4HOUA

Crystal structure of n-terminal human ifit1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
269
structure length
261
Chain Sequence
VKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAYVKHLKGQNEEALKSLKEAENLMQENVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-induced protein with tetratricopeptide repeats 1
publication title Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 97
structure length 261
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4houA00
5KJKA 1XNFA 3MEKA 3ZPJA 3CVLA 5G05C 5FTPA 3TG5A 3PE4A 2XCCA 3CK7A 1ELRA 4UI9K 1NA0A 3CVQA 5BT1A 2DBAA 4LEUA 5C1DA 1QZ2A 4HOSA 4GA0A 4HOQA 4WNEA 4WNGA 3ASGA 3UPVA 3ASHA 3RIBA 2C2LA 4CGVA 2R5SA 3RU0A 3ASDA 3E4BA 3GW4A 3JYSA 5KJLA 2BUGA 4N3BA 3S7FA 4HORA 3KAEA 5JJTA 5M72A 1HZ4A 4J8DA 4G24A 4WUYA 1IYGA 5FZSA 2PQNA 4XI9A 4UQYA 3FWVA 5D0QD 3S7BA 1ZBPA 4G23A 4YNDA 3MKRA 4N3CA 4GA1A 5ARFA 3CVPA 4KYOB 4APOA 4I9EA 3FP3A 3URZA 5CCMA 4N2SA 4YVQC 5FZQA 3U3WA 4J8FA 2XGOA 3ZFWA 2UY1A 3AS5A 5D0OD 4IN3B 2QFCA 4BT9A 3RO3A 3K9IA 2VGYA 3ZHEA 3KD7A 4N2QA 5FJYA 4KXKB 5BNWA 1NZNA 4NRHB 5KJMA 4RG6A 2V5FA 4WNFA 1HH8A 2XGMA 3PDNA 4XIFA 3SZ7A 3ESKA 5EX3A 2C0LA 1NA3A 2UWJG 4BT8A 3TG4A 3FFLA 3LY9A 3WXXA 3EDTB 4YVOA 2GW1A 4BTAA 2KATA 4JL0A 2VSYA 1W3BA 2FF4A 4I1AA 3OXLA 2C0MA 4AY6A 4ME2A 2XEVA 4U07A 5G05J 5FZRA 4I9CA 4GYYA 3QDNA 4BTBA 1P5QA 4B94A 4AY5A 1A17A 5DIZA 1B89A 4N5CA 4J8EA 5A6CA 2FI7A 3QWWA 3IEGA 3N71A 4G26A 4Y6CA 3MA5A 4N39A 2I6HA 4U04A 2HO1A 3Q4AB 1E96B 2PL2A 5G04C 4XI0A 1KT0A 5CHEE 2VGXB 2IF4A 3RO2A 2HYZA 3Q49B 5FT9A 2IFUA 4RG9A 2PQRA 3CKCA 4W9RA 4GCOA 3LY8A 4U0SA 4AM9A 1IHGA 3RKVA 3Q47B 4I17A 2FO7A 2KCLA 2VYIA 3CVNA 3CV0A 4JA7A 4O6FA 4GZ6A 5AYWD 1KLXA 1PC2A 3S7JA 3LYAA 4CGWA 2VSNA 3QWPA 3CKBA 4I2WA 2ONDA 3SF4A 2AVPA 5BW8C 2WPVA 2L6JA 2VQ2A 3U4TA 4G25A 3LKUA 4F3VA 1ELWA 5CCLA 2YHCA 2LSVA 4G1TA 2XCBA 2NC9A 1OUVA 5EX0A 4GZ5A 4CDRA 4Y6WA 3TGOA 5KJNA 3UUXA 3LY7A 5EKQD 2XGSA 5LCWC 2KC7A 5DBKA 3GZ1A 5JJ7A 1HXIA 2Y4UA 1YA0A 3O48A 3PE3A 3VTYA 4AIFA 4GZ3A 4ABNA 4J0UA 4UI9C 5LCWJ 3OXGA 3OXFA 4KBQA 3HYMB 4H7XA 3CEQA 2LSUA 4U0ZA 2P58C 1WAO1 2J9QA 2JLBA 3RJVA 3QKYA 3QOUA 4N3AA 4HOTA 4UI9J 1KT1A 3CK9A 4GA2A 1WM5A 3AS8A 3ULQA 2MHKA 3R9AB 3AS4A 3LCAA 3ZN3A 4EQFA 4HOUA 5HI7A 4UQXA 3S7DA 4GYOA 3Q5MA 2VGXA 3KS2A 2LNIA 3MV3B 1QQEA 5JJ6A 2Q7FA 5G04J 3ASFA 3UQ3A 3LPZA 3GZ2A 1TJCA 2UY1B 1ZU2A 2OOEA 4WNDA 4JA9A 4H7YA 3GYZA 3MV2B 4UQZA 4GCNA 4BWRA 4NQ0A 3NF1A 3VTXA 3ZHEB 2E2EA 2YQ8A 1FCHA 3Q15A 4A1SA 5A7DB 5ARGA 2FBNA 4GPKA 2KCKA 2WQHA 4U0UA 3ZGQA 2HR2A 3BEEA 2XPIA 2FEZA 3QWVA 4JHRA 5HQ8A 4GYWA 2PZIA 2Y4TA 3TAXA 2KCVA 3CK8A 1Y8MA 4I2ZA 4G2VA
chains in the Genus database with same CATH superfamily
5KJKA 3FUDA 1OWNA 3DXKG 3DSSA 5G2NA 2FO1E 1O1SA 2AW6A 4GTMA 3CK7A 1ELRA 2H6HA 2HM8A 1QZ2A 5J08A 3FH5A 1AP7A 1OCOE 4WNEA 3UPVA 3Q7FA 1FVFA 4JD2G 3FTVA 3EHMA 3R7QA 2XRYA 4GTVA 3ASDA 3I4RB 3E4BA 3GW4A 4QFVA 4N3BA 4HORA 4UWGA 3KAEA 5JJTA 2X6HA 4J8DA 4G24A 4WWPA 3C5RA 4R7LA 2I9CA 2PQNA 3CHSA 4E85A 2ZIRA 5D0QD 5AQAA 1BI7B 3S7BA 1TNBA 1ZBPA 4G23A 3R9MA 4TXQA 3UMVA 4G11A 3SFZA 4JEUA 2YINA 3ZXSA 5ENRD 3CHQA 2BF0X 5CCMA 2P9IG 4JB8P 5FWQA 3JQ0A 5FZQA 4MS6A 4UWLA 1Z6TA 3UM3A 2XGOA 3ZFWA 3ABLE 4TV3A 2OEVA 4UWHA 3T5VA 2MYOA 4DJAA 1EDUA 2KZTB 4BT9A 4B0ZA 3RO3A 3S2AA 4U7EB 4O1PA 3B7RL 2X6KA 3HVEB 1IQUA 3DSWA 4AV7A 3CR3A 4DRXE 1K1BA 2R2LA 3B7UX 1N11A 4EZKA 1EPUA 3I3NA 4CEMA 4ZHBA 1N0RA 3FULA 4BY6A 4HRNA 4ACLA 3PRZA 4MRUA 2XZTG 3IXEA 1XGWA 4ILGA 3EDTB 3UKUG 4L1BA 1NI1A 2KATA 4CT4A 1JWFA 1N95A 2CG3A 1TNZA 4C0MA 2C0MA 2XEVA 3HXDA 4U8YD 1OY3D 2QY7A 3D9JA 3QDNA 5B3SE 1MX2A 2Y3AA 4WAFA 4B94A 4YDEA 2DYRE 3BUAA 3BU8A 1TJFA 5HKPA 3ZYLA 4A1GA 5A6CA 3N71A 1NFIE 4LRZA 3MX3A 2L6BA 4OAUC 4N39A 4U04A 3ZVVA 1E96B 2XHEA 2Y69E 1DVPA 2WM9A 4XI0A 2IJGX 5CHEE 2WMOA 2WXIA 5FQ6A 4JHKA 4K5BA 4NACA 5H7PA 3Q47B 2FO7A 3V79K 4MLPA 2B0OE 3UT8A 5AYWD 1ZB1A 4DX5D 1PC2A 2CG2A 3E32A 5CEAA 2LO6A 3FUEA 3CHOA 3FUNA 1JCSA 3SF4A 4F7AA 4KVOA 4GZDA 1YMPA 3CVYA 2WPVA 2VQ2A 5AJLA 3LKUA 3KSQA 3ESLA 1QYMA 2WVIA 2WXHA 4G1TA 3ZIMA 2NC9A 1OUVA 1BI8B 5EX0A 4GZ5A 1H19A 4PDXA 4CDRA 4Y6WA 3TGOA 5ENQD 3B7BA 1UJJA 3L9TA 2WQ7A 3VLFA 2JABA 2KC7A 3FH8A 3PEVB 4K5CA 5BUZA 3FTUA 2NSZA 4AXHA 3SHFA 3O48A 1QBQA 1HE8A 1PAQA 4UWFA 4CT0A 4AIFA 3HXCA 1E8XA 3FU0A 4H7XA 2A5EA 1BPOA 4Q94A 3FEYA 4C48B 2I2OA 3HHMA 2XS1A 1WAO1 1S70B 3L82A 5ENOD 3RJVA 2DCPA 3QOUA 3DRAA 1U3DA 2OEWA 3U66A 1OWOA 5CERB 3PEUB 2XEEA 4OVUA 2NXPA 4HQDA 3TJPA 2MHKA 3E30A 4FLHA 3UM0A 1K1AA 2AXVA 1FPPA 3ZN3A 4HOUA 4GB9A 3S7DA 3Q5MA 2VGXA 2LNIA 1QQEA 3SBTB 2PNNA 3V2OA 2Q7FA 3TWWA 3ASFA 4KT6B 1Y6IA 3GZ2A 1OCZE 3DSUA 2AXZA 1N9AA 3PH0C 1N4SA 4WWNA 3MZLB 4UQZA 3T5XA 4BWRA 2B6CA 2GRMA 5IY5E 1D8DA 2YQ8A 1FCHA 2LXMA 2IQCA 4JPSA 1KZOA 3HVEA 1N0QA 4BETA 4U96D 3ZGQA 4A3VA 3V2XA 3ONKA 3NB2A 2EQXA 2XPIA 2AWIA 1V54E 2FEZA 2XRZA 3ONLA 2Y4TA 1HS6A 1H2VC 2WXQA 2KCVA 3CK8A 5G55A 2IY0C 3Q9NC 3MEKA 5ENSD 3L22A 2V4LA 5G05C 1UW4B 5FTPA 3TG5A 4YDYA 3PE4A 4JVSA 2XCCA 4GU5A 4RLYA 1N54A 1ELKA 4UI9K 5BT1A 4LEUA 2BTDA 5CRUA 4FJZA 5AAOA 1DCQA 5AENA 5ITZF 3ASGA 5CMWA 3ASHA 5AQ7A 2V4HC 2R5SA 4B8CB 2XPZA 5AARA 2DIWA 4F1PA 1TNOA 4BX9A 4J7WA 1HZ4A 1PY1A 3FUIA 4WUYA 4FJYA 4GTRA 5HS0A 5FZSA 4E6HA 1OWPA 3ZYQA 2EIME 2OVFA 5B1AE 5ARFA 3CVPA 4IYPA 1L5JA 4APOA 4ATZD 3LVRE 4O60A 3HXEA 5EDSA 4N2SA 1IXVA 1LD8A 2GGFA 4FHKA 1X5BA 1E90A 