4HOUA

Crystal structure of n-terminal human ifit1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
269
structure length
261
Chain Sequence
VKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAYVKHLKGQNEEALKSLKEAENLMQENVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-induced protein with tetratricopeptide repeats 1
publication title Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 97
structure length 261
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4houA00
4N3AA 4U0UA 3UUXA 4I2WA 3PE4A 4B94A 3ZHEA 1PC2A 3RJVA 2C0LA 3FFLA 2C0MA 3OXGA 4GA2A 4HOTA 4GCOA 4UQYA 5FJYA 2JLBA 4LEUA 3Q5MA 1FCHA 5AYWD 3U4TA 4J8FA 3LKUA 3CVLA 4AY5A 1NZNA 3FWVA 3K9IA 4W9RA 4ABNA 5BNWA 3S7DA 4J8EA 3KD7A 4N3BA 4H7XA 4YVOA 2HR2A 5BW8C 3CKBA 3LPZA 4BWRA 4G2VA 4HOUA 4I9EA 5D0OD 5CCLA 2HO1A 2KC7A 1ELRA 3SZ7A 3UPVA 4A1SA 1OUVA 3ZN3A 3Q15A 2VSYA 4I2ZA 3EDTB 2FEZA 4WUYA 3RIBA 3VTYA 1W3BA 4ME2A 2V5FA 5BT1A 1Y8MA 1IYGA 3ASGA 4F3VA 2KCKA 3TGOA 2PQNA 5KJMA 4O6FA 4GZ3A 5A7DB 3PDNA 4I1AA 3S7FA 1KLXA 3FP3A 2I6HA 3RO2A 3RU0A 2FO7A 4YNDA 5EX0A 5KJNA 4YVQC 4HOQA 4J0UA 4JL0A 3AS4A 4GZ6A 5D0QD 3ESKA 4U04A 2KATA 3QKYA 3ASHA 4WNEA 3RO3A 3CK7A 3E4BA 4RG9A 2OOEA 3QOUA 3MV2B 4G24A 1ZU2A 3Q49B 2C2LA 3CEQA 3AS8A 4N39A 2KCLA 5JJ7A 2PQRA 3BEEA 3MEKA 2LNIA 3S7BA 5G05J 3NF1A 5DBKA 4KBQA 5EKQD 4AIFA 3WXXA 4XI9A 4H7YA 1XNFA 4KYOB 4GZ5A 1B89A 3ASFA 4UQXA 4GA1A 3KS2A 2NC9A 5HQ8A 2XCBA 4HOSA 4GA0A 2VQ2A 2BUGA 1HXIA 5G04J 4UQZA 2XEVA 4IN3B 4BT9A 4RG6A 3O48A 3U3WA 3LCAA 4AM9A 5CHEE 5ARGA 2XCCA 3KAEA 4XI0A 3CVNA 2KCVA 3MKRA 3AS5A 2VGYA 1KT1A 2VSNA 3S7JA 4CGWA 2FF4A 4I9CA 5JJ6A 5A6CA 4BTAA 2DBAA 3ASDA 3QWWA 2VGXB 2J9QA 4GCNA 1HZ4A 2VGXA 3GZ1A 3Q4AB 3CK8A 1HH8A 1ZBPA 5FZQA 2WPVA 2WQHA 3Q47B 5KJLA 4G25A 5G05C 2YQ8A 3LY9A 3GW4A 4WNGA 2E2EA 1ELWA 4GYWA 2XGSA 3CK9A 5FT9A 3LY8A 2XGMA 4XIFA 3OXLA 5FZSA 5KJKA 2Y4UA 1TJCA 4Y6CA 4EQFA 5FZRA 4N2QA 3R9AB 5DIZA 5G04C 3GYZA 1NA0A 1WAO1 4G23A 5HI7A 5LCWJ 2YHCA 1YA0A 2Q7FA 2GW1A 2PL2A 3LY7A 4UI9J 2LSVA 4G26A 3IEGA 4GYYA 4N3CA 3MV3B 4BT8A 4U0ZA 4I17A 3QDNA 2ONDA 3ULQA 2R5SA 4J8DA 3CVPA 4GYOA 2XGOA 1QQEA 3UQ3A 4APOA 3TG5A 3URZA 4UI9K 4GPKA 2IF4A 3LYAA 2MHKA 3CKCA 3QWVA 4Y6WA 4U07A 3CVQA 5JJTA 4WNDA 3JYSA 5M72A 2AVPA 2UY1B 2IFUA 5C1DA 5FTPA 4KXKB 2FBNA 2Y4TA 2UY1A 4CDRA 3ZGQA 5CCMA 4HORA 3OXFA 2LSUA 3PE3A 2L6JA 1NA3A 1A17A 5EX3A 1IHGA 5LCWC 2UWJG 4WNFA 4G1TA 1P5QA 1QZ2A 3TAXA 5ARFA 4BTBA 3SF4A 4U0SA 2FI7A 4UI9C 3VTXA 2QFCA 2VYIA 2HYZA 4JA7A 3QWPA 3CV0A 1E96B 2P58C 2PZIA 3HYMB 3TG4A 3ZPJA 1KT0A 4NRHB 4NQ0A 4JA9A 3RKVA 4JHRA 4AY6A 3MA5A 4N5CA 2XPIA 1WM5A 3GZ2A 3N71A 3ZFWA 4CGVA 4N2SA 3ZHEB
chains in the Genus database with same CATH superfamily
4I2WA 3PE4A 2QYUA 2L0IA 3RJVA 4GMJA 3FFLA 2C0MA 4BFRA 4GA2A 4GCOA 2GRNB 3CQGB 5FJYA 2XENA 5AYWD 3U4TA 4Q94A 3LKUA 1JWGA 3ONKA 2CHXA 3CVLA 3FWVA 1KPSB 4W9RA 1TYQG 3KD7A 3CVUA 4N3BA 2F8XK 4HBDA 2R17C 4YVOA 2HR2A 3CKBA 3LPZA 5FINA 3SO8A 2XPYA 2IONA 3QB2A 2KC7A 4M3OA 4XX5A 1N9AA 1EPUA 3SY2A 4A1SA 3LDZA 3FUKA 2GGFA 3Q15A 3Q7FA 2MRIA 4HRNA 5CMWA 3T8MA 2V5QC 3HXCA 5CMYA 2WVIA 1W3BA 3D9MA 3G2WA 4F3VA 2V8SE 5B1AE 1IXVA 2WXLA 3FH7A 3FP3A 4GAAA 2BEDA 3OTNA 2FO7A 4YNDA 3PVLA 2R2LA 4YVQC 4JL0A 1MX2A 2XS1A 1JCSA 3ESKA 3FTUA 2KATA 3UM3A 5D66A 3AU4A 4WNEA 2WXJA 3CK7A 3E4BA 1IQRA 3L82A 4G24A 1ZU2A 3Q49B 3ZYMA 4ANXA 2KCLA 1TNUA 2GRMA 1PAQA 1TR4A 3MZLB 3MKQA 2EILE 5EYPF 4FADA 2LNIA 2EIME 4FA6A 5DBKA 2NYJA 4AIFA 4O1OA 2J09A 1QBQA 4RQIA 1E7UA 1Z3XA 4L7TA 3MCXA 2WQ6A 3I4RB 3IXEA 4GTSA 3UKRG 5HQ8A 4ANWA 4JB8P 3AG2E 3L22A 3PZ1A 5AQ9A 3B7RL 1HXIA 3HXBA 1IHBA 3CSTA 3HG0D 4DLOA 4BT9A 2NSZA 4AVXA 1KZPA 4GTOA 4DX1A 3DXKG 3PUJA 4AM9A 5CHEE 1FVFA 3D9JA 4G11A 3AS5A 3NAWA 4FHKA 1KT1A 4XKCA 3S7JA 2FF4A 5JJ6A 3PNTB 1H0AA 5A6CA 2DBAA 3L6AA 2V4HC 3DXMG 3ULYA 4G8LA 4OAVB 3ABLE 3QWWA 2J49A 2J9QA 3L08A 1SVXA 5AN8A 4I43A 2J4DA 2M63A 4U63A 3Q4AB 3CHOA 2Y1LE 1H6OA 3FTSA 1D8DA 4F53A 1HH8A 3FUFA 4JHKA 5FZQA 2WPVA 2WQHA 3Q47B 3NBNB 3R7QA 1ELWA 4GYWA 1SA4A 4KVMA 3CVXA 4XIFA 3R7RA 3OXLA 4CYMD 2QY7A 3G2TA 3KEAA 2DWZA 1NP7A 3TXMA 3MKQB 4Y6CA 3MX3A 5FZRA 3UT4A 1HS6A 2IJGX 3SI5A 5DIZA 4FLBA 2DCPA 2IOSA 3B7BA 1NI1A 2J08A 4ZFHA 1Z3YA 4FJZA 2QYJA 1UW4B 3DSWA 2IQCA 4U96D 3ISMC 4G26A 3IEGA 3I3NA 3JXJA 4N3CA 3V2OA 2HE0A 3QDNA 4CT0A 3IV0A 4KVOA 2WM9A 4J8DA 3CVPA 2XGOA 3UQ3A 3TG5A 4FC8A 5LOZA 4UI9K 4GPKA 1H2VC 5T3RA 5LP0A 4K5CA 2J4BA 2WXMA 3DEOA 4ANVA 4YDEA 5M72A 3CGHA 4JXTA 3PZ2A 2IFUA 3UKUG 2FBNA 2UY1A 2JABA 4C9BB 3E33A 3T8KA 4QQIA 2GRRB 3PE3A 5CEDB 5CERB 4HXIA 2AJAA 5T4YA 4PS7A 1YMPA 4TUUA 1TNOA 4L9PA 4OYSA 2BKGA 2AWIA 2B0OE 3ZKJA 4FU3A 3VTXA 2GROB 1PY1A 2RKKA 4BERA 2WXKA 4DX2A 1FVHA 1BLXB 3CV0A 3DWLG 4WWNA 4IRUA 1E96B 4GTTA 3HYMB 3B95A 1FT1A 3ZPJA 5CBOA 5BXOA 4JA9A 5FWQA 4JHRA 2R59A 3MA5A 2EINE 3HHMA 3Q78A 4UUCA 3N71A 4CGVA 3ZHEB 3ML9A 3AU5A 4TXQA 3TXNA 4BX9A 4B94A 1E90A 3CSFA 4AEZC 4BETA 3FUIA 3CVYA 2X6JA 3OXGA 2X38A 4GU5A 3BG0B 2F37A 3LEWA 3D9IA 2JLBA 3KSLA 4LEUA 3Q5MA 1N0QA 3AAAC 3APFA 4F6RD 2WXPA 4AY5A 5EIBE 4XE0A 3C3OA 3S7DA 5AAOA 3ABME 1DNPA 4IYPA 3TWSA 4FULA 3D9HA 2XZDG 4HS2A 4G2VA 3IKOB 4PS8A 2HM8A 3EHMA 2F8YA 3TJPA 3CLJA 3C5RA 5FQ6A 2HO1A 4O60A 1ELRA 3SZ7A 1HU3A 3B7TA 2BF0X 4EZLA 1TJFA 4HB5A 3EHNA 1YCSB 4I2ZA 3PS6A 5KBAA 2XEHA 2X6FA 3NOGD 4WUYA 4FLHA 3UI2A 1OY3D 3SD5A 3Q75A 5BT1A 2X6IA 1Y8MA 4E85A 2KCKA 1E8YA 3TGOA 4O6FA 