3AE1 A;  2AJA A;  4B3T T;  1XMQ T;  4J7W A;  4EXT A;  4C0M A;  4HVB A;  4UI9 C;  1BR0 A;  4XE0 A;  3L08 A;  2XQ8 A;  1XDP A;  2VAS A;  3UUL A;  5ARG A;  3DEP A;  1HF8 A;  5HYA A;  1HS6 A;  2YDR A;  1D0Z A;  4TZ4 C;  4LRZ A;  3OTN A;  5EYP F;  2F4V T;  2YU1 A;  2YDS A;  1OY3 D;  4G11 A;  4WWN A;  1LF8 A;  5LB7 B;  1S63 A;  2YEV C;  2CHW A;  1BI8 B;  4GU5 A;  1EF1 C;  2P9K G;  1OCZ E;  2FBW A;  4XI0 A;  4UI9 K;  4OVV A;  3O1H A;  1V54 E;  2VL0 A;  4DUY T;  4X62 T;  3Q2M A;  3Q4A B;  2CXL A;  2X9X A;  4UI9 J;  4DV3 T;  1DNP A;  2WXR A;  2KBX A;  2LKH A;  3DXM G;  3I9Y A;  5LXT E;  2WAU A;  3ZPO A;  4B3M T;  3ENE A;  3QJZ A;  1AP7 A;  5CHE E;  2NWB A;  3E32 A;  2WXJ A;  4FAD A;  1K8K G;  5FMN A;  1IHG A;  3VKG A;  1U2V G;  5JJ6 A;  1NEN A;  5CA0 E;  4LCT A;  4AVX A;  2NXP A;  3HKC E;  3P4Q A;  2XHE B;  4DI4 A;  5JTG A;  2VTB A;  3P50 A;  1YMP A;  3QAQ A;  2OVB A;  4PS7 A;  3IBE A;  2ZU6 B;  3CHR A;  4BA9 A;  4LG6 A;  2GRQ B;  1JUQ A;  1TR4 A;  2ZGD A;  3MA5 A;  3PEV B;  1Y6I A;  2CXD A;  3KBT A;  3HRA A;  5M72 A;  1SE7 A;  5BR8 T;  3HKB E;  5JDN A;  3I5P A;  4HQD A;  4U96 D;  3LY7 A;  3UM1 A;  5JJT A;  2RA1 A;  4J8S A;  3IBP A;  4A55 A;  3ONL A;  2WDV A;  3FU0 A;  3TLV A;  2FJA A;  3E37 A;  5ANR A;  4HXI A;  1UOH A;  3U4T A;  1OXJ A;  3CVL A;  1D8E A;  4KZC A;  3ESL A;  5T4Y A;  2X6J A;  5HCJ A;  3NOG D;  5CBO A;  2MOZ A;  2BTD A;  2BF0 X;  5ENP D;  1WY6 A;  4ZEY A;  4O4J E;  2XEV A;  4DV2 T;  4IE7 A;  1CHU A;  3SRZ A;  2CCQ A;  3HG0 D;  3HA4 A;  2IJG X;  2BS2 A;  4UQX A;  2JMH A;  1OUV A;  2A9U A;  4WYV A;  3UKR G;  3MA9 A;  3ONL C;  3JXJ A;  3LKU A;  3AAI A;  3O9X A;  4IDN A;  2LSG A;  1Y64 B;  4YHH T;  1FVF A;  3FDH A;  3MZL B;  4EZK A;  1OT8 A;  2RD0 A;  3ONK A;  4O8S A;  4GMJ A;  3G06 A;  1O1S A;  2WDR A;  2MOW A;  4ZI3 D;  4ME2 A;  2UXB T;  3K3O A;  1O5M A;  1QQE A;  4DV6 T;  1QYM A;  2KCL A;  3OJA A;  3UQ4 A;  5G04 C;  3JQ1 A;  1WRD A;  1N95 A;  4QHO A;  3VHL A;  5AQF B;  4GKK T;  2BS3 A;  1TJF A;  4U0U A;  1OED A;  4N78 D;  3K9I A;  4Z8X A;  1X5B A;  3NQP A;  3ZW3 A;  2W4X A;  3CX8 B;  2F37 A;  2H6G A;  4J0U A;  1N11 A;  4NXN T;  4EBA A;  3O4Z A;  4UUC A;  1Z6T A;  2H89 A;  1N4S A;  3ZT7 A;  3MJW A;  4X1K E;  4N3B A;  5AQB A;  2WXF A;  5EK3 A;  2IO3 C;  4YJ2 E;  3SFD A;  4GA1 A;  4XKB A;  4WAF A;  4XX5 A;  5G2N A;  3RRU A;  1S94 A;  4XZC A;  2GRL A;  3SWH A;  1FT2 A;  3I0O A;  1SHZ C;  3QWP A;  5KBA A;  3QAR A;  5G04 J;  2YNQ A;  2LSK A;  3KV9 A;  3Q7F A;  3PNT B;  2X9W A;  4U72 A;  2NYJ A;  2LRL A;  3B7R L;  4ZZB A;  1OED C;  2PTF A;  3PUV F;  3FHE A;  1YA0 A;  2X3M A;  2XGO A;  3GWH A;  4EEC A;  3UI2 A;  3UUM A;  1IZN B;  3RQU A;  2V6Y B;  2EQX A;  4U95 D;  1RW2 A;  2NSZ A;  2GRP B;  5EZY E;  3PS6 A;  5AQU B;  3TWU A;  2V8S E;  3FTV A;  4O2B E;  3NVO A;  1OWL A;  3X1D A;  3DPD A;  4AM9 A;  4JI3 T;  3C98 A;  1Z8U A;  3ZYL A;  3UT7 A;  3QB2 A;  4IDZ A;  2XAQ B;  4HOR A;  3S4U A;  2D0T A;  4IRU A;  3BK9 A;  4HFI A;  2FUL A;  4U04 A;  4DUZ T;  2WXH A;  2XQ6 A;  2XQA A;  4HFC A;  3ETU A;  3MCX A;  3U78 A;  2H7O A;  2BKK B;  1E8Z A;  1MQS A;  2KLQ A;  5JVD E;  3U66 A;  4QH5 A;  5JMN D;  3R7Q A;  3G2S A;  3B7T A;  3E4B A;  2J07 A;  2E0I A;  3AE4 A;  3HXF A;  3L13 A;  2A5U A;  3N2K E;  3IEE A;  5TAO A;  4U7I A;  4G63 A;  2FO1 E;  5L2L A;  4ILI A;  5KWD A;  3H37 A;  3WAK A;  2WMO A;  2J8S D;  5JRC B;  3DWL G;  3L16 A;  1EPU A;  4OFZ A;  1NI1 A;  2W61 A;  3KS2 A;  3Q5W A;  1HG5 A;  4HTE A;  3KFW X;  4WWP A;  2KSR A;  4G1T A;  4QFV A;  3CHQ A;  4Y6C A;  4EZ4 A;  4HRL A;  5J2T E;  4AP2 A;  2YK0 A;  1JCR A;  3EHN A;  3PRZ A;  2E2E A;  1ZB1 A;  4AQG A;  4WW0 A;  2E5V A;  4QWN B;  3AED A;  3RC3 A;  2AW6 A;  3CHM A;  4XZ4 A;  5CCM A;  2WXK A;  4C48 B;  3PU8 A;  3FTS A;  3GZ1 A;  4H9N C;  1IBL T;  2BG9 A;  1H2V C;  4O60 A;  2LSV A;  5D66 A;  4L23 A;  2ETB A;  2Y0B G;  5FQ8 A;  2KXP B;  3NKZ A;  3P2B A;  1TNU A;  4B94 A;  4QKN A;  4YVO A;  2QA7 A;  4ILG A;  3ZN0 B;  5CJ5 A;  3NBN B;  2M6B A;  4G2A A;  2HM8 A;  3ASH A;  2IHR 1;  2BBJ A;  2QRX A;  4JI7 T;  1HX8 A;  2L0T B;  3CVV A;  2V7J A;  1LVK A;  3L39 A;  4J2C A;  4ZS3 A;  3EUV A;  3HXD A;  5IUX A;  3QOU A;  4GTT A;  2L6B A;  1UN8 A;  5G05 C;  1PAQ A;  3DST A;  5AQG B;  1T7S A;  4B8A A;  5LYJ E;  1Z3Y A;  3W9F