2Y0BG

Caspase-3 in complex with an inhibitory darpin-3.4_s76r
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
DLGKKLLEATRAGQDDEVRILMANGADVNAMDDAGVTPLHLAAKRGHLEIVEVLLKHGADVNARDIWGRTPLHLAATVGHLEIVEVLLEYGADVNAQDKFGKTAFDISIDNGNEDLAEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords CASPASE-3 SUBUNIT P17
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 119
sequence length 119
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2y0bG00
3SO8A 2KBXA 2XEEA 5AARA 3TWWA 4A63B 3V31A 2XZTG 2F8XK 4DX1A 5CBOA 4F6RD 4CYMD 5ENSD 5AQ7A 2NYJA 5AQBA 2DZOA 2ETCA 3J5QB 4ATZD 4BSZB 3JUEA 1TR4A 4DX6D 4J7WA 1MJ0A 1IHBA 2Y1LE 3Q9NC 4O60A 5HKPA 1SVXA 3TWUA 2ZGDA 3B95A 4K5AB 5ITZF 2HE0A 4K5CA 4HBDA 3V79K 5KWDA 4OAUC 4DX5D 1YYHA 2J8SD 1BU9A 3UI2A 3EHQA 4U8VD 2DVWA 4OAVB 3TWQA 5ENQD 3TWRA 4LNUD 3HG0D 5AAOA 2BKKB 3T9KA 3NOCD 4YDYA 4HLLA 4HB5A 5AN8A 1WG0A 3AAAC 4HRLA 4BERA 5EILA 1NFIE 5CECB 4HQDA 4LG6A 1N0RA 4HI8A 3TWVA 3W9FA 5BXOA 3V2XA 4DUIA 2XENA 2ZGGA 4TUMA 4Z68A 3W9GA 1UOHA 3TWTA 1N0QA 5KBAA 4U96D 1AP7A 1D9SA 2MYOA 3ZU7B 4DX2A 2ETAA 3V2OA 4N5QA 5EYPF 5EIDA 5CEDB 2RFMA 2Y0BG 3F6QA 4ZFHA 2AJAA 2DWZA 4J8YA 2QC9A 5KNHD 3ZUVB 5EYLA 2P2CP 2L6BA 4HRNA 5ENPD 5ENTD 2V5QC 2F37A 1BI7B 3Q9UC 2FO1E 3EU9A 3JXJA 1S70B 3J5PA 1K1AA 3V30A 2XEHA 1IXVA 3HRAA 4BEPA 4HI9A 5AQ9A 4RLYA 3TWSA 4O1PA 5CERB 3D9HA 2XZDG 2DZNA 2PNNA 4U8YD 1SW6A 4QFVA 4K5BA 3ZKJA 5ENRD 3LJNA 1DCQA 1OT8A 5CEAA 3EHRA 4O1OA 3B7BA 1BLXB 3T8KA 4DRXE 2BKGA 3ZNGA 5EIBE 4GPMA 3AJIA 1N11A 5HS0A 3C5RA 4U95D 4ZHBA 2KXPC 2QYJA 3JXIA 4NIKA 3UTMA 5KNGA 4QQIA 2JABA 4CZ2D 1K1BA 3UXGA 2F8YA 1MX4A 5AQAA 3NBNB 5ENOD 2ETBA 3KEAA 4HNAD 3NOGD 1QYMA 5JMND 4GMRA 1BD8A 1MX2A 1OY3D 1MX6A 4UUCA 2VGEA 1MYOA 5FIOA 5JA4D 3TWXA 4C48B 2V4HC 1DC2A 4BETA 1IKND 1A5EA 4DX7D 2RFAA 1BI8B 1AWCB 5HRYA 2B0OE 4G8KA 4JB8P 1K3ZD 1YMPA 4HRMB 3DEPA 4G8LA 5EN5D 4YDWA 4B93B 4BESA 4F1PA 5CBNA 5FINA 1WDYA 1YCSB 5BXUA 3IXEA 2A5EA 4LSZE 5D66A 3DEOA 1G3NB
chains in the Genus database with same CATH superfamily
4ACLA 4G2VA 2VSNA 3D9PA 4HOSA 2XEVA 1WY6A 3Q9NC 5D2MC 2PL2A 1SVXA 4KVOA 3KS2A 2J8SD 1ELKA 3ESLA 2DBAA 2BKKB 3T9KA 4HB5A 3ULQA 1OCRE 3UQ3A 5CECB 1TNYA 3FUHA 3MV3B 3NZSA 2IY0C 4U96D 1OWOA 3ZU7B 4L2YA 2L0TB 2CHZA 2IEJA 4PS7A 3ZFWA 3FUDA 1NA3A 4A55A 1A17A 4PDXA 5ARGA 5LCWJ 1WAO1 3L08A 1XGWA 1HO8A 3UT8A 4WWNA 1XNFA 5LOZA 2YNQA 3U3WA 3LKUA 5T3RA 2I9CA 3CVPA 1DNPA 3MGBA 5AYWD 5AJDA 4WNDA 3EU5A 2XRYA 5EIBE 3D9NA 4H7YA 3UTMA 3SBTB 4HLEA 3ESKA 1MYOA 5ANLA 2LXLA 5JA4D 4BETA 3QAQA 1EPUA 3LY8A 3C3RA 2B0OE 3E33A 1YMPA 4M7CA 3ZHEA 1ZB1A 3Q7FA 2IF4A 3ZYMA 3PZ3A 3TWWA 4A63B 1OWNA 2LO6A 3FUMA 1BPOA 4F6RD 1KZOA 2DZOA 4ATZD 2PQRA 2WVIA 3HDXA 1E8XA 3IBEA 2WXRA 4K5AB 2HE0A 5KWDA 1OWPA 3QB2A 2KCKA 2VGXA 3TWQA 4BTAA 3QDNA 3HG0D 2VJ8A 4GAAA 3U66A 1FT2A 3PZ1A 3URZA 4NRHB 4G26A 2ILRA 4TUUA 2KATA 3ASHA 4ANWA 3CR3A 4JA9A 2Y0BG 3ZVVA 3PEUB 2V5FA 3APFA 4UQYA 4UQZA 3ZXPA 2A5UA 4G11A 3RO3A 3TG5A 3CHMA 5ENNA 3I4GA 3LY7A 1TN6A 4BY6A 4N3CA 5JJ6A 2RD0A 4P29A 3ZRHA 3CSFA 1DCQA 1UW4B 2EILE 4K0RA 1UG3A 4K03A 2PM6A 2I1KA 1Y8MA 4U7EB 4I17A 5KNGA 4GMLA 3NOGD 3ZHEB 1EF1C 1OY3D 3QNKA 5G04C 3T8MA 1O1SA 5FQ7A 5HI7A 1L5JA 3B7UX 1JCQA 5HRYA 4XKCA 3LVRE 5JHBA 1HX8A 2BF0X 2OOEA 1G3NB 4ILHB 1UJJA 3C98A 2IFUA 1JCRA 2VGXB 3AS8A 2X6KA 3ULYA 1TR4A 3GYZA 4ANVA 3CK9A 3X2QE 3BQOA 3K9IA 4K5CA 4HBDA 2RKKA 2C0LA 3IHVA 2ZXWE 2WMOA 4YNDA 4XIFA 4HRLA 3Q15A 5E76A 3FTYA 4GTMA 3TWTA 3FU3A 2WMNA 2WQHA 4AY6A 1QBQA 1K8KG 5H7PA 4AJWA 2PZIA 2PQNA 4JHKA 4U8HA 5LX8A 3FY4A 3TXMA 1K1AA 3IKOB 2OEWA 3V30A 3PZ4A 2IQCA 4BEPA 2CG2A 4RLYA 4GCOA 3FDHA 3CSTA 1TJCA 3LY9A 5B1AE 3FULA 1RZ4A 3C5RA 3NB2A 3NBNB 5ENOD 4UWFA 1H2TC 3MX3A 2R59A 4ANXA 1B89A 4GZ3A 4UWLA 3TWXA 2V4HC 2FO7A 4DLOA 3CVXA 5AARA 2IO3C 2VSOE 3FH8A 