4HOUA

Crystal structure of n-terminal human ifit1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
269
structure length
261
Chain Sequence
VKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAYVKHLKGQNEEALKSLKEAENLMQENVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Interferon-induced protein with tetratricopeptide repeats 1
publication title Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 261
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4houA00
3E4BA 3JYSA 5FZSA 5ARFA 3K9IA 3AS4A 4HOUA 5FZQA 4GYWA 1WM5A 4UQYA 3MA5A 1IHGA 1PC2A 1E96B 5JJ7A 3KS2A 4EQFA 5A6CA 3CKCA 4WNGA 2XGOA 1XNFA 5DIZA 3ASHA 4Y6CA 3ZGQA 4BTBA 1ELWA 3SF4A 2HR2A 3OXFA 3ASGA 1NZNA 4HOTA 2JLBA 1B89A 1IYGA 2YQ8A 2XCCA 3O48A 4I2WA 4GYOA 3RIBA 3MV3B 2C2LA 4NRHB 2GW1A 2LNIA 2L6JA 4GCOA 1HXIA 3ZHEA 3S7JA 3AS5A 4G24A 5BNWA 4J8EA 4J8FA 4HORA 3RO3A 3QDNA 3QWVA 4WNFA 3PE3A 3LPZA 2QFCA 4I17A 3ZN3A 3LYAA 4JHRA 2VYIA 5FT9A 4N2SA 3ULQA 3QOUA 4UQXA 4ABNA 3CEQA 3LCAA 4G23A 3QKYA 5LCWJ 1Y8MA 2AVPA 3TGOA 4F3VA 4G25A 3LKUA 3CV0A 5KJKA 5JJ6A 2E2EA 3Q49B 3RO2A 3ZHEB 2J9QA 2KCVA 2ONDA 4UI9C 2VSNA 3PE4A 2FBNA 4G2VA 1P5QA 5D0OD 2HO1A 1HZ4A 2XGMA 2I6HA 4H7YA 4B94A 2Q7FA 3Q4AB 4N2QA 3URZA 4WUYA 4UI9K 5A7DB 2YHCA 3RJVA 4GA2A 4KBQA 4CGVA 4HOSA 4N3AA 1TJCA 3FFLA 3CKBA 2KC7A 2LSVA 2KCLA 2NC9A 5C1DA 3GZ1A 4BWRA 5JJTA 3KD7A 4GA0A 4YVQC 4N3CA 2FF4A 4I1AA 5G04C 1NA3A 2LSUA 4GZ6A 4BT8A 2UY1A 4O6FA 1ZBPA 4U0ZA 2V5FA 2MHKA 4AIFA 1KLXA 5D0QD 3CK8A 4I9CA 2OOEA 3TAXA 3CVQA 4GPKA 4YVOA 4A1SA 2KATA 5LCWC 5G05C 2WQHA 4W9RA 5KJMA 4IN3B 1ELRA 5DBKA 2HYZA 3S7FA 2PZIA 3GYZA 5HQ8A 2PQRA 5CCMA 2C0LA 4XI9A 2FO7A 4GZ5A 2VQ2A 3UQ3A 3ASFA 1NA0A 2UY1B 4HOQA 2P58C 3RKVA 4KYOB 2DBAA 4GCNA 2R5SA 1QQEA 2PL2A 2BUGA 3CK7A 3CVNA 3OXGA 4GA1A 1YA0A 2VSYA 3R9AB 4ME2A 4YNDA 1A17A 3TG5A 3VTXA 2VGXA 5AYWD 2C0MA 1OUVA 4APOA 4BTAA 3NF1A 4NQ0A 3S7BA 3GW4A 3QWWA 3UPVA 3U4TA 4CGWA 3CK9A 2Y4UA 4CDRA 3EDTB 3LY9A 5CHEE 3PDNA 4JA7A 2IF4A 4RG9A 3SZ7A 4I9EA 1FCHA 3LY8A 3GZ2A 3N71A 4G26A 4GYYA 5BW8C 4WNDA 4UI9J 4GZ3A 3AS8A 3QWPA 2XEVA 4AY6A 3OXLA 3Q5MA 4LEUA 2VGXB 3Q15A 3CVLA 5FJYA 2XCBA 3MV2B 4AY5A 2KCKA 1KT0A 4U07A 4JA9A 4KXKB 5EX3A 3CVPA 4XI0A 4G1TA 2WPVA 4XIFA 4J0UA 4I2ZA 3ZPJA 2IFUA 5EKQD 3ZFWA 5M72A 2VGYA 2UWJG 4U0SA 4N39A 5FZRA 3LY7A 4JL0A 3U3WA 3MKRA 5KJNA 5HI7A 1W3BA 5G04J 4UQZA 3VTYA 3RU0A 2Y4TA 3S7DA 2FEZA 5BT1A 4RG6A 3UUXA 3Q47B 3KAEA 3MEKA 3ESKA 5CCLA 1ZU2A 3ASDA 2XPIA 3IEGA 3FP3A 4N5CA 1KT1A 1QZ2A 4N3BA 3HYMB 5EX0A 5G05J 4Y6WA 4WNEA 1WAO1 4J8DA 3TG4A 2FI7A 5FTPA 3BEEA 4H7XA 2PQNA 4U04A 2XGSA 3FWVA 4BT9A 4U0UA 5KJLA 5ARGA 3WXXA 1HH8A 4AM9A
chains in the Genus database with same CATH superfamily
4O60A 3JYSA 4WWPA 5ARFA 4K5BA 4HOUA 4FA6A 1PY1A 4LNBA 4ATZD 3KSLA 1IHGA 3MYVA 3Q9NC 1O1TA 4A3TA 3MKQA 5CERB 1N95A 5JA4D 4EQFA 5A6CA 3CKCA 4PS3A 3UX4A 2X38A 1E90A 3NAWA 4LCTA 4JHKA 4XKCA 2BKKB 2GRNB 3SNXA 4HOTA 3L22A 2KZTB 2A5EA 4OVVA 4F53A 3RIBA 2MRIA 4I43A 2H6IA 4IYPA 4WWOA 2GW1A 3FU6A 3DXMG 3ZHEA 1S64A 4G24A 5HS0A 2XQ0A 2VTBA 4WWNA 3EIQC 5LP0A 1OWNA 4G11A 1SQMA 2GRLA 1UG3A 2XPZA 4DX6D 4OYSA 2AXUA 4JXTA 4ABNA 4GMLA 2IO2C 3CVYA 2E0IA 3TWVA 3PS6A 2Y1LE 4AVXA 2OEVA 4F3VA 3RO2A 2KCVA 2ONDA 3NOCD 2LXMA 1HE8A 2A4ZA 5EIDA 2QZAA 2HO1A 1HZ4A 2XGMA 5HKPA 4H7YA 5CRVA 3Q9UC 4XKBA 3C3RA 2EIME 4EBAA 4N2QA 2XPYA 4UI9K 1O1SA 1OCZE 5ENSD 4HS2A 5EYPF 4GTSA 2X6KA 4HRMB 4GA2A 3FULA 3CSTA 3IKOB 4KBQA 3C98A 4N3AA 4FJYA 1HO8A 2RG8A 2VSOE 3FFLA 3CKBA 3D9IA 4RSYA 4Q96A 2NC9A 3BU8A 5C1DA 3GZ1A 2P9SG 5JJTA 3KD7A 2XENA 2WMOA 1H2TC 4GZ6A 4BT8A 1TN8A 2WXGA 1GW6A 4U0ZA 1X81A 2J8SD 3ZW3A 3VLDA 1TN7A 1LF8A 3T9KA 3ML9A 4I9CA 3DXKG 3ZVVA 4U8HA 1N0RA 1TNUA 3ZEFA 4CDMA 1N9AA 3ULEG 2NSZA 3DRAA 3RRUA 4JHJA 4J6IA 1QYMA 2LAHA 5EYLA 2J08A 3ABME 2WMNA 5DBKA 3SQVA 4FHKA 3UM3A 3D3MA 2GROB 3V31A 2C0LA 4XI9A 2FO7A 2VQ2A 2EQXA 2UY1B 4HOQA 3PRZA 2DBAA 1FPPA 4DK5A 2XS1A 2FO1E 4WAFA 4U8YD 3CVNA 3Q78A 4YNDA 3CHRA 2VTBB 1Z5SC 3TWUA 2RD0A 4NQ0A 3S7BA 4K5AB 4HXIA 4CZ2D 3LY9A 2OVFA 4L2LA 3EIJA 3HXEA 3U64A 1PAQA 4ANVA 4CYMD 1YYHA 1A5EA 4I9EA 3FUJA 4UI9J 3TJPA 3L08A 3AAAC 2XEVA 3CVVA 3TWSA 1S63A 2XCBA 4IRUA 2KCKA 2WXLA 4J8YA 5CEDB 1D8DA 2ZIRA 5FINA 5EX3A 3FUNA 3CR3A 4KZCA 2AWIA 2GRMA 5EDSA 4XIFA 5AJLA 3ZPJA 5EKQD 2NYJA 5CBNA 2B6CA 4FLBA 3CVWA 1V55E 4A3VA 4OVUA 5FZRA 4JL0A 5HI7A 1MJ0A 2JABA 3CHMA 2L0IA 3VTYA 3RU0A 3S7DA 2FEZA 4XZ4A 5KWDA 4P29A 3FTVA 3Q75A 4TXRA 1FVFA 2XPIA 1BLXB 1JCSA 3IBEA 4CEMA 1Y6IA 5FIOA 2QC9A 3JQ0A 2B0OE 3HYMB 5EX0A 5J90A 1H6KA 3TXNA 2EINE 4HI9A 1N11A 4J8SA 2R2LA 3FEYA 1H2VC 3DPDA 2I2OA 3LEWA 5IY5E 4U04A 3D9OA 3B7SA 3U66A 4BT9A 3DSUA 1HH8A 4X8QA 3E4BA 1NFIE 5JMND 3K9IA 1N94A 5D2MC 5FZQA 2KZTA 2QY7A 3D9NA 1WM5A 1MYOA 1HU3A 1IKND 4YDWA 4I6EA 4GMRA 3KSQA 1TYQG 1PC2A 1E96B 3PNTB 5JJ7A 4BEPA 5CECB 3SY2A 5LOZA 4M7CA 1KPSB 3IHVA 1O1RA 1XNFA 5DIZA 3ASHA 4Y6CA 3CQCB 4BX9A 4GB9A 2Y69E 4B0ZA 3U9WA 2P9UG 3ASGA 1NZNA 2OCCE 4HQDA 2WXRA 2WXIA 2JLBA 4K03A 5FQ7A 3L9TA 1UN8A 3B7RL 3FU0A 3MV3B 5JHBA 1HX8A 3FTWA 5ITZF 5FWQA 2LNIA 3FY4A 3APDA 1HXIA 3HXBA 3UT8A 3S7JA 3LDZA 5HRYA 3AS5A 1EDUA 2IY0C 4TUMA 4JVSA 3PE3A 2X6HA 3LPZA 3AU5A 4ANXA 5CBOA 3UT7A 3EJNA 1LTXA 3MX3A 3D9KA 2GRRB 5FT9A 1NL4A 1XGWA 2R02A 4N2SA 3QOUA 2BKGA 2OEWA 3LXUX 3CEQA 3G2UA 5AQ9A 4JW1A 4BFRA 1JCRA 3FUDA 4HI8A 3ZXPA 3VLFA 2AVPA 3TGOA 5LX8A 3CV0A 4GTPA 3T8KA 4CRWA 4OAVB 