4HOUA

Crystal structure of n-terminal human ifit1
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
269
structure length
261
Chain Sequence
VKDSLEQLRCHFTWELSIDDDEMPDLENRVLDQIEFLDTKYSVGIHNLLAYVKHLKGQNEEALKSLKEAENLMQENVRSLVTWGNFAWMYYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAKACFEKVLEVDPENPESSAGYAISAYRLDGFKLATHKPFSLLPLRQAVRLNPDNGYIKVLLALKLQDEGQEAEGEKYIEEALANMSSQTYVFRYAAKFYRRKGSVDKALELLKKAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Interferon-induced protein with tetratricopeptide repeats 1
total genus 97
structure length 261
sequence length 269
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4houA00
3OXFA 5KJKA 2BUGA 4ABNA 4N3CA 1HZ4A 2XEVA 4GCOA 1IYGA 2Y4UA 1ELWA 3CEQA 5CCMA 3MA5A 4I9CA 4J8EA 4N3BA 3AS4A 4YNDA 3WXXA 3ZHEB 3CKBA 5LCWC 5BW8C 4YVQC 2VGXB 3FP3A 5AYWD 2FEZA 4KXKB 3SZ7A 3ASDA 2PL2A 3CKCA 4I9EA 3HYMB 5EX3A 4LEUA 3EDTB 5FZQA 2VSNA 3UPVA 3U3WA 2VGXA 5D0OD 3IEGA 2HYZA 4B94A 5C1DA 1NA3A 3LKUA 2NC9A 3U4TA 3LY7A 1Y8MA 3VTYA 5FT9A 3QWWA 5FZRA 3ZGQA 3LCAA 2VGYA 3PE3A 3ZPJA 2MHKA 2V5FA 3OXLA 5FJYA 4GYYA 1P5QA 2PQRA 4KYOB 4WNDA 4HORA 2WQHA 3ASHA 3CVPA 4GA1A 3LY9A 2HR2A 2L6JA 2XGSA 3E4BA 2KCKA 4WUYA 3TG5A 2FF4A 5JJ6A 4KBQA 3RO2A 3PE4A 3UQ3A 3CV0A 4AIFA 5CCLA 5DIZA 1IHGA 5HQ8A 2KATA 5HI7A 2UY1B 5G04J 4UQYA 4UI9J 3SF4A 4WNFA 3O48A 4HOUA 2AVPA 4G25A 4GZ5A 5G05J 4JA7A 3S7JA 4A1SA 4BTBA 4BWRA 1ELRA 4GCNA 1HXIA 2KC7A 3QKYA 4I1AA 4AY6A 5KJMA 1NZNA 3RIBA 2Q7FA 4G26A 4GYOA 4U0SA 2IF4A 3K9IA 2FI7A 3RJVA 2E2EA 3Q4AB 3LPZA 3LY8A 4YVOA 5FZSA 1YA0A 4NQ0A 4U0ZA 5A7DB 3RKVA 3UUXA 2DBAA 3CVQA 5BNWA 3CK7A 4AM9A 4GA0A 3MV3B 3BEEA 3LYAA 2XPIA 2LSUA 4XIFA 4U0UA 3GW4A 4N3AA 1E96B 2GW1A 1PC2A 3AS8A 3Q49B 2FO7A 3TGOA 1QQEA 2C2LA 2HO1A 2LNIA 2UWJG 4I17A 4UQZA 5BT1A 5ARGA 5KJLA 4G2VA 2R5SA 4Y6CA 2P58C 4J8DA 4APOA 5EX0A 4UQXA 4JHRA 3MKRA 4H7YA 4N39A 4XI0A 3R9AB 3TAXA 2YHCA 3OXGA 3CK9A 3RO3A 2KCLA 3FFLA 1QZ2A 3ZHEA 2I6HA 5LCWJ 2JLBA 3ESKA 4BT9A 3S7DA 1KLXA 5DBKA 4WNEA 3PDNA 3Q15A 4IN3B 4RG6A 4F3VA 2WPVA 4UI9C 2Y4TA 4WNGA 5CHEE 3ZN3A 3NF1A 3GZ2A 4G23A 1B89A 4JL0A 3RU0A 4JA9A 2XCCA 4U07A 2C0MA 4I2WA 5KJNA 4W9RA 3Q47B 2PZIA 3GYZA 4U04A 5M72A 4GZ6A 4ME2A 1KT0A 3CK8A 4EQFA 5G04C 1W3BA 3TG4A 4UI9K 4BT8A 2UY1A 4N2SA 3JYSA 4J8FA 4CDRA 2QFCA 5G05C 1TJCA 2ONDA 2FBNA 2PQNA 2XCBA 4H7XA 2C0LA 3AS5A 1ZU2A 5D0QD 4G24A 1HH8A 1KT1A 1XNFA 3FWVA 3KD7A 3ULQA 2J9QA 3ZFWA 4BTAA 3QWVA 4G1TA 3URZA 3GZ1A 5JJ7A 4HOTA 4J0UA 4HOQA 3QOUA 4NRHB 3Q5MA 2KCVA 3S7BA 4HOSA 2LSVA 4Y6WA 3CVNA 2VQ2A 3KS2A 4O6FA 4GA2A 1OUVA 2VSYA 4RG9A 4XI9A 1A17A 5EKQD 3MEKA 3VTXA 5A6CA 3S7FA 4N5CA 1FCHA 2OOEA 1WM5A 2XGOA 4I2ZA 5ARFA 2VYIA 2YQ8A 3CVLA 5FTPA 1ZBPA 2IFUA 2XGMA 3QDNA 3QWPA 3N71A 3ASFA 4AY5A 4CGVA 4GZ3A 4CGWA 4N2QA 1NA0A 3MV2B 4GPKA 1WAO1 5JJTA 3KAEA 4GYWA 3ASGA
chains in the Genus database with same CATH superfamily
2ZU6B 2GRNB 2WVIA 4O1PA 3ASDA 3DEPA 4WWNA 5C1DA 3TWQA 2R59A 5CERB 1HE8A 2WQHA 3L08A 1FVFA 2RFMA 2I1KA 1AP7A 4ANXA 2XEEA 4KMOA 2IF4A 2X6FA 2P2CP 1O1RA 3FY4A 1Z5SC 4APOA 3R9AB 4JHRA 3C72A 4G8LA 3FFLA 3E37A 2L6BA 4BT9A 3PZ2A 3Q15A 4IN3B 4WWOA 1SZ9A 1Z3YA 3U9WA 3LJ3A 4OVUA 4UWKA 1U3DA 4WWPA 4C48B 1NI1A 2OEVA 5G04C 5CMWA 5KNGA 3PZ1A 5ENOD 4H7XA 3EU5A 4RVBA 3ENEA 4J0UA 3MCXA 3G2TA 1O5MA 3EIQC 1HS6A 2KBXA 2I9CA 3ONKA 4N3AA 2Y4UA 2IO2C 3AS4A 4LNGA 5LCWC 4EECA 4YVQC 2VGXB 2EIKE 4PUCA 5CECB 2H6HA 2KXPC 5ENNA 2WMOA 3TWXA 2NC9A 1KPSB 4BFRA 3Q7AA 4U8HA 2KZTB 1DNPA 1IHGA 2I2OA 2GROB 5AENA 1BU9A 4UWGA 4ACLA 4BWRA 3ABLE 4O1OA 3QKYA 1N4RA 2WXLA 2V5QC 5KNHD 4X8QA 1MZCA 1UN8A 5JHAA 4GA0A 1HO8A 1O1SA 3AS8A 4B8CB 5AJLA 3UKUG 1S63A 3ZIMA 3L82A 2EILE 4U7EB 4I6GA 2RG8A 3HDXA 3D9MA 4I2WA 4CYMD 3JQ0A 4DX1A 4GU5A 4M3OA 3TG4A 3DEOA 3P2BA 2LO6A 5JHBA 5D0QD 5JMND 3ESLA 3SBTB 3CVNA 1WY6A 3OAWA 3WG7E 3EJNA 1G3NB 4RG9A 4FHKA 4N5CA 1BPOA 1ZBPA 2IFUA 4GZ3A 4KT6B 1RZ4A 1SA4A 3CGHA 4DK5A 3UX4A 3SI5A 4C0EA 3ZNGA 5EX3A 5KWDA 4CZ2D 3DSSA 5G2NA 3AG1E 3D9IA 5FZRA 3SO8A 3FTWA 3AU4A 3FTYA 1QNFA 3UQ3A 5EILA 3IBEA 5ENRD 3APCA 2ILRA 2AW6A 4BTBA 4GCNA 4I1AA 4MLPA 1E90A 1K1BA 1H6PA 2FI7A 2QY7A 4YVOA 1YA0A 5EYLA 4I6JA 3JCKC 3V31A 5FQ8A 4EZLA 3D9OA 2C2LA 2PNNA 2A4ZA 3AU5A 1MJ0A 2P58C 2XENA 3TAXA 3LVQE 2F8YA 1JCQA 4WNEA 2EINE 3ZN3A 3IHVA 1N54A 4U07A 3G2UA 5M72A 3HXFA 2V0PA 4J8FA 2C0LA 3PS6A 3PZDA 1XNFA 3HG0D 2XQ0A 3I4GA 4ZHBA 3T5XA 3UM0A 3ZYLA 2ZISA 4GA2A 3ZXPA 2F37A 4B0ZA 1JCRA 3RAUA 4AV7A 3C3RA 3CVLA 3L16A 5FTPA 4EBAG 1N4PA 4TRQA 3V79K 3EU9A 4GTVA 2ZIRA 3ABME 2FULA 2H6GA 4N3CA 1HZ4A 2XEVA 2A5UA 2QZAA 4MRUA 4I9CA 3HRAA 3D9KA 4UWLA 3PNTB 3ZHEB 3BQOA 3C98A 5ENQD 3NBNB 2DWZA 3VTYA 1Y8MA 3L13A 2VGYA 3R9MA 4C9BB 2GRLA 2L6JA 4F7AA 4FJYA 3UINC 1MHQA 2B0OE 2I1JA 3NZUA 4UQYA 2R02A 4HFGA 4KZ0A 2LAHA 4HNAD 3FHEA 4FLBA 5HS0A 3CQGB 5BPPA 4AP2A 5CRUA 3TXMA 4DX5D 3ZU7B 3JXIA 4DX2A 3PZ4A 3UT4A 4LNUD 4B93B 3RO3A 3CHRA 3UXGA 5LCWJ 4AXHA 1S0PA 3FU6A 4JEHA 1Y6IA 4JL0A 3NQPA 4BX8A 1WDYA 1TN8A 4DI4A 3FTSA 1IXVA 2QFCA 4LSZE 2FBNA 4DX6D 3KD7A 3PZ3A 4ILGA 4JXTA 3KS2A 5CMYA 3VTXA 2E0IA 3DSUA 5BUZA 3ASFA 3MJWA 3FUEA 3UIPC 1WAO1 4JPSA 3TJPA 4V3IA 3CEQA 3ISMC 3T8MA 4YNDA 2OVBA 2FEZA 4DPRA 4ACKA 2PL2A 4I9EA 1OT8A 5CRVA 2WXIA 1NA3A 5A23A 2VTBA 3QWWA 3LCAA 3Q9UC 2L9BA 3FTUA 2LUHA 5E76A 3R7RA 2GGFA 2J4BA 2EIJE 1MQSA 3T8KA 3ZXSA 3SF4A 4GZ5A 2OCCE 1ELRA 4DJAA 3RIBA 1E8ZA 1TYQG 3CIAA 2F0YA 4LG6A 4XIFA 4FU3A 3DXMG 4UQZA 3FUKA 3PNLB 