1SA5A 4AXHA 4GZ3A 1QNFA 2I6HA 4FHJA 5LFAA 3RO2A 4LRZA 3DRAA 4ATZD 4HOQA 3FUHA 2KBXA 4R7LA 2OV8A 3D9KA 4RLYA 1IKND 4WAFA 3ASHA 3BG1B 3PEVB 3RO3A 3VLFA 3QOUA 3MV2B 1U2VG 2MYOA 4HI8A 2WXFA 3FTWA 4N39A 3UM2A 3ZEFA 5FQ4A 1SZAA 4ACLA 3VLDA 3EHRA 2WXRA 3S7BA 3HDXA 3EU5A 4I6GA 5E75A 2LXMA 1WDYA 2BTDA 4L23A 1TNZA 3KS2A 3QNKA 3NB2A 2IU1A 4B8AA 4BX8A 2VQ2A 2BUGA 5G04J 4Q96A 2XEVA 1KZOA 2WMNA 1U3CA 2AW6A 4RG6A 3O48A 3LCAA 5ARGA 2XCCA 2GRQB 3CVNA 1O1TA 4I6EA 3MKRA 3ZXSA 4TXPA 4OAUC 1H6PA 3R9MA 4I9CA 1BU9A 2XPZA 4BTAA 3JCKC 2ETCA 2OCCE 4GTQA 3DSTA 1K1AA 3NQPA 4WWPA 3CHQA 3LXUX 2P9SG 2VGXB 4DX5D 1D9SA 4GCNA 1HZ4A 4LCTA 3W9GA 2FULA 3CK8A 4BEPA 1FT2A 2H6HA 4NIKA 3OAWA 4WWOA 3U66A 5FQ7A 2E2EA 5JA4D 4TV3A 4LNGA 5FT9A 4XEIG 4NACA 4E6HA 1N11A 3Q7AA 5FZSA 1H2TC 4EQFA 5ANLA 4N2QA 3R9AB 5G04C 3GYZA 5ENRD 5EDSA 2IY0C 1NA0A 3IHYA 4C0MA 4ACKA 2YHCA 3LVQE 1YA0A 3FH5A 2PL2A 5G55A 5JMND 4CDNA 3KEZA 2LSVA 3C72A 3FTVA 4GTMA 1MQSA 3FULA 3B13A 2A4ZA 3EHQA 4I17A 3TL5A 5EYLA 1DC2A 4M7CA 4ANUA 1N4RA 3ULQA 2R5SA 3FU0A 4B93B 3HVEA 5J90A 1QQEA 3L16A 4APOA 2YINA 2IF4A 3C98A 2MHKA 5AQAA 4F1SA 1TN8A 2CG3A 2DYSE 5AQBA 2VTBA 3CVQA 5JJTA 3FTZA 2LXLA 4GZDA 4P29A 2Y4TA 1MX4A 3EU9A 3UXGA 1TN7A 2H6FA 2RG8A 1DCEA 4JC8A 5EIDA 4DPRA 3OXFA 2LSUA 4TXRA 2H6IA 3JUIA 3D9PA 3TWUA 4K0RA 4APFA 4WNFA 4DRXE 4HLLA 3UMVA 4G1TA 1HG2A 1O1RA 4I1OB 3S2AA 4NURA 3G2SA 3TAXA 4HRMB 1OCZE 3SF4A 4U0SA 3UT7A 4CRWA 2VYIA 3AG3E 5KCMA 4JA7A 3FUNA 4HVBA 1H6KA 4L1BA 2PZIA 2ETAA 2Y69E 1OXJA 2J8SD 2BKKB 3Q79A 3P1UA 4LUNU 4LSZE 1KT0A 4U8HA 2P9NG 4BSXA 1HFAA 1S63A 3J5PA 3ZYLA 3RKVA 3SFYA 3L17A 2IO3C 1FPPA 3V30A 4U0UA 2AXZA 3DEPA 5ITZF 2XHEA 4J8SA 3ZHEA 1PC2A 4JPSA 2LUHA 5ANRA 4A1GA 4HOTA 3HVEB 4UQYA 3RRNB 2GRPB 3ENEA 1H19A 3ZVVA 3G2VA 5ENQD 3FTYA 1FCHA 3IBEA 3HXDA 1SQMA 3QC1A 4ABNA 2VTBB 3UM0A 1N95A 5BV0A 3FDHA 4HRLA 5BW8C 4URKA 4U95D 5BXUA 1MJ0A 4BWRA 3APCA 4A55A 2CG2A 4I9EA 5D0OD 4AOFA 5CCLA 4U7EB 4J8YA 4GMLA 2P9PG 5EILA 3UPVA 2L6BA 2PNNA 1INZA 3ZN3A 3G2UA 3V79K 1JUQA 3TWTA 3C3QA 2FEZA 3RIBA 3DSXA 1JCQA 2IO2C 3VTYA 5BPPA 1HX8A 2V5FA 1IYGA 2PQNA 1OWMA 5KJMA 2YHEA 3PDNA 3S7FA 4ILHB 3TWXA 2XS8A 5KJNA 4GTVA 4J0UA 1MZCA 2R02A 5D0QD 2RFMA 3SBTB 3PZDA 4CEMA 2OOEA 2C2LA 3FH8A 4ATGA 3DBSA 3SQVA 5KNGA 5JJ7A 5LX8A 2IEJA 2WMOA 3ZYKA 3J5QB 1LD8A 2KXPC 3T9KA 1UN9A 4XI9A 2X3MA 1OWLA 4QFVA 1XNFA 4KYOB 1B89A 5ENNA 4K03A 3NOCD 2Y3AA 2NC9A 1YYHA 3FUDA 4HOSA 4GA0A 3TWQA 2XRYA 4GMRA 4EBAA 2X6HA 1LD7A 3CHRA 3ZIMA 5HS0A 3PNLB 2P9UG 2A5UA 3KAEA 1ELKA 2L9BA 2KCVA 5AQ7A 4OVVA 4C0EA 2VGYA 1N4SA 2VSNA 5AJDA 3EJNA 2LO6A 2ZU6B 3LS8A 4Q69A 4EZKA 3TWVA 3UX4A 3PZ4A 2H6GA 3ASDA 2DZOA 2R03A 1IQUA 2P9IG 1S70B 3FHEA 4FJYA 2I1KA 3ABKE 2VGXA 2QC9A 1ZB1A 5G2NA 3DSUA 5AARA 2XQ0A 4EZJA 1LTXA 1ZBPA 2WXIA 3ZU7B 2DIWA 4B0ZA 1EDUA 5KJLA 3LY9A 4WNGA 1MYOA 2DZNA 2WXGA 1OWOA 2XGSA 3CK9A 1K1BA 3LY8A 3D9OA 1Q2ZA 2XGMA 2DYRE 3DSVA 3FU3A 3CR3A 5BUZA 1MX6A 4I6JA 1TJCA 3PREA 1DCQA 2VJ8A 1N4QA 4DUIA 4O1PA 3QK0A 3SFXA 2I1JA 3T5VA 1RW2A 4G23A 4F7AA 3PH0C 1N52A 3WG7E 4A63B 2GW1A 4GZCA 1OCCE 3HIZA 3EUVA 4JHJA 4MS6A 4EPZA 1SZ9A 4XKBA 3ZYQA 1E7VA 4KMOA 4JEHA 1X5BA 3RRUA 3NZSA 3FTXA 3FUMA 4GYYA 3ZW3A 2Y0BG 3MGBA 3V2XA 3MV3B 2I2OA 4U0ZA 3FU6A 4L2LA 5EN5D 1N0RA 1TN6A 3JXIA 3W9FA 2A5EA 3PUKA 3URZA 3TWWA 3B7SA 3L54A 3UIPC 3QJZA 5A23A 4K5AB 4BY6A 4ZHBA 2XEEA 4EECA 1BI8B 2OEVA 3CVWA 3BQOA 3ONLA 4Y6WA 3PZ3A 4WNDA 3JYSA 2V0PA 2VGEA 5FTPA 2CFUA 4V3IA 4KXKB 5B1BE 3ZXPA 3ZGQA 3CHPA 1JPLA 4HQDA 1Y6IA 2WXQA 2F0YA 2NXPA 4UWFA 3KSQA 3X2QE 3FY4A 3V31A 5D2MC 2L6JA 3U64A 2X6KA 1NA3A 2RD0A 3AG1E 5EX3A 5J08A 4ILGA 4RSYA 4CZ2D 1P5QA 1QZ2A 4GTPA 4KZCA 4GPMA 1OCOE 4BTBA 1V54E 3CVVA 2YNQA 3UT8A 2HYZA 3QWPA 2WXHA 1LF8A 2P58C 4JEUA 3D9LA 3CHSA 1TEZA 2XRZA 5AENA 3U9WA 3QAQA 5CEAA 2EQXA 4UWGA 4NQ0A 3E34A 4PS3A 4AY6A 3Q9UC 2R05A 4N5CA 1AWCB 2XPIA 2DVWA 4DX6D 3UTMA 1TNBA 2V4LA 4UWHA 4J7WA 4N2SA 3PEUB 4N3AA 5JHBA 3UUXA 3CQCB 3RSEG 1UN8A 1U3DA 5ENSD 1NFIE 2C0LA 3EIQC 4MRUA 5H7PA 3F6QA 2CHWA 4HNAD 1A5EA 1OWNA 3JQ1A 2GRLA 1HF8A 2ZGGA 4KZ0A 3UIOC 4J8FA 3D9NA 2XZTG 1NZNA 4XZ4A 3K9IA 4DLQA 1X81A 4PUCA 5BV1A 1OT8A 5BNWA 4J8EA 4C48B 3C3RA 3Q73A 4A3VA 3ESLA 4H7XA 5CBNA 1XGWA 1G3NB 4HOUA 1OWPA 3RRMB 3E37A 1QYMA 1EYHA 5AIJA 1OUVA 3SNXA 5ENTD 2VSYA 1UJJA 2L0TB 3EDTB 1Z6TA 3AG4E 4U8VD 4AP2A 4UWLA 3CIAA 4ME2A 1DVPA 4LNUD 3ASGA 2P9KG 5A7DB 5JHAA 4I1AA 3Q9NC 1Z5SC 1KLXA 3ZNGA 4D10C 3MJWA 3RU0A 3NZUA 5EX0A 4DJAA 2EIJE 3AS4A 2WXNA 3QARA 4JZYA 4GZ6A 4U8YD 4U04A 5IY5E 3E30A 3QKYA 1MHQA 1HG5A 2MOWA 1UG3A 4RG9A 3P2BA 3CEQA 3AS8A 4G8KA 1S64A 2PQRA 3BEEA 3SHFA 3MEKA 4OVUA 4DX7D 4IULA 1O1SA 4LERA 5G05J 4EHMA 3NF1A 4KBQA 5EKQD 3TWRA 3WXXA 4H7YA 3UINC 4GZ5A 2AXVA 3ASFA 4UQXA 2VSXE 4GA1A 3ZUVB 3DPDA 2KZTA 1N94A 2XCBA 3UM1A 4UQZA 4IN3B 3FU5A 3U3WA 4GTRA 3RK6A 3D3MA 4PDXA 3JUEA 4B8CB 5B3SE 4N5QA 4XI0A 1AP7A 3ULEG 5HRYA 5HKPA 5AJLA 2P9LG 4CGWA 2OEWA 4JW1A 1EF1C 3APDA 2IOLA 2ZGDA 3ASNE 3JQ0A 1N54A 3ZRHA 1BPOA 4B89A 1UJKA 2I9CA 4ILIA 5CECB 4HI9A 4DI4A 4Z68A 1GW6A 4X8QA 2E0IA 3E32A 2ZIRA 1HO8A 3GZ1A 3BU8A 2P2CP 3AJIA 4MBGA 1O5MA 4BESA 2OVBA 3EIJA 3BUAA 4DI3A 4BSZB 1HE8A 2VSOE 3IHVA 2OVFA 2QZAA 2WB2A 4RVBA 4G25A 1E8XA 5G05C 4KT6B 2YQ8A 4L2YA 3T5XA 3GW4A 4YDOA 4JVSA 3LVRE 4LNBA 4J6IA 2KM4A 3I4GA 2EIKE 5ENPD 1OCRE 5KJKA 2Y4UA 3PRZA 4EBAG 2FO1E 2J07A 2ZXWE 1N4PA 2PM7A 5CRUA 3LJ3A 4F1PA 3ML8A 1H2UA 1WY6A 1WAO1 5HI7A 2WXOA 5LCWJ 1E8ZA 5FQ8A 2Q7FA 3B7UX 3FUEA 4DK5A 3LY7A 2KZTB 4GB9A 4UI9J 3HXFA 4I1MA 3FEYA 4MLPA 3FUJA 3DSSA 5E76A 4AV7A 2LAIA 4BT8A 2ONDA 1JWFA 2ETBA 1L5JA 4GYOA 4A3TA 5T8IA 1K8KG 1JCRA 2JEKA 4UWKA 1TNYA 1E8WA 1S0PA 3RAUA 3LYAA 3CHMA 4FP7A 2ILRA 3SBSA 3CKCA 4TUMA 3QWVA 4MKTA 4U07A 5KNHD 1K3ZD 1V55E 4AJWA 4CDMA 2AVPA 2UY1B 3L9TA 5C1DA 4LG6A 3LJNA 3ASOE 4CT4A 3GZSA 4YDYA 1BD8A 4CDRA 2LAHA 3HRAA 5KWDA 2PM6A 3I5PA 3SFZA 5CCMA 4YDWA 1D8EA 3MYVA 4JD2G 4HORA 1SW6A 2WQ7A 4PH4B 2CFZA 2CHZA 1A17A 2ZISA 1IHGA 5LCWC 2UWJG 5CRVA 2RFAA 5ARFA 2FI7A 4UI9C 2QFCA 3VLEA 4K5BA 3L13A 4TRQA 3SGHA 1BI7B 5C2YA 4CCAA 3HXEA 4HLEA 3TG4A 1WG0A 5FIOA 3DPYA 1VDYA 1UOHA 3FEXA 2B6CA 4HFGA 4NRHB 1RZ4A 1NL4A 1WM5A 2AXUA 3GZ2A 3O4ZA 5ENOD 3ZFWA