4JD2G 3FU3A 4UI9C 3ZYQA 4C48B 4FADA 1UN9A 2ETAA 5T3RA 3ZNGA 2KM4A 3ASOE 1INZA 4DPRA 3D9JA 3AU4A 3Q4AB 1FT2A 5A7DB 5ENTD 3G2WA 3NBNB 3R9MA 2V4LA 3PUKA 2IQCA 4CGVA 4E6HA 3TWTA 3FUFA 3ONLA 3SHFA 1MX6A 3O4ZA 2KC7A 2KCLA 2GGFA 2CG2A 1IHBA 3CGHA 3PZ2A 4NIKA 4BWRA 4N3CA 1TNYA 4C9BB 3PZ1A 1NA3A 2DWZA 2XRZA 3UM1A 3CIAA 4A63B 5E75A 2UY1A 1K1BA 4TXPA 3MGBA 2MHKA 1OWOA 3PVLA 1DNPA 3B7TA 3D9MA 2M63A 2L9BA 5FQ6A 3CVQA 4K0RA 4UWGA 2H6GA 4HVBA 5FQ8A 4ZFHA 4A1SA 5LCWC 4F1PA 4RLYA 4URKA 4EZLA 2CHZA 5KJMA 3CSFA 4IN3B 2V8SE 3PZDA 1BI7B 3S7FA 2GRPB 2PZIA 2WXMA 1AP7A 1UJKA 1NA0A 5BPPA 4GCNA 1QQEA 5ENNA 3UINC 3HXFA 3CK7A 5G55A 4GA1A 3R9AB 5B3SE 4I1OB 3TG5A 2C0MA 3NF1A 2WXJA 3QWWA 3UPVA 2L0TB 4LERA 3UXGA 3ABLE 2DCPA 4CDRA 3D9PA 4I6JA 3ENEA 5BXUA 5CHEE 3D9LA 2JEKA 3QK0A 4JA7A 3UM2A 1Z6TA 3SFZA 3SZ7A 3FTYA 4EZKA 2EIJE 5BW8C 4WNDA 4AP2A 2Y0BG 5FQ4A 3QWPA 3HXDA 4F1SA 3AG3E 3OXLA 3ZYLA 3Q5MA 2CHXA 3FTSA 2VGXB 1TR4A 2DYSE 3OTNA 1KZOA 1UJJA 1IXVA 4BSZB 2XZDG 5FJYA 1E8XA 2NXPA 3MZLB 3MV2B 4JZYA 1KT0A 4JA9A 1K8KG 2HM8A 4GTQA 5ENQD 4XI0A 3UT4A 1H6OA 3T5XA 4ANWA 2WPVA 4I2ZA 4TRQA 4GTOA 5KBAA 3Q79A 1QBQA 4MLPA 3UM0A 2CFZA 2UWJG 3G2TA 3ZUVB 3MKRA 5KJNA 3ESLA 4C0EA 5G04J 4UQZA 2YHEA 3TWRA 2XEEA 2Y4TA 5BT1A 4RG6A 4BERA 2P9NG 3MEKA 4BX8A 3ESKA 1EF1C 4L1BA 4L2YA 2CG3A 3PEUB 3UI2A 3FUMA 4Q69A 2WQ6A 5ENRD 5BV1A 4L9PA 5B1BE 2XHEA 5G05J 1U2VG 4Y6WA 4WNEA 1WAO1 4ACKA 4KVMA 4LNGA 3TG4A 2FI7A 1N54A 4HB5A 1E8YA 2XGSA 3QB2A 3WXXA 4FP7A 3AS4A 2H6FA 3F6QA 2I1KA 4GYWA 2YNQA 4GMJA 2VJ8A 1VDYA 3MA5A 4MBGA 2ETBA 3FUKA 4DUIA 2V5QC 1BPOA 2WVIA 4UUCA 1HG2A 5EILA 4WNGA 3LVRE 2WXHA 4UWKA 3ML8A 4BTBA 1V54E 4PDXA 5AIJA 5CMYA 4G8KA 1ELWA 2HR2A 3PEVB 3WG7E 4EPZA 2WXPA 1TN6A 4GTVA 4HNAD 3Q73A 3R7QA 1B89A 2P9IG 2WM9A 3O48A 3UIPC 3E34A 4GYOA 3SFYA 4O1OA 4FC8A 4NRHB 2CFUA 2L6JA 2LAIA 4LNUD 2BEDA 5AAOA 1HF8A 3MCXA 3V30A 2X6IA 3ULYA 5CEAA 4J8FA 4DX7D 2F37A 4HORA 3QWVA 4WNFA 3OAWA 4MRUA 1N4QA 4I17A 3ZN3A 4EBAG 4JHRA 4LUNU 2VYIA 1ZB1A 4GTMA 3LJNA 1SVXA 3ULQA 4UQXA 4DLQA 3LCAA 5ENPD 4DX1A 4AEZC 4G23A 3QKYA 5LCWJ 1Y8MA 2I9CA 2A5UA 4HLLA 3I4GA 3L17A 3B7BA 3LKUA 3QJZA 5KJKA 2E2EA 1HS6A 3Q49B 5JHAA 2ZXWE 2J9QA 4DX5D 1X5BA 5B1AE 3LS8A 4YDOA 2J09A 3PE4A 4FULA 3L13A 4G2VA 1SA5A 1P5QA 5D0OD 2F8YA 5CRUA 1NP7A 2I6HA 3EUVA 4B94A 2Q7FA 5BV0A 1EYHA 4G8LA 4RVBA 3DBSA 3J5QB 2ETCA 3L82A 3UKRG 3URZA 4NACA 3CVXA 1JWFA 5C2YA 2YHCA 3P1UA 4ILGA 3BQOA 4UWHA 3ZYMA 1MQSA 1S70B 3NQPA 3SBSA 3ZXSA 4HOSA 1D8EA 4LG6A 2J07A 4PH4B 5AARA 1LD8A 1TJCA 2BTDA 3ABKE 3BG0B 4EECA 3QAQA 1SA4A 3HVEB 4U7EB 3FUHA 3NOGD 4GA0A 3TWWA 3B13A 4YVQC 2P2CP 5G04C 2LSUA 2EILE 2EIKE 3FUIA 4JEUA 3FEXA 1ZBPA 2V5FA 1KLXA 3JXIA 2XZTG 3KEZA 4CCAA 5D0QD 2OOEA 4J7WA 3UKUG 1DC2A 3RRNB 4ILHB 2DIWA 3V2XA 3I5PA 3SD5A 3DSVA 1E8WA 4GPKA 4YVOA 3DPYA 3L16A 4YDYA 1TEZA 2PM6A 4PS7A 2KATA 3CHOA 5G05C 2IJGX 2DYRE 2IONA 3MJWA 3GYZA 5HQ8A 1DVPA 2PQRA 3HDXA 3DSSA 3UQ3A 3ASFA 2P58C 2ZU6B 2CHWA 4KYOB 2YINA 4UWLA 3ONKA 5LFAA 3OXGA 4L7TA 1YA0A 1UOHA 3EU9A 2WXNA 3UIOC 2VGXA 5AYWD 3T5VA 1OUVA 3GW4A 3E32A 1D9SA 3X2QE 3U4TA 4CGWA 3CK9A 3EDTB 3AG2E 4AXHA 1IQUA 4YDEA 1OXJA 1SZ9A 3TWQA 3TXMA 1FCHA 3LY8A 3GZ2A 3N71A 4D10C 1N52A 4HLEA 4GYYA 2R03A 3AS8A 4TXQA 5EIBE 4RQIA 4EHMA 2I1JA 4AY6A 3ZKJA 4KT6B 1BD8A 3Q15A 4LSZE 3CVLA 2VGEA 4DI3A 2ZGDA 4R7LA 4AY5A 2IOLA 4TUUA 4KMOA 4U07A 4KXKB 4BSXA 1S0PA 3PH0C 1H6PA 4FU3A 2IEJA 4G1TA 3AG4E 3CVUA 2IFUA 4U96D 4KZ0A 4BETA 4JC8A 2OV8A 2OVBA 2WXOA 5M72A 3SBTB 2VGYA 3HIZA 4U0SA 3C3OA 2V0PA 4N39A 3L54A 4EZJA 1OY3D 3U3WA 2WB2A 1W3BA 1EPUA 1YMPA 4K5CA 1OWPA 4DI4A 3UUXA 3EHNA 3KAEA 4QQIA 5J08A 5CCLA 1ZU2A 1TNBA 3ASDA 1G3NB 4DX2A 2R17C 4CT0A 3EHRA 1DCQA 1JPLA 4AOFA 4JEHA 2DZNA 1BI8B 1QZ2A 4N3BA 4BESA 2PM7A 1WDYA 4MKTA 4APFA 3IV0A 4HBDA 4N5QA 5ENOD 3CLJA 5FTPA 3P2BA 2PQNA 2LUHA 3FWVA 5KJLA 1N4SA 4ILIA 4A1GA 1FT1A 4AM9A 2MYOA 3FH5A 1N4PA 5FZSA 2L6BA 1YCSB 2IU1A 4NURA 2V4HC 4U95D 1FVHA 4UQYA 2F0YA 3C5RA 1QNFA 3HRAA 5H7PA 5BXOA 5KNGA 1WY6A 3KS2A 4O1PA 2X6FA 2XGOA 4B89A 3ZGQA 3W9FA 5AQBA 1RW2A 3HXCA 3DSXA 3SF4A 4ZHBA 3OXFA 2VSXE 3B7UX 4XE0A 3G2SA 3NZUA 2XS8A 3J5PA 3E33A 1U3DA 2P9KG 1E7UA 4Q94A 1IYGA 2YQ8A 2XCCA 4I2WA 4HFGA 5AN8A 2C2LA 1O5MA 4GTRA 2GRQB 3NB2A 2J4DA 3JUEA 4GCOA 1NI1A 3ZYKA 2BF0X 3MKQB 4U63A 5CMWA 1OCCE 2R05A 1H19A 5BNWA 4GZCA 2WQ7A 4C0MA 1UW4B 4J8EA 5EN5D 3DEPA 5KCMA 1U3CA 3Q7AA 3RO3A 2X3MA 3QDNA 3EHMA 2QFCA 3LYAA 3CHPA 3TL5A 3FDHA 4LRZA 2ZGGA 4V3IA 2RFAA 3SFXA 4A55A 3NZSA 5T8IA 3L6AA 1JCQA 4G25A 5KNHD 1RZ4A 1E8ZA 5JJ6A 2QYUA 3ZHEB 2WXKA 3JCKC 3JXJA 1JUQA 3PUJA 3DSWA 5AJDA 2VSNA 3RAUA 4OAUC 4B8CB 1L5JA 2FBNA 2AJAA 2LXLA 1HFAA 3HVEA 4MS6A 3RRMB 3FUEA 3QARA 1OCOE 1Z3YA 3ZU7B 5T4YA 5AQAA 3I3NA 3ASNE 3FH7A 2ILRA 5ANRA 3PREA 3I4RB 3LJ3A 3KEAA 4WUYA 2ZISA 4JB8P 2IOSA 3RJVA 2HE0A 1DCEA 1Q2ZA 3HHMA 3T8MA 3JQ1A 4ACLA 4PUCA 3W9GA 3QC1A 1N4RA 3AG1E 1TNOA 4CDNA 4XX5A 2DZOA 3R7RA 2LSVA 5A23A 3V79K 2FF4A 3PNLB 2AXZA 3DEOA 4I1AA 4Z68A 3DSTA 3UTMA 2AXVA 4QFVA 4O6FA 3E37A 4AIFA 1JWGA 4HRLA 2J4BA 3SGHA 2DVWA 3CK8A 2F8XK 2AW6A 3SO8A 2P9PG 3TAXA 4GPMA 4U8VD 3BG1B 2P9LG 4L23A 4CT4A 1K3ZD 2WXFA 2J49A 2X6JA 2WQHA 4W9RA 2Y3AA 1ELRA 2RFMA 2HYZA 3ISMC 1N0QA 2KXPC 3QNKA 1LD7A 5CCMA 3HG0D 1H0AA 4GZDA 4GZ5A 3V2OA 1OWMA 3FU5A 2XRYA 3RKVA 3IHYA 3PZ4A 3C72A 2R5SA 4UWFA 2PL2A 3LVQE 2BUGA 2VSYA 4ME2A 5BUZA 1IQRA 4AJWA 2XEHA 1A17A 4F6RD 3VTXA 3RK6A 4ATGA 1Z3XA 3D9HA 4APOA 4BTAA 1SW6A 3IXEA 4DRXE 1MX2A 2Y4UA 5D66A 3FTZA 2H6HA 2WXQA 4PS8A 3PDNA 1BU9A 2IF4A 4XEIG 3FH8A 4RG9A 4FJZA 2IO3C 4I1MA 3E30A 3JUIA 3FHEA 4G26A 3B95A 4GTTA 3C3QA 4ANUA 4GU5A 4GZ3A 1ELKA 4IULA 3CHQA 4I6GA 3Q7FA 1WG0A 1MX4A 1E7VA 5E76A 5G2NA 4HRNA 2LO6A 3CHSA 5ANLA 4LEUA 1AWCB 3FTXA 3PZ3A 3EHQA 4FLHA 1K1AA 3DWLG 3CQGB 4DLOA 3S2AA 3CVPA 3UMVA 2KBXA 2PNNA 1OT8A 1OWLA 4KVOA 1OCRE 4J0UA 1MHQA 4B93B 4F7AA 2FULA 2RKKA 3ZIMA 3ZFWA 1H2UA 1MZCA 1KZPA 3LY7A 4B8AA 1TJFA 4BY6A 5AQ7A 2R59A 4FHJA 3SI5A 1SZAA 3RSEG 4DJAA 1HG5A 3VLEA 3Q47B 3EU5A 2QYJA 3IEGA 3FP3A 4N5CA 3APFA 4TV3A 1KT1A 3GZSA 3APCA 3ZRHA 4AV7A 3TWXA 3BUAA 4GAAA 4J8DA 4JPSA 2MOWA 4E85A 3BEEA 4H7XA 4M3OA 1TNZA 3FTUA 3G2VA 3AJIA 5AENA 4U0UA 5ARGA