4GTSA 3SD5A 3RJVA 4WNEA 3RKVA 3O48A 3MV2B 4JD2G 4KYOB 1D8EA 4EHMA 3TXNA 3G2TA 1KT1A 4N5CA 3IEGA 2R2LA 3MYVA 3MZLB 4HLLA 4I1OB 1H19A 1X5BA 2P9SG 2WXQA 1NFIE 5FJYA 3FHEA 4LG6A 3W9FA 3QJZA 2A4ZA 1KT0A 3LCAA 1HXIA 3GW4A 1S64A 4BX9A 3ZPJA 2WQ7A 4ILIA 3AG2E 2RFMA 2OVFA 3TJPA 4F3VA 4A3TA 1SA5A 3Q9UC 2FO1E 2BEDA 4CDRA 4CRWA 2CHWA 3U64A 4O1PA 3D9HA 3LJ3A 4F1SA 4IRUA 2P9LG 2XCCA 1E8YA 3T8KA 3APCA 2WXMA 2WM9A 1SZ9A 2CFUA 1QYMA 1MX6A 2VGEA 3CHOA 3B7TA 1FT1A 2HO1A 1N4PA 4PH4B 3ZN3A 3FFLA 2RFAA 3Q49B 4G8KA 2FI7A 5EN5D 2WXIA 4I9EA 4F1PA 3G2UA 4I2ZA 5BXUA 2WXLA 3VLFA 3CQGB 3Q5MA 3CVWA 4NQ0A 3L9TA 5AQ7A 4B94A 4JW1A 3OXGA 1LF8A 2KZTB 1W3BA 4J7WA 3S7FA 1DVPA 3ISMC 4ILGA 4O60A 3ZXSA 3G2VA 4UI9K 3B95A 2FBNA 1QZ2A 2R02A 5AJLA 5ENQD 1V54E 3NOCD 4GTVA 2FEZA 3GZSA 1TNBA 4DUIA 4MBGA 2XGSA 4TUMA 1ELWA 4URKA 2WXJA 3CVUA 3U9WA 5AENA 4I6JA 3Q4AB 1RW2A 2L0IA 4KXKB 4FU3A 4HOQA 4PUCA 3Q7AA 2DZNA 4U8YD 3EHNA 4J8FA 4GTTA 4C0MA 1OCOE 4Y6CA 2JLBA 3CHQA 4CDMA 4F7AA 2F8YA 4EZLA 4J8DA 4HNAD 3PE4A 1TNOA 5JJTA 2GROB 3GZ2A 3EDTB 4ANUA 4C48B 3PDNA 4DX7D 3C3OA 4G8LA 4CT0A 3UKUG 4KBQA 1WDYA 2P9NG 2DYRE 3L13A 3IXEA 3RSEG 4AEZC 1H6KA 3OTNA 3AG3E 1NL4A 1FCHA 4ME2A 2EINE 2F8XK 4CYMD 4APFA 4D10C 2ETCA 3D9LA 1ELRA 4EBAA 2XPYA 2Y1LE 4YVQC 5CMYA 4ATGA 2VSYA 4AVXA 3UM2A 5ITZF 4KVMA 3Q75A 3PRZA 2LUHA 2OEVA 5E75A 1H6PA 1LD7A 3AU4A 2GRRB 2MHKA 3RRUA 4WNGA 1N94A 3TWVA 1N0RA 3L82A 5G04J 1D8DA 2AXZA 3ZGQA 4GTQA 2VTBB 4LNBA 2QC9A 5KNHD 3L16A 3FEXA 4CCAA 4E6HA 4I43A 2YINA 5D0QD 5CCMA 5LP0A 4M3OA 5BUZA 3QWPA 3PVLA 4UI9C 4YDEA 3ZKJA 3LJNA 4OVVA 5CEAA 3EHRA 1Z5SC 1N4SA 2H6IA 2MOWA 3AJIA 4GU5A 3UXGA 4RQIA 4N3BA 3DSSA 2B6CA 3C72A 4B0ZA 3UMVA 2VGYA 5FQ6A 4AOFA 3CVQA 1YA0A 3B13A 5HQ8A 4HOTA 3N71A 1PC2A 5FZQA 4JHRA 3D9OA 3P2BA 2V0PA 3MEKA 4DX6D 5BV1A 2LAIA 4U0UA 2OVBA 5LFAA 2R17C 3R9MA 1Z3YA 1U2VG 3EIQC 3HXCA 3G2WA 1S63A 2IU1A 3BU8A 3I5PA 4EBAG 3CLJA 2ETAA 2XGMA 3V2OA 4GYWA 2ZU6B 3EHMA 1V55E 3DPYA 4B89A 4FP7A 2KC7A 1MQSA 2Q7FA 2QYUA 4FADA 3NF1A 1LTXA 3AS4A 3LEWA 3RRMB 1KPSB 3S2AA 2V5QC 4NURA 3PZDA 1HFAA 3FUKA 5FZSA 4FJYA 5ARFA 1KLXA 5EX0A 2WXHA 2F0YA 3PNLB 2L6JA 4FJZA 4JHJA 4JL0A 1HG5A 2AXUA 3QARA 3HIZA 5D0OD 4GPMA 1QNFA 4U95D 3WG7E 5BW8C 3FTUA 5JJ7A 3CK7A 2RG8A 3DPDA 3DSTA 1IKND 5FTPA 2GRMA 2EIJE 4A3VA 4IYPA 2I2OA 4BSXA 2LSVA 2X3MA 3ASDA 1O1RA 4GCNA 2XS8A 3BUAA 2BTDA 3CVYA 5AQBA 3PNTB 3CHSA 3JYSA 1FVFA 3QKYA 3RO2A 2XHEA 4BFRA 3VTYA 2P9UG 2X6FA 4J8SA 5J90A 2J9QA 4I6GA 2X38A 1YYHA 4CGVA 3QWWA 4CDNA 1N9AA 3LVQE 2WXKA 3ASGA 3ZEFA 4FLHA 5AN8A 3R9AB 5BXOA 3V2XA 3CKCA 2P9IG 3UINC 5CRVA 1D9SA 5KJMA 4FA6A 5CMWA 4GTPA 3HXFA 5KJNA 4C0EA 4DLQA 2VSXE 4TXQA 4CT4A 4HRNA 3D9MA 4HVBA 4N39A 3P1UA 4MLPA 3HRAA 3KD7A 4TRQA 4HFGA 3UT7A 3DXMG 1SW6A 1UN8A 3WXXA 1MHQA 4O1OA 1PAQA 3ZNGA 1N11A 1N4RA 1N4QA 3JXIA 4AV7A 4Q94A 3SHFA 2QZAA 3ENEA 2H6FA 4Y6WA 3MKQB 3UT4A 3D9KA 1MZCA 4JB8P 3SBSA 4GZCA 3IHYA 5A7DB 2HM8A 4JVSA 4OYSA 5G05C 3JUIA 2CG3A 1IQUA 5HKPA 3SFYA 4BT9A 3TG4A 2ZGDA 2XS1A 3V79K 3FU6A 3ML9A 2LXMA 2V4LA 4U8VD 3CV0A 1O5MA 3UKRG 2YHEA 4GA2A 4KT6B 2GRQB 1TN7A 5DBKA 3FUIA 2L9BA 1OCCE 4JEUA 2ZGGA 4Z68A 3U4TA 4N2SA 2AWIA 3VTXA 2AW6A 2CHXA 5A23A 5EIDA 3F6QA 3NAWA 4ZFHA 4EECA 2ZISA 4J8YA 4DI4A 4EZKA 5EYLA 2P2CP 2IOLA 2KZTA 3UM3A 1S70B 4HXIA 4MRUA 2XEHA 2XGOA 1TEZA 3HVEA 3R7QA 2XZDG 2Y4TA 3CHRA 2GRLA 3G2SA 3CHPA 1OT8A 3B7BA 1QQEA 2HR2A 1BD8A 3ASOE 4LCTA 1TN8A 3GZ1A 3SZ7A 3DBSA 4FULA 3OXLA 3OAWA 4YDWA 4B93B 1Q2ZA 2A5EA 5C2YA 2KBXA 2M63A 3BG0B 5KJKA 2J08A 3FUEA 4DX1A 5CBOA 2GW1A 2Y3AA 2R05A 1O1TA 4BSZB 4UI9J 1ZU2A 2XPZA 4U07A 2H6GA 1Z3XA 1GW6A 3HYMB 3PUKA 4B8AA 1HG2A 1PY1A 5EILA 4CGWA 4RVBA 4GMJA 4AXHA 4CEMA 2PM7A 4X8QA 1VDYA 3LXUX 5KCMA 3ULEG 4DI3A 1E90A 4L7TA 3TL5A 3CVLA 1SQMA 4WWPA 3FTXA 4A1GA 3HVEB 4XI9A 3ABME 4LEUA 3DXKG 