2Y0BG

Caspase-3 in complex with an inhibitory darpin-3.4_s76r
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
119
structure length
119
Chain Sequence
DLGKKLLEATRAGQDDEVRILMANGADVNAMDDAGVTPLHLAAKRGHLEIVEVLLKHGADVNARDIWGRTPLHLAATVGHLEIVEVLLEYGADVNAQDKFGKTAFDISIDNGNEDLAEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CASPASE-3 SUBUNIT P17
publication title Specific Inhibition of Caspase-3 by a Competitive Darpin: Molecular Mimicry between Native and Designed Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 37
structure length 119
sequence length 119
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2y0bG00
4BSZB 2DVWA 3W9FA 5CEDB 2ETBA 4G8LA 3TWSA 5ITZF 5ENPD 3B7BA 2JABA 1SVXA 3KEAA 5AQ9A 3D9HA 1MYOA 2KXPC 4HRLA 2RFAA 3EHQA 3HRAA 1BI7B 2DZOA 2ZGGA 4K5BA 3ZUVB 5CBOA 2KBXA 4RLYA 2DWZA 1IHBA 3HG0D 3V30A 3NOCD 4A63B 2P2CP 3IXEA 4JB8P 1BU9A 3Q9UC 2HE0A 3ZNGA 1S70B 5EYLA 5CECB 4CZ2D 4DRXE 4G8KA 5FINA 4NIKA 5EN5D 5HKPA 1K1AA 3JXJA 5AAOA 5CERB 1YCSB 4K5AB 3W9GA 3Q9NC 2F8YA 3TWRA 1N11A 2F37A 3TWUA 2Y1LE 1BI8B 2AJAA 5JA4D 2F8XK 4J7WA 4N5QA 1YMPA 5EILA 1MX2A 3EU9A 5ENOD 5ENSD 3EHRA 4HBDA 4HRMB 1N0RA 2XZTG 4QQIA 4B93B 4LSZE 4HI9A 4HNAD 1A5EA 1N0QA 1YYHA 4LNUD 3V79K 1K3ZD 3DEPA 2XEHA 2B0OE 3C5RA 3NOGD 1AP7A 1WDYA 3UTMA 4OAVB 2QYJA 4HB5A 1TR4A 4HQDA 5AQ7A 4BERA 2ETAA 4BESA 4HLLA 5BXUA 2XZDG 1NFIE 2V5QC 4O1PA 2NYJA 4K5CA 2ZGDA 5HS0A 4TUMA 5EIDA 5ENRD 4Z68A 4GPMA 4LG6A 4U96D 1DC2A 5BXOA 2V4HC 2ETCA 2XENA 1D9SA 5ENTD 1WG0A 4O60A 4UUCA 3AAAC 1OY3D 5JMND 2BKKB 3B95A 1SW6A 3LJNA 4U8VD 2Y0BG 1BLXB 4YDYA 4OAUC 5AQAA 5EIBE 2MYOA 3J5QB 1IXVA 4YDWA 3T8KA 4BETA 4CYMD 2PNNA 4DUIA 5CEAA 5AN8A 2DZNA 4ZHBA 5AARA 3TWQA 4ATZD 4U8YD 3UI2A 4ZFHA 1BD8A 3TWVA 1OT8A 5HRYA 3NBNB 5KNHD 5FIOA 2QC9A 3SO8A 3V31A 5KNGA 1IKND 3J5PA 3F6QA 4C48B 1G3NB 4F1PA 4HRNA 4DX7D 4DX2A 2A5EA 4BEPA 4DX5D 4QFVA 2RFMA 5AQBA 2J8SD 3DEOA 5D66A 5EYPF 3JXIA 2VGEA 3JUEA 4O1OA 3T9KA 3TWWA 2L6BA 3UXGA 4DX6D 2FO1E 4DX1A 3V2OA 1UOHA 3ZKJA 3ZU7B 1MX4A 3TWXA 1AWCB 3TWTA 4F6RD 4HI8A 3AJIA 2XEEA 2BKGA 1K1BA 4GMRA 4U95D 5CBNA 5KWDA 5ENQD 1MX6A 3V2XA 4J8YA 1MJ0A 1DCQA 1QYMA 5KBAA
chains in the Genus database with same CATH superfamily
1OXJA 3EUVA 3W9FA 3BUAA 3CKBA 2XPYA 4G8LA 1E8ZA 4WWNA 1TEZA 3HXFA 3FTXA 2Y4UA 2YHCA 2IO3C 1HF8A 4RLYA 4GTRA 3JUIA 3APDA 3PEUB 2WXIA 4FJZA 4EPZA 5EYLA 4G8KA 3Q79A 4IRUA 4EZLA 2MHKA 5D0QD 5HKPA 3RRNB 3OAWA 3SZ7A 3TWRA 2WXKA 4HBDA 1N0RA 4YNDA 4O6FA 4OVVA 1WAO1 4GZ5A 1Z5SC 4HLLA 2WXMA 4YDEA 2P9PG 4BX8A 2X3MA 3D9MA 3MA5A 3NZSA 5HI7A 2XCBA 1OY3D 5DIZA 4G1TA 3J5QB 4YDWA 4GTTA 5FQ8A 4RQIA 3I4GA 4XKCA 5JHBA 2BF0X 4GYOA 4PS8A 4YVQC 4A3VA 4WWPA 2MOWA 4GZCA 4I6JA 1HS6A 2FF4A 4F1PA 3C3OA 3ONKA 4LERA 3VLEA 3EIJA 2FEZA 3JUEA 2LAHA 2EINE 3S2AA 3WG7E 5JJTA 3JQ0A 3TWTA 3RU0A 1N9AA 3AS4A 4DI4A 3QOUA 3ASHA 1NI1A 1JCRA 3R9AB 3AG3E 3NQPA 1IQUA 4ANWA 3CQGB 3C3QA 3PZDA 3CVWA 3QARA 2VSYA 3ZHEA 2C2LA 2IOSA 3GZ1A 3W9GA 3ULEG 3TWUA 3NZUA 1NL4A 4W9RA 4FP7A 3EHRA 4HI9A 5T8IA 3RK6A 5JJ7A 4I9CA 4LNUD 1UJJA 1WDYA 3KSQA 3VTYA 4ME2A 2ETAA 1S64A 5ENRD 1HG5A 5BXOA 5KJMA 4LCTA 4DJAA 3AG4E 4U8VD 2Y0BG 2EIME 2VGYA 3FH5A 3VLFA 2PNNA 4GMLA 5FWQA 3CVNA 3BQOA 3LYAA 2X6JA 1D8DA 5AYWD 1L5JA 3E37A 4C48B 1EPUA 4DX7D 4DX2A 5H7PA 4QFVA 5B1AE 1MX4A 3E34A 1S0PA 3DXKG 4I1OB 2WXRA 4FHJA 3GW4A 3PREA 1OCCE 1MQSA 1DCEA 3FDHA 1TNBA 2ETBA 5CMWA 1X81A 3T8MA 2DWZA 3DPDA 3FUJA 2XRYA 4DI3A 3Q73A 3T5VA 2WMNA 1E7UA 4AIFA 4FJYA 2OOEA 5JA4D 4TXRA 1FPPA 4N5QA 3VTXA 4GCNA 4JA9A 1H2VC 2XEHA 1AP7A 4FLBA 1H0AA 5BXUA 2V5QC 4O1PA 3UT7A 1TJCA 1ELKA 4U96D 4GZDA 3TJPA 2IONA 2LXMA 4YDYA 1TN6A 5BV1A 3T5XA 2XEVA 3T8KA 3SFZA 2R03A 3FU3A 5EX3A 4CDRA 4N3CA 1E8XA 5HRYA 1NA3A 2AXVA 5FIOA 5KNGA 4NURA 1G3NB 3CSFA 4I6EA 3KAEA 4FADA 4F53A 2J8SD 2QFCA 4O1OA 3GZSA 3PZ2A 