3E30A 3CK9A 1QZ2A 2CHWA 2WM9A 3NF1A 1SA5A 4D10C 4GTQA 2BTDA 3EHQA 3IV0A 4QFVA 5D66A 2KM4A 4GZ6A 4F1SA 4BT8A 2WXJA 2NYJA 4DLOA 2XCBA 4XZ4A 1HH8A 1X81A 4BTAA 5JJ7A 4K5CA 2IONA 3RRNB 4A3VA 4LNBA 1BD8A 3QDNA 4IYPA 3V2OA 1NA0A 4K0RA 3RK6A 4GCOA 2J8SD 3CSTA 4FADA 3HIZA 1ELKA 5BW8C 3QK0A 2P9IG 4YDWA 5BV0A 4EBAA 5D0OD 1TNZA 5B1BE 2Y3AA 5E75A 3UMVA 3AG3E 4U96D 3SD5A 3OXLA 4ATGA 3DSTA 4GA1A 3E4BA 3EHMA 2QYJA 3MYVA 3PE4A 3CV0A 5AQ9A 2IU1A 2UY1B 1IHBA 5FIOA 4FC8A 2JEKA 1O1TA 4TXPA 2YHEA 5EYPF 2R05A 4MS6A 3RJVA 4LERA 3ZRHA 3Q78A 1H6KA 2XPIA 3ZYMA 4IULA 4EZKA 2LNIA 4Y6CA 2CFZA 3D9JA 3ESKA 5CHEE 4GTPA 3SHFA 5AQAA 4APFA 5FINA 1H2VC 2L0TB 1OCCE 4I1MA 3IXEA 1Q2ZA 1TJCA 1QYMA 4XX5A 3L54A 1OXJA 3UT7A 3FWVA 3DSXA 3QWVA 4YDYA 3URZA 2CG2A 1TJFA 3Q5MA 1MX2A 5LOZA 3SBSA 4K5AB 2YNQA 5EKQD 2Y1LE 5KBAA 3HVEA 1WM5A 3JQ1A 3PUJA 2YQ8A 3S7JA 4FULA 1TNOA 3N71A 4HRNA 4CGWA 4HI8A 3EHRA 3FUJA 4U8YD 3X2QE 1U2VG 4YDOA 3CKBA 4RQIA 4KXKB 3CHMA 3U3WA 2IO3C 2BF0X 3TWRA 1X5BA 1Z6TA 2HM8A 5CBNA 5FJYA 1FVHA 3FEYA 1JCSA 4ILHB 1P5QA 4I6EA 5ENTD 2WXFA 5G04J 4UI9J 3B7RL 4WNFA 3O48A 2P9PG 3UIOC 3FH7A 2GRMA 2CHXA 4M7CA 2PM7A 4ILIA 3MKQB 5EIDA 4N5QA 3Q75A 2XZDG 2I6HA 3V2XA 4UUCA 2OEWA 1N95A 3S7DA 3ZKJA 2RFAA 4ATZD 4CT0A 5AAOA 1B89A 2C0MA 3ASNE 3UM2A 4WAFA 4EQFA 1UG3A 1W3BA 3P1UA 4UI9K 5CBOA 5EDSA 3C3QA 2LAIA 4TXRA 5G05C 1ZU2A 2J07A 5CEDB 4HB5A 4HOQA 4B89A 3FH5A 5LX8A 3DBSA 4O6FA 1NP7A 3B95A 3FUNA 4JW1A 4GMRA 3UM1A 3FUDA 4EPZA 4N2QA 5JJTA 2BUGA 1ELWA 3JUIA 4AJWA 4TUUA 2LXLA 3CKCA 3HYMB 2HYZA 2P9KG 3ZGQA 3APDA 3ULYA 3ZPJA 4XE0A 4TXQA 4I1OB 4JVSA 1E7VA 3U64A 2XGSA 3FTZA 3FU3A 2EIME 3QJZA 2V8SE 1N52A 4E6HA 1HF8A 1S64A 1HFAA 2BKKB 3MX3A 4GTTA 2DCPA 5KJMA 1DCQA 3APFA 2DYSE 1XGWA 4HI9A 3LXUX 2ETCA 4F6RD 1PC2A 3TGOA 3QB2A 5EIBE 2AXZA 4G2VA 3ZUVB 2P9NG 4N39A 1BLXB 1YMPA 4LUNU 2DZNA 3SY2A 1OY3D 3PDNA 1UJJA 2WXNA 3GZ2A 3R7QA 4DX7D 2XCCA 3HHMA 3ABKE 3CVYA 3B7SA 4ME2A 1V54E 2KZTA 4FHJA 3VLFA 3ML9A 2WXKA 1RW2A 3HVEB 4L9PA 2VSOE 4XI9A 3CQCB 4NIKA 3CSFA 2MOWA 4BSXA 2XGMA 4AOFA 1N11A 4HRMB 2R2LA 4HORA 4AVXA 4HLEA 3QNKA 4GMJA 5CCMA 4G8KA 3FU5A 3DPYA 2XPZA 4B94A 1OWOA 4AEZC 3LY7A 1FT1A 3FUIA 4JHJA 4KBQA 5G55A 2RD0A 4L7TA 5G05J 2CG3A 1U3CA 1NZNA 1SQMA 4K5BA 5FQ4A 3FTXA 3LPZA 3Q4AB 3D9LA 3FUFA 5A7DB 4BESA 1JWFA 2ZGDA 2QYUA 3AG4E 1HX8A 5FQ6A 4J8DA 3ULEG 1IKND 1E8YA 4GTOA 4JA9A 4QQIA 2IEJA 3MZLB 3QARA 4K03A 1EF1C 3UKRG 3SFYA 4HBDA 4CDMA 1FT2A 3C5RA 4HOTA 5CEAA 4Q94A 3S7BA 4NACA 3D9PA 1UW4B 3F6QA 3QWPA 4CRWA 1OWMA 1FPPA 1IYGA 3HXEA 3J5QB 3B13A 1N4QA 3I3NA 1JUQA 4YDEA 3JXJA 3EDTB 4RLYA 2VGXA 3JUEA 3LKUA 4JHKA 2V5FA 4GYYA 3LY9A 3W9FA 2FF4A 2X6KA 3OTNA 5DIZA 2WMNA 2ZGGA 5H7PA 4UWHA 1MYOA 2Y69E 3AG2E 4JA7A 2KC7A 3TWTA 4A63B 4GTRA 3K9IA 5ENPD 3LY8A 5J90A 1D8EA 4AM9A 3MV3B 4PS7A 1MX4A 2R5SA 4U63A 2IJGX 2J09A 5ANRA 3OXGA 2KCLA 1SW6A 5BXUA 3ZHEA 2HE0A 3FEXA 3TL5A 3I5PA 1LD7A 3EUVA 5IY5E 3VLEA 3DSVA 3TWVA 4PH4B 1UJKA 2WQ6A 1KT1A 1IQRA 2A5EA 3RRUA 4KZCA 3DPDA 2XPYA 3IHYA 4LRZA 1TEZA 2IOSA 3B7UX 2DVWA 2IY0C 2OOEA 4HRLA 1LF8A 5KJKA 1EDUA 1BI8B 4ANUA 3ZYKA 4JC8A 3IEGA 2R17C 1ZB1A 4A55A 2MHKA 1EPUA 1VDYA 4L23A 3CVPA 4BX9A 2XZTG 4GAAA 4AIFA 2BKGA 3I4RB 2AVPA 4AY6A 1SVXA 2OV8A 3E33A 5JA4D 4GB9A 2AJAA 3UI2A 1NL4A 1E96B 2GW1A 4Q69A 3EIJA 1QQEA 2UWJG 4PS8A 5BT1A 2WXPA 2MYOA 1N9AA 4Z68A 4UQXA 1L5JA 3ZEFA 3ONLA 5LP0A 1TNUA 2PZIA 4RSYA 2VTBB 4Q96A 4GZDA 1JPLA 1K3ZD 3HXCA 2WXQA 4G24A 3GZ1A 4OYSA 2X6JA 4NRHB 4GPMA 3TXNA 3QC1A 1OUVA 3UT8A 4OAUC 3FU0A 3CHQA 3MV2B 5HI7A 3L22A 3MA5A 4J8EA 3WXXA 2WQ7A 3FP3A 3BG0B 1PAQA 3BG1B 4LEUA 5HRYA 5T4YA 2VGEA 2Y0BG 1K8KG 4KYOB 2VJ8A 3CVWA 5BXOA 2KCKA 4WUYA 3TG5A 3PRZA 2J49A 4A1SA 4G25A 4A3TA 4DRXE 3GZSA 2Q7FA 5BV1A 1N0RA 3ZW3A 2E2EA 4ABNA 3LDZA 3CVQA 3BEEA 3LYAA 2JABA 4PS3A 4XEIG 4BY6A 2HO1A 5D2MC 2J08A 5KJLA 5EX0A 5AJDA 3NAWA 2AXUA 1OCZE 1AWCB 4XKBA 5DBKA 4RG6A 2IQCA 1E7UA 4FA6A 4IRUA 3TWUA 3Q47B 2WXOA 1LTXA 2P9SG 3GYZA 3T5VA 4JEUA 1H2TC 2P9UG 3JYSA 2ONDA 3SNXA 3FULA 3L6AA 4HOSA 2AWIA 3BUAA 4EHMA 3TWWA 3FUMA 1FCHA 1K1AA 4AY5A 2P9LG 4GMLA 3CVVA 2F8XK 3CR3A 4F1PA 3OXFA 1IQUA 3PUKA 4J8YA 2X6IA 5T8IA 5ENSD 5AYWD 4P29A 5FWQA 3ASOE 4UWFA 5FZQA 3UPVA 2V4LA 3W9GA 3ZYQA 5FT9A 1PY1A 4WNDA 3SFZA 2M63A 2H6IA 5JJ6A 4B8AA 5AN8A 4KVMA 1HG5A 5KCMA 2KATA 4URKA 2IOLA 4OAVB 2X3MA 4G26A 4U0SA 1N0QA 3FDHA 4NQ0A 5BNWA 3RKVA 2DBAA 3FUHA 3LJNA 4L2LA 3E32A 4G11A 4I17A 2WB2A 4A1GA 3ML8A 1TNYA 3MKRA 3LEWA 1S70B 2XS1A 1LD8A 5HKPA 2R03A 1KLXA 2DZOA 4CEMA 1YCSB 3HXDA 2Y4TA 4G23A 1JWGA 4I43A 3CK8A 4CDNA 4CDRA 3D3MA 2B6CA 3SFXA 4ZFHA 1NFIE 2ZXWE 3QOUA 4Y6WA 2WXHA 3G2VA 1GW6A 4JD2G 2VSYA 1A17A 4JB8P 3S7FA 1OWNA 5ARFA 3S2AA 4NURA 3RRMB 1HG2A 4HXIA 4GYWA 1DC2A 3NZSA 4TUMA 4N3BA 2DYRE 3AJIA 1OCRE 2YINA 3T9KA 1TNBA 4BSZB 4HVBA 3PVLA 3B7TA 3AAAC 5LFAA 4MKTA 2PQRA 2FO1E 1H6OA 3Q79A 5J08A 3RO2A 3G2SA 1TR4A 5HQ8A 1KZPA 3CLJA 3CVUA 1A5EA 2XRZA 4FP7A 2GRPB 3MGBA 1H2UA 3ZVVA 4U0ZA 4FJZA 3NB2A 2BEDA 2WXMA 3NOGD 4J8SA 3PREA 5T3RA 2XS8A 4ANWA 2YHCA 4GZCA 3PH0C 5AQBA 3V30A 2NSZA 2WPVA 4UI9C 2XEHA 4BETA 1TN7A 1KT0A 2ETBA 2NXPA 3E34A 2J9QA 3L9TA 2KCVA 1MX6A 3C3OA 4R7LA 3FH8A 5A6CA 3NOCD 1DVPA 2XGOA 4E85A 4I2ZA 2X38A 4CCAA 2PM6A 2VSXE 3U66A 2LXMA 3CVXA 3KAEA 5AIJA 3ASGA 3UTMA 5ANLA 2OVFA 2EQXA 2VSNA 3LVRE 4GTSA 1QBQA 4ANVA 3PE3A 3PEUB 3BU8A 3KSQA 3ASHA 2ETAA 2GRQB 4L2YA 3DXKG 5CCLA 4MBGA 1WG0A 4PDXA 3CHPA 3Q7FA 4HOUA 4GTMA 2XHEA 