4XZ4A 5B3SE 3UPVA 5BPPA 2I6HA 4HI9A 5AQ9A 4DPRA 2DYSE 4GZDA 4MKTA 2R03A 3MJWA 3PH0C 3SI5A 3E37A 1E8WA 4I1AA 4HOUA 1MX4A 5AQAA 1OXJA 4WAFA 1MX2A 3FUFA 2VTBA 3ASFA 2V8SE 4EZJA 5A6CA 1U3DA 3L54A 3PREA 4ACKA 4XX5A 4TV3A 3LDZA 3LS8A 4GB9A 4H7XA 3S7JA 2QY7A 1EYHA 2P58C 4BX8A 5BNWA 4G24A 4O6FA 2IOSA 4KMOA 3HXBA 4N2QA 1HH8A 4RG9A 4APOA 4OAVB 4JXTA 4AY5A 2BUGA 5FWQA 3FTWA 4FHKA 5KBAA 2KCVA 1AP7A 2MYOA 4DX2A 1JPLA 4XKBA 1UJKA 3MCXA 3ML8A 3E34A 2UWJG 1H2UA 3FTSA 5B1BE 3D9IA 4KZ0A 2J07A 3TAXA 3EIJA 5KJLA 5CHEE 4U04A 4E85A 3QK0A 2FULA 2AXVA 4GTRA 2JABA 4NACA 3CIAA 4G25A 2WPVA 4BWRA 5AIJA 1A5EA 3FU0A 1AWCB 5EKQD 1TNUA 5T4YA 2XQ0A 4GYOA 4LSZE 5JMND 3SO8A 1E7VA 1TNZA 4A1SA 4HORA 5FZRA 4XEIG 2LSUA 3SY2A 1INZA 1IHGA 2WQ6A 3FUJA 1TYQG 3RK6A 2XRZA 3D3MA 1E7UA 4EQFA 2EQXA 5AAOA 5C1DA 4UWHA 1WG0A 3RAUA 4B8CB 5BT1A 2AVPA 4HQDA 4HI8A 2VYIA 4Q69A 3ONLA 3FTVA 1UOHA 4TXPA 5ANRA 3SQVA 2WB2A 1U3CA 2Y69E 3AG4E 1FPPA 4U0SA 1TJFA 2NSZA 5G05J 3CGHA 3EU9A 2DIWA 3JXJA 3FTZA 4GZ5A 1E8ZA 5CRUA 5M72A 3RIBA 1IXVA 3ASNE 4GA0A 3FEYA 5JHAA 1JCSA 3O4ZA 4DRXE 4PS3A 2KXPC 4FHJA 3ABKE 3KAEA 1HS6A 4HS2A 3KEAA 3ZYLA 4GZ6A 5FIOA 5T8IA 1HZ4A 4JZYA 3KSLA 4XE0A 4AIFA 2C2LA 3DEOA 3PUJA 4G23A 2NC9A 4WNFA 3L6AA 5EDSA 4G1TA 3J5QB 2MRIA 3JUEA 4L23A 3HXDA 1MJ0A 2P9KG 3TWUA 3DSXA 3MA5A 3RRNB 2NXPA 3Q78A 1BU9A 3UI2A 3TWRA 4LNUD 3MKQA 1HE8A 4F53A 1KZPA 1DCEA 3W9GA 4Q96A 5G55A 3DWLG 3L17A 1E96B 3UIPC 3NZUA 4N5QA 3Q79A 5EYPF 2E0IA 2HYZA 3ZUVB 3ZYKA 1FVHA 2E2EA 2L6BA 5ENTD 3T5VA 3UM1A 3PEVB 2I1JA 2IJGX 4BT8A 2PNNA 2YHCA 2BKGA 2LNIA 1H6OA 4LNGA 1H2VC 1K1BA 3QOUA 2ETBA 4GMRA 4UUCA 1LD8A 4GYYA 2X6IA 3FH7A 3PZ2A 1HU3A 2XPIA 1H0AA 4KZCA 3CQCB 4U0ZA 4XI0A 4BESA 4R7LA 1YCSB 2IO2C 2YQ8A 5LCWC 1ZBPA 2XZTG 4UWKA 5ENSD 2NYJA 4FLBA 2LAHA 2GGFA 2WXNA 3UX4A 3FP3A 4UWGA 2J09A 3LPZA 3SFZA 3I3NA 2JEKA 4DX5D 2WXOA 1JWFA 3EHQA 4J6IA 4JPSA 3ZIMA 4C9BB 2P9PG 2EIME 3HHMA 3ABLE 1NZNA 4RG6A 5FQ8A 2J49A 3FU5A 1OUVA 4WWOA 2R5SA 3JCKC 4YVOA 2X6HA 5FQ4A 4N3AA 3Q47B 2FF4A 5DIZA 1WM5A 4WUYA 3EUVA 1BI7B 2J4BA 3BEEA 1N52A 1SZAA 3PE3A 2IONA 5IY5E 3C3QA 1NA0A 3TWSA 3UIOC 3SFXA 2QFCA 3QC1A 5ENRD 1NP7A 3T5XA 4UQXA 3RU0A 2ONDA 3AU5A 5HS0A 4DK5A 2OCCE 4GTOA 2QYJA 4CZ2D 4TXRA 4DJAA 4I6EA 3L22A 3VLEA 1K3ZD 3DEPA 3QWVA 4JEHA 1OWMA 5EX3A 4V3IA 3V31A 2VQ2A 4W9RA 3DRAA 4RSYA 2UY1A 4EPZA 3FUNA 1JWGA 1IHBA 4IN3B 3UM0A 4LERA 4I2WA 4OAUC 1EDUA 2DVWA 4U63A 2ZIRA 1P5QA 1IQRA 3PS6A 4LUNU 3AAAC 3JQ1A 1OCZE 3APDA 3KEZA 3CK8A 4IULA 2XENA 3BG1B 2EIKE 4J0UA 3SNXA 5CCLA 4JC8A 2AJAA 3R7RA 2WXFA 5ENPD 1UN9A 3J5PA 3LYAA 5G2NA 5BV0A 2CFZA 4YDOA 3UUXA 3AS5A 3E32A 3DSWA 4L9PA 3CKBA 4JA7A 4PS8A 3ZW3A 3KSQA 1X81A 4MS6A 4LRZA 2UY1B 3VLDA 3CVNA 1S0PA 5FINA 3SF4A 2XEEA 1Z6TA 3E4BA 4AP2A 3AG1E 3E30A 2OV8A 3MKRA 2GRNB 1N95A 2KCLA 2H6HA 1HF8A 3SGHA 4BTBA 3ONKA 2Y4UA 3D9JA 3JQ0A 1NI1A 1JUQA 1N54A 1Y6IA 4I1MA 5J08A 4YDYA 4BERA 2WXGA 2J4DA 4AM9A 2KM4A 3Q73A 3NQPA 3ZYQA 3EJNA 1N0QA 3DSVA 5CEDB 2DWZA 3I4RB 2GRPB 3B7SA 2F37A 4L1BA 3CVVA 3IV0A 4J8EA 3CEQA 5CERB 3TGOA 3FWVA 4GPKA 2WXPA 2XCBA 3S7DA 4QFVA 2C0MA 4K5BA 1BLXB 4ABNA 3HXEA 2DCPA 4GA1A 4ZHBA 4NIKA 1SA4A 3OXFA 4QQIA 4FC8A 1OWLA 4L2LA 1IYGA 3B7RL 3FH5A 4OVUA 5FT9A 1DC2A 1BI8B 2X6JA 4HRMB 4I9CA 5CBNA 3DSUA 3S7BA 5D66A
chains in the Genus database with same CATH topology