2UY1A 3UKRG 1BLXB 4RVBA 3KSLA 4IN3B 3OAWA 1O1RA 3SD5A 4XE0A 3I5PA 3K9IA 2VGYA 2P9SG 4EZLA 4N2QA 1VDYA 3L13A 4HBDA 4HI8A 5AIJA 3HXFA 5KJMA 4Q96A 3IV0A 3QK0A 4L23A 1HH8A 2R05A 1EYHA 5T3RA 1Z3XA 3T9KA 3DPYA 1OT8A 4XKBA 4GPMA 3WXXA 3CVVA 2GW1A 1W3BA 2P2CP 1H6OA 4I1AA 3G2SA 4ME2A 3APCA 3RK6A 5FZRA 4I9CA 4GYYA 4B89A 4BTBA 1P5QA 4HB5A 5BXUA 3EJNA 2GRLA 3WG7E 2XQ0A 4HLEA 2IO2C 1YYHA 4K5AB 4DI3A 1B89A 2WXMA 3DBSA 4GMLA 4N5CA 5ANLA 2I1KA 4J8EA 3D9IA 2FI7A 3QWWA 3IEGA 1MHQA 2WMNA 3ULYA 2HO1A 3B13A 4OVVA 2X38A 4HFGA 2PL2A 3QB2A 4I6EA 3SBSA 2VGXB 2WXJA 2RD0A 3UIPC 4LSZE 3CKCA 2ZU6B 3LY8A 4AM9A 1IHGA 3OTNA 5ENPD 4I17A 2XZDG 3CVNA 1O1TA 3D9LA 4JA7A 4O6FA 3AG2E 2QYUA 1KLXA 1X81A 3W9FA 3L54A 4DX6D 3QWPA 3RRNB 3CKBA 1TN6A 4ILHB 4QQIA 1YCSB 3NAWA 5BW8C 4YDOA 2P9LG 3U4TA 2RKKA 3ZKJA 3DXMG 4IRUA 5BV0A 3C98A 1E8YA 4DX2A 4F3VA 4KZ0A 4N5QA 3NZSA 5JA4D 2LSVA 3FY4A 5E75A 2NYJA 5CECB 3UUXA 2RG8A 5E76A 4JZYA 3CSTA 2P9KG 1Z5SC 3LDZA 3ENEA 2ILRA 2PM7A 3FTZA 4TUMA 5JJ7A 2H6FA 4FP7A 1SW6A 4J6IA 3VTYA 4ZFHA 3D9HA 4GZ3A 2A5UA 4D10C 3IHVA 4DI4A 3CIAA 4KBQA 1S0PA 1MQSA 2GRRB 3AG3E 2LSUA 5AQ9A 1MJ0A 1BD8A 3PZDA 2OVBA 2ZISA 4A55A 1SQMA 4B8AA 3QKYA 1N4PA 1KT1A 3AAAC 4GA2A 4HRMB 1BU9A 3ZUVB 1E8ZA 1WM5A 3CQGB 3R9AB 3FDHA 3W9GA 4CDMA 2WXPA 4UQXA 4AP2A 4GYOA 3KS2A 3TWSA 3MV3B 5LX8A 5JJ6A 4K0RA 5LFAA 3CHMA 2P9NG 5G04J 3NZUA 2EILE 2UY1B 3P1UA 4FA6A 3FH7A 1TYQG 1NP7A 3T8MA 1V55E 2CHZA 3GYZA 1JWGA 3KEZA 3MV2B 4JC8A 5CEDB 4OAVB 3V31A 5CMYA 2F8YA 3Q7AA 4HVBA 3IBEA 2E2EA 3Q15A 2XENA 5ANRA 3DEPA 5A7DB 2PM6A 3UINC 2DZNA 3TWUA 2KCKA 1SA4A 2AXUA 1SZ9A 2F37A 2KXPC 3BEEA 2IEJA 1E7UA 4YDWA 3TWXA 3QWVA 4GYWA 2VJ8A 4JXTA 2DVWA 3TWRA 3LJ3A 1UN9A 4G2VA 4I43A 3EU9A 2J08A 2J4BA 3QC1A 4HRLA 4UUCA 4GTQA 1JUQA 3C3RA 3CVQA 2DBAA 4V3IA 4ATGA 1Z3YA 5C1DA 2J07A 2ZGDA 4HOSA 4GA0A 4WNGA 3FUKA 3C3OA 3UT4A 2BKGA 4EECA 5JHBA 1UOHA 3NOGD 3RU0A 3L16A 3AJIA 3FTWA 3JYSA 2VTBB 3FTXA 3S7FA 3PREA 5LOZA 2R17C 4C9BB 3C3QA 4XEIG 1AWCB 1IYGA 1SZAA 3NQPA 2CHXA 2GRNB 3D9MA 2HE0A 3ZRHA 4YNDA 3MKRA 2WB2A 3PUJA 3ABKE 3SFYA 2FULA 3HG0D 4I9EA 3FP3A 3URZA 4U8HA 1MX4A 3DEOA 4L7TA 1H6PA 2IOSA 3E34A 3PZ4A 2CHWA 4CZ2D 4UWKA 2E0IA 1K3ZD 3AS5A 4FULA 1IQRA 4BX8A 3MJWA 2OV8A 1LTXA 2QFCA 3CSFA 3SFXA 1S64A 1QNFA 3TXMA 4LERA 5C2YA 4HXIA 5KBAA 1DCEA 5FQ8A 2H6GA 5BNWA 4NRHB 2V5FA 3EHNA 3B7SA 2WXOA 2RFAA 4WNFA 1U2VG 4U8VD 3QARA 1OCRE 3ZW3A 3FUMA 1MZCA 2C0LA 2ZXWE 2UWJG 4BT8A 3TG4A 3FFLA 3O4ZA 4G8LA 4YVOA 5JHAA 2VSYA 4JEHA 5AQBA 4BESA 4ANUA 4AY6A 1INZA 3HRAA 3LJNA 4U07A 4WWOA 2Y0BG 3IHYA 1E8WA 3UI2A 3JQ1A 2IONA 4L9PA 3U9WA 4AY5A 4B93B 2OCCE 3SI5A 2LXLA 4DPRA 3HXBA 4X8QA 1N52A 3PNLB 3CHPA 4TXRA 3MA5A 2I6HA 3BG0B 4LNGA 3UTMA 1N4RA 1KT0A 3FEXA 3CVXA 3EHQA 1HG2A 1N94A 3JXIA 3DSXA 3SQVA 2CFUA 5FT9A 2IFUA 4RG9A 5KNHD 4MBGA 2DWZA 1MYOA 2PQRA 4FU3A 5FQ7A 4W9RA 2VSOE 3B95A 4GCOA 1A5EA 3D9NA 4EHMA 2WQ6A 4PS8A 1TEZA 3RKVA 2BKKB 4M7CA 4GTSA 3JXJA 4AJWA 4FLBA 4I1MA 3CV0A 3APDA 4FADA 3VLDA 2ETAA 3CVWA 3U64A 3AU5A 3LYAA 2BEDA 4AVXA 4CGWA 2VSNA 3CHRA 3AG4E 2AVPA 3PNTB 5EYLA 3MKQB 2L6JA 2AJAA 4G25A 5AJDA 1KZPA 2GROB 4LG6A 4LCTA 2J8SD 3G2WA 3SO8A 4MKTA 2WXGA 1HU3A 3RSEG 3PZ2A 2KBXA 5EKQD 5LCWC 5DBKA 4BERA 3F6QA 1RW2A 3GZ1A 4DX7D 3QJZA 3CLJA 2Y4UA 1YA0A 1H2TC 5HRYA 3PE3A 4ABNA 1O5MA 4UI9C 3Q73A 1HF8A 3P2BA 4U95D 3UIOC 3ASNE 4NIKA 3OXFA 5KNGA 3HYMB 3T8KA 3RRMB 3JUEA 4U0ZA 3B7TA 2P58C 3UXGA 1Q2ZA 2J9QA 2JLBA 5A23A 2VTBA 3L6AA 4HOTA 2WXFA 3QNKA 3CK9A 2VSXE 4O1OA 4XX5A 4F6RD 4KZCA 2M63A 4CRWA 2J09A 4LNBA 3AS8A 1TR4A 5T8IA 3ULQA 3E37A 4AEZC 4RQIA 5J90A 1D9SA 4EQFA 2EIJE 4NURA 4GAAA 4I1OB 3DSTA 3UQ3A 4CDNA 1U3CA 3AG1E 5FQ4A 1ZU2A 1K8KG 1H2UA 2QYJA 3SNXA 4GCNA 2F0YA 3TWVA 3LXUX 1H6KA 3UM2A 3NF1A 2Y1LE 2WXKA 1OXJA 3UM1A 4GZCA 1WG0A 3RRUA 4GTTA 1UJKA 3HIZA 3FUHA 3L08A 2HR2A 2WXRA 3GZSA 1OWLA 1HX8A 3LS8A 2PZIA 3TAXA 3MGBA 5KCMA 3LVQE 4I2ZA 5FINA 3ZYKA 3PUKA 1XNFA 5EIBE 2A4ZA 3ZPJA 3CVLA 3ML8A 2GRPB 1OWMA 3DPDA 3BG1B 3EIJA 4FHJA 1NA0A 5EN5D 5T4YA 3SY2A 2IO3C 4HOQA 4I6GA 2X3MA 1TNUA 3FHEA 2JEKA 3RIBA 2C2LA 4CGVA 4KMOA 5EIDA 4AOFA 2ETBA 3QAQA 2J49A 5KJLA 2BUGA 4PS7A 5M72A 3ULEG 1HFAA 4C0EA 2LAHA 4XI9A 4UQYA 3FWVA 1WY6A 2IU1A 4A3TA 3D3MA 4N3CA 4GA1A 4ILIA 4KYOB 2WXNA 4BSXA 3DSVA 3SGHA 3JCKC 4Z68A 5CRVA 3CQCB 4YVQC 3NBNB 3U3WA 4J8FA 5ENTD 1HO8A 2LUHA 3TXNA 3FTSA 5D0OD 2QC9A 2MRIA 3L17A 1S63A 3V30A 3IKOB 5AN8A 5BV1A 3LEWA 2L0IA 3ZHEA 3KD7A 3MCXA 4M3OA 3MKQA 3EIQC 3APFA 4HS2A 5FJYA 1UG3A 4KXKB 1NZNA 4RG6A 1TNYA 3JUIA 3G2TA 3ASOE 1TN8A 2XGMA 3PDNA 4XIFA 5EILA 3SZ7A 3ESKA 5EX3A 1UN8A 1NA3A 4ACKA 2ZGGA 2H6IA 3CGHA 3LY9A 3J5PA 2X6JA 2YNQA 3ZXPA 4BTAA 4JL0A 4DUIA 3ZNGA 3KEAA 5ENNA 2QZAA 2FF4A 3OXLA 3FU3A 3X2QE 1FVHA 4GMRA 4U63A 5G05J 1G3NB 2GRQB 4I6JA 3ISMC 3MYVA 1LF8A 4RSYA 2XS8A 1A17A 4OYSA 5DIZA 4ANWA 3FU6A 5EYPF 2RFMA 3TWQA 4GTOA 3Q79A 1SA5A 4G26A 4TRQA 3ML9A 4XZ4A 4Y6CA 4PH4B 4KVMA 3Q75A 1GW6A 3G2UA 2IOLA 3Q4AB 3EUVA 1FT1A 4TXPA 1IHBA 5G04C 4L2LA 1FT2A 3Q78A 2IF4A 5D2MC 4DX1A 3RO2A 2XPYA 2HYZA 3Q49B 1OCCE 3PZ1A 3RAUA 4G8KA 1DNPA 4CYMD 3C72A 1LD7A 4U0SA 1HG5A 2X6IA 2EIKE 2KCLA 2VYIA 4BEPA 4GZ6A 3NOCD 3S7JA 2P9PG 2X6FA 4L2YA 3CVUA 4I2WA 2KZTA 3PZ3A 2ONDA 4EZJA 3DWLG 2EINE 5BXOA 5BPPA 1ELWA 5FIOA 5CCLA 1E7VA 2YHCA 4J8YA 2XCBA 1IKND 3ZYMA 4Q69A 1JCQA 5KJNA 1WDYA 1JCRA 1JPLA 5D66A 2WXLA 3LY7A 2VGEA 2XGSA 3E33A 4DLOA 4DK5A 4PUCA 3ABME 3HDXA 1HXIA 1SVXA 4IULA 4ANXA 3ZU7B 4BFRA 3FU5A 5CBNA 5LP0A 4HLLA 4DLQA 4J0UA 5LCWJ 3OXGA 4EBAA 1MX6A 4LUNU 3CEQA 5JMND 2YHEA 4ANVA 4GTPA 2I1JA 1KPSB 4BSZB 4N3AA 4EBAG 4UI9J 2P9UG 3EHRA 3VLEA 2R59A 3FUFA 2CFZA 1NL4A 4HNAD 3R7RA 3BQOA 3Q9UC 4XKCA 2R03A 2V0PA 3AS4A 2DZOA 2XEHA 3D9OA 3LCAA 5HI7A 3PVLA 3J5QB 3UX4A 1D8EA 2L0TB 1N4QA 2KM4A 3AU4A 4LNUD 3FUJA 3FTYA 5KWDA 4FC8A 2V8SE 3G2VA 2V5QC 3ZEFA 2L9BA 5CBOA 2R02A 3LPZA 3TL5A 1TJCA 4URKA 2LAIA 3TWTA 4APFA 2OOEA 4WNDA 4JA9A 4JHJA 4TUUA 4H7YA 2ETCA 4NQ0A 4EPZA 3D9PA 4HI9A 4F53A 3VTXA 3ZHEB 4CCAA 4J8SA 1DC2A 3EU5A 4A1SA 4K03A 4P29A 5ARGA 5B1BE 4GMJA 2FBNA 4GPKA 2WQHA 2MOWA 4U0UA 4PS3A 3PS6A 1TN7A 1H0AA 3UT7A 3I4GA 3D9KA 2DYSE 2J4DA 4JHRA 5HQ8A 4JW1A 4F1SA 1RZ4A 4A63B 2F8XK 1EF1C 1Y8MA