4PS3A 3S7FA 4EZKA 3HIZA 2KCVA 4GMRA 2OVBA 3CSTA 4UWGA 2BUGA 4B8AA 2P9NG 4G23A 1UW4B 4AM9A 4TRQA 4GA0A 2XGSA 1E96B 5LX8A 3ONLA 4CEMA 5EX0A 4JA7A 4GTQA 3ZFWA 3B7TA 3PS6A 1ELWA 2HM8A 3Q9UC 4V3IA 5ANLA 3ZGQA 5FZQA 4NRHB 3B13A 1FVFA 3PZ1A 4AEZC 3JXJA 3C98A 3Q9NC 3ISMC 5LP0A 3OXFA 3UT4A 4RSYA 4LSZE 5BUZA 2I2OA 3MEKA 3UTMA 1JPLA 1XGWA 4WNEA 4FULA 1OWOA 5AQ7A 4CGWA 2XQ0A 3ZYMA 3SHFA 3NB2A 4N2QA 4UI9K 3SFXA 2X6IA 1BLXB 4OAUC 5J90A 3K9IA 5EKQD 2WXGA 2CFUA 2WXJA 4E6HA 2GGFA 3UT8A 3F6QA 3CVUA 4EZJA 5CCMA 1JCSA 1IQRA 1KT0A 1UN8A 4GTOA 4F6RD 4JZYA 1Z6TA 1FCHA 4IULA 4LRZA 4HORA 4LUNU 4FC8A 2GRMA 3DSXA 3ULQA 2JLBA 1Q2ZA 5JHAA 4JEHA 2PM6A 1NP7A 3KD7A 3ZEFA 2HE0A 4Y6WA 3SNXA 4DRXE 3LY7A 3RIBA 3HYMB 3G2VA 3UM2A 4YVOA 3P1UA 5ENOD 3FUIA 1N0QA 3IHVA 5M72A 1PY1A 4K5CA 4BY6A 4CRWA 4I1MA 4C0MA 3EIQC 4FU3A 2GRPB 4J0UA 2XENA 3EU5A 1FT1A 1ZU2A 4E85A 5LOZA 5E76A 3APFA 2M63A 3L17A 3PE4A 4N39A 4LNBA 3FTVA 2FULA 4G26A 1X5BA 5KNHD 3Q15A 1WY6A 4H7XA 2I9CA 3ZXPA 3V2OA 3ASOE 3TL5A 5AENA 3AJIA 3AU5A 5A7DB 3CQCB 4LEUA 3L54A 3LXUX 4TV3A 2GRNB 4GAAA 4UI9J 4L23A 2VTBB 3PEVB 3HRAA 2R17C 5G2NA 3TG4A 4WWOA 2E0IA 1E8YA 2CHWA 3C72A 3FEYA 2WM9A 4JHKA 2KZTA 4L7TA 5CERB 4U8HA 3LY8A 5T3RA 2H6IA 4L2YA 3NAWA 3ZYQA 3LPZA 3FHEA 3C5RA 2HYZA 4EQFA 4HQDA 4BERA 3SD5A 2WMOA 4Z68A 3Q49B 3TG5A 3I5PA 2V4HC 5ENTD 4UUCA 1NZNA 3FUNA 3U3WA 4ANXA 4BETA 2XPZA 4ATZD 4UWFA 3TWVA 5C1DA 4IYPA 3ZN3A 4WUYA 3CHSA 4KVMA 4U04A 3MYVA 4B89A 3S7DA 4DLOA 2JEKA 3D3MA 4HI8A 2LO6A 5DBKA 5CBNA 1OCRE 1D8EA 4JPSA 4U63A 3E4BA 2H6FA 3DWLG 3U9WA 3JYSA 3D9JA 2R02A 5J08A 2NSZA 3UQ3A 3ZYKA 3LS8A 3IV0A 3ZNGA 4C0EA 4UQYA 1SZAA 4CZ2D 1GW6A 4PS7A 1OWLA 2AVPA 3HXCA 3CHOA 3DBSA 3FP3A 4H7YA 3HVEB 3Q4AB 4J7WA 3SF4A 3DSUA 5ENSD 1Y6IA 2XZTG 4BTBA 2VQ2A 3N71A 1YYHA 3CHRA 4TXQA 3CHPA 4KBQA 2CG2A 1OWPA 2V5FA 2ZGDA 4UI9C 3ASFA 1O5MA 4D10C 1TYQG 2HO1A 4GCOA 3PRZA 2VSOE 2ZISA 4ACLA 3LJNA 4GB9A 5AQAA 3QWVA 1NA0A 2UWJG 3MKQB 3RRUA 2WQ6A 4MKTA 2P58C 4N5CA 2EQXA 2GROB 3U4TA 3ZVVA 2QY7A 3NBNB 2Y3AA 3BG1B 3CK7A 3QNKA 1IKND 3OXLA 4AXHA 5G05C 2A5EA 5B3SE 4GA1A 4DX5D 2J4BA 5AQBA 3DEOA 1O1RA 5BW8C 2XEEA 2YHEA 3L22A 4HOUA 2WVIA 1LTXA 4PUCA 5CMYA 4HFGA 3ZYLA 1HO8A 2DZOA 2WXLA 5FTPA 5FJYA 1TNUA 3QDNA 2YINA 5CECB 1IHGA 4DK5A 3EJNA 4MBGA 2BEDA 3QAQA 3PE3A 4K5AB 4I2ZA 2F0YA 3PZ3A 2J4DA 1MX2A 3E32A 3RJVA 2B6CA 1OWMA 4HNAD 1W3BA 3U64A 4CDMA 2KM4A 2IY0C 4UWLA 5ENNA 1S63A 3CVLA 3CLJA 5FZRA 1OCOE 4BESA 1QZ2A 4B94A 2NYJA 4KYOB 5AIJA 3ESKA 4LG6A 4JW1A 2IEJA 4RG9A 4A3TA 2WPVA 5JJ6A 2MYOA 4JC8A 4B0ZA 4XE0A 3CKCA 5AN8A 3GZ2A 3HDXA 2PQNA 3ESLA 1SA4A 4J6IA 3CIAA 3KEZA 3CEQA 1SZ9A 3SGHA 5EYPF 3UXGA 4KT6B 3AS8A 4DX1A 4I43A 1AWCB 4FA6A 4AV7A 5KWDA 4X8QA 4CT0A 1UN9A 3JCKC 1DCQA 2WXHA 2GRQB 3ZRHA 4KVOA 3QB2A 5ITZF 4GZ6A 1LD7A 4EBAA 5AQ9A 1MYOA 3PUKA 2L9BA 4K5BA 3L13A 4GZ3A 5HQ8A 1IHBA 4A63B 3RSEG 4JB8P 3TXNA 5KCMA 5FINA 4NIKA 4M3OA 3FTYA 4UWKA 3ZHEB 5AAOA 4I2WA 2P9LG 2X6HA 3QK0A 1Z3XA 4HOSA 4L9PA 1TNYA 3LVQE 2PZIA 3D9PA 1ELRA 2VGXA 3RAUA 3X2QE 2Y4TA 3CGHA 4OAVB 4XEIG 3LCAA 4GPMA 4JVSA 2OEVA 1D9SA 4O60A 4CT4A 2NXPA 3FY4A 2Q7FA 3L82A 4DUIA 2C0MA 2ZU6B 5FZSA 2DZNA 5AARA 3D9KA 2DYRE 3ZW3A 2QC9A 2XGMA 2VSNA 4APFA 2A4ZA 4BWRA 4HRNA 3PDNA 4BEPA 4GPKA 3ULYA 4KMOA 4WNGA 2WXFA 3ZKJA 3ZU7B 2IJGX 3P2BA 4GTPA 3B7SA 4GU5A 1Z3YA 1H19A 1MJ0A 4F1SA 2EIKE 1V54E 5ARFA 3Q7FA 4ANVA 2VYIA 3B7BA 3CVQA 3NF1A 4MRUA 3KEAA 3FUFA 2ZGGA 4KZCA 3RO3A 3SQVA 1BU9A 2YQ8A 2WXNA 2V8SE 3CVXA 1H2UA 2XCCA 1S70B 3PZ4A 4F7AA 3OTNA 3EHMA 2CFZA 3RO2A 1N11A 2F37A 3HHMA 5KJLA 2L0TB 5EDSA 5KJKA 4XIFA 4Q94A 3EU9A 4JL0A 5BPPA 4ABNA 3NOGD 3UPVA 1YA0A 3MZLB 3UUXA 2EILE 3B7UX 4HS2A 4AOFA 2LSUA 3ML8A 1HFAA 2ETCA 2R05A 1WG0A 4B8CB 3SFYA 1E8WA 5BNWA 3LVRE 4GYWA 1IXVA 1Y8MA 5FQ7A 4CYMD 4A1GA 4ZHBA 1KT1A 3UI2A 3B7RL 5AJLA 3MGBA 2R5SA 4J8EA 