2XRYA 1UN9A 3D9NA 1N4SA 5FZSA 1SZAA 3CK7A 3EHNA 2LSUA 5C2YA 1N94A 4J7WA 3Q49B 1HU3A 4F53A 4H7YA 1H19A 4XI0A 3CHOA 1YYHA 4XKCA 3VLDA 3MKQA 4BERA 1EYHA 5AQ7A 1OWLA 3J5PA 5B3SE 3RU0A 4W9RA 1E8XA 4U04A 2J4DA 2UY1A 4N2SA 3AS5A 3SQVA 3ULQA 3D9HA 4DI3A 2WXRA 2X6HA 2VQ2A 4KVOA 1V55E 1INZA 3QAQA 3MEKA 3Q9NC 2VYIA 4FLHA 4CGVA 4L1BA 4U95D 3LS8A 1D8DA 1KZOA 5EN5D 2CHZA 3TWSA 3SZ7A 4DUIA 3PEVB 3U4TA 3KEZA 3KEAA 2MRIA 3G2WA 2HR2A 2DIWA 4OVVA 4O60A 3HXBA 5B1AE 4JZYA 2QC9A 3IKOB 3DWLG 3UM3A 4HLLA 2GRRB 1HXIA 2RKKA 5FQ7A 4GYOA 3O4ZA 3DRAA 4C0MA 3UUXA 3CHSA 3B7BA 4U0UA 4TV3A 3GW4A 4DLQA 2V4HC 2H6FA 2FO7A 4CT4A 4HS2A 5ARGA 3KSLA 3RSEG 2AXVA 3L17A 4BEPA 4LCTA 2JLBA 2WXGA 1OCOE 4F3VA 4WNGA 3Q73A 1D9SA 2L0IA 1UOHA 5KJNA 1OWPA 3FTVA 4HQDA 1DCEA 1E8WA 3DSWA 2PQNA 5AARA 1Z3XA 5ITZF 3ZFWA 3SGHA 4G1TA 1H0AA 4J6IA 1BI7B 4EZJA 2LSVA 2CFUA 1TN6A 4U8VD 4GPKA
chains in the Genus database with same CATH topology
3OXFA 2ZU6B 4HLEA 1IQUA 3PUKA 4V3IA 3QNKA 3CEQA 4GMJA 3T8MA 5CCMA 2WVIA 3FU5A 4YNDA 2X6IA 5T8IA 2OVBA 5AYWD 2FEZA 4DPRA 3ASDA 2PL2A 4P29A 4I9EA 4ACKA 2XPZA 5FZQA 4UWFA 5FWQA 3UPVA 4WWNA 2V4LA 5C1DA 2WXIA 3ZYQA 1OWOA 4B94A 1NA3A 4AEZC 3LY7A 5A23A 5FT9A 3QWWA 1PY1A 2R59A 3LCAA 2VTBA 1HE8A 2L9BA 3FTUA 4HORA 4WNDA 2WQHA 5E76A 3R7RA 3FUIA 3L08A 3SFZA 1FVFA 2GGFA 2M63A 5JJ6A 4B8AA 2J4BA 4JHJA 4KBQA 4KVMA 2I1KA 1HG5A 5KCMA 4ANXA 5G55A 2KATA 2RD0A 4URKA 1MQSA 3ZXSA 3SF4A 4L7TA 5G05J 2IOLA 4GZ5A 2CG3A 1ELRA 1U3CA 4DJAA 1NZNA 2X3MA 3RIBA 4G26A 4U0SA 1SQMA 4KMOA 2IF4A 1E8ZA 5FQ4A 3FTXA 3FDHA 3LPZA 2X6FA 3CIAA 3D9LA 3FUFA 3Q4AB 4NQ0A 5A7DB 3RKVA 2DBAA 3FUHA 5BNWA 1JWFA 4L2LA 4XIFA 4FU3A 3FY4A 4G11A 1HX8A 4I17A 4UQZA 5FQ6A 2WB2A 3FUKA 4A1GA 3ML8A 4APOA 4J8DA 3PNLB 3R9AB 4JHRA 3MKRA 3LEWA 3CK9A 3FFLA 1QZ2A 2CHWA 2WM9A 4BT9A 1KLXA 3Q15A 4IN3B 4WWOA 4CEMA 2Y4TA 1E8YA 1SZ9A 3NF1A 4G23A 4D10C 1Z3YA 3U9WA 2BTDA 4JA9A 3LJ3A 4OVUA 4UWKA 1U3DA 3IV0A 4WWPA 4QFVA 1JWGA 2KM4A 4GZ6A 4I43A 4F1SA 3MZLB 3QARA 3CK8A 4K03A 1EF1C 5G04C 4BT8A 4CDNA 5CMWA 4CDRA 2WXJA 4DLOA 3D3MA 2XCBA 4H7XA 4XZ4A 4CDMA 4RVBA 1HH8A 3ENEA 4BTAA 4HOTA 5JJ7A 4Q94A 2IONA 4J0UA 3S7BA 3QOUA 4NACA 4Y6WA 2WXHA 3G2VA 3D9PA 1GW6A 3MCXA 3G2TA 1UW4B 2VSYA 1A17A 3S7FA 1OWNA 5ARFA 3S2AA 3RRNB 3EIQC 4A3VA 3QWPA 4NURA 3QDNA 4IYPA 1OWMA 1HS6A 3RRMB 4CRWA 1NA0A 1HG2A 4HXIA 2I9CA 3ONKA 4GYWA 4N3AA 4K0RA 3RK6A 1IYGA 4GCOA 3CSTA 2Y4UA 3NZSA 3HIZA 4FADA 1ELKA 3B13A 4N3BA 3AS4A 4E85A 5LCWC 4EECA 5BW8C 4YVQC 2YINA 3I3NA 1JUQA 2VGXB 3QK0A 4PUCA 5BV0A 4EBAA 4HVBA 3EDTB 3PVLA 2VGXA 5D0OD 5ENNA 3LKUA 2WMOA 2NC9A 2Y3AA 5E75A 3UMVA 4BFRA 3B7TA 4JHKA 3SD5A 2V5FA 3OXLA 5LFAA 4GYYA 2PQRA 4MKTA 4ATGA 4GA1A 3LY9A 3E4BA 3EHMA 4U8HA 2KZTB 5J08A 2FF4A 3MYVA 3RO2A 2X6KA 3PE4A 1DNPA 3CV0A 3OTNA 5DIZA 2WMNA 1IHGA 3G2SA 5HQ8A 2I2OA 2IU1A 2UY1B 5AENA 3CLJA 3CVUA 4UWGA 4FC8A 4ACLA 2JEKA 4UWHA 4FP7A 4BWRA 2XRZA 4JA7A 2YHEA 2KC7A 3QKYA 2WXLA 4MS6A 3MGBA 1H2UA 3K9IA 3RJVA 1UN8A 4LERA 3LY8A 3ZVVA 5J90A 4U0ZA 3ZRHA 4AM9A 4FJZA 4GA0A 3MV3B 5JHAA 1H6KA 4PS7A 2XPIA 3ZYMA 2WXMA 4IULA 4EZKA 1HO8A 3AS8A 4B8CB 2LNIA 5AJLA 4J8SA 3ZIMA 3PREA 4Y6CA 2R5SA 5T3RA 4U63A 2IJGX 2J09A 4ANWA 2CFZA 2YHCA 3OXGA 5ANRA 4GZCA 2KCLA 3PH0C 3ZHEA 4I6GA 3D9JA 3ESKA 2RG8A 3FEXA 2NSZA 2WPVA 4UI9C 5CHEE 3TL5A 3SHFA 4APFA 3I5PA 3HDXA 3D9MA 4I2WA 1H2VC 2L0TB 4I1MA 3JQ0A 1KT0A 4GU5A 3VLEA 4M3OA 3TG4A 2NXPA 3P2BA 4PH4B 2LO6A 5JHBA 1TJCA 4XX5A 1UJKA 3L54A 3UT7A 5D0QD 2WQ6A 1KT1A 3FWVA 1IQRA 2J9QA 3QWVA 3RRUA 3URZA 2CG2A 1TJFA 4KZCA 3Q5MA 2KCVA 3DPDA 3ESLA 3SBTB 2XPYA 3FH8A 3CVNA 3IHYA 4LRZA 4R7LA 1WY6A 2YNQA 3OAWA 5LOZA 3SBSA 1TEZA 3EJNA 4RG9A 5EKQD 4FHKA 5A6CA 2IOSA 3B7UX 1DVPA 4N5CA 2OOEA 3HVEA 1WM5A 2XGOA 3JQ1A 3PUJA 2X38A 4I2ZA 2YQ8A 1BPOA 3S7JA 4CCAA 1ZBPA 2IFUA 4FULA 3N71A 2PM6A 2VSXE 4GZ3A 4CGWA 3U66A 4KT6B 1LF8A 3CVXA 3KAEA 5AIJA 3ASGA 5KJKA 1EDUA 3CGHA 3FUJA 4DK5A 3UX4A 3CKBA 3SI5A 4ANUA 5ANLA 2OVFA 4C0EA 3ZYKA 2EQXA 4JC8A 4KXKB 5EX3A 3CHMA 3U3WA 2VSNA 2BF0X 3IEGA 1X5BA 3LVRE 2R17C 1Z6TA 2HM8A 5G2NA 3D9IA 5FZRA 4ANVA 3PE3A 4A55A 2MHKA 5FJYA 1FVHA 3FEYA 4ILHB 1P5QA 3PEUB 1EPUA 3ASHA 1VDYA 3FTWA 4L23A 3CVPA 4BX9A 4I6EA 3AU4A 3FTYA 4GAAA 1QNFA 4L2YA 3UQ3A 4AIFA 5CCLA 3IBEA 2WXFA 5G04J 4PDXA 3APCA 2ILRA 4UI9J 2AW6A 3CHPA 3B7RL 3I4RB 4WNFA 3O48A 4HOUA 2AVPA 4BTBA 4GCNA 4I1AA 4MLPA 1E90A 3FH7A 4AY6A 2XHEA 2OV8A 2XRYA 1UN9A 4GB9A 2FI7A 2QY7A 3D9NA 4YVOA 2GRMA 5FZSA 2CHXA 1SZAA 1YA0A 4I6JA 3CK7A 3EHNA 3JCKC 2LSUA 2PM7A 5C2YA 4ILIA 5FQ8A 1E96B 2GW1A 3Q49B 3D9OA 3EIJA 4Q69A 1QQEA 2C2LA 2UWJG 4PS8A 4EZLA 5BT1A 3MKQB 2WXPA 1HU3A 2A4ZA 3AU5A 4F53A 2P58C 4UQXA 4H7YA 1H19A 4XI0A 3TAXA 3LVQE 3CHOA 4XKCA 3VLDA 3MKQA 1L5JA 1EYHA 2I6HA 3ZEFA 3S7DA 4WNEA 3ONLA 3ZN3A 5LP0A 1OWLA 4CT0A 1B89A 3IHVA 1N54A 3RU0A 4U07A 2C0MA 3G2UA 4W9RA 1E8XA 2PZIA 4RSYA 4U04A 5M72A 2VTBB 2J4DA 4WAFA 4EQFA 1UG3A 2V0PA 1W3BA 3P1UA 4GZDA 4Q96A 2UY1A 4UI9K 4J8FA 5EDSA 4N2SA 2LAIA 5G05C 1JPLA 2C0LA 2WXQA 1ZU2A 3AS5A 3PZDA 3PS6A 1XNFA 2J07A 2XQ0A 4G24A 3ULQA 3I4GA 4DI3A 3GZ1A 4OYSA 3T5XA 2X6JA 2WXRA 4HOQA 4NRHB 3ZYLA 3FH5A 4B89A 2X6HA 2VQ2A 4KVOA 5LX8A 3DBSA 4O6FA 1NP7A 4GA2A 3QC1A 1OUVA 3TXNA 4B0ZA 1INZA 3QAQA 3MEKA 3FUNA 4JW1A 4AV7A 2VYIA 3CVLA 3FUDA 3L16A 4FLHA 5FTPA 3UT8A 3FU0A 4EBAG 4TRQA 4CGVA 4EPZA 3CHQA 4N2QA 3MV2B 4L1BA 5JJTA 5HI7A 3L22A 3LS8A 2BUGA 2FULA 4N3CA 1HZ4A 2XEVA 2A5UA 4MRUA 1ELWA 3JUIA 3MA5A 4I9CA 