chains in the Genus database with same CATH topology
3FH5A 3E4BA 3JYSA 5FZSA 4WWPA 5ARFA 4FP7A 3K9IA 3AS4A 4HOUA 2IU1A 4NURA 5FZQA 2I1KA 4GYWA 2KZTA 2QY7A 3D9NA 4FA6A 1FVHA 1WM5A 1PY1A 2YNQA 4UQYA 1HU3A 4GMJA 2VJ8A 1VDYA 4I6EA 1QNFA 3MA5A 1IHGA 1PC2A 1E96B 3PNTB 5JJ7A 3MYVA 1WY6A 4A3TA 3KS2A 3MKQA 3FUKA 5LOZA 4EQFA 5A6CA 1BPOA 2X6FA 3CKCA 2WVIA 4PS3A 2X38A 3UX4A 1HG2A 4WNGA 3IHVA 3LVRE 2XGOA 1XNFA 4B89A 2WXHA 4UWKA 1E90A 3ML8A 5DIZA 3ASHA 4Y6CA 3CQCB 3ZGQA 4BTBA 4BX9A 4PDXA 4GB9A 4LCTA 4JHKA 4B0ZA 5AIJA 4XKCA 5CMYA 3U9WA 1ELWA 3SF4A 2HR2A 3PEVB 3SNXA 4EPZA 2WXPA 3OXFA 2VSXE 3ASGA 1NZNA 2WXRA 3B7UX 4XE0A 3G2SA 4HOTA 3NZUA 2WXIA 2JLBA 3R7QA 4K03A 1U3DA 1B89A 3L22A 5FQ7A 1E7UA 4Q94A 1UN8A 1IYGA 2KZTB 4OVVA 2YQ8A 2XCCA 2WM9A 4F53A 3B7RL 3O48A 4I2WA 4GYOA 2MRIA 3FU0A 4HFGA 3MV3B 3RIBA 2C2LA 5JHBA 4I43A 4FC8A 1HX8A 3FTWA 4IYPA 4NRHB 2CFUA 4WWOA 5FWQA 2GW1A 2LNIA 2J4DA 3FU6A 3FY4A 2L6JA 3APDA 4GCOA 3ZYKA 1HXIA 2BF0X 2LAIA 3MKQB 4U63A 3UT8A 3ZHEA 5CMWA 1HF8A 3S7JA 3LDZA 3MCXA 1H19A 3AS5A 4G24A 5BNWA 4GZCA 2WQ7A 2XQ0A 4C0MA 2X6IA 1EDUA 1UW4B 4J8EA 4J8FA 2VTBA 4WWNA 3EIQC 5KCMA 1U3CA 4HORA 3RO3A 2X3MA 3QDNA 3QWVA 4JVSA 1OWNA 4G11A 4WNFA 1SQMA 2X6HA 3LPZA 3AU5A 3OAWA 3PE3A 4ANXA 2GRLA 3EHMA 2QFCA 4MRUA 3UT7A 4I17A 3ZN3A 3LYAA 4EBAG 3CHPA 3EJNA 1UG3A 2XPZA 4JHRA 4LUNU 2VYIA 3TL5A 3FDHA 3MX3A 3D9KA 5FT9A 4OYSA 4LRZA 1XGWA 4N2SA 2AXUA 3ULQA 3QOUA 4UQXA 4JXTA 4DLQA 4ABNA 4GMLA 3CVYA 3LXUX 4V3IA 2E0IA 3CEQA 3G2UA 3LCAA 4A55A 3PS6A 4JW1A 4AEZC 3NZSA 5T8IA 4G23A 3QKYA 5LCWJ 1Y8MA 2I9CA 2A5UA 4BFRA 3I4GA 3FUDA 3L17A 3VLFA 2AVPA 3L6AA 4AVXA 3TGOA 4F3VA 4G25A 3LKUA 3QJZA 5LX8A 1E8ZA 3CV0A 5JJ6A 5KJKA 2E2EA 1HS6A 3Q49B 5JHAA 3RO2A 3ZHEB 2WXKA 3JCKC 2J9QA 1JUQA 2KCVA 2ONDA 3PUJA 4CRWA 3FU3A 4UI9C 1X5BA 5AJDA 2VSNA 3ZYQA 3LS8A 1HE8A 2J09A 4FADA 4B8CB 3PE4A 1L5JA 1UN9A 3L13A 4FULA 2FBNA 4MS6A 3HVEA 1HFAA 4G2VA 2A4ZA 3RRMB 1P5QA 3FUEA 5T3RA 5D0OD 2HO1A 1HZ4A 1NP7A 2KM4A 2XGMA 2I6HA 4H7YA 3QARA 1Z3YA 4B94A 5BV0A 2Q7FA 1EYHA 5T4YA 1INZA 3I3NA 4DPRA 4RVBA 3DBSA 4XKBA 3D9JA 3FH7A 3AU4A 2ILRA 5ANRA 3PREA 5LP0A 3I4RB 4EBAA 3LJ3A 3Q4AB 3URZA 4N2QA 4NACA 3CVXA 4WUYA 2XPYA 4UI9K 1JWFA 5A7DB 5C2YA 2YHCA 2IOSA 3P1UA 3RJVA 4HS2A 3G2WA 4ILGA 3HHMA 4UWHA 2X6KA 3ZYMA 4GA2A 1MQSA 3FULA 3T8MA 3CSTA 3IKOB 3NQPA 2V4LA 3JQ1A 3PUKA 3SBSA 4ACLA 4PUCA 3ZXSA 2IQCA 4KBQA 4CGVA 3C98A 3QC1A 4HOSA 4E6HA 4N3AA 4FJYA 1HO8A 2RG8A 2J07A 2VSOE 3FUFA 4PH4B 4CDNA 3ONLA 3SHFA 1TJCA 3FFLA 3CKBA 2BTDA 3O4ZA 4XX5A 3BG0B 3R7RA 4EECA 3QAQA 3D9IA 2KC7A 3HVEB 2LSVA 4Q96A 2KCLA 4RSYA 2CG2A 2GGFA 2NC9A 3FUHA 5C1DA 3GZ1A 5A23A 3CGHA 4BWRA 5JJTA 3KD7A 4GA0A 3B13A 4YVQC 4N3CA 2FF4A 3PNLB 2AXZA 4I1AA 4C9BB 5G04C 1NA3A 2LSUA 2WMOA 1H2TC 2XRZA 4GZ6A 3CIAA 4BT8A 3FUIA 2AXVA 4QFVA 5E75A 2UY1A 4JEUA 2WXGA 4O6FA 3FEXA 1GW6A 1ZBPA 4U0ZA 2V5FA 2MHKA 1JWGA 1KLXA 3MGBA 4AIFA 3ZW3A 1OWOA 3PVLA 1DNPA 3B7TA 2J4BA 3SGHA 3VLDA 3KEZA 4CCAA 5D0QD 3D9MA 1LF8A 3CK8A 3ML9A 4I9CA 2OOEA 2AW6A 3ZVVA 2M63A 4U8HA 2L9BA 3RRNB 5FQ6A 4ILHB 2DIWA 3TAXA 3I5PA 3CVQA 4K0RA 3SD5A 3ZEFA 4CDMA 4UWGA 1E8WA 3BG1B 4L23A 4GPKA 4YVOA 2NSZA 3L16A 4CT4A 1TEZA 3RRUA 4HVBA 5FQ8A 4JHJA 2PM6A 4PS7A 4A1SA 4J6IA 2KATA 3CHOA 5LCWC 5G05C 2LAHA 4URKA 2WXFA 4EZLA 2J49A 2X6JA 2CHZA 2IJGX 2J08A 2WQHA 4W9RA 5KJMA 2Y3AA 3CSFA 4IN3B 1ELRA 2V8SE 2WMNA 2IONA 3PZDA 5DBKA 3MJWA 2HYZA 4FHKA 3S7FA 2PZIA 2WXMA 3GYZA 5HQ8A 1DVPA 3D3MA 2PQRA 3QNKA 5CCMA 1UJKA 2C0LA 3HDXA 4XI9A 1H0AA 2FO7A 2VQ2A 4GZDA 4GZ5A 3UQ3A 2EQXA 3ASFA 1NA0A 2UY1B 4HOQA 2P58C 1OWMA 2ZU6B 3PRZA 5BPPA 3FU5A 2XRYA 2CHWA 3RKVA 4KYOB 3IHYA 2DBAA 2YINA 4UWLA 3ONKA 4GCNA 4DK5A 2R5SA 1QQEA 2PL2A 4UWFA 3LVQE 5ENNA 4WAFA 2BUGA 3CK7A 5LFAA 3CVNA 3OXGA 5G55A 4L7TA 4GA1A 1YA0A 2VSYA 3R9AB 4ME2A 5BUZA 1IQRA 2WXNA 3CHRA 4YNDA 2VTBB 4AJWA 1A17A 4I1OB 3TG5A 3VTXA 3RK6A 2VGXA 4ATGA 5AYWD 1Z3XA 3T5VA 2C0MA 1OUVA 4APOA 2RD0A 4BTAA 3NF1A 2WXJA 4NQ0A 3S7BA 3GW4A 3QWWA 3UPVA 2L0TB 4HXIA 3U4TA 4LERA 4CGWA 3CK9A 2DCPA 2Y4UA 4CDRA 3D9PA 4I6JA 3ENEA 3FTZA 3EDTB 3LY9A 5CHEE 2OVFA 2WXQA 3D9LA 4L2LA 4PS8A 3EIJA 1IQUA 2JEKA 3PDNA 3QK0A 4JA7A 4AXHA 1Z6TA 2IF4A 3U64A 3FH8A 1PAQA 1SZ9A 4RG9A 4FJZA 3SFZA 4ANVA 4I1MA 3SZ7A 4I9EA 3TXMA 1FCHA 3FTYA 3LY8A 3GZ2A 3N71A 3JUIA 4D10C 3FHEA 4EZKA 1N52A 4G26A 4HLEA 3FUJA 4GYYA 4ANUA 5BW8C 4WNDA 4UI9J 4GU5A 4GZ3A 1ELKA 4IULA 3AS8A 3TJPA 3CHQA 4AP2A 3L08A 4I6GA 5FQ4A 3QWPA 2XEVA 1E7VA 2I1JA 5E76A 4F1SA 4AY6A 5G2NA 3OXLA 3CVVA 3ZYLA 3Q5MA 2LO6A 2CHXA 3CHSA 5ANLA 4LEUA 3FTSA 2VGXB 3OTNA 3Q15A 4KT6B 1UJJA 3CVLA 5FJYA 2NXPA 1E8XA 4DI3A 3MZLB 2XCBA 4R7LA 3FTXA 3MV2B 