3EDTB 2LXLA 2P9KG 4XKBA 3PUJA 1N4SA 4GYYA 3JXIA 2FO1E 4I6GA 4G24A 2QZAA 1UJKA 2BKGA 2P9SG 5AJDA 4PH4B 1N4PA 5KBAA 3O4ZA 2DVWA 3D9IA 2P9UG 2WQHA 5LCWJ 2JABA 4GTSA 1BI7B 3DSTA 3UKRG 5CBOA 5BT1A 2AW6A 2P2CP 4AY6A 3DRAA 2LSVA 2J07A 2RKKA 3ASGA 5G55A 3JQ1A 2DIWA 4BT8A 3CVYA 4LNGA 2ONDA 3CR3A 2PL2A 4QQIA 2HR2A 4URKA 3PVLA 4BT9A 3LY9A 3DEPA 2Y69E 4HB5A 3BEEA 3G2TA 3UM1A 2XZDG 3PNTB 1U3CA 1EYHA 1TNOA 2WXPA 4F3VA 4AY5A 1RW2A 3E30A 4K03A 1A17A 1WM5A 5G05J 4I17A 3O48A 4DLQA 4FLHA 2DYSE 1N4QA 4OYSA 3TWQA 2LUHA 5CCLA 1P5QA 1H6KA 1INZA 4GMJA 3SO8A 1N94A 4XI0A 3J5PA 1VDYA 2WXOA 3UM3A 3FH7A 3QJZA 2H6HA 4OVUA 4ACKA 3QKYA 1TJFA 1DVPA 1B89A 3IKOB 5ANRA 1K1BA 4U95D 5ENQD 4U07A 3IEGA 5D0OD 1QYMA 4BSZB 1MZCA 2DCPA 3MV2B 2KXPC 4YDOA 4RG6A 2KBXA 4U0ZA 3V30A 3NOCD 1BPOA 2I6HA 2I1JA 3FTUA 1TN7A 4Y6CA 2RD0A 1O1SA 2OVFA 3L16A 2RG8A 3UIOC 4AJWA 3ZPJA 2Y1LE 2AJAA 1JCQA 5EILA 1TNZA 1JWFA 4APOA 1U2VG 2XHEA 2UY1A 4L1BA 1N52A 1E90A 4TXPA 4TUMA 5LCWC 3R9MA 2OV8A 3S7BA 1SW6A 5C2YA 4U0SA 3E33A 3BG0B 2LAIA 4ILHB 3MX3A 3OXGA 4AP2A 1PC2A 3CHMA 3UKUG 4ATGA 4DPRA 3FU5A 2AXZA 1KZOA 3IBEA 1HG2A 1UG3A 1ZB1A 1QBQA 5B1BE 2IF4A 4BFRA 1MHQA 1MX6A 3V2XA 4J8YA 4FHKA 3R7QA 4EECA 2OCCE 5CEDB 4I1AA 3BU8A 4JHJA 1SVXA 4N3BA 4HRLA 2IQCA 3SY2A 3FWVA 4K0RA 4J8DA 4N2SA 3FEXA 3FTZA 1TN8A 3DSSA 5FQ4A 5E75A 4WNFA 2KCKA 4ILGA 1RZ4A 3UINC 2F8YA 2KZTB 3D9OA 2ZXWE 1HX8A 4GTVA 3SBTB 3D9LA 4JHRA 3CVPA 2CHXA 3FUHA 1KLXA 5CRUA 3G2UA 5T4YA 3VLDA 4ANUA 1XNFA 5HS0A 2FO7A 3UX4A 2WXQA 2XGOA 1OWNA 3FU6A 1KZPA 4KXKB 2CG3A 2FI7A 1EF1C 1OUVA 3B95A 2L0IA 3FTWA 3EHNA 2OEWA 4U8YD 3AG1E 3C3RA 4ZFHA 4G2VA 3ZIMA 1QQEA 3DXMG 3AU4A 5D66A 4DX6D 3AS5A 4R7LA 5KJNA 4G11A 3FTSA 3G2WA 3PH0C 2XPIA 3KSLA 4TUUA 5FT9A 3TWSA 4G25A 3LJ3A 3ZUVB 3L08A 3GYZA 3HG0D 1SQMA 3L9TA 2AWIA 5D2MC 5G04J 3AG2E 3ABME 2UY1B 2EIJE 4U7EB 2H6GA 3FUKA 1BI8B 2F8XK 3RRMB 2DBAA 2KATA 5A23A 2J08A 1A5EA 2X38A 4UWHA 3V79K 1TR4A 3UIPC 3CV0A 1NFIE 4XI9A 1QNFA 4UQZA 3AAAC 3FULA 3ZXSA 1OCZE 3R7RA 2QYUA 5EIBE 3CK9A 1HE8A 2KCLA 3DPYA 3QWPA 4M7CA 2J9QA 4J8SA 1OT8A 1JWGA 4J8FA 2V0PA 3CVVA 2RFMA 4RVBA 3FUMA 2VGEA 3TWWA 2L6BA 2R59A 4HLEA 1ZBPA 3G2SA 4PDXA 4WNDA 3DSWA 1SA5A 3CK8A 2KC7A 2CHZA 3MJWA 4MLPA 4Q69A 2NC9A 5ENPD 2VTBA 1N4RA 3D9HA 3HXBA 2RFAA 1DNPA 2J09A 2WQ7A 4HXIA 3IXEA 2A5UA 3ABKE 4JD2G 2VSXE 1IYGA 3DSVA 4C9BB 1H6PA 1KPSB 1YCSB 2GRRB 1YMPA 2IO2C 5A6CA 1FT2A 3FU0A 1JUQA 4P29A 2XS1A 3SBSA 2VJ8A 1HZ4A 2PM7A 3ENEA 2J49A 4IN3B 4GA2A 3TXMA 5EIDA 4AVXA 4CCAA 1O1TA 5CHEE 2V4LA 3Q78A 1V55E 2BKKB 4I9EA 3UM0A 4BTAA 4HOTA 4BX9A 3LKUA 4A1SA 1U3DA 3Q7AA 3MCXA 5G04C 3HXDA 4KZ0A 5CRVA 3KS2A 5CEAA 3MKRA 4CGVA 3URZA 4U0UA 3CHQA 2PQRA 5BV0A 1BD8A 1K8KG 4L2LA 3V31A 1N54A 1N95A 2IU1A 4HVBA 3D9NA 3T9KA 3MV3B 1H6OA 2YNQA 1UOHA 1HH8A 3TWXA 3LDZA 2C0LA 4A55A 3U66A 1EDUA 4EHMA 3L6AA 2R2LA 5FQ6A 4MS6A 2ILRA 4NQ0A 3I3NA 3EHQA 3FUEA 1H2TC 4BSXA 2LNIA 2I1KA 3RKVA 3UMVA 4JXTA 5EN5D 1LD8A 1K1AA 3HVEA 4N3AA 2ZIRA 4NACA 4GTMA 4HRMB 2IFUA 4B93B 4ILIA 3I4RB 4WAFA 3HXEA 4HOQA 1K3ZD 3FH8A 2B0OE 3ASNE 3FFLA 4JEUA 4XX5A 3S7JA 2QYJA 2VGXB 2IOLA 3ABLE 2L6JA 3APCA 3ML9A 4EBAG 1DC2A 2GRLA 2P9IG 1LF8A 3Q5MA 5JMND 3PNLB 3Q47B 3MKQA 2FBNA 2X6FA 3LEWA 1HXIA 5ARGA 3Q75A 4CDNA 4XZ4A 2GW1A 3WXXA 3IHYA 3QC1A 2MRIA 2X6KA 3SI5A 3ASDA 1PAQA 3QWWA 4UQXA 3TGOA 1E7VA 2BTDA 2AXUA 2XRZA 3TAXA 2XS8A 5IY5E 1FVHA 2E2EA 5LFAA 4Q96A 3FUDA 1HU3A 2WB2A
chains in the Genus database with same CATH topology