A;  3PJA A;  1OWM A;  3LDQ B;  2GRM A;  4GYR A;  4L7T A;  3VTX A;  2BG9 C;  3HKE E;  4FLB A;  2RP4 A;  3RK6 A;  3R84 B;  5AFU L;  2JEK A;  2UWJ G;  5KDM C;  2ZGG A;  4EQF A;  3V2X A;  2XPZ A;  3BEE A;  4HWC A;  4ILA A;  4BES A;  1IJ6 A;  5HEO A;  1Q2Z A;  3HVE B;  5HCM A;  1N33 T;  4GZC A;  4KI0 F;  4PK4 A;  4N5C A;  1D0X A;  3RAU A;  5FQ6 A;  2W63 A;  4DK5 A;  3KEZ A;  4B89 A;  2NP9 A;  1TNB A;  3TWW A;  3SOL A;  5HXC A;  2PBI A;  2DHR A;  3ZHE B;  3ZCI A;  2L9B A;  5HEJ A;  3J5Q B;  4QQI A;  5G05 J;  2BVM A;  2R6G F;  4P0B A;  3QK6 A;  2WXP A;  4PDX A;  3G2W A;  1KFY A;  2X68 A;  4BX9 A;  1H6O A;  5EK2 A;  3G2V A;  4X5T A;  5LGU B;  1MX2 A;  5ENT D;  3OXF A;  5HEU A;  3OXG A;  3DSS A;  1XZY A;  2Q9Q A;  5CED B;  1TEZ A;  3R9M A;  3TKL B;  2W62 A;  1N32 T;  4NUV A;  4GA2 A;  3UM2 A;  4GTR A;  5HI7 A;  2LNI A;  1NP7 A;  4I0U A;  5HRY A;  4ILB A;  1Y8M A;  4ADZ A;  2Q9Q D;  5LCY A;  1KF6 A;  4RLY A;  5JHA A;  2A3D A;  1KZO A;  4GTM A;  3B7B A;  4ANU A;  3ULQ A;  5AQO B;  3CVQ A;  3UIP C;  3KV6 A;  3EHR A;  5BPP A;  1MZC A;  3TWR A;  4Q96 A;  2VKH A;  3P4S A;  2ETC A;  3ZYM A;  3ISM C;  1DC2 A;  4GZ6 A;  4DR5 T;  4G26 A;  4QH1 A;  3E34 A;  3PJA J;  3CVU A;  2X38 A;  3LY8 A;  4ANX A;  4I6E A;  3AB3 B;  4UQZ A;  4APF A;  5CA1 E;  2MYO A;  3O4X E;  2Q9Q C;  1X9B A;  4BJN A;  2IF4 A;  3CIR A;  3MK7 C;  4GTS A;  4CN4 A;  3NAW A;  4ZZC A;  2LSY A;  2VVN A;  4OVU A;  5A6C A;  3IHV A;  5LJN A;  3EU9 A;  3CK6 A;  3UFG A;  1T98 A;  4G8L A;  2QYW A;  3KV5 A;  3N9M A;  5L3D B;  4HRM B;  1HNZ T;  1BR2 A;  5JDM A;  3CVR A;  3SS1 A;  1SUM B;  3RYF E;  4HI8 A;  3PTR B;  1MIV A;  2CXF A;  4OAV B;  2CBJ A;  4DX2 A;  3UFE A;  1E90 A;  3U3W A;  3WI3 A;  3JYS A;  1WR6 A;  1H6K A;  3ETV A;  4LER A;  3TXM A;  4EB6 E;  3BQO A;  2WZH A;  3E30 A;  3ZT6 A;  3MX3 A;  4EGW A;  1G3N B;  2Y6X A;  2BED A;  5HXR A;  5LGN B;  5LP6 E;  1OCR E;  3PUK A;  1UW4 B;  4LF9 T;  1KEY A;  1XDO A;  2IML A;  3LSV A;  4NPP A;  3ZMT B;  4D10 C;  1HX1 B;  4WZX A;  3L17 A;  4BX8 A;  3T1H T;  4WBN E;  3P7I A;  3RIU A;  1DCQ A;  4F3V A;  2F8X K;  4UWK A;  3ZYK A;  2XTL A;  2J09 A;  3EI0 A;  4FU3 A;  3QC1 A;  4NUR A;  2LE8 A;  4XBF B;  2AXV A;  3C3R A;  2VKJ A;  3AAA C;  1Z3X A;  2KT9 A;  3C51 A;  2P58 C;  2KIN B;  3ML9 A;  3SF4 A;  3RI5 A;  2E9X C;  4GML A;  3KIN B;  5ENR D;  3E08 A;  4GZ3 A;  2C0S A;  3AEG A;  1DCE A;  2JQ9 A;  3LJN A;  4MAL A;  3RKO A;  3MYV A;  2DL1 A;  4MS6 A;  2GRO B;  3A5X A;  3O1I A;  4TNW A;  4LF8 T;  3GN5 B;  2VWA A;  4I9C A;  5A23 A;  1YXR A;  1SW6 A;  2AXU A;  3JAD A;  4IT4 A;  5LHI B;  4GK5 E;  4DMW A;  4A98 A;  4JUY A;  3A7M A;  3FTZ A;  2K48 A;  4PFO A;  2KZT A;  5CB4 E;  1WDY A;  5FY0 A;  4M7C A;  3BG0 B;  2XM2 A;  2CFZ A;  5AQK B;  1XNF A;  4WWO A;  2XQ9 A;  4H63 V;  4FHK A;  3AA7 B;  5JR9 A;  5A1L A;  4JHJ A;  4E7S A;  4DLO A;  4DX1 A;  4FUL A;  3FZK B;  4HNA D;  4YDY A;  4UIG A;  3ZLI A;  4JC8 A;  1H2T C;  3H3M A;  5FXX A;  3AA1 B;  2ACX A;  2V1D B;  4CN6 A;  4KBQ A;  4CZ2 D;  2KMF A;  2J62 A;  4MBG A;  2P9L G;  1QBQ A;  5DBK A;  1ZEE A;  2X6I A;  2M63 A;  3V79 K;  2N1G A;  3FU3 A;  5LBM A;  3CV0 A;  5AQR B;  1NEK A;  4P0A A;  3TWX A;  3LK4 2;  4HGA A;  2KCV A;  4JD2 G;  2UY1 A;  3UX4 A;  2HN2 A;  1WYB A;  3FY4 A;  4GPK A;  4NAC A;  3T8M A;  2XEH A;  2J4B A;  4U2Y A;  3ASG A;  2K24 A;  2XEN A;  4FHJ A;  2Z6E A;  2DWK A;  5JR9 C;  2ACZ A;  5E75 A;  4FLH A;  5KNH D;  4GIW A;  3G2T A;  1UX5 A;  1G73 A;  4AKI A;  2P9P G;  3BU8 A;  4G24 A;  3N71 A;  2XUE A;  2AVP A;  1HNX T;  2C5K T;  3C4Z A;  3AG4 E;  4GMR A;  4BSX A;  2XQ4 A;  2OND A;  4I4T E;  2DVW A;  4B3R T;  2LAH A;  5D0O D;  4N3A A;  4N3C A;  3BQL A;  2AXD S;  4JHK A;  3ABL E;  4X1I E;  2VGX A;  2XRZ A;  3MXZ A;  2XZD G;  3CKC A;  3AE5 A;  4KMO A;  5BV1 A;  2XAS B;  3FWV A;  4JI6 T;  4X20 E;  1T8B A;  2LSU A;  2D2S A;  4HFV A;  2H3R A;  3PZ2 A;  4QXH B;  3PEU B;  1Z5S C;  2UUC T;  3D9I A;  4U8H A;  3ZNG A;  4GAA A;  4EEB A;  1Y01 A;  4IE5 A;  4J8D A;  3UUX B;  2RG8 A;  2XEE A;  3LBX B;  5LP0 A;  3LS8 A;  4C91 A;  4HS2 A;  4LUN U;  5KMG P;  4KUM B;  3AEB A;  4PJJ A;  3CEQ A;  4O4H E;  1S0P A;  3TG4 A;  4PS8 A;  5C1D A;  5AAO A;  2CFU A;  3ZEF B;  2LSJ A;  3DRA A;  4C90 A;  4CZZ B;  4LF5 T;  3LCA A;  1V55 E;  4WNG A;  