chains in the Genus database with same CATH topology
5KJKA 1XNFA 2J08A 2J4BA 3MEKA 2A4ZA 3ZPJA 3L22A 2V4LA 3FUDA 3QC1A 3CVLA 5G05C 3ML8A 1OWNA 1UW4B 5FTPA 1OWMA 5G2NA 3TG5A 3PE4A 3DPDA 3BG1B 1JUQA 4JVSA 2XCCA 4GU5A 3EIJA 4FHJA 1N54A 2AW6A 3CK7A 1ELRA 1ELKA 4UI9K 1NA0A 3CVQA 5BT1A 2DBAA 4V3IA 2HM8A 4LEUA 1Z3YA 5T4YA 2J07A 4ATGA 5C1DA 1QZ2A 2BTDA 5J08A 4FJZA 4HOSA 3FH5A 4GA0A 5AENA 4HOQA 4WNEA 4WNGA 3FUKA 3ASGA 3UPVA 4I6GA 5CMWA 2X3MA 3UT4A 3ASHA 4EECA 1FVFA 3FHEA 2JEKA 3RIBA 5JHBA 2C2LA 4CGVA 3FTVA 4KMOA 3EHMA 3R7QA 2R5SA 2XRYA 4B8CB 2XPZA 3RU0A 4AOFA 2DIWA 3ASDA 3I4RB 3E4BA 3GW4A 3L16A 2J49A 3FTWA 3JYSA 3QAQA 2BUGA 3FTXA 4N3BA 4QFVA 3S7FA 5KJLA 2VTBB 3PREA 4BX9A 4HORA 4UWGA 3KAEA 4PS7A 5JJTA 5LOZA 1HZ4A 2R17C 5M72A 2X6HA 1PY1A 4J8DA 4G24A 3FUIA 4WUYA 4C9BB 1HFAA 4WWPA 4C0EA 4FJYA 4R7LA 2I9CA 2LAHA 2PQNA 3CHSA 1SZAA 4XI9A 5FZSA 1IYGA 4UQYA 3FWVA 3NQPA 2CHXA 4E85A 5D0QD 1WY6A 2IU1A 3D9MA 3S7BA 3ZRHA 1ZBPA 4G23A 4A3TA 4E6HA 4YNDA 1OWPA 3MKRA 3D3MA 3ZYQA 2WB2A 3PUJA 4N3CA 2OVFA 4GA1A 4ILIA 3CVPA 5ARFA 4KYOB 4IYPA 2WXNA 4BSXA 3UMVA 2FULA 4G11A 1L5JA 4APOA 4I9EA 3SGHA 3JCKC 3FP3A 4JEUA 3SFZA 3LVRE 2YINA 4U8HA 3URZA 3ZXSA 3CHQA 3CQCB 2BF0X 5CCMA 4L7TA 5FWQA 5EDSA 3JQ0A 2IOSA 4N2SA 4YVQC 5FZQA 4MS6A 4UWLA 2GGFA 2CHWA 3U3WA 4FHKA 1Z6TA 1X5BA 4J8FA 1E90A 1HO8A 2XGOA 2E0IA 4UWKA 2UY1A 3AS5A 4TV3A 4UWHA 3ZFWA 4FULA 3TXNA 3T5VA 1IQRA 4BX8A 3MJWA 3FTSA 5D0OD 4RVBA 2MRIA 3L17A 2OV8A 4DJAA 4IN3B 1EDUA 2KZTB 2QFCA 3CSFA 3OAWA 3IKOB 1QNFA 3SD5A 3TXMA 4BT9A 4LERA 4XE0A 3I5PA 5C2YA 4HXIA 3RO3A 4B0ZA 5BV1A 3K9IA 2VGYA 3LEWA 3B7RL 3S2AA 2L0IA 3ZHEA 4EZLA 3KD7A 4N2QA 3MCXA 4M3OA 1VDYA 2X6KA 3MKQA 3HVEB 1IQUA 3EIQC 3L13A 3APFA 4HS2A 5FQ8A 4AV7A 5FJYA 1UG3A 4KXKB 5AIJA 5BNWA 1NZNA 3CR3A 4NRHB 5KJMA 4Q96A 4RG6A 2V5FA 3EHNA 3JUIA 3IV0A 3B7UX 3B7SA 2WXOA 3G2TA 3QK0A 4EZKA 4L23A 1EPUA 3I3NA 4CEMA 4WNFA 1HH8A 2XGMA 3PDNA 4XIFA 3SZ7A 3QARA 3FULA 3ESKA 5EX3A 1EYHA 4BY6A 5T3RA 1UN8A 1Z3XA 4ACLA 3FUMA 3ZW3A 2C0LA 1NA3A 4ACKA 3PRZA 4MRUA 2UWJG 4BT8A 4XKBA 3FFLA 3TG4A 3CGHA 3LY9A 3O4ZA 1XGWA 2X6JA 4ILGA 3EDTB 2YNQA 3WXXA 4YVOA 2GW1A 5JHAA 4L1BA 4BTAA 3CVVA 2KATA 4CT4A 4JL0A 1JWFA 2VSYA 2CG3A 5ENNA 1W3BA 2FF4A 4JEHA 4I1AA 3G2SA 3OXLA 4C0MA 2C0MA 4ANUA 4AY6A 1INZA 4ME2A 3FU3A 2XEVA 1FVHA 4U63A 3APCA 3RK6A 4U07A 5G05J 2QY7A 5FZRA 4WWOA 4I6JA 3IHYA 4GYYA 4I9CA 3D9JA 3QDNA 4B89A 4BTBA 1E8WA 1P5QA 2Y3AA 3EJNA 4WAFA 3MYVA 1LF8A 4RSYA 4B94A 2GRLA 3JQ1A 2IONA 2XQ0A 3U9WA 4AY5A 1A17A 4OYSA 1TJFA 4HLEA 5DIZA 3ZYLA 4DI3A 3SI5A 3FU6A 4ANWA 4A1GA 1B89A 2WXMA 3DBSA 4DPRA 4GMLA 4N5CA 5ANLA 2I1KA 4J8EA 3D9IA 2FI7A 3QWWA 5A6CA 1N52A 3IEGA 3N71A 1MHQA 4LRZA 3MX3A 3PNLB 4G26A 2WMNA 3CHPA 4TRQA 3ML9A 4XZ4A 4Y6CA 3MA5A 4PH4B 4KVMA 1GW6A 4N39A 2I6HA 3G2UA 2IOLA 4U04A 2HO1A 3ZVVA 3Q4AB 3B13A 4OVVA 3BG0B 1E96B 2XHEA 2X38A 4HFGA 2PL2A 5G04C 1DVPA 3QB2A 2WM9A 1KT0A 2IJGX 4I6EA 3FEXA 4L2LA 2VGXB 2WXJA 4XI0A 5CHEE 3SBSA 2IF4A 3CVXA 3RO2A 1HG2A 2HYZA 2RD0A 2XPYA 3Q49B 2WMOA 2CFUA 5FT9A 2IFUA 2WXIA 4RG9A 2PQRA 5FQ6A 4FU3A 4JHKA 1DNPA 5FQ7A 3CKCA 4W9RA 2VSOE 4GCOA 2ZU6B 3D9NA 3LY8A 2WQ6A 4U0SA 4PS8A 4NACA 4AM9A 1HG5A 1TEZA 1IHGA 3RKVA 3OTNA 2X6IA 3Q47B 4I17A 2FO7A 2KCLA 2VYIA 3CVNA 4AJWA 4FLBA 4I1MA 3CV0A 3D9LA 3APDA 4MLPA 4JA7A 4O6FA 3UT8A 4GZ6A 5AYWD 1PC2A 1KLXA 2CG2A 3S7JA 4FADA 3VLDA 3CVWA 3U64A 3AU5A 3L54A 2LO6A 3LYAA 2X6FA 4AVXA 3FUEA 3CHOA 4CGWA 2VSNA 3QWPA 3FUNA 4L2YA 3RRNB 3CHRA 3CKBA 3CVUA 4I2WA 2KZTA 4ILHB 2ONDA 4EZJA 3SF4A 4F7AA 4KVOA 2AVPA 3PNTB 4GZDA 3CVYA 5BW8C 3MKQB 2WPVA 2L6JA 2VQ2A 3U4TA 4G25A 5AJDA 4IRUA 5BV0A 3C98A 5AJLA 1E8YA 3LKUA 5BPPA 3ESLA 4F3VA 1ELWA 5CCLA 1E7VA 4KZ0A 3NZSA 4LCTA 2YHCA 2WVIA 2LSVA 2WXHA 3G2WA 4G1TA 2XCBA 2NC9A 1OUVA 4MKTA 3ZIMA 5EX0A 3FY4A 4GZ5A 1H19A 4PDXA 2WXGA 5E75A 3ZYMA 4CDRA 4Y6WA 4Q69A 3TGOA 5KJNA 3UUXA 2RG8A 5E76A 1HU3A 1UJJA 3CSTA 1JPLA 4JZYA 2WXLA 3LY7A 2WQ7A 3VLFA 5EKQD 3LDZA 2XGSA 3ENEA 5LCWC 2KC7A 3FH8A 2ILRA 5DBKA 4DLOA 2PM7A 3FTZA 4PUCA 3PEVB 4DK5A 3GZ1A 3HDXA 5JJ7A 5BUZA 3FTUA 1HXIA 3QJZA 2NSZA 3CLJA 4IULA 2Y4UA 1YA0A 1H2TC 4AXHA 3SHFA 4FP7A 3O48A 4ANXA 4BFRA 3PE3A 1HE8A 3FU5A 4J6IA 3VTYA 1PAQA 4UWFA 4CT0A 4AIFA 5LP0A 4GZ3A 2A5UA 4DLQA 4ABNA 4D10C 4J0UA 3IHVA 4UI9C 1HF8A 3OXGA 3P2BA 5LCWJ 4DI4A 1E8XA 3OXFA 3CIAA 4KBQA 4EBAA 3FU0A 3HYMB 1S0PA 1MQSA 4H7XA 4LUNU 3CEQA 1BPOA 3RRMB 2LSUA 4U0ZA 3B7TA 2YHEA 2P58C 3FEYA 3PZDA 4Q94A 4ANVA 2OVBA 2I2OA 2I1JA 3HHMA 4A55A 1SQMA 4B8AA 1WAO1 2J9QA 2JLBA 5A23A 3RJVA 2VTBA 3L6AA 2DCPA 3QKYA 3QOUA 4N3AA 1U3DA 4EBAG 3U66A 2WXFA 4HOTA 1OWOA 3QNKA 4UI9J 1KT1A 3CK9A 2VSXE 