2WMNA

Structure of the complex between dock9 and cdc42-gdp.
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
423
structure length
403
Chain Sequence
STPELRKTWLDSMARIHVKNGDLSEAAMCYVHVTALVAEYLTRKGVFRQGCTAFRVITPNIDEEAHFNEDVLMELLEQCADGLWKAERYELIADIYKLIIPIYEKRRDFERLAHLYDTLHRAYSKVTEVMHSGRRLLGTYFRVAFFGQGFFEDEDGKEYIYKEPKLTPLSEISQRLLKLYSDKFGSENVKMIQDSGKVNPKDLDSKYAYIQVTHVIPFFDEKELQERKTEFERSHNIRRFMFEMPFTQRQGGVEEQCKRRTILTAIHCFPYVKKRIPVMYQHHTDLNPIEVAIDEMSKKVAELRQLCSSAEVDMIKLQLKLQGSVSVQVNAGPLAYARAFLDDPDNKVKLLKEVFRQFVEACGQALAVNERLIKEDQLEYQEEMKANYREMAKELSEIMHEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords DEDICATOR OF CYTOKINESIS PROTEIN 9
publication title Activation of Rho Gtpases by Dock Exchange Factors is Mediated by a Nucleotide Sensor.
pubmed doi rcsb
source organism Homo sapiens
total genus 152
structure length 403
sequence length 423
ec nomenclature
pdb deposition date 2009-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2wmnA03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2wmnA01
2WM9A 2WMOA 3B13A 2WMNA 3VHLA 2YINA
chains in the Genus database with same CATH superfamily
3DP7A 5B1BE 5HEOA 3I5PA 2J47A 2AE9A 2WXIA 2WXQA 4N2QA 3N2KE 4N3AA 4MBGA 1H19A 3HVEA 2KWHA 1XDPA 1K1AA 4UWKA 3DTOA 5LHHB 3VLDA 1D1CA 1PAQA 5B1AE 2D0UA 3O4XE 2EILE 2A2FX 4HS2A 2MOZA 2F8YA 4FJOA 3L16A 2Q9QC 3PUGA 3FY4A 3CK9A 3FBLA 3LK2B 4GA0A 3ABVA 3Q4AB 4G1TA 4OX9T 5CEAA 2MHKA 4DMWA 4J6IA 1AWCB 3IXEA 2RFMA 2B1EA 4TZ4C 5C2TA 3ZMVB 2OCCE 2VWAA 4L0RA 4XAXB 4AKGA 5FYMA 2VJ8A 3Q15A 1U3DA 3AXJB 2X9YA 5L2LA 1O1RA 2BTDA 4IE0A 4NRHB 3Q9DA 3ISMC 3HL6A 4CI2B 1S63A 4JI6T 3QWWA 3RQUA 3V31A 1E7PA 2XEEA 2XPZA 1YKHB 3QB2A 3FUJA 4FHKA 4GTPA 4G8KA 1UJJA 4X66T 4AKLA 2H6IA 3PUSA 4DV7T 2XS8A 5AJLA 5KWDA 5BT1A 2BVMA 4KYOB 4QKNA 3LVQE 3J9X1 4GTMA 4PJJA 5KDMC 3OTNA 1KLXA 1OCZE 3UFGA 4LF5T 4AY6A 4OVVA 2JJ9A 5HXHA 2WQYA 5JDNA 1KT0A 3PJAA 3KVAA 4JZYA 5HAXA 4HRNA 3CK8A 4ILUA 5JJTA 1UX4A 2P9KG 3MKRA 5JR9A 3SGHA 4I43A 4B8CB 4JB8P 3HHMA 3CX7B 4DR7T 3A8YC 3Q7AA 4GZ6A 3TWWA 3TWQA 4IDZA 4AM9A 1I94T 3RIUA 3NRXA 2OA5A 2OEWA 4CN6A 4K0RA 2BBHA 3ZMUB 4GMLA 1N36T 1E7UA 2VQ2A 1TEZA 4TWHA 2NW8A 4F7AA 4ANWA 3X2QE 4QWNB 3AAIA 3FZLB 3KINB 3KAEA 4LFAT 4OAUC 4OYKA 1IBLT 2WMOA 4HXIA 2K48A 2KLQA 2DIWA 3AE6A 5EX3A 3C64A 1GQEA 3PU3A 2IOSA 3DSSA 3O4ZA 2Q9QB 2XGMA 5HEUA 4G25A 2QFCA 3Q2MA 5BW8C 4QH5A 5LJNA 2CFZA 3TJPA 3LK42 4LFCT 3EDTB 5LBQB 4B3RT 4EZKA 3LG7A 4MFRA 3FBZA 1HFAA 3JCFA 3MKDA 2J49A 4GTQA 1DNPA 4K0UA 2VTBB 2L0IA 4LMLA 2M6IA 4EYYR 3IBEA 3DSVA 4IDPA 1N0RA 1HU3A 2DCPA 2RD0A 2CWOA 3AXJA 1HNZT 3EABA 3FZMB 5HWYA 3CVUA 2XZDG 3RYFE 4I9CA 5LCWC 2CHXA 4U2ZA 2V0PA 4AVXA 4HRLA 2DCFA 4A63B 3UINC 3JQ0A 4BX9A 2UUAT 3PZ1A 2YQ8A 3CVXA 3PRZA 4TRQA 2KCLA 2WXFA 4U8VD 4RQIA 2XQAA 4XKBA 3HR0A 1H2UA 1MIYA 4TUYE 4RG6A 3AS5A 1OT8A 2BDEA 2VURA 2V5FA 2W2UA 4HFVA 2PG8A 3E33A 3G2UA 2VVSA 5EIBE 4QQIA 2VSYA 2J07A 3FH7A 5EK3A 5L3CB 1XGWA 1S0PA 3FZFB 3ZXSA 2J4GA 3ETVA 1FJGT 2A3DA 2IW5B 1ZU2A 4JLEA 5HXSA 3D9HA 3RRMB 4GMRA 2AWIA 2F0YA 2H7OA 3BG1B 5ENRD 1LF8A 3I3NA 1Z3YA 2WY2A 3VR9A 5BMVE 3IHVA 3ABLE 2EIKE 3MZLB 4XEIG 3C4ZA 3Q5WA 4CGWA 3CHOA 4A98A 5EDSA 3J5PA 2YK0A 5HEJA 3R9AB 3QWVA 2ODVA 2B6CA 2ZMAA 3FXDB 4X65T 2HN1A 3AE5A 2QVAA 1UOHA 3FTUA 5CMYA 4ZI3C 4FJZA 2P9BA 1SA0E 3P4SA 4Z91A 4URKA 3DSWA 4AISA 3UM0A 4WNKA 1TNZA 5ARFA 2MYOA 2NW9A 2LSJA 4B3MT 2Q9QA 2VL8A 4GTRA 4I17A 2W63A 5KJMA 3L17A 4TV8E 5ADXL 3OVUA 1A5EA 2XHEB 2IAKA 4LF4T 3FFLA 4I6GA 2JIWA 4I4TE 1HCIA 3AE4A 2AXDS 3SQVA 2Q7FA 5JJ6A 4ZZCA 3UQ7A 2VASA 3CVVA 5JDHA 2XS1A 3KV5A 3ZJ1A 5EN5D 3LJNA 2IO3C 4ILHB 2VTBA 5EIDA 2P9IG 4G2VA 2ODUA 4N78D 3ZT6A 2W61A 4IHJE 5AIJA 4ILIA 1H6PA 3MA9A 2NOXA 3K3OA 4IDQA 2R03A 1MNDA 2UY1B 4IL9A 3URZA 3QK0A 4CRWA 2MOWA 2IY0C 2HN2A 3CVNA 3EJNA 3Q5MA 2HE0A 2G0UA 4UVBB 5JREA 4HORA 3PZDA 3R9MA 4Q94A 4KHZF 4CZ2D 5EILA 4J2CA 5CA0E 1TNBA 1U4QA 4PS3A 1ZBPA 3EHNA 2A9UA 3RRUA 3KBTA 1LD7A 1XMOT 4FA6A 4WZXA 2X66A 3R6NA 4BJMA 2V6XA 3Q78A 1ZV4X 5AQQB 2ONDA 4YDEA 3ULQA 5HI7A 4DR6T 3MV2B 2J4DA 1NENA 2JMKA 3LFMA 4A56A 3EDUA 4TXRA 4QH1A 3HXDA 4IGUA 4GIWA 5G05J 1UX5A 4GPKA 2V5QC 4Q96A 3S4UA 4X62T 1D8EA 1KNRA 2VGYA 3N2OA 2XQ3A 3FH5A 1OWOA 2X6KA 3U64A 4YDYA 4I6JA 5H7PA 4F6RC 1ELKA 4CI1B 4WW0A 2YDRA 4XZ4A 1D1BA 3UU5A 1EPUA 3FUNA 4AJWA 2P9SG 2YHCA 2CG3A 1T8BA 4LUNU 2E5VA 2LHNA 3ZKJA 3P1UA 4ZFHA 4XI9A 4O1OA 4ISSA 2LSYA 2SPCA 1J1JA 4B94A 1N4PA 5IUXA 2LAIA 4EGWA 4I9EA 2X0YA 4YFSA 5F8PA 2V7IA 3UFEA 2IJGX 3UKRG 3ZJ2A 4NIQA 4DNDA 4YVQC 2IIUA 4CXXA 3WAKA 1HR0T 2XHEA 3AAAC 5LB7B 3CQGB 2I1JA 4HFGA 5FINA 2DLRA 3ZKRA 2XCBA 2DWGA 3UT8A 1IJ6A 4GOUA 3RU0A 2XQ7A 1LD8A 2AVPA 4AKHA 3JQ1A 4TXPA 4HGAA 4U8YD 4GAAA 3KEZA 3ZN3A 3SZ7A 4AP2A 1FIOA 1HG5A 4MLPA 4O8SA 4JHKA 4N39A 1DC2A 3ZVVA 4CN1A 3OKQA 3Q73A 4L1BA 3LKUA 3PNLB 2UY1A 3DJBA 4GZCA 3W15B 4LCTA 4HFHA 2DZNA 2FI7A 4H7YA 1N33T 4G8LA 5E76A 1A17A 3DRAA 4K5AB 1NWMX 3PZ2A 2XSAA 3T1YT 4UI9K 1K8KG 3FTZA 4HRMB 3S2AA 2XRYA 4AQFC 4A55A 3RPUA 4J8YA 3UX4A 5JA4D 3AU5A 3FHEA 2CXLA 3G2TA 3FH8A 3E08A 1G8XA 2WXRA 4EHMA 1YW0A 3TWUA 4ILCA 3TG5A 5ABGA 3P4WA 4P0BA 2ZU6B 3CLJA 3F2EA 4GPMA 4O6FA 2IO2C 1U2VG 4GZ3A 3TXNA 2L3LA 4OFZA 3ML9A 3TWSA 1TYQG 2IOLA 4BERA 4TWFA 1IKND 5FNVE 3SFDA 3RHWA 5D66A 4P0AA 4I0UA 4TUUA 1QUUA 2UU9T 5EX0A 4OYSA 2CHNA 2P9PG 5JDQA 3HRAA 5LMNT 4KZCA 3TL5A 3HIZA 4ILGA 3PUJA 4F6RD 3GWHA 3G2WA 5FWQA 4GB9A 4E7ZA 2QRXA 2ACZA 3PUXF 2BS2A 2AJAA 1H2VC 1KZPA 3APDA 4UQZA 3AAAB 3N9OA 5EYLA 3ULYA 3I1AA 3FUHA 4OAVB 3EHRA 2UXBT 4BA9A 4NXNT 4GYWA 4KMCA 5LNKA 3EU5A 4AQGA 5LFAA 4GMJA 1OY3D 5G04J 4B3TT 2BKOA 5LP6E 3OXFA 2D0TA 4DUZT 1MX2A 4BTAA 1NZNA 5LXTE 3L82A 2IFUA 3PDYA 5HCJA 3C3RA 1JWGA 2FULA 2RG8A 3E4BA 3UIOC 5JR9C 1N11A 1B89A 4HN9A 1BR2A 2V1DB 2CLYC 5FZRA 4BSZB 5IHYA 1P5QA 3C72A 1MQSA 3ZC0A 3LYAA 1M7KA 3P4QA 3FULA 4FADA 1MZCA 4RSYA 4UI9C 2WXKA 4U31A 1JCSA 3ZU7B 2QA7A 5FQ7A 4UVCB 1NL4A 3D9OA 4GTVA 3RKGA 3BUAA 2DYSE 1HS7A 3C4WA 4HWIB 4UQYA 3CVWA 1OCCE 4GKKT 3NOCD 3MACA 2UUCT 3E0ZA 3P7IA 4BEPA 4IDNA 4KBMB 2OLTA 1MJ0A 2AXZA 4CDMA 3UUNA 3I9WA 3SBTB 1ZEEA 2WQ6A 1E7VA 2XAGB 3AJIA 3PNTB 4AY5A 5AQHB 3I0OA 5ITZF 3R7RA 2BEDA 5FXXA 4YVOA 2V8SV 3U3WA 5HXRA 4X20E 3RRWA 3G2VA 4B8AA 4RLYA 4ATZD 3DSTA 3PUAA 5C8YE 3DPDA 3ESKA 4NXMT 1YYHA 2EQXA 1D0ZA 3JCKC 3A7MA 5GONE 3SI5A 4E85A 2BBJA 4X1KE 2Y48B 1Y01A 1O1SA 3U4TA 3UU6A 3RC8A 2IC6A 2VSNA 3TGOA 5HXCA 1NFIE 4LNGA 2XAFB 3Q5XA 1R8IA 4X1YE 2CCQA 2RPAA 3PUVF 2I1KA 4YTMA 4MBQA 1JCRA 2D9DA 3C3OA 4UELA 3RO3A 3UT5E 3F31A 2HPLA 1XZYA 2XQ4A 1XNFA 4HI8A 3ETUA 3OXGA 2LJLA 1S64A 3UXGA 2Y69E 2CLYB 4YTPA 4UIGA 2BG9C 3HXFA 4H63H 3T5XA 4I2ZA 2K24A 1INZA 3UIPC 4EOZB 1XNQT 5BXUA 3ZNGA 5HXEA 2JQQA 4HOQA 4YDOA 5IYZE 1N4RA 3AEFA 4FC8A 4DRXE 5L3EB 3MGBA 3QC9A 5BNWA 4H9RC 3MKQB 1YD8G 1X5BA 4PK5A 1HO8A 2VVNA 4C0MA 1OEDC 2ZGGA 2J08A 1H0AA 1IBMT 1HX8A 4B6XA 3AEAA 2YHEA 1OWNA 3ULEG 3DSXA 4YXDA 2BKNA 1N4SA 5T4YA 3ONKA 3AB3B 2JABA 1QNFA 2KT9A 4V1Av 1G3NB 1VDYA 5CB4E 1NA0A 2NSZA 1IZNB 3IBPA 4HWHA 2XAHB 1KF6A 1N32T 3CSFA 3FEYA 3E34A 5G04C 4EV6A 2WMNA 4QH4A 4EPZA 4HOTA 2HHHT 2BKPA 2OV8A 1D0XA 4TV9E 3F6QA 2PL2A 3D9LA 2ZIRA 3L3PA 3AG4E 4WNFA 1JNZA 3RQWA 2UXNB 4GZDA 3T8OA 2ZISA 5JDMA 3HDXA 4Z68A 2WU2A 2R02A 4EZLA 2W0GA 3RK6A 2EIJE 3RF1A 1X81A 3ZC1A 3ZFWA 4DUIA 3HG0D 4O2AE 3UQ4A 3LXUX 2WDVA 4DV5T 3NZUA 1GW6A 1KPSB 1FMVA 2K3WA 2BG9B 1PY1A 4IT4A 3T8KA 2NR4A 3O1JA 2QC9A 2WPVA 2XZEA 3EDVA 5G2NA 1WLXA 4DPRA 2XY8B 3ASOE 4B0ZA 2E2AA 2DNXA 3HXBA 3MJXA 1FCHA 1ZB1A 5BV1A 2V26A 4UXNB 2BUGA 2GROB 5ENTD 4BETA 4MKTA 2FJBA 4HFCA 4Q69A 3P4RA 3D9IA 5ENOD 2KBXA 1OEDB 3VLEA 3O9XA 3ENEA 4QHOA 2A4ZA 2IUBA 5DQVA 4M1PA 1Z3XA 2NC9A 3MKQA 4LF6T 2A5EA 5L3FB 5LGNB 2Y4TA 2DHRA 3CHPA 3O48A 2GW1A 3MCXA 3SFYA 3N9QA 2WP9A 3CHSA 3B7UX 3MJWA 3WXXA 3GMIA 2PZIA 2BKKB 2GRLA 1RW2A 3PUWF 1HTJF 3OYZA 5LP0A 4CT4A 3V79K 4U3CA 3APFA 3ONLC 1MNEA 4WNGA 4H9SE 3PH0C 4EBAG 2A72A 4LNUD 3B7RL 4DLQA 2A5UA 5CHEE 2JMHA 4PH4B 4DX6D 3AE1A 3T5VA 3VKGA 4IE6A 3EAMA 3U78A 5FQ6A 3AG1E 1VCSA 3KEAA 2I2OA 1YQ3A 4GYRA 3QWPA 3TWXA 4UQXA 4KP3C 4UUCA 4ZEYA 4ACLA 4DBQA 3B57A 3FZKB 5HS0A 3ABKE 2Q9QD 2XPIA 2CM0A 2FBNA 4ATGA 4DR3T 2R59A 4EZJA 4JI4T 1OWPA 5JQGE 5DABA 2X67A 5L47A 4TNVA 4B89A 4QXHB 1UJKA 1EDUA 1PC2A 2Y8DA 4PW8A 3ANWB 5TAOA 4AIUA 3PDNA 2XTLA 3KBUA 2VKOA 4GK5E 3CEQA 4JXTA 1CHUA 3RRNB 3N9NA 1TN8A 5T3RA 1QZ2A 3W9FA 5J08A 2EIME 3D9KA 2I9CA 2JQKA 3ZPOA 2W67A 2FEZA 1Z5SC 1MMNA 4PNIA 2E2EA 4WWPA 2BZBA 1U5PA 2HR2A 3G06A 2BG9A 3O1HA 5L3GB 4LRZA 2PBIA 1SUMB 1W9RA 5L3BB 4L23A 4APFA 1HS6A 2HH7A 3N5LA 5F3JA 3OBVE 5JRCB 3S7JA 5L4EA 1FMWA 2FUPA 3MX3A 3N9LA 2X0LB 3FTYA 4Z90A 3KS2A 3EUVA 3EUHA 5AQSB 2LT3A 2VKDA 2F4VT 4PFPA 2RP4A 3BK9A 4GA2A 5C1DA 3TWVA 2M6BA 2FJDA 2OVBA 5LBMA 2XJ7A 1UW4B 2HYZA 4ASKA 5JJ7A 1M62A 1OEDA 3FHNA 2L0TB 5DIZA 4M7CA 1K3ZD 2J9QA 2XQ5A 2HO1A 3DXMG 3FUEA 5ANRA 2ETAA 2Y0BG 3VTYA 2ETBA 1LVFA 3TAXA 5AQ7A 2R6GF 4HOSA 5FMNA 