5L4E A;  4PJL A;  3Q47 B;  1EYH A;  4IN3 B;  2CG3 A;  3SNX A;  3UKU G;  4HWF A;  3PUG A;  1I6Z A;  3FUM A;  4U8V D;  3CIA A;  4HOS A;  3AEA A;  2EIM E;  4AY5 A;  4OYS A;  5BUZ A;  4KXK B;  3D3M A;  3CVW A;  2UXN B;  4U33 A;  3AU4 A;  1HXI A;  4A3T A;  2R17 C;  1AJ3 A;  1XGW A;  2PL2 A;  4AIF A;  2NW7 A;  3NBX X;  3TWV A;  3FZL B;  2WXM A;  2FJE A;  4ANV A;  5LNK A;  3AA0 B;  4MKT A;  4F53 A;  5CGM A;  4LSZ E;  2QGS A;  5HWX A;  2VKO A;  3ML8 A;  2XS1 A;  4GB9 A;  5LOV E;  1OED E;  4G25 A;  3RC8 A;  4UF0 B;  4K5B A;  2LHN A;  2ZIR A;  1G8X A;  2PQR A;  4TUU A;  4O6F A;  3UTM A;  2WMN A;  4Q25 A;  3MKQ A;  3VTY A;  4JB8 P;  1E2A A;  2IC6 A;  3ZJ2 A;  3FU6 A;  1ELW A;  3KDS E;  4AIS A;  1OED B;  5JRE A;  4I2Z A;  4YDW A;  3RIB A;  2UXD T;  1M7K A;  1FMV A;  3P4P A;  3QNU A;  2XJ7 A;  4UVA B;  1N54 A;  2FF4 A;  5L4H A;  1IQR A;  1MMA A;  4H9R C;  4F8H A;  5C3J A;  2XZT G;  3DSV A;  2R02 A;  4C0E A;  2X0H A;  3RRW A;  5LBQ B;  5LMU T;  1BR4 A;  1PY1 A;  1W9R A;  4U31 A;  3FFL A;  2R05 A;  4I9E A;  3PE0 A;  4U0Z A;  2V26 A;  1TJC A;  2ZM2 A;  2B6C A;  5BXO A;  5DIZ A;  4YLH A;  4JL0 A;  2J47 A;  4G2V A;  5AQA A;  1WLX A;  2Y48 B;  1N34 T;  3Q9N C;  5JDH A;  4EPZ A;  4JI5 T;  3KAE A;  2JIW A;  2KAT A;  1WM5 A;  5FZR A;  2MTQ A;  1O1T A;  2F0Y A;  1K1B A;  5ABH A;  4DX5 D;  5CBN A;  1BU9 A;  3LEW A;  4GCO A;  4YTM A;  1U4Q A;  3DJB A;  2ZM8 A;  4TV9 E;  3N9P A;  3W15 B;  3RRM B;  4EZL A;  2BKN A;  2YIN A;  1KT0 A;  4RVB A;  5AQL B;  2D9D A;  3C98 B;  4BSZ B;  3PUA A;  1SA5 A;  3CQG B;  2KWI B;  1E7P A;  4NQ0 A;  3Q49 B;  2RFA A;  4L2L A;  4TXQ A;  2PFV A;  5JHB A;  2VSO E;  2XQ3 A;  4U7E B;  2JQH A;  2JRK A;  2XY8 B;  2M6I A;  4LML A;  1UK5 A;  5LMN T;  1IKN D;  1UN9 A;  2FEZ A;  4JW1 A;  5FNV E;  1MX4 A;  2UXX B;  2YHE A;  2BS4 A;  2X0L B;  4IDP A;  2LM2 A;  4CGW A;  3EAM A;  3OPC A;  3ZJ1 A;  5L3B B;  1NL4 A;  4PK6 A;  2CE7 A;  2LXM A;  1MYO A;  2JMK A;  4B93 B;  1ELR A;  3M65 A;  4HFB A;  4YTN A;  3AXJ B;  5C8Y E;  3ESK A;  4DR7 T;  2VQ2 A;  5KXJ A;  2XAG B;  3FEY A;  2LKG A;  2VUR A;  3SFX A;  4EIW A;  3UIN C;  4A1S A;  1IYG A;  2YDQ A;  4JZY A;  5HKP A;  4CEM A;  3ANW B;  3ULE G;  5L3F B;  4K03 A;  2YKS A;  2ZXW E;  1BPO A;  3LPZ A;  3MKR A;  3N9O A;  1WYC A;  5EKQ D;  2SPC A;  4LMJ A;  1MMD A;  2EIL E;  3TWT A;  4J6I A;  1VDY A;  2DIW A;  4PFP A;  3AG3 E;  3L54 A;  1N52 A;  3I4G A;  2BG9 E;  2VYI A;  3IEG A;  3PU3 A;  4U63 A;  1HR0 T;  1FPP A;  4ZI3 C;  3ZUV B;  4TWD A;  4N5Q A;  4TWF A;  2QZA A;  3D9H A;  3HXC A;  1INZ A;  3VRA A;  2LXL A;  3A8Y C;  3ZC1 A;  4ZFH A;  4LMK A;  5AJD A;  2C2L A;  4LFC T;  3LFM A;  4ZI7 E;  3VKH A;  4GYO A;  3UU8 A;  3EIQ C;  4NXM T;  3L8R A;  3ZSS A;  3AEF A;  2IO2 C;  3CR3 A;  2XSB A;  3FH8 A;  2AE9 A;  4AKR B;  1LD7 A;  3I3N A;  3AS5 A;  4X8Q A;  2IUB A;  3AVR A;  3WXX A;  4A63 B;  3GYZ A;  2QFC A;  3RF1 A;  1N4P A;  3NZP A;  3ZPJ A;  3AG1 E;  3SGH A;  2OVF A;  5AQ7 A;  4YXD A;  1L5J A;  3RSE G;  3Q7A A;  2DNX A;  2HPJ A;  4DID B;  3ZGQ A;  4EED A;  1E1H B;  2IY0 C;  5C2T A;  3B7S A;  1YQ3 A;  1WAO 1;  2JAB A;  2V5Q C;  3CWZ B;  2AXZ A;  5FY1 A;  2I59 A;  2JJ9 A;  3R7R A;  3B95 A;  2WP9 A;  5HAX A;  4HOU A;  4TX5 A;  2P9I G;  5EIL A;  4EOZ B;  4DR3 T;  1VRB A;  3JUE A;  4P1N A;  3VU7 H;  3ZFW A;  1N36 T;  5ABG A;  3QOF A;  5AQP B;  4DO0 A;  1FIO A;  3D9L A;  1A5E A;  2LRK A;  1T72 A;  3TAX A;  3FUJ A;  3C50 A;  5AQJ B;  3B5M A;  2MPK A;  2YN6 A;  1MMN A;  4GYS A;  3JXI A;  2LHR A;  4CXX A;  1HH8 A;  4F1P A;  2LOP A;  2NC9 A;  3FH7 A;  2XM1 A;  4WBO A;  3PE4 A;  3Q5M A;  2AWI A;  2LM9 A;  1WR0 A;  4ILH B;  2HN1 A;  2X66 A;  3MGB A;  5JDF A;  3HIZ A;  4R7L A;  3AS8 A;  4LFA T;  5E76 A;  1SA4 A;  3RKV A;  3HXB A;  5FJY A;  2J08 A;  3T8K A;  1U5P A;  5ABF B;  5ENN A;  2YHC A;  4HFH A;  1KNR A;  3VRB A;  2K3W A;  4GOU A;  1BLX B;  3FXE B;  4FI5 A;  1L0V A;  5FZS A;  5H7P A;  2WWU A;  4KHP T;  4BT9 A;  5FKY A;  5E0O A;  2BKP A;  3BQK A;  5CMY A;  2EHO B;  2V7M A;  1FJG T;  4U2Z A;  2JQK A;  2KZ7 B;  4GKJ T;  3H3A A;  1LTX A;  3APC A;  4FJY A;  2XRY A;  3N2O A;  2C5I T;  3CQC B;  5FXW A;  3UTK A;  2CA5 A;  3URZ A;  4CXW A;  3KVA A;  2E9X B;  1MHQ A;  3Q9U C;  4AKL A;  3ZN3 A;  2IAK A;  3FXD B;  5ENQ D;  4ASK A;  3EDV A;  4EZH