chains in the Genus database with same CATH topology
4N3AA 4U0UA 5JHBA 2AXZA 3UUXA 3CQCB 4I2WA 3ML9A 3AU5A 2XHEA 3PE4A 3TXNA 4BX9A 1UN8A 4J8SA 1U3DA 4B94A 1E90A 1PC2A 2L0IA 4JPSA 3RJVA 3CSFA 3ZHEA 2C0LA 3FUIA 4GMJA 4AEZC 3EIQC 3FFLA 3CVYA 2X6JA 2C0MA 3OXGA 4BFRA 2X38A 4GU5A 4MRUA 4GA2A 5ANRA 4A1GA 2CHWA 4HOTA 3BG0B 4GCOA 1OWNA 3HVEB 4UQYA 3RRNB 3ENEA 3CQGB 3JQ1A 3LEWA 5FJYA 3D9IA 2JLBA 1H19A 2GRLA 4LEUA 3G2VA 3ZVVA 1HF8A 3Q5MA 3FTYA 3APFA 1FCHA 4KZ0A 2WXPA 5AYWD 4J8FA 3U4TA 4Q94A 3LKUA 1JWGA 3ONKA 3IBEA 2CHXA 3CVLA 3D9NA 4AY5A 1NZNA 3FWVA 4XE0A 3K9IA 4XZ4A 4DLQA 4PUCA 5BV1A 1SQMA 3QC1A 4W9RA 4ABNA 5BNWA 3S7DA 4J8EA 2VTBB 3KD7A 3CVUA 4N3BA 4A3VA 3ESLA 4H7XA 1DNPA 2R17C 4IYPA 5BV0A 3FDHA 4FULA 4YVOA 2HR2A 1XGWA 5BW8C 3CKBA 4URKA 4HS2A 3LPZA 4BWRA 3APCA 4G2VA 3IKOB 2XPYA 4PS8A 2HM8A 4A55A 2IONA 4HOUA 2CG2A 3EHMA 3QB2A 4I9EA 3TJPA 5D0OD 3CLJA 4AOFA 5CCLA 5FQ6A 2HO1A 1OWPA 2KC7A 1ELRA 4GMLA 3SZ7A 1HU3A 3B7TA 4M3OA 3RRMB 4XX5A 2BF0X 3UPVA 1EPUA 4EZLA 1TJFA 4A1SA 1EYHA 3LDZA 5AIJA 1INZA 1OUVA 3FUKA 3SNXA 3ZN3A 2GGFA 3Q15A 3EHNA 2MRIA 2VSYA 3G2UA 4I2ZA 5CMWA 1UJJA 2L0TB 3PS6A 1JUQA 3T8MA 3EDTB 1Z6TA 2X6FA 2FEZA 4WUYA 3RIBA 4FLHA 3VTYA 4AP2A 3SD5A 5CMYA 4UWLA 2WVIA 3CIAA 1W3BA 5BPPA 4ME2A 1HX8A 2V5FA 5BT1A 1DVPA 2X6IA 3D9MA 1Y8MA 1IYGA 3G2WA 3ASGA 4E85A 4F3VA 2KCKA 1E8YA 3TGOA 2PQNA 1OWMA 5KJMA 4O6FA 2YHEA 2V8SE 4AXHA 4GZ3A 5A7DB 1QNFA 2WXLA 5JHAA 3PDNA 4I1AA 3S7FA 1KLXA 3FH7A 3FP3A 4GAAA 2I6HA 3MJWA 4FHJA 4D10C 3RO2A 3OTNA 4ILHB 4LRZA 2FO7A 3RU0A 4YNDA 3NZUA 3PVLA 5EX0A 5KJNA 4YVQC 4HOQA 3FUHA 4R7LA 4DJAA 4J0UA 4JL0A 2OV8A 3AS4A 2WXNA 3D9KA 3QARA 4JZYA 4GZ6A 5D0QD 3SBTB 4WAFA 3PZDA 3ESKA 3FTUA 4U04A 2KATA 3QKYA 1MHQA 1HG5A 2MOWA 3ASHA 3AU4A 3BG1B 4WNEA 1UG3A 3PEVB 3RO3A 3VLFA 4CEMA 2WXJA 3CK7A 3E4BA 4RG9A 1IQRA 2OOEA 3QOUA 3MV2B 4G24A 1ZU2A 3Q49B 3P2BA 2C2LA 3ZYMA 3CEQA 3AS8A 3FH8A 4ATGA 2WXFA 3DBSA 3FTWA 4N39A 4ANXA 2KCLA 2GRMA 3ZEFA 1PAQA 5JJ7A 2PQRA 3BEEA 3SHFA 3MEKA 3MZLB 3MKQA 5LX8A 4FADA 4OVUA 5FQ4A 2LNIA 2WMOA 1SZAA 4IULA 4ACLA 3VLDA 3ZYKA 2WXRA 3S7BA 4FA6A 4LERA 5G05J 3HDXA 3NF1A 5DBKA 4I6GA 4KBQA 5EKQD 5E75A 4AIFA 3WXXA 2BTDA 2J09A 1UN9A 4XI9A 2X3MA 1OWLA 4H7YA 4L23A 1XNFA 4KYOB 4QFVA 4GZ5A 1B89A 5ENNA 2AXVA 3ASFA 4K03A 1E7UA 4UQXA 1Z3XA 2VSXE 3MCXA 4GA1A 3KS2A 2Y3AA 4L7TA 2WQ6A 2NC9A 3DPDA 2KZTA 3QNKA 3I4RB 5HQ8A 2XCBA 3FUDA 4ANWA 4HOSA 2IU1A 4GA0A 4B8AA 4BX8A 2XRYA 4EBAA 3L22A 3B7RL 2VQ2A 2BUGA 1HXIA 5G04J 2X6HA 4Q96A 3CSTA 4UQZA 3CHRA 2XEVA 4DLOA 2WMNA 4IN3B 4BT9A 3FU5A 1U3CA 2NSZA 2AW6A 3ZIMA 4AVXA 4RG6A 3O48A 3PNLB 3U3WA 3LCAA 3PUJA 4AM9A 3RK6A 5CHEE 3D3MA 4PDXA 5ARGA 2A5UA 2XCCA 3KAEA 1ELKA 2L9BA 1FVFA 3D9JA 4B8CB 4XI0A 3CVNA 2KCVA 4I6EA 4OVVA 4G11A 3MKRA 3ZXSA 3AS5A 4C0EA 2VGYA 4FHKA 5AJLA 1KT1A 2VSNA 5AJDA 3EJNA 4XKCA 3S7JA 2LO6A 4CGWA 4JW1A 1EF1C 3APDA 2IOLA 2FF4A 2ZU6B 3JQ0A 4I9CA 5JJ6A 1N54A 3LS8A 1H0AA 3PNTB 3ZRHA 4Q69A 5A6CA 2XPZA 4EZKA 4BTAA 2DBAA 1BPOA 3JCKC 3L6AA 3UX4A 3ASDA 4B89A 1UJKA 2I9CA 4ILIA 3NQPA 1IQUA 4WWPA 3CHQA 3LXUX 4DI4A 3QWWA 3FHEA 2VGXB 2J49A 2J9QA 1GW6A 3L08A 2E0IA 4I43A 2J4DA 2M63A 4FJYA 2I1KA 4GCNA 1HZ4A 1HO8A 2VGXA 3GZ1A 4LCTA 4U63A 3Q4AB 2FULA 3CK8A 5G2NA 3CHOA 3FTSA 2XQ0A 4EZJA 2OVBA 3EIJA 4DI3A 1HE8A 2VSOE 4F53A 3IHVA 1HH8A 2OVFA 1ZBPA 2WXIA 3FUFA 2WB2A 4JHKA 2DIWA 5FZQA 2WPVA 2WQHA 4B0ZA 3Q47B 1EDUA 4RVBA 4G25A 1E8XA 3OAWA 5G05C 4KT6B 4WWOA 5KJLA 2YQ8A 4L2YA 3LY9A 3T5XA 5FQ7A 3U66A 3R7QA 3GW4A 4WNGA 4JVSA 3LVRE 2E2EA 2WXGA 1ELWA 4TV3A 4GYWA 1OWOA 2XGSA 3CK9A 4J6IA 5FT9A 3LY8A 3D9OA 4NACA 2KM4A 4KVMA 4E6HA 2XGMA 4XIFA 3CVXA 3I4GA 3FU3A 3R7RA 3OXLA 5FZSA 1H2TC 3CR3A 2Y4UA 5BUZA 4I6JA 2QY7A 5KJKA 3G2TA 3PRZA 1TJCA 4EBAG 3PREA 1NP7A 3TXMA 3MKQB 2J07A 4Y6CA 3MX3A 4EQFA 5FZRA 3UT4A 2PM7A 5ANLA 1HS6A 4N2QA 2IJGX 3R9AB 2VJ8A 3SI5A 5DIZA 3LJ3A 3GYZA 5G04C 5EDSA 4FLBA 3ML8A 1NA0A 3IHYA 2DCPA 4C0MA 3T5VA 3QK0A 2I1JA 1H2UA 1WY6A 1WAO1 4G23A 4ACKA 4F7AA 5HI7A 2IOSA 2WXOA 2YHCA 3LVQE 5LCWJ 3PH0C 1YA0A 1N52A 1E8ZA 3FH5A 5FQ8A 2Q7FA 2GW1A 2PL2A 2J08A 3B7UX 3FUEA 3HIZA 1Z3YA 4FJZA 4GZCA 4JHJA 5G55A 3LY7A 4MS6A 2KZTB 4DK5A 4GB9A 4EPZA 1SZ9A 4UI9J 4CDNA 3KEZA 2LSVA 1UW4B 4XKBA 4I1MA 2IQCA 3FTVA 3ZYQA 1E7VA 4KMOA 1MQSA 3FEYA 4JEHA 4MLPA 1X5BA 3FULA 3B13A 3FUJA 3IEGA 4G26A 3RRUA 3NZSA 3I3NA 2A4ZA 5E76A 3FTXA 3FUMA 4GYYA 3ZW3A 4AV7A 4N3CA 3MGBA 2LAIA 3MV3B 4BT8A 2I2OA 4U0ZA 4I17A 3QDNA 3TL5A 4CT0A 3IV0A 3FU6A 2ONDA 4L2LA 1JWFA 4KVOA 1L5JA 4ANUA 2WM9A 3ULQA 2R5SA 3FU0A 4J8DA 3CVPA 4GYOA 4A3TA 5T8IA 3HVEA 2XGOA 5J90A 1QQEA 3L16A 3UQ3A 2JEKA 4UWKA 3TG5A 3PUKA 4APOA 3URZA 4FC8A 