4QX7B 3OXLA 3U3IA 2CA5A 4DV6T 4DV0T 5AYWD 1ZP0A 3BQLA 3B7BA 5EKQD 4YJ3E 3UM3A 3IHRA 2JQ9A 1UN8A 2QYUA 4JA9A 3D0TA 4CXWA 4F8HA 5AQTB 2QZAA 3SD5A 4IREA 3EU9A 5JMND 1B7TA 5AQUB 2P9LG 2CWYA 4IDOA 1HG2A 4JI3T 2XQ8A 4U33A 4I50E 5LHIB 2XUEA 4O4IE 3MZKB 1H6KA 1ZHCA 2J09A 3E32A 2X3MA 4CYMD 4AEZC 4A97A 4P09A 3FZHB 1OWLA 4ZI2C 1O1TA 2WU5A 5L3DB 1L5JA 1SHZC 2E5LT 1H6OA 3CVRA 2LSUA 1N9AA 3QOUA 2IMLA 4QFVA 3UQ3A 3OJAA 4UVAB 1Z6TA 2XRZA 2K5BB 3ANWA 3CMLA 5L4HA 4I1AA 4CQIA 3B7TA 4J8FA 4QXBB 2V6YB 5KNHD 1HNXT 5CECB 3H37A 4KX6A 3RH3A 4GTOA 1SA5A 2H6HA 1UK5A 5AQ9A 4LERA 1IJ5A 4XX5A 2ZM0A 3AEEA 3RIFA 1W0BA 5J2UE 4DV2T 3Q9NC 3UU3A 1N94A 1WM5A 3P8CD 5FXWA 3K1SA 4EQFA 3ZCJA 4I2WA 2J1DG 2FO7A 1VRBA 4XZCA 4F3VA 5JRCA 3Q47B 1OXJA 4DK5A 2UWJG 4A3VA 4U0SA 2BG9E 3QARA 4BJNA 1L0VA 2AW6A 5FXZA 4U7IA 4HBDA 3LEWA 4O4JE 1RZ4A 4DX7D 3JC6C 2XM1A 3BQKA 1BI8B 2C0MA 5ENSD 4FP7A 2LE8A 2FJAA 2V8SE 3TLSA 2XZTG 1HH8A 2VSOE 3Q75A 3CQCB 3FDHA 3DWLG 3ONLA 4AKIA 2F8XK 1D1AA 3ZN1B 3NZQA 3JAFA 4GYYA 2MBGA 2WAUA 1OEDE 3RLFF 4BWRA 5LYJE 2LSKA 2X9WA 3TLTA 2PQNA 3MK7C 5CGMA 3V2OA 2ETCA 1X79A 1YMPA 1YKEB 3LPZA 4AXPA 4ZI3D 3ZMSB 2M63A 4BT9A 1ZOYA 2PJQA 3FUMA 3UUMA 2DVWA 3AEDA 1T98A 1Y64B 3ASNE 4U0ZA 1OWMA 1LRZA 2V5CA 3L54A 3LBXB 3CGHA 4O4LE 3LS8A 1SQMA 3C51A 4AKRB 5J2TE 4EEBA 1QYMA 5AQAA 3AS4A 1JPLA 2PTFA 3HXEA 4FHJA 1K1BA 2X6JA 1BLXB 2DWZA 2L8KA 5AQIB 1MHQA 5AQGB 2L6JA 1U3CA 4A1SA 3EHZA 2RA1A 3V5UA 4HNAD 4A3TA 3QNKA 3N9MA 2W62A 3NWIA 2LXMA 4F1PA 2WZIA 4Y6CA 1BPOA 2XEHA 3QKYA 1UGOA 3G2SA 3PEUB 1MMAA 4ZI2D 5HWXA 4G11A 1DU2A 1TNOA 2Y4UA 5LG4A 2V6YA 5J0ZA 4IRUA 1HZ4A 2L9BA 3AVRA 2IDOB 2IHR1 5FQ8A 4JEUB 2YN6A 2WXPA 5CEDB 1H7CA 3CWZB 5HEGA 5AQFB 2ZXWE 4QXCB 4COFA 3E37A 2NP9A 4F1SA 2W4XA 4EEDA 2CHWA 4H63V 3PV0F 3AE9A 3VLFA 4ACKA 3EIQC 2V7MA 2GRMA 3FTSA 2EHOB 4AQYT 4PS7A 5KJLA 2PM7A 2LKHA 2C5IT 4WNDA 2XGSA 4APOA 3VR8A 3KV6A 3AG3E 4AV7A 3RRCA 5FJYA 3UKUG 2KNDA 3QNUA 4U04A 4E7SA 3LJCA 2ZGDA 4NACA 4XKCA 3PU8A 2X6HA 4A5XA 4HTEA 2DWKA 2YKSA 3JUEA 1YXRA 3R84B 2E9XC 1E1HB 2WB5A 2WZHA 1WR0A 3OYXA 2BS4A 3CIAA 3JC6D 2UUBT 4JV5T 4YSYA 2VK9A 4BAYB 4RG9A 5AENA 2KINB 4U63A 1FEWA 4U7YA 1KNPA 1FT2A 3HKDE 4GYOA 2V7JA 4CDNA 2KSRA 4YJ2E 4IE5A 2WDQA 3SFXA 4LF8T 4X8QA 2NTXA 4ANVA 3NZSA 3U9WA 2XQ6A 4TX5A 3GW4A 4EBAA 1DCQA 2KXPC 2R2LA 4PK6A 5ABFB 3LBXA 3SFZA 3PTRB 4YY3T 4LNBA 3TWRA 3SOLA 5KCMA 5IWAT 1DVPA 3UT7A 5BPPA 2KCKA 3SRZA 3PE3A 5AQJB 3UT4A 2V7KA 1N0QA 2R17C 3D3MA 5G05C 4DX1A 2BS3A 2X38A 2X68A 3AVSA 4HI9A 1UCUA 3Q5DA 2UXXB 1MX4A 3EVYA 1XDOA 1Z0PA 4DMVA 2LHRA 4BESA 1FVFA 4A1GA 4IE7A 4TNWA 2QYJA 1UURA 4UF0B 5B3SE 3NBNB 5FY0A 5EYPF 3ZEFB 3J7Yq 4JEUA 3IA3A 3HXCA 4HE8A 5JVDE 3SS1A 5BUZA 1Y8MA 3B5MA 3AS8A 5CA1E 3LY7A 1BR4A 5AQRB 3ASGA 4G63A 3KD7A 1TJFA 2EHOA 3V2XA 3QUJA 1ZKEA 3AAEB 1WY6A 2MYSA 2LKGA 3Q7FA 2E9XB 3CKBA 1E8XA 2J4BA 4HWDA 4LMKA 3CKCA 4OVUA 3B7SA 2Y3AA 2KMFA 4HVBA 2XAQB 3CHMA 1XMQT 4CXYA 1ELRA 2WVIA 2XQYA 1S35A 4ADZA 1IHBA 3L08A 1E2AA 1J5ET 4ZHQE 5BV0A 2FBWA 3APCA 2VSXE 3OAWA 3SWHA 2PNNA 1IHGA 3FU3A 3RIAA 2E9XD 5AQNB 4FJYA 3H3AA 1BI7B 3GYZA 4I1MA 2Z6EA 2QGSA 5G55A 5LX8A 3SFEA 4DVDA 5A7DB 4L7TA 1V54E 5CMWA 2KXPB 3C5RA 2JQHA 3GZ1A 2LM2A 2CRBA 3LY9A 4KBQA 4R7LA 4CI3B 4X5TA 3WI3A 4DIDB 2LSVA 4HFIA 3LVRE 5KXJA 2IC9A 3U66A 1NP7A 3I9YA 1IAPA 5FKYA 4GYSA 3PZ4A 5ABFA 2UXCT 2CPTA 4UWFA 2IF4A 2IQCA 4UWGA 3ASHA 2LRLA 4UV8B 1OWAA 5AFUL 1OCRE 4U2YA 1UN9A 4CCAA 2J8SD 4G23A 1E8YA 4JEHB 4ZI7E 4Q25A 2GRNB 4JUYA 2NW7A 1TR4A 4L2LA 2V4HC 3NRYA 2HM8A 2OV9A 4HEAA 4UWHA 2XSBA 4KMOA 1I6ZA 5EK4A 5ENQD 5JH7E 3FUDA 2X6FA 1D0YA 3NQPA 4EYUA 2P2CP 2WXLA 3AA1B 4Y6WA 5LCWJ 1KNZA 4HQDA 2XGOA 3CPZA 4UF0A 4J7WA 4CT0A 2WQHA 3ZEFA 3VKHA 1S70B 4OHFA 2F37A 2XENA 4J8EA 2X6IA 5FTPA 4WNEA 3ZT5A 2VL0A 4DV3T 4H9PC 4ISTA 4L2YA 4U0UA 5KJKA 4L9PA 3DXKG 3BQIA 3EHMA 4ABNA 5KX5E 5HYAA 3RYHE 4O2BE 3CHRA 4C0EA 4LEUA 2E9XA 2GGFA 5IY5E 5FVKA 2ACXA 2ZM2A 4X64T 3L8RA 4WUYA 5M72A 2CBIA 3CVYA 1KK7A 4BT8A 1BR1A 3KDSE 1S94A 3UU4A 3X1DA 2N2NA 2LNIA 3S7FA 2OVFA 4IE4A 4GU5A 4DJAA 4ZHBA 4LF9T 4DO0A 2LSGA 3CQXC 3UUXB 1IXVA 2P9UG 4DI3A 4MS6A 2H3RA 3L9TA 2IONA 4HWCA 4JHRA 3AG2E 4BX8A 4ANJA 4I55E 3QB5A 1SZAA 5AQBA 3CVQA 3ML8A 3ONXA 5LG3A 5HQ8A 3QOFA 3FWVA 3ABME 5ABEA 1NEKA 4KHPT 1QLBA 3ZUVB 1KT1A 2B76A 4ZXLA 2DBAA 4AOFA 2KWIB 2R5SA 2CHZA 5HKPA 5FY7A 4C48B 1FVHA 3KV9A 1LTXA 4LSZE 4YSXA 1WYBA 1N95A 2PFVA 3AA7B 5AQKB 4U72A 2VKJA 4JEHA 3AU4A 2XCCA 3LY8A 2JRKA 1NAFA 2W66A 2WXNA 2CEAA 4EB6E 3HKCE 3ZYMA 1Q2ZA 4KVMA 4I6EA 4PS8A 2CXFA 4HKAA 2ZM8A 2RFAA 4PAGA 3UMVA 2DL1A 4UEMA 1UG3A 5CJ5A 4C91A 5FL1A 3RIBA 3CVPA 3KVBA 3HKBE 1HXIA 4DR1T 4BFRA 3RJVA 3CKDA 3E22E 4NUUA 5DBKA 1YA0A 3ZSTA 2GRRB 2JLBA 5CCLA 4NPPA 5CRVA 4FULA 3E30A 5E0OA 2BKGA 2DYRE 3PS6A 4K03A 4DV4T 3PUKA 1X9BA 4ERRA 5CBNA 3ZMZB 2LUHA 2WXOA 4AIFA 5A6CA 1EF1C 4CDRA 2V7LA 3PURA 1NA3A 1MX6A 2WXHA 4HLEA 4K5CA 4XIFA 3P50A 4YNDA 4ANXA 3N2GE 2UXDT 1QSDA 2MAWA 3FP3A 5HEHA 1IYGA 5LOZA 3CSTA 1KEYA 4Z8XA 4PJNA 2WQ7A 3AE8A 3NAWA 3L39A 5AQOB 4XBFB 4JC8A 3O1IA 3UUXA 4GCOA 3KSLA 2X9HA 2HPJA 3LDZA 4MALA 1D8DA 3KSQA 5CCMA 5FVLA 2FJEA 3C98B 3FUFA 3CV0A 4DLOA 3RYCE 3PZ3A 5ARGA 2E8IA 2J62A 4D10C 3VTXA 4N5CA 2MPKA 3DSUA 5DJQC 3I4GA 2ZM6T 1BU9A 5KNGA 1W0AA 3CVLA 5FP3A 1J5WA 2YEVC 4CZZB 4GTTA 5KBAA 3ZW3A 5LMUT 3ESLA 3Q5EA 3VRBA 4N3BA 4MRUA 3BG0B 3EHQA 3FU6A 3ZYKA 4JD2G 3AE2A 4PUCA 3M65A 1QBQA 4HOUA 4ZS3A 3JADA 3RGLA 4DX2A 5LGTB 5AN8A 2CG2A 2KZ7B 3BQOA 4GCNA 5FZQA 1SVXA 5ENNA 2X51A 3K9IA 3SBSA 3NZPA 1E8ZA 4WYVA 3FTWA 3KV4A 1TNYA 4CEMA 3T9KA 3CIRA 3EIJA 4W9RA 5KJNA 3JUIA 2VQET 4JL0A 2XPYA 2VGEA 1AJ3A 2YNQA 1XWMA 2AXVA 3P2BA 2NXPA 4JBWF 4CGVA 1BD8A 5JHBA 2LSIA 4PFOA 4O1PA 3RSEG 4UR9A 4UWLA 2GRQB 4YTNA 3ZIMA 5FT9A 2PM6A 3DBSA 2NTYA 4O60A 4XI0A 4IL4A 2LAHA 2H6GA 3MA5A 2C5JA 2K9AA 3AA0B 4ME2A 3SHFA 5CFBA 2PQRA 5LHGB 4EXTA 5E75A 4YHJA 2X9XA 5JHAA 4V3IA 3K8PC 3UUBA 4DX5D 2JEKA 4ILAA 4U95D 4JI8T 3MYVA 2VKHA 4KI0F 4G24A 1H2TC 2YDSA 3NKZA 3ASFA 3AEBA 2D2SA 2C0SA 1QQEA 3BU8A 4YDWA 4DBRA 1LVKA 3R7QA 4DI4A 1WFDA 5BXOA 4TWDA 1HE8A 3IF8B 1IQRA 3C98A 3ONJA 5JDFA 3D9JA 3FEXA 4QX8B 1T72A 5M4YA 3SY2A 4EIWA 1W09A 3V30A 4XE0A 2FO1E 3H3MA 3QK6A 4HFDA 3V5SA 4KVOA 2CBJA 5AAOA 2CXDA 4FU3A 3UULA 1HNWT 3L22A 4JI2T 5ANLA 1MIVA 4X1IE 3M3ZB 2LO6A 5FY1A 4K0KT 4KZ0A 1EZ3A 2EHOC 5LOVE 1T7SA 3I0QA 3ZN0B 1WRDA 4TXQA 4B93B 2ZLYA 3NOGD 1WCRA 2MTQA 2M67A 5HRYA 3PJAJ 4KT6B 4AXHA 3HI2A 4GA1A 4YSZA 1JWFA 3J5QB 5FIOA 1TNUA 5LCYA 3HA4A 3BEEA 4L9IA 3C4XA 2YU2A 4DR2T 3K3NA 4JI1T 4PK4A 4JA7A 2Y1LE 1TN7A 2DI4A 3LDQB 5A23A 1MMGA 3IEGA 1OUVA 4UV9B 1IBKT 4PDXA 5J90A 3TXMA 2VB6A 2WS3A 3HKEE 4LF7T 4UI9J 2CE7A 3D9PA 1SZ9A 4LMJA 3MEKA 5ETWA 4YHHT 3UTMA 4EZ4A 5AQMB 3AEGA 2XEVA 4FLBA 4C9BB 3JAEA 3QB5K 1O5MA 3KFWX 3I4RB 2Y6XA 1OCOE 3SF4A 3AE7A 3T1HT 4JYAT 4HWFA 4YT0A 2WSSV 5T8IA 5AARA 4N2SA 4BY6A 1DCEA 1FT1A 1E96B 5FXVA 3B95A 3C3QA 5EZYE 4WWOA 5FL0A 1BR0A 5C3JA 4KUMB 3S7BA 3ZRHA 3TLVA 2OOEA 2XQ0A 1CUNA 2X0HA 3P4PA 2IU1A 2KATA 4E6HA 1HX1B 4GK0E 2FF4A 2P58C 4MHCA 4P1NA 2XQ9A 2KC7A 1WAO1 2R05A 3CR3A 4KXKB 4IIJE 2VQFT 4ZS2A 3FUIA 3FB2A 3DEOA 4BTBA 2XM2A 3QDNA 1LKXA 4IULA 2N9DA 5JDGA 3GZSA 4CN4A 3PVLA 3W9GA 1N34T 4K5BA 2C2LA 3FU0A 4G2AA 4L5GA 1N4QA 3ZGQA 2WWUA 3Q79A 4TUMA 3ZHEB 3GN5B 5JTGA 3TLUA 3VRAA 2XASB 4I1OB 4B3ST 4IN3B 1WG0A 4MLKA 5FZSA 5D0QD 3FXEB 4FI5A 3ZYLA 2EHOD 2D5UA 4U8HA 3ZPJA 4DR5T 4J0UA 2KZTB 1E8WA 1VOMA 3IEEA 1HF8A 1NI1A 5AQVB 1MMDA 2EINE 2KCVA 3TG4A 1OXZA 3TLWA 3RKVA 3ZLIA 2VYIA 5H6QB 4NQ0A 2VGXB 4J8SA 3RC3A 2WXJA 1WYCA 3Q9UC 3UTKA 1V55E 2DZOA 2AXUA 4RVBA 4GKJT 1JNRA 2I0MA 4IYPA 2YINA 2L9QA 4JI5T 3DPYA 3Q49B 1YQ4A 2CMRA 3K3QC 3TKLB 4JHJA 3T8MA 1Y6IA 3OTOT 2OEVA 3FTXA 2LOPA 3QC1A 2C5KT 3IV0A 4H7XA 3NB2A 4M3OA 2LXLA 3AECA 4H9OC 4OK0A 3PUYF 1N54A 4N3CA 1SW6A 4ILBA 3RYIE 3CK6A 3ZSSA 2RKKA 2WBLA 5BR8T 4PJMA 1UUSA 5AQLB 3IKOB 3N71A 4ANUA 3UPVA 3A5XA 5F5WA 2QY7A 2H7VC 1V9DA 3PUZF 4HFEA 4C90A 4LFBT 3HYMB 5H6RB 2CFUA 3PEVB 2N1GA 3NVOA 2I59A 3JXJA 2WDRA 3VHLA 5LA6E 4JPSA 1KFYA 2CHOA 5HCMA 2LEHA 4JI7T 2BF0X 5EK2A 4BSXA 4F53A 3ZMTB 5KMGP 2YOEA 4DV1T 4TN7B 3TWTA 4HLLA 3LSVA 1O3XA 3CHQA 4ZZBA 4FLHA 1TN6A 2ILRA 4DR4T 2E0IA 4DUYT 3LJ3A 2YU1A 3FUKA 1US7B 3RIUC 3WG7E 2NYJA 3EI0A 5A1LA 4EECA 2LOSA 4GZ5A 4NIKA 3VU7H 3NBXX 3ZHEA 3QAQA 3UM1A 3GN5A 5LJMA 4NUVA 4NURA 4J8DA 3PUQA 4YLHA 1IQUA 3MV3B 1G73A 3HVEB 3SO8A 2LLYA 1JUQA 1TJCA 4JVSA 3N9PA 3ZT7A 2P9NG 4HB5A 3L09A 4U96D 1AP7A 1E90A 4LG6A 3RKOA 2ES0A 3D9MA 3RI5A 3RAUA 2QYWA 2WB2A 2LM9A 5C2YA 1XNRT 5CBOA 3C50A 4EZHA 1WDYA 3GZ2A 2WXMA 2KZTA 1SA4A 5LGUB 4ZOLE 4GTSA 5AQPB 2WXGA 4N5QA 1VCTA 4U7EB 2V4LA 5FQ4A 1D9SA 3DEPA 4U74A 5ABHA 3UM2A 2VGXA 4EAHA 3SNXA 5JDLA 1W3BA 3L6AA 3RX6A 3FTVA 3GA8A 3D9NA 3OPCA 2L6BA 2H88A 3RO2A 2WWVA 3S7DA 1ELWA 5CERB 3AA6B 4WBNE 3F57A 1WR6A 4AI6A 4PJLA 2BVLA 1EYHA 2IEJA 4H9QC 4JW1A 4P29A 3PE0A 5D0OD 2XAJB 3JXIA 1N52A 2NWBA 2YDQA 2LRKA 5CRUA 1JCQA 3ZCIA 3MXZA 3CX6B 5D2MC 2JPFA 5DQWA 1KZOA 2KM4A 3UI2A 3LCAA 3LK3B 4OYJA 5JR9B 2H89A 4I43B 1MYOA 2B0OE 2GRPB 1FPPA 5AJDA 3CX8B 3PE4A 3WAJA 2I6HA 2W00A 4HFBA 3NF1A 5J1GA 2MRIA 2V5DA 5ENPD 1Z8UA 2WCAA 3FU5A 1MIWA 4WBOA 4O4HE 3ZYQA 3QJZA 4TV3A 2GK9A 3PREA 2C0LA 4WAFA 1SE7A 3B13A 4AQFA 4G26A 4WWNA 2H6FA 3AE3A 3ASDA 3JYSA 3CK7A 2WM9A 4JI0T 3ZXPA 2XPKA 4H9NC 3L13A 4U07A 3IHYA 3UU8A 1YCSB