3SO8A 2KBXA 2XEEA 5AARA 3TWWA 4A63B 3V31A 2XZTG 2F8XK 4DX1A 5CBOA 4F6RD 4CYMD 5ENSD 5AQ7A 2NYJA 5AQBA 2DZOA 2ETCA 3J5QB 4ATZD 4BSZB 3JUEA 1TR4A 4DX6D 4J7WA 1MJ0A 1IHBA 2Y1LE 3Q9NC 4O60A 5HKPA 1SVXA 3TWUA 2ZGDA 3B95A 4K5AB 5ITZF 2HE0A 4K5CA 4HBDA 3V79K 5KWDA 4OAUC 4DX5D 1YYHA 2J8SD 1BU9A 3UI2A 3EHQA 4U8VD 2DVWA 4OAVB 3TWQA 5ENQD 3TWRA 4LNUD 3HG0D 5AAOA 2BKKB 3T9KA 3NOCD 4YDYA 4HLLA 4HB5A 5AN8A 1WG0A 3AAAC 4HRLA 4BERA 5EILA 1NFIE 5CECB 4HQDA 4LG6A 1N0RA 4HI8A 3TWVA 3W9FA 5BXOA 3V2XA 4DUIA 2XENA 2ZGGA 4TUMA 4Z68A 3W9GA 1UOHA 3TWTA 1N0QA 5KBAA 4U96D 1AP7A 1D9SA 2MYOA 3ZU7B 4DX2A 2ETAA 3V2OA 4N5QA 5EYPF 5EIDA 5CEDB 2RFMA 2Y0BG 3F6QA 4ZFHA 2AJAA 2DWZA 4J8YA 2QC9A 5KNHD 3ZUVB 5EYLA 2P2CP 2L6BA 4HRNA 5ENPD 5ENTD 2V5QC 2F37A 1BI7B 3Q9UC 2FO1E 3EU9A 3JXJA 1S70B 3J5PA 1K1AA 3V30A 2XEHA 1IXVA 3HRAA 4BEPA 4HI9A 5AQ9A 4RLYA 3TWSA 4O1PA 5CERB 3D9HA 2XZDG 2DZNA 2PNNA 4U8YD 1SW6A 4QFVA 4K5BA 3ZKJA 5ENRD 3LJNA 1DCQA 1OT8A 5CEAA 3EHRA 4O1OA 3B7BA 1BLXB 3T8KA 4DRXE 2BKGA 3ZNGA 5EIBE 4GPMA 3AJIA 1N11A 5HS0A 3C5RA 4U95D 4ZHBA 2KXPC 2QYJA 3JXIA 4NIKA 3UTMA 5KNGA 4QQIA 2JABA 4CZ2D 1K1BA 3UXGA 2F8YA 1MX4A 5AQAA 3NBNB 5ENOD 2ETBA 3KEAA 4HNAD 3NOGD 1QYMA 5JMND 4GMRA 1BD8A 1MX2A 1OY3D 1MX6A 4UUCA 2VGEA 1MYOA 5FIOA 5JA4D 3TWXA 4C48B 2V4HC 1DC2A 4BETA 1IKND 1A5EA 4DX7D 2RFAA 1BI8B 1AWCB 5HRYA 2B0OE 4G8KA 4JB8P 1K3ZD 1YMPA 4HRMB 3DEPA 4G8LA 5EN5D 4YDWA 4B93B 4BESA 4F1PA 5CBNA 5FINA 1WDYA 1YCSB 5BXUA 3IXEA 2A5EA 4LSZE 5D66A 3DEOA 1G3NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SO8 A;  2KBX A;  2XEE A;  5AAR A;  3TWW A;  4A63 B;  3V31 A;  2XZT G;  2F8X K;  4DX1 A;  5CBO A;  4F6R D;  4CYM D;  5ENS D;  5AQ7 A;  2NYJ A;  5AQB A;  2DZO A;  2ETC A;  3J5Q B;  4ATZ D;  4BSZ B;  3JUE A;  1TR4 A;  4DX6 D;  4J7W A;  1MJ0 A;  1IHB A;  2Y1L E;  3Q9N C;  4O60 A;  5HKP A;  1SVX A;  3TWU A;  2ZGD A;  3B95 A;  4K5A B;  5ITZ F;  2HE0 A;  4K5C A;  4HBD A;  3V79 K;  5KWD A;  4OAU C;  4DX5 D;  1YYH A;  2J8S D;  1BU9 A;  3UI2 A;  3EHQ A;  4U8V D;  2DVW A;  4OAV B;  3TWQ A;  5ENQ D;  3TWR A;  4LNU D;  3HG0 D;  5AAO A;  2BKK B;  3T9K A;  3NOC D;  4YDY A;  4HLL A;  4HB5 A;  5AN8 A;  1WG0 A;  3AAA C;  4HRL A;  4BER A;  5EIL A;  1NFI E;  5CEC B;  4HQD A;  4LG6 A;  1N0R A;  4HI8 A;  3TWV A;  3W9F A;  5BXO A;  3V2X A;  4DUI A;  2XEN A;  2ZGG A;  4TUM A;  4Z68 A;  3W9G A;  1UOH A;  3TWT A;  1N0Q A;  5KBA A;  4U96 D;  1AP7 A;  1D9S A;  2MYO A;  3ZU7 B;  4DX2 A;  2ETA A;  3V2O A;  4N5Q A;  5EYP F;  5EID A;  5CED B;  2RFM A;  2Y0B G;  3F6Q A;  4ZFH A;  2AJA A;  2DWZ A;  4J8Y A;  2QC9 A;  5KNH D;  3ZUV B;  5EYL A;  2P2C P;  2L6B A;  4HRN A;  5ENP D;  5ENT D;  2V5Q C;  2F37 A;  1BI7 B;  3Q9U C;  2FO1 E;  3EU9 A;  3JXJ A;  1S70 B;  3J5P A;  1K1A A;  3V30 A;  2XEH A;  1IXV A;  3HRA A;  4BEP A;  4HI9 A;  5AQ9 A;  4RLY A;  3TWS A;  4O1P A;  5CER B;  3D9H A;  2XZD G;  2DZN A;  2PNN A;  4U8Y D;  1SW6 A;  4QFV A;  4K5B A;  3ZKJ A;  5ENR D;  3LJN A;  1DCQ A;  1OT8 A;  5CEA A;  3EHR A;  4O1O A;  3B7B A;  1BLX B;  3T8K A;  4DRX E;  2BKG A;  3ZNG A;  5EIB E;  4GPM A;  3AJI A;  1N11 A;  5HS0 A;  3C5R A;  4U95 D;  4ZHB A;  2KXP C;  2QYJ A;  3JXI A;  4NIK A;  3UTM A;  5KNG A;  4QQI A;  2JAB A;  4CZ2 D;  1K1B A;  3UXG A;  2F8Y A;  1MX4 A;  5AQA A;  3NBN B;  5ENO D;  2ETB A;  3KEA A;  4HNA D;  3NOG D;  1QYM A;  5JMN D;  4GMR A;  1BD8 A;  1MX2 A;  1OY3 D;  1MX6 A;  4UUC A;  2VGE A;  1MYO A;  5FIO A;  5JA4 D;  3TWX A;  4C48 B;  2V4H C;  1DC2 A;  4BET A;  1IKN D;  1A5E A;  4DX7 D;  2RFA A;  1BI8 B;  1AWC B;  5HRY A;  2B0O E;  4G8K A;  4JB8 P;  1K3Z D;  1YMP A;  4HRM B;  3DEP A;  4G8L A;  5EN5 D;  4YDW A;  4B93 B;  4BES A;  4F1P A;  5CBN A;  5FIN A;  1WDY A;  1YCS B;  5BXU A;  3IXE A;  2A5E A;  4LSZ E;  5D66 A;  3DEO A;  1G3N B; 
#chains in the Genus database with same CATH topology