2YINA 5LOZA 4UI9K 4GPKA 3B7SA 1H2VC 3L54A 2IF4A 5T3RA 1E8WA 5LP0A 3QJZA 1S0PA 5A23A 3C98A 3LYAA 2J4BA 2WXMA 2MHKA 3CHMA 4FP7A 4ANVA 4BY6A 2ILRA 4F1SA 4EECA 2CG3A 3SBSA 3CKCA 3QWVA 3ONLA 3CVWA 4MKTA 4Y6WA 4U07A 2VTBA 3CVQA 5JJTA 4WNDA 3JYSA 5M72A 2V0PA 4AJWA 3FTZA 4CDMA 2AVPA 2UY1B 3CGHA 4GZDA 4JXTA 4P29A 2IFUA 5C1DA 5FTPA 2CFUA 4V3IA 4KXKB 2FBNA 2Y4TA 4CT4A 2UY1A 3GZSA 4CDRA 3ZGQA 2LAHA 4C9BB 3CHPA 1JPLA 2PM6A 3I5PA 3SFZA 1Y6IA 5CCMA 2RG8A 2WXQA 4JC8A 3MYVA 4DPRA 4HORA 2NXPA 4UWFA 3FY4A 3OXFA 2LSUA 3PE3A 2WQ7A 2L6JA 3U64A 2X6KA 4PH4B 1NA3A 2RD0A 2CFZA 4HXIA 3JUIA 2CHZA 5T4YA 1A17A 4PS7A 3D9PA 5EX3A 4K0RA 4APFA 4TUUA 1IHGA 5J08A 4OYSA 5LCWC 2UWJG 4ILGA 4WNFA 3UMVA 4G1TA 4RSYA 1HG2A 1P5QA 2AWIA 4I1OB 3S2AA 1QZ2A 4KZCA 4NURA 3G2SA 3TAXA 5ARFA 4BTBA 4FU3A 3SF4A 4U0SA 2FI7A 4UI9C 3UT7A 3VTXA 2QFCA 3CVVA 1PY1A 2YNQA 3UT8A 3VLEA 4CRWA 2WXKA 1FVHA 2VYIA 5KCMA 2HYZA 3L13A 4TRQA 3SGHA 4JA7A 3QWPA 3FUNA 4HVBA 3CV0A 2WXHA 4WWNA 1LF8A 1H6KA 4IRUA 4L1BA 1E96B 2P58C 2PZIA 3HYMB 4JEUA 5C2YA 3D9LA 4CCAA 3P1UA 3CHSA 1TEZA 4HLEA 5LFAA 5AENA 3TG4A 4LUNU 3U9WA 2XRZA 3ZPJA 1KT0A 4U8HA 3QAQA 1VDYA 4BSXA 1HFAA 2EQXA 3FEXA 4NRHB 4HFGA 4NQ0A 4UWGA 4PS3A 4JA9A 5FWQA 3ZYLA 3RKVA 4JHRA 4AY6A 2R59A 3MA5A 4N5CA 2XPIA 3HHMA 1WM5A 2AXUA 3GZ2A 2V4LA 4UWHA 3L17A 3O4ZA 3N71A 3ZFWA 4CGVA 4N2SA 3PEUB 3ZHEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N3A A;  4U0U A;  3UUX A;  4I2W A;  3PE4 A;  4B94 A;  3ZHE A;  1PC2 A;  3RJV A;  2C0L A;  3FFL A;  2C0M A;  3OXG A;  4GA2 A;  4HOT A;  4GCO A;  4UQY A;  5FJY A;  2JLB A;  4LEU A;  3Q5M A;  1FCH A;  5AYW D;  3U4T A;  4J8F A;  3LKU A;  3CVL A;  4AY5 A;  1NZN A;  3FWV A;  3K9I A;  4W9R A;  4ABN A;  5BNW A;  3S7D A;  4J8E A;  3KD7 A;  4N3B A;  4H7X A;  4YVO A;  2HR2 A;  5BW8 C;  3CKB A;  3LPZ A;  4BWR A;  4G2V A;  4HOU A;  4I9E A;  5D0O D;  5CCL A;  2HO1 A;  2KC7 A;  1ELR A;  3SZ7 A;  3UPV A;  4A1S A;  1OUV A;  3ZN3 A;  3Q15 A;  2VSY A;  4I2Z A;  3EDT B;  2FEZ A;  4WUY A;  3RIB A;  3VTY A;  1W3B A;  4ME2 A;  2V5F A;  5BT1 A;  1Y8M A;  1IYG A;  3ASG A;  4F3V A;  2KCK A;  3TGO A;  2PQN A;  5KJM A;  4O6F A;  4GZ3 A;  5A7D B;  3PDN A;  4I1A A;  3S7F A;  1KLX A;  3FP3 A;  2I6H A;  3RO2 A;  3RU0 A;  2FO7 A;  4YND A;  5EX0 A;  5KJN A;  4YVQ C;  4HOQ A;  4J0U A;  4JL0 A;  3AS4 A;  4GZ6 A;  5D0Q D;  3ESK A;  4U04 A;  2KAT A;  3QKY A;  3ASH A;  4WNE A;  3RO3 A;  3CK7 A;  3E4B A;  4RG9 A;  2OOE A;  3QOU A;  3MV2 B;  4G24 A;  1ZU2 A;  3Q49 B;  2C2L A;  3CEQ A;  3AS8 A;  4N39 A;  2KCL A;  5JJ7 A;  2PQR A;  3BEE A;  3MEK A;  2LNI A;  3S7B A;  5G05 J;  3NF1 A;  5DBK A;  4KBQ A;  5EKQ D;  4AIF A;  3WXX A;  4XI9 A;  4H7Y A;  1XNF A;  4KYO B;  4GZ5 A;  1B89 A;  3ASF A;  4UQX A;  4GA1 A;  3KS2 A;  2NC9 A;  5HQ8 A;  2XCB A;  4HOS A;  4GA0 A;  2VQ2 A;  2BUG A;  1HXI A;  5G04 J;  4UQZ A;  2XEV A;  4IN3 B;  4BT9 A;  4RG6 A;  3O48 A;  3U3W A;  3LCA A;  4AM9 A;  5CHE E;  5ARG A;  2XCC A;  3KAE A;  4XI0 A;  3CVN A;  2KCV A;  3MKR A;  3AS5 A;  2VGY A;  1KT1 A;  2VSN A;  3S7J A;  4CGW A;  2FF4 A;  4I9C A;  5JJ6 A;  5A6C A;  4BTA A;  2DBA A;  3ASD A;  3QWW A;  2VGX B;  2J9Q A;  4GCN A;  1HZ4 A;  2VGX A;  3GZ1 A;  3Q4A B;  3CK8 A;  1HH8 A;  1ZBP A;  5FZQ A;  2WPV A;  2WQH A;  3Q47 B;  5KJL A;  4G25 A;  5G05 C;  2YQ8 A;  3LY9 A;  3GW4 A;  4WNG A;  2E2E A;  1ELW A;  4GYW A;  2XGS A;  3CK9 A;  5FT9 A;  3LY8 A;  2XGM A;  4XIF A;  3OXL A;  5FZS A;  5KJK A;  2Y4U A;  1TJC A;  4Y6C A;  4EQF A;  5FZR A;  4N2Q A;  3R9A B;  5DIZ A;  5G04 C;  3GYZ A;  1NA0 A;  1WAO 1;  4G23 A;  5HI7 A;  5LCW J;  2YHC A;  1YA0 A;  2Q7F A;  2GW1 A;  2PL2 A;  3LY7 A;  4UI9 J;  2LSV A;  4G26 A;  3IEG A;  4GYY A;  4N3C A;  3MV3 B;  4BT8 A;  4U0Z A;  4I17 A;  3QDN A;  2OND A;  3ULQ A;  2R5S A;  4J8D A;  3CVP A;  4GYO A;  2XGO A;  1QQE A;  3UQ3 A;  4APO A;  3TG5 A;  3URZ A;  4UI9 K;  4GPK A;  2IF4 A;  3LYA A;  2MHK A;  3CKC A;  3QWV A;  4Y6W A;  4U07 A;  3CVQ A;  5JJT A;  4WND A;  3JYS A;  5M72 A;  2AVP A;  2UY1 B;  2IFU A;  5C1D A;  5FTP A;  4KXK B;  2FBN A;  2Y4T A;  2UY1 A;  4CDR A;  3ZGQ A;  5CCM A;  4HOR A;  3OXF A;  2LSU A;  3PE3 A;  2L6J A;  1NA3 A;  1A17 A;  5EX3 A;  1IHG A;  5LCW C;  2UWJ G;  4WNF A;  4G1T A;  1P5Q A;  1QZ2 A;  3TAX A;  5ARF A;  4BTB A;  3SF4 A;  4U0S A;  2FI7 A;  4UI9 C;  3VTX A;  2QFC A;  2VYI A;  2HYZ A;  4JA7 A;  3QWP A;  3CV0 A;  1E96 B;  2P58 C;  2PZI A;  3HYM B;  3TG4 A;  3ZPJ A;  1KT0 A;  4NRH B;  4NQ0 A;  4JA9 A;  3RKV A;  4JHR A;  4AY6 A;  3MA5 A;  4N5C A;  2XPI A;  1WM5 A;  3GZ2 A;  3N71 A;  3ZFW A;  4CGV A;  4N2S A;  3ZHE B; 
#chains in the Genus database with same CATH topology