chains in the Genus database with same CATH topology
3DP7A 3I5PA 2WXQA 2WXIA 4N2QA 3N2KE 4N3AA 1H19A 3HVEA 2KWHA 4UWKA 3DTOA 5LHHB 3VLDA 1D1CA 1PAQA 2D0UA 3O4XE 2A2FX 4HS2A 2MOZA 4FJOA 3L16A 2Q9QC 3PUGA 3FY4A 3CK9A 3FBLA 3LK2B 4GA0A 3Q4AB 4G1TA 2MHKA 4DMWA 4J6IA 2B1EA 4TZ4C 3ZMVB 2VWAA 4L0RA 4XAXB 4AKGA 5FYMA 2VJ8A 3Q15A 1U3DA 5L2LA 2X9YA 2BTDA 4IE0A 4NRHB 3Q9DA 3HL6A 4CI2B 3QWWA 2XPZA 1YKHB 3FUJA 4FHKA 1UJJA 4AKLA 3PUSA 5AJLA 5BT1A 2BVMA 4KYOB 4QKNA 3LVQE 3J9X1 4PJJA 5KDMC 3OTNA 1KLXA 4AY6A 4OVVA 2JJ9A 5HXHA 5JDNA 1KT0A 4JZYA 3KVAA 5HAXA 3CK8A 4ILUA 5JJTA 1UX4A 3MKRA 5JR9A 3SGHA 4I43A 4B8CB 3HHMA 3CX7B 4GZ6A 4IDZA 4AM9A 3NRXA 2OA5A 4K0RA 3ZMUB 4GMLA 1E7UA 2VQ2A 1TEZA 2NW8A 4F7AA 4ANWA 4QWNB 3AAIA 3KAEA 3KINB 4OYKA 2WMOA 4HXIA 2K48A 2KLQA 2DIWA 5EX3A 3C64A 3PU3A 2IOSA 3O4ZA 2Q9QB 2XGMA 4G25A 2QFCA 3Q2MA 5BW8C 5LJNA 2CFZA 3TJPA 3LK42 3EDTB 5LBQB 4EZKA 3LG7A 4MFRA 3FBZA 1HFAA 3MKDA 2J49A 1DNPA 4K0UA 2VTBB 2L0IA 4EYYR 3IBEA 1HU3A 2DCPA 2RD0A 2CWOA 5HWYA 3CVUA 4I9CA 3RYFE 5LCWC 2CHXA 4AVXA 2V0PA 2DCFA 3JQ0A 4BX9A 2YQ8A 3CVXA 3PRZA 4TRQA 2KCLA 2WXFA 4XKBA 3HR0A 1H2UA 1MIYA 4TUYE 4RG6A 3AS5A 2BDEA 2V5FA 4HFVA 2PG8A 3G2UA 2VSYA 2J07A 3FH7A 5EK3A 5L3CB 1XGWA 1S0PA 3ZXSA 3ETVA 2A3DA 2IW5B 1ZU2A 4JLEA 5HXSA 3RRMB 2AWIA 2H7OA 3BG1B 1LF8A 3I3NA 1Z3YA 3IHVA 5BMVE 3MZLB 3C4ZA 3Q5WA 4CGWA 3CHOA 5EDSA 2YK0A 3R9AB 3QWVA 2ODVA 2ZMAA 3FXDB 3FTUA 5CMYA 4ZI3C 4FJZA 2P9BA 1SA0E 4URKA 4WNKA 5ARFA 2NW9A 2LSJA 4I17A 2Q9QA 2VL8A 2W63A 5KJMA 3L17A 4TV8E 5ADXL 2XHEB 2IAKA 3FFLA 4I6GA 4I4TE 1HCIA 2Q7FA 5JJ6A 2VASA 3CVVA 5JDHA 3KV5A 3ZJ1A 4ILHB 2VTBA 4G2VA 2ODUA 4N78D 2W61A 4IHJE 5AIJA 4ILIA 3MA9A 2NOXA 3K3OA 1MNDA 2UY1B 3URZA 3QK0A 4CRWA 2MOWA 3EJNA 3CVNA 3Q5MA 2G0UA 4UVBB 5JREA 4HORA 3PZDA 4Q94A 4J2CA 5CA0E 4PS3A 1U4QA 1ZBPA 3EHNA 3RRUA 3KBTA 4FA6A 2X66A 3R6NA 4BJMA 1ZV4X 2ONDA 3ULQA 5HI7A 3MV2B 2J4DA 2JMKA 3LFMA 4A56A 3EDUA 4IGUA 4GIWA 5G05J 1UX5A 4GPKA 4Q96A 3S4UA 2VGYA 3N2OA 3FH5A 1OWOA 2X6KA 3U64A 4I6JA 4F6RC 1ELKA 4CI1B 4WW0A 4XZ4A 1D1BA 3FUNA 1EPUA 4AJWA 2YHCA 2CG3A 4LUNU 2LHNA 3P1UA 4XI9A 4ISSA 2LSYA 2SPCA 4B94A 2LAIA 4I9EA 4YFSA 5F8PA 2V7IA 3UFEA 2IJGX 3ZJ2A 4DNDA 4YVQC 4CXXA 3WAKA 2XHEA 3CQGB 2I1JA 4HFGA 2DLRA 2XCBA 2DWGA 3UT8A 1IJ6A 4GOUA 3RU0A 2AVPA 4AKHA 3JQ1A 4HGAA 4GAAA 3KEZA 3ZN3A 3SZ7A 4AP2A 1FIOA 1HG5A 4MLPA 4O8SA 4JHKA 4N39A 3ZVVA 4L1BA 3OKQA 3LKUA 3PNLB 2UY1A 3DJBA 4GZCA 3W15B 4LCTA 2FI7A 4H7YA 5E76A 1A17A 1NWMX 4UI9K 3FTZA 3S2AA 2XRYA 4AQFC 4A55A 3RPUA 3UX4A 3AU5A 3FHEA 2CXLA 3G2TA 3FH8A 3E08A 1G8XA 2WXRA 1YW0A 3TG5A 4P0BA 2ZU6B 3CLJA 3F2EA 4O6FA 4GZ3A 3TXNA 2L3LA 4OFZA 3ML9A 2IOLA 5FNVE 4P0AA 4TUUA 1QUUA 5EX0A 4OYSA 5JDQA 4KZCA 3TL5A 3HIZA 4ILGA 3PUJA 3GWHA 3G2WA 5FWQA 4GB9A 4E7ZA 3APDA 1H2VC 4UQZA 3AAAB 3N9OA 3I1AA 3FUHA 4BA9A 4GYWA 4KMCA 5LNKA 4AQGA 5LFAA 4GMJA 5G04J 5LP6E 3OXFA 2D0TA 4BTAA 1NZNA 5LXTE 2IFUA 3PDYA 1JWGA 2FULA 2RG8A 3E4BA 5JR9C 1B89A 4HN9A 1BR2A 2V1DB 2CLYC 5FZRA 5IHYA 1P5QA 1MQSA 3ZC0A 3LYAA 3FULA 4FADA 4RSYA 4UI9C 2WXKA 2QA7A 5FQ7A 4UVCB 3D9OA 1HS7A 3C4WA 4UQYA 3CVWA 3MACA 3E0ZA 3P7IA 4KBMB 2AXZA 4CDMA 3UUNA 3I9WA 3SBTB 1ZEEA 2WQ6A 1E7VA 2XAGB 3PNTB 4AY5A 3I0OA 3R7RA 5FXXA 4YVOA 3U3WA 5HXRA 4X20E 3RRWA 3G2VA 4B8AA 3PUAA 5C8YE 3DPDA 3ESKA 2EQXA 1D0ZA 3JCKC 5GONE 3SI5A 4E85A 4X1KE 2Y48B 3U4TA 3RC8A 2IC6A 2VSNA 3TGOA 5HXCA 2XAFB 3Q5XA 4X1YE 2CCQA 2I1KA 4MBQA 4UELA 3RO3A 3UT5E 3F31A 2HPLA 1XNFA 3ETUA 3OXGA 2LJLA 2CLYB 4UIGA 4H63H 3T5XA 4I2ZA 2K24A 1INZA 4EOZB 5HXEA 2JQQA 4HOQA 5IYZE 4FC8A 5L3EB 3MGBA 3QC9A 5BNWA 4H9RC 3MKQB 1YD8G 1X5BA 4PK5A 1HO8A 4C0MA 2J08A 1H0AA 1HX8A 4B6XA 2YHEA 1OWNA 5T4YA 3ONKA 3AB3B 1QNFA 2KT9A 4V1Av 1VDYA 5CB4E 1NA0A 2NSZA 1IZNB 3IBPA 2XAHB 3CSFA 3FEYA 5G04C 4EPZA 2WMNA 4HOTA 2OV8A 1D0XA 4TV9E 2PL2A 3D9LA 3L3PA 4WNFA 2UXNB 4GZDA 3T8OA 5JDMA 3HDXA 4EZLA 2W0GA 3RK6A 3ZC1A 3ZFWA 4O2AE 3LXUX 3NZUA 1GW6A 1FMVA 1PY1A 3O1JA 2WPVA 3EDVA 5G2NA 1WLXA 4DPRA 4B0ZA 2DNXA 3MJXA 1FCHA 5BV1A 2V26A 4UXNB 2BUGA 4MKTA 4Q69A 3D9IA 3VLEA 3O9XA 3ENEA 4QHOA 2A4ZA 5DQVA 4M1PA 1Z3XA 2NC9A 3MKQA 2Y4TA 5L3FB 5LGNB 3O48A 2DHRA 3CHPA 2GW1A 3MCXA 3N9QA 3CHSA 3B7UX 3MJWA 3WXXA 2PZIA 3GMIA 2GRLA 1HTJF 3OYZA 5LP0A 4CT4A 3APFA 1MNEA 4WNGA 4H9SE 3PH0C 4EBAG 2A72A 3B7RL 4DLQA 2A5UA 5CHEE 2JMHA 4PH4B 3T5VA 3VKGA 4IE6A 3U78A 5FQ6A 2I2OA 3QWPA 4GYRA 4UQXA 4KP3C 4ACLA 4DBQA 3B57A 2Q9QD 2XPIA 2CM0A 2FBNA 4ATGA 2R59A 4EZJA 1OWPA 5JQGE 5DABA 2X67A 4B89A 4QXHB 1UJKA 1EDUA 1PC2A 2Y8DA 4PW8A 3ANWB 5TAOA 3PDNA 2XTLA 3KBUA 2VKOA 4GK5E 3CEQA 4JXTA 3RRNB 3N9NA 5T3RA 1QZ2A 5J08A 3D9KA 2I9CA 3ZPOA 2FEZA 1MMNA 4PNIA 2E2EA 4WWPA 2BZBA 1U5PA 2HR2A 4LRZA 3O1HA 5L3GB 2PBIA 5L3BB 4L23A 4APFA 1HS6A 2HH7A 3N5LA 5F3JA 3OBVE 5JRCB 3S7JA 1FMWA 3MX3A 3N9LA 2X0LB 3FTYA 3KS2A 3EUHA 2LT3A 2VKDA 4PFPA 2RP4A 3BK9A 4GA2A 5C1DA 2OVBA 5LBMA 1UW4B 2HYZA 4ASKA 5JJ7A 3FHNA 2L0TB 5DIZA 2J9QA 2HO1A 3FUEA 5ANRA 3VTYA 1LVFA 3TAXA 4HOSA 5FMNA 4QX7B 3OXLA 3U3IA 2CA5A 5AYWD 3BQLA 5EKQD 4YJ3E 3IHRA 1UN8A 4JA9A 3D0TA 4CXWA 3SD5A 1B7TA 2CWYA 1HG2A 4I50E 5LHIB 2XUEA 4O4IE 3MZKB 1H6KA 1ZHCA 2J09A 2X3MA 4AEZC 4P09A 1OWLA 4ZI2C 5L3DB 1L5JA 1SHZC 3CVRA 2LSUA 3QOUA 4QFVA 3UQ3A 3OJAA 4UVAB 1Z6TA 2XRZA 2K5BB 3ANWA 3CMLA 4I1AA 4CQIA 3B7TA 4J8FA 4QXBB 3H37A 3RH3A 4LERA 1IJ5A 4XX5A 2ZM0A 5J2UE 1WM5A 3P8CD 5FXWA 4EQFA 3ZCJA 4I2WA 2J1DG 2FO7A 1VRBA 4XZCA 4F3VA 5JRCA 3Q47B 4DK5A 2UWJG 4A3VA 4U0SA 3QARA 4BJNA 2AW6A 5FXZA 3LEWA 4O4JE 3JC6C 3BQKA 2C0MA 4FP7A 2LE8A 2V8SE 1HH8A 2VSOE 3CQCB 3FDHA 3ONLA 4AKIA 1D1AA 3ZN1B 3NZQA 4GYYA 2MBGA 2WAUA 4BWRA 5LYJE 2LSKA 2X9WA 2PQNA 3MK7C 1X79A 1YKEB 3LPZA 4AXPA 4ZI3D 3ZMSB 2M63A 4BT9A 2PJQA 3FUMA 3UUMA 1T98A 1Y64B 4U0ZA 1OWMA 1LRZA 3L54A 3LBXB 3CGHA 4O4LE 3LS8A 1SQMA 3C51A 4AKRB 5J2TE 3AS4A 1JPLA 4FHJA 2X6JA 2L8KA 1MHQA 2L6JA 1U3CA 4A1SA 4A3TA 2RA1A 3V5UA 3QNKA 3N9MA 2W62A 4Y6CA 1BPOA 3QKYA 3G2SA 3PEUB 1MMAA 4ZI2D 5HWXA 4G11A 2Y4UA 5LG4A 4IRUA 1HZ4A 2L9BA 3AVRA 5FQ8A 4JEUB 2WXPA 1H7CA 3CWZB 4QXCB 4F1SA 2NP9A 2CHWA 4H63V 3VLFA 4ACKA 3EIQC 2V7MA 2GRMA 3FTSA 2EHOB 4PS7A 5KJLA 2PM7A 4WNDA 2C5IT 4APOA 2XGSA 3KV6A 4AV7A 3RRCA 5FJYA 2KNDA 4U04A 4E7SA 3LJCA 4NACA 4XKCA 3PU8A 2X6HA 4HTEA 2DWKA 3R84B 2E9XC 1E1HB 3OYXA 3CIAA 3JC6D 2VK9A 4BAYB 4RG9A 5AENA 2KINB 4U63A 1FEWA 3HKDE 4GYOA 2V7JA 4CDNA 4YJ2E 4IE5A 2NTXA 4ANVA 3NZSA 3U9WA 4TX5A 3GW4A 4EBAA 4PK6A 3LBXA 3SFZA 3PTRB 3SOLA 5KCMA 1DVPA 3UT7A 5BPPA 2KCKA 3SRZA 3PE3A 3UT4A 2V7KA 2R17C 3D3MA 5G05C 2X38A 2X68A 3AVSA 1UCUA 2UXXB 3EVYA 1Z0PA 4DMVA 2LHRA 1FVFA 4A1GA 4IE7A 4UF0B 5FY0A 3ZEFB 3J7Yq 4JEUA 4HE8A 5JVDE 3SS1A 5BUZA 1Y8MA 3AS8A 5CA1E 3LY7A 1BR4A 3ASGA 4G63A 3KD7A 1TJFA 2EHOA 3QUJA 1ZKEA 3AAEB 1WY6A 2MYSA 2E9XB 3CKBA 1E8XA 2J4BA 3CKCA 4OVUA 3B7SA 2Y3AA 2KMFA 4HVBA 2XAQB 3CHMA 4CXYA 1ELRA 2WVIA 2XQYA 1S35A 4ADZA 3L08A 4ZHQE 5BV0A 3APCA 2VSXE 3OAWA 3SWHA 1IHGA 3FU3A 2E9XD 4FJYA 3H3AA 3GYZA 4I1MA 2Z6EA 2QGSA 5G55A 5LX8A 4DVDA 5A7DB 4L7TA 5CMWA 2KXPB 3GZ1A 3LY9A 4KBQA 4R7LA 4CI3B 3WI3A 2LSVA 3LVRE 2IC9A 3U66A 1NP7A 3I9YA 1IAPA 4GYSA 4UWFA 2IF4A 2IQCA 4UWGA 3ASHA 4UV8B 1OWAA 5AFUL 1UN9A 4CCAA 4G23A 1E8YA 4JEHB 4ZI7E 4JUYA 2NW7A 4L2LA 3NRYA 2HM8A 4UWHA 4HEAA 4KMOA 5EK4A 5JH7E 3FUDA 2X6FA 1D0YA 3NQPA 4EYUA 2WXLA 3AA1B 4Y6WA 5LCWJ 1KNZA 2XGOA 3CPZA 4UF0A 4CT0A 2WQHA 3ZEFA 3VKHA 4OHFA 4J8EA 2X6IA 5FTPA 4WNEA 4H9PC 4ISTA 4L2YA 4U0UA 5KJKA 3BQIA 3EHMA 4ABNA 5KX5E 5HYAA 3RYHE 4O2BE 3CHRA 4C0EA 4LEUA 2E9XA 2GGFA 2ACXA 2ZM2A 4WUYA 3CVYA 5M72A 1KK7A 4BT8A 1BR1A 3KDSE 1S94A 2N2NA 2LNIA 3S7FA 2OVFA 4IE4A 4GU5A 4DJAA 4DO0A 2LSGA 3CQXC 3UUXB 4DI3A 4MS6A 2H3RA 2IONA 4JHRA 4BX8A 4ANJA 4I55E 1SZAA 3CVQA 3ML8A 3ONXA 5HQ8A 3FWVA 1KT1A 2DBAA 4AOFA 2KWIB 2R5SA 2CHZA 5FY7A 1FVHA 3KV9A 1WYBA 2PFVA 3AA7B 4U72A 2VKJA 4JEHA 3AU4A 2XCCA 3LY8A 2JRKA 1NAFA 2WXNA 2CEAA 4EB6E 3HKCE 3ZYMA 4KVMA 4I6EA 4PS8A 2CXFA 4HKAA 2ZM8A 3UMVA 4PAGA 4UEMA 1UG3A 4C91A 3RIBA 3CVPA 3KVBA 3HKBE 1HXIA 4BFRA 3RJVA 3CKDA 3E22E 4NUUA 5DBKA 1YA0A 2JLBA 5CCLA 4FULA 5E0OA 3PS6A 4K03A 3PUKA 4ERRA 3ZMZB 2WXOA 4AIFA 5A6CA 1EF1C 4CDRA 2V7LA 3PURA 1NA3A 2WXHA 4HLEA 4XIFA 4YNDA 4ANXA 3N2GE 1QSDA 3FP3A 1IYGA 5LOZA 3CSTA 4Z8XA 4PJNA 2WQ7A 4XBFB 4JC8A 3O1IA 3UUXA 4GCOA 2X9HA 2HPJA 3LDZA 4MALA 5CCMA 3C98B 3FUFA 3CV0A 4DLOA 3RYCE 5ARGA 2E8IA 4D10C 3VTXA 4N5CA 5DJQC 3I4GA 3CVLA 5FP3A 2YEVC 4CZZB 3ZW3A 3ESLA 4N3BA 4MRUA 3BG0B 3FU6A 3ZYKA 4PUCA 3M65A 4HOUA 4ZS3A 5LGTB 2CG2A 2KZ7B 4GCNA 5FZQA 5ENNA 2X51A 3K9IA 3SBSA 3NZPA 1E8ZA 3FTWA 3KV4A 4CEMA 