4JZYA 4IRUA 4AY5A 2IOLA 1KT0A 2KCKA 4TUUA 3ZFWA 2WXLA 4KMOA 4U07A 4FLHA 4JA9A 3CQGB 4KXKB 4DLOA 3S2AA 4BSXA 1S0PA 3PH0C 2HM8A 5EX3A 3CVPA 3UMVA 3FUNA 4FU3A 1OWLA 4XI0A 3CR3A 4KVOA 3UT4A 4KZCA 2AWIA 2GRMA 4G1TA 3T5XA 4ANWA 2WPVA 5EDSA 4XIFA 4J0UA 1MHQA 5AJLA 4I2ZA 4TRQA 3ZPJA 4F7AA 3CVUA 2IFUA 4KZ0A 2FULA 5EKQD 4MLPA 3ZIMA 2CFZA 2OV8A 2OVBA 2WXOA 4FLBA 4JC8A 2VGYA 2UWJG 3HIZA 3SBTB 5M72A 3CVWA 4U0SA 1H2UA 2V0PA 4OVUA 4A3VA 4N39A 5FZRA 3L54A 4EZJA 3G2TA 3LY7A 4B8AA 4JL0A 3U3WA 2WB2A 1TJFA 4BY6A 3MKRA 5KJNA 3ESLA 5HI7A 1W3BA 2R59A 5G04J 4UQZA 4C0EA 2YHEA 3CHMA 1EPUA 2L0IA 3VTYA 4FHJA 3RU0A 3SI5A 2Y4TA 3S7DA 1OWPA 1SZAA 2FEZA 4DI4A 5BT1A 4RG6A 4DJAA 1HG5A 4XZ4A 3UUXA 3VLEA 3Q47B 3EHNA 3KAEA 3MEKA 4BX8A 3ESKA 4P29A 3FTVA 1EF1C 5J08A 5CCLA 4L1BA 1ZU2A 3ASDA 2R17C 4L2YA 2CG3A 1FVFA 2XPIA 4CT0A 3PEUB 3IBEA 3IEGA 1JPLA 4CEMA 1Y6IA 3FP3A 3FUMA 4AOFA 4Q69A 4N5CA 3APFA 4JEHA 1KT1A 4TV3A 3GZSA 1QZ2A 3APCA 4N3BA 2WQ6A 3JQ0A 5BV1A 3HYMB 2PM7A 5EX0A 3ZRHA 4MKTA 5J90A 1H6KA 2XHEA 5G05J 4APFA 4Y6WA 4AV7A 4WNEA 1WAO1 3TXNA 3IV0A 4GAAA 4ACKA 4KVMA 4J8DA 3CLJA 2FI7A 2MOWA 4J8SA 4JPSA 5FTPA 1N54A 3TG4A 3FEYA 4E85A 1H2VC 3DPDA 3BEEA 4H7XA 4M3OA 3P2BA 2I2OA 1E8YA 2PQNA 3LEWA 4U04A 2XGSA 3QB2A 3D9OA 3FWVA 3FTUA 3G2VA 3B7SA 3U66A 4BT9A 5AENA 4U0UA 5KJLA 5ARGA 4ILIA 4A1GA 3WXXA 1HH8A 4AM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E4B A;  3JYS A;  5FZS A;  5ARF A;  3K9I A;  3AS4 A;  4HOU A;  5FZQ A;  4GYW A;  1WM5 A;  4UQY A;  3MA5 A;  1IHG A;  1PC2 A;  1E96 B;  5JJ7 A;  3KS2 A;  4EQF A;  5A6C A;  3CKC A;  4WNG A;  2XGO A;  1XNF A;  5DIZ A;  3ASH A;  4Y6C A;  3ZGQ A;  4BTB A;  1ELW A;  3SF4 A;  2HR2 A;  3OXF A;  3ASG A;  1NZN A;  4HOT A;  2JLB A;  1B89 A;  1IYG A;  2YQ8 A;  2XCC A;  3O48 A;  4I2W A;  4GYO A;  3RIB A;  3MV3 B;  2C2L A;  4NRH B;  2GW1 A;  2LNI A;  2L6J A;  4GCO A;  1HXI A;  3ZHE A;  3S7J A;  3AS5 A;  4G24 A;  5BNW A;  4J8E A;  4J8F A;  4HOR A;  3RO3 A;  3QDN A;  3QWV A;  4WNF A;  3PE3 A;  3LPZ A;  2QFC A;  4I17 A;  3ZN3 A;  3LYA A;  4JHR A;  2VYI A;  5FT9 A;  4N2S A;  3ULQ A;  3QOU A;  4UQX A;  4ABN A;  3CEQ A;  3LCA A;  4G23 A;  3QKY A;  5LCW J;  1Y8M A;  2AVP A;  3TGO A;  4F3V A;  4G25 A;  3LKU A;  3CV0 A;  5KJK A;  5JJ6 A;  2E2E A;  3Q49 B;  3RO2 A;  3ZHE B;  2J9Q A;  2KCV A;  2OND A;  4UI9 C;  2VSN A;  3PE4 A;  2FBN A;  4G2V A;  1P5Q A;  5D0O D;  2HO1 A;  1HZ4 A;  2XGM A;  2I6H A;  4H7Y A;  4B94 A;  2Q7F A;  3Q4A B;  4N2Q A;  3URZ A;  4WUY A;  4UI9 K;  5A7D B;  2YHC A;  3RJV A;  4GA2 A;  4KBQ A;  4CGV A;  4HOS A;  4N3A A;  1TJC A;  3FFL A;  3CKB A;  2KC7 A;  2LSV A;  2KCL A;  2NC9 A;  5C1D A;  3GZ1 A;  4BWR A;  5JJT A;  3KD7 A;  4GA0 A;  4YVQ C;  4N3C A;  2FF4 A;  4I1A A;  5G04 C;  1NA3 A;  2LSU A;  4GZ6 A;  4BT8 A;  2UY1 A;  4O6F A;  1ZBP A;  4U0Z A;  2V5F A;  2MHK A;  4AIF A;  1KLX A;  5D0Q D;  3CK8 A;  4I9C A;  2OOE A;  3TAX A;  3CVQ A;  4GPK A;  4YVO A;  4A1S A;  2KAT A;  5LCW C;  5G05 C;  2WQH A;  4W9R A;  5KJM A;  4IN3 B;  1ELR A;  5DBK A;  2HYZ A;  3S7F A;  2PZI A;  3GYZ A;  5HQ8 A;  2PQR A;  5CCM A;  2C0L A;  4XI9 A;  2FO7 A;  4GZ5 A;  2VQ2 A;  3UQ3 A;  3ASF A;  1NA0 A;  2UY1 B;  4HOQ A;  2P58 C;  3RKV A;  4KYO B;  2DBA A;  4GCN A;  2R5S A;  1QQE A;  2PL2 A;  2BUG A;  3CK7 A;  3CVN A;  3OXG A;  4GA1 A;  1YA0 A;  2VSY A;  3R9A B;  4ME2 A;  4YND A;  1A17 A;  3TG5 A;  3VTX A;  2VGX A;  5AYW D;  2C0M A;  1OUV A;  4APO A;  4BTA A;  3NF1 A;  4NQ0 A;  3S7B A;  3GW4 A;  3QWW A;  3UPV A;  3U4T A;  4CGW A;  3CK9 A;  2Y4U A;  4CDR A;  3EDT B;  3LY9 A;  5CHE E;  3PDN A;  4JA7 A;  2IF4 A;  4RG9 A;  3SZ7 A;  4I9E A;  1FCH A;  3LY8 A;  3GZ2 A;  3N71 A;  4G26 A;  4GYY A;  5BW8 C;  4WND A;  4UI9 J;  4GZ3 A;  3AS8 A;  3QWP A;  2XEV A;  4AY6 A;  3OXL A;  3Q5M A;  4LEU A;  2VGX B;  3Q15 A;  3CVL A;  5FJY A;  2XCB A;  3MV2 B;  4AY5 A;  2KCK A;  1KT0 A;  4U07 A;  4JA9 A;  4KXK B;  5EX3 A;  3CVP A;  4XI0 A;  4G1T A;  2WPV A;  4XIF A;  4J0U A;  4I2Z A;  3ZPJ A;  2IFU A;  5EKQ D;  3ZFW A;  5M72 A;  2VGY A;  2UWJ G;  4U0S A;  4N39 A;  5FZR A;  3LY7 A;  4JL0 A;  3U3W A;  3MKR A;  5KJN A;  5HI7 A;  1W3B A;  5G04 J;  4UQZ A;  3VTY A;  3RU0 A;  2Y4T A;  3S7D A;  2FEZ A;  5BT1 A;  4RG6 A;  3UUX A;  3Q47 B;  3KAE A;  3MEK A;  3ESK A;  5CCL A;  1ZU2 A;  3ASD A;  2XPI A;  3IEG A;  3FP3 A;  4N5C A;  1KT1 A;  1QZ2 A;  4N3B A;  3HYM B;  5EX0 A;  5G05 J;  4Y6W A;  4WNE A;  1WAO 1;  4J8D A;  3TG4 A;  2FI7 A;  5FTP A;  3BEE A;  4H7X A;  2PQN A;  4U04 A;  2XGS A;  3FWV A;  4BT9 A;  4U0U A;  5KJL A;  5ARG A;  3WXX A;  1HH8 A;  4AM9 A; 
#chains in the Genus database with same CATH topology