 4I2W A;  3PE4 A;  2QYU A;  2L0I A;  3RJV A;  4GMJ A;  3FFL A;  2C0M A;  4BFR A;  4GA2 A;  4GCO A;  2GRN B;  3CQG B;  5FJY A;  2XEN A;  5AYW D;  3U4T A;  4Q94 A;  3LKU A;  1JWG A;  3ONK A;  2CHX A;  3CVL A;  3FWV A;  1KPS B;  4W9R A;  1TYQ G;  3KD7 A;  3CVU A;  4N3B A;  2F8X K;  4HBD A;  2R17 C;  4YVO A;  2HR2 A;  3CKB A;  3LPZ A;  5FIN A;  3SO8 A;  2XPY A;  2ION A;  3QB2 A;  2KC7 A;  4M3O A;  4XX5 A;  1N9A A;  1EPU A;  3SY2 A;  4A1S A;  3LDZ A;  3FUK A;  2GGF A;  3Q15 A;  3Q7F A;  2MRI A;  4HRN A;  5CMW A;  3T8M A;  2V5Q C;  3HXC A;  5CMY A;  2WVI A;  1W3B A;  3D9M A;  3G2W A;  4F3V A;  2V8S E;  5B1A E;  1IXV A;  2WXL A;  3FH7 A;  3FP3 A;  4GAA A;  2BED A;  3OTN A;  2FO7 A;  4YND A;  3PVL A;  2R2L A;  4YVQ C;  4JL0 A;  1MX2 A;  2XS1 A;  1JCS A;  3ESK A;  3FTU A;  2KAT A;  3UM3 A;  5D66 A;  3AU4 A;  4WNE A;  2WXJ A;  3CK7 A;  3E4B A;  1IQR A;  3L82 A;  4G24 A;  1ZU2 A;  3Q49 B;  3ZYM A;  4ANX A;  2KCL A;  1TNU A;  2GRM A;  1PAQ A;  1TR4 A;  3MZL B;  3MKQ A;  2EIL E;  5EYP F;  4FAD A;  2LNI A;  2EIM E;  4FA6 A;  5DBK A;  2NYJ A;  4AIF A;  4O1O A;  2J09 A;  1QBQ A;  4RQI A;  1E7U A;  1Z3X A;  4L7T A;  3MCX A;  2WQ6 A;  3I4R B;  3IXE A;  4GTS A;  3UKR G;  5HQ8 A;  4ANW A;  4JB8 P;  3AG2 E;  3L22 A;  3PZ1 A;  5AQ9 A;  3B7R L;  1HXI A;  3HXB A;  1IHB A;  3CST A;  3HG0 D;  4DLO A;  4BT9 A;  2NSZ A;  4AVX A;  1KZP A;  4GTO A;  4DX1 A;  3DXK G;  3PUJ A;  4AM9 A;  5CHE E;  1FVF A;  3D9J A;  4G11 A;  3AS5 A;  3NAW A;  4FHK A;  1KT1 A;  4XKC A;  3S7J A;  2FF4 A;  5JJ6 A;  3PNT B;  1H0A A;  5A6C A;  2DBA A;  3L6A A;  2V4H C;  3DXM G;  3ULY A;  4G8L A;  4OAV B;  3ABL E;  3QWW A;  2J49 A;  2J9Q A;  3L08 A;  1SVX A;  5AN8 A;  4I43 A;  2J4D A;  2M63 A;  4U63 A;  3Q4A B;  3CHO A;  2Y1L E;  1H6O A;  3FTS A;  1D8D A;  4F53 A;  1HH8 A;  3FUF A;  4JHK A;  5FZQ A;  2WPV A;  2WQH A;  3Q47 B;  3NBN B;  3R7Q A;  1ELW A;  4GYW A;  1SA4 A;  4KVM A;  3CVX A;  4XIF A;  3R7R A;  3OXL A;  4CYM D;  2QY7 A;  3G2T A;  3KEA A;  2DWZ A;  1NP7 A;  3TXM A;  3MKQ B;  4Y6C A;  3MX3 A;  5FZR A;  3UT4 A;  1HS6 A;  2IJG X;  3SI5 A;  5DIZ A;  4FLB A;  2DCP A;  2IOS A;  3B7B A;  1NI1 A;  2J08 A;  4ZFH A;  1Z3Y A;  4FJZ A;  2QYJ A;  1UW4 B;  3DSW A;  2IQC A;  4U96 D;  3ISM C;  4G26 A;  3IEG A;  3I3N A;  3JXJ A;  4N3C A;  3V2O A;  2HE0 A;  3QDN A;  4CT0 A;  3IV0 A;  4KVO A;  2WM9 A;  4J8D A;  3CVP A;  2XGO A;  3UQ3 A;  3TG5 A;  4FC8 A;  5LOZ A;  4UI9 K;  4GPK A;  1H2V C;  5T3R A;  5LP0 A;  4K5C A;  2J4B A;  2WXM A;  3DEO A;  4ANV A;  4YDE A;  5M72 A;  3CGH A;  4JXT A;  3PZ2 A;  2IFU A;  3UKU G;  2FBN A;  2UY1 A;  2JAB A;  4C9B B;  3E33 A;  3T8K A;  4QQI A;  2GRR B;  3PE3 A;  5CED B;  5CER B;  4HXI A;  2AJA A;  5T4Y A;  4PS7 A;  1YMP A;  4TUU A;  1TNO A;  4L9P A;  4OYS A;  2BKG A;  2AWI A;  2B0O E;  3ZKJ A;  4FU3 A;  3VTX A;  2GRO B;  1PY1 A;  2RKK A;  4BER A;  2WXK A;  4DX2 A;  1FVH A;  1BLX B;  3CV0 A;  3DWL G;  4WWN A;  4IRU A;  1E96 B;  4GTT A;  3HYM B;  3B95 A;  1FT1 A;  3ZPJ A;  5CBO A;  5BXO A;  4JA9 A;  5FWQ A;  4JHR A;  2R59 A;  3MA5 A;  2EIN E;  3HHM A;  3Q78 A;  4UUC A;  3N71 A;  4CGV A;  3ZHE B;  3ML9 A;  3AU5 A;  4TXQ A;  3TXN A;  4BX9 A;  4B94 A;  1E90 A;  3CSF A;  4AEZ C;  4BET A;  3FUI A;  3CVY A;  2X6J A;  3OXG A;  2X38 A;  4GU5 A;  3BG0 B;  2F37 A;  3LEW A;  3D9I A;  2JLB A;  3KSL A;  4LEU A;  3Q5M A;  1N0Q A;  3AAA C;  3APF A;  4F6R D;  2WXP A;  4AY5 A;  5EIB E;  4XE0 A;  3C3O A;  3S7D A;  5AAO A;  3ABM E;  1DNP A;  4IYP A;  3TWS A;  4FUL A;  3D9H A;  2XZD G;  4HS2 A;  4G2V A;  3IKO B;  4PS8 A;  2HM8 A;  3EHM A;  2F8Y A;  3TJP A;  3CLJ A;  3C5R A;  5FQ6 A;  2HO1 A;  4O60 A;  1ELR A;  3SZ7 A;  1HU3 A;  3B7T A;  2BF0 X;  4EZL A;  1TJF A;  4HB5 A;  3EHN A;  1YCS B;  4I2Z A;  3PS6 A;  5KBA A;  2XEH A;  2X6F A;  3NOG D;  4WUY A;  4FLH A;  3UI2 A;  1OY3 D;  3SD5 A;  3Q75 A;  5BT1 A;  2X6I A;  1Y8M A;  4E85 A;  2KCK A;  1E8Y A;  3TGO A;  4O6F A;  1SA5 A;  4AXH A;  4GZ3 A;  1QNF A;  2I6H A;  4FHJ A;  5LFA A;  3RO2 A;  4LRZ A;  3DRA A;  4ATZ D;  4HOQ A;  3FUH A;  2KBX A;  4R7L A;  2OV8 A;  3D9K A;  4RLY A;  1IKN D;  4WAF A;  3ASH A;  3BG1 B;  3PEV B;  3RO3 A;  3VLF A;  3QOU A;  3MV2 B;  1U2V G;  2MYO A;  4HI8 A;  2WXF A;  3FTW A;  4N39 A;  3UM2 A;  3ZEF A;  5FQ4 A;  1SZA A;  4ACL A;  3VLD A;  3EHR A;  2WXR A;  3S7B A;  3HDX A;  3EU5 A;  4I6G A;  5E75 A;  2LXM A;  1WDY A;  2BTD A;  4L23 A;  1TNZ A;  3KS2 A;  3QNK A;  3NB2 A;  2IU1 A;  4B8A A;  4BX8 A;  2VQ2 A;  2BUG A;  5G04 J;  4Q96 A;  2XEV A;  1KZO A;  2WMN A;  1U3C A;  2AW6 A;  4RG6 A;  3O48 A;  3LCA A;  5ARG A;  2XCC A;  2GRQ B;  3CVN A;  1O1T A;  4I6E A;  3MKR A;  3ZXS A;  4TXP A;  4OAU C;  1H6P A;  3R9M A;  4I9C A;  1BU9 A;  2XPZ A;  4BTA A;  3JCK C;  2ETC A;  2OCC E;  4GTQ A;  3DST A;  1K1A A;  3NQP A;  4WWP A;  3CHQ A;  3LXU X;  2P9S G;  2VGX B;  4DX5 D;  1D9S A;  4GCN A;  1HZ4 A;  4LCT A;  3W9G A;  2FUL A;  3CK8 A;  4BEP A;  1FT2 A;  2H6H A;  4NIK A;  3OAW A;  4WWO A;  3U66 A;  5FQ7 A;  2E2E A;  5JA4 D;  4TV3 A;  4LNG A;  5FT9 A;  4XEI G;  4NAC A;  4E6H A;  1N11 A;  3Q7A A;  5FZS A;  1H2T C;  4EQF A;  5ANL A;  4N2Q A;  3R9A B;  5G04 C;  3GYZ A;  5ENR D;  5EDS A;  2IY0 C;  1NA0 A;  3IHY A;  4C0M A;  4ACK A;  2YHC A;  3LVQ E;  1YA0 A;  3FH5 A;  2PL2 A;  5G55 A;  5JMN D;  4CDN A;  3KEZ A;  2LSV A;  3C72 A;  3FTV A;  4GTM A;  1MQS A;  3FUL A;  3B13 A;  2A4Z A;  3EHQ A;  4I17 A;  3TL5 A;  5EYL A;  1DC2 A;  4M7C A;  4ANU A;  1N4R A;  3ULQ A;  2R5S A;  3FU0 A;  4B93 B;  3HVE A;  5J90 A;  1QQE A;  3L16 A;  4APO A;  2YIN A;  2IF4 A;  3C98 A;  2MHK A;  5AQA A;  4F1S A;  1TN8 A;  2CG3 A;  2DYS E;  5AQB A;  2VTB A;  3CVQ A;  5JJT A;  3FTZ A;  2LXL A;  4GZD A;  4P29 A;  2Y4T A;  1MX4 A;  3EU9 A;  3UXG A;  1TN7 A;  2H6F A;  2RG8 A;  1DCE A;  4JC8 A;  5EID A;  4DPR A;  3OXF A;  2LSU A;  4TXR A;  2H6I A;  3JUI A;  3D9P A;  3TWU A;  4K0R A;  4APF A;  4WNF A;  4DRX E;  4HLL A;  3UMV A;  4G1T A;  1HG2 A;  1O1R A;  4I1O B;  3S2A A;  