3EIJA 4W9RA 5KJNA 3JUIA 4JL0A 2XPYA 1AJ3A 2YNQA 2AXVA 3P2BA 2NXPA 4CGVA 5JHBA 2LSIA 4PFOA 3ZIMA 4UWLA 5FT9A 2PM6A 3DBSA 2NTYA 4XI0A 2LAHA 3MA5A 2C5JA 2K9AA 3AA0B 4ME2A 3SHFA 2PQRA 5LHGB 4EXTA 5E75A 4YHJA 2X9XA 5JHAA 4V3IA 3K8PC 2JEKA 3MYVA 2VKHA 4G24A 1H2TC 3ASFA 2D2SA 2C0SA 1QQEA 4DBRA 1LVKA 3R7QA 4DI4A 1HE8A 3IF8B 1IQRA 3C98A 5JDFA 3D9JA 3FEXA 4QX8B 5M4YA 4EIWA 4XE0A 3QK6A 3V5SA 4KVOA 2CXDA 4FU3A 3UULA 3L22A 5ANLA 1MIVA 4X1IE 2LO6A 5FY1A 4KZ0A 1EZ3A 2EHOC 5LOVE 3I0QA 3ZN0B 1WRDA 2ZLYA 2MTQA 2M67A 4AXHA 4KT6B 3HI2A 4GA1A 1JWFA 5LCYA 3HA4A 3BEEA 4L9IA 3C4XA 2YU2A 3K3NA 4PK4A 4JA7A 2DI4A 5A23A 1MMGA 3IEGA 1OUVA 4UV9B 4PDXA 5J90A 3TXMA 2VB6A 3HKEE 4UI9J 2CE7A 3D9PA 1SZ9A 3MEKA 5ETWA 4EZ4A 2XEVA 4FLBA 4C9BB 3KFWX 3I4RB 2Y6XA 3SF4A 2WSSV 5T8IA 4N2SA 4BY6A 1E96B 5FXVA 5EZYE 4WWOA 1BR0A 4KUMB 3S7BA 3ZRHA 2OOEA 2XQ0A 1CUNA 2IU1A 2KATA 4E6HA 4GK0E 2FF4A 2P58C 4MHCA 3CR3A 2KC7A 1WAO1 4KXKB 4IIJE 3FUIA 4ZS2A 3FB2A 4BTBA 3QDNA 1LKXA 2N9DA 5JDGA 3GZSA 3PVLA 2C2LA 3FU0A 4G2AA 4L5GA 3ZGQA 2WWUA 3ZHEB 3GN5B 2XASB 4I1OB 4IN3B 4MLKA 5FZSA 5D0QD 3FXEB 4FI5A 3ZYLA 2EHOD 2D5UA 4U8HA 3ZPJA 4J0UA 2KZTB 1E8WA 1VOMA 3IEEA 1HF8A 1MMDA 2KCVA 3TG4A 1OXZA 3RKVA 3ZLIA 2VYIA 5H6QB 4NQ0A 2VGXB 4J8SA 3RC3A 2WXJA 1WYCA 3UTKA 2AXUA 4RVBA 4IYPA 2YINA 2L9QA 3Q49B 2CMRA 3K3QC 3TKLB 4JHJA 3T8MA 1Y6IA 3FTXA 3QC1A 2LOPA 2C5KT 3IV0A 4H7XA 4M3OA 4OK0A 4H9OC 1N54A 4N3CA 3RYIE 2WBLA 4PJMA 3IKOB 3N71A 4ANUA 3UPVA 3A5XA 2QY7A 2H7VC 1V9DA 4C90A 3HYMB 5H6RB 2CFUA 3PEVB 2N1GA 2I59A 3VHLA 5LA6E 4JPSA 2LEHA 2BF0X 5EK2A 4BSXA 4F53A 3ZMTB 5KMGP 4TN7B 1O3XA 3CHQA 4FLHA 2ILRA 2E0IA 3LJ3A 2YU1A 3FUKA 1US7B 5A1LA 4EECA 2LOSA 4GZ5A 3VU7H 3NBXX 3ZHEA 3QAQA 3GN5A 5LJMA 4NUVA 4NURA 4J8DA 3PUQA 4YLHA 1IQUA 3MV3B 1G73A 3HVEB 1JUQA 1TJCA 4JVSA 3N9PA 3L09A 1E90A 3RKOA 2ES0A 3D9MA 2WB2A 2LM9A 5C2YA 3C50A 4EZHA 3GZ2A 2WXMA 2KZTA 5LGUB 4ZOLE 2WXGA 2V4LA 5FQ4A 4U74A 2VGXA 4EAHA 3SNXA 5JDLA 1W3BA 3L6AA 3RX6A 3FTVA 3GA8A 3D9NA 3RO2A 3S7DA 1ELWA 3AA6B 4WBNE 4AI6A 3F57A 1WR6A 1EYHA 2BVLA 4PJLA 5D0OD 4H9QC 4JW1A 4P29A 3PE0A 2XAJB 1N52A 2NWBA 3ZCIA 3MXZA 3CX6B 2JPFA 5DQWA 2KM4A 3LCAA 3LK3B 4OYJA 5JR9B 4I43B 5AJDA 3CX8B 3PE4A 3WAJA 2I6HA 2W00A 3NF1A 5J1GA 2MRIA 3FU5A 1MIWA 4WBOA 4O4HE 3ZYQA 3QJZA 4TV3A 2GK9A 3PREA 2C0LA 4WAFA 3B13A 4AQFA 4G26A 4WWNA 3ASDA 3JYSA 3CK7A 2WM9A 4H9NC 3L13A 4U07A 3IHYA 3QB2A 4IULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WM9 A;  2WMO A;  3B13 A;  2WMN A;  3VHL A;  2YIN A; 
#chains in the Genus database with same CATH topology
 3DP7 A;  5B1B E;  5HEO A;  3I5P A;  2J47 A;  2AE9 A;  2WXI A;  2WXQ A;  4N2Q A;  3N2K E;  4N3A A;  4MBG A;  1H19 A;  3HVE A;  2KWH A;  1XDP A;  1K1A A;  4UWK A;  3DTO A;  5LHH B;  3VLD A;  1D1C A;  1PAQ A;  5B1A E;  2D0U A;  3O4X E;  2EIL E;  2A2F X;  4HS2 A;  2MOZ A;  2F8Y A;  4FJO A;  3L16 A;  2Q9Q C;  3PUG A;  3FY4 A;  3CK9 A;  3FBL A;  3LK2 B;  4GA0 A;  3ABV A;  3Q4A B;  4G1T A;  4OX9 T;  5CEA A;  2MHK A;  4DMW A;  4J6I A;  1AWC B;  3IXE A;  2RFM A;  2B1E A;  4TZ4 C;  5C2T A;  3ZMV B;  2OCC E;  2VWA A;  4L0R A;  4XAX B;  4AKG A;  5FYM A;  2VJ8 A;  3Q15 A;  1U3D A;  3AXJ B;  2X9Y A;  5L2L A;  1O1R A;  2BTD A;  4IE0 A;  4NRH B;  3Q9D A;  3ISM C;  3HL6 A;  4CI2 B;  1S63 A;  4JI6 T;  3QWW A;  3RQU A;  3V31 A;  1E7P A;  2XEE A;  2XPZ A;  1YKH B;  3QB2 A;  3FUJ A;  4FHK A;  4GTP A;  4G8K A;  1UJJ A;  4X66 T;  4AKL A;  2H6I A;  3PUS A;  4DV7 T;  2XS8 A;  5AJL A;  5KWD A;  5BT1 A;  2BVM A;  4KYO B;  4QKN A;  3LVQ E;  3J9X 1;  4GTM A;  4PJJ A;  5KDM C;  3OTN A;  1KLX A;  1OCZ E;  3UFG A;  4LF5 T;  4AY6 A;  4OVV A;  2JJ9 A;  5HXH A;  2WQY A;  5JDN A;  1KT0 A;  3PJA A;  3KVA A;  4JZY A;  5HAX A;  4HRN A;  3CK8 A;  4ILU A;  5JJT A;  1UX4 A;  2P9K G;  3MKR A;  5JR9 A;  3SGH A;  4I43 A;  4B8C B;  4JB8 P;  3HHM A;  3CX7 B;  4DR7 T;  3A8Y C;  3Q7A A;  4GZ6 A;  3TWW A;  3TWQ A;  4IDZ A;  4AM9 A;  1I94 T;  3RIU A;  3NRX A;  2OA5 A;  2OEW A;  4CN6 A;  4K0R A;  2BBH A;  3ZMU B;  4GML A;  1N36 T;  1E7U A;  2VQ2 A;  1TEZ A;  4TWH A;  2NW8 A;  4F7A A;  4ANW A;  3X2Q E;  4QWN B;  3AAI A;  3FZL B;  3KIN B;  3KAE A;  4LFA T;  4OAU C;  4OYK A;  1IBL T;  2WMO A;  4HXI A;  2K48 A;  2KLQ A;  2DIW A;  3AE6 A;  5EX3 A;  3C64 A;  1GQE A;  3PU3 A;  2IOS A;  3DSS A;  3O4Z A;  2Q9Q B;  2XGM A;  5HEU A;  4G25 A;  2QFC A;  3Q2M A;  5BW8 C;  4QH5 A;  5LJN A;  2CFZ A;  3TJP A;  3LK4 2;  4LFC T;  3EDT B;  5LBQ B;  4B3R T;  4EZK A;  3LG7 A;  4MFR A;  3FBZ A;  1HFA A;  3JCF A;  3MKD A;  2J49 A;  4GTQ A;  1DNP A;  4K0U A;  2VTB B;  2L0I A;  4LML A;  2M6I A;  4EYY R;  3IBE A;  3DSV A;  4IDP A;  1N0R A;  1HU3 A;  2DCP A;  2RD0 A;  2CWO A;  3AXJ A;  1HNZ T;  3EAB A;  3FZM B;  5HWY A;  3CVU A;  2XZD G;  3RYF E;  4I9C A;  5LCW C;  2CHX A;  4U2Z A;  2V0P A;  4AVX A;  4HRL A;  2DCF A;  4A63 B;  3UIN C;  3JQ0 A;  4BX9 A;  2UUA T;  3PZ1 A;  2YQ8 A;  3CVX A;  3PRZ A;  4TRQ A;  2KCL A;  2WXF A;  4U8V D;  4RQI A;  2XQA A;  4XKB A;  3HR0 A;  1H2U A;  1MIY A;  4TUY E;  4RG6 A;  3AS5 A;  1OT8 A;  2BDE A;  2VUR A;  2V5F A;  2W2U A;  4HFV A;  2PG8 A;  3E33 A;  3G2U A;  2VVS A;  5EIB E;  4QQI A;  2VSY A;  2J07 A;  3FH7 A;  5EK3 A;  5L3C B;  1XGW A;  1S0P A;  3FZF B;  3ZXS A;  2J4G A;  3ETV A;  1FJG T;  2A3D A;  2IW5 B;  1ZU2 A;  4JLE A;  5HXS A;  3D9H A;  3RRM B;  4GMR A;  2AWI A;  2F0Y A;  2H7O A;  3BG1 B;  5ENR D;  1LF8 A;  3I3N A;  1Z3Y A;  2WY2 A;  3VR9 A;  5BMV E;  3IHV A;  3ABL E;  2EIK E;  3MZL B;  4XEI G;  3C4Z A;  3Q5W A;  4CGW A;  3CHO A;  4A98 A;  5EDS A;  3J5P A;  2YK0 A;  5HEJ A;  3R9A B;  3QWV A;  2ODV A;  2B6C A;  2ZMA A;  3FXD B;  4X65 T;  2HN1 A;  3AE5 A;  2QVA A;  1UOH A;  3FTU A;  5CMY A;  4ZI3 C;  4FJZ A;  2P9B A;  1SA0 E;  3P4S A;  4Z91 A;  4URK A;  3DSW A;  4AIS A;  3UM0 A;  4WNK A;  1TNZ A;  5ARF A;  2MYO A;  2NW9 A;  2LSJ A;  4B3M T;  2Q9Q A;  2VL8 A;  4GTR A;  4I17 A;  2W63 A;  5KJM A;  3L17 A;  4TV8 E;  5ADX L;  3OVU A;  1A5E A;  2XHE B;  2IAK A;  4LF4 T;  3FFL A;  4I6G A;  2JIW A;  4I4T E;  1HCI A;  3AE4 A;  2AXD S;  3SQV A;  2Q7F A;  5JJ6 A;  4ZZC A;  3UQ7 A;  2VAS A;  3CVV A;  5JDH A;  2XS1 A;  3KV5 A;  3ZJ1 A;  5EN5 D;  3LJN A;  2IO3 C;  4ILH B;  2VTB A;  5EID A;  2P9I G;  4G2V A;  2ODU A;  4N78 D;  3ZT6 A;  2W61 A;  4IHJ E;  5AIJ A;  4ILI A;  1H6P A;  3MA9 A;  2NOX A;  3K3O A;  4IDQ A;  2R03 A;  1MND A;  2UY1 B;  4IL9 A;  3URZ A;  3QK0 A;  4CRW A;  2MOW A;  2IY0 C;  2HN2 A;  3CVN A;  3EJN A;  3Q5M A;  2HE0 A;  2G0U A;  4UVB B;  5JRE A;  4HOR A;  3PZD A;  3R9M A;  4Q94 A;  4KHZ F;  4CZ2 D;  5EIL A;  4J2C A;  5CA0 E;  1TNB A;  1U4Q A;  4PS3 A;  1ZBP A;  3EHN A;  2A9U A;  3RRU A;  3KBT A;  1LD7 A;  1XMO T;  4FA6 A;  4WZX A;  2X66 A;  3R6N A;  4BJM A;  2V6X A;  3Q78 A;  1ZV4 X;  5AQQ B;  2OND A;  4YDE A;  3ULQ A;  5HI7 A;  4DR6 T;  3MV2 B;  2J4D A;  1NEN A;  2JMK A;  3LFM A;  4A56 A;  3EDU A;  4TXR A;  4QH1 A;  3HXD A;  4IGU A;  4GIW A;  5G05 J;  1UX5 A;  4GPK A;  2V5Q C;  4Q96 A;  3S4U A;  4X62 T;  1D8E A;  1KNR A;  2VGY A;  3N2O A;  2XQ3 A;  3FH5 A;  1OWO A;  2X6K A;  3U64 A;  4YDY A;  4I6J A;  5H7P A;  4F6R C;  1ELK A;  4CI1 B;  4WW0 A;  2YDR A;  4XZ4 A;  1D1B A;  3UU5 A;  1EPU A;  3FUN A;  4AJW A;  2P9S G;  2YHC A;  2CG3 A;  1T8B A;  4LUN U;  2E5V A;  2LHN A;  3ZKJ A;  3P1U A;  4ZFH A;  4XI9 A;  4O1O A;  4ISS A;  2LSY A;  2SPC A;  1J1J A;  4B94 A;  1N4P A;  5IUX A;  2LAI A;  4EGW A;  4I9E A;  2X0Y A;  4YFS A;  5F8P A;  2V7I A;  3UFE A;  2IJG X;  3UKR G;  3ZJ2 A;  4NIQ A;  4DND A;  4YVQ C;  2IIU A;  4CXX A;  3WAK A;  1HR0 T;  2XHE A;  3AAA C;  5LB7 B;  3CQG B;  2I1J A;  4HFG A;  5FIN A;  2DLR A;  3ZKR A;  2XCB A;  2DWG A;  3UT8 A;  1IJ6 A;  4GOU A;  3RU0 A;  2XQ7 A;  1LD8 A;  2AVP A;  4AKH A;  3JQ1 A;  4TXP A;  4HGA A;  4U8Y D;  4GAA A;  3KEZ A;  3ZN3 A;  3SZ7 A;  4AP2 A;  1FIO A;  1HG5 A;  4MLP A;  4O8S A;  4JHK A;  4N39 A;  1DC2 A;  3ZVV A;  4CN1 A;  3OKQ A;  3Q73 A;  4L1B A;  3LKU A;  3PNL B;  2UY1 A;  3DJB A;  4GZC A;  3W15 B;  4LCT A;  4HFH A;  2DZN A;  2FI7 A;  4H7Y A;  1N33 T;  4G8L A;  5E76 A;  1A17 A;  3DRA A;  4K5A B;  1NWM X;  3PZ2 A;  2XSA A;  3T1Y T;  4UI9 K;  1K8K G;  3FTZ A;  4HRM B;  3S2A A;  2XRY A;  4AQF C;  4A55 A;  3RPU A;  4J8Y A;  3UX4 A;  5JA4 D;  3AU5 A;  3FHE A;  2CXL A;  3G2T A;  3FH8 A;  3E08 A;  1G8X A;  2WXR A;  4EHM A;  1YW0 A;  3TWU A;  4ILC A;  3TG5 A;  5ABG A;  3P4W A;  4P0B A;  2ZU6 B;  3CLJ A;  3F2E A;  4GPM A;  4O6F A;  2IO2 C;  1U2V G;  4GZ3 A;  3TXN A;  2L3L A;  4OFZ A;  3ML9 A;  3TWS A;  1TYQ G;  2IOL A;  4BER A;  4TWF A;  1IKN D;  5FNV E;  3SFD A;  3RHW A;  5D66 A;  4P0A A;  4I0U A;  4TUU A;  1QUU A;  2UU9 T;  5EX0 A;  4OYS A;  2CHN A;  2P9P G;  5JDQ A;  3HRA A;  5LMN T;  4KZC A;  3TL5 A;  3HIZ A;  4ILG A;  3PUJ A;  4F6R D;  3GWH A;  3G2W A;  5FWQ A;  