 4O60 A;  3JYS A;  4WWP A;  5ARF A;  4K5B A;  4HOU A;  4FA6 A;  1PY1 A;  4LNB A;  4ATZ D;  3KSL A;  1IHG A;  3MYV A;  3Q9N C;  1O1T A;  4A3T A;  3MKQ A;  5CER B;  1N95 A;  5JA4 D;  4EQF A;  5A6C A;  3CKC A;  4PS3 A;  3UX4 A;  2X38 A;  1E90 A;  3NAW A;  4LCT A;  4JHK A;  4XKC A;  2BKK B;  2GRN B;  3SNX A;  4HOT A;  3L22 A;  2KZT B;  2A5E A;  4OVV A;  4F53 A;  3RIB A;  2MRI A;  4I43 A;  2H6I A;  4IYP A;  4WWO A;  2GW1 A;  3FU6 A;  3DXM G;  3ZHE A;  1S64 A;  4G24 A;  5HS0 A;  2XQ0 A;  2VTB A;  4WWN A;  3EIQ C;  5LP0 A;  1OWN A;  4G11 A;  1SQM A;  2GRL A;  1UG3 A;  2XPZ A;  4DX6 D;  4OYS A;  2AXU A;  4JXT A;  4ABN A;  4GML A;  2IO2 C;  3CVY A;  2E0I A;  3TWV A;  3PS6 A;  2Y1L E;  4AVX A;  2OEV A;  4F3V A;  3RO2 A;  2KCV A;  2OND A;  3NOC D;  2LXM A;  1HE8 A;  2A4Z A;  5EID A;  2QZA A;  2HO1 A;  1HZ4 A;  2XGM A;  5HKP A;  4H7Y A;  5CRV A;  3Q9U C;  4XKB A;  3C3R A;  2EIM E;  4EBA A;  4N2Q A;  2XPY A;  4UI9 K;  1O1S A;  1OCZ E;  5ENS D;  4HS2 A;  5EYP F;  4GTS A;  2X6K A;  4HRM B;  4GA2 A;  3FUL A;  3CST A;  3IKO B;  4KBQ A;  3C98 A;  4N3A A;  4FJY A;  1HO8 A;  2RG8 A;  2VSO E;  3FFL A;  3CKB A;  3D9I A;  4RSY A;  4Q96 A;  2NC9 A;  3BU8 A;  5C1D A;  3GZ1 A;  2P9S G;  5JJT A;  3KD7 A;  2XEN A;  2WMO A;  1H2T C;  4GZ6 A;  4BT8 A;  1TN8 A;  2WXG A;  1GW6 A;  4U0Z A;  1X81 A;  2J8S D;  3ZW3 A;  3VLD A;  1TN7 A;  1LF8 A;  3T9K A;  3ML9 A;  4I9C A;  3DXK G;  3ZVV A;  4U8H A;  1N0R A;  1TNU A;  3ZEF A;  4CDM A;  1N9A A;  3ULE G;  2NSZ A;  3DRA A;  3RRU A;  4JHJ A;  4J6I A;  1QYM A;  2LAH A;  5EYL A;  2J08 A;  3ABM E;  2WMN A;  5DBK A;  3SQV A;  4FHK A;  3UM3 A;  3D3M A;  2GRO B;  3V31 A;  2C0L A;  4XI9 A;  2FO7 A;  2VQ2 A;  2EQX A;  2UY1 B;  4HOQ A;  3PRZ A;  2DBA A;  1FPP A;  4DK5 A;  2XS1 A;  2FO1 E;  4WAF A;  4U8Y D;  3CVN A;  3Q78 A;  4YND A;  3CHR A;  2VTB B;  1Z5S C;  3TWU A;  2RD0 A;  4NQ0 A;  3S7B A;  4K5A B;  4HXI A;  4CZ2 D;  3LY9 A;  2OVF A;  4L2L A;  3EIJ A;  3HXE A;  3U64 A;  1PAQ A;  4ANV A;  4CYM D;  1YYH A;  1A5E A;  4I9E A;  3FUJ A;  4UI9 J;  3TJP A;  3L08 A;  3AAA C;  2XEV A;  3CVV A;  3TWS A;  1S63 A;  2XCB A;  4IRU A;  2KCK A;  2WXL A;  4J8Y A;  5CED B;  1D8D A;  2ZIR A;  5FIN A;  5EX3 A;  3FUN A;  3CR3 A;  4KZC A;  2AWI A;  2GRM A;  5EDS A;  4XIF A;  5AJL A;  3ZPJ A;  5EKQ D;  2NYJ A;  5CBN A;  2B6C A;  4FLB A;  3CVW A;  1V55 E;  4A3V A;  4OVU A;  5FZR A;  4JL0 A;  5HI7 A;  1MJ0 A;  2JAB A;  3CHM A;  2L0I A;  3VTY A;  3RU0 A;  3S7D A;  2FEZ A;  4XZ4 A;  5KWD A;  4P29 A;  3FTV A;  3Q75 A;  4TXR A;  1FVF A;  2XPI A;  1BLX B;  1JCS A;  3IBE A;  4CEM A;  1Y6I A;  5FIO A;  2QC9 A;  3JQ0 A;  2B0O E;  3HYM B;  5EX0 A;  5J90 A;  1H6K A;  3TXN A;  2EIN E;  4HI9 A;  1N11 A;  4J8S A;  2R2L A;  3FEY A;  1H2V C;  3DPD A;  2I2O A;  3LEW A;  5IY5 E;  4U04 A;  3D9O A;  3B7S A;  3U66 A;  4BT9 A;  3DSU A;  1HH8 A;  4X8Q A;  3E4B A;  1NFI E;  5JMN D;  3K9I A;  1N94 A;  5D2M C;  5FZQ A;  2KZT A;  2QY7 A;  3D9N A;  1WM5 A;  1MYO A;  1HU3 A;  1IKN D;  4YDW A;  4I6E A;  4GMR A;  3KSQ A;  1TYQ G;  1PC2 A;  1E96 B;  3PNT B;  5JJ7 A;  4BEP A;  5CEC B;  3SY2 A;  5LOZ A;  4M7C A;  1KPS B;  3IHV A;  1O1R A;  1XNF A;  5DIZ A;  3ASH A;  4Y6C A;  3CQC B;  4BX9 A;  4GB9 A;  2Y69 E;  4B0Z A;  3U9W A;  2P9U G;  3ASG A;  1NZN A;  2OCC E;  4HQD A;  2WXR A;  2WXI A;  2JLB A;  4K03 A;  5FQ7 A;  3L9T A;  1UN8 A;  3B7R L;  3FU0 A;  3MV3 B;  5JHB A;  1HX8 A;  3FTW A;  5ITZ F;  5FWQ A;  2LNI A;  3FY4 A;  3APD A;  1HXI A;  3HXB A;  3UT8 A;  3S7J A;  3LDZ A;  5HRY A;  3AS5 A;  1EDU A;  2IY0 C;  4TUM A;  4JVS A;  3PE3 A;  2X6H A;  3LPZ A;  3AU5 A;  4ANX A;  5CBO A;  3UT7 A;  3EJN A;  1LTX A;  3MX3 A;  3D9K A;  2GRR B;  5FT9 A;  1NL4 A;  1XGW A;  2R02 A;  4N2S A;  3QOU A;  2BKG A;  2OEW A;  3LXU X;  3CEQ A;  3G2U A;  5AQ9 A;  4JW1 A;  4BFR A;  1JCR A;  3FUD A;  4HI8 A;  3ZXP A;  3VLF A;  2AVP A;  3TGO A;  5LX8 A;  3CV0 A;  4GTP A;  3T8K A;  4CRW A;  4OAV B;  4JD2 G;  3FU3 A;  4UI9 C;  3ZYQ A;  4C48 B;  4FAD A;  1UN9 A;  2ETA A;  5T3R A;  3ZNG A;  2KM4 A;  3ASO E;  1INZ A;  4DPR A;  3D9J A;  3AU4 A;  3Q4A B;  1FT2 A;  5A7D B;  5ENT D;  3G2W A;  3NBN B;  3R9M A;  2V4L A;  3PUK A;  2IQC A;  4CGV A;  4E6H A;  3TWT A;  3FUF A;  3ONL A;  3SHF A;  1MX6 A;  3O4Z A;  2KC7 A;  2KCL A;  2GGF A;  2CG2 A;  1IHB A;  3CGH A;  3PZ2 A;  4NIK A;  4BWR A;  4N3C A;  1TNY A;  4C9B B;  3PZ1 A;  1NA3 A;  2DWZ A;  2XRZ A;  3UM1 A;  3CIA A;  4A63 B;  5E75 A;  2UY1 A;  1K1B A;  4TXP A;  3MGB A;  2MHK A;  1OWO A;  3PVL A;  1DNP A;  3B7T A;  3D9M A;  2M63 A;  2L9B A;  5FQ6 A;  3CVQ A;  4K0R A;  4UWG A;  2H6G A;  4HVB A;  5FQ8 A;  4ZFH A;  4A1S A;  5LCW C;  4F1P A;  4RLY A;  4URK A;  4EZL A;  2CHZ A;  5KJM A;  3CSF A;  4IN3 B;  2V8S E;  3PZD A;  1BI7 B;  3S7F A;  2GRP B;  2PZI A;  2WXM A;  1AP7 A;  1UJK A;  1NA0 A;  5BPP A;  4GCN A;  1QQE A;  5ENN A;  3UIN C;  3HXF A;  3CK7 A;  5G55 A;  4GA1 A;  3R9A B;  5B3S E;  4I1O B;  3TG5 A;  2C0M A;  3NF1 A;  2WXJ A;  3QWW A;  3UPV A;  2L0T B;  4LER A;  3UXG A;  3ABL E;  2DCP A;  4CDR A;  3D9P A;  4I6J A;  3ENE A;  5BXU A;  5CHE E;  3D9L A;  2JEK A;  3QK0 A;  4JA7 A;  3UM2 A;  1Z6T A;  3SFZ A;  3SZ7 A;  3FTY A;  4EZK A;  2EIJ E;  5BW8 C;  4WND A;  4AP2 A;  2Y0B G;  5FQ4 A;  3QWP A;  3HXD A;  4F1S A;  3AG3 E;  3OXL A;  3ZYL A;  3Q5M A;  2CHX A;  3FTS A;  2VGX B;  1TR4 A;  2DYS E;  3OTN A;  1KZO A;  1UJJ A;  1IXV A;  4BSZ B;  2XZD G;  5FJY A;  1E8X A;  2NXP A;  3MZL B;  3MV2 B;  4JZY A;  1KT0 A;  4JA9 A;  1K8K G;  2HM8 A;  4GTQ A;  5ENQ D;  4XI0 A;  3UT4 A;  1H6O A;  3T5X A;  4ANW A;  2WPV A;  4I2Z A;  4TRQ A;  4GTO A;  5KBA A;  3Q79 A;  1QBQ A;  4MLP A;  3UM0 A;  2CFZ A;  2UWJ G;  3G2T A;  3ZUV B;  3MKR A;  5KJN A;  3ESL A;  4C0E A;  5G04 J;  4UQZ A;  2YHE A;  3TWR A;  2XEE A;  2Y4T A;  5BT1 A;  4RG6 A;  4BER A;  2P9N G;  3MEK A;  4BX8 A;  3ESK A;  1EF1 C;  4L1B A;  4L2Y A;  2CG3 A;  3PEU B;  3UI2 A;  3FUM A;  4Q69 A;  2WQ6 A;  5ENR D;  5BV1 A;  4L9P A;  5B1B E;  2XHE