 4ACL A;  4G2V A;  2VSN A;  3D9P A;  4HOS A;  2XEV A;  1WY6 A;  3Q9N C;  5D2M C;  2PL2 A;  1SVX A;  4KVO A;  3KS2 A;  2J8S D;  1ELK A;  3ESL A;  2DBA A;  2BKK B;  3T9K A;  4HB5 A;  3ULQ A;  1OCR E;  3UQ3 A;  5CEC B;  1TNY A;  3FUH A;  3MV3 B;  3NZS A;  2IY0 C;  4U96 D;  1OWO A;  3ZU7 B;  4L2Y A;  2L0T B;  2CHZ A;  2IEJ A;  4PS7 A;  3ZFW A;  3FUD A;  1NA3 A;  4A55 A;  1A17 A;  4PDX A;  5ARG A;  5LCW J;  1WAO 1;  3L08 A;  1XGW A;  1HO8 A;  3UT8 A;  4WWN A;  1XNF A;  5LOZ A;  2YNQ A;  3U3W A;  3LKU A;  5T3R A;  2I9C A;  3CVP A;  1DNP A;  3MGB A;  5AYW D;  5AJD A;  4WND A;  3EU5 A;  2XRY A;  5EIB E;  3D9N A;  4H7Y A;  3UTM A;  3SBT B;  4HLE A;  3ESK A;  1MYO A;  5ANL A;  2LXL A;  5JA4 D;  4BET A;  3QAQ A;  1EPU A;  3LY8 A;  3C3R A;  2B0O E;  3E33 A;  1YMP A;  4M7C A;  3ZHE A;  1ZB1 A;  3Q7F A;  2IF4 A;  3ZYM A;  3PZ3 A;  3TWW A;  4A63 B;  1OWN A;  2LO6 A;  3FUM A;  1BPO A;  4F6R D;  1KZO A;  2DZO A;  4ATZ D;  2PQR A;  2WVI A;  3HDX A;  1E8X A;  3IBE A;  2WXR A;  4K5A B;  2HE0 A;  5KWD A;  1OWP A;  3QB2 A;  2KCK A;  2VGX A;  3TWQ A;  4BTA A;  3QDN A;  3HG0 D;  2VJ8 A;  4GAA A;  3U66 A;  1FT2 A;  3PZ1 A;  3URZ A;  4NRH B;  4G26 A;  2ILR A;  4TUU A;  2KAT A;  3ASH A;  4ANW A;  3CR3 A;  4JA9 A;  2Y0B G;  3ZVV A;  3PEU B;  2V5F A;  3APF A;  4UQY A;  4UQZ A;  3ZXP A;  2A5U A;  4G11 A;  3RO3 A;  3TG5 A;  3CHM A;  5ENN A;  3I4G A;  3LY7 A;  1TN6 A;  4BY6 A;  4N3C A;  5JJ6 A;  2RD0 A;  4P29 A;  3ZRH A;  3CSF A;  1DCQ A;  1UW4 B;  2EIL E;  4K0R A;  1UG3 A;  4K03 A;  2PM6 A;  2I1K A;  1Y8M A;  4U7E B;  4I17 A;  5KNG A;  4GML A;  3NOG D;  3ZHE B;  1EF1 C;  1OY3 D;  3QNK A;  5G04 C;  3T8M A;  1O1S A;  5FQ7 A;  5HI7 A;  1L5J A;  3B7U X;  1JCQ A;  5HRY A;  4XKC A;  3LVR E;  5JHB A;  1HX8 A;  2BF0 X;  2OOE A;  1G3N B;  4ILH B;  1UJJ A;  3C98 A;  2IFU A;  1JCR A;  2VGX B;  3AS8 A;  2X6K A;  3ULY A;  1TR4 A;  3GYZ A;  4ANV A;  3CK9 A;  3X2Q E;  3BQO A;  3K9I A;  4K5C A;  4HBD A;  2RKK A;  2C0L A;  3IHV A;  2ZXW E;  2WMO A;  4YND A;  4XIF A;  4HRL A;  3Q15 A;  5E76 A;  3FTY A;  4GTM A;  3TWT A;  3FU3 A;  2WMN A;  2WQH A;  4AY6 A;  1QBQ A;  1K8K G;  5H7P A;  4AJW A;  2PZI A;  2PQN A;  4JHK A;  4U8H A;  5LX8 A;  3FY4 A;  3TXM A;  1K1A A;  3IKO B;  2OEW A;  3V30 A;  3PZ4 A;  2IQC A;  4BEP A;  2CG2 A;  4RLY A;  4GCO A;  3FDH A;  3CST A;  1TJC A;  3LY9 A;  5B1A E;  3FUL A;  1RZ4 A;  3C5R A;  3NB2 A;  3NBN B;  5ENO D;  4UWF A;  1H2T C;  3MX3 A;  2R59 A;  4ANX A;  1B89 A;  4GZ3 A;  4UWL A;  3TWX A;  2V4H C;  2FO7 A;  4DLO A;  3CVX A;  5AAR A;  2IO3 C;  2VSO E;  3FH8 A;  4GTS A;  3SD5 A;  3RJV A;  4WNE A;  3RKV A;  3O48 A;  3MV2 B;  4JD2 G;  4KYO B;  1D8E A;  4EHM A;  3TXN A;  3G2T A;  1KT1 A;  4N5C A;  3IEG A;  2R2L A;  3MYV A;  3MZL B;  4HLL A;  4I1O B;  1H19 A;  1X5B A;  2P9S G;  2WXQ A;  1NFI E;  5FJY A;  3FHE A;  4LG6 A;  3W9F A;  3QJZ A;  2A4Z A;  1KT0 A;  3LCA A;  1HXI A;  3GW4 A;  1S64 A;  4BX9 A;  3ZPJ A;  2WQ7 A;  4ILI A;  3AG2 E;  2RFM A;  2OVF A;  3TJP A;  4F3V A;  4A3T A;  1SA5 A;  3Q9U C;  2FO1 E;  2BED A;  4CDR A;  4CRW A;  2CHW A;  3U64 A;  4O1P A;  3D9H A;  3LJ3 A;  4F1S A;  4IRU A;  2P9L G;  2XCC A;  1E8Y A;  3T8K A;  3APC A;  2WXM A;  2WM9 A;  1SZ9 A;  2CFU A;  1QYM A;  1MX6 A;  2VGE A;  3CHO A;  3B7T A;  1FT1 A;  2HO1 A;  1N4P A;  4PH4 B;  3ZN3 A;  3FFL A;  2RFA A;  3Q49 B;  4G8K A;  2FI7 A;  5EN5 D;  2WXI A;  4I9E A;  4F1P A;  3G2U A;  4I2Z A;  5BXU A;  2WXL A;  3VLF A;  3CQG B;  3Q5M A;  3CVW A;  4NQ0 A;  3L9T A;  5AQ7 A;  4B94 A;  4JW1 A;  3OXG A;  1LF8 A;  2KZT B;  1W3B A;  4J7W A;  3S7F A;  1DVP A;  3ISM C;  4ILG A;  4O60 A;  3ZXS A;  3G2V A;  4UI9 K;  3B95 A;  2FBN A;  1QZ2 A;  2R02 A;  5AJL A;  5ENQ D;  1V54 E;  3NOC D;  4GTV A;  2FEZ A;  3GZS A;  1TNB A;  4DUI A;  4MBG A;  2XGS A;  4TUM A;  1ELW A;  4URK A;  2WXJ A;  3CVU A;  3U9W A;  5AEN A;  4I6J A;  3Q4A B;  1RW2 A;  2L0I A;  4KXK B;  4FU3 A;  4HOQ A;  4PUC A;  3Q7A A;  2DZN A;  4U8Y D;  3EHN A;  4J8F A;  4GTT A;  4C0M A;  1OCO E;  4Y6C A;  2JLB A;  3CHQ A;  4CDM A;  4F7A A;  2F8Y A;  4EZL A;  4J8D A;  4HNA D;  3PE4 A;  1TNO A;  5JJT A;  2GRO B;  