A;  3SZ7 A;  2VJ8 A;  4WUY A;  2WCA A;  2WU5 A;  2V6Y A;  3FBL A;  3HL6 A;  3S2A A;  4CCA A;  5JDQ A;  3ASO E;  1OWP A;  1IBK T;  2P9B A;  1TN6 A;  4UVC B;  3UXG A;  2N9D A;  1N4Q A;  1K3Z D;  1ZU2 A;  4I55 E;  3KEA A;  2FJD A;  2X6H A;  1ZBP A;  4HWH A;  4JEU B;  3W9G A;  4F1S A;  3U9W A;  5H6R B;  4I1M A;  4EHM A;  5KJM A;  4K0R A;  5LHG B;  4H7X A;  5IWA T;  4CDN A;  3PRE A;  3LVQ E;  3UU3 A;  2WB5 A;  4LNU D;  3EDU A;  2UUA T;  3EDT B;  3J9X 1;  2P9U G;  3L6A A;  5C2Y A;  2JPF A;  4COF A;  2IOS A;  2Y4U A;  3GW4 A;  5DQV A;  1E7V A;  3G2U A;  3AE6 A;  2NW8 A;  3B57 A;  1E8W A;  2GRN B;  2DLR A;  4YND A;  3VR9 A;  5JRC A;  2LUH A;  2IDO B;  4ZXL A;  1BD8 A;  4BET A;  5AQM B;  2VSY A;  2MYS A;  4O1O A;  3IXE A;  2QC9 A;  1UUR A;  4XEI G;  2VB6 A;  4IRE A;  3TLW A;  4LF6 T;  5LG3 A;  4XI9 A;  3CVY A;  3K8P C;  3Q9D A;  4DV1 T;  4IDO A;  3O48 A;  2V4H C;  3PDY A;  3AJI A;  4O4L E;  1WFD A;  5CRV A;  2HHH T;  1NZN A;  4ZHQ E;  2VQE T;  1ZHC A;  1MND A;  2L3L A;  4ZHB A;  2YOE A;  3L9T A;  4KMC A;  5F3J A;  2RFM A;  2P2C P;  5FYM A;  4L2Y A;  5F8P A;  4BER A;  2DBA A;  4BTB A;  1O3X A;  2LT3 A;  4UXN B;  4TV3 A;  2WQ7 A;  5AJL A;  2ETA A;  3RX6 A;  2EIN E;  5HS0 A;  1D9S A;  2PM7 A;  2EIJ E;  1JWG A;  3LG7 A;  3PZ4 A;  4W9R A;  3DXK G;  3MEK A;  4I2W A;  2XQ0 A;  3AU5 A;  4YHJ A;  4I43 B;  3UM0 A;  3SD5 A;  3VLE A;  2PZI A;  3DEO A;  1VCS A;  1JNR A;  4U7Y A;  2H6I A;  4OHF A;  2Q7F A;  2IIU A;  3N9N A;  5HQ8 A;  5LGT B;  3Q5X A;  4JEH B;  1SZ9 A;  3OYZ A;  2GGF A;  3IF8 B;  4MFR A;  4RSY A;  5CEC B;  2X51 A;  4NUU A;  3FZM B;  2KND A;  4BT8 A;  3RKG A;  3CVX A;  5ENS D;  2BKO A;  4IHJ E;  1JWF A;  1SZA A;  4LF7 T;  2M67 A;  4X66 T;  1MIY A;  3L09 A;  2CRB A;  3E22 E;  4L1B A;  3UU4 A;  2OOE A;  3FP3 A;  3VLD A;  4XAX B;  4QXB B;  3MZK B;  2KXP C;  3FUN A;  4AKH A;  4B6X A;  1E8Y A;  3HVE A;  4DV5 T;  1IAP A;  5CMW A;  1UX4 A;  1HU3 A;  2H7V C;  3D9O A;  3S7J A;  2XCC A;  5D2M C;  3Q73 A;  2QY7 A;  4PS3 A;  3LDZ A;  4HI9 A;  2CG2 A;  5EX3 A;  1ZOY A;  2BVL A;  3OVU A;  4UR9 A;  2IQC A;  3UU5 A;  3DSU A;  3CPZ A;  3FTU A;  5CFB A;  4FJZ A;  4ZI2 D;  1OCC E;  5ANL A;  3BQI A;  3QWV A;  2FUP A;  4A97 A;  1HE8 A;  3RIU C;  4GZ5 A;  2IOL A;  3GA8 A;  5FTP A;  5JA4 D;  2C0M A;  4KZ0 A;  1SVX A;  4FP7 A;  5AIJ A;  5IHY A;  5AEN A;  1J5E T;  4AY6 A;  3JCK C;  3CX7 B;  5CRU A;  1NAF A;  4DLQ A;  1IBM T;  4QH4 A;  4EAH A;  3ZKR A;  1YD8 G;  4ERR A;  4YY3 T;  1X81 A;  4KX6 A;  5AQV B;  4Z68 A;  4GTV A;  5J0Z A;  1D1C A;  1VCT A;  4APO A;  4KBM B;  2VGE A;  4FC8 A;  3LY9 A;  2DWZ A;  3FU5 A;  2F8Y A;  3X2Q E;  4GK0 E;  5CEA A;  1M62 A;  1NWM X;  3NOC D;  4U07 A;  4XKC A;  2XCB A;  4DND A;  2XAF B;  4ANJ A;  2WU2 A;  2MHK A;  2I0M A;  4YJ3 E;  3RHW A;  3AVS A;  1KNZ A;  3DPY A;  3CST A;  4GYY A;  5BW8 C;  2CHX A;  3FHN A;  1X79 A;  3OAW A;  1KT1 A;  3ZIM A;  4V1A v;  1B89 A;  3D0T A;  4UV8 B;  5FXZ A;  4J8F A;  1FMW A;  3HDX A;  3C3O A;  3WAJ A;  2HYZ A;  5DJQ C;  3E0Z A;  4JI0 T;  5LG4 A;  3TGO A;  1B7T A;  4PH4 B;  4G23 A;  5AQH B;  5GON E;  2ODU A;  1UCU A;  2WB2 A;  3EHM A;  1YYH A;  4DI3 A;  2VTB B;  4DR2 T;  4AKG A;  3FUK A;  3PUQ A;  1QSD A;  3SI5 A;  3UQ7 A;  3F6Q A;  5B3S E;  4KYO B;  1HTJ F;  2WXI A;  3RJV A;  3IV0 A;  2NTY A;  2YQ8 A;  4HOT A;  3S7B A;  1OXZ A;  4P09 A;  1N4R A;  2E8I A;  2H6H A;  3Q15 A;  4H63 H;  2WBL A;  1TN8 A;  4TN7 B;  4F6R D;  2E5L T;  1J5W A;  1FT1 A;  3AG2 E;  4GYW A;  3Q78 A;  4TXR A;  4UWL A;  5BV0 A;  2MAW A;  5IYZ E;  3C72 A;  2KCK A;  1KPS B;  3T5V A;  4HFD A;  1UJJ A;  2W00 A;  1YQ4 A;  4EYY R;  3RO3 A;  1MX6 A;  4LNG A;  5EX0 A;  5CCL A;  1E8X A;  3VR8 A;  5FIN A;  2VQF T;  1MIW A;  3RIA A;  3GN5 A;  3TWS A;  2L9Q A;  1HFA A;  4F6R C;  1K1A A;  2BKG A;  4CYM D;  5JDL A;  3KSQ A;  2V5C A;  2UUB T;  2WXQ A;  2A2F X;  2W0G A;  4JI2 T;  3KV4 A;  4DR6 T;  3CKB A;  4ZS2 A;  4K0K T;  3LJC A;  4PJN A;  4OK0 A;  2V7I A;  5HXS A;  4L9I A;  4DBQ A;  3C64 A;  4X64 T;  3TWQ A;  3UT5 E;  4N2Q A;  3HR0 A;  5JH7 E;  1DU2 A;  5LA6 E;  1O1R A;  4JPS A;  4O1P A;  4DX7 D;  1OWO A;  2GW1 A;  4IL4 A;  3AA6 B;  2X67 A;  3OYX A;  4CI3 B;  1TNO A;  3ZRH A;  2CMR A;  4WNK A;  4L9P A;  3PV0 F;  4CN1 A;  4GTQ A;  1OWN A;  3I1A A;  2QVA A;  1HZ4 A;  4XIF