A;  5G05 J;  1U2V G;  4Y6W A;  4WNE A;  1WAO 1;  4ACK A;  4KVM A;  4LNG A;  3TG4 A;  2FI7 A;  1N54 A;  4HB5 A;  1E8Y A;  2XGS A;  3QB2 A;  3WXX A;  4FP7 A;  3AS4 A;  2H6F A;  3F6Q A;  2I1K A;  4GYW A;  2YNQ A;  4GMJ A;  2VJ8 A;  1VDY A;  3MA5 A;  4MBG A;  2ETB A;  3FUK A;  4DUI A;  2V5Q C;  1BPO A;  2WVI A;  4UUC A;  1HG2 A;  5EIL A;  4WNG A;  3LVR E;  2WXH A;  4UWK A;  3ML8 A;  4BTB A;  1V54 E;  4PDX A;  5AIJ A;  5CMY A;  4G8K A;  1ELW A;  2HR2 A;  3PEV B;  3WG7 E;  4EPZ A;  2WXP A;  1TN6 A;  4GTV A;  4HNA D;  3Q73 A;  3R7Q A;  1B89 A;  2P9I G;  2WM9 A;  3O48 A;  3UIP C;  3E34 A;  4GYO A;  3SFY A;  4O1O A;  4FC8 A;  4NRH B;  2CFU A;  2L6J A;  2LAI A;  4LNU D;  2BED A;  5AAO A;  1HF8 A;  3MCX A;  3V30 A;  2X6I A;  3ULY A;  5CEA A;  4J8F A;  4DX7 D;  2F37 A;  4HOR A;  3QWV A;  4WNF A;  3OAW A;  4MRU A;  1N4Q A;  4I17 A;  3ZN3 A;  4EBA G;  4JHR A;  4LUN U;  2VYI A;  1ZB1 A;  4GTM A;  3LJN A;  1SVX A;  3ULQ A;  4UQX A;  4DLQ A;  3LCA A;  5ENP D;  4DX1 A;  4AEZ C;  4G23 A;  3QKY A;  5LCW J;  1Y8M A;  2I9C A;  2A5U A;  4HLL A;  3I4G A;  3L17 A;  3B7B A;  3LKU A;  3QJZ A;  5KJK A;  2E2E A;  1HS6 A;  3Q49 B;  5JHA A;  2ZXW E;  2J9Q A;  4DX5 D;  1X5B A;  5B1A E;  3LS8 A;  4YDO A;  2J09 A;  3PE4 A;  4FUL A;  3L13 A;  4G2V A;  1SA5 A;  1P5Q A;  5D0O D;  2F8Y A;  5CRU A;  1NP7 A;  2I6H A;  3EUV A;  4B94 A;  2Q7F A;  5BV0 A;  1EYH A;  4G8L A;  4RVB A;  3DBS A;  3J5Q B;  2ETC A;  3L82 A;  3UKR G;  3URZ A;  4NAC A;  3CVX A;  1JWF A;  5C2Y A;  2YHC A;  3P1U A;  4ILG A;  3BQO A;  4UWH A;  3ZYM A;  1MQS A;  1S70 B;  3NQP A;  3SBS A;  3ZXS A;  4HOS A;  1D8E A;  4LG6 A;  2J07 A;  4PH4 B;  5AAR A;  1LD8 A;  1TJC A;  2BTD A;  3ABK E;  3BG0 B;  4EEC A;  3QAQ A;  1SA4 A;  3HVE B;  4U7E B;  3FUH A;  3NOG D;  4GA0 A;  3TWW A;  3B13 A;  4YVQ C;  2P2C P;  5G04 C;  2LSU A;  2EIL E;  2EIK E;  3FUI A;  4JEU A;  3FEX A;  1ZBP A;  2V5F A;  1KLX A;  3JXI A;  2XZT G;  3KEZ A;  4CCA A;  5D0Q D;  2OOE A;  4J7W A;  3UKU G;  1DC2 A;  3RRN B;  4ILH B;  2DIW A;  3V2X A;  3I5P A;  3SD5 A;  3DSV A;  1E8W A;  4GPK A;  4YVO A;  3DPY A;  3L16 A;  4YDY A;  1TEZ A;  2PM6 A;  4PS7 A;  2KAT A;  3CHO A;  5G05 C;  2IJG X;  2DYR E;  2ION A;  3MJW A;  3GYZ A;  5HQ8 A;  1DVP A;  2PQR A;  3HDX A;  3DSS A;  3UQ3 A;  3ASF A;  2P58 C;  2ZU6 B;  2CHW A;  4KYO B;  2YIN A;  4UWL A;  3ONK A;  5LFA A;  3OXG A;  4L7T A;  1YA0 A;  1UOH A;  3EU9 A;  2WXN A;  3UIO C;  2VGX A;  5AYW D;  3T5V A;  1OUV A;  3GW4 A;  3E32 A;  1D9S A;  3X2Q E;  3U4T A;  4CGW A;  3CK9 A;  3EDT B;  3AG2 E;  4AXH A;  1IQU A;  4YDE A;  1OXJ A;  1SZ9 A;  3TWQ A;  3TXM A;  1FCH A;  3LY8 A;  3GZ2 A;  3N71 A;  4D10 C;  1N52 A;  4HLE A;  4GYY A;  2R03 A;  3AS8 A;  4TXQ A;  5EIB E;  4RQI A;  4EHM A;  2I1J A;  4AY6 A;  3ZKJ A;  4KT6 B;  1BD8 A;  3Q15 A;  4LSZ E;  3CVL A;  2VGE A;  4DI3 A;  2ZGD A;  4R7L A;  4AY5 A;  2IOL A;  4TUU A;  4KMO A;  4U07 A;  4KXK B;  4BSX A;  1S0P A;  3PH0 C;  1H6P A;  4FU3 A;  2IEJ A;  4G1T A;  3AG4 E;  3CVU A;  2IFU A;  4U96 D;  4KZ0 A;  4BET A;  4JC8 A;  2OV8 A;  2OVB A;  2WXO A;  5M72 A;  3SBT B;  2VGY A;  3HIZ A;  4U0S A;  3C3O A;  2V0P A;  4N39 A;  3L54 A;  4EZJ A;  1OY3 D;  3U3W A;  2WB2 A;  1W3B A;  1EPU A;  1YMP A;  4K5C A;  1OWP A;  4DI4 A;  3UUX A;  3EHN A;  3KAE A;  4QQI A;  5J08 A;  5CCL A;  1ZU2 A;  1TNB A;  3ASD A;  1G3N B;  4DX2 A;  2R17 C;  4CT0 A;  3EHR A;  1DCQ A;  1JPL A;  4AOF A;  4JEH A;  2DZN A;  1BI8 B;  1QZ2 A;  4N3B A;  4BES A;  2PM7 A;  1WDY A;  4MKT A;  4APF A;  3IV0 A;  4HBD A;  4N5Q A;  5ENO D;  3CLJ A;  5FTP A;  3P2B A;  2PQN A;  2LUH A;  3FWV A;  5KJL A;  1N4S A;  4ILI A;  4A1G A;  1FT1 A;  4AM9 A;  2MYO A;  3FH5 A;  1N4P A;  5FZS A;  2L6B A;  1YCS B;  2IU1 A;  4NUR A;  2V4H C;  4U95 D;  1FVH A;  4UQY A;  2F0Y A;  3C5R A;  1QNF A;  3HRA A;  5H7P A;  5BXO A;  5KNG A;  1WY6 A;  3KS2 A;  4O1P A;  2X6F A;  2XGO A;  4B89 A;  3ZGQ A;  3W9F A;  5AQB A;  1RW2 A;  3HXC A;  3DSX A;  3SF4 A;  4ZHB A;  3OXF A;  2VSX E;  3B7U X;  4XE0 A;  3G2S A;  3NZU A;  2XS8 A;  3J5P A;  3E33 A;  1U3D A;  2P9K G;  1E7U A;  4Q94 A;  1IYG A;  2YQ8 A;  2XCC A;  4I2W A;  4HFG A;  5AN8 A;  2C2L A;  1O5M A;  4GTR A;  2GRQ B;  3NB2 A;  2J4D A;  3JUE A;  4GCO A;  1NI1 A;  3ZYK A;  2BF0 X;  3MKQ B;  4U63 A;  5CMW A;  1OCC E;  2R05 A;  1H19 A;  5BNW A;  4GZC A;  2WQ7 A;  4C0M A;  1UW4 B;  4J8E A;  5EN5 D;  3DEP A;  5KCM A;  1U3C A;  3Q7A A;  3RO3 A;  2X3M A;  3QDN A;  3EHM A;  2QFC A;  3LYA A;  3CHP A;  3TL5 A;  3FDH A;  4LRZ A;  2ZGG A;  4V3I A;  2RFA A;  3SFX A;  4A55 A;  3NZS A;  5T8I A;  3L6A A;  1JCQ A;  4G25 A;  5KNH D;  1RZ4 A;  1E8Z A;  5JJ6 A;  2QYU A;  3ZHE B;  2WXK A;  3JCK C;  3JXJ A;  1JUQ A;  3PUJ A;  3DSW A;  5AJD A;  2VSN A;  3RAU A;  4OAU C;  4B8C B;  1L5J A;  2FBN A;  2AJA A;  2LXL A;  1HFA A;  3HVE A;  4MS6 A;  3RRM B;  3FUE A;  3QAR A;  1OCO E;  1Z3Y A;  3ZU7 B;  5T4Y A;  5AQA A;  3I3N A;  3ASN E;  3FH7 A;  2ILR A;  5ANR A;  3PRE A;  3I4R B;  3LJ3 A;  3KEA A;  4WUY A;  2ZIS A;  4JB8 P;  2IOS A;  3RJV A;  2HE0 A;  1DCE A;  1Q2Z A;  3HHM A;  3T8M A;  3JQ1 A;  4ACL A;  4PUC A;  3W9G A;  3QC1 A;  1N4R A;  3AG1 E;  1TNO A;  4CDN A;  4XX5 A;  2DZO A;  3R7R A;  2LSV A;  5A23 A;  3V79 K;  2FF4 A;  3PNL B;  2AXZ A;  3DEO A;  4I1A A;  4Z68 A;  3DST A;  3UTM A;  2AXV