3D9KA 4J8EA 4TUUA 3PNTB 2CHZA 4UWLA 3WXXA 3ZHEB 4AJWA 2WQ7A 3FP3A 3BG0B 1PAQA 3BG1B 3SZ7A 3CKCA 3HYMB 4LEUA 3C98A 3PEVB 2HYZA 5T4YA 3U4TA 1Y8MA 3APDA 3KEZA 3VTYA 3ZGQA 3ZPJA 3L13A 2VGYA 4XE0A 2MRIA 4C9BB 4I1OB 4KYOB 4JVSA 2VJ8A 3CVWA 1E7VA 3G2WA 3U64A 2GRLA 2HR2A 2DIWA 2L6JA 2XGSA 4OVVA 2KCKA 3FTZA 4WUYA 3TG5A 3FU3A 3QJZA 2V8SE 4JZYA 4F7AA 1N52A 4E6HA 3IKOB 4FJYA 1MHQA 1HF8A 2I1JA 3NZUA 3PRZA 4UQYA 1HFAA 2J49A 3MX3A 4A1SA 4G25A 4HFGA 4A3TA 4KZ0A 1HXIA 2DCPA 2LAHA 3GZSA 5FQ7A 3FHEA 5KJMA 2Q7FA 4GYOA 4FLBA 3APFA 3O4ZA 5BV1A 3ZW3A 2E2EA 4C0MA 3CQGB 3LDZA 4ABNA 5BPPA 3UUXA 4AP2A 1XGWA 3CHSA 3CVQA 3TXMA 3LXUX 3BEEA 3LYAA 4U0UA 4TV3A 3GW4A 4PS3A 4DLQA 1PC2A 2FO7A 4BY6A 3TGOA 2HO1A 3QB2A 4CT4A 2J08A 4HS2A 5ARGA 2AXZA 5KJLA 4G2VA 3UT4A 5EX0A 5AJDA 2AXUA 4N39A 2AXVA 3RO3A 3CHRA 3L17A 4LCTA 5LCWJ 2JLBA 4AXHA 4LUNU 4XKBA 1S0PA 2WXGA 3FU6A 3PDNA 1UJJA 4JEHA 4RG6A 5DBKA 2WXNA 2IQCA 4WNGA 4F3VA 1E7UA 1Y6IA 3GZ2A 4FA6A 4JL0A 3R7QA 2XCCA 4IRUA 3NQPA 2L0IA 3HHMA 4BX8A 5KJNA 1OWPA 3Q47B 2WXOA 3GYZA 3CVYA 3B7SA 4ME2A 3FTVA 3FTSA 4DI4A 3T5VA 4JEUA 1H2TC 1E8WA 3JYSA 2QFCA 2ONDA 2PQNA 2FBNA 1Z3XA 2KZTA 3KD7A 4FHJA 4ILGA 3VLFA 3SGHA 4G1TA 4JXTA 1H0AA 3FULA 4J6IA 3SNXA 3ZFWA 3ML9A 4EZJA 3L6AA 2WXKA 2AWIA 4HOSA 2LSVA 3HVEB 3KS2A 5CMYA 2VSOE 4XI9A 3VTXA 3CQCB 2CFUA 3CSFA 2MOWA 3FUMA 1FCHA 2E0IA 4BSXA 2XGMA 5BUZA 4AY5A 3ASFA 3MJWA 4GMLA 3FUEA 4AOFA 3CVVA 4GPKA 3CR3A 1WAO1 4JPSA 4AVXA 3TJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXF A;  5KJK A;  2BUG A;  4ABN A;  4N3C A;  1HZ4 A;  2XEV A;  4GCO A;  1IYG A;  2Y4U A;  1ELW A;  3CEQ A;  5CCM A;  3MA5 A;  4I9C A;  4J8E A;  4N3B A;  3AS4 A;  4YND A;  3WXX A;  3ZHE B;  3CKB A;  5LCW C;  5BW8 C;  4YVQ C;  2VGX B;  3FP3 A;  5AYW D;  2FEZ A;  4KXK B;  3SZ7 A;  3ASD A;  2PL2 A;  3CKC A;  4I9E A;  3HYM B;  5EX3 A;  4LEU A;  3EDT B;  5FZQ A;  2VSN A;  3UPV A;  3U3W A;  2VGX A;  5D0O D;  3IEG A;  2HYZ A;  4B94 A;  5C1D A;  1NA3 A;  3LKU A;  2NC9 A;  3U4T A;  3LY7 A;  1Y8M A;  3VTY A;  5FT9 A;  3QWW A;  5FZR A;  3ZGQ A;  3LCA A;  2VGY A;  3PE3 A;  3ZPJ A;  2MHK A;  2V5F A;  3OXL A;  5FJY A;  4GYY A;  1P5Q A;  2PQR A;  4KYO B;  4WND A;  4HOR A;  2WQH A;  3ASH A;  3CVP A;  4GA1 A;  3LY9 A;  2HR2 A;  2L6J A;  2XGS A;  3E4B A;  2KCK A;  4WUY A;  3TG5 A;  2FF4 A;  5JJ6 A;  4KBQ A;  3RO2 A;  3PE4 A;  3UQ3 A;  3CV0 A;  4AIF A;  5CCL A;  5DIZ A;  1IHG A;  5HQ8 A;  2KAT A;  5HI7 A;  2UY1 B;  5G04 J;  4UQY A;  4UI9 J;  3SF4 A;  4WNF A;  3O48 A;  4HOU A;  2AVP A;  4G25 A;  4GZ5 A;  5G05 J;  4JA7 A;  3S7J A;  4A1S A;  4BTB A;  4BWR A;  1ELR A;  4GCN A;  1HXI A;  2KC7 A;  3QKY A;  4I1A A;  4AY6 A;  5KJM A;  1NZN A;  3RIB A;  2Q7F A;  4G26 A;  4GYO A;  4U0S A;  2IF4 A;  3K9I A;  2FI7 A;  3RJV A;  2E2E A;  3Q4A B;  3LPZ A;  3LY8 A;  4YVO A;  5FZS A;  1YA0 A;  4NQ0 A;  4U0Z A;  5A7D B;  3RKV A;  3UUX A;  2DBA A;  3CVQ A;  5BNW A;  3CK7 A;  4AM9 A;  4GA0 A;  3MV3 B;  3BEE A;  3LYA A;  2XPI A;  2LSU A;  4XIF A;  4U0U A;  3GW4 A;  4N3A A;  1E96 B;  2GW1 A;  1PC2 A;  3AS8 A;  3Q49 B;  2FO7 A;  3TGO A;  1QQE A;  2C2L A;  2HO1 A;  2LNI A;  2UWJ G;  4I17 A;  4UQZ A;  5BT1 A;  5ARG A;  5KJL A;  4G2V A;  2R5S A;  4Y6C A;  2P58 C;  4J8D A;  4APO A;  5EX0 A;  4UQX A;  4JHR A;  3MKR A;  4H7Y A;  4N39 A;  4XI0 A;  3R9A B;  3TAX A;  2YHC A;  3OXG A;  3CK9 A;  3RO3 A;  2KCL A;  3FFL A;  1QZ2 A;  3ZHE A;  2I6H A;  5LCW J;  2JLB A;  3ESK A;  4BT9 A;  3S7D A;  1KLX A;  5DBK A;  4WNE A;  3PDN A;  3Q15 A;  4IN3 B;  4RG6 A;  4F3V A;  2WPV A;  4UI9 C;  2Y4T A;  4WNG A;  5CHE E;  3ZN3 A;  3NF1 A;  3GZ2 A;  4G23 A;  1B89 A;  4JL0 A;  3RU0 A;  4JA9 A;  2XCC A;  4U07 A;  2C0M A;  4I2W A;  5KJN A;  4W9R A;  3Q47 B;  2PZI A;  3GYZ A;  4U04 A;  5M72 A;  4GZ6 A;  4ME2 A;  1KT0 A;  3CK8 A;  4EQF A;  5G04 C;  1W3B A;  3TG4 A;  4UI9 K;  4BT8 A;  2UY1 A;  4N2S A;  3JYS A;  4J8F A;  4CDR A;  2QFC A;  5G05 C;  1TJC A;  2OND A;  2FBN A;  2PQN A;  2XCB A;  4H7X A;  2C0L A;  3AS5 A;  1ZU2 A;  5D0Q D;  4G24 A;  1HH8 A;  1KT1 A;  1XNF A;  3FWV A;  3KD7 A;  3ULQ A;  2J9Q A;  3ZFW A;  4BTA A;  3QWV A;  4G1T A;  3URZ A;  3GZ1 A;  5JJ7 A;  4HOT A;  4J0U A;  4HOQ A;  3QOU A;  4NRH B;  3Q5M A;  2KCV A;  3S7B A;  4HOS A;  2LSV A;  4Y6W A;  3CVN A;  2VQ2 A;  3KS2 A;  4O6F A;  4GA2 A;  1OUV A;  2VSY A;  4RG9 A;  4XI9 A;  1A17 A;  5EKQ D;  3MEK A;  3VTX A;  5A6C A;  3S7F A;  4N5C A;  1FCH A;  2OOE A;  1WM5 A;  2XGO A;  4I2Z A;  5ARF A;  2VYI A;  2YQ8 A;  3CVL A;  5FTP A;  1ZBP A;  2IFU A;  2XGM A;  3QDN A;  3QWP A;  3N71 A;  3ASF A;  4AY5 A;  4CGV A;  4GZ3 A;  4CGW A;  4N2Q A;  1NA0 A;  3MV2 B;  4GPK A;  1WAO 1;  5JJT A;  3KAE A;  4GYW A;  3ASG A; 
#chains in the Genus database with same CATH topology