3GZ2 A;  3EDT B;  4ANU A;  4C48 B;  3PDN A;  4DX7 D;  3C3O A;  4G8L A;  4CT0 A;  3UKU G;  4KBQ A;  1WDY A;  2P9N G;  2DYR E;  3L13 A;  3IXE A;  3RSE G;  4AEZ C;  1H6K A;  3OTN A;  3AG3 E;  1NL4 A;  1FCH A;  4ME2 A;  2EIN E;  2F8X K;  4CYM D;  4APF A;  4D10 C;  2ETC A;  3D9L A;  1ELR A;  4EBA A;  2XPY A;  2Y1L E;  4YVQ C;  5CMY A;  4ATG A;  2VSY A;  4AVX A;  3UM2 A;  5ITZ F;  4KVM A;  3Q75 A;  3PRZ A;  2LUH A;  2OEV A;  5E75 A;  1H6P A;  1LD7 A;  3AU4 A;  2GRR B;  2MHK A;  3RRU A;  4WNG A;  1N94 A;  3TWV A;  1N0R A;  3L82 A;  5G04 J;  1D8D A;  2AXZ A;  3ZGQ A;  4GTQ A;  2VTB B;  4LNB A;  2QC9 A;  5KNH D;  3L16 A;  3FEX A;  4CCA A;  4E6H A;  4I43 A;  2YIN A;  5D0Q D;  5CCM A;  5LP0 A;  4M3O A;  5BUZ A;  3QWP A;  3PVL A;  4UI9 C;  4YDE A;  3ZKJ A;  3LJN A;  4OVV A;  5CEA A;  3EHR A;  1Z5S C;  1N4S A;  2H6I A;  2MOW A;  3AJI A;  4GU5 A;  3UXG A;  4RQI A;  4N3B A;  3DSS A;  2B6C A;  3C72 A;  4B0Z A;  3UMV A;  2VGY A;  5FQ6 A;  4AOF A;  3CVQ A;  1YA0 A;  3B13 A;  5HQ8 A;  4HOT A;  3N71 A;  1PC2 A;  5FZQ A;  4JHR A;  3D9O A;  3P2B A;  2V0P A;  3MEK A;  4DX6 D;  5BV1 A;  2LAI A;  4U0U A;  2OVB A;  5LFA A;  2R17 C;  3R9M A;  1Z3Y A;  1U2V G;  3EIQ C;  3HXC A;  3G2W A;  1S63 A;  2IU1 A;  3BU8 A;  3I5P A;  4EBA G;  3CLJ A;  2ETA A;  2XGM A;  3V2O A;  4GYW A;  2ZU6 B;  3EHM A;  1V55 E;  3DPY A;  4B89 A;  4FP7 A;  2KC7 A;  1MQS A;  2Q7F A;  2QYU A;  4FAD A;  3NF1 A;  1LTX A;  3AS4 A;  3LEW A;  3RRM B;  1KPS B;  3S2A A;  2V5Q C;  4NUR A;  3PZD A;  1HFA A;  3FUK A;  5FZS A;  4FJY A;  5ARF A;  1KLX A;  5EX0 A;  2WXH A;  2F0Y A;  3PNL B;  2L6J A;  4FJZ A;  4JHJ A;  4JL0 A;  1HG5 A;  2AXU A;  3QAR A;  3HIZ A;  5D0O D;  4GPM A;  1QNF A;  4U95 D;  3WG7 E;  5BW8 C;  3FTU A;  5JJ7 A;  3CK7 A;  2RG8 A;  3DPD A;  3DST A;  1IKN D;  5FTP A;  2GRM A;  2EIJ E;  4A3V A;  4IYP A;  2I2O A;  4BSX A;  2LSV A;  2X3M A;  3ASD A;  1O1R A;  4GCN A;  2XS8 A;  3BUA A;  2BTD A;  3CVY A;  5AQB A;  3PNT B;  3CHS A;  3JYS A;  1FVF A;  3QKY A;  3RO2 A;  2XHE A;  4BFR A;  3VTY A;  2P9U G;  2X6F A;  4J8S A;  5J90 A;  2J9Q A;  4I6G A;  2X38 A;  1YYH A;  4CGV A;  3QWW A;  4CDN A;  1N9A A;  3LVQ E;  2WXK A;  3ASG A;  3ZEF A;  4FLH A;  5AN8 A;  3R9A B;  5BXO A;  3V2X A;  3CKC A;  2P9I G;  3UIN C;  5CRV A;  1D9S A;  5KJM A;  4FA6 A;  5CMW A;  4GTP A;  3HXF A;  5KJN A;  4C0E A;  4DLQ A;  2VSX E;  4TXQ A;  4CT4 A;  4HRN A;  3D9M A;  4HVB A;  4N39 A;  3P1U A;  4MLP A;  3HRA A;  3KD7 A;  4TRQ A;  4HFG A;  3UT7 A;  3DXM G;  1SW6 A;  1UN8 A;  3WXX A;  1MHQ A;  4O1O A;  1PAQ A;  3ZNG A;  1N11 A;  1N4R A;  1N4Q A;  3JXI A;  4AV7 A;  4Q94 A;  3SHF A;  2QZA A;  3ENE A;  2H6F A;  4Y6W A;  3MKQ B;  3UT4 A;  3D9K A;  1MZC A;  4JB8 P;  3SBS A;  4GZC A;  3IHY A;  5A7D B;  2HM8 A;  4JVS A;  4OYS A;  5G05 C;  3JUI A;  2CG3 A;  1IQU A;  5HKP A;  3SFY A;  4BT9 A;  3TG4 A;  2ZGD A;  2XS1 A;  3V79 K;  3FU6 A;  3ML9 A;  2LXM A;  2V4L A;  4U8V D;  3CV0 A;  1O5M A;  3UKR G;  2YHE A;  4GA2 A;  4KT6 B;  2GRQ B;  1TN7 A;  5DBK A;  3FUI A;  2L9B A;  1OCC E;  4JEU A;  2ZGG A;  4Z68 A;  3U4T A;  4N2S A;  2AWI A;  3VTX A;  2AW6 A;  2CHX A;  5A23 A;  5EID A;  3F6Q A;  3NAW A;  4ZFH A;  4EEC A;  2ZIS A;  4J8Y A;  4DI4 A;  4EZK A;  5EYL A;  2P2C P;  2IOL A;  2KZT A;  3UM3 A;  1S70 B;  4HXI A;  4MRU A;  2XEH A;  2XGO A;  1TEZ A;  3HVE A;  3R7Q A;  2XZD G;  2Y4T A;  3CHR A;  2GRL A;  3G2S A;  3CHP A;  1OT8 A;  3B7B A;  1QQE A;  2HR2 A;  1BD8 A;  3ASO E;  4LCT A;  1TN8 A;  3GZ1 A;  3SZ7 A;  3DBS A;  4FUL A;  3OXL A;  3OAW A;  4YDW A;  4B93 B;  1Q2Z A;  2A5E A;  5C2Y A;  2KBX A;  2M63 A;  3BG0 B;  5KJK A;  2J08 A;  3FUE A;  4DX1 A;  5CBO A;  2GW1 A;  2Y3A A;  2R05 A;  1O1T A;  4BSZ B;  4UI9 J;  1ZU2 A;  2XPZ A;  4U07 