4BSZB 2DVWA 3W9FA 5CEDB 2ETBA 4G8LA 3TWSA 5ITZF 5ENPD 3B7BA 2JABA 1SVXA 3KEAA 5AQ9A 3D9HA 1MYOA 2KXPC 4HRLA 2RFAA 3EHQA 3HRAA 1BI7B 2DZOA 2ZGGA 4K5BA 3ZUVB 5CBOA 2KBXA 4RLYA 2DWZA 1IHBA 3HG0D 3V30A 3NOCD 4A63B 2P2CP 3IXEA 4JB8P 1BU9A 3Q9UC 2HE0A 3ZNGA 1S70B 5EYLA 5CECB 4CZ2D 4DRXE 4G8KA 5FINA 4NIKA 5EN5D 5HKPA 1K1AA 3JXJA 5AAOA 5CERB 1YCSB 4K5AB 3W9GA 3Q9NC 2F8YA 3TWRA 1N11A 2F37A 3TWUA 2Y1LE 1BI8B 2AJAA 5JA4D 2F8XK 4J7WA 4N5QA 1YMPA 5EILA 1MX2A 3EU9A 5ENOD 5ENSD 3EHRA 4HBDA 4HRMB 1N0RA 2XZTG 4QQIA 4B93B 4LSZE 4HI9A 4HNAD 1A5EA 1N0QA 1YYHA 4LNUD 3V79K 1K3ZD 3DEPA 2XEHA 2B0OE 3C5RA 3NOGD 1AP7A 1WDYA 3UTMA 4OAVB 2QYJA 4HB5A 1TR4A 4HQDA 5AQ7A 4BERA 2ETAA 4BESA 4HLLA 5BXUA 2XZDG 1NFIE 2V5QC 4O1PA 2NYJA 4K5CA 2ZGDA 5HS0A 4TUMA 5EIDA 5ENRD 4Z68A 4GPMA 4LG6A 4U96D 1DC2A 5BXOA 2V4HC 2ETCA 2XENA 1D9SA 5ENTD 1WG0A 4O60A 4UUCA 3AAAC 1OY3D 5JMND 2BKKB 3B95A 1SW6A 3LJNA 4U8VD 2Y0BG 1BLXB 4YDYA 4OAUC 5AQAA 5EIBE 2MYOA 3J5QB 1IXVA 4YDWA 3T8KA 4BETA 4CYMD 2PNNA 4DUIA 5CEAA 5AN8A 2DZNA 4ZHBA 5AARA 3TWQA 4ATZD 4U8YD 3UI2A 4ZFHA 1BD8A 3TWVA 1OT8A 5HRYA 3NBNB 5KNHD 5FIOA 2QC9A 3SO8A 3V31A 5KNGA 1IKND 3J5PA 3F6QA 4C48B 1G3NB 4F1PA 4HRNA 4DX7D 4DX2A 2A5EA 4BEPA 4DX5D 4QFVA 2RFMA 5AQBA 2J8SD 3DEOA 5D66A 5EYPF 3JXIA 2VGEA 3JUEA 4O1OA 3T9KA 3TWWA 2L6BA 3UXGA 4DX6D 2FO1E 4DX1A 3V2OA 1UOHA 3ZKJA 3ZU7B 1MX4A 3TWXA 1AWCB 3TWTA 4F6RD 4HI8A 3AJIA 2XEEA 2BKGA 1K1BA 4GMRA 4U95D 5CBNA 5KWDA 5ENQD 1MX6A 3V2XA 4J8YA 1MJ0A 1DCQA 1QYMA 5KBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BSZ B;  2DVW A;  3W9F A;  5CED B;  2ETB A;  4G8L A;  3TWS A;  5ITZ F;  5ENP D;  3B7B A;  2JAB A;  1SVX A;  3KEA A;  5AQ9 A;  3D9H A;  1MYO A;  2KXP C;  4HRL A;  2RFA A;  3EHQ A;  3HRA A;  1BI7 B;  2DZO A;  2ZGG A;  4K5B A;  3ZUV B;  5CBO A;  2KBX A;  4RLY A;  2DWZ A;  1IHB A;  3HG0 D;  3V30 A;  3NOC D;  4A63 B;  2P2C P;  3IXE A;  4JB8 P;  1BU9 A;  3Q9U C;  2HE0 A;  3ZNG A;  1S70 B;  5EYL A;  5CEC B;  4CZ2 D;  4DRX E;  4G8K A;  5FIN A;  4NIK A;  5EN5 D;  5HKP A;  1K1A A;  3JXJ A;  5AAO A;  5CER B;  1YCS B;  4K5A B;  3W9G A;  3Q9N C;  2F8Y A;  3TWR A;  1N11 A;  2F37 A;  3TWU A;  2Y1L E;  1BI8 B;  2AJA A;  5JA4 D;  2F8X K;  4J7W A;  4N5Q A;  1YMP A;  5EIL A;  1MX2 A;  3EU9 A;  5ENO D;  5ENS D;  3EHR A;  4HBD A;  4HRM B;  1N0R A;  2XZT G;  4QQI A;  4B93 B;  4LSZ E;  4HI9 A;  4HNA D;  1A5E A;  1N0Q A;  1YYH A;  4LNU D;  3V79 K;  1K3Z D;  3DEP A;  2XEH A;  2B0O E;  3C5R A;  3NOG D;  1AP7 A;  1WDY A;  3UTM A;  4OAV B;  2QYJ A;  4HB5 A;  1TR4 A;  4HQD A;  5AQ7 A;  4BER A;  2ETA A;  4BES A;  4HLL A;  5BXU A;  2XZD G;  1NFI E;  2V5Q C;  4O1P A;  2NYJ A;  4K5C A;  2ZGD A;  5HS0 A;  4TUM A;  5EID A;  5ENR D;  4Z68 A;  4GPM A;  4LG6 A;  4U96 D;  1DC2 A;  5BXO A;  2V4H C;  2ETC A;  2XEN A;  1D9S A;  5ENT D;  1WG0 A;  4O60 A;  4UUC A;  3AAA C;  1OY3 D;  5JMN D;  2BKK B;  3B95 A;  1SW6 A;  3LJN A;  4U8V D;  2Y0B G;  1BLX B;  4YDY A;  4OAU C;  5AQA A;  5EIB E;  2MYO A;  3J5Q B;  1IXV A;  4YDW A;  3T8K A;  4BET A;  4CYM D;  2PNN A;  4DUI A;  5CEA A;  5AN8 A;  2DZN A;  4ZHB A;  5AAR A;  3TWQ A;  4ATZ D;  4U8Y D;  3UI2 A;  4ZFH A;  1BD8 A;  3TWV A;  1OT8 A;  5HRY A;  3NBN B;  5KNH D;  5FIO A;  2QC9 A;  3SO8 A;  3V31 A;  5KNG A;  1IKN D;  3J5P A;  3F6Q A;  4C48 B;  1G3N B;  4F1P A;  4HRN A;  4DX7 D;  4DX2 A;  2A5E A;  4BEP A;  4DX5 D;  4QFV A;  2RFM A;  5AQB A;  2J8S D;  3DEO A;  5D66 A;  5EYP F;  3JXI A;  2VGE A;  3JUE A;  4O1O A;  3T9K A;  3TWW A;  2L6B A;  3UXG A;  4DX6 D;  2FO1 E;  4DX1 A;  3V2O A;  1UOH A;  3ZKJ A;  3ZU7 B;  1MX4 A;  3TWX A;  1AWC B;  3TWT A;  4F6R D;  4HI8 A;  3AJI A;  2XEE A;  2BKG A;  1K1B A;  4GMR A;  4U95 D;  5CBN A;  5KWD A;  5ENQ D;  1MX6 A;  3V2X A;  4J8Y A;  1MJ0 A;  1DCQ A;  1QYM A;  5KBA A; 
#chains in the Genus database with same CATH topology