4NUR A;  3G2S A;  3TAX A;  4HRM B;  1OCZ E;  3SF4 A;  4U0S A;  3UT7 A;  4CRW A;  2VYI A;  3AG3 E;  5KCM A;  4JA7 A;  3FUN A;  4HVB A;  1H6K A;  4L1B A;  2PZI A;  2ETA A;  2Y69 E;  1OXJ A;  2J8S D;  2BKK B;  3Q79 A;  3P1U A;  4LUN U;  4LSZ E;  1KT0 A;  4U8H A;  2P9N G;  4BSX A;  1HFA A;  1S63 A;  3J5P A;  3ZYL A;  3RKV A;  3SFY A;  3L17 A;  2IO3 C;  1FPP A;  3V30 A;  4U0U A;  2AXZ A;  3DEP A;  5ITZ F;  2XHE A;  4J8S A;  3ZHE A;  1PC2 A;  4JPS A;  2LUH A;  5ANR A;  4A1G A;  4HOT A;  3HVE B;  4UQY A;  3RRN B;  2GRP B;  3ENE A;  1H19 A;  3ZVV A;  3G2V A;  5ENQ D;  3FTY A;  1FCH A;  3IBE A;  3HXD A;  1SQM A;  3QC1 A;  4ABN A;  2VTB B;  3UM0 A;  1N95 A;  5BV0 A;  3FDH A;  4HRL A;  5BW8 C;  4URK A;  4U95 D;  5BXU A;  1MJ0 A;  4BWR A;  3APC A;  4A55 A;  2CG2 A;  4I9E A;  5D0O D;  4AOF A;  5CCL A;  4U7E B;  4J8Y A;  4GML A;  2P9P G;  5EIL A;  3UPV A;  2L6B A;  2PNN A;  1INZ A;  3ZN3 A;  3G2U A;  3V79 K;  1JUQ A;  3TWT A;  3C3Q A;  2FEZ A;  3RIB A;  3DSX A;  1JCQ A;  2IO2 C;  3VTY A;  5BPP A;  1HX8 A;  2V5F A;  1IYG A;  2PQN A;  1OWM A;  5KJM A;  2YHE A;  3PDN A;  3S7F A;  4ILH B;  3TWX A;  2XS8 A;  5KJN A;  4GTV A;  4J0U A;  1MZC A;  2R02 A;  5D0Q D;  2RFM A;  3SBT B;  3PZD A;  4CEM A;  2OOE A;  2C2L A;  3FH8 A;  4ATG A;  3DBS A;  3SQV A;  5KNG A;  5JJ7 A;  5LX8 A;  2IEJ A;  2WMO A;  3ZYK A;  3J5Q B;  1LD8 A;  2KXP C;  3T9K A;  1UN9 A;  4XI9 A;  2X3M A;  1OWL A;  4QFV A;  1XNF A;  4KYO B;  1B89 A;  5ENN A;  4K03 A;  3NOC D;  2Y3A A;  2NC9 A;  1YYH A;  3FUD A;  4HOS A;  4GA0 A;  3TWQ A;  2XRY A;  4GMR A;  4EBA A;  2X6H A;  1LD7 A;  3CHR A;  3ZIM A;  5HS0 A;  3PNL B;  2P9U G;  2A5U A;  3KAE A;  1ELK A;  2L9B A;  2KCV A;  5AQ7 A;  4OVV A;  4C0E A;  2VGY A;  1N4S A;  2VSN A;  5AJD A;  3EJN A;  2LO6 A;  2ZU6 B;  3LS8 A;  4Q69 A;  4EZK A;  3TWV A;  3UX4 A;  3PZ4 A;  2H6G A;  3ASD A;  2DZO A;  2R03 A;  1IQU A;  2P9I G;  1S70 B;  3FHE A;  4FJY A;  2I1K A;  3ABK E;  2VGX A;  2QC9 A;  1ZB1 A;  5G2N A;  3DSU A;  5AAR A;  2XQ0 A;  4EZJ A;  1LTX A;  1ZBP A;  2WXI A;  3ZU7 B;  2DIW A;  4B0Z A;  1EDU A;  5KJL A;  3LY9 A;  4WNG A;  1MYO A;  2DZN A;  2WXG A;  1OWO A;  2XGS A;  3CK9 A;  1K1B A;  3LY8 A;  3D9O A;  1Q2Z A;  2XGM A;  2DYR E;  3DSV A;  3FU3 A;  3CR3 A;  5BUZ A;  1MX6 A;  4I6J A;  1TJC A;  3PRE A;  1DCQ A;  2VJ8 A;  1N4Q A;  4DUI A;  4O1P A;  3QK0 A;  3SFX A;  2I1J A;  3T5V A;  1RW2 A;  4G23 A;  4F7A A;  3PH0 C;  1N52 A;  3WG7 E;  4A63 B;  2GW1 A;  4GZC A;  1OCC E;  3HIZ A;  3EUV A;  4JHJ A;  4MS6 A;  4EPZ A;  1SZ9 A;  4XKB A;  3ZYQ A;  1E7V A;  4KMO A;  4JEH A;  1X5B A;  3RRU A;  3NZS A;  3FTX A;  3FUM A;  4GYY A;  3ZW3 A;  2Y0B G;  3MGB A;  3V2X A;  3MV3 B;  2I2O A;  4U0Z A;  3FU6 A;  4L2L A;  5EN5 D;  1N0R A;  1TN6 A;  3JXI A;  3W9F A;  2A5E A;  3PUK A;  3URZ A;  3TWW A;  3B7S A;  3L54 A;  3UIP C;  3QJZ A;  5A23 A;  4K5A B;  4BY6 A;  4ZHB A;  2XEE A;  4EEC A;  1BI8 B;  2OEV A;  3CVW A;  3BQO A;  3ONL A;  4Y6W A;  3PZ3 A;  4WND A;  3JYS A;  2V0P A;  2VGE A;  5FTP A;  2CFU A;  4V3I A;  4KXK B;  5B1B E;  3ZXP A;  3ZGQ A;  3CHP A;  1JPL A;  4HQD A;  1Y6I A;  2WXQ A;  2F0Y A;  2NXP A;  4UWF A;  3KSQ A;  3X2Q E;  3FY4 A;  3V31 A;  5D2M C;  2L6J A;  3U64 A;  2X6K A;  1NA3 A;  2RD0 A;  3AG1 E;  5EX3 A;  5J08 A;  4ILG A;  4RSY A;  4CZ2 D;  1P5Q A;  1QZ2 A;  4GTP A;  4KZC A;  4GPM A;  1OCO E;  4BTB A;  1V54 E;  3CVV A;  2YNQ A;  3UT8 A;  2HYZ A;  3QWP A;  2WXH A;  1LF8 A;  2P58 C;  4JEU A;  3D9L A;  3CHS A;  1TEZ A;  2XRZ A;  5AEN A;  3U9W A;  3QAQ A;  5CEA A;  2EQX A;  4UWG A;  4NQ0 A;  3E34 A;  4PS3 A;  4AY6 A;  3Q9U C;  2R05 A;  4N5C A;  1AWC B;  2XPI A;  2DVW A;  4DX6 D;  3UTM A;  1TNB A;  2V4L A;  4UWH A;  4J7W A;  4N2S A;  3PEU B;  4N3A A;  5JHB A;  3UUX A;  3CQC B;  3RSE G;  1UN8 A;  1U3D A;  5ENS D;  1NFI E;  2C0L A;  3EIQ C;  4MRU A;  5H7P A;  3F6Q A;  2CHW A;  4HNA D;  1A5E A;  1OWN A;  3JQ1 A;  2GRL A;  1HF8 A;  2ZGG A;  4KZ0 A;  3UIO C;  4J8F A;  3D9N A;  2XZT G;  1NZN A;  4XZ4 A;  3K9I A;  4DLQ A;  1X81 A;  4PUC A;  5BV1 A;  1OT8 A;  5BNW A;  4J8E A;  4C48 B;  3C3R A;  3Q73 A;  4A3V A;  3ESL A;  4H7X A;  5CBN A;  1XGW A;  1G3N B;  4HOU A;  1OWP A;  3RRM B;  3E37 A;  1QYM A;  1EYH A;  5AIJ A;  1OUV A;  3SNX A;  5ENT D;  2VSY A;  1UJJ A;  2L0T B;  3EDT B;  1Z6T A;  3AG4 E;  4U8V D;  4AP2 A;  4UWL A;  3CIA A;  4ME2 A;  1DVP A;  4LNU D;  3ASG A;  2P9K G;  5A7D B;  5JHA A;  4I1A A;  3Q9N C;  1Z5S C;  1KLX A;  3ZNG A;  4D10 C;  3MJW A;  3RU0 A;  3NZU A;  5EX0 A;  4DJA A;  2EIJ E;  3AS4 A;  2WXN A;  3QAR A;  4JZY A;  4GZ6 A;  4U8Y D;  4U04 A;  5IY5 E;  3E30 A;  3QKY A;  1MHQ A;  1HG5 A;  2MOW A;  1UG3 A;  4RG9 A;  3P2B A;  3CEQ A;  3AS8 A;  4G8K A;  1S64 A;  2PQR A;  3BEE A;  3SHF A;  3MEK A;  4OVU A;  4DX7 D;  4IUL A;  1O1S A;  4LER A;  5G05 J;  4EHM A;  3NF1 A;  4KBQ A;  5EKQ D;  3TWR A;  3WXX A;  4H7Y A;  3UIN C;  4GZ5 A;  2AXV A;  3ASF A;  4UQX A;  2VSX E;  4GA1 A;  3ZUV B;  3DPD A;  2KZT A;  1N94 A;  2XCB A;  3UM1 A;  4UQZ A;  4IN3 B;  3FU5 A;  3U3W A;  4GTR A;  3RK6 A;  3D3M A;  4PDX A;  3JUE A;  4B8C B;  5B3S E;  4N5Q A;  4XI0 A;  1AP7 A;  3ULE G;  5HRY A;  5HKP A;  5AJL A;  2P9L G;  4CGW A;  2OEW A;  4JW1 A;  1EF1 C;  3APD A;  2IOL A;  2ZGD A;  3ASN E;  3JQ0 A;  1N54 A;  3ZRH A;  1BPO A;  4B89 A;  1UJK A;  2I9C