A;  3ABV A;  5JQG E;  1P5Q A;  5LOZ A;  1D1B A;  3AE2 A;  5FXV A;  5EN5 D;  3EHZ A;  4JYA T;  5L3G B;  3Q75 A;  5AN8 A;  4U3C A;  2I2O A;  3CSF A;  1ZP0 A;  3AEE A;  3Q5E A;  4JV5 T;  4GCN A;  3MJX A;  4DVD A;  2A4Z A;  3HYM B;  3LXU X;  3JCF A;  1QZ2 A;  3T1Y T;  4U74 A;  2NOX A;  2QYU A;  2DZO A;  2R2L A;  3LYA A;  3ZMU B;  3PUZ F;  4OX9 T;  4AIU A;  2ION A;  3ZU7 B;  5JDG A;  4ILC A;  4JHR A;  3P4W A;  5L3E B;  4YSZ A;  3SO8 A;  3SHF A;  4DV0 T;  3BG1 B;  4CT0 A;  3I0Q A;  3ZCJ A;  2LAI A;  3SFZ A;  3UQ3 A;  3V5U A;  3APD A;  2V7K A;  2V5D A;  4EV6 A;  4ILU A;  3Q79 A;  3ASD A;  3U64 A;  1H2U A;  2DWG A;  3GZ2 A;  3N2G E;  3S7D A;  1UJK A;  2PJQ A;  5BT1 A;  2WPV A;  4YTP A;  1MMG A;  3PUJ A;  3D9N A;  2Y3A A;  4X65 T;  4JI1 T;  1NA3 A;  1ZV4 X;  1FCH A;  2I9C A;  4AQY T;  1VOM A;  3ABM E;  1QUU A;  5L47 A;  4BAY B;  4HBD A;  3QDN A;  2Y4T A;  2IFU A;  2WDQ A;  4PUC A;  3KSL A;  4JXT A;  3K3N A;  2DZN A;  3TJP A;  2JLB A;  4NRH B;  2CPT A;  1TN7 A;  1EZ3 A;  3NB2 A;  2IEJ A;  3PZ1 A;  1KLX A; 
#chains in the Genus database with same CATH homology
 3EVY A;  2K5B B;  4A3V A;  4CT4 A;  4J8E A;  3UUX A;  4F7A A;  3LBX A;  4AQF A;  2IC9 A;  3FTX A;  4BFR A;  2N2N A;  4DPR A;  3UUN A;  2LEH A;  3CVP A;  3ZEF A;  3R6N A;  5HXH A;  4I6G A;  2LSI A;  2WXG A;  4KVO A;  4P29 A;  2XAH B;  4URK A;  2XGM A;  3FUI A;  5D0Q D;  3ONX A;  2CLY C;  3ZXS A;  3L22 A;  4I6J A;  5BMV E;  2D5U A;  3DP7 A;  3L3P A;  4AQF C;  3FUD A;  2VSN A;  4HN9 A;  2FO7 A;  4UEM A;  3DTO A;  4HFG A;  4CGV A;  5FT9 A;  4WNE A;  1ZKE A;  1SQM A;  4HOQ A;  4CXY A;  1IQU A;  3SBS A;  2J9Q A;  4KP3 C;  4HLE A;  2KWH A;  3D9M A;  4UF0 A;  2V5F A;  1U3D A;  5FZQ A;  4ISS A;  3PUS A;  1YW0 A;  3D9J A;  3LK2 B;  4CI1 B;  4KT6 B;  3QUJ A;  2VKD A;  3T5X A;  2V7L A;  3C4W A;  3RYC E;  3P1U A;  3RO2 A;  2ODV A;  1OWA A;  3JQ0 A;  3D9K A;  4Y6W A;  2XHE A;  3IKO B;  2R59 A;  2XGS A;  5KJN A;  4CDM A;  4M3O A;  3RRC A;  3AAE B;  3ZN1 B;  3MV3 B;  5ARF A;  3P8C D;  3NZS A;  5FWQ A;  4ATG A;  4IIJ E;  2HR2 A;  2ZLY A;  3F2E A;  3TL5 A;  5EDS A;  4B8C B;  3FUF A;  2XAJ B;  4L0R A;  4O2A E;  4UEL A;  2J4D A;  4CI2 B;  2PG8 A;  3NRY A;  4H9P C;  3IHY A;  3F57 A;  1DVP A;  4PK5 A;  2WXO A;  1LVF A;  4M1P A;  3HI2 A;  3JC6 D;  2A72 A;  1PC2 A;  2BUG A;  3KBU A;  2Q9Q B;  4L5G A;  3CK9 A;  2BDE A;  2KM4 A;  4IUL A;  1CUN A;  2L8K A;  4MLK A;  4JVS A;  4CQI A;  4IYP A;  5LFA A;  1HCI A;  4GA0 A;  4I1O B;  3JC6 C;  1FVH A;  2VSX E;  2HH7 A;  3S7F A;  4EZJ A;  1UG3 A;  2I6H A;  4BY6 A;  3ANW A;  5M4Y A;  3ASF A;  4AI6 A;  3RYH E;  4WNF A;  1LRZ A;  4YFS A;  5DAB A;  3D9P A;  4LEU A;  3V5S A;  2WXL A;  5KJK A;  4TV8 E;  3RU0 A;  2KC7 A;  3CK8 A;  1KK7 A;  2VL8 A;  2ZM0 A;  3CHS A;  3O1J A;  3AAA B;  1EDU A;  5LJM A;  2WQH A;  1H19 A;  3B7U X;  2CEA A;  3HHM A;  5G55 A;  3I4R B;  5ETW A;  3N9L A;  3I9W A;  1HS7 A;  3OKQ A;  2V4L A;  4I50 E;  5FP3 A;  3KD7 A;  3CHO A;  3CLJ A;  5KJL A;  3PVL A;  3EIJ A;  2MBG A;  3MAC A;  5FQ7 A;  4GZD A;  5LCW C;  4H9Q C;  2IW5 B;  3OXL A;  3UMV A;  3ZMS B;  3LK3 B;  1V9D A;  2ZMA A;  3TXN A;  3MKD A;  1U3C A;  4UQY A;  3FUH A;  3N9Q A;  3CK7 A;  2X6F A;  4BJM A;  4UWF A;  3U3I A;  5FY7 A;  3CHP A;  1GW6 A;  3AS4 A;  1H0A A;  2CWO A;  3NZQ A;  4U0S A;  1MNE A;  5LCW J;  5HXE A;  3ZYQ A;  2PM6 A;  2KZT B;  3PUR A;  2LJL A;  1YKH B;  4PJM A;  4IGU A;  5ADX L;  5JR9 B;  5EK4 A;  2HO1 A;  3GZS A;  4IE4 A;  1ELK A;  4DBR A;  2J1D G;  4E7Z A;  3KVB A;  2X9Y A;  2XPI A;  3LVR E;  2WQ6 A;  1FEW A;  2X6K A;  4RG9 A;  1NA0 A;  3RYI E;  3F31 A;  1QNF A;  4UV9 B;  3CQX C;  4QXC B;  5KX5 E;  3J7Y q;  4IST A;  3JUI A;  3PZD A;  2Y8D A;  3EUH A;  4JA7 A;  2UY1 B;  2C0L A;  4PNI A;  5L3C B;  2CWY A;  3GMI A;  2DCP A;  3RRN B;  1HG2 A;  4AXP A;  3QK0 A;  3IHR A;  5A7D B;  3UT8 A;  3CGH A;  2DI4 A;  2EHO A;  4Q94 A;  4A56 A;  2FI7 A;  2CHZ A;  2MRI A;  1IJ5 A;  4AOF A;  2IU1 A;  2I1K A;  2EHO D;  3FTY A;  4RG6 A;  2X9H A;  2DCF A;  2XQY A;  5BNW A;  3PH0 C;  4KVM A;  2HPL A;  3FUE A;  4JLE A;  2VGX B;  4JA9 A;  5LHH B;  3K3Q C;  2E9X A;  2ES0 A;  3OBV E;  4E6H A;  1A17 A;  4EBA G;  3FUL A;  4AV7 A;  2PQN A;  2E9X D;  2YU2 A;  2EHO C;  3APF A;  4Q69 A;  4QX7 B;  3DBS A;  3C4X A;  3PDN A;  2WVI A;  