A;  2H6G A;  1Z3X A;  1GW6 A;  3HYM B;  3PUK A;  4B8A A;  1HG2 A;  1PY1 A;  5EIL A;  4CGW A;  4RVB A;  4GMJ A;  4AXH A;  4CEM A;  2PM7 A;  4X8Q A;  1VDY A;  3LXU X;  5KCM A;  3ULE G;  4DI3 A;  1E90 A;  4L7T A;  3TL5 A;  3CVL A;  1SQM A;  4WWP A;  3FTX A;  4A1G A;  3HVE B;  4XI9 A;  3ABM E;  4LEU A;  3DXK G;  4XZ4 A;  5B3S E;  3UPV A;  5BPP A;  2I6H A;  4HI9 A;  5AQ9 A;  4DPR A;  2DYS E;  4GZD A;  4MKT A;  2R03 A;  3MJW A;  3PH0 C;  3SI5 A;  3E37 A;  1E8W A;  4I1A A;  4HOU A;  1MX4 A;  5AQA A;  1OXJ A;  4WAF A;  1MX2 A;  3FUF A;  2VTB A;  3ASF A;  2V8S E;  4EZJ A;  5A6C A;  1U3D A;  3L54 A;  3PRE A;  4ACK A;  4XX5 A;  4TV3 A;  3LDZ A;  3LS8 A;  4GB9 A;  4H7X A;  3S7J A;  2QY7 A;  1EYH A;  2P58 C;  4BX8 A;  5BNW A;  4G24 A;  4O6F A;  2IOS A;  4KMO A;  3HXB A;  4N2Q A;  1HH8 A;  4RG9 A;  4APO A;  4OAV B;  4JXT A;  4AY5 A;  2BUG A;  5FWQ A;  3FTW A;  4FHK A;  5KBA A;  2KCV A;  1AP7 A;  2MYO A;  4DX2 A;  1JPL A;  4XKB A;  1UJK A;  3MCX A;  3ML8 A;  3E34 A;  2UWJ G;  1H2U A;  3FTS A;  5B1B E;  3D9I A;  4KZ0 A;  2J07 A;  3TAX A;  3EIJ A;  5KJL A;  5CHE E;  4U04 A;  4E85 A;  3QK0 A;  2FUL A;  2AXV A;  4GTR A;  2JAB A;  4NAC A;  3CIA A;  4G25 A;  2WPV A;  4BWR A;  5AIJ A;  1A5E A;  3FU0 A;  1AWC B;  5EKQ D;  1TNU A;  5T4Y A;  2XQ0 A;  4GYO A;  4LSZ E;  5JMN D;  3SO8 A;  1E7V A;  1TNZ A;  4A1S A;  4HOR A;  5FZR A;  4XEI G;  2LSU A;  3SY2 A;  1INZ A;  1IHG A;  2WQ6 A;  3FUJ A;  1TYQ G;  3RK6 A;  2XRZ A;  3D3M A;  1E7U A;  4EQF A;  2EQX A;  5AAO A;  5C1D A;  4UWH A;  1WG0 A;  3RAU A;  4B8C B;  5BT1 A;  2AVP A;  4HQD A;  4HI8 A;  2VYI A;  4Q69 A;  3ONL A;  3FTV A;  1UOH A;  4TXP A;  5ANR A;  3SQV A;  2WB2 A;  1U3C A;  2Y69 E;  3AG4 E;  1FPP A;  4U0S A;  1TJF A;  2NSZ A;  5G05 J;  3CGH A;  3EU9 A;  2DIW A;  3JXJ A;  3FTZ A;  4GZ5 A;  1E8Z A;  5CRU A;  5M72 A;  3RIB A;  1IXV A;  3ASN E;  4GA0 A;  3FEY A;  5JHA A;  1JCS A;  3O4Z A;  4DRX E;  4PS3 A;  2KXP C;  4FHJ A;  3ABK E;  3KAE A;  1HS6 A;  4HS2 A;  3KEA A;  3ZYL A;  4GZ6 A;  5FIO A;  5T8I A;  1HZ4 A;  4JZY A;  3KSL A;  4XE0 A;  4AIF A;  2C2L A;  3DEO A;  3PUJ A;  4G23 A;  2NC9 A;  4WNF A;  3L6A A;  5EDS A;  4G1T A;  3J5Q B;  2MRI A;  3JUE A;  4L23 A;  3HXD A;  1MJ0 A;  2P9K G;  3TWU A;  3DSX A;  3MA5 A;  3RRN B;  2NXP A;  3Q78 A;  1BU9 A;  3UI2 A;  3TWR A;  4LNU D;  3MKQ A;  1HE8 A;  4F53 A;  1KZP A;  1DCE A;  3W9G A;  4Q96 A;  5G55 A;  3DWL G;  3L17 A;  1E96 B;  3UIP C;  3NZU A;  4N5Q A;  3Q79 A;  5EYP F;  2E0I A;  2HYZ A;  3ZUV B;  3ZYK A;  1FVH A;  2E2E A;  2L6B A;  5ENT D;  3T5V A;  3UM1 A;  3PEV B;  2I1J A;  2IJG X;  4BT8 A;  2PNN A;  2YHC A;  2BKG A;  2LNI A;  1H6O A;  4LNG A;  1H2V C;  1K1B A;  3QOU A;  2ETB A;  4GMR A;  4UUC A;  1LD8 A;  4GYY A;  2X6I A;  3FH7 A;  3PZ2 A;  1HU3 A;  2XPI A;  1H0A A;  4KZC A;  3CQC B;  4U0Z A;  4XI0 A;  4BES A;  4R7L A;  1YCS B;  2IO2 C;  2YQ8 A;  5LCW C;  1ZBP A;  2XZT G;  4UWK A;  5ENS D;  2NYJ A;  4FLB A;  2LAH A;  2GGF A;  2WXN A;  3UX4 A;  3FP3 A;  4UWG A;  2J09 A;  3LPZ A;  3SFZ A;  3I3N A;  2JEK A;  4DX5 D;  2WXO A;  1JWF A;  3EHQ A;  4J6I A;  4JPS A;  3ZIM A;  4C9B B;  2P9P G;  2EIM E;  3HHM A;  3ABL E;  1NZN A;  4RG6 A;  5FQ8 A;  2J49 A;  3FU5 A;  1OUV A;  4WWO A;  2R5S A;  3JCK C;  4YVO A;  2X6H A;  5FQ4 A;  4N3A A;  3Q47 B;  2FF4 A;  5DIZ A;  1WM5 A;  4WUY A;  3EUV A;  1BI7 B;  2J4B A;  3BEE A;  1N52 A;  1SZA A;  3PE3 A;  2ION A;  5IY5 E;  3C3Q A;  1NA0 A;  3TWS A;  3UIO C;  3SFX A;  2QFC A;  3QC1 A;  5ENR D;  1NP7 A;  3T5X A;  4UQX A;  3RU0 A;  2OND A;  3AU5 A;  5HS0 A;  4DK5 A;  2OCC E;  4GTO A;  2QYJ A;  4CZ2 D;  4TXR A;  4DJA A;  4I6E A;  3L22 A;  3VLE A;  1K3Z D;  3DEP A;  3QWV A;  4JEH A;  1OWM A;  5EX3 A;  4V3I A;  3V31 A;  2VQ2 A;  