4GB9 A;  4E7Z A;  2QRX A;  2ACZ A;  3PUX F;  2BS2 A;  2AJA A;  1H2V C;  1KZP A;  3APD A;  4UQZ A;  3AAA B;  3N9O A;  5EYL A;  3ULY A;  3I1A A;  3FUH A;  4OAV B;  3EHR A;  2UXB T;  4BA9 A;  4NXN T;  4GYW A;  4KMC A;  5LNK A;  3EU5 A;  4AQG A;  5LFA A;  4GMJ A;  1OY3 D;  5G04 J;  4B3T T;  2BKO A;  5LP6 E;  3OXF A;  2D0T A;  4DUZ T;  1MX2 A;  4BTA A;  1NZN A;  5LXT E;  3L82 A;  2IFU A;  3PDY A;  5HCJ A;  3C3R A;  1JWG A;  2FUL A;  2RG8 A;  3E4B A;  3UIO C;  5JR9 C;  1N11 A;  1B89 A;  4HN9 A;  1BR2 A;  2V1D B;  2CLY C;  5FZR A;  4BSZ B;  5IHY A;  1P5Q A;  3C72 A;  1MQS A;  3ZC0 A;  3LYA A;  1M7K A;  3P4Q A;  3FUL A;  4FAD A;  1MZC A;  4RSY A;  4UI9 C;  2WXK A;  4U31 A;  1JCS A;  3ZU7 B;  2QA7 A;  5FQ7 A;  4UVC B;  1NL4 A;  3D9O A;  4GTV A;  3RKG A;  3BUA A;  2DYS E;  1HS7 A;  3C4W A;  4HWI B;  4UQY A;  3CVW A;  1OCC E;  4GKK T;  3NOC D;  3MAC A;  2UUC T;  3E0Z A;  3P7I A;  4BEP A;  4IDN A;  4KBM B;  2OLT A;  1MJ0 A;  2AXZ A;  4CDM A;  3UUN A;  3I9W A;  3SBT B;  1ZEE A;  2WQ6 A;  1E7V A;  2XAG B;  3AJI A;  3PNT B;  4AY5 A;  5AQH B;  3I0O A;  5ITZ F;  3R7R A;  2BED A;  5FXX A;  4YVO A;  2V8S V;  3U3W A;  5HXR A;  4X20 E;  3RRW A;  3G2V A;  4B8A A;  4RLY A;  4ATZ D;  3DST A;  3PUA A;  5C8Y E;  3DPD A;  3ESK A;  4NXM T;  1YYH A;  2EQX A;  1D0Z A;  3JCK C;  3A7M A;  5GON E;  3SI5 A;  4E85 A;  2BBJ A;  4X1K E;  2Y48 B;  1Y01 A;  1O1S A;  3U4T A;  3UU6 A;  3RC8 A;  2IC6 A;  2VSN A;  3TGO A;  5HXC A;  1NFI E;  4LNG A;  2XAF B;  3Q5X A;  1R8I A;  4X1Y E;  2CCQ A;  2RPA A;  3PUV F;  2I1K A;  4YTM A;  4MBQ A;  1JCR A;  2D9D A;  3C3O A;  4UEL A;  3RO3 A;  3UT5 E;  3F31 A;  2HPL A;  1XZY A;  2XQ4 A;  1XNF A;  4HI8 A;  3ETU A;  3OXG A;  2LJL A;  1S64 A;  3UXG A;  2Y69 E;  2CLY B;  4YTP A;  4UIG A;  2BG9 C;  3HXF A;  4H63 H;  3T5X A;  4I2Z A;  2K24 A;  1INZ A;  3UIP C;  4EOZ B;  1XNQ T;  5BXU A;  3ZNG A;  5HXE A;  2JQQ A;  4HOQ A;  4YDO A;  5IYZ E;  1N4R A;  3AEF A;  4FC8 A;  4DRX E;  5L3E B;  3MGB A;  3QC9 A;  5BNW A;  4H9R C;  3MKQ B;  1YD8 G;  1X5B A;  4PK5 A;  1HO8 A;  2VVN A;  4C0M A;  1OED C;  2ZGG A;  2J08 A;  1H0A A;  1IBM T;  1HX8 A;  4B6X A;  3AEA A;  2YHE A;  1OWN A;  3ULE G;  3DSX A;  4YXD A;  2BKN A;  1N4S A;  5T4Y A;  3ONK A;  3AB3 B;  2JAB A;  1QNF A;  2KT9 A;  4V1A v;  1G3N B;  1VDY A;  5CB4 E;  1NA0 A;  2NSZ A;  1IZN B;  3IBP A;  4HWH A;  2XAH B;  1KF6 A;  1N32 T;  3CSF A;  3FEY A;  3E34 A;  5G04 C;  4EV6 A;  2WMN A;  4QH4 A;  4EPZ A;  4HOT A;  2HHH T;  2BKP A;  2OV8 A;  1D0X A;  4TV9 E;  3F6Q A;  2PL2 A;  3D9L A;  2ZIR A;  3L3P A;  3AG4 E;  4WNF A;  1JNZ A;  3RQW A;  2UXN B;  4GZD A;  3T8O A;  2ZIS A;  5JDM A;  3HDX A;  4Z68 A;  2WU2 A;  2R02 A;  4EZL A;  2W0G A;  3RK6 A;  2EIJ E;  3RF1 A;  1X81 A;  3ZC1 A;  3ZFW A;  4DUI A;  3HG0 D;  4O2A E;  3UQ4 A;  3LXU X;  2WDV A;  4DV5 T;  3NZU A;  1GW6 A;  1KPS B;  1FMV A;  2K3W A;  2BG9 B;  1PY1 A;  4IT4 A;  3T8K A;  2NR4 A;  3O1J A;  2QC9 A;  2WPV A;  2XZE A;  3EDV A;  5G2N A;  1WLX A;  4DPR A;  2XY8 B;  3ASO E;  4B0Z A;  2E2A A;  2DNX A;  3HXB A;  3MJX A;  1FCH A;  1ZB1 A;  5BV1 A;  2V26 A;  4UXN B;  2BUG A;  2GRO B;  5ENT D;  4BET A;  4MKT A;  2FJB A;  4HFC A;  4Q69 A;  3P4R A;  3D9I A;  5ENO D;  2KBX A;  1OED B;  3VLE A;  3O9X A;  3ENE A;  4QHO A;  2A4Z A;  2IUB A;  5DQV A;  4M1P A;  1Z3X A;  2NC9 A;  3MKQ A;  4LF6 T;  2A5E A;  5L3F B;  5LGN B;  2Y4T A;  2DHR A;  3CHP A;  3O48 A;  2GW1 A;  3MCX A;  3SFY A;  3N9Q A;  2WP9 A;  3CHS A;  3B7U X;  3MJW A;  3WXX A;  3GMI A;  2PZI A;  2BKK B;  2GRL A;  1RW2 A;  3PUW F;  1HTJ F;  3OYZ A;  5LP0 A;  4CT4 A;  3V79 K;  4U3C A;  3APF A;  3ONL C;  1MNE A;  4WNG A;  4H9S E;  3PH0 C;  4EBA G;  2A72 A;  4LNU D;  3B7R L;  4DLQ A;  2A5U A;  5CHE E;  2JMH A;  4PH4 B;  4DX6 D;  3AE1 A;  3T5V A;  3VKG A;  4IE6 A;  3EAM A;  3U78 A;  5FQ6 A;  3AG1 E;  1VCS A;  3KEA A;  2I2O A;  1YQ3 A;  4GYR A;  3QWP A;  3TWX A;  4UQX A;  4KP3 C;  4UUC A;  4ZEY A;  4ACL A;  4DBQ A;  3B57 A;  3FZK B;  5HS0 A;  3ABK E;  2Q9Q D;  2XPI A;  2CM0 A;  2FBN A;  4ATG A;  4DR3 T;  2R59 A;  4EZJ A;  4JI4 T;  1OWP A;  5JQG E;  5DAB A;  2X67 A;  5L47 A;  4TNV A;  4B89 A;  4QXH B;  1UJK A;  1EDU A;  1PC2 A;  2Y8D A;  4PW8 A;  3ANW B;  5TAO A;  4AIU A;  3PDN A;  2XTL A;  3KBU A;  2VKO A;  4GK5 E;  3CEQ A;  4JXT A;  1CHU A;  3RRN B;  3N9N A;  1TN8 A;  5T3R A;  1QZ2 A;  3W9F A;  5J08 A;  2EIM E;  3D9K A;  2I9C A;  2JQK A;  3ZPO A;  2W67 A;  2FEZ A;  1Z5S C;  1MMN A;  4PNI A;  2E2E A;  4WWP A;  2BZB A;  1U5P A;  2HR2 A;  3G06 A;  2BG9 A;  3O1H A;  5L3G B;  4LRZ A;  2PBI A;  1SUM B;  1W9R A;  5L3B B;  4L23 A;  4APF A;  1HS6 A;  2HH7 A;  3N5L A;  5F3J A;  3OBV E;  5JRC B;  3S7J A;  5L4E A;  1FMW A;  2FUP A;  3MX3 A;  3N9L A;  2X0L B;  3FTY A;  4Z90 A;  3KS2 A;  3EUV A;  3EUH A;  5AQS B;  2LT3 A;  2VKD A;  2F4V T;  4PFP A;  2RP4 A;  3BK9 A;  4GA2 A;  5C1D A;  3TWV A;  2M6B A;  2FJD A;  2OVB A;  5LBM A;  2XJ7 A;  1UW4 B;  2HYZ A;  4ASK A;  5JJ7 A;  1M62 A;  1OED A;  3FHN A;  2L0T B;  5DIZ A;  4M7C A;  1K3Z D;  2J9Q A;  2XQ5 A;  2HO1 A;  3DXM G;  3FUE A;  5ANR A;  2ETA A;  2Y0B G;  3VTY A;  2ETB A;  1LVF A;  3TAX A;  5AQ7 A;  2R6G F;  4HOS A;  5FMN A;  4QX7 B;  3OXL A;  3U3I A;  2CA5 A;  4DV6 T;  4DV0 T;  5AYW D;  1ZP0 A;  3BQL A;  3B7B A;  5EKQ D;  4YJ3 E;  3UM3 A;  3IHR A;  2JQ9 A;  1UN8 A;  2QYU A;  4JA9 A;  3D0T A;  4CXW A;  4F8H A;  5AQT B;  2QZA A;  3SD5 A;  4IRE A;  3EU9 A;  5JMN D;  1B7T A;  5AQU B;  2P9L G;  2CWY A;  4IDO A;  1HG2 A;  4JI3 T;  2XQ8 A;  4U33 A;  4I50 E;  5LHI B;  2XUE A;  4O4I E;  3MZK B;  1H6K A;  1ZHC A;  2J09 A;  3E32 A;  2X3M A;  4CYM D;  4AEZ C;  4A97 A;  4P09 A;  3FZH B;  1OWL A;  4ZI2 C;  1O1T A;  2WU5 A;  5L3D B;  1L5J A;  1SHZ C;  2E5L T;  1H6O A;  3CVR A;  2LSU A;  1N9A A;  3QOU A;  2IML A;  4QFV A;  3UQ3 A;  3OJA A;  4UVA B;  1Z6T A;  2XRZ A;  2K5B B;  3ANW A;  3CML A;  5L4H A;  4I1A A;  4CQI A;  3B7T A;  4J8F A;  4QXB B;  2V6Y B;  5KNH D;  1HNX T;  5CEC B;  3H37 A;  4KX6 A;  3RH3 A;  4GTO A;  1SA5 A;  2H6H A;  1UK5 A;  5AQ9 A;  4LER A;  1IJ5 A;  4XX5 A;  2ZM0 A;  3AEE A;  3RIF A;  1W0B A;  5J2U E;  4DV2 T;  3Q9N C;  3UU3 A;  1N94 A;  1WM5 A;  3P8C D;  5FXW A;  3K1S A;  4EQF A;  3ZCJ A;  4I2W A;  2J1D G;  2FO7 A;  1VRB A;  4XZC A;  4F3V A;  5JRC A;  3Q47 B;  1OXJ A;  4DK5 A;  2UWJ G;  4A3V A;  4U0S A;  2BG9 E;  3QAR A;  4BJN A;  1L0V A;  2AW6 A;  5FXZ A;  4U7I A;  4HBD A;  3LEW A;  4O4J E;  1RZ4 A;  4DX7 D;  3JC6 C;  2XM1 A;  3BQK A;  1BI8 B;  2C0M A;  5ENS D;  4FP7 A;  2LE8 A;  2FJA A;  2V8S E;  3TLS A;  2XZT G;  1HH8 A;  2VSO E;  3Q75 A;  3CQC B;  3FDH A;  3DWL G;  3ONL A;  4AKI A;  2F8X K;  1D1A A;  3ZN1 B;  3NZQ A;  3JAF A;  4GYY A;  2MBG A;  2WAU A;  1OED E;  3RLF F;  4BWR A;  5LYJ E;  2LSK A;  2X9W A;  3TLT A;  2PQN A;  3MK7 C;  5CGM A;  3V2O A;  2ETC A;  1X79 A;  1YMP A;  1YKE B;  3LPZ A;  4AXP A;  4ZI3 D;  3ZMS B;  2M63 A;  4BT9 A;  1ZOY A;  2PJQ A;  3FUM A;  3UUM A;  2DVW A;  3AED A;  1T98 A;  1Y64 B;  3ASN E;  4U0Z A;  1OWM A;  1LRZ A;  2V5C A;  3L54 A;  3LBX B;  3CGH A;  4O4L E;  3LS8 A;  1SQM A;  3C51 A;  4AKR B;  5J2T E;  4EEB A;  1QYM A;  5AQA A;  3AS4 A;  1JPL A;  2PTF A;  3HXE A;  4FHJ A;  1K1B A;  2X6J A;  1BLX B;  2DWZ A;  2L8K A;  5AQI B;  1MHQ A;  5AQG B;  2L6J A;  1U3C A;  4A1S A;  3EHZ A;  2RA1 A;  3V5U A;  4HNA D;  4A3T A;  3QNK A;  3N9M A;  2W62 A;  3NWI A;  2LXM A;  4F1P A;  2WZI A;  4Y6C A;  1BPO A;  2XEH A;  3QKY A;  1UGO A;  3G2S A;  3PEU B;  1MMA A;  4ZI2 D;  5HWX A;  4G11 A;  1DU2 A;  1TNO A;  2Y4U A;  5LG4 A;  2V6Y A;  5J0Z A;  4IRU A;  1HZ4 A;  2L9B A;  3AVR A;  2IDO B;  2IHR 1;  5FQ8 A;  4JEU B;  2YN6 A;  2WXP A;  5CED B;  1H7C A;  3CWZ B;  5HEG A;  5AQF B;  2ZXW E;  4QXC B;  4COF A;  3E37 A;  2NP9 A;  4F1S A;  2W4X A;  4EED A;  2CHW A;  4H63 V;  3PV0 F;  3AE9 A;  3VLF A;  4ACK A;  3EIQ C;  2V7M A;  2GRM A;  3FTS A;  2EHO B;  4AQY T;  4PS7 A;  5KJL A;  2PM7 A;  2LKH A;  2C5I T;  4WND A;  2XGS A;  4APO A;  3VR8 A;  3KV6 A;  3AG3 E;  4AV7 A;  3RRC A;  5FJY A;  3UKU G;  2KND A;  3QNU A;  4U04 A;  4E7S A;  3LJC A;  2ZGD A;  4NAC A;  4XKC A;  3PU8 A;  2X6H A;  4A5X A;  4HTE A;  2DWK A;  2YKS A;  3JUE A;  1YXR A;  3R84 B;  2E9X C;  1E1H B;  2WB5 A;  2WZH A;  1WR0 A;  3OYX A;  2BS4 A;  3CIA A;  3JC6 D;  2UUB T;  4JV5 T;  4YSY A;  2VK9 A;  4BAY B;  4RG9 A;  5AEN A;  2KIN B;  4U63 A;  1FEW A;  4U7Y A;  1KNP A;  1FT2 A;  3HKD E;  4GYO A;  2V7J A;  4CDN A;  2KSR A;  4YJ2 E;  4IE5 A;  2WDQ A;  3SFX A;  4LF8 T;  4X8Q A;  2NTX A;  4ANV A;  3NZS A;  3U9W A;  2XQ6 A;  4TX5 A;  3GW4 A;  4EBA A;  1DCQ A;  2KXP C;  2R2L A;  4PK6 A;  5ABF B;  3LBX A;  3SFZ A;  3PTR B;  4YY3 T;  4LNB A;  3TWR A;  3SOL A;  5KCM A;  5IWA T;  1DVP A;  3UT7 A;  5BPP A;  2KCK A;  3SRZ A;  3PE3 A;  