3VLEA 4GA2A 2R59A 3PEUB 4XX5A 3FUFA 2CFZA 2M63A 4KZCA 2J09A 2NXPA 4OVUA 4CRWA 3R7RA 1E8ZA 1WM5A 3TJPA 3AS8A 3CQGB 5T8IA 3ULQA 2MHKA 4XKCA 3R9AB 2V0PA 3AS4A 3FDHA 4FLHA 4AEZC 3D9OA 2AXVA 3LCAA 5J90A 3ZN3A 4EQFA 4CDMA 4HOUA 2WXPA 4GB9A 4UQXA 5HI7A 3S7DA 3PVLA 4AP2A 4GYOA 4NURA 3UX4A 3Q5MA 2VGXA 3KS2A 2LNIA 3MV3B 2L0TB 1QQEA 5LX8A 5JJ6A 3SBTB 2KM4A 3AU4A 4GAAA 3FUJA 2Q7FA 4I1OB 3FTYA 4FC8A 2V8SE 4K0RA 3G2VA 5LFAA 3CHMA 5G04J 2L9BA 3ASFA 3UQ3A 3ZEFA 4KT6B 4CDNA 3LPZA 1Y6IA 3GZ2A 3NZUA 3TL5A 1TJCA 1U3CA 5FQ4A 2AXZA 4URKA 2LAIA 2UY1B 1ZU2A 4APFA 2OOEA 3P1UA 4FA6A 3FH7A 4JA9A 4JHJA 4TUUA 4H7YA 1H2UA 4WNDA 3PH0C 1NP7A 3T8MA 2CHZA 3GYZA 4WWNA 3MZLB 1JWGA 3KEZA 3SNXA 3MV2B 4JC8A 4GCNA 4UQZA 5G55A 3T5XA 4BWRA 3LXUX 5CMYA 4NQ0A 1H6KA 4EPZA 3D9PA 4F53A 2GRMA 3NF1A 3VTXA 3ZHEB 4HVBA 3IBEA 2E2EA 4CCAA 4J8SA 2YQ8A 1FCHA 2WXKA 2IQCA 3Q15A 4GZCA 5ANRA 4JPSA 4A1SA 5A7DB 3RRUA 2PM6A 4K03A 4P29A 5ARGA 3HVEA 4GMJA 2FBNA 4GPKA 1UJKA 3HIZA 2KCKA 2WQHA 2MOWA 4U0UA 3FUHA 2AXUA 3L08A 4PS3A 3ZGQA 3PS6A 4A3VA 2HR2A 1SZ9A 1H0AA 2WXRA 3ONKA 3BEEA 3GZSA 2EQXA 3I4GA 1E7UA 2XPIA 3UT7A 2AWIA 1OWLA 2FEZA 3QWVA 3D9KA 1HX8A 2J4DA 4JHRA 4GYWA 4JW1A 3ONLA 5HQ8A 3LS8A 4F1SA 2XRZA 2VJ8A 2PZIA 2Y4TA 1HS6A 1H2VC 4JXTA 3TAXA 3MGBA 5KCMA 1EF1C 2KCVA 2WXQA 1Y8MA 3CK8A 3LVQE 3LJ3A 1UN9A 4G2VA 4I2ZA 3ZYKA 4I43A 3PUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJK A;  1XNF A;  3MEK A;  3ZPJ A;  3CVL A;  5G05 C;  5FTP A;  3TG5 A;  3PE4 A;  2XCC A;  3CK7 A;  1ELR A;  4UI9 K;  1NA0 A;  3CVQ A;  5BT1 A;  2DBA A;  4LEU A;  5C1D A;  1QZ2 A;  4HOS A;  4GA0 A;  4HOQ A;  4WNE A;  4WNG A;  3ASG A;  3UPV A;  3ASH A;  3RIB A;  2C2L A;  4CGV A;  2R5S A;  3RU0 A;  3ASD A;  3E4B A;  3GW4 A;  3JYS A;  5KJL A;  2BUG A;  4N3B A;  3S7F A;  4HOR A;  3KAE A;  5JJT A;  5M72 A;  1HZ4 A;  4J8D A;  4G24 A;  4WUY A;  1IYG A;  5FZS A;  2PQN A;  4XI9 A;  4UQY A;  3FWV A;  5D0Q D;  3S7B A;  1ZBP A;  4G23 A;  4YND A;  3MKR A;  4N3C A;  4GA1 A;  5ARF A;  3CVP A;  4KYO B;  4APO A;  4I9E A;  3FP3 A;  3URZ A;  5CCM A;  4N2S A;  4YVQ C;  5FZQ A;  3U3W A;  4J8F A;  2XGO A;  3ZFW A;  2UY1 A;  3AS5 A;  5D0O D;  4IN3 B;  2QFC A;  4BT9 A;  3RO3 A;  3K9I A;  2VGY A;  3ZHE A;  3KD7 A;  4N2Q A;  5FJY A;  4KXK B;  5BNW A;  1NZN A;  4NRH B;  5KJM A;  4RG6 A;  2V5F A;  4WNF A;  1HH8 A;  2XGM A;  3PDN A;  4XIF A;  3SZ7 A;  3ESK A;  5EX3 A;  2C0L A;  1NA3 A;  2UWJ G;  4BT8 A;  3TG4 A;  3FFL A;  3LY9 A;  3WXX A;  3EDT B;  4YVO A;  2GW1 A;  4BTA A;  2KAT A;  4JL0 A;  2VSY A;  1W3B A;  2FF4 A;  4I1A A;  3OXL A;  2C0M A;  4AY6 A;  4ME2 A;  2XEV A;  4U07 A;  5G05 J;  5FZR A;  4I9C A;  4GYY A;  3QDN A;  4BTB A;  1P5Q A;  4B94 A;  4AY5 A;  1A17 A;  5DIZ A;  1B89 A;  4N5C A;  4J8E A;  5A6C A;  2FI7 A;  3QWW A;  3IEG A;  3N71 A;  4G26 A;  4Y6C A;  3MA5 A;  4N39 A;  2I6H A;  4U04 A;  2HO1 A;  3Q4A B;  1E96 B;  2PL2 A;  5G04 C;  4XI0 A;  1KT0 A;  5CHE E;  2VGX B;  2IF4 A;  3RO2 A;  2HYZ A;  3Q49 B;  5FT9 A;  2IFU A;  4RG9 A;  2PQR A;  3CKC A;  4W9R A;  4GCO A;  3LY8 A;  4U0S A;  4AM9 A;  1IHG A;  3RKV A;  3Q47 B;  4I17 A;  2FO7 A;  2KCL A;  2VYI A;  3CVN A;  3CV0 A;  4JA7 A;  4O6F A;  4GZ6 A;  5AYW D;  1KLX A;  1PC2 A;  3S7J A;  3LYA A;  4CGW A;  2VSN A;  3QWP A;  3CKB A;  4I2W A;  2OND A;  3SF4 A;  2AVP A;  5BW8 C;  2WPV A;  2L6J A;  2VQ2 A;  3U4T A;  4G25 A;  3LKU A;  4F3V A;  1ELW A;  5CCL A;  2YHC A;  2LSV A;  4G1T A;  2XCB A;  2NC9 A;  1OUV A;  5EX0 A;  4GZ5 A;  4CDR A;  4Y6W A;  3TGO A;  5KJN A;  3UUX A;  3LY7 A;  5EKQ D;  2XGS A;  5LCW C;  2KC7 A;  5DBK A;  3GZ1 A;  5JJ7 A;  1HXI A;  2Y4U A;  1YA0 A;  3O48 A;  3PE3 A;  3VTY A;  4AIF A;  4GZ3 A;  4ABN A;  4J0U A;  4UI9 C;  5LCW J;  3OXG A;  3OXF A;  4KBQ A;  3HYM B;  4H7X A;  3CEQ A;  2LSU A;  4U0Z A;  2P58 C;  1WAO 1;  2J9Q A;  2JLB A;  3RJV A;  3QKY A;  3QOU A;  4N3A A;  4HOT A;  4UI9 J;  1KT1 A;  3CK9 A;  4GA2 A;  1WM5 A;  3AS8 A;  3ULQ A;  2MHK A;  3R9A B;  3AS4 A;  3LCA A;  3ZN3 A;  4EQF A;  4HOU A;  5HI7 A;  4UQX A;  3S7D A;  4GYO A;  3Q5M A;  2VGX A;  3KS2 A;  2LNI A;  3MV3 B;  1QQE A;  5JJ6 A;  2Q7F A;  5G04 J;  3ASF A;  3UQ3 A;  3LPZ A;  3GZ2 A;  1TJC A;  2UY1 B;  1ZU2 A;  2OOE A;  4WND A;  4JA9 A;  4H7Y A;  3GYZ A;  3MV2 B;  4UQZ A;  4GCN A;  4BWR A;  4NQ0 A;  3NF1 A;  3VTX A;  3ZHE B;  2E2E A;  2YQ8 A;  1FCH A;  3Q15 A;  4A1S A;  5A7D B;  5ARG A;  2FBN A;  4GPK A;  2KCK A;  2WQH A;  4U0U A;  3ZGQ A;  2HR2 A;  3BEE A;  2XPI A;  2FEZ A;  3QWV A;  4JHR A;  5HQ8 A;  4GYW A;  2PZI A;  2Y4T A;  3TAX A;  2KCV A;  3CK8 A;  1Y8M A;  4I2Z A;  4G2V A; 
#chains in the Genus database with same CATH topology