4HEA A;  2LOS A;  4X1Y E;  4C9B B;  3ZHE A;  1E7U A;  3QWW A;  4BWR A;  3UT4 A;  3VLF A;  4JEU A;  5DQW A;  3FBZ A;  3CVN A;  4DMV A;  2GK9 A;  4H9O C;  5T3R A;  3FEX A;  2WXN A;  3NF1 A;  4MRU A;  5H6Q B;  2JQQ A;  2L0I A;  2J49 A;  2VGY A;  4FA6 A;  1YKE B;  4TRQ A;  2G0U A;  4UVB B;  1HO8 A;  1BR1 A;  3MV2 B;  4N2S A;  1S35 A;  4ZI2 C;  2WM9 A;  4IE6 A;  3RH3 A;  4AEZ C;  4PAG A;  4V3I A;  3UPV A;  2D0U A;  4UWG A;  4TUY E;  4IE0 A;  2NW9 A;  4ACK A;  5J90 A;  3SBT B;  3FB2 A;  5LX8 A;  3LJ3 A;  2XPY A;  3QNK A;  4H7Y A;  2OV8 A;  2K9A A;  5JJ7 A;  2VK9 A;  3QC9 A;  4EYU A;  5FQ4 A;  1D0Y A;  3MKQ B;  1W3B A;  4MBQ A;  3PE3 A;  4YVQ C;  5J08 A;  2LO6 A;  4CRW A;  4DJA A;  3ZVV A;  3ZMV B;  4MHC A;  2R5S A;  3N5L A;  4H9S E;  3RPU A;  1E96 B;  5KCM A;  1US7 B;  4BTA A;  4ZOL E;  5AYW D;  2ILR A;  3CML A;  1H7C A;  4I43 A;  3CKD A;  3TG5 A;  4AXH A;  3NRX A;  3FH5 A;  3CX6 B;  3NZU A;  2NTX A;  5HWY A;  2OA5 A;  2B1E A;  4QX8 B;  4JEH A;  4ANW A;  4HE8 A;  4K0U A;  2CM0 A;  4MLP A;  3T8O A;  2I1J A;  1SA0 E;  3R9A B;  4OYK A;  3ZMZ B;  3QKY A;  2BZB A;  3ZC0 A;  3PNL B;  5T8I A;  4PW8 A;  4OYJ A;  4FJO A;  4WND A;  4ACL A;  2CLY B;  5J2U E;  2C5J A;  2V0P A;  4N39 A;  4HKA A;  4I1A A;  5J1G A;  4B0Z A;  1LKX A;  4ABN A;  3EJN A;  1D1A A;  2L6J A;  4O4I E;  2WSS V;  4E85 A;  2FBN A;  1JPL A;  4UWH A;  3HKD E;  4A1G A;  4I17 A;  3FTW A;  3B13 A;  4AJW A;  4CDR A;  1Z0P A;  4EXT A;  4C0M A;  4HVB A;  4UI9 C;  1BR0 A;  4XE0 A;  3L08 A;  2VAS A;  3UUL A;  5ARG A;  1HF8 A;  5HYA A;  1HS6 A;  1D0Z A;  4TZ4 C;  4LRZ A;  3OTN A;  2YU1 A;  4G11 A;  4WWN A;  1LF8 A;  2YEV C;  2CHW A;  4GU5 A;  1EF1 C;  4XI0 A;  4UI9 K;  4OVV A;  3O1H A;  3Q2M A;  3Q4A B;  2CXL A;  2X9X A;  4UI9 J;  1DNP A;  2WXR A;  3I9Y A;  5LXT E;  2WAU A;  3ZPO A;  3ENE A;  3QJZ A;  5CHE E;  2NWB A;  2WXJ A;  4FAD A;  5FMN A;  1IHG A;  3VKG A;  5JJ6 A;  5CA0 E;  4LCT A;  4AVX A;  2NXP A;  3HKC E;  2XHE B;  4DI4 A;  2VTB A;  3QAQ A;  2OVB A;  4PS7 A;  3IBE A;  2ZU6 B;  3CHR A;  4BA9 A;  1JUQ A;  3MA5 A;  3PEV B;  1Y6I A;  2CXD A;  3KBT A;  5M72 A;  3HKB E;  5JDN A;  3I5P A;  3LY7 A;  5JJT A;  2RA1 A;  4J8S A;  3IBP A;  4A55 A;  3ONL A;  3FU0 A;  5ANR A;  4HXI A;  3U4T A;  3CVL A;  4KZC A;  3ESL A;  5T4Y A;  2X6J A;  2MOZ A;  2BTD A;  2BF0 X;  1WY6 A;  4O4J E;  2XEV A;  4IE7 A;  3SRZ A;  2CCQ A;  3HA4 A;  2IJG X;  4UQX A;  2JMH A;  1OUV A;  3MA9 A;  3LKU A;  3AAI A;  3O9X A;  2LSG A;  1Y64 B;  3MZL B;  1FVF A;  3FDH A;  4EZK A;  2RD0 A;  3ONK A;  4O8S A;  4GMJ A;  2MOW A;  4ZI3 D;  4ME2 A;  3K3O A;  1QQE A;  2KCL A;  3OJA A;  5G04 C;  3JQ1 A;  1WRD A;  4QHO A;  3VHL A;  1TJF A;  4U0U A;  4N78 D;  3K9I A;  4Z8X A;  1X5B A;  3NQP A;  3ZW3 A;  3CX8 B;  4J0U A;  4EBA A;  3O4Z A;  1Z6T A;  3MJW A;  4X1K E;  4N3B A;  2WXF A;  5EK3 A;  4YJ2 E;  4WAF A;  4GA1 A;  4XKB A;  4XX5 A;  5G2N A;  3RRU A;  1S94 A;  4XZC A;  2GRL A;  3SWH A;  3I0O A;  1SHZ C;  3QWP A;  3QAR A;  5G04 J;  2YNQ A;  2LSK A;  3KV9 A;  3PNT B;  2X9W A;  4U72 A;  3B7R L;  3FHE A;  1YA0 A;  2X3M A;  2XGO A;  3GWH A;  4EEC A;  3UUM A;  1IZN B;  2EQX A;  2NSZ A;  5EZY E;  3PS6 A;  2V8S E;  3FTV A;  4O2B E;  1OWL A;  3DPD A;  4AM9 A;  3C98 A;  3ZYL A;  3UT7 A;  3QB2 A;  4IDZ A;  2XAQ B;  4HOR A;  3S4U A;  2D0T A;  4IRU A;  3BK9 A;  2FUL A;  4U04 A;  2WXH A;  3ETU A;  3MCX A;  3U78 A;  2H7O A;  1E8Z A;  1MQS A;  2KLQ A;  5JVD E;  3U66 A;  3R7Q A;  3G2S A;  3B7T A;  3E4B A;  2J07 A;  2E0I A;  3L13 A;  2A5U A;  3N2K E;  3IEE A;  5TAO A;  4G63 A;  5L2L A;  4ILI A;  3H37 A;  3WAK A;  2WMO A;  5JRC B;  3L16 A;  1EPU A;  4OFZ A;  2W61 A;  3KS2 A;  3Q5W A;  1HG5 A;  4HTE A;  3KFW X;  4WWP A;  4G1T A;  4QFV A;  3CHQ A;  4Y6C A;  4EZ4 A;  5J2T E;  4AP2 A;  2YK0 A;  3EHN A;  3PRZ A;  2E2E A;  4AQG A;  4WW0 A;  4QWN B;  3RC3 A;  2AW6 A;  3CHM A;  4XZ4 A;  5CCM A;  2WXK A;  3PU8 A;  3FTS A;  3GZ1 A;  4H9N C;  1H2V C;  2LSV A;  4L23 A;  5FQ8 A;  2KXP B;  3P2B A;  4B94 A;  4QKN A;  4YVO A;  2QA7 A;  4ILG A;  3ZN0 B;  4G2A A;  2HM8 A;  3ASH A;  1HX8 A;  2L0T B;  3CVV A;  2V7J A;  1LVK A;  4ZS3 A;  4J2C A;  3QOU A;  1UN8 A;  5G05 C;  1PAQ A;  4B8A A;  5LYJ E;  1Z3Y A;  1OWM A;  2GRM A;  4GYR A;  4L7T A;  3VTX A;  3HKE E;  4FLB A;  2RP4 A;  3RK6 A;  3R84 