A;  4QFV A;  4O6F A;  3E37 A;  4AIF A;  1JWG A;  4HRL A;  2J4B A;  3SGH A;  2DVW A;  3CK8 A;  2F8X K;  2AW6 A;  3SO8 A;  2P9P G;  3TAX A;  4GPM A;  4U8V D;  3BG1 B;  2P9L G;  4L23 A;  4CT4 A;  1K3Z D;  2WXF A;  2J49 A;  2X6J A;  2WQH A;  4W9R A;  2Y3A A;  1ELR A;  2RFM A;  2HYZ A;  3ISM C;  1N0Q A;  2KXP C;  3QNK A;  1LD7 A;  5CCM A;  3HG0 D;  1H0A A;  4GZD A;  4GZ5 A;  3V2O A;  1OWM A;  3FU5 A;  2XRY A;  3RKV A;  3IHY A;  3PZ4 A;  3C72 A;  2R5S A;  4UWF A;  2PL2 A;  3LVQ E;  2BUG A;  2VSY A;  4ME2 A;  5BUZ A;  1IQR A;  4AJW A;  2XEH A;  1A17 A;  4F6R D;  3VTX A;  3RK6 A;  4ATG A;  1Z3X A;  3D9H A;  4APO A;  4BTA A;  1SW6 A;  3IXE A;  4DRX E;  1MX2 A;  2Y4U A;  5D66 A;  3FTZ A;  2H6H A;  2WXQ A;  4PS8 A;  3PDN A;  1BU9 A;  2IF4 A;  4XEI G;  3FH8 A;  4RG9 A;  4FJZ A;  2IO3 C;  4I1M A;  3E30 A;  3JUI A;  3FHE A;  4G26 A;  3B95 A;  4GTT A;  3C3Q A;  4ANU A;  4GU5 A;  4GZ3 A;  1ELK A;  4IUL A;  3CHQ A;  4I6G A;  3Q7F A;  1WG0 A;  1MX4 A;  1E7V A;  5E76 A;  5G2N A;  4HRN A;  2LO6 A;  3CHS A;  5ANL A;  4LEU A;  1AWC B;  3FTX A;  3PZ3 A;  3EHQ A;  4FLH A;  1K1A A;  3DWL G;  3CQG B;  4DLO A;  3S2A A;  3CVP A;  3UMV A;  2KBX A;  2PNN A;  1OT8 A;  1OWL A;  4KVO A;  1OCR E;  4J0U A;  1MHQ A;  4B93 B;  4F7A A;  2FUL A;  2RKK A;  3ZIM A;  3ZFW A;  1H2U A;  1MZC A;  1KZP A;  3LY7 A;  4B8A A;  1TJF A;  4BY6 A;  5AQ7 A;  2R59 A;  4FHJ A;  3SI5 A;  1SZA A;  3RSE G;  4DJA A;  1HG5 A;  3VLE A;  3Q47 B;  3EU5 A;  2QYJ A;  3IEG A;  3FP3 A;  4N5C A;  3APF A;  4TV3 A;  1KT1 A;  3GZS A;  3APC A;  3ZRH A;  4AV7 A;  3TWX A;  3BUA A;  4GAA A;  4J8D A;  4JPS A;  2MOW A;  4E85 A;  3BEE A;  4H7X A;  4M3O A;  1TNZ A;  3FTU A;  3G2V A;  3AJI A;  5AEN A;  4U0U A;  5ARG A; 
#chains in the Genus database with same CATH homology
 3FH5 A;  3E4B A;  3JYS A;  5FZS A;  4WWP A;  5ARF A;  4FP7 A;  3K9I A;  3AS4 A;  4HOU A;  2IU1 A;  4NUR A;  5FZQ A;  2I1K A;  4GYW A;  2KZT A;  2QY7 A;  3D9N A;  4FA6 A;  1FVH A;  1WM5 A;  1PY1 A;  2YNQ A;  4UQY A;  1HU3 A;  4GMJ A;  2VJ8 A;  1VDY A;  4I6E A;  1QNF A;  3MA5 A;  1IHG A;  1PC2 A;  1E96 B;  3PNT B;  5JJ7 A;  3MYV A;  1WY6 A;  4A3T A;  3KS2 A;  3MKQ A;  3FUK A;  5LOZ A;  4EQF A;  5A6C A;  1BPO A;  2X6F A;  3CKC A;  2WVI A;  4PS3 A;  2X38 A;  3UX4 A;  1HG2 A;  4WNG A;  3IHV A;  3LVR E;  2XGO A;  1XNF A;  4B89 A;  2WXH A;  4UWK A;  1E90 A;  3ML8 A;  5DIZ A;  3ASH A;  4Y6C A;  3CQC B;  3ZGQ A;  4BTB A;  4BX9 A;  4PDX A;  4GB9 A;  4LCT A;  4JHK A;  4B0Z A;  5AIJ A;  4XKC A;  5CMY A;  3U9W A;  1ELW A;  3SF4 A;  2HR2 A;  3PEV B;  3SNX A;  4EPZ A;  2WXP A;  3OXF A;  2VSX E;  3ASG A;  1NZN A;  2WXR A;  3B7U X;  4XE0 A;  3G2S A;  4HOT A;  3NZU A;  2WXI A;  2JLB A;  3R7Q A;  4K03 A;  1U3D A;  1B89 A;  3L22 A;  5FQ7 A;  1E7U A;  4Q94 A;  1UN8 A;  1IYG A;  2KZT B;  4OVV A;  2YQ8 A;  2XCC A;  2WM9 A;  4F53 A;  3B7R L;  3O48 A;  4I2W A;  4GYO A;  2MRI A;  3FU0 A;  4HFG A;  3MV3 B;  3RIB A;  2C2L A;  5JHB A;  4I43 A;  4FC8 A;  1HX8 A;  3FTW A;  4IYP A;  4NRH B;  2CFU A;  4WWO A;  5FWQ A;  2GW1 A;  2LNI A;  2J4D A;  3FU6 A;  3FY4 A;  2L6J A;  3APD A;  4GCO A;  3ZYK A;  1HXI A;  2BF0 X;  2LAI A;  3MKQ B;  4U63 A;  3UT8 A;  3ZHE A;  5CMW A;  1HF8 A;  3S7J A;  3LDZ A;  3MCX A;  1H19 A;  3AS5 A;  4G24 A;  5BNW A;  4GZC A;  2WQ7 A;  2XQ0 A;  4C0M A;  2X6I A;  1EDU A;  1UW4 B;  4J8E A;  4J8F A;  2VTB A;  4WWN A;  3EIQ C;  5KCM A;  1U3C A;  4HOR A;  3RO3 A;  2X3M A;  3QDN A;  3QWV A;  4JVS A;  1OWN A;  4G11 A;  4WNF A;  1SQM A;  2X6H A;  3LPZ A;  3AU5 A;  3OAW A;  3PE3 A;  4ANX A;  2GRL A;  3EHM A;  2QFC A;  4MRU A;  3UT7 A;  4I17 A;  3ZN3 A;  3LYA A;  4EBA G;  3CHP A;  3EJN A;  1UG3 A;  2XPZ A;  4JHR A;  4LUN U;  2VYI A;  3TL5 A;  3FDH A;  3MX3 A;  3D9K A;  5FT9 A;  4OYS A;  4LRZ A;  1XGW A;  4N2S A;  2AXU A;  3ULQ A;  3QOU A;  4UQX A;  4JXT A;  4DLQ A;  4ABN A;  4GML A;  3CVY A;  3LXU X;  4V3I A;  2E0I A;  3CEQ A;  3G2U A;  3LCA A;  4A55 A;  3PS6 A;  4JW1 A;  4AEZ C;  3NZS A;  5T8I A;  4G23 A;  3QKY A;  5LCW J;  1Y8M A;  2I9C A;  2A5U A;  4BFR A;  3I4G A;  3FUD A;  3L17 A;  3VLF A;  2AVP A;  3L6A A;  4AVX A;  3TGO A;  4F3V A;  4G25 A;  3LKU A;  3QJZ A;  5LX8 A;  1E8Z A;  3CV0 A;  5JJ6 A;  5KJK A;  2E2E A;  1HS6 A;  3Q49 B;  5JHA A;  3RO2 A;  3ZHE B;  2WXK A;  3JCK C;  2J9Q A;  1JUQ A;  2KCV A;  2OND A;  3PUJ A;  4CRW A;  3FU3 A;  4UI9 C;  1X5B A;  5AJD A;  2VSN A;  3ZYQ A;  3LS8 A;  1HE8 A;  2J09 A;  4FAD A;  4B8C B;  3PE4 A;  1L5J A;  1UN9 A;  3L13 A;  4FUL A;  2FBN A;  4MS6 A;  3HVE A;  1HFA A;  4G2V A;  2A4Z A;  3RRM B;  1P5Q A;  3FUE A;  5T3R A;  5D0O D;  2HO1 A;  1HZ4 A;  1NP7 A;  2KM4 A;  2XGM A;  2I6H A;  4H7Y A;  3QAR A;  1Z3Y A;  4B94 A;  5BV0 A;  2Q7F A;  1EYH A;  5T4Y A;  1INZ A;  3I3N A;  4DPR A;  4RVB A;  3DBS A;  4XKB A;  3D9J A;  3FH7 A;  3AU4 A;  2ILR A;  5ANR A;  3PRE A;  5LP0 A;  3I4R B;  4EBA A;  3LJ3 A;  3Q4A B;  3URZ A;  4N2Q A;  4NAC A;  3CVX A;  4WUY A;  2XPY A;  4UI9 K;  1JWF A;  5A7D B;  5C2Y A;  2YHC A;  2IOS A;  3P1U A;  3RJV A;  4HS2 A;  3G2W A;  4ILG A;  3HHM A;  4UWH A;  2X6K A;  3ZYM A;  4GA2 A;  1MQS A;  3FUL A;  3T8M A;  3CST A;  3IKO B;  3NQP A;  2V4L A;  3JQ1 A;  3PUK A;  3SBS A;  4ACL A;  4PUC A;  3ZXS A;  2IQC A;  4KBQ A;  4CGV A;  3C98 A;  3QC1 A;  4HOS A;  4E6H A;  4N3A A;  4FJY