 5KJK A;  3FUD A;  1OWN A;  3DXK G;  3DSS A;  5G2N A;  2FO1 E;  1O1S A;  2AW6 A;  4GTM A;  3CK7 A;  1ELR A;  2H6H A;  2HM8 A;  1QZ2 A;  5J08 A;  3FH5 A;  1AP7 A;  1OCO E;  4WNE A;  3UPV A;  3Q7F A;  1FVF A;  4JD2 G;  3FTV A;  3EHM A;  3R7Q A;  2XRY A;  4GTV A;  3ASD A;  3I4R B;  3E4B A;  3GW4 A;  4QFV A;  4N3B A;  4HOR A;  4UWG A;  3KAE A;  5JJT A;  2X6H A;  4J8D A;  4G24 A;  4WWP A;  3C5R A;  4R7L A;  2I9C A;  2PQN A;  3CHS A;  4E85 A;  2ZIR A;  5D0Q D;  5AQA A;  1BI7 B;  3S7B A;  1TNB A;  1ZBP A;  4G23 A;  3R9M A;  4TXQ A;  3UMV A;  4G11 A;  3SFZ A;  4JEU A;  2YIN A;  3ZXS A;  5ENR D;  3CHQ A;  2BF0 X;  5CCM A;  2P9I G;  4JB8 P;  5FWQ A;  3JQ0 A;  5FZQ A;  4MS6 A;  4UWL A;  1Z6T A;  3UM3 A;  2XGO A;  3ZFW A;  3ABL E;  4TV3 A;  2OEV A;  4UWH A;  3T5V A;  2MYO A;  4DJA A;  1EDU A;  2KZT B;  4BT9 A;  4B0Z A;  3RO3 A;  3S2A A;  4U7E B;  4O1P A;  3B7R L;  2X6K A;  3HVE B;  1IQU A;  3DSW A;  4AV7 A;  3CR3 A;  4DRX E;  1K1B A;  2R2L A;  3B7U X;  1N11 A;  4EZK A;  1EPU A;  3I3N A;  4CEM A;  4ZHB A;  1N0R A;  3FUL A;  4BY6 A;  4HRN A;  4ACL A;  3PRZ A;  4MRU A;  2XZT G;  3IXE A;  1XGW A;  4ILG A;  3EDT B;  3UKU G;  4L1B A;  1NI1 A;  2KAT A;  4CT4 A;  1JWF A;  1N95 A;  2CG3 A;  1TNZ A;  4C0M A;  2C0M A;  2XEV A;  3HXD A;  4U8Y D;  1OY3 D;  2QY7 A;  3D9J A;  3QDN A;  5B3S E;  1MX2 A;  2Y3A A;  4WAF A;  4B94 A;  4YDE A;  2DYR E;  3BUA A;  3BU8 A;  1TJF A;  5HKP A;  3ZYL A;  4A1G A;  5A6C A;  3N71 A;  1NFI E;  4LRZ A;  3MX3 A;  2L6B A;  4OAU C;  4N39 A;  4U04 A;  3ZVV A;  1E96 B;  2XHE A;  2Y69 E;  1DVP A;  2WM9 A;  4XI0 A;  2IJG X;  5CHE E;  2WMO A;  2WXI A;  5FQ6 A;  4JHK A;  4K5B A;  4NAC A;  5H7P A;  3Q47 B;  2FO7 A;  3V79 K;  4MLP A;  2B0O E;  3UT8 A;  5AYW D;  1ZB1 A;  4DX5 D;  1PC2 A;  2CG2 A;  3E32 A;  5CEA A;  2LO6 A;  3FUE A;  3CHO A;  3FUN A;  1JCS A;  3SF4 A;  4F7A A;  4KVO A;  4GZD A;  1YMP A;  3CVY A;  2WPV A;  2VQ2 A;  5AJL A;  3LKU A;  3KSQ A;  3ESL A;  1QYM A;  2WVI A;  2WXH A;  4G1T A;  3ZIM A;  2NC9 A;  1OUV A;  1BI8 B;  5EX0 A;  4GZ5 A;  1H19 A;  4PDX A;  4CDR A;  4Y6W A;  3TGO A;  5ENQ D;  3B7B A;  1UJJ A;  3L9T A;  2WQ7 A;  3VLF A;  2JAB A;  2KC7 A;  3FH8 A;  3PEV B;  4K5C A;  5BUZ A;  3FTU A;  2NSZ A;  4AXH A;  3SHF A;  3O48 A;  1QBQ A;  1HE8 A;  1PAQ A;  4UWF A;  4CT0 A;  4AIF A;  3HXC A;  1E8X A;  3FU0 A;  4H7X A;  2A5E A;  1BPO A;  4Q94 A;  3FEY A;  4C48 B;  2I2O A;  3HHM A;  2XS1 A;  1WAO 1;  1S70 B;  3L82 A;  5ENO D;  3RJV A;  2DCP A;  3QOU A;  3DRA A;  1U3D A;  2OEW A;  3U66 A;  1OWO A;  5CER B;  3PEU B;  2XEE A;  4OVU A;  2NXP A;  4HQD A;  3TJP A;  2MHK A;  3E30 A;  4FLH A;  3UM0 A;  1K1A A;  2AXV A;  1FPP A;  3ZN3 A;  4HOU A;  4GB9 A;  3S7D A;  3Q5M A;  2VGX A;  2LNI A;  1QQE A;  3SBT B;  2PNN A;  3V2O A;  2Q7F A;  3TWW A;  3ASF A;  4KT6 B;  1Y6I A;  3GZ2 A;  1OCZ E;  3DSU A;  2AXZ A;  1N9A A;  3PH0 C;  1N4S A;  4WWN A;  3MZL B;  4UQZ A;  3T5X A;  4BWR A;  2B6C A;  2GRM A;  5IY5 E;  1D8D A;  2YQ8 A;  1FCH A;  2LXM A;  2IQC A;  4JPS A;  1KZO A;  3HVE A;  1N0Q A;  4BET A;  4U96 D;  3ZGQ A;  4A3V A;  3V2X A;  3ONK A;  3NB2 A;  2EQX A;  2XPI A;  2AWI A;  1V54 E;  2FEZ A;  2XRZ A;  3ONL A;  2Y4T A;  1HS6 A;  1H2V C;  2WXQ A;  2KCV A;  3CK8 A;  5G55 A;  2IY0 C;  3Q9N C;  3MEK A;  5ENS D;  3L22 A;  2V4L A;  5G05 C;  1UW4 B;  5FTP A;  3TG5 A;  4YDY A;  3PE4 A;  4JVS A;  2XCC A;  4GU5 A;  4RLY A;  1N54 A;  1ELK A;  4UI9 K;  5BT1 A;  4LEU A;  2BTD A;  5CRU A;  4FJZ A;  5AAO A;  1DCQ A;  5AEN A;  5ITZ F;  3ASG A;  5CMW A;  3ASH A;  5AQ7 A;  2V4H C;  2R5S A;  4B8C B;  2XPZ A;  5AAR A;  2DIW A;  4F1P A;  1TNO A;  4BX9 A;  4J7W A;  1HZ4 A;  1PY1 A;  3FUI A;  4WUY A;  4FJY A;  4GTR A;  5HS0 A;  5FZS A;  4E6H A;  1OWP A;  3ZYQ A;  2EIM E;  2OVF A;  5B1A E;  5ARF A;  3CVP A;  4IYP A;  1L5J A;  4APO A;  4ATZ D;  3LVR E;  4O60 A;  3HXE A;  5EDS A;  4N2S A;  1IXV A;  1LD8 A;  2GGF A;  4FHK A;  1X5B A;  1E90 A;  2UY1 A;  3UKR G;  1BLX B;  4RVB A;  3KSL A;  4IN3 B;  3OAW A;  1O1R A;  3SD5 A;  4XE0 A;  3I5P A;  3K9I A;  2VGY A;  2P9S G;  4EZL A;  4N2Q A;  1VDY A;  3L13 A;  4HBD A;  4HI8 A;  5AIJ A;  3HXF A;  5KJM A;  4Q96 A;  3IV0 A;  3QK0 A;  4L23 A;  1HH8 A;  2R05 A;  1EYH A;  5T3R A;  1Z3X A;  3T9K A;  3DPY A;  1OT8 A;  4XKB A;  4GPM A;  3WXX A;  3CVV A;  2GW1 A;  1W3B A;  2P2C P;  1H6O A;  4I1A A;  3G2S A;  4ME2 A;  3APC A;  3RK6 A;  5FZR A;  4I9C A;  4GYY A;  4B89 A;  4BTB A;  1P5Q A;  4HB5 A;  5BXU A;  3EJN A;  2GRL A;  3WG7 E;  2XQ0 A;  4HLE A;  2IO2 C;  1YYH A;  4K5A B;  4DI3 A;  1B89 A;  2WXM A;  3DBS A;  4GML A;  4N5C A;  5ANL A;  2I1K A;  4J8E A;  3D9I A;  2FI7 A;  3QWW A;  3IEG A;  1MHQ A;  2WMN A;  3ULY A;  2HO1 A;  3B13 A;  4OVV A;  2X38 A;  4HFG A;  2PL2 A;  3QB2 A;  4I6E A;  3SBS A;  2VGX B;  2WXJ A;  2RD0 A;  3UIP C;  4LSZ E;  3CKC A;  2ZU6 B;  3LY8 A;  4AM9 A;  1IHG A;  3OTN A;  5ENP D;  4I17 A;  2XZD G;  3CVN A;  1O1T A;  3D9L A;  4JA7 A;  4O6F A;  3AG2 E;  2QYU A;  1KLX A;  1X81 A;  3W9F A;  3L54 A;  4DX6 D;  3QWP A;  3RRN B;  3CKB A;  1TN6 A;  4ILH B;  4QQI A;  1YCS B;  3NAW A;  5BW8 C;  4YDO A;  2P9L G;  3U4T A;  2RKK A;  3ZKJ A;  3DXM G;  4IRU A;  5BV0 A;  3C98 A;  1E8Y A;  4DX2 A;  4F3V A;  4KZ0 A;  4N5Q A;  3NZS A;  5JA4 D;  2LSV A;  3FY4 A;  5E75 A;  2NYJ A;  5CEC B;  3UUX A;  2RG8 A;  5E76 A;  4JZY A;  3CST A;  2P9K G;  1Z5S C;  3LDZ A;  3ENE A;  2ILR A;  2PM7 A;  3FTZ A;  4TUM A;  5JJ7 A;  2H6F A;  4FP7 A;  1SW6 A;  4J6I A;  3VTY A;  4ZFH A;  3D9H A;  4GZ3 A;  2A5U A;  4D10 C;  3IHV A;  4DI4 A;  3CIA A;  4KBQ A;  1S0P A;  1MQS A;  2GRR B;  3AG3 E;  2LSU A;  5AQ9 A;  1MJ0 A;  1BD8 A;  3PZD A;  2OVB A;  2ZIS A;  4A55 A;  1SQM A;  4B8A A;  3QKY A;  1N4P A;  1KT1 A;  3AAA C;  4GA2 A;  4HRM B;  1BU9 A;  3ZUV B;  1E8Z A;  1WM5 A;  3CQG B;  3R9A B;  3FDH A;  3W9G A;  4CDM A;  2WXP A;  4UQX A;  4AP2 A;  4GYO A;  3KS2 A;  3TWS A;  3MV3 B;  5LX8 A;  5JJ6 A;  4K0R A;  5LFA A;  3CHM A;  2P9N G;  5G04 J;  3NZU A;  2EIL E;  