B;  5AFU L;  2JEK A;  2UWJ G;  5KDM C;  4EQF A;  2XPZ A;  3BEE A;  1IJ6 A;  3HVE B;  4GZC A;  4N5C A;  4PK4 A;  1D0X A;  4DK5 A;  5FQ6 A;  2W63 A;  3KEZ A;  4B89 A;  2NP9 A;  3SOL A;  5HXC A;  2PBI A;  2DHR A;  3ZHE B;  3ZCI A;  2L9B A;  5G05 J;  2BVM A;  4P0B A;  3QK6 A;  2WXP A;  4PDX A;  3G2W A;  2X68 A;  4BX9 A;  5EK2 A;  3G2V A;  5LGU B;  3OXF A;  3OXG A;  2Q9Q A;  1TEZ A;  3TKL B;  2W62 A;  4NUV A;  4GA2 A;  5HI7 A;  2LNI A;  1NP7 A;  1Y8M A;  4ADZ A;  2Q9Q D;  5LCY A;  5JHA A;  2A3D A;  4ANU A;  3ULQ A;  3CVQ A;  3KV6 A;  5BPP A;  4Q96 A;  2VKH A;  3ZYM A;  4GZ6 A;  4G26 A;  3CVU A;  2X38 A;  3LY8 A;  4ANX A;  4I6E A;  3AB3 B;  4UQZ A;  4APF A;  5CA1 E;  3O4X E;  2Q9Q C;  4BJN A;  2IF4 A;  3MK7 C;  2LSY A;  4OVU A;  5A6C A;  3IHV A;  5LJN A;  1T98 A;  3KV5 A;  3N9M A;  5L3D B;  1BR2 A;  5JDM A;  3CVR A;  3SS1 A;  3RYF E;  3PTR B;  1MIV A;  2CXF A;  3UFE A;  1E90 A;  3U3W A;  3JYS A;  3WI3 A;  1WR6 A;  1H6K A;  3ETV A;  4LER A;  3TXM A;  4EB6 E;  3MX3 A;  2Y6X A;  5HXR A;  5LGN B;  5LP6 E;  3PUK A;  1UW4 B;  3ZMT B;  4D10 C;  3L17 A;  4BX8 A;  4WBN E;  3P7I A;  4F3V A;  4UWK A;  3ZYK A;  2XTL A;  2J09 A;  4FU3 A;  3QC1 A;  4NUR A;  2LE8 A;  4XBF B;  2AXV A;  2VKJ A;  1Z3X A;  2KT9 A;  3C51 A;  2P58 C;  2KIN B;  3ML9 A;  3SF4 A;  2E9X C;  4GML A;  3KIN B;  3E08 A;  4GZ3 A;  2C0S A;  4MAL A;  3RKO A;  3MYV A;  4MS6 A;  3A5X A;  3O1I A;  3GN5 B;  2VWA A;  4I9C A;  5A23 A;  2AXU A;  5LHI B;  4GK5 E;  4DMW A;  4JUY A;  3FTZ A;  2K48 A;  4PFO A;  2KZT A;  5CB4 E;  5FY0 A;  3BG0 B;  2CFZ A;  1XNF A;  4WWO A;  4H63 V;  4FHK A;  3AA7 B;  5JR9 A;  5A1L A;  4JHJ A;  4E7S A;  4DLO A;  4FUL A;  4UIG A;  3ZLI A;  4JC8 A;  1H2T C;  5FXX A;  3AA1 B;  2ACX A;  2V1D B;  4KBQ A;  2KMF A;  5DBK A;  1ZEE A;  2X6I A;  2M63 A;  2N1G A;  3FU3 A;  5LBM A;  3CV0 A;  4P0A A;  3LK4 2;  4HGA A;  2KCV A;  3UX4 A;  2UY1 A;  1WYB A;  3FY4 A;  4GPK A;  4NAC A;  3T8M A;  2J4B A;  3ASG A;  2K24 A;  4FHJ A;  2Z6E A;  2DWK A;  5JR9 C;  5E75 A;  4FLH A;  4GIW A;  3G2T A;  1UX5 A;  1G73 A;  4AKI A;  4G24 A;  3N71 A;  2XUE A;  2AVP A;  2C5K T;  3C4Z A;  4BSX A;  2OND A;  5D0O D;  4I4T E;  2LAH A;  4N3A A;  4N3C A;  3BQL A;  4JHK A;  4X1I E;  2VGX A;  2XRZ A;  3MXZ A;  3CKC A;  4KMO A;  5BV1 A;  2XAS B;  3FWV A;  4X20 E;  2LSU A;  2D2S A;  4HFV A;  2H3R A;  4QXH B;  3PEU B;  3D9I A;  4U8H A;  4GAA A;  4IE5 A;  4J8D A;  3UUX B;  2RG8 A;  3LBX B;  5LP0 A;  3LS8 A;  4C91 A;  4HS2 A;  4LUN U;  4KUM B;  5KMG P;  4PJJ A;  3CEQ A;  4O4H E;  1S0P A;  3TG4 A;  4PS8 A;  5C1D A;  2CFU A;  3ZEF B;  2LSJ A;  3LCA A;  4C90 A;  4CZZ B;  4WNG A;  4PJL A;  3Q47 B;  1EYH A;  4IN3 B;  2CG3 A;  3SNX A;  3PUG A;  3FUM A;  4HOS A;  3CIA A;  4AY5 A;  4OYS A;  5BUZ A;  4KXK B;  3D3M A;  3CVW A;  2UXN B;  3AU4 A;  1HXI A;  4A3T A;  2R17 C;  1AJ3 A;  1XGW A;  2PL2 A;  4AIF A;  2NW7 A;  3NBX X;  2WXM A;  4ANV A;  5LNK A;  3AA0 B;  4MKT A;  4F53 A;  2QGS A;  5HWX A;  2VKO A;  3ML8 A;  4GB9 A;  5LOV E;  4G25 A;  3RC8 A;  4UF0 B;  2LHN A;  1G8X A;  2PQR A;  4TUU A;  4O6F A;  2WMN A;  3MKQ A;  3VTY A;  2IC6 A;  3ZJ2 A;  3FU6 A;  1ELW A;  3KDS E;  5JRE A;  4I2Z A;  3RIB A;  1FMV A;  4UVA B;  1N54 A;  2FF4 A;  1IQR A;  1MMA A;  4H9R C;  4C0E A;  3RRW A;  5LBQ B;  1BR4 A;  1PY1 A;  3FFL A;  4I9E A;  3PE0 A;  4U0Z A;  2V26 A;  1TJC A;  2ZM2 A;  5DIZ A;  4YLH A;  4JL0 A;  4G2V A;  1WLX A;  2Y48 B;  5JDH A;  4EPZ A;  3KAE A;  2KAT A;  1WM5 A;  5FZR A;  2MTQ A;  3LEW A;  4GCO A;  1U4Q A;  3DJB A;  2ZM8 A;  4TV9 E;  3N9P A;  3W15 B;  3RRM B;  4EZL A;  2YIN A;  1KT0 A;  4RVB A;  3C98 B;  3PUA A;  3CQG B;  2KWI B;  4NQ0 A;  3Q49 B;  4L2L A;  5JHB A;  2PFV A;  2VSO E;  2JRK A;  2FEZ A;  1UN9 A;  4JW1 A;  5FNV E;  2YHE A;  2UXX B;  2X0L B;  4CGW A;  3ZJ1 A;  5L3B B;  4PK6 A;  2CE7 A;  2JMK A;  1ELR A;  3M65 A;  5C8Y E;  3ESK A;  2VQ2 A;  2XAG B;  3FEY A;  4EIW A;  4A1S A;  1IYG A;  4JZY A;  4CEM A;  3ANW B;  5L3F B;  4K03 A;  3LPZ A;  1BPO A;  3MKR A;  1WYC A;  3N9O A;  5EKQ D;  2SPC A;  1MMD A;  4J6I A;  1VDY A;  2DIW A;  4PFP A;  3L54 A;  1N52 A;  3I4G A;  2VYI A;  3IEG A;  4U63 A;  3PU3 A;  4ZI3 C;  1INZ A;  3ZC1 A;  5AJD A;  2C2L A;  3LFM A;  4ZI7 E;  3VKH A;  4GYO A;  3EIQ C;  3CR3 A;  3FH8 A;  4AKR B;  3I3N A;  3AS5 A;  