 1OXJ A;  3EUV A;  3W9F A;  3BUA A;  3CKB A;  2XPY A;  4G8L A;  1E8Z A;  4WWN A;  1TEZ A;  3HXF A;  3FTX A;  2Y4U A;  2YHC A;  2IO3 C;  1HF8 A;  4RLY A;  4GTR A;  3JUI A;  3APD A;  3PEU B;  2WXI A;  4FJZ A;  4EPZ A;  5EYL A;  4G8K A;  3Q79 A;  4IRU A;  4EZL A;  2MHK A;  5D0Q D;  5HKP A;  3RRN B;  3OAW A;  3SZ7 A;  3TWR A;  2WXK A;  4HBD A;  1N0R A;  4YND A;  4O6F A;  4OVV A;  1WAO 1;  4GZ5 A;  1Z5S C;  4HLL A;  2WXM A;  4YDE A;  2P9P G;  4BX8 A;  2X3M A;  3D9M A;  3MA5 A;  3NZS A;  5HI7 A;  2XCB A;  1OY3 D;  5DIZ A;  4G1T A;  3J5Q B;  4YDW A;  4GTT A;  5FQ8 A;  4RQI A;  3I4G A;  4XKC A;  5JHB A;  2BF0 X;  4GYO A;  4PS8 A;  4YVQ C;  4A3V A;  4WWP A;  2MOW A;  4GZC A;  4I6J A;  1HS6 A;  2FF4 A;  4F1P A;  3C3O A;  3ONK A;  4LER A;  3VLE A;  3EIJ A;  2FEZ A;  3JUE A;  2LAH A;  2EIN E;  3S2A A;  3WG7 E;  5JJT A;  3JQ0 A;  3TWT A;  3RU0 A;  1N9A A;  3AS4 A;  4DI4 A;  3QOU A;  3ASH A;  1NI1 A;  1JCR A;  3R9A B;  3AG3 E;  3NQP A;  1IQU A;  4ANW A;  3CQG B;  3C3Q A;  3PZD A;  3CVW A;  3QAR A;  2VSY A;  3ZHE A;  2C2L A;  2IOS A;  3GZ1 A;  3W9G A;  3ULE G;  3TWU A;  3NZU A;  1NL4 A;  4W9R A;  4FP7 A;  3EHR A;  4HI9 A;  5T8I A;  3RK6 A;  5JJ7 A;  4I9C A;  4LNU D;  1UJJ A;  1WDY A;  3KSQ A;  3VTY A;  4ME2 A;  2ETA A;  1S64 A;  5ENR D;  1HG5 A;  5BXO A;  5KJM A;  4LCT A;  4DJA A;  3AG4 E;  4U8V D;  2Y0B G;  2EIM E;  2VGY A;  3FH5 A;  3VLF A;  2PNN A;  4GML A;  5FWQ A;  3CVN A;  3BQO A;  3LYA A;  2X6J A;  1D8D A;  5AYW D;  1L5J A;  3E37 A;  4C48 B;  1EPU A;  4DX7 D;  4DX2 A;  5H7P A;  4QFV A;  5B1A E;  1MX4 A;  3E34 A;  1S0P A;  3DXK G;  4I1O B;  2WXR A;  4FHJ A;  3GW4 A;  3PRE A;  1OCC E;  1MQS A;  1DCE A;  3FDH A;  1TNB A;  2ETB A;  5CMW A;  1X81 A;  3T8M A;  2DWZ A;  3DPD A;  3FUJ A;  2XRY A;  4DI3 A;  3Q73 A;  3T5V A;  2WMN A;  1E7U A;  4AIF A;  4FJY A;  2OOE A;  5JA4 D;  4TXR A;  1FPP A;  4N5Q A;  3VTX A;  4GCN A;  4JA9 A;  1H2V C;  2XEH A;  1AP7 A;  4FLB A;  1H0A A;  5BXU A;  2V5Q C;  4O1P A;  3UT7 A;  1TJC A;  1ELK A;  4U96 D;  4GZD A;  3TJP A;  2ION A;  2LXM A;  4YDY A;  1TN6 A;  5BV1 A;  3T5X A;  2XEV A;  3T8K A;  3SFZ A;  2R03 A;  3FU3 A;  5EX3 A;  4CDR A;  4N3C A;  1E8X A;  5HRY A;  1NA3 A;  2AXV A;  5FIO A;  5KNG A;  4NUR A;  1G3N B;  3CSF A;  4I6E A;  3KAE A;  4FAD A;  4F53 A;  2J8S D;  2QFC A;  4O1O A;  3GZS A;  3PZ2 A;  4PS3 A;  3S7F A;  4EZK A;  3HIZ A;  2KCV A;  4GMR A;  2OVB A;  3CST A;  4UWG A;  2BUG A;  4B8A A;  2P9N G;  4G23 A;  1UW4 B;  4AM9 A;  4TRQ A;  4GA0 A;  2XGS A;  1E96 B;  5LX8 A;  3ONL A;  4CEM A;  5EX0 A;  4JA7 A;  4GTQ A;  3ZFW A;  3B7T A;  3PS6 A;  1ELW A;  2HM8 A;  3Q9U C;  4V3I A;  5ANL A;  3ZGQ A;  5FZQ A;  4NRH B;  3B13 A;  1FVF A;  3PZ1 A;  4AEZ C;  3JXJ A;  3C98 A;  3Q9N C;  3ISM C;  5LP0 A;  3OXF A;  3UT4 A;  4RSY A;  4LSZ E;  5BUZ A;  2I2O A;  3MEK A;  3UTM A;  1JPL A;  1XGW A;  4WNE A;  4FUL A;  1OWO A;  5AQ7 A;  4CGW A;  2XQ0 A;  3ZYM A;  3SHF A;  3NB2 A;  4N2Q A;  4UI9 K;  3SFX A;  2X6I A;  1BLX B;  4OAU C;  5J90 A;  3K9I A;  5EKQ D;  2WXG A;  2CFU A;  2WXJ A;  4E6H A;  2GGF A;  3UT8 A;  3F6Q A;  3CVU A;  4EZJ A;  5CCM A;  1JCS A;  1IQR A;  1KT0 A;  1UN8 A;  4GTO A;  4F6R D;  4JZY A;  1Z6T A;  1FCH A;  4IUL A;  4LRZ A;  4HOR A;  4LUN U;  4FC8 A;  2GRM A;  3DSX A;  3ULQ A;  2JLB A;  1Q2Z A;  5JHA A;  4JEH A;  2PM6 A;  1NP7 A;  3KD7 A;  3ZEF A;  2HE0 A;  4Y6W A;  3SNX A;  4DRX E;  3LY7 A;  3RIB A;  3HYM B;  3G2V A;  3UM2 A;  4YVO A;  3P1U A;  5ENO D;  3FUI A;  1N0Q A;  3IHV A;  5M72 A;  1PY1 A;  4K5C A;  4BY6 A;  4CRW A;  4I1M A;  4C0M A;  3EIQ C;  4FU3 A;  2GRP B;  4J0U A;  2XEN A;  3EU5 A;  1FT1 A;  1ZU2 A;  4E85 A;  5LOZ A;  5E76 A;  3APF A;  2M63 A;  3L17 A;  3PE4 A;  4N39 A;  4LNB A;  3FTV A;  2FUL A;  4G26 A;  1X5B A;  5KNH D;  3Q15 A;  1WY6 A;  4H7X A;  2I9C A;  3ZXP A;  3V2O A;  3ASO E;  3TL5 A;  5AEN A;  3AJI A;  3AU5 A;  5A7D B;  3CQC B;  4LEU A;  3L54 A;  3LXU X;  4TV3 A;  2GRN B;  4GAA A;  4UI9 J;  4L23 A;  2VTB B;  3PEV B;  3HRA A;  2R17 C;  5G2N A;  3TG4 A;  4WWO A;  2E0I A;  1E8Y A;  2CHW A;  