4W9R A;  3DRA A;  4RSY A;  2UY1 A;  4EPZ A;  3FUN A;  1JWG A;  1IHB A;  4IN3 B;  3UM0 A;  4LER A;  4I2W A;  4OAU C;  1EDU A;  2DVW A;  4U63 A;  2ZIR A;  1P5Q A;  1IQR A;  3PS6 A;  4LUN U;  3AAA C;  3JQ1 A;  1OCZ E;  3APD A;  3KEZ A;  3CK8 A;  4IUL A;  2XEN A;  3BG1 B;  2EIK E;  4J0U A;  3SNX A;  5CCL A;  4JC8 A;  2AJA A;  3R7R A;  2WXF A;  5ENP D;  1UN9 A;  3J5P A;  3LYA A;  5G2N A;  5BV0 A;  2CFZ A;  4YDO A;  3UUX A;  3AS5 A;  3E32 A;  3DSW A;  4L9P A;  3CKB A;  4JA7 A;  4PS8 A;  3ZW3 A;  3KSQ A;  1X81 A;  4MS6 A;  4LRZ A;  2UY1 B;  3VLD A;  3CVN A;  1S0P A;  5FIN A;  3SF4 A;  2XEE A;  1Z6T A;  3E4B A;  4AP2 A;  3AG1 E;  3E30 A;  2OV8 A;  3MKR A;  2GRN B;  1N95 A;  2KCL A;  2H6H A;  1HF8 A;  3SGH A;  4BTB A;  3ONK A;  2Y4U A;  3D9J A;  3JQ0 A;  1NI1 A;  1JUQ A;  1N54 A;  1Y6I A;  4I1M A;  5J08 A;  4YDY A;  4BER A;  2WXG A;  2J4D A;  4AM9 A;  2KM4 A;  3Q73 A;  3NQP A;  3ZYQ A;  3EJN A;  1N0Q A;  3DSV A;  5CED B;  2DWZ A;  3I4R B;  2GRP B;  3B7S A;  2F37 A;  4L1B A;  3CVV A;  3IV0 A;  4J8E A;  3CEQ A;  5CER B;  3TGO A;  3FWV A;  4GPK A;  2WXP A;  2XCB A;  3S7D A;  4QFV A;  2C0M A;  4K5B A;  1BLX B;  4ABN A;  3HXE A;  2DCP A;  4GA1 A;  4ZHB A;  4NIK A;  1SA4 A;  3OXF A;  4QQI A;  4FC8 A;  1OWL A;  4L2L A;  1IYG A;  3B7R L;  3FH5 A;  4OVU A;  5FT9 A;  1DC2 A;  1BI8 B;  2X6J A;  4HRM B;  4I9C A;  5CBN A;  3DSU A;  3S7B A;  5D66 A; 
#chains in the Genus database with same CATH homology
 3SO8 A;  2KBX A;  2XEE A;  5AAR A;  3TWW A;  4A63 B;  3V31 A;  2XZT G;  2F8X K;  4DX1 A;  5CBO A;  4F6R D;  4CYM D;  5ENS D;  5AQ7 A;  2NYJ A;  5AQB A;  2DZO A;  2ETC A;  3J5Q B;  4ATZ D;  4BSZ B;  3JUE A;  1TR4 A;  4DX6 D;  4J7W A;  1MJ0 A;  1IHB A;  2Y1L E;  3Q9N C;  4O60 A;  5HKP A;  1SVX A;  3TWU A;  2ZGD A;  3B95 A;  4K5A B;  5ITZ F;  2HE0 A;  4K5C A;  4HBD A;  3V79 K;  5KWD A;  4OAU C;  4DX5 D;  1YYH A;  2J8S D;  1BU9 A;  3UI2 A;  3EHQ A;  4U8V D;  2DVW A;  4OAV B;  3TWQ A;  5ENQ D;  3TWR A;  4LNU D;  3HG0 D;  5AAO A;  2BKK B;  3T9K A;  3NOC D;  4YDY A;  4HLL A;  4HB5 A;  5AN8 A;  1WG0 A;  3AAA C;  4HRL A;  4BER A;  5EIL A;  1NFI E;  5CEC B;  4HQD A;  4LG6 A;  1N0R A;  4HI8 A;  3TWV A;  3W9F A;  5BXO A;  3V2X A;  4DUI A;  2XEN A;  2ZGG A;  4TUM A;  4Z68 A;  3W9G A;  1UOH A;  3TWT A;  1N0Q A;  5KBA A;  4U96 D;  1AP7 A;  1D9S A;  2MYO A;  3ZU7 B;  4DX2 A;  2ETA A;  3V2O A;  4N5Q A;  5EYP F;  5EID A;  5CED B;  2RFM A;  2Y0B G;  3F6Q A;  4ZFH A;  2AJA A;  2DWZ A;  4J8Y A;  2QC9 A;  5KNH D;  3ZUV B;  5EYL A;  2P2C P;  2L6B A;  4HRN A;  5ENP D;  5ENT D;  2V5Q C;  2F37 A;  1BI7 B;  3Q9U C;  2FO1 E;  3EU9 A;  3JXJ A;  1S70 B;  3J5P A;  1K1A A;  3V30 A;  2XEH A;  1IXV A;  3HRA A;  4BEP A;  4HI9 A;  5AQ9 A;  4RLY A;  3TWS A;  4O1P A;  5CER B;  3D9H A;  2XZD G;  2DZN A;  2PNN A;  4U8Y D;  1SW6 A;  4QFV A;  4K5B A;  3ZKJ A;  5ENR D;  3LJN A;  1DCQ A;  1OT8 A;  5CEA A;  3EHR A;  4O1O A;  3B7B A;  1BLX B;  3T8K A;  4DRX E;  2BKG A;  3ZNG A;  5EIB E;  4GPM A;  3AJI A;  1N11 A;  5HS0 A;  3C5R A;  4U95 D;  4ZHB A;  2KXP C;  2QYJ A;  3JXI A;  4NIK A;  3UTM A;  5KNG A;  4QQI A;  2JAB A;  4CZ2 D;  1K1B A;  3UXG A;  2F8Y A;  1MX4 A;  5AQA A;  3NBN B;  5ENO D;  2ETB A;  3KEA A;  4HNA D;  3NOG D;  1QYM A;  5JMN D;  4GMR A;  1BD8 A;  1MX2 A;  1OY3 D;  1MX6 A;  4UUC A;  2VGE A;  1MYO A;  5FIO A;  5JA4 D;  3TWX A;  4C48 B;  2V4H C;  1DC2 A;  4BET A;  1IKN D;  1A5E A;  4DX7 D;  2RFA A;  1BI8 B;  1AWC B;  5HRY A;  2B0O E;  4G8K A;  4JB8 P;  1K3Z D;  1YMP A;  4HRM B;  3DEP A;  4G8L A;  5EN5 D;  4YDW A;  4B93 B;  4BES A;  4F1P A;  5CBN A;  5FIN A;  1WDY A;  1YCS B;  5BXU A;  3IXE A;  2A5E A;  4LSZ E;  5D66 A;  3DEO A;  1G3N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...