3WXX A;  3AVR A;  3GYZ A;  2QFC A;  3NZP A;  3ZPJ A;  3SGH A;  2OVF A;  1L5J A;  2DNX A;  2HPJ A;  3ZGQ A;  1E1H B;  3B7S A;  1WAO 1;  3CWZ B;  2AXZ A;  5FY1 A;  2I59 A;  2JJ9 A;  3R7R A;  5HAX A;  4HOU A;  4TX5 A;  4EOZ B;  1VRB A;  3VU7 H;  3ZFW A;  4DO0 A;  1FIO A;  3D9L A;  3TAX A;  3FUJ A;  3C50 A;  1MMN A;  4GYS A;  2LHR A;  4CXX A;  1HH8 A;  2LOP A;  2NC9 A;  3FH7 A;  4WBO A;  3PE4 A;  3Q5M A;  2AWI A;  2LM9 A;  4ILH B;  2X66 A;  3MGB A;  5JDF A;  3HIZ A;  4R7L A;  3AS8 A;  5E76 A;  3RKV A;  5FJY A;  2J08 A;  1U5P A;  5ENN A;  2YHC A;  4GOU A;  3FXE B;  4FI5 A;  5FZS A;  2WWU A;  4BT9 A;  5E0O A;  3BQK A;  5CMY A;  2EHO B;  2V7M A;  2KZ7 B;  3H3A A;  3APC A;  4FJY A;  2XRY A;  3N2O A;  2C5I T;  3CQC B;  5FXW A;  3UTK A;  2CA5 A;  3URZ A;  4CXW A;  3KVA A;  2E9X B;  1MHQ A;  4AKL A;  3ZN3 A;  2IAK A;  3FXD B;  4ASK A;  3EDV A;  4EZH A;  3SZ7 A;  2VJ8 A;  4WUY A;  3FBL A;  3HL6 A;  3S2A A;  4CCA A;  5JDQ A;  1OWP A;  2P9B A;  4UVC B;  2N9D A;  1ZU2 A;  4I55 E;  2X6H A;  1ZBP A;  4JEU B;  4F1S A;  3U9W A;  5H6R B;  4I1M A;  5KJM A;  4K0R A;  5LHG B;  4H7X A;  4CDN A;  3PRE A;  3LVQ E;  3EDU A;  3EDT B;  3J9X 1;  3L6A A;  5C2Y A;  2JPF A;  2IOS A;  2Y4U A;  3GW4 A;  5DQV A;  1E7V A;  3G2U A;  2NW8 A;  3B57 A;  1E8W A;  2DLR A;  4YND A;  5JRC A;  2VSY A;  2MYS A;  2VB6 A;  4XI9 A;  3CVY A;  3K8P C;  3Q9D A;  3O48 A;  3PDY A;  4O4L E;  1NZN A;  4ZHQ E;  1ZHC A;  1MND A;  2L3L A;  4KMC A;  5F3J A;  4L2Y A;  5FYM A;  5F8P A;  2DBA A;  4BTB A;  1O3X A;  2LT3 A;  4UXN B;  4TV3 A;  2WQ7 A;  5AJL A;  3RX6 A;  2PM7 A;  1JWG A;  3LG7 A;  4W9R A;  3MEK A;  4I2W A;  2XQ0 A;  3AU5 A;  4YHJ A;  4I43 B;  3SD5 A;  3VLE A;  2PZI A;  4OHF A;  2Q7F A;  3N9N A;  5HQ8 A;  5LGT B;  3Q5X A;  4JEH B;  1SZ9 A;  3OYZ A;  2GGF A;  3IF8 B;  4MFR A;  4RSY A;  2X51 A;  4NUU A;  2KND A;  4BT8 A;  3CVX A;  4IHJ E;  1JWF A;  1SZA A;  2M67 A;  1MIY A;  3L09 A;  3E22 E;  4L1B A;  2OOE A;  3FP3 A;  3VLD A;  4XAX B;  4QXB B;  3MZK B;  3FUN A;  4AKH A;  4B6X A;  1E8Y A;  3HVE A;  1IAP A;  5CMW A;  1UX4 A;  1HU3 A;  2H7V C;  3D9O A;  3S7J A;  2XCC A;  2QY7 A;  4PS3 A;  3LDZ A;  2CG2 A;  5EX3 A;  2BVL A;  2IQC A;  3CPZ A;  3FTU A;  4FJZ A;  5ANL A;  4ZI2 D;  3BQI A;  3QWV A;  1HE8 A;  4GZ5 A;  2IOL A;  3GA8 A;  5FTP A;  2C0M A;  4KZ0 A;  4FP7 A;  5AIJ A;  5IHY A;  5AEN A;  4AY6 A;  3JCK C;  3CX7 B;  1NAF A;  4DLQ A;  4EAH A;  1YD8 G;  4ERR A;  1D1C A;  4APO A;  4KBM B;  4FC8 A;  3LY9 A;  3FU5 A;  4GK0 E;  1NWM X;  4U07 A;  4XKC A;  2XCB A;  4DND A;  2XAF B;  4ANJ A;  2MHK A;  4YJ3 E;  3AVS A;  1KNZ A;  3CST A;  4GYY A;  5BW8 C;  2CHX A;  3FHN A;  1X79 A;  3OAW A;  1KT1 A;  3ZIM A;  4V1A v;  1B89 A;  3D0T A;  4UV8 B;  5FXZ A;  4J8F A;  1FMW A;  3HDX A;  3WAJ A;  2HYZ A;  5DJQ C;  3E0Z A;  3TGO A;  5LG4 A;  1B7T A;  4PH4 B;  4G23 A;  5GON E;  2ODU A;  1UCU A;  2WB2 A;  3EHM A;  4DI3 A;  2VTB B;  4AKG A;  3FUK A;  3PUQ A;  1QSD A;  3SI5 A;  4KYO B;  1HTJ F;  2WXI A;  3RJV A;  3IV0 A;  2NTY A;  2YQ8 A;  4HOT A;  3S7B A;  1OXZ A;  4P09 A;  2E8I A;  3Q15 A;  4H63 H;  2WBL A;  4TN7 B;  4GYW A;  4UWL A;  5BV0 A;  5IYZ E;  2KCK A;  3T5V A;  1UJJ A;  2W00 A;  4EYY R;  3RO3 A;  5EX0 A;  5CCL A;  1E8X A;  1MIW A;  3GN5 A;  2L9Q A;  1HFA A;  4F6R C;  5JDL A;  2WXQ A;  2A2F X;  2W0G A;  3KV4 A;  3CKB A;  4ZS2 A;  3LJC A;  4PJN A;  4OK0 A;  2V7I A;  5HXS A;  4L9I A;  4DBQ A;  3C64 A;  3UT5 E;  4N2Q A;  3HR0 A;  5JH7 E;  4JPS A;  5LA6 E;  1OWO A;  2GW1 A;  3AA6 B;  2X67 A;  3OYX A;  4CI3 B;  3ZRH A;  2CMR A;  4WNK A;  1OWN A;  3I1A A;  1HZ4 A;  4XIF A;  5JQG E;  1P5Q A;  5LOZ A;  1D1B A;  5FXV A;  5L3G B;  2I2O A;  3CSF A;  4GCN A;  3MJX A;  4DVD A;  2A4Z A;  3HYM B;  3LXU X;  1QZ2 A;  4U74 A;  2NOX A;  3LYA A;  3ZMU B;  2ION A;  5JDG A;  4JHR A;  5L3E B;  3SHF A;  3BG1 B;  4CT0 A;  3I0Q A;  3ZCJ A;  2LAI A;  3SFZ A;  3UQ3 A;  3V5U A;  3APD A;  2V7K A;  4ILU A;  3ASD A;  3U64 A;  1H2U A;  2DWG A;  3GZ2 A;  3N2G E;  3S7D A;  1UJK A;  2PJQ A;  5BT1 A;  2WPV A;  1MMG A;  3PUJ A;  3D9N A;  2Y3A A;  1NA3 A;  1ZV4 X;  1FCH A;  2I9C A;  1VOM A;  1QUU A;  4BAY B;  3QDN A;  2Y4T A;  2IFU A;  4PUC A;  4JXT A;  3K3N A;  3TJP A;  2JLB A;  4NRH B;  1EZ3 A;  1KLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...