5AQJ B;  3UT4 A;  2V7K A;  1N0Q A;  2R17 C;  3D3M A;  5G05 C;  4DX1 A;  2BS3 A;  2X38 A;  2X68 A;  3AVS A;  4HI9 A;  1UCU A;  3Q5D A;  2UXX B;  1MX4 A;  3EVY A;  1XDO A;  1Z0P A;  4DMV A;  2LHR A;  4BES A;  1FVF A;  4A1G A;  4IE7 A;  4TNW A;  2QYJ A;  1UUR A;  4UF0 B;  5B3S E;  3NBN B;  5FY0 A;  5EYP F;  3ZEF B;  3J7Y q;  4JEU A;  3IA3 A;  3HXC A;  4HE8 A;  5JVD E;  3SS1 A;  5BUZ A;  1Y8M A;  3B5M A;  3AS8 A;  5CA1 E;  3LY7 A;  1BR4 A;  5AQR B;  3ASG A;  4G63 A;  3KD7 A;  1TJF A;  2EHO A;  3V2X A;  3QUJ A;  1ZKE A;  3AAE B;  1WY6 A;  2MYS A;  2LKG A;  3Q7F A;  2E9X B;  3CKB A;  1E8X A;  2J4B A;  4HWD A;  4LMK A;  3CKC A;  4OVU A;  3B7S A;  2Y3A A;  2KMF A;  4HVB A;  2XAQ B;  3CHM A;  1XMQ T;  4CXY A;  1ELR A;  2WVI A;  2XQY A;  1S35 A;  4ADZ A;  1IHB A;  3L08 A;  1E2A A;  1J5E T;  4ZHQ E;  5BV0 A;  2FBW A;  3APC A;  2VSX E;  3OAW A;  3SWH A;  2PNN A;  1IHG A;  3FU3 A;  3RIA A;  2E9X D;  5AQN B;  4FJY A;  3H3A A;  1BI7 B;  3GYZ A;  4I1M A;  2Z6E A;  2QGS A;  5G55 A;  5LX8 A;  3SFE A;  4DVD A;  5A7D B;  4L7T A;  1V54 E;  5CMW A;  2KXP B;  3C5R A;  2JQH A;  3GZ1 A;  2LM2 A;  2CRB A;  3LY9 A;  4KBQ A;  4R7L A;  4CI3 B;  4X5T A;  3WI3 A;  4DID B;  2LSV A;  4HFI A;  3LVR E;  5KXJ A;  2IC9 A;  3U66 A;  1NP7 A;  3I9Y A;  1IAP A;  5FKY A;  4GYS A;  3PZ4 A;  5ABF A;  2UXC T;  2CPT A;  4UWF A;  2IF4 A;  2IQC A;  4UWG A;  3ASH A;  2LRL A;  4UV8 B;  1OWA A;  5AFU L;  1OCR E;  4U2Y A;  1UN9 A;  4CCA A;  2J8S D;  4G23 A;  1E8Y A;  4JEH B;  4ZI7 E;  4Q25 A;  2GRN B;  4JUY A;  2NW7 A;  1TR4 A;  4L2L A;  2V4H C;  3NRY A;  2HM8 A;  2OV9 A;  4HEA A;  4UWH A;  2XSB A;  4KMO A;  1I6Z A;  5EK4 A;  5ENQ D;  5JH7 E;  3FUD A;  2X6F A;  1D0Y A;  3NQP A;  4EYU A;  2P2C P;  2WXL A;  3AA1 B;  4Y6W A;  5LCW J;  1KNZ A;  4HQD A;  2XGO A;  3CPZ A;  4UF0 A;  4J7W A;  4CT0 A;  2WQH A;  3ZEF A;  3VKH A;  1S70 B;  4OHF A;  2F37 A;  2XEN A;  4J8E A;  2X6I A;  5FTP A;  4WNE A;  3ZT5 A;  2VL0 A;  4DV3 T;  4H9P C;  4IST A;  4L2Y A;  4U0U A;  5KJK A;  4L9P A;  3DXK G;  3BQI A;  3EHM A;  4ABN A;  5KX5 E;  5HYA A;  3RYH E;  4O2B E;  3CHR A;  4C0E A;  4LEU A;  2E9X A;  2GGF A;  5IY5 E;  5FVK A;  2ACX A;  2ZM2 A;  4X64 T;  3L8R A;  4WUY A;  5M72 A;  2CBI A;  3CVY A;  1KK7 A;  4BT8 A;  1BR1 A;  3KDS E;  1S94 A;  3UU4 A;  3X1D A;  2N2N A;  2LNI A;  3S7F A;  2OVF A;  4IE4 A;  4GU5 A;  4DJA A;  4ZHB A;  4LF9 T;  4DO0 A;  2LSG A;  3CQX C;  3UUX B;  1IXV A;  2P9U G;  4DI3 A;  4MS6 A;  2H3R A;  3L9T A;  2ION A;  4HWC A;  4JHR A;  3AG2 E;  4BX8 A;  4ANJ A;  4I55 E;  3QB5 A;  1SZA A;  5AQB A;  3CVQ A;  3ML8 A;  3ONX A;  5LG3 A;  5HQ8 A;  3QOF A;  3FWV A;  3ABM E;  5ABE A;  1NEK A;  4KHP T;  1QLB A;  3ZUV B;  1KT1 A;  2B76 A;  4ZXL A;  2DBA A;  4AOF A;  2KWI B;  2R5S A;  2CHZ A;  5HKP A;  5FY7 A;  4C48 B;  1FVH A;  3KV9 A;  1LTX A;  4LSZ E;  4YSX A;  1WYB A;  1N95 A;  2PFV A;  3AA7 B;  5AQK B;  4U72 A;  2VKJ A;  4JEH A;  3AU4 A;  2XCC A;  3LY8 A;  2JRK A;  1NAF A;  2W66 A;  2WXN A;  2CEA A;  4EB6 E;  3HKC E;  3ZYM A;  1Q2Z A;  4KVM A;  4I6E A;  4PS8 A;  2CXF A;  4HKA A;  2ZM8 A;  2RFA A;  4PAG A;  3UMV A;  2DL1 A;  4UEM A;  1UG3 A;  5CJ5 A;  4C91 A;  5FL1 A;  3RIB A;  3CVP A;  3KVB A;  3HKB E;  1HXI A;  4DR1 T;  4BFR A;  3RJV A;  3CKD A;  3E22 E;  4NUU A;  5DBK A;  1YA0 A;  3ZST A;  2GRR B;  2JLB A;  5CCL A;  4NPP A;  5CRV A;  4FUL A;  3E30 A;  5E0O A;  2BKG A;  2DYR E;  3PS6 A;  4K03 A;  4DV4 T;  3PUK A;  1X9B A;  4ERR A;  5CBN A;  3ZMZ B;  2LUH A;  2WXO A;  4AIF A;  5A6C A;  1EF1 C;  4CDR A;  2V7L A;  3PUR A;  1NA3 A;  1MX6 A;  2WXH A;  4HLE A;  4K5C A;  4XIF A;  3P50 A;  4YND A;  4ANX A;  3N2G E;  2UXD T;  1QSD A;  2MAW A;  3FP3 A;  5HEH A;  1IYG A;  5LOZ A;  3CST A;  1KEY A;  4Z8X A;  4PJN A;  2WQ7 A;  3AE8 A;  3NAW A;  3L39 A;  5AQO B;  4XBF B;  4JC8 A;  3O1I A;  3UUX A;  4GCO A;  3KSL A;  2X9H A;  2HPJ A;  3LDZ A;  4MAL A;  1D8D A;  3KSQ A;  5CCM A;  5FVL A;  2FJE A;  3C98 B;  3FUF A;  3CV0 A;  4DLO A;  3RYC E;  3PZ3 A;  5ARG A;  2E8I A;  2J62 A;  4D10 C;  3VTX A;  4N5C A;  2MPK A;  3DSU A;  5DJQ C;  3I4G A;  2ZM6 T;  1BU9 A;  5KNG A;  1W0A A;  3CVL A;  5FP3 A;  1J5W A;  2YEV C;  4CZZ B;  4GTT A;  5KBA A;  3ZW3 A;  5LMU T;  3ESL A;  3Q5E A;  3VRB A;  4N3B A;  4MRU A;  3BG0 B;  3EHQ A;  3FU6 A;  3ZYK A;  4JD2 G;  3AE2 A;  4PUC A;  3M65 A;  1QBQ A;  4HOU A;  4ZS3 A;  3JAD A;  3RGL A;  4DX2 A;  5LGT B;  5AN8 A;  2CG2 A;  2KZ7 B;  3BQO A;  4GCN A;  5FZQ A;  1SVX A;  5ENN A;  2X51 A;  3K9I A;  3SBS A;  3NZP A;  1E8Z A;  4WYV A;  3FTW A;  3KV4 A;  1TNY A;  4CEM A;  3T9K A;  3CIR A;  3EIJ A;  4W9R A;  5KJN A;  3JUI A;  2VQE T;  4JL0 A;  2XPY A;  2VGE A;  1AJ3 A;  2YNQ A;  1XWM A;  2AXV A;  3P2B A;  2NXP A;  4JBW F;  4CGV A;  1BD8 A;  5JHB A;  2LSI A;  4PFO A;  4O1P A;  3RSE G;  4UR9 A;  4UWL A;  2GRQ B;  4YTN A;  3ZIM A;  5FT9 A;  2PM6 A;  3DBS A;  2NTY A;  4O60 A;  4XI0 A;  4IL4 A;  2LAH A;  2H6G A;  3MA5 A;  2C5J A;  2K9A A;  3AA0 B;  4ME2 A;  3SHF A;  5CFB A;  2PQR A;  5LHG B;  4EXT A;  5E75 A;  4YHJ A;  2X9X A;  5JHA A;  4V3I A;  3K8P C;  3UUB A;  4DX5 D;  2JEK A;  4ILA A;  4U95 D;  4JI8 T;  3MYV A;  2VKH A;  4KI0 F;  4G24 A;  1H2T C;  2YDS A;  3NKZ A;  3ASF A;  3AEB A;  2D2S A;  2C0S A;  1QQE A;  3BU8 A;  4YDW A;  4DBR A;  1LVK A;  3R7Q A;  4DI4 A;  1WFD A;  5BXO A;  4TWD A;  1HE8 A;  3IF8 B;  1IQR A;  3C98 A;  3ONJ A;  5JDF A;  3D9J A;  3FEX A;  4QX8 B;  1T72 A;  5M4Y A;  3SY2 A;  4EIW A;  1W09 A;  3V30 A;  4XE0 A;  2FO1 E;  3H3M A;  3QK6 A;  4HFD A;  3V5S A;  4KVO A;  2CBJ A;  5AAO A;  2CXD A;  4FU3 A;  3UUL A;  1HNW T;  3L22 A;  4JI2 T;  5ANL A;  1MIV A;  4X1I E;  3M3Z B;  2LO6 A;  5FY1 A;  4K0K T;  4KZ0 A;  1EZ3 A;  2EHO C;  5LOV E;  1T7S A;  3I0Q A;  3ZN0 B;  1WRD A;  4TXQ A;  4B93 B;  2ZLY A;  3NOG D;  1WCR A;  2MTQ A;  2M67 A;  5HRY A;  3PJA J;  4KT6 B;  4AXH A;  3HI2 A;  4GA1 A;  4YSZ A;  1JWF A;  3J5Q B;  5FIO A;  1TNU A;  5LCY A;  3HA4 A;  3BEE A;  4L9I A;  3C4X A;  2YU2 A;  4DR2 T;  3K3N A;  4JI1 T;  4PK4 A;  4JA7 A;  2Y1L E;  1TN7 A;  2DI4 A;  3LDQ B;  5A23 A;  1MMG A;  3IEG A;  1OUV A;  4UV9 B;  1IBK T;  4PDX A;  5J90 A;  3TXM A;  2VB6 A;  2WS3 A;  3HKE E;  4LF7 T;  4UI9 J;  2CE7 A;  3D9P A;  1SZ9 A;  4LMJ A;  3MEK A;  5ETW A;  4YHH T;  3UTM A;  4EZ4 A;  5AQM B;  3AEG A;  2XEV A;  4FLB A;  4C9B B;  3JAE A;  3QB5 K;  1O5M A;  3KFW X;  3I4R B;  2Y6X A;  1OCO E;  3SF4 A;  3AE7 A;  3T1H T;  4JYA T;  4HWF A;  4YT0 A;  2WSS V;  5T8I A;  5AAR A;  4N2S A;  4BY6 A;  1DCE A;  1FT1 A;  1E96 B;  5FXV A;  3B95 A;  3C3Q A;  5EZY E;  4WWO A;  5FL0 A;  1BR0 A;  5C3J A;  4KUM B;  3S7B A;  3ZRH A;  3TLV A;  2OOE A;  2XQ0 A;  1CUN A;  2X0H A;  3P4P A;  2IU1 A;  2KAT A;  4E6H A;  1HX1 B;  4GK0 E;  2FF4 A;  2P58 C;  4MHC A;  4P1N A;  2XQ9 A;  2KC7 A;  1WAO 1;  2R05 A;  3CR3 A;  4KXK B;  4IIJ E;  2VQF T;  4ZS2 A;  3FUI A;  3FB2 A;  3DEO A;  4BTB A;  2XM2 A;  3QDN A;  1LKX A;  4IUL A;  2N9D A;  5JDG A;  3GZS A;  4CN4 A;  3PVL A;  3W9G A;  1N34 T;  4K5B A;  2C2L A;  3FU0 A;  4G2A A;  4L5G A;  1N4Q A;  3ZGQ A;  2WWU A;  3Q79 A;  4TUM A;  3ZHE B;  3GN5 B;  5JTG A;  3TLU A;  3VRA A;  2XAS B;  4I1O B;  4B3S T;  4IN3 B;  1WG0 A;  4MLK A;  5FZS A;  5D0Q D;  3FXE B;  4FI5 A;  3ZYL A;  2EHO D;  2D5U A;  4U8H A;  3ZPJ A;  4DR5 T;  4J0U A;  2KZT B;  1E8W A;  1VOM A;  3IEE A;  1HF8 A;  1NI1 A;  5AQV B;  1MMD A;  2EIN E;  2KCV A;  3TG4 A;  1OXZ A;  3TLW A;  3RKV A;  3ZLI A;  2VYI A;  5H6Q B;  4NQ0 A;  2VGX B;  4J8S A;  3RC3 A;  2WXJ A;  1WYC A;  3Q9U C;  3UTK A;  1V55 E;  2DZO A;  2AXU A;  4RVB A;  4GKJ T;  1JNR A;  2I0M A;  4IYP A;  2YIN A;  2L9Q A;  4JI5 T;  3DPY A;  3Q49 B;  1YQ4 A;  2CMR A;  3K3Q C;  3TKL B;  4JHJ A;  3T8M A;  1Y6I A;  3OTO T;  2OEV A;  3FTX A;  2LOP A;  3QC1 A;  2C5K T;  3IV0 A;  4H7X A;  3NB2 A;  4M3O A;  2LXL A;  3AEC A;  4H9O C;  4OK0 A;  3PUY F;  1N54 A;  4N3C A;  1SW6 A;  4ILB A;  3RYI E;  3CK6 A;  3ZSS A;  2RKK A;  2WBL A;  5BR8 T;  4PJM A;  1UUS A;  5AQL B;  3IKO B;  3N71 A;  4ANU A;  3UPV A;  3A5X A;  5F5W A;  2QY7 A;  2H7V C;  1V9D A;  3PUZ F;  4HFE A;  4C90 A;  4LFB T;  3HYM B;  5H6R B;  2CFU A;  3PEV B;  2N1G A;  3NVO A;  2I59 A;  3JXJ A;  2WDR A;  3VHL A;  5LA6 E;  4JPS A;  1KFY A;  2CHO A;  5HCM A;  2LEH A;  4JI7 T;  2BF0 X;  5EK2 A;  4BSX A;  4F53 A;  3ZMT B;  5KMG P;  2YOE A;  4DV1 T;  4TN7 B;  3TWT A;  4HLL A;  3LSV A;  1O3X A;  3CHQ A;  4ZZB A;  4FLH A;  1TN6 A;  2ILR A;  4DR4 T;  2E0I A;  4DUY T;  3LJ3 A;  2YU1 A;  3FUK A;  1US7 B;  3RIU C;  3WG7 E;  2NYJ A;  3EI0 A;  5A1L A;  4EEC A;  2LOS A;  4GZ5 A;  4NIK A;  3VU7 H;  3NBX X;  3ZHE A;  3QAQ A;  3UM1 A;  3GN5 A;  5LJM A;  4NUV A;  4NUR A;  4J8D A;  3PUQ A;  4YLH A;  1IQU A;  3MV3 B;  1G73 A;  3HVE B;  3SO8 A;  2LLY A;  1JUQ A;  1TJC