 2ZU6 B;  2GRN B;  2WVI A;  4O1P A;  3ASD A;  3DEP A;  4WWN A;  5C1D A;  3TWQ A;  2R59 A;  5CER B;  1HE8 A;  2WQH A;  3L08 A;  1FVF A;  2RFM A;  2I1K A;  1AP7 A;  4ANX A;  2XEE A;  4KMO A;  2IF4 A;  2X6F A;  2P2C P;  1O1R A;  3FY4 A;  1Z5S C;  4APO A;  3R9A B;  4JHR A;  3C72 A;  4G8L A;  3FFL A;  3E37 A;  2L6B A;  4BT9 A;  3PZ2 A;  3Q15 A;  4IN3 B;  4WWO A;  1SZ9 A;  1Z3Y A;  3U9W A;  3LJ3 A;  4OVU A;  4UWK A;  1U3D A;  4WWP A;  4C48 B;  1NI1 A;  2OEV A;  5G04 C;  5CMW A;  5KNG A;  3PZ1 A;  5ENO D;  4H7X A;  3EU5 A;  4RVB A;  3ENE A;  4J0U A;  3MCX A;  3G2T A;  1O5M A;  3EIQ C;  1HS6 A;  2KBX A;  2I9C A;  3ONK A;  4N3A A;  2Y4U A;  2IO2 C;  3AS4 A;  4LNG A;  5LCW C;  4EEC A;  4YVQ C;  2VGX B;  2EIK E;  4PUC A;  5CEC B;  2H6H A;  2KXP C;  5ENN A;  2WMO A;  3TWX A;  2NC9 A;  1KPS B;  4BFR A;  3Q7A A;  4U8H A;  2KZT B;  1DNP A;  1IHG A;  2I2O A;  2GRO B;  5AEN A;  1BU9 A;  4UWG A;  4ACL A;  4BWR A;  3ABL E;  4O1O A;  3QKY A;  1N4R A;  2WXL A;  2V5Q C;  5KNH D;  4X8Q A;  1MZC A;  1UN8 A;  5JHA A;  4GA0 A;  1HO8 A;  1O1S A;  3AS8 A;  4B8C B;  5AJL A;  3UKU G;  1S63 A;  3ZIM A;  3L82 A;  2EIL E;  4U7E B;  4I6G A;  2RG8 A;  3HDX A;  3D9M A;  4I2W A;  4CYM D;  3JQ0 A;  4DX1 A;  4GU5 A;  4M3O A;  3TG4 A;  3DEO A;  3P2B A;  2LO6 A;  5JHB A;  5D0Q D;  5JMN D;  3ESL A;  3SBT B;  3CVN A;  1WY6 A;  3OAW A;  3WG7 E;  3EJN A;  1G3N B;  4RG9 A;  4FHK A;  4N5C A;  1BPO A;  1ZBP A;  2IFU A;  4GZ3 A;  4KT6 B;  1RZ4 A;  1SA4 A;  3CGH A;  4DK5 A;  3UX4 A;  3SI5 A;  4C0E A;  3ZNG A;  5EX3 A;  5KWD A;  4CZ2 D;  3DSS A;  5G2N A;  3AG1 E;  3D9I A;  5FZR A;  3SO8 A;  3FTW A;  3AU4 A;  3FTY A;  1QNF A;  3UQ3 A;  5EIL A;  3IBE A;  5ENR D;  3APC A;  2ILR A;  2AW6 A;  4BTB A;  4GCN A;  4I1A A;  4MLP A;  1E90 A;  1K1B A;  1H6P A;  2FI7 A;  2QY7 A;  4YVO A;  1YA0 A;  5EYL A;  4I6J A;  3JCK C;  3V31 A;  5FQ8 A;  4EZL A;  3D9O A;  2C2L A;  2PNN A;  2A4Z A;  3AU5 A;  1MJ0 A;  2P58 C;  2XEN A;  3TAX A;  3LVQ E;  2F8Y A;  1JCQ A;  4WNE A;  2EIN E;  3ZN3 A;  3IHV A;  1N54 A;  4U07 A;  3G2U A;  5M72 A;  3HXF A;  2V0P A;  4J8F A;  2C0L A;  3PS6 A;  3PZD A;  1XNF A;  3HG0 D;  2XQ0 A;  3I4G A;  4ZHB A;  3T5X A;  3UM0 A;  3ZYL A;  2ZIS A;  4GA2 A;  3ZXP A;  2F37 A;  4B0Z A;  1JCR A;  3RAU A;  4AV7 A;  3C3R A;  3CVL A;  3L16 A;  5FTP A;  4EBA G;  1N4P A;  4TRQ A;  3V79 K;  3EU9 A;  4GTV A;  2ZIR A;  3ABM E;  2FUL A;  2H6G A;  4N3C A;  1HZ4 A;  2XEV A;  2A5U A;  2QZA A;  4MRU A;  4I9C A;  3HRA A;  3D9K A;  4UWL A;  3PNT B;  3ZHE B;  3BQO A;  3C98 A;  5ENQ D;  3NBN B;  2DWZ A;  3VTY A;  1Y8M A;  3L13 A;  2VGY A;  3R9M A;  4C9B B;  2GRL A;  2L6J A;  4F7A A;  4FJY A;  3UIN C;  1MHQ A;  2B0O E;  2I1J A;  3NZU A;  4UQY A;  2R02 A;  4HFG A;  4KZ0 A;  2LAH A;  4HNA D;  3FHE A;  4FLB A;  5HS0 A;  3CQG B;  5BPP A;  4AP2 A;  5CRU A;  3TXM A;  4DX5 D;  3ZU7 B;  3JXI A;  4DX2 A;  3PZ4 A;  3UT4 A;  4LNU D;  4B93 B;  3RO3 A;  3CHR A;  3UXG A;  5LCW J;  4AXH A;  1S0P A;  3FU6 A;  4JEH A;  1Y6I A;  4JL0 A;  3NQP A;  4BX8 A;  1WDY A;  1TN8 A;  4DI4 A;  3FTS A;  1IXV A;  2QFC A;  4LSZ E;  2FBN A;  4DX6 D;  3KD7 A;  3PZ3 A;  4ILG A;  4JXT A;  3KS2 A;  5CMY A;  3VTX A;  2E0I A;  3DSU A;  5BUZ A;  3ASF A;  3MJW A;  3FUE A;  3UIP C;  1WAO 1;  4JPS A;  3TJP A;  4V3I A;  3CEQ A;  3ISM C;  3T8M A;  4YND A;  2OVB A;  2FEZ A;  4DPR A;  4ACK A;  2PL2 A;  4I9E A;  1OT8 A;  5CRV A;  2WXI A;  1NA3 A;  5A23 A;  2VTB A;  3QWW A;  3LCA A;  3Q9U C;  2L9B A;  3FTU A;  2LUH A;  5E76 A;  3R7R A;  2GGF A;  2J4B A;  2EIJ E;  1MQS A;  3T8K A;  3ZXS A;  3SF4 A;  4GZ5 A;  2OCC E;  1ELR A;  4DJA A;  3RIB A;  1E8Z A;  1TYQ G;  3CIA A;  2F0Y A;  4LG6 A;  4XIF A;  4FU3 A;  3DXM G;  4UQZ A;  3FUK A;  3PNL B;  3E30 A;  3CK9 A;  1QZ2 A;  2CHW A;  2WM9 A;  3NF1 A;  1SA5 A;  4D10 C;  4GTQ A;  2BTD A;  3EHQ A;  3IV0 A;  4QFV A;  5D66 A;  2KM4 A;  4GZ6 A;  4F1S A;  4BT8 A;  2WXJ A;  2NYJ A;  4DLO A;  2XCB A;  4XZ4 A;  1HH8 A;  1X81 A;  4BTA A;  5JJ7 A;  4K5C A;  2ION A;  3RRN B;  4A3V A;  4LNB A;  1BD8 A;  3QDN A;  4IYP A;  3V2O A;  1NA0 A;  4K0R A;  3RK6 A;  4GCO A;  2J8S D;  3CST A;  4FAD A;  3HIZ A;  1ELK A;  5BW8 C;  3QK0 A;  2P9I G;  4YDW A;  5BV0 A;  4EBA A;  5D0O D;  1TNZ A;  5B1B E;  2Y3A A;  5E75 A;  3UMV A;  3AG3 E;  4U96 D;  3SD5 A;  3OXL A;  4ATG A;  3DST A;  4GA1 A;  3E4B A;  3EHM A;  2QYJ A;  3MYV A;  3PE4 A;  3CV0 A;  5AQ9 A;  2IU1 A;  2UY1 B;  1IHB A;  5FIO A;  4FC8 A;  2JEK A;  1O1T A;  4TXP A;  2YHE A;  5EYP F;  2R05 A;  4MS6 A;  3RJV A;  4LER A;  3ZRH A;  3Q78 A;  1H6K A;  2XPI A;  3ZYM A;  4IUL A;  4EZK A;  2LNI A;  4Y6C A;  2CFZ A;  3D9J A;  3ESK A;  5CHE E;  4GTP A;  3SHF A;  5AQA A;  4APF A;  5FIN A;  1H2V C;  2L0T B;  1OCC E;  4I1M A;  3IXE A;  1Q2Z A;  1TJC A;  1QYM A;  4XX5 A;  3L54 A;  1OXJ A;  3UT7 A;  3FWV A;  3DSX A;  3QWV A;  4YDY A;  3URZ A;  2CG2 A;  1TJF A;  3Q5M A;  1MX2 A;  5LOZ A;  3SBS A;  4K5A B;  2YNQ A;  5EKQ D;  2Y1L E;  5KBA A;  3HVE A;  1WM5 A;  3JQ1 A;  3PUJ A;  2YQ8 A;  3S7J A;  4FUL A;  1TNO A;  3N71 A;  4HRN A;  4CGW A;  4HI8 A;  3EHR A;  3FUJ A;  4U8Y D;  3X2Q E;  1U2V G;  4YDO A;  3CKB A;  4RQI A;  4KXK B;  3CHM A;  3U3W A;  2IO3 C;  2BF0 X;  3TWR A;  1X5B A;  1Z6T A;  2HM8 A;  5CBN A;  5FJY A;  1FVH A;  3FEY A;  1JCS A;  4ILH B;  1P5Q A;  4I6E A;  5ENT D;  2WXF A;  5G04 J;  4UI9 J;  3B7R L;  4WNF A;  3O48 A;  2P9P G;  3UIO C;  3FH7 A;  2GRM A;  2CHX A;  4M7C A;  2PM7 A;  4ILI A;  3MKQ B;  5EID A;  4N5Q A;  3Q75 A;  2XZD G;  2I6H A;  3V2X A;  4UUC A;  2OEW A;  1N95 A;  3S7D A;  3ZKJ A;  2RFA A;  4ATZ D;  4CT0 A;  5AAO A;  1B89 A;  2C0M A;  3ASN E;  3UM2 A;  4WAF A;  4EQF A;  1UG3 A;  1W3B A;  3P1U A;  4UI9 K;  5CBO A;  5EDS A;  3C3Q A;  2LAI A;  4TXR A;  5G05 C;  1ZU2 A;  2J07 A;  5CED B;  4HB5 A;  4HOQ A;  4B89 A;  3FH5 A;  5LX8 A;  3DBS A;  4O6F A;  1NP7 A;  3B95 A;  3FUN A;  4JW1 A;  4GMR A;  3UM1 A;  3FUD A;  4EPZ A;  4N2Q A;  