3C72 A;  3FEY A;  2WM9 A;  4JHK A;  2KZT A;  4L7T A;  5CER B;  4U8H A;  3LY8 A;  5T3R A;  2H6I A;  4L2Y A;  3NAW A;  3ZYQ A;  3LPZ A;  3FHE A;  3C5R A;  2HYZ A;  4EQF A;  4HQD A;  4BER A;  3SD5 A;  2WMO A;  4Z68 A;  3Q49 B;  3TG5 A;  3I5P A;  2V4H C;  5ENT D;  4UUC A;  1NZN A;  3FUN A;  3U3W A;  4ANX A;  4BET A;  2XPZ A;  4ATZ D;  4UWF A;  3TWV A;  5C1D A;  4IYP A;  3ZN3 A;  4WUY A;  3CHS A;  4KVM A;  4U04 A;  3MYV A;  4B89 A;  3S7D A;  4DLO A;  2JEK A;  3D3M A;  4HI8 A;  2LO6 A;  5DBK A;  5CBN A;  1OCR E;  1D8E A;  4JPS A;  4U63 A;  3E4B A;  2H6F A;  3DWL G;  3U9W A;  3JYS A;  3D9J A;  2R02 A;  5J08 A;  2NSZ A;  3UQ3 A;  3ZYK A;  3LS8 A;  3IV0 A;  3ZNG A;  4C0E A;  4UQY A;  1SZA A;  4CZ2 D;  1GW6 A;  4PS7 A;  1OWL A;  2AVP A;  3HXC A;  3CHO A;  3DBS A;  3FP3 A;  4H7Y A;  3HVE B;  3Q4A B;  4J7W A;  3SF4 A;  3DSU A;  5ENS D;  1Y6I A;  2XZT G;  4BTB A;  2VQ2 A;  3N71 A;  1YYH A;  3CHR A;  4TXQ A;  3CHP A;  4KBQ A;  2CG2 A;  1OWP A;  2V5F A;  2ZGD A;  4UI9 C;  3ASF A;  1O5M A;  4D10 C;  1TYQ G;  2HO1 A;  4GCO A;  3PRZ A;  2VSO E;  2ZIS A;  4ACL A;  3LJN A;  4GB9 A;  5AQA A;  3QWV A;  1NA0 A;  2UWJ G;  3MKQ B;  3RRU A;  2WQ6 A;  4MKT A;  2P58 C;  4N5C A;  2EQX A;  2GRO B;  3U4T A;  3ZVV A;  2QY7 A;  3NBN B;  2Y3A A;  3BG1 B;  3CK7 A;  3QNK A;  1IKN D;  3OXL A;  4AXH A;  5G05 C;  2A5E A;  5B3S E;  4GA1 A;  4DX5 D;  2J4B A;  5AQB A;  3DEO A;  1O1R A;  5BW8 C;  2XEE A;  2YHE A;  3L22 A;  4HOU A;  2WVI A;  1LTX A;  4PUC A;  5CMY A;  4HFG A;  3ZYL A;  1HO8 A;  2DZO A;  2WXL A;  5FTP A;  5FJY A;  1TNU A;  3QDN A;  2YIN A;  5CEC B;  1IHG A;  4DK5 A;  3EJN A;  4MBG A;  2BED A;  3QAQ A;  3PE3 A;  4K5A B;  4I2Z A;  2F0Y A;  3PZ3 A;  2J4D A;  1MX2 A;  3E32 A;  3RJV A;  2B6C A;  1OWM A;  4HNA D;  1W3B A;  3U64 A;  4CDM A;  2KM4 A;  2IY0 C;  4UWL A;  5ENN A;  1S63 A;  3CVL A;  3CLJ A;  5FZR A;  1OCO E;  4BES A;  1QZ2 A;  4B94 A;  2NYJ A;  4KYO B;  5AIJ A;  3ESK A;  4LG6 A;  4JW1 A;  2IEJ A;  4RG9 A;  4A3T A;  2WPV A;  5JJ6 A;  2MYO A;  4JC8 A;  4B0Z A;  4XE0 A;  3CKC A;  5AN8 A;  3GZ2 A;  3HDX A;  2PQN A;  3ESL A;  1SA4 A;  4J6I A;  3CIA A;  3KEZ A;  3CEQ A;  1SZ9 A;  3SGH A;  5EYP F;  3UXG A;  4KT6 B;  3AS8 A;  4DX1 A;  4I43 A;  1AWC B;  4FA6 A;  4AV7 A;  5KWD A;  4X8Q A;  4CT0 A;  1UN9 A;  3JCK C;  1DCQ A;  2WXH A;  2GRQ B;  3ZRH A;  4KVO A;  3QB2 A;  5ITZ F;  4GZ6 A;  1LD7 A;  4EBA A;  5AQ9 A;  1MYO A;  3PUK A;  2L9B A;  4K5B A;  3L13 A;  4GZ3 A;  5HQ8 A;  1IHB A;  4A63 B;  3RSE G;  4JB8 P;  3TXN A;  5KCM A;  5FIN A;  4NIK A;  4M3O A;  3FTY A;  4UWK A;  3ZHE B;  5AAO A;  4I2W A;  2P9L G;  2X6H A;  3QK0 A;  1Z3X A;  4HOS A;  4L9P A;  1TNY A;  3LVQ E;  2PZI A;  3D9P A;  1ELR A;  2VGX A;  3RAU A;  3X2Q E;  2Y4T A;  3CGH A;  4OAV B;  4XEI G;  3LCA A;  4GPM A;  4JVS A;  2OEV A;  1D9S A;  4O60 A;  4CT4 A;  2NXP A;  3FY4 A;  2Q7F A;  3L82 A;  4DUI A;  2C0M A;  2ZU6 B;  5FZS A;  2DZN A;  5AAR A;  3D9K A;  2DYR E;  3ZW3 A;  2QC9 A;  2XGM A;  2VSN A;  4APF A;  2A4Z A;  4BWR A;  4HRN A;  3PDN A;  4BEP A;  4GPK A;  3ULY A;  4KMO A;  4WNG A;  2WXF A;  3ZKJ A;  3ZU7 B;  2IJG X;  3P2B A;  4GTP A;  3B7S A;  4GU5 A;  1Z3Y A;  1H19 A;  1MJ0 A;  4F1S A;  2EIK E;  1V54 E;  5ARF A;  3Q7F A;  4ANV A;  2VYI A;  3B7B A;  3CVQ A;  3NF1 A;  4MRU A;  3KEA A;  3FUF A;  2ZGG A;  4KZC A;  3RO3 A;  3SQV A;  1BU9 A;  2YQ8 A;  2WXN A;  2V8S E;  3CVX A;  1H2U A;  2XCC A;  1S70 B;  3PZ4 A;  4F7A A;  3OTN A;  3EHM A;  2CFZ A;  3RO2 A;  1N11 A;  2F37 A;  3HHM A;  5KJL A;  2L0T B;  5EDS A;  5KJK A;  4XIF A;  4Q94 A;  3EU9 A;  4JL0 A;  5BPP A;  4ABN A;  3NOG D;  3UPV A;  1YA0 A;  3MZL B;  3UUX A;  2EIL E;  3B7U X;  4HS2 A;  4AOF A;  2LSU A;  3ML8 A;  1HFA A;  2ETC A;  2R05 A;  1WG0 A;  4B8C B;  3SFY A;  