A;  4ILI A;  5CEC B;  4HI9 A;  4DI4 A;  4Z68 A;  1GW6 A;  4X8Q A;  2E0I A;  3E32 A;  2ZIR A;  1HO8 A;  3GZ1 A;  3BU8 A;  2P2C P;  3AJI A;  4MBG A;  1O5M A;  4BES A;  2OVB A;  3EIJ A;  3BUA A;  4DI3 A;  4BSZ B;  1HE8 A;  2VSO E;  3IHV A;  2OVF A;  2QZA A;  2WB2 A;  4RVB A;  4G25 A;  1E8X A;  5G05 C;  4KT6 B;  2YQ8 A;  4L2Y A;  3T5X A;  3GW4 A;  4YDO A;  4JVS A;  3LVR E;  4LNB A;  4J6I A;  2KM4 A;  3I4G A;  2EIK E;  5ENP D;  1OCR E;  5KJK A;  2Y4U A;  3PRZ A;  4EBA G;  2FO1 E;  2J07 A;  2ZXW E;  1N4P A;  2PM7 A;  5CRU A;  3LJ3 A;  4F1P A;  3ML8 A;  1H2U A;  1WY6 A;  1WAO 1;  5HI7 A;  2WXO A;  5LCW J;  1E8Z A;  5FQ8 A;  2Q7F A;  3B7U X;  3FUE A;  4DK5 A;  3LY7 A;  2KZT B;  4GB9 A;  4UI9 J;  3HXF A;  4I1M A;  3FEY A;  4MLP A;  3FUJ A;  3DSS A;  5E76 A;  4AV7 A;  2LAI A;  4BT8 A;  2OND A;  1JWF A;  2ETB A;  1L5J A;  4GYO A;  4A3T A;  5T8I A;  1K8K G;  1JCR A;  2JEK A;  4UWK A;  1TNY A;  1E8W A;  1S0P A;  3RAU A;  3LYA A;  3CHM A;  4FP7 A;  2ILR A;  3SBS A;  3CKC A;  4TUM A;  3QWV A;  4MKT A;  4U07 A;  5KNH D;  1K3Z D;  1V55 E;  4AJW A;  4CDM A;  2AVP A;  2UY1 B;  3L9T A;  5C1D A;  4LG6 A;  3LJN A;  3ASO E;  4CT4 A;  3GZS A;  4YDY A;  1BD8 A;  4CDR A;  2LAH A;  3HRA A;  5KWD A;  2PM6 A;  3I5P A;  3SFZ A;  5CCM A;  4YDW A;  1D8E A;  3MYV A;  4JD2 G;  4HOR A;  1SW6 A;  2WQ7 A;  4PH4 B;  2CFZ A;  2CHZ A;  1A17 A;  2ZIS A;  1IHG A;  5LCW C;  2UWJ G;  5CRV A;  2RFA A;  5ARF A;  2FI7 A;  4UI9 C;  2QFC A;  3VLE A;  4K5B A;  3L13 A;  4TRQ A;  3SGH A;  1BI7 B;  5C2Y A;  4CCA A;  3HXE A;  4HLE A;  3TG4 A;  1WG0 A;  5FIO A;  3DPY A;  1VDY A;  1UOH A;  3FEX A;  2B6C A;  4HFG A;  4NRH B;  1RZ4 A;  1NL4 A;  1WM5 A;  2AXU A;  3GZ2 A;  3O4Z A;  5ENO D;  3ZFW A; 
#chains in the Genus database with same CATH homology
 4N3A A;  4U0U A;  5JHB A;  2AXZ A;  3UUX A;  3CQC B;  4I2W A;  3ML9 A;  3AU5 A;  2XHE A;  3PE4 A;  3TXN A;  4BX9 A;  1UN8 A;  4J8S A;  1U3D A;  4B94 A;  1E90 A;  1PC2 A;  2L0I A;  4JPS A;  3RJV A;  3CSF A;  3ZHE A;  2C0L A;  3FUI A;  4GMJ A;  4AEZ C;  3EIQ C;  3FFL A;  3CVY A;  2X6J A;  2C0M A;  3OXG A;  4BFR A;  2X38 A;  4GU5 A;  4MRU A;  4GA2 A;  5ANR A;  4A1G A;  2CHW A;  4HOT A;  3BG0 B;  4GCO A;  1OWN A;  3HVE B;  4UQY A;  3RRN B;  3ENE A;  3CQG B;  3JQ1 A;  3LEW A;  5FJY A;  3D9I A;  2JLB A;  1H19 A;  2GRL A;  4LEU A;  3G2V A;  3ZVV A;  1HF8 A;  3Q5M A;  3FTY A;  3APF A;  1FCH A;  4KZ0 A;  2WXP A;  5AYW D;  4J8F A;  3U4T A;  4Q94 A;  3LKU A;  1JWG A;  3ONK A;  3IBE A;  2CHX A;  3CVL A;  3D9N A;  4AY5 A;  1NZN A;  3FWV A;  4XE0 A;  3K9I A;  4XZ4 A;  4DLQ A;  4PUC A;  5BV1 A;  1SQM A;  3QC1 A;  4W9R A;  4ABN A;  5BNW A;  3S7D A;  4J8E A;  2VTB B;  3KD7 A;  3CVU A;  4N3B A;  4A3V A;  3ESL A;  4H7X A;  1DNP A;  2R17 C;  4IYP A;  5BV0 A;  3FDH A;  4FUL A;  4YVO A;  2HR2 A;  1XGW A;  5BW8 C;  3CKB A;  4URK A;  4HS2 A;  3LPZ A;  4BWR A;  3APC A;  4G2V A;  3IKO B;  2XPY A;  4PS8 A;  2HM8 A;  4A55 A;  2ION A;  4HOU A;  2CG2 A;  3EHM A;  3QB2 A;  4I9E A;  3TJP A;  5D0O D;  3CLJ A;  4AOF A;  5CCL A;  5FQ6 A;  2HO1 A;  1OWP A;  2KC7 A;  1ELR A;  4GML A;  3SZ7 A;  1HU3 A;  3B7T A;  4M3O A;  3RRM B;  4XX5 A;  2BF0 X;  3UPV A;  1EPU A;  4EZL A;  1TJF A;  4A1S A;  1EYH A;  3LDZ A;  5AIJ A;  1INZ A;  1OUV A;  3FUK A;  3SNX A;  3ZN3 A;  2GGF A;  3Q15 A;  3EHN A;  2MRI A;  2VSY A;  3G2U A;  4I2Z A;  5CMW A;  1UJJ A;  2L0T B;  3PS6 A;  1JUQ A;  3T8M A;  3EDT B;  1Z6T A;  2X6F A;  2FEZ A;  4WUY A;  3RIB A;  4FLH A;  3VTY A;  4AP2 A;  3SD5 A;  5CMY A;  4UWL A;  2WVI A;  3CIA A;  1W3B A;  5BPP A;  4ME2 A;  1HX8 A;  2V5F A;  5BT1 A;  1DVP A;  2X6I A;  3D9M A;  1Y8M A;  1IYG A;  3G2W A;  3ASG A;  4E85 A;  4F3V A;  2KCK A;  1E8Y A;  3TGO A;  2PQN A;  1OWM A;  5KJM A;  4O6F A;  2YHE A;  2V8S E;  4AXH A;  4GZ3 A;  5A7D B;  1QNF A;  2WXL A;  5JHA A;  3PDN A;  4I1A A;  3S7F A;  1KLX A;  3FH7 A;  3FP3 A;  4GAA A;  2I6H A;  3MJW A;  4FHJ A;  4D10 C;  3RO2 A;  3OTN A;  4ILH B;  4LRZ A;  2FO7 A;  3RU0 A;  4YND A;  3NZU A;  3PVL A;  5EX0 A;  5KJN A;  4YVQ C;  4HOQ A;  3FUH A;  4R7L A;  4DJA A;  4J0U A;  4JL0 A;  2OV8 A;  3AS4 A;  2WXN A;  3D9K A;  3QAR A;  4JZY A;  4GZ6 A;  5D0Q D;  3SBT B;  4WAF A;  3PZD A;  3ESK A;  3FTU A;  4U04 A;  2KAT A;  3QKY A;  1MHQ A;  1HG5 A;  2MOW A;  3ASH A;  3AU4 A;  3BG1 B;  4WNE A;  1UG3 A;  3PEV B;  3RO3 A;  3VLF A;  4CEM A;  2WXJ A;  3CK7 A;  3E4B A;  4RG9 A;  1IQR A;  2OOE A;  3QOU A;  3MV2 B;  4G24 A;  1ZU2 A;  3Q49 B;  3P2B A;  2C2L A;  3ZYM A;  3CEQ A;  3AS8 A;  3FH8 A;  4ATG A;  2WXF A;  3DBS A;  3FTW A;  4N39 A;  4ANX A;  2KCL A;  2GRM A;  3ZEF A;  1PAQ A;  5JJ7 A;  2PQR A;  3BEE A;  3SHF A;  3MEK A;  3MZL B;  3MKQ A;  5LX8 A;  4FAD A;  4OVU A;  5FQ4 A;  2LNI A;  2WMO A;  1SZA A;  4IUL A;  4ACL A;  3VLD A;  3ZYK A;  2WXR A;  3S7B A;  4FA6 A;  4LER A;  5G05 J;  3HDX A;  3NF1 A;  5DBK A;  4I6G A;  4KBQ A;  5EKQ D;  5E75 A;  4AIF A;  3WXX A;  2BTD A;  2J09 A;  1UN9 A;  4XI9 A;  2X3M A;  1OWL A;  4H7Y A;  4L23 A;  1XNF A;  4KYO B;  4QFV A;  4GZ5 A;  1B89 A;  5ENN A;  2AXV A;  3ASF A;  4K03 A;  1E7U A;  4UQX A;  1Z3X A;  2VSX E;  3MCX A;  4GA1 A;  3KS2 A;  2Y3A A;  4L7T A;  2WQ6 A;  2NC9 A;  3DPD A;  2KZT A;  3QNK A;  3I4R B;  5HQ8 A;  2XCB A;  3FUD A;  4ANW A;  4HOS A;  2IU1 A;  4GA0 A;  4B8A A;  4BX8 