5JJT A;  2BUG A;  1ELW A;  3JUI A;  4AJW A;  4TUU A;  2LXL A;  3CKC A;  3HYM B;  2HYZ A;  2P9K G;  3ZGQ A;  3APD A;  3ULY A;  3ZPJ A;  4XE0 A;  4TXQ A;  4I1O B;  4JVS A;  1E7V A;  3U64 A;  2XGS A;  3FTZ A;  3FU3 A;  2EIM E;  3QJZ A;  2V8S E;  1N52 A;  4E6H A;  1HF8 A;  1S64 A;  1HFA A;  2BKK B;  3MX3 A;  4GTT A;  2DCP A;  5KJM A;  1DCQ A;  3APF A;  2DYS E;  1XGW A;  4HI9 A;  3LXU X;  2ETC A;  4F6R D;  1PC2 A;  3TGO A;  3QB2 A;  5EIB E;  2AXZ A;  4G2V A;  3ZUV B;  2P9N G;  4N39 A;  1BLX B;  1YMP A;  4LUN U;  2DZN A;  3SY2 A;  1OY3 D;  3PDN A;  1UJJ A;  2WXN A;  3GZ2 A;  3R7Q A;  4DX7 D;  2XCC A;  3HHM A;  3ABK E;  3CVY A;  3B7S A;  4ME2 A;  1V54 E;  2KZT A;  4FHJ A;  3VLF A;  3ML9 A;  2WXK A;  1RW2 A;  3HVE B;  4L9P A;  2VSO E;  4XI9 A;  3CQC B;  4NIK A;  3CSF A;  2MOW A;  4BSX A;  2XGM A;  4AOF A;  1N11 A;  4HRM B;  2R2L A;  4HOR A;  4AVX A;  4HLE A;  3QNK A;  4GMJ A;  5CCM A;  4G8K A;  3FU5 A;  3DPY A;  2XPZ A;  4B94 A;  1OWO A;  4AEZ C;  3LY7 A;  1FT1 A;  3FUI A;  4JHJ A;  4KBQ A;  5G55 A;  2RD0 A;  4L7T A;  5G05 J;  2CG3 A;  1U3C A;  1NZN A;  1SQM A;  4K5B A;  5FQ4 A;  3FTX A;  3LPZ A;  3Q4A B;  3D9L A;  3FUF A;  5A7D B;  4BES A;  1JWF A;  2ZGD A;  2QYU A;  3AG4 E;  1HX8 A;  5FQ6 A;  4J8D A;  3ULE G;  1IKN D;  1E8Y A;  4GTO A;  4JA9 A;  4QQI A;  2IEJ A;  3MZL B;  3QAR A;  4K03 A;  1EF1 C;  3UKR G;  3SFY A;  4HBD A;  4CDM A;  1FT2 A;  3C5R A;  4HOT A;  5CEA A;  4Q94 A;  3S7B A;  4NAC A;  3D9P A;  1UW4 B;  3F6Q A;  3QWP A;  4CRW A;  1OWM A;  1FPP A;  1IYG A;  3HXE A;  3J5Q B;  3B13 A;  1N4Q A;  3I3N A;  1JUQ A;  4YDE A;  3JXJ A;  3EDT B;  4RLY A;  2VGX A;  3JUE A;  3LKU A;  4JHK A;  2V5F A;  4GYY A;  3LY9 A;  3W9F A;  2FF4 A;  2X6K A;  3OTN A;  5DIZ A;  2WMN A;  2ZGG A;  5H7P A;  4UWH A;  1MYO A;  2Y69 E;  3AG2 E;  4JA7 A;  2KC7 A;  3TWT A;  4A63 B;  4GTR A;  3K9I A;  5ENP D;  3LY8 A;  5J90 A;  1D8E A;  4AM9 A;  3MV3 B;  4PS7 A;  1MX4 A;  2R5S A;  4U63 A;  2IJG X;  2J09 A;  5ANR A;  3OXG A;  2KCL A;  1SW6 A;  5BXU A;  3ZHE A;  2HE0 A;  3FEX A;  3TL5 A;  3I5P A;  1LD7 A;  3EUV A;  5IY5 E;  3VLE A;  3DSV A;  3TWV A;  4PH4 B;  1UJK A;  2WQ6 A;  1KT1 A;  1IQR A;  2A5E A;  3RRU A;  4KZC A;  3DPD A;  2XPY A;  3IHY A;  4LRZ A;  1TEZ A;  2IOS A;  3B7U X;  2DVW A;  2IY0 C;  2OOE A;  4HRL A;  1LF8 A;  5KJK A;  1EDU A;  1BI8 B;  4ANU A;  3ZYK A;  4JC8 A;  3IEG A;  2R17 C;  1ZB1 A;  4A55 A;  2MHK A;  1EPU A;  1VDY A;  4L23 A;  3CVP A;  4BX9 A;  2XZT G;  4GAA A;  4AIF A;  2BKG A;  3I4R B;  2AVP A;  4AY6 A;  1SVX A;  2OV8 A;  3E33 A;  5JA4 D;  4GB9 A;  2AJA A;  3UI2 A;  1NL4 A;  1E96 B;  2GW1 A;  4Q69 A;  3EIJ A;  1QQE A;  2UWJ G;  4PS8 A;  5BT1 A;  2WXP A;  2MYO A;  1N9A A;  4Z68 A;  4UQX A;  1L5J A;  3ZEF A;  3ONL A;  5LP0 A;  1TNU A;  2PZI A;  4RSY A;  2VTB B;  4Q96 A;  4GZD A;  1JPL A;  1K3Z D;  3HXC A;  2WXQ A;  4G24 A;  3GZ1 A;  4OYS A;  2X6J A;  4NRH B;  4GPM A;  3TXN A;  3QC1 A;  1OUV A;  3UT8 A;  4OAU C;  3FU0 A;  3CHQ A;  3MV2 B;  5HI7 A;  3L22 A;  3MA5 A;  4J8E A;  3WXX A;  2WQ7 A;  3FP3 A;  3BG0 B;  1PAQ A;  3BG1 B;  4LEU A;  5HRY A;  5T4Y A;  2VGE A;  2Y0B G;  1K8K G;  4KYO B;  2VJ8 A;  3CVW A;  5BXO A;  2KCK A;  4WUY A;  3TG5 A;  3PRZ A;  2J49 A;  4A1S A;  4G25 A;  4A3T A;  4DRX E;  3GZS A;  2Q7F A;  5BV1 A;  1N0R A;  3ZW3 A;  2E2E A;  4ABN A;  3LDZ A;  3CVQ A;  3BEE A;  3LYA A;  2JAB A;  4PS3 A;  4XEI G;  4BY6 A;  2HO1 A;  5D2M C;  2J08 A;  5KJL A;  5EX0 A;  5AJD A;  3NAW A;  2AXU A;  1OCZ E;  1AWC B;  4XKB A;  5DBK A;  4RG6 A;  2IQC A;  1E7U A;  4FA6 A;  4IRU A;  3TWU A;  3Q47 B;  2WXO A;  1LTX A;  2P9S G;  3GYZ A;  3T5V A;  4JEU A;  1H2T C;  2P9U G;  3JYS A;  2OND A;  3SNX A;  3FUL A;  3L6A A;  4HOS A;  2AWI A;  3BUA A;  4EHM A;  3TWW A;  3FUM A;  1FCH A;  1K1A A;  4AY5 A;  2P9L G;  4GML A;  3CVV A;  2F8X K;  3CR3 A;  4F1P A;  3OXF A;  1IQU A;  3PUK A;  4J8Y A;  2X6I A;  5T8I A;  5ENS D;  5AYW D;  4P29 A;  5FWQ A;  3ASO E;  4UWF A;  5FZQ A;  3UPV A;  2V4L A;  3W9G A;  3ZYQ A;  5FT9 A;  1PY1 A;  4WND A;  3SFZ A;  2M63 A;  2H6I A;  5JJ6 A;  4B8A A;  5AN8 A;  4KVM A;  1HG5 A;  5KCM A;  2KAT A;  4URK A;  2IOL A;  4OAV B;  2X3M A;  4G26 A;  4U0S A;  1N0Q A;  3FDH A;  4NQ0 A;  5BNW A;  3RKV A;  2DBA A;  3FUH A;  3LJN A;  4L2L A;  3E32 A;  4G11 A;  4I17 A;  2WB2 A;  4A1G A;  3ML8 A;  1TNY A;  3MKR A;  3LEW A;  1S70 B;  2XS1 A;  1LD8 A;  5HKP A;  2R03 A;  1KLX A;  2DZO A;  4CEM A;  1YCS B;  3HXD A;  2Y4T A;  4G23 A;  1JWG A;  4I43 A;  3CK8 A;  4CDN A;  4CDR A;  3D3M A;  2B6C A;  3SFX A;  4ZFH A;  1NFI E;  2ZXW E;  3QOU A;  4Y6W A;  2WXH A;  3G2V A;  1GW6 A;  4JD2 G;  2VSY A;  1A17 A;  4JB8 P;  3S7F A;  1OWN A;  5ARF A;  3S2A A;  4NUR A;  3RRM B;  1HG2 A;  4HXI A;  4GYW A;  1DC2 A;  3NZS A;  4TUM A;  4N3B A;  2DYR E;  3AJI A;  1OCR E;  2YIN A;  3T9K A;  1TNB A;  4BSZ B;  4HVB A;  3PVL A;  3B7T A;  3AAA C;  5LFA A;  4MKT A;  2PQR A;  2FO1 E;  1H6O A;  3Q79 A;  5J08 A;  3RO2 A;  3G2S A;  1TR4 A;  5HQ8 A;  1KZP A;  3CLJ A;  3CVU A;  1A5E A;  2XRZ A;  4FP7 A;  2GRP B;  3MGB A;  1H2U A;  3ZVV A;  4U0Z A;  4FJZ A;  3NB2 A;  2BED A;  2WXM A;  3NOG D;  4J8S A;  3PRE A;  5T3R A;  2XS8 A;  4ANW A;  2YHC A;  4GZC A;  3PH0 C;  5AQB A;  3V30 A;  2NSZ A;  2WPV A;  4UI9 C;  2XEH A;  4BET A;  1TN7 A;  1KT0 A;  2ETB A;  2NXP A;  3E34 A;  