2UY1 B;  3P1U A;  4FA6 A;  3FH7 A;  1TYQ G;  1NP7 A;  3T8M A;  1V55 E;  2CHZ A;  3GYZ A;  1JWG A;  3KEZ A;  3MV2 B;  4JC8 A;  5CED B;  4OAV B;  3V31 A;  5CMY A;  2F8Y A;  3Q7A A;  4HVB A;  3IBE A;  2E2E A;  3Q15 A;  2XEN A;  5ANR A;  3DEP A;  5A7D B;  2PM6 A;  3UIN C;  2DZN A;  3TWU A;  2KCK A;  1SA4 A;  2AXU A;  1SZ9 A;  2F37 A;  2KXP C;  3BEE A;  2IEJ A;  1E7U A;  4YDW A;  3TWX A;  3QWV A;  4GYW A;  2VJ8 A;  4JXT A;  2DVW A;  3TWR A;  3LJ3 A;  1UN9 A;  4G2V A;  4I43 A;  3EU9 A;  2J08 A;  2J4B A;  3QC1 A;  4HRL A;  4UUC A;  4GTQ A;  1JUQ A;  3C3R A;  3CVQ A;  2DBA A;  4V3I A;  4ATG A;  1Z3Y A;  5C1D A;  2J07 A;  2ZGD A;  4HOS A;  4GA0 A;  4WNG A;  3FUK A;  3C3O A;  3UT4 A;  2BKG A;  4EEC A;  5JHB A;  1UOH A;  3NOG D;  3RU0 A;  3L16 A;  3AJI A;  3FTW A;  3JYS A;  2VTB B;  3FTX A;  3S7F A;  3PRE A;  5LOZ A;  2R17 C;  4C9B B;  3C3Q A;  4XEI G;  1AWC B;  1IYG A;  1SZA A;  3NQP A;  2CHX A;  2GRN B;  3D9M A;  2HE0 A;  3ZRH A;  4YND A;  3MKR A;  2WB2 A;  3PUJ A;  3ABK E;  3SFY A;  2FUL A;  3HG0 D;  4I9E A;  3FP3 A;  3URZ A;  4U8H A;  1MX4 A;  3DEO A;  4L7T A;  1H6P A;  2IOS A;  3E34 A;  3PZ4 A;  2CHW A;  4CZ2 D;  4UWK A;  2E0I A;  1K3Z D;  3AS5 A;  4FUL A;  1IQR A;  4BX8 A;  3MJW A;  2OV8 A;  1LTX A;  2QFC A;  3CSF A;  3SFX A;  1S64 A;  1QNF A;  3TXM A;  4LER A;  5C2Y A;  4HXI A;  5KBA A;  1DCE A;  5FQ8 A;  2H6G A;  5BNW A;  4NRH B;  2V5F A;  3EHN A;  3B7S A;  2WXO A;  2RFA A;  4WNF A;  1U2V G;  4U8V D;  3QAR A;  1OCR E;  3ZW3 A;  3FUM A;  1MZC A;  2C0L A;  2ZXW E;  2UWJ G;  4BT8 A;  3TG4 A;  3FFL A;  3O4Z A;  4G8L A;  4YVO A;  5JHA A;  2VSY A;  4JEH A;  5AQB A;  4BES A;  4ANU A;  4AY6 A;  1INZ A;  3HRA A;  3LJN A;  4U07 A;  4WWO A;  2Y0B G;  3IHY A;  1E8W A;  3UI2 A;  3JQ1 A;  2ION A;  4L9P A;  3U9W A;  4AY5 A;  4B93 B;  2OCC E;  3SI5 A;  2LXL A;  4DPR A;  3HXB A;  4X8Q A;  1N52 A;  3PNL B;  3CHP A;  4TXR A;  3MA5 A;  2I6H A;  3BG0 B;  4LNG A;  3UTM A;  1N4R A;  1KT0 A;  3FEX A;  3CVX A;  3EHQ A;  1HG2 A;  1N94 A;  3JXI A;  3DSX A;  3SQV A;  2CFU A;  5FT9 A;  2IFU A;  4RG9 A;  5KNH D;  4MBG A;  2DWZ A;  1MYO A;  2PQR A;  4FU3 A;  5FQ7 A;  4W9R A;  2VSO E;  3B95 A;  4GCO A;  1A5E A;  3D9N A;  4EHM A;  2WQ6 A;  4PS8 A;  1TEZ A;  3RKV A;  2BKK B;  4M7C A;  4GTS A;  3JXJ A;  4AJW A;  4FLB A;  4I1M A;  3CV0 A;  3APD A;  4FAD A;  3VLD A;  2ETA A;  3CVW A;  3U64 A;  3AU5 A;  3LYA A;  2BED A;  4AVX A;  4CGW A;  2VSN A;  3CHR A;  3AG4 E;  2AVP A;  3PNT B;  5EYL A;  3MKQ B;  2L6J A;  2AJA A;  4G25 A;  5AJD A;  1KZP A;  2GRO B;  4LG6 A;  4LCT A;  2J8S D;  3G2W A;  3SO8 A;  4MKT A;  2WXG A;  1HU3 A;  3RSE G;  3PZ2 A;  2KBX A;  5EKQ D;  5LCW C;  5DBK A;  4BER A;  3F6Q A;  1RW2 A;  3GZ1 A;  4DX7 D;  3QJZ A;  3CLJ A;  2Y4U A;  1YA0 A;  1H2T C;  5HRY A;  3PE3 A;  4ABN A;  1O5M A;  4UI9 C;  3Q73 A;  1HF8 A;  3P2B A;  4U95 D;  3UIO C;  3ASN E;  4NIK A;  3OXF A;  5KNG A;  3HYM B;  3T8K A;  3RRM B;  3JUE A;  4U0Z A;  3B7T A;  2P58 C;  3UXG A;  1Q2Z A;  2J9Q A;  2JLB A;  5A23 A;  2VTB A;  3L6A A;  4HOT A;  2WXF A;  3QNK A;  3CK9 A;  2VSX E;  4O1O A;  4XX5 A;  4F6R D;  4KZC A;  2M63 A;  4CRW A;  2J09 A;  4LNB A;  3AS8 A;  1TR4 A;  5T8I A;  3ULQ A;  3E37 A;  4AEZ C;  4RQI A;  5J90 A;  1D9S A;  4EQF A;  2EIJ E;  4NUR A;  4GAA A;  4I1O B;  3DST A;  3UQ3 A;  4CDN A;  1U3C A;  3AG1 E;  5FQ4 A;  1ZU2 A;  1K8K G;  1H2U A;  2QYJ A;  3SNX A;  4GCN A;  2F0Y A;  3TWV A;  3LXU X;  1H6K A;  3UM2 A;  3NF1 A;  2Y1L E;  2WXK A;  1OXJ A;  3UM1 A;  4GZC A;  1WG0 A;  3RRU A;  4GTT A;  1UJK A;  3HIZ A;  3FUH A;  3L08 A;  2HR2 A;  2WXR A;  3GZS A;  1OWL A;  1HX8 A;  3LS8 A;  2PZI A;  3TAX A;  3MGB A;  5KCM A;  3LVQ E;  4I2Z A;  5FIN A;  3ZYK A;  3PUK A;  1XNF A;  5EIB E;  2A4Z A;  3ZPJ A;  3CVL A;  3ML8 A;  2GRP B;  1OWM A;  3DPD A;  3BG1 B;  3EIJ A;  4FHJ A;  1NA0 A;  5EN5 D;  5T4Y A;  3SY2 A;  2IO3 C;  4HOQ A;  4I6G A;  2X3M A;  1TNU A;  3FHE A;  2JEK A;  3RIB A;  2C2L A;  4CGV A;  4KMO A;  5EID A;  4AOF A;  2ETB A;  3QAQ A;  2J49 A;  5KJL A;  2BUG A;  4PS7 A;  5M72 A;  3ULE G;  1HFA A;  4C0E A;  2LAH A;  4XI9 A;  4UQY A;  3FWV A;  1WY6 A;  2IU1 A;  4A3T A;  3D3M A;  4N3C A;  4GA1 A;  4ILI A;  4KYO B;  2WXN A;  4BSX A;  3DSV A;  3SGH A;  3JCK C;  4Z68 A;  5CRV A;  3CQC B;  4YVQ C;  3NBN B;  3U3W A;  4J8F A;  5ENT D;  1HO8 A;  2LUH A;  3TXN A;  3FTS A;  5D0O D;  2QC9 A;  2MRI A;  3L17 A;  1S63 A;  3V30 A;  3IKO B;  5AN8 A;  5BV1 A;  3LEW A;  2L0I A;  3ZHE A;  3KD7 A;  3MCX A;  4M3O A;  3MKQ A;  3EIQ C;  3APF A;  4HS2 A;  5FJY A;  1UG3 A;  4KXK B;  1NZN A;  4RG6 A;  1TNY A;  3JUI A;  3G2T A;  3ASO E;  1TN8 A;  2XGM A;  3PDN A;  4XIF A;  5EIL A;  3SZ7 A;  3ESK A;  5EX3 A;  1UN8 A;  1NA3 A;  4ACK A;  2ZGG A;  2H6I A;  3CGH A;  3LY9 A;  3J5P A;  2X6J A;  2YNQ A;  3ZXP A;  4BTA A;  4JL0 A;  4DUI A;  3ZNG A;  3KEA A;  5ENN A;  2QZA A;  2FF4 A;  3OXL A;  3FU3 A;  3X2Q E;  1FVH A;  4GMR A;  4U63 A;  5G05 J;  1G3N B;  2GRQ B;  4I6J A;  3ISM C;  3MYV A;  1LF8 A;  4RSY A;  2XS8 A;  1A17 A;  4OYS A;  5DIZ A;  4ANW A;  3FU6 A;  5EYP F;  2RFM A;  3TWQ A;  4GTO A;  3Q79 A;  1SA5 A;  4G26 A;  4TRQ A;  3ML9 A;  4XZ4 A;  4Y6C A;  4PH4 B;  4KVM A;  3Q75 A;  1GW6 A;  3G2U A;  2IOL A;  3Q4A B;  3EUV A;  1FT1 A;  4TXP A;  1IHB A;  5G04 C;  4L2L A;  1FT2 A;  3Q78 A;  2IF4 