A;  4JVS A;  3N9P A;  3ZT7 A;  2P9N G;  4HB5 A;  3L09 A;  4U96 D;  1AP7 A;  1E90 A;  4LG6 A;  3RKO A;  2ES0 A;  3D9M A;  3RI5 A;  3RAU A;  2QYW A;  2WB2 A;  2LM9 A;  5C2Y A;  1XNR T;  5CBO A;  3C50 A;  4EZH A;  1WDY A;  3GZ2 A;  2WXM A;  2KZT A;  1SA4 A;  5LGU B;  4ZOL E;  4GTS A;  5AQP B;  2WXG A;  4N5Q A;  1VCT A;  4U7E B;  2V4L A;  5FQ4 A;  1D9S A;  3DEP A;  4U74 A;  5ABH A;  3UM2 A;  2VGX A;  4EAH A;  3SNX A;  5JDL A;  1W3B A;  3L6A A;  3RX6 A;  3FTV A;  3GA8 A;  3D9N A;  3OPC A;  2L6B A;  2H88 A;  3RO2 A;  2WWV A;  3S7D A;  1ELW A;  5CER B;  3AA6 B;  4WBN E;  3F57 A;  1WR6 A;  4AI6 A;  4PJL A;  2BVL A;  1EYH A;  2IEJ A;  4H9Q C;  4JW1 A;  4P29 A;  3PE0 A;  5D0O D;  2XAJ B;  3JXI A;  1N52 A;  2NWB A;  2YDQ A;  2LRK A;  5CRU A;  1JCQ A;  3ZCI A;  3MXZ A;  3CX6 B;  5D2M C;  2JPF A;  5DQW A;  1KZO A;  2KM4 A;  3UI2 A;  3LCA A;  3LK3 B;  4OYJ A;  5JR9 B;  2H89 A;  4I43 B;  1MYO A;  2B0O E;  2GRP B;  1FPP A;  5AJD A;  3CX8 B;  3PE4 A;  3WAJ A;  2I6H A;  2W00 A;  4HFB A;  3NF1 A;  5J1G A;  2MRI A;  2V5D A;  5ENP D;  1Z8U A;  2WCA A;  3FU5 A;  1MIW A;  4WBO A;  4O4H E;  3ZYQ A;  3QJZ A;  4TV3 A;  2GK9 A;  3PRE A;  2C0L A;  4WAF A;  1SE7 A;  3B13 A;  4AQF A;  4G26 A;  4WWN A;  2H6F A;  3AE3 A;  3ASD A;  3JYS A;  3CK7 A;  2WM9 A;  4JI0 T;  3ZXP A;  2XPK A;  4H9N C;  3L13 A;  4U07 A;  3IHY A;  3UU8 A;  1YCS B; 
#chains in the Genus database with same CATH homology
 3DP7 A;  3I5P A;  2WXQ A;  2WXI A;  4N2Q A;  3N2K E;  4N3A A;  1H19 A;  3HVE A;  2KWH A;  4UWK A;  3DTO A;  5LHH B;  3VLD A;  1D1C A;  1PAQ A;  2D0U A;  3O4X E;  2A2F X;  4HS2 A;  2MOZ A;  4FJO A;  3L16 A;  2Q9Q C;  3PUG A;  3FY4 A;  3CK9 A;  3FBL A;  3LK2 B;  4GA0 A;  3Q4A B;  4G1T A;  2MHK A;  4DMW A;  4J6I A;  2B1E A;  4TZ4 C;  3ZMV B;  2VWA A;  4L0R A;  4XAX B;  4AKG A;  5FYM A;  2VJ8 A;  3Q15 A;  1U3D A;  5L2L A;  2X9Y A;  2BTD A;  4IE0 A;  4NRH B;  3Q9D A;  3HL6 A;  4CI2 B;  3QWW A;  2XPZ A;  1YKH B;  3FUJ A;  4FHK A;  1UJJ A;  4AKL A;  3PUS A;  5AJL A;  5BT1 A;  2BVM A;  4KYO B;  4QKN A;  3LVQ E;  3J9X 1;  4PJJ A;  5KDM C;  3OTN A;  1KLX A;  4AY6 A;  4OVV A;  2JJ9 A;  5HXH A;  5JDN A;  1KT0 A;  4JZY A;  3KVA A;  5HAX A;  3CK8 A;  4ILU A;  5JJT A;  1UX4 A;  3MKR A;  5JR9 A;  3SGH A;  4I43 A;  4B8C B;  3HHM A;  3CX7 B;  4GZ6 A;  4IDZ A;  4AM9 A;  3NRX A;  2OA5 A;  4K0R A;  3ZMU B;  4GML A;  1E7U A;  2VQ2 A;  1TEZ A;  2NW8 A;  4F7A A;  4ANW A;  4QWN B;  3AAI A;  3KAE A;  3KIN B;  4OYK A;  2WMO A;  4HXI A;  2K48 A;  2KLQ A;  2DIW A;  5EX3 A;  3C64 A;  3PU3 A;  2IOS A;  3O4Z A;  2Q9Q B;  2XGM A;  4G25 A;  2QFC A;  3Q2M A;  5BW8 C;  5LJN A;  2CFZ A;  3TJP A;  3LK4 2;  3EDT B;  5LBQ B;  4EZK A;  3LG7 A;  4MFR A;  3FBZ A;  1HFA A;  3MKD A;  2J49 A;  1DNP A;  4K0U A;  2VTB B;  2L0I A;  4EYY R;  3IBE A;  1HU3 A;  2DCP A;  2RD0 A;  2CWO A;  5HWY A;  3CVU A;  4I9C A;  3RYF E;  5LCW C;  2CHX A;  4AVX A;  2V0P A;  2DCF A;  3JQ0 A;  4BX9 A;  2YQ8 A;  3CVX A;  3PRZ A;  4TRQ A;  2KCL A;  2WXF A;  4XKB A;  3HR0 A;  1H2U A;  1MIY A;  4TUY E;  4RG6 A;  3AS5 A;  2BDE A;  2V5F A;  4HFV A;  2PG8 A;  3G2U A;  2VSY A;  2J07 A;  3FH7 A;  5EK3 A;  5L3C B;  1XGW A;  1S0P A;  3ZXS A;  3ETV A;  2A3D A;  2IW5 B;  1ZU2 A;  4JLE A;  5HXS A;  3RRM B;  2AWI A;  2H7O A;  3BG1 B;  1LF8 A;  3I3N A;  1Z3Y A;  3IHV A;  5BMV E;  3MZL B;  3C4Z A;  3Q5W A;  4CGW A;  3CHO A;  5EDS A;  2YK0 A;  3R9A B;  3QWV A;  2ODV A;  2ZMA A;  3FXD B;  3FTU A;  5CMY A;  4ZI3 C;  4FJZ A;  2P9B A;  1SA0 E;  4URK A;  4WNK A;  5ARF A;  2NW9 A;  2LSJ A;  4I17 A;  2Q9Q A;  2VL8 A;  2W63 A;  5KJM A;  3L17 A;  4TV8 E;  5ADX L;  2XHE B;  2IAK A;  3FFL A;  4I6G A;  4I4T E;  1HCI A;  2Q7F A;  5JJ6 A;  2VAS A;  3CVV A;  5JDH A;  3KV5 A;  3ZJ1 A;  4ILH B;  2VTB A;  4G2V A;  2ODU A;  4N78 D;  2W61 A;  4IHJ E;  5AIJ A;  4ILI A;  3MA9 A;  2NOX A;  3K3O A;  1MND A;  2UY1 B;  3URZ A;  3QK0 A;  4CRW A;  2MOW A;  3EJN A;  3CVN A;  3Q5M A;  2G0U A;  4UVB B;  5JRE A;  4HOR A;  3PZD A;  4Q94 A;  4J2C A;  5CA0 E;  4PS3 A;  1U4Q A;  1ZBP A;  3EHN A;  3RRU A;  3KBT A;  4FA6 A;  2X66 A;  3R6N A;  4BJM A;  1ZV4 X;  2OND A;  3ULQ A;  5HI7 A;  3MV2 B;  2J4D A;  2JMK A;  3LFM A;  4A56 A;  3EDU A;  4IGU A;  4GIW A;  5G05 J;  1UX5 A;  4GPK A;  4Q96 A;  3S4U A;  2VGY A;  3N2O A;  3FH5 A;  1OWO A;  2X6K A;  3U64 A;  4I6J A;  4F6R C;  1ELK A;  4CI1 B;  4WW0 A;  4XZ4 A;  1D1B A;  3FUN A;  1EPU A;  4AJW A;  2YHC A;  2CG3 A;  4LUN U;  2LHN A;  3P1U A;  4XI9 A;  4ISS A;  2LSY A;  2SPC A;  4B94 A;  2LAI A;  4I9E A;  4YFS A;  5F8P A;  2V7I A;  3UFE A;  2IJG X;  3ZJ2 A;  4DND A;  4YVQ C;  4CXX A;  3WAK A;  2XHE A;  3CQG B;  2I1J A;  4HFG A;  2DLR A;  2XCB A;  2DWG A;  3UT8 A;  1IJ6 A;  4GOU A;  3RU0 A;  2AVP A;  4AKH A;  3JQ1 A;  4HGA A;  4GAA A;  3KEZ A;  3ZN3 A;  3SZ7 A;  4AP2 A;  1FIO A;  1HG5 A;  4MLP A;  4O8S A;  4JHK A;  4N39 A;  3ZVV A;  4L1B A;  3OKQ A;  3LKU A;  3PNL B;  2UY1 A;  3DJB A;  4GZC A;  3W15 B;  4LCT A;  2FI7 A;  4H7Y A;  5E76 A;  1A17 A;  1NWM X;  4UI9 K;  3FTZ A;  3S2A A;  2XRY A;  4AQF C;  4A55 A;  3RPU A;  3UX4 A;  3AU5 A;  3FHE A;  2CXL A;  3G2T A;  3FH8 A;  3E08 A;  1G8X A;  2WXR A;  1YW0 A;  3TG5 A;  4P0B A;  2ZU6 B;  3CLJ A;  3F2E A;  4O6F A;  4GZ3 A;  3TXN A;  2L3L A;  4OFZ A;  3ML9 A;  2IOL A;  5FNV E;  4P0A A;  4TUU A;  1QUU A;  5EX0 A;  4OYS A;  5JDQ A;  4KZC A;  3TL5 A;  3HIZ A;  4ILG A;  3PUJ A;  3GWH A;  3G2W A;  5FWQ A;  4GB9 A;  4E7Z A;  3APD A;  1H2V C;  4UQZ A;  3AAA B;  3N9O A;  3I1A A;  3FUH A;  4BA9 A;  4GYW A;  4KMC A;  5LNK A;  4AQG A;  5LFA A;  4GMJ A;  5G04 J;  5LP6 E;  3OXF A;  2D0T A;  4BTA A;  1NZN A;  5LXT E;  2IFU A;  3PDY A;  1JWG A;  2FUL A;  2RG8 A;  3E4B A;  5JR9 C;  1B89 A;  4HN9 A;  1BR2 A;  2V1D B;  2CLY C;  5FZR A;  5IHY A;  1P5Q A;  1MQS A;  3ZC0 A;  3LYA A;  3FUL A;  4FAD A;  4RSY A;  4UI9 C;  2WXK A;  2QA7 A;  5FQ7 A;  4UVC B;  3D9O A;  1HS7 A;  3C4W A;  4UQY A;  3CVW A;  3MAC A;  3E0Z A;  3P7I A;  4KBM B;  2AXZ A;  4CDM A;  3UUN A;  3I9W A;  3SBT B;  1ZEE A;  2WQ6 A;  1E7V A;  2XAG B;  3PNT B;  4AY5 A;  3I0O A;  3R7R A;  5FXX A;  4YVO A;  3U3W A;  5HXR A;  4X20 E;  3RRW A;  3G2V A;  4B8A A;  3PUA A;  5C8Y E;  3DPD A;  3ESK A;  2EQX A;  1D0Z A;  3JCK C;  5GON E;  3SI5 A;  4E85 A;  4X1K E;  2Y48 B;  3U4T A;  3RC8 A;  2IC6 A;  2VSN A;  3TGO A;  5HXC A;  2XAF B;  3Q5X A;  4X1Y E;  2CCQ A;  2I1K A;  4MBQ A;  4UEL A;  3RO3 A;  3UT5 E;  3F31 A;  2HPL A;  1XNF A;  3ETU A;  3OXG A;  2LJL A;  2CLY B;  4UIG A;  4H63 H;  3T5X A;  4I2Z A;  2K24 A;  1INZ A;  4EOZ B;  5HXE A;  2JQQ A;  4HOQ A;  5IYZ E;  4FC8 A;  5L3E B;  3MGB A;  3QC9 A;  5BNW A;  4H9R C;  3MKQ B;  1YD8 G;  1X5B A;  4PK5 A;  1HO8 A;  4C0M A;  2J08 A;  1H0A A;  1HX8 A;  4B6X A;  2YHE A;  1OWN A;  5T4Y A;  3ONK A;  3AB3 B;  1QNF A;  2KT9 A;  4V1A v;  1VDY A;  5CB4 E;  1NA0 A;  2NSZ A;  1IZN B;  3IBP A;  2XAH B;  3CSF A;  3FEY A;  5G04 C;  4EPZ A;  2WMN A;  4HOT A;  2OV8 A;  1D0X A;  4TV9 E;  2PL2 A;  3D9L A;  3L3P A;  4WNF A;  2UXN B;  4GZD A;  3T8O A;  5JDM A;  3HDX A;  4EZL A;  2W0G A;  3RK6 A;  3ZC1 A;  3ZFW A;  4O2A E;  3LXU X;  3NZU A;  1GW6 A;  1FMV A;  1PY1 A;  3O1J A;  2WPV A;  3EDV A;  5G2N A;  1WLX A;  4DPR A;  4B0Z A;  2DNX A;  3MJX A;  1FCH A;  5BV1 A;  2V26 A;  4UXN B;  2BUG A;  4MKT A;  4Q69 A;  3D9I A;  3VLE A;  3O9X A;  3ENE A;  4QHO A;  2A4Z A;  5DQV A;  4M1P A;  1Z3X A;  2NC9 A;  3MKQ A;  2Y4T A;  5L3F B;  5LGN B;  3O48 A;  2DHR A;  3CHP A;  2GW1 A;  3MCX A;  3N9Q A;  3CHS A;  3B7U X;  3MJW A;  3WXX A;  2PZI A;  3GMI A;  2GRL A;  1HTJ F;  3OYZ A;  5LP0 A;  4CT4 A;  3APF A;  1MNE A;  4WNG A;  4H9S E;  3PH0 C;  4EBA G;  2A72 A;  3B7R L;  4DLQ A;  2A5U A;  5CHE E;  2JMH A;  4PH4 B;  3T5V A;  3VKG A;  4IE6 A;  3U78 A;  5FQ6 A;  2I2O A;  3QWP A;  4GYR A;  4UQX A;  4KP3 C;  4ACL A;  4DBQ A;  3B57 A;  2Q9Q D;  2XPI A;  2CM0 A;  2FBN A;  4ATG A;  2R59 A;  4EZJ A;  1OWP A;  5JQG E;  5DAB A;  2X67 A;  4B89 A;  4QXH B;  1UJK A;  1EDU A;  1PC2 A;  2Y8D A;  4PW8 A;  3ANW B;  5TAO A;  3PDN A;  2XTL A;  3KBU A;  2VKO A;  4GK5 E;  3CEQ A;  4JXT A;  3RRN B;  3N9N A;  5T3R A;  1QZ2 A;  5J08 A;  3D9K A;  2I9C A;  3ZPO A;  2FEZ A;  1MMN A;  4PNI A;  2E2E A;  4WWP A;  2BZB A;  1U5P A;  2HR2 A;  4LRZ A;  3O1H A;  5L3G B;  2PBI A;  5L3B B;  4L23 A;  4APF A;  1HS6 A;  2HH7 A;  3N5L A;  5F3J A;  3OBV E;  5JRC B;  3S7J A;  1FMW A;  3MX3 A;  3N9L A;  2X0L B;  3FTY A;  3KS2 A;  3EUH A;  2LT3 A;  2VKD A;  4PFP A;  2RP4 A;  3BK9 A;  4GA2 A;  5C1D A;  2OVB A;  5LBM A;  1UW4 B;  2HYZ A;  4ASK A;  5JJ7 A;  3FHN A;  2L0T B;  5DIZ A;  2J9Q A;  2HO1 A;  3FUE A;  5ANR A;  3VTY A;  1LVF A;  3TAX A;  4HOS A;  5FMN A;  4QX7 B;  3OXL A;  3U3I A;  2CA5 A;  5AYW D;  3BQL A;  5EKQ D;  4YJ3 E;  3IHR A;  