2J9Q A;  3L9T A;  2KCV A;  1MX6 A;  3C3O A;  4R7L A;  3FH8 A;  5A6C A;  3NOC D;  1DVP A;  2XGO A;  4E85 A;  4I2Z A;  2X38 A;  4CCA A;  2PM6 A;  2VSX E;  3U66 A;  2LXM A;  3CVX A;  3KAE A;  5AIJ A;  3ASG A;  3UTM A;  5ANL A;  2OVF A;  2EQX A;  2VSN A;  3LVR E;  4GTS A;  1QBQ A;  4ANV A;  3PE3 A;  3PEU B;  3BU8 A;  3KSQ A;  3ASH A;  2ETA A;  2GRQ B;  4L2Y A;  3DXK G;  5CCL A;  4MBG A;  1WG0 A;  4PDX A;  3CHP A;  3Q7F A;  4HOU A;  4GTM A;  2XHE A;  2XRY A;  1UN9 A;  3D9N A;  1N4S A;  5FZS A;  1SZA A;  3CK7 A;  3EHN A;  2LSU A;  5C2Y A;  1N94 A;  4J7W A;  3Q49 B;  1HU3 A;  4F53 A;  4H7Y A;  1H19 A;  4XI0 A;  3CHO A;  1YYH A;  4XKC A;  3VLD A;  3MKQ A;  4BER A;  1EYH A;  5AQ7 A;  1OWL A;  3J5P A;  5B3S E;  3RU0 A;  4W9R A;  1E8X A;  4U04 A;  2J4D A;  2UY1 A;  4N2S A;  3AS5 A;  3SQV A;  3ULQ A;  3D9H A;  4DI3 A;  2WXR A;  2X6H A;  2VQ2 A;  4KVO A;  1V55 E;  1INZ A;  3QAQ A;  3MEK A;  3Q9N C;  2VYI A;  4FLH A;  4CGV A;  4L1B A;  4U95 D;  3LS8 A;  1D8D A;  1KZO A;  5EN5 D;  2CHZ A;  3TWS A;  3SZ7 A;  4DUI A;  3PEV B;  3U4T A;  3KEZ A;  3KEA A;  2MRI A;  3G2W A;  2HR2 A;  2DIW A;  4OVV A;  4O60 A;  3HXB A;  5B1A E;  4JZY A;  2QC9 A;  3IKO B;  3DWL G;  3UM3 A;  4HLL A;  2GRR B;  1HXI A;  2RKK A;  5FQ7 A;  4GYO A;  3O4Z A;  3DRA A;  4C0M A;  3UUX A;  3CHS A;  3B7B A;  4U0U A;  4TV3 A;  3GW4 A;  4DLQ A;  2V4H C;  2H6F A;  2FO7 A;  4CT4 A;  4HS2 A;  5ARG A;  3KSL A;  3RSE G;  2AXV A;  3L17 A;  4BEP A;  4LCT A;  2JLB A;  2WXG A;  1OCO E;  4F3V A;  4WNG A;  3Q73 A;  1D9S A;  2L0I A;  1UOH A;  5KJN A;  1OWP A;  3FTV A;  4HQD A;  1DCE A;  1E8W A;  3DSW A;  2PQN A;  5AAR A;  1Z3X A;  5ITZ F;  3ZFW A;  3SGH A;  4G1T A;  1H0A A;  4J6I A;  1BI7 B;  4EZJ A;  2LSV A;  2CFU A;  1TN6 A;  4U8V D;  4GPK A; 
#chains in the Genus database with same CATH homology
 3OXF A;  2ZU6 B;  4HLE A;  1IQU A;  3PUK A;  4V3I A;  3QNK A;  3CEQ A;  4GMJ A;  3T8M A;  5CCM A;  2WVI A;  3FU5 A;  4YND A;  2X6I A;  5T8I A;  2OVB A;  5AYW D;  2FEZ A;  4DPR A;  3ASD A;  2PL2 A;  4P29 A;  4I9E A;  4ACK A;  2XPZ A;  5FZQ A;  4UWF A;  5FWQ A;  3UPV A;  4WWN A;  2V4L A;  5C1D A;  2WXI A;  3ZYQ A;  1OWO A;  4B94 A;  1NA3 A;  4AEZ C;  3LY7 A;  5A23 A;  5FT9 A;  3QWW A;  1PY1 A;  2R59 A;  3LCA A;  2VTB A;  1HE8 A;  2L9B A;  3FTU A;  4HOR A;  4WND A;  2WQH A;  5E76 A;  3R7R A;  3FUI A;  3L08 A;  3SFZ A;  1FVF A;  2GGF A;  2M63 A;  5JJ6 A;  4B8A A;  2J4B A;  4JHJ A;  4KBQ A;  4KVM A;  2I1K A;  1HG5 A;  5KCM A;  4ANX A;  5G55 A;  2KAT A;  2RD0 A;  4URK A;  1MQS A;  3ZXS A;  3SF4 A;  4L7T A;  5G05 J;  2IOL A;  4GZ5 A;  2CG3 A;  1ELR A;  1U3C A;  4DJA A;  1NZN A;  2X3M A;  3RIB A;  4G26 A;  4U0S A;  1SQM A;  4KMO A;  2IF4 A;  1E8Z A;  5FQ4 A;  3FTX A;  3FDH A;  3LPZ A;  2X6F A;  3CIA A;  3D9L A;  3FUF A;  3Q4A B;  4NQ0 A;  5A7D B;  3RKV A;  2DBA A;  3FUH A;  5BNW A;  1JWF A;  4L2L A;  4XIF A;  4FU3 A;  3FY4 A;  4G11 A;  1HX8 A;  4I17 A;  4UQZ A;  5FQ6 A;  2WB2 A;  3FUK A;  4A1G A;  3ML8 A;  4APO A;  4J8D A;  3PNL B;  3R9A B;  4JHR A;  3MKR A;  3LEW A;  3CK9 A;  3FFL A;  1QZ2 A;  2CHW A;  2WM9 A;  4BT9 A;  1KLX A;  3Q15 A;  4IN3 B;  4WWO A;  4CEM A;  2Y4T A;  1E8Y A;  1SZ9 A;  3NF1 A;  4G23 A;  4D10 C;  1Z3Y A;  3U9W A;  2BTD A;  4JA9 A;  3LJ3 A;  4OVU A;  4UWK A;  1U3D A;  3IV0 A;  4WWP A;  4QFV A;  1JWG A;  2KM4 A;  4GZ6 A;  4I43 A;  4F1S A;  3MZL B;  3QAR A;  3CK8 A;  4K03 A;  1EF1 C;  5G04 C;  4BT8 A;  4CDN A;  5CMW A;  4CDR A;  2WXJ A;  4DLO A;  3D3M A;  2XCB A;  4H7X A;  4XZ4 A;  4CDM A;  4RVB A;  1HH8 A;  3ENE A;  4BTA A;  4HOT A;  5JJ7 A;  4Q94 A;  2ION A;  4J0U A;  3S7B A;  3QOU A;  4NAC A;  4Y6W A;  2WXH A;  3G2V A;  3D9P A;  1GW6 A;  3MCX A;  3G2T A;  1UW4 B;  2VSY A;  1A17 A;  3S7F A;  1OWN A;  5ARF A;  3S2A A;  3RRN B;  3EIQ C;  4A3V A;  3QWP A;  4NUR A;  3QDN A;  4IYP A;  1OWM A;  1HS6 A;  3RRM B;  4CRW A;  1NA0 A;  1HG2 A;  4HXI A;  2I9C A;  3ONK A;  4GYW A;  4N3A A;  4K0R A;  3RK6 A;  1IYG A;  4GCO A;  3CST A;  2Y4U A;  3NZS A;  3HIZ A;  4FAD A;  1ELK A;  3B13 A;  4N3B A;  3AS4 A;  4E85 A;  5LCW C;  4EEC A;  5BW8 C;  4YVQ C;  2YIN A;  3I3N A;  1JUQ A;  2VGX B;  3QK0 A;  4PUC A;  5BV0 A;  4EBA A;  4HVB A;  3EDT B;  3PVL A;  2VGX A;  5D0O D;  5ENN A;  3LKU A;  2WMO A;  2NC9 A;  2Y3A A;  5E75 A;  3UMV A;  4BFR A;  3B7T A;  4JHK A;  3SD5 A;  2V5F A;  3OXL A;  5LFA A;  4GYY A;  2PQR A;  4MKT A;  4ATG A;  4GA1 A;  3LY9 A;  3E4B A;  3EHM A;  4U8H A;  2KZT B;  5J08 A;  2FF4 A;  3MYV A;  3RO2 A;  2X6K A;  3PE4 A;  1DNP A;  3CV0 A;  3OTN A;  5DIZ A;  2WMN A;  1IHG A;  3G2S A;  5HQ8 A;  2I2O A;  2IU1 A;  2UY1 B;  5AEN A;  3CLJ A;  3CVU A;  4UWG A;  4FC8 A;  4ACL A;  2JEK A;  4UWH A;  4FP7 A;  4BWR A;  2XRZ A;  4JA7 A;  2YHE A;  2KC7 A;  3QKY A;  2WXL A;  4MS6 A;  3MGB A;  1H2U A;  3K9I A;  3RJV A;  1UN8 A;  4LER A;  3LY8 A;  3ZVV A;  5J90 A;  4U0Z A;  3ZRH A;  4AM9 A;  4FJZ A;  4GA0 A;  3MV3 B;  5JHA A;  1H6K A;  4PS7 A;  2XPI A;  3ZYM A;  2WXM A;  4IUL A;  4EZK A;  1HO8 A;  3AS8 A;  4B8C B;  2LNI A;  5AJL A;  4J8S A;  3ZIM A;  3PRE A;  4Y6C A;  2R5S A;  5T3R A;  4U63 A;  2IJG X;  2J09 A;  4ANW A;  2CFZ A;  2YHC A;  3OXG A;  5ANR A;  4GZC A;  2KCL A;  3PH0 C;  3ZHE A;  4I6G A;  3D9J A;  3ESK A;  2RG8 A;  3FEX A;  2NSZ A;  2WPV A;  4UI9 C;  5CHE E;  3TL5 A;  3SHF A;  4APF A;  3I5P