A;  5D2M C;  4DX1 A;  3RO2 A;  2XPY A;  2HYZ A;  3Q49 B;  1OCC E;  3PZ1 A;  3RAU A;  4G8K A;  1DNP A;  4CYM D;  3C72 A;  1LD7 A;  4U0S A;  1HG5 A;  2X6I A;  2EIK E;  2KCL A;  2VYI A;  4BEP A;  4GZ6 A;  3NOC D;  3S7J A;  2P9P G;  2X6F A;  4L2Y A;  3CVU A;  4I2W A;  2KZT A;  3PZ3 A;  2OND A;  4EZJ A;  3DWL G;  2EIN E;  5BXO A;  5BPP A;  1ELW A;  5FIO A;  5CCL A;  1E7V A;  2YHC A;  4J8Y A;  2XCB A;  1IKN D;  3ZYM A;  4Q69 A;  1JCQ A;  5KJN A;  1WDY A;  1JCR A;  1JPL A;  5D66 A;  2WXL A;  3LY7 A;  2VGE A;  2XGS A;  3E33 A;  4DLO A;  4DK5 A;  4PUC A;  3ABM E;  3HDX A;  1HXI A;  1SVX A;  4IUL A;  4ANX A;  3ZU7 B;  4BFR A;  3FU5 A;  5CBN A;  5LP0 A;  4HLL A;  4DLQ A;  4J0U A;  5LCW J;  3OXG A;  4EBA A;  1MX6 A;  4LUN U;  3CEQ A;  5JMN D;  2YHE A;  4ANV A;  4GTP A;  2I1J A;  1KPS B;  4BSZ B;  4N3A A;  4EBA G;  4UI9 J;  2P9U G;  3EHR A;  3VLE A;  2R59 A;  3FUF A;  2CFZ A;  1NL4 A;  4HNA D;  3R7R A;  3BQO A;  3Q9U C;  4XKC A;  2R03 A;  2V0P A;  3AS4 A;  2DZO A;  2XEH A;  3D9O A;  3LCA A;  5HI7 A;  3PVL A;  3J5Q B;  3UX4 A;  1D8E A;  2L0T B;  1N4Q A;  2KM4 A;  3AU4 A;  4LNU D;  3FUJ A;  3FTY A;  5KWD A;  4FC8 A;  2V8S E;  3G2V A;  2V5Q C;  3ZEF A;  2L9B A;  5CBO A;  2R02 A;  3LPZ A;  3TL5 A;  1TJC A;  4URK A;  2LAI A;  3TWT A;  4APF A;  2OOE A;  4WND A;  4JA9 A;  4JHJ A;  4TUU A;  4H7Y A;  2ETC A;  4NQ0 A;  4EPZ A;  3D9P A;  4HI9 A;  4F53 A;  3VTX A;  3ZHE B;  4CCA A;  4J8S A;  1DC2 A;  3EU5 A;  4A1S A;  4K03 A;  4P29 A;  5ARG A;  5B1B E;  4GMJ A;  2FBN A;  4GPK A;  2WQH A;  2MOW A;  4U0U A;  4PS3 A;  3PS6 A;  1TN7 A;  1H0A A;  3UT7 A;  3I4G A;  3D9K A;  2DYS E;  2J4D A;  4JHR A;  5HQ8 A;  4JW1 A;  4F1S A;  1RZ4 A;  4A63 B;  2F8X K;  1EF1 C;  1Y8M A; 
#chains in the Genus database with same CATH homology
 5KJK A;  1XNF A;  2J08 A;  2J4B A;  3MEK A;  2A4Z A;  3ZPJ A;  3L22 A;  2V4L A;  3FUD A;  3QC1 A;  3CVL A;  5G05 C;  3ML8 A;  1OWN A;  1UW4 B;  5FTP A;  1OWM A;  5G2N A;  3TG5 A;  3PE4 A;  3DPD A;  3BG1 B;  1JUQ A;  4JVS A;  2XCC A;  4GU5 A;  3EIJ A;  4FHJ A;  1N54 A;  2AW6 A;  3CK7 A;  1ELR A;  1ELK A;  4UI9 K;  1NA0 A;  3CVQ A;  5BT1 A;  2DBA A;  4V3I A;  2HM8 A;  4LEU A;  1Z3Y A;  5T4Y A;  2J07 A;  4ATG A;  5C1D A;  1QZ2 A;  2BTD A;  5J08 A;  4FJZ A;  4HOS A;  3FH5 A;  4GA0 A;  5AEN A;  4HOQ A;  4WNE A;  4WNG A;  3FUK A;  3ASG A;  3UPV A;  4I6G A;  5CMW A;  2X3M A;  3UT4 A;  3ASH A;  4EEC A;  1FVF A;  3FHE A;  2JEK A;  3RIB A;  5JHB A;  2C2L A;  4CGV A;  3FTV A;  4KMO A;  3EHM A;  3R7Q A;  2R5S A;  2XRY A;  4B8C B;  2XPZ A;  3RU0 A;  4AOF A;  2DIW A;  3ASD A;  3I4R B;  3E4B A;  3GW4 A;  3L16 A;  2J49 A;  3FTW A;  3JYS A;  3QAQ A;  2BUG A;  3FTX A;  4N3B A;  4QFV A;  3S7F A;  5KJL A;  2VTB B;  3PRE A;  4BX9 A;  4HOR A;  4UWG A;  3KAE A;  4PS7 A;  5JJT A;  5LOZ A;  1HZ4 A;  2R17 C;  5M72 A;  2X6H A;  1PY1 A;  4J8D A;  4G24 A;  3FUI A;  4WUY A;  4C9B B;  1HFA A;  4WWP A;  4C0E A;  4FJY A;  4R7L A;  2I9C A;  2LAH A;  2PQN A;  3CHS A;  1SZA A;  4XI9 A;  5FZS A;  1IYG A;  4UQY A;  3FWV A;  3NQP A;  2CHX A;  4E85 A;  5D0Q D;  1WY6 A;  2IU1 A;  3D9M A;  3S7B A;  3ZRH A;  1ZBP A;  4G23 A;  4A3T A;  4E6H A;  4YND A;  1OWP A;  3MKR A;  3D3M A;  3ZYQ A;  2WB2 A;  3PUJ A;  4N3C A;  2OVF A;  4GA1 A;  4ILI A;  3CVP A;  5ARF A;  4KYO B;  4IYP A;  2WXN A;  4BSX A;  3UMV A;  2FUL A;  4G11 A;  1L5J A;  4APO A;  4I9E A;  3SGH A;  3JCK C;  3FP3 A;  4JEU A;  3SFZ A;  3LVR E;  2YIN A;  4U8H A;  3URZ A;  3ZXS A;  3CHQ A;  3CQC B;  2BF0 X;  5CCM A;  4L7T A;  5FWQ A;  5EDS A;  3JQ0 A;  2IOS A;  4N2S A;  4YVQ C;  5FZQ A;  4MS6 A;  4UWL A;  2GGF A;  2CHW A;  3U3W A;  4FHK A;  1Z6T A;  1X5B A;  4J8F A;  1E90 A;  1HO8 A;  2XGO A;  2E0I A;  4UWK A;  2UY1 A;  3AS5 A;  4TV3 A;  4UWH A;  3ZFW A;  4FUL A;  3TXN A;  3T5V A;  1IQR A;  4BX8 A;  3MJW A;  3FTS A;  5D0O D;  4RVB A;  2MRI A;  3L17 A;  2OV8 A;  4DJA A;  4IN3 B;  1EDU A;  2KZT B;  2QFC A;  3CSF A;  3OAW A;  3IKO B;  1QNF A;  3SD5 A;  3TXM A;  4BT9 A;  4LER A;  4XE0 A;  3I5P A;  5C2Y A;  4HXI A;  3RO3 A;  4B0Z A;  5BV1 A;  3K9I A;  2VGY A;  3LEW A;  3B7R L;  3S2A A;  2L0I A;  3ZHE A;  4EZL A;  3KD7 A;  4N2Q A;  3MCX A;  4M3O A;  1VDY A;  2X6K A;  3MKQ A;  3HVE B;  1IQU A;  3EIQ C;  3L13 A;  3APF A;  4HS2 A;  5FQ8 A;  4AV7 A;  5FJY A;  1UG3 A;  4KXK B;  5AIJ A;  5BNW A;  1NZN A;  3CR3 A;  4NRH B;  5KJM A;  4Q96 A;  4RG6 A;  2V5F A;  3EHN A;  3JUI A;  3IV0 A;  3B7U X;  3B7S A;  2WXO A;  3G2T A;  3QK0 A;  4EZK A;  4L23 A;  1EPU A;  3I3N A;  4CEM A;  4WNF A;  1HH8 A;  2XGM A;  3PDN A;  4XIF A;  3SZ7 A;  3QAR A;  3FUL A;  3ESK A;  5EX3 A;  1EYH A;  4BY6 A;  5T3R A;  1UN8 A;  1Z3X A;  4ACL A;  3FUM A;  3ZW3 A;  2C0L A;  1NA3 A;  4ACK A;  3PRZ A;  4MRU A;  2UWJ G;  4BT8 A;  4XKB A;  3FFL A;  3TG4 A;  3CGH A;  3LY9 A;  3O4Z A;  1XGW A;  2X6J A;  4ILG A;  3EDT B;  2YNQ A;  3WXX A;  4YVO A;  2GW1 A;  5JHA A;  4L1B A;  4BTA A;  3CVV A;  2KAT A;  4CT4 A;  4JL0 A;  1JWF A;  2VSY A;  2CG3 A;  5ENN A;  1W3B A;  2FF4 A;  4JEH A;  4I1A A;  3G2S A;  3OXL A;  4C0M A;  2C0M A;  4ANU A;  4AY6 A;  1INZ A;  4ME2 A;  3FU3 A;  2XEV A;  1FVH A;  4U63 A;  3APC A;  3RK6 A;  4U07 A;  5G05 J;  2QY7 A;  5FZR A;  4WWO A;  4I6J A;  3IHY A;  4GYY A;  4I9C A;  3D9J A;  3QDN A;  4B89 A;  4BTB A;  1E8W A;  1P5Q A;  2Y3A