1E8W A;  5BNW A;  3LVR E;  4GYW A;  1IXV A;  1Y8M A;  5FQ7 A;  4CYM D;  4A1G A;  4ZHB A;  1KT1 A;  3UI2 A;  3B7R L;  5AJL A;  3MGB A;  2R5S A;  4J8E A;  3EDT B;  2LXL A;  2P9K G;  4XKB A;  3PUJ A;  1N4S A;  4GYY A;  3JXI A;  2FO1 E;  4I6G A;  4G24 A;  2QZA A;  1UJK A;  2BKG A;  2P9S G;  5AJD A;  4PH4 B;  1N4P A;  5KBA A;  3O4Z A;  2DVW A;  3D9I A;  2P9U G;  2WQH A;  5LCW J;  2JAB A;  4GTS A;  1BI7 B;  3DST A;  3UKR G;  5CBO A;  5BT1 A;  2AW6 A;  2P2C P;  4AY6 A;  3DRA A;  2LSV A;  2J07 A;  2RKK A;  3ASG A;  5G55 A;  3JQ1 A;  2DIW A;  4BT8 A;  3CVY A;  4LNG A;  2OND A;  3CR3 A;  2PL2 A;  4QQI A;  2HR2 A;  4URK A;  3PVL A;  4BT9 A;  3LY9 A;  3DEP A;  2Y69 E;  4HB5 A;  3BEE A;  3G2T A;  3UM1 A;  2XZD G;  3PNT B;  1U3C A;  1EYH A;  1TNO A;  2WXP A;  4F3V A;  4AY5 A;  1RW2 A;  3E30 A;  4K03 A;  1A17 A;  1WM5 A;  5G05 J;  4I17 A;  3O48 A;  4DLQ A;  4FLH A;  2DYS E;  1N4Q A;  4OYS A;  3TWQ A;  2LUH A;  5CCL A;  1P5Q A;  1H6K A;  1INZ A;  4GMJ A;  3SO8 A;  1N94 A;  4XI0 A;  3J5P A;  1VDY A;  2WXO A;  3UM3 A;  3FH7 A;  3QJZ A;  2H6H A;  4OVU A;  4ACK A;  3QKY A;  1TJF A;  1DVP A;  1B89 A;  3IKO B;  5ANR A;  1K1B A;  4U95 D;  5ENQ D;  4U07 A;  3IEG A;  5D0O D;  1QYM A;  4BSZ B;  1MZC A;  2DCP A;  3MV2 B;  2KXP C;  4YDO A;  4RG6 A;  2KBX A;  4U0Z A;  3V30 A;  3NOC D;  1BPO A;  2I6H A;  2I1J A;  3FTU A;  1TN7 A;  4Y6C A;  2RD0 A;  1O1S A;  2OVF A;  3L16 A;  2RG8 A;  3UIO C;  4AJW A;  3ZPJ A;  2Y1L E;  2AJA A;  1JCQ A;  5EIL A;  1TNZ A;  1JWF A;  4APO A;  1U2V G;  2XHE A;  2UY1 A;  4L1B A;  1N52 A;  1E90 A;  4TXP A;  4TUM A;  5LCW C;  3R9M A;  2OV8 A;  3S7B A;  1SW6 A;  5C2Y A;  4U0S A;  3E33 A;  3BG0 B;  2LAI A;  4ILH B;  3MX3 A;  3OXG A;  4AP2 A;  1PC2 A;  3CHM A;  3UKU G;  4ATG A;  4DPR A;  3FU5 A;  2AXZ A;  1KZO A;  3IBE A;  1HG2 A;  1UG3 A;  1ZB1 A;  1QBQ A;  5B1B E;  2IF4 A;  4BFR A;  1MHQ A;  1MX6 A;  3V2X A;  4J8Y A;  4FHK A;  3R7Q A;  4EEC A;  2OCC E;  5CED B;  4I1A A;  3BU8 A;  4JHJ A;  1SVX A;  4N3B A;  4HRL A;  2IQC A;  3SY2 A;  3FWV A;  4K0R A;  4J8D A;  4N2S A;  3FEX A;  3FTZ A;  1TN8 A;  3DSS A;  5FQ4 A;  5E75 A;  4WNF A;  2KCK A;  4ILG A;  1RZ4 A;  3UIN C;  2F8Y A;  2KZT B;  3D9O A;  2ZXW E;  1HX8 A;  4GTV A;  3SBT B;  3D9L A;  4JHR A;  3CVP A;  2CHX A;  3FUH A;  1KLX A;  5CRU A;  3G2U A;  5T4Y A;  3VLD A;  4ANU A;  1XNF A;  5HS0 A;  2FO7 A;  3UX4 A;  2WXQ A;  2XGO A;  1OWN A;  3FU6 A;  1KZP A;  4KXK B;  2CG3 A;  2FI7 A;  1EF1 C;  1OUV A;  3B95 A;  2L0I A;  3FTW A;  3EHN A;  2OEW A;  4U8Y D;  3AG1 E;  3C3R A;  4ZFH A;  4G2V A;  3ZIM A;  1QQE A;  3DXM G;  3AU4 A;  5D66 A;  4DX6 D;  3AS5 A;  4R7L A;  5KJN A;  4G11 A;  3FTS A;  3G2W A;  3PH0 C;  2XPI A;  3KSL A;  4TUU A;  5FT9 A;  3TWS A;  4G25 A;  3LJ3 A;  3ZUV B;  3L08 A;  3GYZ A;  3HG0 D;  1SQM A;  3L9T A;  2AWI A;  5D2M C;  5G04 J;  3AG2 E;  3ABM E;  2UY1 B;  2EIJ E;  4U7E B;  2H6G A;  3FUK A;  1BI8 B;  2F8X K;  3RRM B;  2DBA A;  2KAT A;  5A23 A;  2J08 A;  1A5E A;  2X38 A;  4UWH A;  3V79 K;  1TR4 A;  3UIP C;  3CV0 A;  1NFI E;  4XI9 A;  1QNF A;  4UQZ A;  3AAA C;  3FUL A;  3ZXS A;  1OCZ E;  3R7R A;  2QYU A;  5EIB E;  3CK9 A;  1HE8 A;  2KCL A;  3DPY A;  3QWP A;  4M7C A;  2J9Q A;  4J8S A;  1OT8 A;  1JWG A;  4J8F A;  2V0P A;  3CVV A;  2RFM A;  4RVB A;  3FUM A;  2VGE A;  3TWW A;  2L6B A;  2R59 A;  4HLE A;  1ZBP A;  3G2S A;  4PDX A;  4WND A;  3DSW A;  1SA5 A;  3CK8 A;  2KC7 A;  2CHZ A;  3MJW A;  4MLP A;  4Q69 A;  2NC9 A;  5ENP D;  2VTB A;  1N4R A;  3D9H A;  3HXB A;  2RFA A;  1DNP A;  2J09 A;  2WQ7 A;  4HXI A;  3IXE A;  2A5U A;  3ABK E;  4JD2 G;  2VSX E;  1IYG A;  3DSV A;  4C9B B;  1H6P A;  1KPS B;  1YCS B;  2GRR B;  1YMP A;  2IO2 C;  5A6C A;  1FT2 A;  3FU0 A;  1JUQ A;  4P29 A;  2XS1 A;  3SBS A;  2VJ8 