1UN8 A;  4JA9 A;  3D0T A;  4CXW A;  3SD5 A;  1B7T A;  2CWY A;  1HG2 A;  4I50 E;  5LHI B;  2XUE A;  4O4I E;  3MZK B;  1H6K A;  1ZHC A;  2J09 A;  2X3M A;  4AEZ C;  4P09 A;  1OWL A;  4ZI2 C;  5L3D B;  1L5J A;  1SHZ C;  3CVR A;  2LSU A;  3QOU A;  4QFV A;  3UQ3 A;  3OJA A;  4UVA B;  1Z6T A;  2XRZ A;  2K5B B;  3ANW A;  3CML A;  4I1A A;  4CQI A;  3B7T A;  4J8F A;  4QXB B;  3H37 A;  3RH3 A;  4LER A;  1IJ5 A;  4XX5 A;  2ZM0 A;  5J2U E;  1WM5 A;  3P8C D;  5FXW A;  4EQF A;  3ZCJ A;  4I2W A;  2J1D G;  2FO7 A;  1VRB A;  4XZC A;  4F3V A;  5JRC A;  3Q47 B;  4DK5 A;  2UWJ G;  4A3V A;  4U0S A;  3QAR A;  4BJN A;  2AW6 A;  5FXZ A;  3LEW A;  4O4J E;  3JC6 C;  3BQK A;  2C0M A;  4FP7 A;  2LE8 A;  2V8S E;  1HH8 A;  2VSO E;  3CQC B;  3FDH A;  3ONL A;  4AKI A;  1D1A A;  3ZN1 B;  3NZQ A;  4GYY A;  2MBG A;  2WAU A;  4BWR A;  5LYJ E;  2LSK A;  2X9W A;  2PQN A;  3MK7 C;  1X79 A;  1YKE B;  3LPZ A;  4AXP A;  4ZI3 D;  3ZMS B;  2M63 A;  4BT9 A;  2PJQ A;  3FUM A;  3UUM A;  1T98 A;  1Y64 B;  4U0Z A;  1OWM A;  1LRZ A;  3L54 A;  3LBX B;  3CGH A;  4O4L E;  3LS8 A;  1SQM A;  3C51 A;  4AKR B;  5J2T E;  3AS4 A;  1JPL A;  4FHJ A;  2X6J A;  2L8K A;  1MHQ A;  2L6J A;  1U3C A;  4A1S A;  4A3T A;  2RA1 A;  3V5U A;  3QNK A;  3N9M A;  2W62 A;  4Y6C A;  1BPO A;  3QKY A;  3G2S A;  3PEU B;  1MMA A;  4ZI2 D;  5HWX A;  4G11 A;  2Y4U A;  5LG4 A;  4IRU A;  1HZ4 A;  2L9B A;  3AVR A;  5FQ8 A;  4JEU B;  2WXP A;  1H7C A;  3CWZ B;  4QXC B;  4F1S A;  2NP9 A;  2CHW A;  4H63 V;  3VLF A;  4ACK A;  3EIQ C;  2V7M A;  2GRM A;  3FTS A;  2EHO B;  4PS7 A;  5KJL A;  2PM7 A;  4WND A;  2C5I T;  4APO A;  2XGS A;  3KV6 A;  4AV7 A;  3RRC A;  5FJY A;  2KND A;  4U04 A;  4E7S A;  3LJC A;  4NAC A;  4XKC A;  3PU8 A;  2X6H A;  4HTE A;  2DWK A;  3R84 B;  2E9X C;  1E1H B;  3OYX A;  3CIA A;  3JC6 D;  2VK9 A;  4BAY B;  4RG9 A;  5AEN A;  2KIN B;  4U63 A;  1FEW A;  3HKD E;  4GYO A;  2V7J A;  4CDN A;  4YJ2 E;  4IE5 A;  2NTX A;  4ANV A;  3NZS A;  3U9W A;  4TX5 A;  3GW4 A;  4EBA A;  4PK6 A;  3LBX A;  3SFZ A;  3PTR B;  3SOL A;  5KCM A;  1DVP A;  3UT7 A;  5BPP A;  2KCK A;  3SRZ A;  3PE3 A;  3UT4 A;  2V7K A;  2R17 C;  3D3M A;  5G05 C;  2X38 A;  2X68 A;  3AVS A;  1UCU A;  2UXX B;  3EVY A;  1Z0P A;  4DMV A;  2LHR A;  1FVF A;  4A1G A;  4IE7 A;  4UF0 B;  5FY0 A;  3ZEF B;  3J7Y q;  4JEU A;  4HE8 A;  5JVD E;  3SS1 A;  5BUZ A;  1Y8M A;  3AS8 A;  5CA1 E;  3LY7 A;  1BR4 A;  3ASG A;  4G63 A;  3KD7 A;  1TJF A;  2EHO A;  3QUJ A;  1ZKE A;  3AAE B;  1WY6 A;  2MYS A;  2E9X B;  3CKB A;  1E8X A;  2J4B A;  3CKC A;  4OVU A;  3B7S A;  2Y3A A;  2KMF A;  4HVB A;  2XAQ B;  3CHM A;  4CXY A;  1ELR A;  2WVI A;  2XQY A;  1S35 A;  4ADZ A;  3L08 A;  4ZHQ E;  5BV0 A;  3APC A;  2VSX E;  3OAW A;  3SWH A;  1IHG A;  3FU3 A;  2E9X D;  4FJY A;  3H3A A;  3GYZ A;  4I1M A;  2Z6E A;  2QGS A;  5G55 A;  5LX8 A;  4DVD A;  5A7D B;  4L7T A;  5CMW A;  2KXP B;  3GZ1 A;  3LY9 A;  4KBQ A;  4R7L A;  4CI3 B;  3WI3 A;  2LSV A;  3LVR E;  2IC9 A;  3U66 A;  1NP7 A;  3I9Y A;  1IAP A;  4GYS A;  4UWF A;  2IF4 A;  2IQC A;  4UWG A;  3ASH A;  4UV8 B;  1OWA A;  5AFU L;  1UN9 A;  4CCA A;  4G23 A;  1E8Y A;  4JEH B;  4ZI7 E;  4JUY A;  2NW7 A;  4L2L A;  3NRY A;  2HM8 A;  4UWH A;  4HEA A;  4KMO A;  5EK4 A;  5JH7 E;  3FUD A;  2X6F A;  1D0Y A;  3NQP A;  4EYU A;  2WXL A;  3AA1 B;  4Y6W A;  5LCW J;  1KNZ A;  2XGO A;  3CPZ A;  4UF0 A;  4CT0 A;  2WQH A;  3ZEF A;  3VKH A;  4OHF A;  4J8E A;  2X6I A;  5FTP A;  4WNE A;  4H9P C;  4IST A;  4L2Y A;  4U0U A;  5KJK A;  3BQI A;  3EHM A;  4ABN A;  5KX5 E;  5HYA A;  3RYH E;  4O2B E;  3CHR A;  4C0E A;  4LEU A;  2E9X A;  2GGF A;  2ACX A;  2ZM2 A;  4WUY A;  3CVY A;  5M72 A;  1KK7 A;  4BT8 A;  1BR1 A;  3KDS E;  1S94 A;  2N2N A;  2LNI A;  3S7F A;  2OVF A;  4IE4 A;  4GU5 A;  4DJA A;  4DO0 A;  2LSG A;  3CQX C;  3UUX B;  4DI3 A;  4MS6 A;  2H3R A;  2ION A;  4JHR A;  4BX8 A;  4ANJ A;  4I55 E;  1SZA A;  3CVQ A;  3ML8 A;  3ONX A;  5HQ8 A;  3FWV A;  1KT1 A;  2DBA A;  4AOF A;  2KWI B;  2R5S A;  2CHZ A;  5FY7 A;  1FVH A;  3KV9 A;  1WYB A;  2PFV A;  3AA7 B;  4U72 A;  2VKJ A;  4JEH A;  3AU4 A;  2XCC A;  3LY8 A;  2JRK A;  1NAF A;  2WXN A;  2CEA A;  4EB6 E;  3HKC E;  3ZYM A;  4KVM A;  4I6E A;  4PS8 A;  2CXF A;  4HKA A;  2ZM8 A;  3UMV A;  4PAG A;  4UEM A;  1UG3 A;  4C91 A;  3RIB A;  3CVP A;  3KVB A;  3HKB E;  1HXI A;  4BFR A;  3RJV A;  3CKD A;  3E22 E;  4NUU A;  5DBK A;  1YA0 A;  2JLB A;  5CCL A;  4FUL A;  5E0O A;  3PS6 A;  4K03 A;  3PUK A;  4ERR A;  3ZMZ B;  2WXO A;  4AIF A;  5A6C A;  1EF1 C;  4CDR A;  2V7L A;  3PUR A;  1NA3 A;  2WXH A;  4HLE A;  4XIF A;  4YND A;  4ANX A;  3N2G E;  1QSD A;  3FP3 A;  1IYG A;  5LOZ A;  3CST A;  4Z8X A;  4PJN A;  2WQ7 A;  4XBF B;  4JC8 A;  3O1I A;  3UUX A;  4GCO A;  2X9H A;  2HPJ A;  3LDZ A;  4MAL A;  5CCM A;  3C98 B;  3FUF A;  3CV0 A;  4DLO A;  3RYC E;  5ARG A;  2E8I A;  4D10 C;  3VTX A;  4N5C A;  5DJQ C;  3I4G A;  3CVL A;  5FP3 A;  2YEV C;  4CZZ B;  3ZW3 A;  3ESL A;  4N3B A;  4MRU A;  3BG0 B;  3FU6 A;  3ZYK A;  4PUC A;  3M65 A;  4HOU A;  4ZS3 A;  5LGT B;  2CG2 A;  2KZ7 B;  4GCN A;  5FZQ A;  5ENN A;  2X51 A;  3K9I A;  3SBS A;  3NZP A;  1E8Z A;  3FTW A;  3KV4 A;  4CEM A;  3EIJ A;  4W9R A;  5KJN A;  3JUI A;  4JL0 A;  2XPY A;  1AJ3 A;  2YNQ A;  2AXV A;  3P2B A;  2NXP A;  4CGV A;  5JHB A;  2LSI A;  4PFO A;  3ZIM A;  4UWL A;  5FT9 A;  2PM6 A;  3DBS A;  2NTY A;  4XI0 A;  2LAH A;  3MA5 A;  2C5J A;  2K9A A;  3AA0 B;  4ME2 A;  3SHF A;  2PQR A;  5LHG B;  4EXT A;  5E75 A;  4YHJ A;  2X9X A;  5JHA A;  4V3I A;  3K8P C;  2JEK A;  3MYV A;  2VKH A;  4G24 A;  1H2T C;  3ASF A;  2D2S A;  2C0S A;  1QQE A;  4DBR A;  1LVK A;  3R7Q A;  4DI4 A;  1HE8 A;  3IF8 B;  1IQR A;  3C98 A;  5JDF A;  3D9J A;  3FEX A;  4QX8 B;  5M4Y A;  4EIW A;  4XE0 A;  3QK6 A;  3V5S A;  4KVO A;  2CXD A;  4FU3 A;  3UUL A;  3L22 A;  5ANL A;  1MIV A;  4X1I E;  2LO6 A;  5FY1 A;  4KZ0 A;  1EZ3 A;  2EHO C;  5LOV E;  3I0Q A;  3ZN0 B;  1WRD A;  2ZLY A;  2MTQ A;  2M67 A;  4AXH A;  4KT6 B;  3HI2 A;  4GA1 A;  1JWF A;  5LCY A;  3HA4 A;  3BEE A;  4L9I A;  3C4X A;  2YU2 A;  3K3N A;  4PK4 A;  4JA7 A;  2DI4 A;  5A23 A;  1MMG A;  3IEG A;  1OUV A;  4UV9 B;  4PDX A;  5J90 A;  3TXM A;  2VB6 A;  3HKE E;  4UI9 J;  2CE7 A;  3D9P A;  1SZ9 A;  3MEK A;  5ETW A;  4EZ4 A;  2XEV A;  4FLB A;  4C9B B;  3KFW X;  3I4R B;  2Y6X A;  3SF4 A;  2WSS V;  5T8I A;  4N2S A;  4BY6 A;  1E96 B;  5FXV A;  5EZY E;  4WWO A;  1BR0 A;  4KUM B;  3S7B A;  3ZRH A;  2OOE A;  2XQ0 A;  1CUN A;  2IU1 A;  2KAT A;  4E6H A;  4GK0 E;  2FF4 A;  2P58 C;  4MHC A;  3CR3 A;  2KC7 A;  1WAO 1;  4KXK B;  4IIJ E;  3FUI A;  4ZS2 A;  3FB2 A;  4BTB A;  3QDN A;  1LKX A;  2N9D A;  5JDG A;  3GZS A;  3PVL A;  2C2L A;  3FU0 A;  4G2A A;  4L5G A;  3ZGQ A;  2WWU A;  3ZHE B;  3GN5 B;  2XAS B;  4I1O B;  4IN3 B;  4MLK A;  5FZS A;  5D0Q D;  3FXE B;  4FI5 A;  3ZYL A;  2EHO D;  2D5U A;  4U8H A;  3ZPJ A;  4J0U A;  2KZT B;  1E8W A;  1VOM A;  3IEE A;  1HF8 A;  1MMD A;  2KCV A;  3TG4 A;  1OXZ A;  3RKV A;  3ZLI A;  2VYI A;  5H6Q B;  4NQ0 A;  2VGX B;  4J8S A;  3RC3 A;  2WXJ A;  1WYC A;  3UTK A;  2AXU A;  4RVB A;  4IYP A;  2YIN A;  2L9Q A;  3Q49 B;  2CMR A;  3K3Q C;  3TKL B;  4JHJ A;  3T8M A;  1Y6I A;  3FTX A;  3QC1 A;  2LOP A;  2C5K T;  3IV0 A;  4H7X A;  4M3O A;  4OK0 A;  4H9O C;  1N54 A;  4N3C A;  3RYI E;  2WBL A;  4PJM A;  3IKO B;  3N71 A;  4ANU A;  3UPV A;  3A5X A;  2QY7 A;  2H7V C;  1V9D A;  4C90 A;  3HYM B;  5H6R B;  2CFU A;  3PEV B;  2N1G A;  2I59 A;  3VHL A;  5LA6 E;  4JPS A;  2LEH A;  2BF0 X;  5EK2 A;  4BSX A;  4F53 A;  3ZMT B;  5KMG P;  4TN7 B;  1O3X A;  3CHQ A;  4FLH A;  2ILR A;  2E0I A;  3LJ3 A;  2YU1 A;  3FUK A;  1US7 B;  5A1L A;  4EEC A;  2LOS A;  4GZ5 A;  3VU7 H;  3NBX X;  3ZHE A;  3QAQ A;  3GN5 A;  5LJM A;  4NUV A;  4NUR A;  4J8D A;  3PUQ A;  4YLH A;  1IQU A;  3MV3 B;  1G73 A;  3HVE B;  1JUQ A;  1TJC A;  4JVS A;  3N9P A;  3L09 A;  1E90 A;  3RKO A;  2ES0 A;  3D9M A;  2WB2 A;  2LM9 A;  5C2Y A;  3C50 A;  4EZH A;  3GZ2 A;  2WXM A;  2KZT A;  5LGU B;  4ZOL E;  2WXG A;  2V4L A;  5FQ4 A;  4U74 A;  2VGX A;  4EAH A;  3SNX A;  5JDL A;  1W3B A;  3L6A A;  3RX6 A;  3FTV A;  3GA8 A;  3D9N A;  3RO2 A;  3S7D A;  1ELW A;  3AA6 B;  4WBN E;  4AI6 A;  3F57 A;  1WR6 A;  1EYH A;  2BVL A;  4PJL A;  5D0O D;  4H9Q C;  4JW1 A;  4P29 A;  3PE0 A;  2XAJ B;  1N52 A;  2NWB A;  3ZCI A;  3MXZ A;  3CX6 B;  2JPF A;  5DQW A;  2KM4 A;  3LCA A;  3LK3 B;  4OYJ A;  5JR9 B;  4I43 B;  5AJD A;  3CX8 B;  3PE4 A;  3WAJ A;  2I6H A;  2W00 A;  3NF1 A;  5J1G A;  2MRI A;  3FU5 A;  1MIW A;  4WBO A;  4O4H E;  3ZYQ A;  3QJZ A;  4TV3 A;  2GK9 A;  3PRE A;  2C0L A;  4WAF A;  3B13 A;  4AQF A;  4G26 A;  4WWN A;  3ASD A;  3JYS A;  3CK7 A;  2WM9 A;  4H9N C;  3L13 A;  4U07 A;  3IHY A;  3QB2 A;  4IUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...