A;  3EJN A;  4WAF A;  3MYV A;  1LF8 A;  4RSY A;  4B94 A;  2GRL A;  3JQ1 A;  2ION A;  2XQ0 A;  3U9W A;  4AY5 A;  1A17 A;  4OYS A;  1TJF A;  4HLE A;  5DIZ A;  3ZYL A;  4DI3 A;  3SI5 A;  3FU6 A;  4ANW A;  4A1G A;  1B89 A;  2WXM A;  3DBS A;  4DPR A;  4GML A;  4N5C A;  5ANL A;  2I1K A;  4J8E A;  3D9I A;  2FI7 A;  3QWW A;  5A6C A;  1N52 A;  3IEG A;  3N71 A;  1MHQ A;  4LRZ A;  3MX3 A;  3PNL B;  4G26 A;  2WMN A;  3CHP A;  4TRQ A;  3ML9 A;  4XZ4 A;  4Y6C A;  3MA5 A;  4PH4 B;  4KVM A;  1GW6 A;  4N39 A;  2I6H A;  3G2U A;  2IOL A;  4U04 A;  2HO1 A;  3ZVV A;  3Q4A B;  3B13 A;  4OVV A;  3BG0 B;  1E96 B;  2XHE A;  2X38 A;  4HFG A;  2PL2 A;  5G04 C;  1DVP A;  3QB2 A;  2WM9 A;  1KT0 A;  2IJG X;  4I6E A;  3FEX A;  4L2L A;  2VGX B;  2WXJ A;  4XI0 A;  5CHE E;  3SBS A;  2IF4 A;  3CVX A;  3RO2 A;  1HG2 A;  2HYZ A;  2RD0 A;  2XPY A;  3Q49 B;  2WMO A;  2CFU A;  5FT9 A;  2IFU A;  2WXI A;  4RG9 A;  2PQR A;  5FQ6 A;  4FU3 A;  4JHK A;  1DNP A;  5FQ7 A;  3CKC A;  4W9R A;  2VSO E;  4GCO A;  2ZU6 B;  3D9N A;  3LY8 A;  2WQ6 A;  4U0S A;  4PS8 A;  4NAC A;  4AM9 A;  1HG5 A;  1TEZ A;  1IHG A;  3RKV A;  3OTN A;  2X6I A;  3Q47 B;  4I17 A;  2FO7 A;  2KCL A;  2VYI A;  3CVN A;  4AJW A;  4FLB A;  4I1M A;  3CV0 A;  3D9L A;  3APD A;  4MLP A;  4JA7 A;  4O6F A;  3UT8 A;  4GZ6 A;  5AYW D;  1PC2 A;  1KLX A;  2CG2 A;  3S7J A;  4FAD A;  3VLD A;  3CVW A;  3U64 A;  3AU5 A;  3L54 A;  2LO6 A;  3LYA A;  2X6F A;  4AVX A;  3FUE A;  3CHO A;  4CGW A;  2VSN A;  3QWP A;  3FUN A;  4L2Y A;  3RRN B;  3CHR A;  3CKB A;  3CVU A;  4I2W A;  2KZT A;  4ILH B;  2OND A;  4EZJ A;  3SF4 A;  4F7A A;  4KVO A;  2AVP A;  3PNT B;  4GZD A;  3CVY A;  5BW8 C;  3MKQ B;  2WPV A;  2L6J A;  2VQ2 A;  3U4T A;  4G25 A;  5AJD A;  4IRU A;  5BV0 A;  3C98 A;  5AJL A;  1E8Y A;  3LKU A;  5BPP A;  3ESL A;  4F3V A;  1ELW A;  5CCL A;  1E7V A;  4KZ0 A;  3NZS A;  4LCT A;  2YHC A;  2WVI A;  2LSV A;  2WXH A;  3G2W A;  4G1T A;  2XCB A;  2NC9 A;  1OUV A;  4MKT A;  3ZIM A;  5EX0 A;  3FY4 A;  4GZ5 A;  1H19 A;  4PDX A;  2WXG A;  5E75 A;  3ZYM A;  4CDR A;  4Y6W A;  4Q69 A;  3TGO A;  5KJN A;  3UUX A;  2RG8 A;  5E76 A;  1HU3 A;  1UJJ A;  3CST A;  1JPL A;  4JZY A;  2WXL A;  3LY7 A;  2WQ7 A;  3VLF A;  5EKQ D;  3LDZ A;  2XGS A;  3ENE A;  5LCW C;  2KC7 A;  3FH8 A;  2ILR A;  5DBK A;  4DLO A;  2PM7 A;  3FTZ A;  4PUC A;  3PEV B;  4DK5 A;  3GZ1 A;  3HDX A;  5JJ7 A;  5BUZ A;  3FTU A;  1HXI A;  3QJZ A;  2NSZ A;  3CLJ A;  4IUL A;  2Y4U A;  1YA0 A;  1H2T C;  4AXH A;  3SHF A;  4FP7 A;  3O48 A;  4ANX A;  4BFR A;  3PE3 A;  1HE8 A;  3FU5 A;  4J6I A;  3VTY A;  1PAQ A;  4UWF A;  4CT0 A;  4AIF A;  5LP0 A;  4GZ3 A;  2A5U A;  4DLQ A;  4ABN A;  4D10 C;  4J0U A;  3IHV A;  4UI9 C;  1HF8 A;  3OXG A;  3P2B A;  5LCW J;  4DI4 A;  1E8X A;  3OXF A;  3CIA A;  4KBQ A;  4EBA A;  3FU0 A;  3HYM B;  1S0P A;  1MQS A;  4H7X A;  4LUN U;  3CEQ A;  1BPO A;  3RRM B;  2LSU A;  4U0Z A;  3B7T A;  2YHE A;  2P58 C;  3FEY A;  3PZD A;  4Q94 A;  4ANV A;  2OVB A;  2I2O A;  2I1J A;  3HHM A;  4A55 A;  1SQM A;  4B8A A;  1WAO 1;  2J9Q A;  2JLB A;  5A23 A;  3RJV A;  2VTB A;  3L6A A;  2DCP A;  3QKY A;  3QOU A;  4N3A A;  1U3D A;  4EBA G;  3U66 A;  2WXF A;  4HOT A;  1OWO A;  3QNK A;  4UI9 J;  1KT1 A;  3CK9 A;  2VSX E;  3VLE A;  4GA2 A;  2R59 A;  3PEU B;  4XX5 A;  3FUF A;  2CFZ A;  2M63 A;  4KZC A;  2J09 A;  2NXP A;  4OVU A;  4CRW A;  3R7R A;  1E8Z A;  1WM5 A;  3TJP A;  3AS8 A;  3CQG B;  5T8I A;  3ULQ A;  2MHK A;  4XKC A;  3R9A B;  2V0P A;  3AS4 A;  3FDH A;  4FLH A;  4AEZ C;  3D9O A;  2AXV A;  3LCA A;  5J90 A;  3ZN3 A;  4EQF A;  4CDM A;  4HOU A;  2WXP A;  4GB9 A;  4UQX A;  5HI7 A;  3S7D A;  3PVL A;  4AP2 A;  4GYO A;  4NUR A;  3UX4 A;  3Q5M A;  2VGX A;  3KS2 A;  2LNI A;  3MV3 B;  2L0T B;  1QQE A;  5LX8 A;  5JJ6 A;  3SBT B;  2KM4 A;  3AU4 A;  4GAA A;  3FUJ A;  2Q7F A;  4I1O B;  3FTY A;  4FC8 A;  2V8S E;  4K0R A;  3G2V A;  5LFA A;  3CHM A;  5G04 J;  2L9B A;  3ASF A;  3UQ3 A;  3ZEF A;  4KT6 B;  4CDN A;  3LPZ A;  1Y6I A;  3GZ2 A;  3NZU A;  3TL5 A;  1TJC A;  1U3C A;  5FQ4 A;  2AXZ A;  4URK A;  2LAI A;  2UY1 B;  1ZU2 A;  4APF A;  2OOE A;  3P1U A;  4FA6 A;  3FH7 A;  4JA9 A;  4JHJ A;  4TUU A;  4H7Y A;  1H2U A;  4WND A;  3PH0 C;  1NP7 A;  3T8M A;  2CHZ A;  3GYZ A;  4WWN A;  3MZL B;  1JWG A;  3KEZ A;  3SNX A;  3MV2 B;  4JC8 A;  4GCN A;  4UQZ A;  5G55 A;  3T5X A;  4BWR A;  3LXU X;  5CMY A;  4NQ0 A;  1H6K A;  4EPZ A;  3D9P A;  4F53 A;  2GRM A;  3NF1 A;  3VTX A;  3ZHE B;  4HVB A;  3IBE A;  2E2E A;  4CCA A;  4J8S A;  2YQ8 A;  1FCH A;  2WXK A;  2IQC A;  3Q15 A;  4GZC A;  5ANR A;  4JPS A;  4A1S A;  5A7D B;  3RRU A;  2PM6 A;  4K03 A;  4P29 A;  5ARG A;  3HVE A;  4GMJ A;  2FBN A;  4GPK A;  1UJK A;  3HIZ A;  2KCK A;  2WQH A;  2MOW A;  4U0U A;  3FUH A;  2AXU A;  3L08 A;  4PS3 A;  3ZGQ A;  3PS6 A;  4A3V A;  2HR2 A;  1SZ9 A;  1H0A A;  2WXR A;  3ONK A;  3BEE A;  3GZS A;  2EQX A;  3I4G A;  1E7U A;  2XPI A;  3UT7 A;  2AWI A;  1OWL A;  2FEZ A;  3QWV A;  3D9K A;  1HX8 A;  2J4D A;  4JHR A;  4GYW A;  4JW1 A;  3ONL A;  5HQ8 A;  3LS8 A;  4F1S A;  2XRZ A;  2VJ8 A;  2PZI A;  2Y4T A;  1HS6 A;  1H2V C;  4JXT A;  3TAX A;  3MGB A;  5KCM A;  1EF1 C;  2KCV A;  2WXQ A;  1Y8M A;  3CK8 A;  3LVQ E;  3LJ3 A;  1UN9 A;  4G2V A;  4I2Z A;  3ZYK A;  4I43 A;  3PUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...