A;  2XRY A;  4EBA A;  3L22 A;  3B7R L;  2VQ2 A;  2BUG A;  1HXI A;  5G04 J;  2X6H A;  4Q96 A;  3CST A;  4UQZ A;  3CHR A;  2XEV A;  4DLO A;  2WMN A;  4IN3 B;  4BT9 A;  3FU5 A;  1U3C A;  2NSZ A;  2AW6 A;  3ZIM A;  4AVX A;  4RG6 A;  3O48 A;  3PNL B;  3U3W A;  3LCA A;  3PUJ A;  4AM9 A;  3RK6 A;  5CHE E;  3D3M A;  4PDX A;  5ARG A;  2A5U A;  2XCC A;  3KAE A;  1ELK A;  2L9B A;  1FVF A;  3D9J A;  4B8C B;  4XI0 A;  3CVN A;  2KCV A;  4I6E A;  4OVV A;  4G11 A;  3MKR A;  3ZXS A;  3AS5 A;  4C0E A;  2VGY A;  4FHK A;  5AJL A;  1KT1 A;  2VSN A;  5AJD A;  3EJN A;  4XKC A;  3S7J A;  2LO6 A;  4CGW A;  4JW1 A;  1EF1 C;  3APD A;  2IOL A;  2FF4 A;  2ZU6 B;  3JQ0 A;  4I9C A;  5JJ6 A;  1N54 A;  3LS8 A;  1H0A A;  3PNT B;  3ZRH A;  4Q69 A;  5A6C A;  2XPZ A;  4EZK A;  4BTA A;  2DBA A;  1BPO A;  3JCK C;  3L6A A;  3UX4 A;  3ASD A;  4B89 A;  1UJK A;  2I9C A;  4ILI A;  3NQP A;  1IQU A;  4WWP A;  3CHQ A;  3LXU X;  4DI4 A;  3QWW A;  3FHE A;  2VGX B;  2J49 A;  2J9Q A;  1GW6 A;  3L08 A;  2E0I A;  4I43 A;  2J4D A;  2M63 A;  4FJY A;  2I1K A;  4GCN A;  1HZ4 A;  1HO8 A;  2VGX A;  3GZ1 A;  4LCT A;  4U63 A;  3Q4A B;  2FUL A;  3CK8 A;  5G2N A;  3CHO A;  3FTS A;  2XQ0 A;  4EZJ A;  2OVB A;  3EIJ A;  4DI3 A;  1HE8 A;  2VSO E;  4F53 A;  3IHV A;  1HH8 A;  2OVF A;  1ZBP A;  2WXI A;  3FUF A;  2WB2 A;  4JHK A;  2DIW A;  5FZQ A;  2WPV A;  2WQH A;  4B0Z A;  3Q47 B;  1EDU A;  4RVB A;  4G25 A;  1E8X A;  3OAW A;  5G05 C;  4KT6 B;  4WWO A;  5KJL A;  2YQ8 A;  4L2Y A;  3LY9 A;  3T5X A;  5FQ7 A;  3U66 A;  3R7Q A;  3GW4 A;  4WNG A;  4JVS A;  3LVR E;  2E2E A;  2WXG A;  1ELW A;  4TV3 A;  4GYW A;  1OWO A;  2XGS A;  3CK9 A;  4J6I A;  5FT9 A;  3LY8 A;  3D9O A;  4NAC A;  2KM4 A;  4KVM A;  4E6H A;  2XGM A;  4XIF A;  3CVX A;  3I4G A;  3FU3 A;  3R7R A;  3OXL A;  5FZS A;  1H2T C;  3CR3 A;  2Y4U A;  5BUZ A;  4I6J A;  2QY7 A;  5KJK A;  3G2T A;  3PRZ A;  1TJC A;  4EBA G;  3PRE A;  1NP7 A;  3TXM A;  3MKQ B;  2J07 A;  4Y6C A;  3MX3 A;  4EQF A;  5FZR A;  3UT4 A;  2PM7 A;  5ANL A;  1HS6 A;  4N2Q A;  2IJG X;  3R9A B;  2VJ8 A;  3SI5 A;  5DIZ A;  3LJ3 A;  3GYZ A;  5G04 C;  5EDS A;  4FLB A;  3ML8 A;  1NA0 A;  3IHY A;  2DCP A;  4C0M A;  3T5V A;  3QK0 A;  2I1J A;  1H2U A;  1WY6 A;  1WAO 1;  4G23 A;  4ACK A;  4F7A A;  5HI7 A;  2IOS A;  2WXO A;  2YHC A;  3LVQ E;  5LCW J;  3PH0 C;  1YA0 A;  1N52 A;  1E8Z A;  3FH5 A;  5FQ8 A;  2Q7F A;  2GW1 A;  2PL2 A;  2J08 A;  3B7U X;  3FUE A;  3HIZ A;  1Z3Y A;  4FJZ A;  4GZC A;  4JHJ A;  5G55 A;  3LY7 A;  4MS6 A;  2KZT B;  4DK5 A;  4GB9 A;  4EPZ A;  1SZ9 A;  4UI9 J;  4CDN A;  3KEZ A;  2LSV A;  1UW4 B;  4XKB A;  4I1M A;  2IQC A;  3FTV A;  3ZYQ A;  1E7V A;  4KMO A;  1MQS A;  3FEY A;  4JEH A;  4MLP A;  1X5B A;  3FUL A;  3B13 A;  3FUJ A;  3IEG A;  4G26 A;  3RRU A;  3NZS A;  3I3N A;  2A4Z A;  5E76 A;  3FTX A;  3FUM A;  4GYY A;  3ZW3 A;  4AV7 A;  4N3C A;  3MGB A;  2LAI A;  3MV3 B;  4BT8 A;  2I2O A;  4U0Z A;  4I17 A;  3QDN A;  3TL5 A;  4CT0 A;  3IV0 A;  3FU6 A;  2OND A;  4L2L A;  1JWF A;  4KVO A;  1L5J A;  4ANU A;  2WM9 A;  3ULQ A;  2R5S A;  3FU0 A;  4J8D A;  3CVP A;  4GYO A;  4A3T A;  5T8I A;  3HVE A;  2XGO A;  5J90 A;  1QQE A;  3L16 A;  3UQ3 A;  2JEK A;  4UWK A;  3TG5 A;  3PUK A;  4APO A;  3URZ A;  4FC8 A;  2YIN A;  5LOZ A;  4UI9 K;  4GPK A;  3B7S A;  1H2V C;  3L54 A;  2IF4 A;  5T3R A;  1E8W A;  5LP0 A;  3QJZ A;  1S0P A;  5A23 A;  3C98 A;  3LYA A;  2J4B A;  2WXM A;  2MHK A;  3CHM A;  4FP7 A;  4ANV A;  4BY6 A;  2ILR A;  4F1S A;  4EEC A;  2CG3 A;  3SBS A;  3CKC A;  3QWV A;  3ONL A;  3CVW A;  4MKT A;  4Y6W A;  4U07 A;  2VTB A;  3CVQ A;  5JJT A;  4WND A;  3JYS A;  5M72 A;  2V0P A;  4AJW A;  3FTZ A;  4CDM A;  2AVP A;  2UY1 B;  3CGH A;  4GZD A;  4JXT A;  4P29 A;  2IFU A;  5C1D A;  5FTP A;  2CFU A;  4V3I A;  4KXK B;  2FBN A;  2Y4T A;  4CT4 A;  2UY1 A;  3GZS A;  4CDR A;  3ZGQ A;  2LAH A;  4C9B B;  3CHP A;  1JPL A;  2PM6 A;  3I5P A;  3SFZ A;  1Y6I A;  5CCM A;  2RG8 A;  2WXQ A;  4JC8 A;  3MYV A;  4DPR A;  4HOR A;  2NXP A;  4UWF A;  3FY4 A;  3OXF A;  2LSU A;  3PE3 A;  2WQ7 A;  2L6J A;  3U64 A;  2X6K A;  4PH4 B;  1NA3 A;  2RD0 A;  2CFZ A;  4HXI A;  3JUI A;  2CHZ A;  5T4Y A;  1A17 A;  4PS7 A;  3D9P A;  5EX3 A;  4K0R A;  4APF A;  4TUU A;  1IHG A;  5J08 A;  4OYS A;  5LCW C;  2UWJ G;  4ILG A;  4WNF A;  3UMV A;  4G1T A;  4RSY A;  1HG2 A;  1P5Q A;  2AWI A;  4I1O B;  3S2A A;  1QZ2 A;  4KZC A;  4NUR A;  3G2S A;  3TAX A;  5ARF A;  4BTB A;  4FU3 A;  3SF4 A;  4U0S A;  2FI7 A;  4UI9 C;  3UT7 A;  3VTX A;  2QFC A;  3CVV A;  1PY1 A;  2YNQ A;  3UT8 A;  3VLE A;  4CRW A;  2WXK A;  1FVH A;  2VYI A;  5KCM A;  2HYZ A;  3L13 A;  4TRQ A;  3SGH A;  4JA7 A;  3QWP A;  3FUN A;  4HVB A;  3CV0 A;  2WXH A;  4WWN A;  1LF8 A;  1H6K A;  4IRU A;  4L1B A;  1E96 B;  2P58 C;  2PZI A;  3HYM B;  4JEU A;  5C2Y A;  3D9L A;  4CCA A;  3P1U A;  3CHS A;  1TEZ A;  4HLE A;  5LFA A;  5AEN A;  3TG4 A;  4LUN U;  3U9W A;  2XRZ A;  3ZPJ A;  1KT0 A;  4U8H A;  3QAQ A;  1VDY A;  4BSX A;  1HFA A;  2EQX A;  3FEX A;  4NRH B;  4HFG A;  4NQ0 A;  4UWG A;  4PS3 A;  4JA9 A;  5FWQ A;  3ZYL A;  3RKV A;  4JHR A;  4AY6 A;  2R59 A;  3MA5 A;  4N5C A;  2XPI A;  3HHM A;  1WM5 A;  2AXU A;  3GZ2 A;  2V4L A;  4UWH A;  3L17 A;  3O4Z A;  3N71 A;  3ZFW A;  4CGV A;  4N2S A;  3PEU B;  3ZHE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...