A;  3HDX A;  3D9M A;  4I2W A;  1H2V C;  2L0T B;  4I1M A;  3JQ0 A;  1KT0 A;  4GU5 A;  3VLE A;  4M3O A;  3TG4 A;  2NXP A;  3P2B A;  4PH4 B;  2LO6 A;  5JHB A;  1TJC A;  4XX5 A;  1UJK A;  3L54 A;  3UT7 A;  5D0Q D;  2WQ6 A;  1KT1 A;  3FWV A;  1IQR A;  2J9Q A;  3QWV A;  3RRU A;  3URZ A;  2CG2 A;  1TJF A;  4KZC A;  3Q5M A;  2KCV A;  3DPD A;  3ESL A;  3SBT B;  2XPY A;  3FH8 A;  3CVN A;  3IHY A;  4LRZ A;  4R7L A;  1WY6 A;  2YNQ A;  3OAW A;  5LOZ A;  3SBS A;  1TEZ A;  3EJN A;  4RG9 A;  5EKQ D;  4FHK A;  5A6C A;  2IOS A;  3B7U X;  1DVP A;  4N5C A;  2OOE A;  3HVE A;  1WM5 A;  2XGO A;  3JQ1 A;  3PUJ A;  2X38 A;  4I2Z A;  2YQ8 A;  1BPO A;  3S7J A;  4CCA A;  1ZBP A;  2IFU A;  4FUL A;  3N71 A;  2PM6 A;  2VSX E;  4GZ3 A;  4CGW A;  3U66 A;  4KT6 B;  1LF8 A;  3CVX A;  3KAE A;  5AIJ A;  3ASG A;  5KJK A;  1EDU A;  3CGH A;  3FUJ A;  4DK5 A;  3UX4 A;  3CKB A;  3SI5 A;  4ANU A;  5ANL A;  2OVF A;  4C0E A;  3ZYK A;  2EQX A;  4JC8 A;  4KXK B;  5EX3 A;  3CHM A;  3U3W A;  2VSN A;  2BF0 X;  3IEG A;  1X5B A;  3LVR E;  2R17 C;  1Z6T A;  2HM8 A;  5G2N A;  3D9I A;  5FZR A;  4ANV A;  3PE3 A;  4A55 A;  2MHK A;  5FJY A;  1FVH A;  3FEY A;  4ILH B;  1P5Q A;  3PEU B;  1EPU A;  3ASH A;  1VDY A;  3FTW A;  4L23 A;  3CVP A;  4BX9 A;  4I6E A;  3AU4 A;  3FTY A;  4GAA A;  1QNF A;  4L2Y A;  3UQ3 A;  4AIF A;  5CCL A;  3IBE A;  2WXF A;  5G04 J;  4PDX A;  3APC A;  2ILR A;  4UI9 J;  2AW6 A;  3CHP A;  3B7R L;  3I4R B;  4WNF A;  3O48 A;  4HOU A;  2AVP A;  4BTB A;  4GCN A;  4I1A A;  4MLP A;  1E90 A;  3FH7 A;  4AY6 A;  2XHE A;  2OV8 A;  2XRY A;  1UN9 A;  4GB9 A;  2FI7 A;  2QY7 A;  3D9N A;  4YVO A;  2GRM A;  5FZS A;  2CHX A;  1SZA A;  1YA0 A;  4I6J A;  3CK7 A;  3EHN A;  3JCK C;  2LSU A;  2PM7 A;  5C2Y A;  4ILI A;  5FQ8 A;  1E96 B;  2GW1 A;  3Q49 B;  3D9O A;  3EIJ A;  4Q69 A;  1QQE A;  2C2L A;  2UWJ G;  4PS8 A;  4EZL A;  5BT1 A;  3MKQ B;  2WXP A;  1HU3 A;  2A4Z A;  3AU5 A;  4F53 A;  2P58 C;  4UQX A;  4H7Y A;  1H19 A;  4XI0 A;  3TAX A;  3LVQ E;  3CHO A;  4XKC A;  3VLD A;  3MKQ A;  1L5J A;  1EYH A;  2I6H A;  3ZEF A;  3S7D A;  4WNE A;  3ONL A;  3ZN3 A;  5LP0 A;  1OWL A;  4CT0 A;  1B89 A;  3IHV A;  1N54 A;  3RU0 A;  4U07 A;  2C0M A;  3G2U A;  4W9R A;  1E8X A;  2PZI A;  4RSY A;  4U04 A;  5M72 A;  2VTB B;  2J4D A;  4WAF A;  4EQF A;  1UG3 A;  2V0P A;  1W3B A;  3P1U A;  4GZD A;  4Q96 A;  2UY1 A;  4UI9 K;  4J8F A;  5EDS A;  4N2S A;  2LAI A;  5G05 C;  1JPL A;  2C0L A;  2WXQ A;  1ZU2 A;  3AS5 A;  3PZD A;  3PS6 A;  1XNF A;  2J07 A;  2XQ0 A;  4G24 A;  3ULQ A;  3I4G A;  4DI3 A;  3GZ1 A;  4OYS A;  3T5X A;  2X6J A;  2WXR A;  4HOQ A;  4NRH B;  3ZYL A;  3FH5 A;  4B89 A;  2X6H A;  2VQ2 A;  4KVO A;  5LX8 A;  3DBS A;  4O6F A;  1NP7 A;  4GA2 A;  3QC1 A;  1OUV A;  3TXN A;  4B0Z A;  1INZ A;  3QAQ A;  3MEK A;  3FUN A;  4JW1 A;  4AV7 A;  2VYI A;  3CVL A;  3FUD A;  3L16 A;  4FLH A;  5FTP A;  3UT8 A;  3FU0 A;  4EBA G;  4TRQ A;  4CGV A;  4EPZ A;  3CHQ A;  4N2Q A;  3MV2 B;  4L1B A;  5JJT A;  5HI7 A;  3L22 A;  3LS8 A;  2BUG A;  2FUL A;  4N3C A;  1HZ4 A;  2XEV A;  2A5U A;  4MRU A;  1ELW A;  3JUI A;  3MA5 A;  4I9C A;  3D9K A;  4J8E A;  4TUU A;  3PNT B;  2CHZ A;  4UWL A;  3WXX A;  3ZHE B;  4AJW A;  2WQ7 A;  3FP3 A;  3BG0 B;  1PAQ A;  3BG1 B;  3SZ7 A;  3CKC A;  3HYM B;  4LEU A;  3C98 A;  3PEV B;  2HYZ A;  5T4Y A;  3U4T A;  1Y8M A;  3APD A;  3KEZ A;  3VTY A;  3ZGQ A;  3ZPJ A;  3L13 A;  2VGY A;  4XE0 A;  2MRI A;  4C9B B;  4I1O B;  4KYO B;  4JVS A;  2VJ8 A;  3CVW A;  1E7V A;  3G2W A;  3U64 A;  2GRL A;  2HR2 A;  2DIW A;  2L6J A;  2XGS A;  4OVV A;  2KCK A;  3FTZ A;  4WUY A;  3TG5 A;  3FU3 A;  3QJZ A;  2V8S E;  4JZY A;  4F7A A;  1N52 A;  4E6H A;  3IKO B;  4FJY A;  1MHQ A;  1HF8 A;  2I1J A;  3NZU A;  3PRZ A;  4UQY A;  1HFA A;  2J49 A;  3MX3 A;  4A1S A;  4G25 A;  4HFG A;  4A3T A;  4KZ0 A;  1HXI A;  2DCP A;  2LAH A;  3GZS A;  5FQ7 A;  3FHE A;  5KJM A;  2Q7F A;  4GYO A;  4FLB A;  3APF A;  3O4Z A;  5BV1 A;  3ZW3 A;  2E2E A;  4C0M A;  3CQG B;  3LDZ A;  4ABN A;  5BPP A;  3UUX A;  4AP2 A;  1XGW A;  3CHS A;  3CVQ A;  3TXM A;  3LXU X;  3BEE A;  3LYA A;  4U0U A;  4TV3 A;  3GW4 A;  4PS3 A;  4DLQ A;  1PC2 A;  2FO7 A;  4BY6 A;  3TGO A;  2HO1 A;  3QB2 A;  4CT4 A;  2J08 A;  4HS2 A;  5ARG A;  2AXZ A;  5KJL A;  4G2V A;  3UT4 A;  5EX0 A;  5AJD A;  2AXU A;  4N39 A;  2AXV A;  3RO3 A;  3CHR A;  3L17 A;  4LCT A;  5LCW J;  2JLB A;  4AXH A;  4LUN U;  4XKB A;  1S0P A;  2WXG A;  3FU6 A;  3PDN A;  1UJJ A;  4JEH A;  4RG6 A;  5DBK A;  2WXN A;  2IQC A;  4WNG A;  4F3V A;  1E7U A;  1Y6I A;  3GZ2 A;  4FA6 A;  4JL0 A;  3R7Q A;  2XCC A;  4IRU A;  3NQP A;  2L0I A;  3HHM A;  4BX8 A;  5KJN A;  1OWP A;  3Q47 B;  2WXO A;  3GYZ A;  3CVY A;  3B7S A;  4ME2 A;  3FTV A;  3FTS A;  4DI4 A;  3T5V A;  4JEU A;  1H2T C;  1E8W A;  3JYS A;  2QFC A;  2OND A;  2PQN A;  2FBN A;  1Z3X A;  2KZT A;  3KD7 A;  4FHJ A;  4ILG A;  3VLF A;  3SGH A;  4G1T A;  4JXT A;  1H0A A;  3FUL A;  4J6I A;  3SNX A;  3ZFW A;  3ML9 A;  4EZJ A;  3L6A A;  2WXK A;  2AWI A;  4HOS A;  2LSV A;  3HVE B;  3KS2 A;  5CMY A;  2VSO E;  4XI9 A;  3VTX A;  3CQC B;  2CFU A;  3CSF A;  2MOW A;  3FUM A;  1FCH A;  2E0I A;  4BSX A;  2XGM A;  5BUZ A;  4AY5 A;  3ASF A;  3MJW A;  4GML A;  3FUE A;  4AOF A;  3CVV A;  4GPK A;  3CR3 A;  1WAO 1;  4JPS A;  4AVX A;  3TJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...