A;  1HO8 A;  2RG8 A;  2J07 A;  2VSO E;  3FUF A;  4PH4 B;  4CDN A;  3ONL A;  3SHF A;  1TJC A;  3FFL A;  3CKB A;  2BTD A;  3O4Z A;  4XX5 A;  3BG0 B;  3R7R A;  4EEC A;  3QAQ A;  3D9I A;  2KC7 A;  3HVE B;  2LSV A;  4Q96 A;  2KCL A;  4RSY A;  2CG2 A;  2GGF A;  2NC9 A;  3FUH A;  5C1D A;  3GZ1 A;  5A23 A;  3CGH A;  4BWR A;  5JJT A;  3KD7 A;  4GA0 A;  3B13 A;  4YVQ C;  4N3C A;  2FF4 A;  3PNL B;  2AXZ A;  4I1A A;  4C9B B;  5G04 C;  1NA3 A;  2LSU A;  2WMO A;  1H2T C;  2XRZ A;  4GZ6 A;  3CIA A;  4BT8 A;  3FUI A;  2AXV A;  4QFV A;  5E75 A;  2UY1 A;  4JEU A;  2WXG A;  4O6F A;  3FEX A;  1GW6 A;  1ZBP A;  4U0Z A;  2V5F A;  2MHK A;  1JWG A;  1KLX A;  3MGB A;  4AIF A;  3ZW3 A;  1OWO A;  3PVL A;  1DNP A;  3B7T A;  2J4B A;  3SGH A;  3VLD A;  3KEZ A;  4CCA A;  5D0Q D;  3D9M A;  1LF8 A;  3CK8 A;  3ML9 A;  4I9C A;  2OOE A;  2AW6 A;  3ZVV A;  2M63 A;  4U8H A;  2L9B A;  3RRN B;  5FQ6 A;  4ILH B;  2DIW A;  3TAX A;  3I5P A;  3CVQ A;  4K0R A;  3SD5 A;  3ZEF A;  4CDM A;  4UWG A;  1E8W A;  3BG1 B;  4L23 A;  4GPK A;  4YVO A;  2NSZ A;  3L16 A;  4CT4 A;  1TEZ A;  3RRU A;  4HVB A;  5FQ8 A;  4JHJ A;  2PM6 A;  4PS7 A;  4A1S A;  4J6I A;  2KAT A;  3CHO A;  5LCW C;  5G05 C;  2LAH A;  4URK A;  2WXF A;  4EZL A;  2J49 A;  2X6J A;  2CHZ A;  2IJG X;  2J08 A;  2WQH A;  4W9R A;  5KJM A;  2Y3A A;  3CSF A;  4IN3 B;  1ELR A;  2V8S E;  2WMN A;  2ION A;  3PZD A;  5DBK A;  3MJW A;  2HYZ A;  4FHK A;  3S7F A;  2PZI A;  2WXM A;  3GYZ A;  5HQ8 A;  1DVP A;  3D3M A;  2PQR A;  3QNK A;  5CCM A;  1UJK A;  2C0L A;  3HDX A;  4XI9 A;  1H0A A;  2FO7 A;  2VQ2 A;  4GZD A;  4GZ5 A;  3UQ3 A;  2EQX A;  3ASF A;  1NA0 A;  2UY1 B;  4HOQ A;  2P58 C;  1OWM A;  2ZU6 B;  3PRZ A;  5BPP A;  3FU5 A;  2XRY A;  2CHW A;  3RKV A;  4KYO B;  3IHY A;  2DBA A;  2YIN A;  4UWL A;  3ONK A;  4GCN A;  4DK5 A;  2R5S A;  1QQE A;  2PL2 A;  4UWF A;  3LVQ E;  5ENN A;  4WAF A;  2BUG A;  3CK7 A;  5LFA A;  3CVN A;  3OXG A;  5G55 A;  4L7T A;  4GA1 A;  1YA0 A;  2VSY A;  3R9A B;  4ME2 A;  5BUZ A;  1IQR A;  2WXN A;  3CHR A;  4YND A;  2VTB B;  4AJW A;  1A17 A;  4I1O B;  3TG5 A;  3VTX A;  3RK6 A;  2VGX A;  4ATG A;  5AYW D;  1Z3X A;  3T5V A;  2C0M A;  1OUV A;  4APO A;  2RD0 A;  4BTA A;  3NF1 A;  2WXJ A;  4NQ0 A;  3S7B A;  3GW4 A;  3QWW A;  3UPV A;  2L0T B;  4HXI A;  3U4T A;  4LER A;  4CGW A;  3CK9 A;  2DCP A;  2Y4U A;  4CDR A;  3D9P A;  4I6J A;  3ENE A;  3FTZ A;  3EDT B;  3LY9 A;  5CHE E;  2OVF A;  2WXQ A;  3D9L A;  4L2L A;  4PS8 A;  3EIJ A;  1IQU A;  2JEK A;  3PDN A;  3QK0 A;  4JA7 A;  4AXH A;  1Z6T A;  2IF4 A;  3U64 A;  3FH8 A;  1PAQ A;  1SZ9 A;  4RG9 A;  4FJZ A;  3SFZ A;  4ANV A;  4I1M A;  3SZ7 A;  4I9E A;  3TXM A;  1FCH A;  3FTY A;  3LY8 A;  3GZ2 A;  3N71 A;  3JUI A;  4D10 C;  3FHE A;  4EZK A;  1N52 A;  4G26 A;  4HLE A;  3FUJ A;  4GYY A;  4ANU A;  5BW8 C;  4WND A;  4UI9 J;  4GU5 A;  4GZ3 A;  1ELK A;  4IUL A;  3AS8 A;  3TJP A;  3CHQ A;  4AP2 A;  3L08 A;  4I6G A;  5FQ4 A;  3QWP A;  2XEV A;  1E7V A;  2I1J A;  5E76 A;  4F1S A;  4AY6 A;  5G2N A;  3OXL A;  3CVV A;  3ZYL A;  3Q5M A;  2LO6 A;  2CHX A;  3CHS A;  5ANL A;  4LEU A;  3FTS A;  2VGX B;  3OTN A;  3Q15 A;  4KT6 B;  1UJJ A;  3CVL A;  5FJY A;  2NXP A;  1E8X A;  4DI3 A;  3MZL B;  2XCB A;  4R7L A;  3FTX A;  3MV2 B;  4JZY A;  4IRU A;  4AY5 A;  2IOL A;  1KT0 A;  2KCK A;  4TUU A;  3ZFW A;  2WXL A;  4KMO A;  4U07 A;  4FLH A;  4JA9 A;  3CQG B;  4KXK B;  4DLO A;  3S2A A;  4BSX A;  1S0P A;  3PH0 C;  2HM8 A;  5EX3 A;  3CVP A;  3UMV A;  3FUN A;  4FU3 A;  1OWL A;  4XI0 A;  3CR3 A;  4KVO A;  3UT4 A;  4KZC A;  2AWI A;  2GRM A;  4G1T A;  3T5X A;  4ANW A;  2WPV A;  5EDS A;  4XIF A;  4J0U A;  1MHQ A;  5AJL A;  4I2Z A;  4TRQ A;  3ZPJ A;  4F7A A;  3CVU A;  2IFU A;  4KZ0 A;  2FUL A;  5EKQ D;  4MLP A;  3ZIM A;  2CFZ A;  2OV8 A;  2OVB A;  2WXO A;  4FLB A;  4JC8 A;  2VGY A;  2UWJ G;  3HIZ A;  3SBT B;  5M72 A;  3CVW A;  4U0S A;  1H2U A;  2V0P A;  4OVU A;  4A3V A;  4N39 A;  5FZR A;  3L54 A;  4EZJ A;  3G2T A;  3LY7 A;  4B8A A;  4JL0 A;  3U3W A;  2WB2 A;  1TJF A;  4BY6 A;  3MKR A;  5KJN A;  3ESL A;  5HI7 A;  1W3B A;  2R59 A;  5G04 J;  4UQZ A;  4C0E A;  2YHE A;  3CHM A;  1EPU A;  2L0I A;  3VTY A;  4FHJ A;  3RU0 A;  3SI5 A;  2Y4T A;  3S7D A;  1OWP A;  1SZA A;  2FEZ A;  4DI4 A;  5BT1 A;  4RG6 A;  4DJA A;  1HG5 A;  4XZ4 A;  3UUX A;  3VLE A;  3Q47 B;  3EHN A;  3KAE A;  3MEK A;  4BX8 A;  3ESK A;  4P29 A;  3FTV A;  1EF1 C;  5J08 A;  5CCL A;  4L1B A;  1ZU2 A;  3ASD A;  2R17 C;  4L2Y A;  2CG3 A;  1FVF A;  2XPI A;  4CT0 A;  3PEU B;  3IBE A;  3IEG A;  1JPL A;  4CEM A;  1Y6I A;  3FP3 A;  3FUM A;  4AOF A;  4Q69 A;  4N5C A;  3APF A;  4JEH A;  1KT1 A;  4TV3 A;  3GZS A;  1QZ2 A;  3APC A;  4N3B A;  2WQ6 A;  3JQ0 A;  5BV1 A;  3HYM B;  2PM7 A;  5EX0 A;  3ZRH A;  4MKT A;  5J90 A;  1H6K A;  2XHE A;  5G05 J;  4APF A;  4Y6W A;  4AV7 A;  4WNE A;  1WAO 1;  3TXN A;  3IV0 A;  4GAA A;  4ACK A;  4KVM A;  4J8D A;  3CLJ A;  2FI7 A;  2MOW A;  4J8S A;  4JPS A;  5FTP A;  1N54 A;  3TG4 A;  3FEY A;  4E85 A;  1H2V C;  3DPD A;  3BEE A;  4H7X A;  4M3O A;  3P2B A;  2I2O A;  1E8Y A;  2PQN A;  3LEW A;  4U04 A;  2XGS A;  3QB2 A;  3D9O A;  3FWV A;  3FTU A;  3G2V A;  3B7S A;  3U66 A;  4BT9 A;  5AEN A;  4U0U A;  5KJL A;  5ARG A;  4ILI A;  4A1G A;  3WXX A;  1HH8 A;  4AM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...