A;  1HZ4 A;  2PM7 A;  3ENE A;  2J49 A;  4IN3 B;  4GA2 A;  3TXM A;  5EID A;  4AVX A;  4CCA A;  1O1T A;  5CHE E;  2V4L A;  3Q78 A;  1V55 E;  2BKK B;  4I9E A;  3UM0 A;  4BTA A;  4HOT A;  4BX9 A;  3LKU A;  4A1S A;  1U3D A;  3Q7A A;  3MCX A;  5G04 C;  3HXD A;  4KZ0 A;  5CRV A;  3KS2 A;  5CEA A;  3MKR A;  4CGV A;  3URZ A;  4U0U A;  3CHQ A;  2PQR A;  5BV0 A;  1BD8 A;  1K8K G;  4L2L A;  3V31 A;  1N54 A;  1N95 A;  2IU1 A;  4HVB A;  3D9N A;  3T9K A;  3MV3 B;  1H6O A;  2YNQ A;  1UOH A;  1HH8 A;  3TWX A;  3LDZ A;  2C0L A;  4A55 A;  3U66 A;  1EDU A;  4EHM A;  3L6A A;  2R2L A;  5FQ6 A;  4MS6 A;  2ILR A;  4NQ0 A;  3I3N A;  3EHQ A;  3FUE A;  1H2T C;  4BSX A;  2LNI A;  2I1K A;  3RKV A;  3UMV A;  4JXT A;  5EN5 D;  1LD8 A;  1K1A A;  3HVE A;  4N3A A;  2ZIR A;  4NAC A;  4GTM A;  4HRM B;  2IFU A;  4B93 B;  4ILI A;  3I4R B;  4WAF A;  3HXE A;  4HOQ A;  1K3Z D;  3FH8 A;  2B0O E;  3ASN E;  3FFL A;  4JEU A;  4XX5 A;  3S7J A;  2QYJ A;  2VGX B;  2IOL A;  3ABL E;  2L6J A;  3APC A;  3ML9 A;  4EBA G;  1DC2 A;  2GRL A;  2P9I G;  1LF8 A;  3Q5M A;  5JMN D;  3PNL B;  3Q47 B;  3MKQ A;  2FBN A;  2X6F A;  3LEW A;  1HXI A;  5ARG A;  3Q75 A;  4CDN A;  4XZ4 A;  2GW1 A;  3WXX A;  3IHY A;  3QC1 A;  2MRI A;  2X6K A;  3SI5 A;  3ASD A;  1PAQ A;  3QWW A;  4UQX A;  3TGO A;  1E7V A;  2BTD A;  2AXU A;  2XRZ A;  3TAX A;  2XS8 A;  5IY5 E;  1FVH A;  2E2E A;  5LFA A;  4Q96 A;  3FUD A;  1HU3 A;  2WB2 A; 
#chains in the Genus database with same CATH homology
 4BSZ B;  2DVW A;  3W9F A;  5CED B;  2ETB A;  4G8L A;  3TWS A;  5ITZ F;  5ENP D;  3B7B A;  2JAB A;  1SVX A;  3KEA A;  5AQ9 A;  3D9H A;  1MYO A;  2KXP C;  4HRL A;  2RFA A;  3EHQ A;  3HRA A;  1BI7 B;  2DZO A;  2ZGG A;  4K5B A;  3ZUV B;  5CBO A;  2KBX A;  4RLY A;  2DWZ A;  1IHB A;  3HG0 D;  3V30 A;  3NOC D;  4A63 B;  2P2C P;  3IXE A;  4JB8 P;  1BU9 A;  3Q9U C;  2HE0 A;  3ZNG A;  1S70 B;  5EYL A;  5CEC B;  4CZ2 D;  4DRX E;  4G8K A;  5FIN A;  4NIK A;  5EN5 D;  5HKP A;  1K1A A;  3JXJ A;  5AAO A;  5CER B;  1YCS B;  4K5A B;  3W9G A;  3Q9N C;  2F8Y A;  3TWR A;  1N11 A;  2F37 A;  3TWU A;  2Y1L E;  1BI8 B;  2AJA A;  5JA4 D;  2F8X K;  4J7W A;  4N5Q A;  1YMP A;  5EIL A;  1MX2 A;  3EU9 A;  5ENO D;  5ENS D;  3EHR A;  4HBD A;  4HRM B;  1N0R A;  2XZT G;  4QQI A;  4B93 B;  4LSZ E;  4HI9 A;  4HNA D;  1A5E A;  1N0Q A;  1YYH A;  4LNU D;  3V79 K;  1K3Z D;  3DEP A;  2XEH A;  2B0O E;  3C5R A;  3NOG D;  1AP7 A;  1WDY A;  3UTM A;  4OAV B;  2QYJ A;  4HB5 A;  1TR4 A;  4HQD A;  5AQ7 A;  4BER A;  2ETA A;  4BES A;  4HLL A;  5BXU A;  2XZD G;  1NFI E;  2V5Q C;  4O1P A;  2NYJ A;  4K5C A;  2ZGD A;  5HS0 A;  4TUM A;  5EID A;  5ENR D;  4Z68 A;  4GPM A;  4LG6 A;  4U96 D;  1DC2 A;  5BXO A;  2V4H C;  2ETC A;  2XEN A;  1D9S A;  5ENT D;  1WG0 A;  4O60 A;  4UUC A;  3AAA C;  1OY3 D;  5JMN D;  2BKK B;  3B95 A;  1SW6 A;  3LJN A;  4U8V D;  2Y0B G;  1BLX B;  4YDY A;  4OAU C;  5AQA A;  5EIB E;  2MYO A;  3J5Q B;  1IXV A;  4YDW A;  3T8K A;  4BET A;  4CYM D;  2PNN A;  4DUI A;  5CEA A;  5AN8 A;  2DZN A;  4ZHB A;  5AAR A;  3TWQ A;  4ATZ D;  4U8Y D;  3UI2 A;  4ZFH A;  1BD8 A;  3TWV A;  1OT8 A;  5HRY A;  3NBN B;  5KNH D;  5FIO A;  2QC9 A;  3SO8 A;  3V31 A;  5KNG A;  1IKN D;  3J5P A;  3F6Q A;  4C48 B;  1G3N B;  4F1P A;  4HRN A;  4DX7 D;  4DX2 A;  2A5E A;  4BEP A;  4DX5 D;  4QFV A;  2RFM A;  5AQB A;  2J8S D;  3DEO A;  5D66 A;  5EYP F;  3JXI A;  2VGE A;  3JUE A;  4O1O A;  3T9K A;  3TWW A;  2L6B A;  3UXG A;  4DX6 D;  2FO1 E;  4DX1 A;  3V2O A;  1UOH A;  3ZKJ A;  3ZU7 B;  1MX4 A;  3TWX A;  1AWC B;  3TWT A;  4F6R D;  4HI8 A;  3AJI A;  2XEE A;  2BKG A;  1K1B A;  4GMR A;  4U95 D;  5CBN A;  5KWD A;  5ENQ D;  1MX6 A;  3V2X A;  4J8Y A;  1MJ0 A;  1DCQ A;  1QYM A;  5KBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...