2VQ2A

Crystal structure of pilw, widely conserved type iv pilus biogenesis factor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
220
structure length
220
Chain Sequence
ANQVSNIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLCGRLNRPAESMAYFDKALADPTYPTPYIANLNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDADYYFKKYQSRVEVLQADDLLLGWKIAKALGNAQAAYEYEAQLQANFPYSEELQTVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MOTILITY PROTEIN
publication title Structure of a widely conserved type IV pilus biogenesis factor that affects the stability of secretin multimers.
pubmed doi rcsb
source organism Neisseria meningitidis
total genus 94
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13429 TPR_15 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vq2A00
3RIBA 3ZGQA 5DIZA 4B94A 3KD7A 5KJMA 5C1DA 3KAEA 2XGMA 4AIFA 1Y8MA 3ASFA 4U0UA 2E2EA 5D0OD 5HQ8A 2PZIA 2L6JA 3GZ2A 3HYMB 3QDNA 3RJVA 4W9RA 5JJ7A 4LEUA 3URZA 3SZ7A 4G25A 1IHGA 1NA3A 3RKVA 2FO7A 4HOTA 5FZQA 4WNDA 2KCVA 2VYIA 4ABNA 4KBQA 4N3BA 3AS8A 1KT1A 3TGOA 2HO1A 4UQYA 1PC2A 3FP3A 4J8EA 1ZBPA 1WAO1 4WNEA 4GZ6A 2IFUA 3MEKA 1YA0A 3QWPA 4U07A 3VTXA 4J8DA 3O48A 2MHKA 3CK8A 5CCLA 3E4BA 3ZN3A 1IYGA 5G05C 4I17A 3MA5A 3S7JA 1HXIA 2C0MA 2VQ2A 3LPZA 4J8FA 5JJTA 4J0UA 4RG6A 3FWVA 2HYZA 3S7FA 2YHCA 2DBAA 5CHEE 4WNGA 2QFCA 1XNFA 4I1AA 4H7XA 4N3AA 3ZFWA 4AY6A 2FBNA 3LY8A 4BT9A 4WNFA 1HH8A 1QQEA 5G04J 3LYAA 3CK9A 2PQRA 2XEVA 4G1TA 4Y6WA 4GA1A 4UI9J 5FT9A 4I2WA 3CKBA 3OXLA 3EDTB 5A7DB 2BUGA 1HZ4A 5LCWC 2Y4UA 2IF4A 5ARFA 2VGXA 5HI7A 3UPVA 3JYSA 1FCHA 2XPIA 1WM5A 4GYWA 2LSVA 2FI7A 4BTAA 5JJ6A 5A6CA 4N2SA 3S7BA 2C0LA 1OUVA 4JHRA 4JA7A 1ZU2A 4NRHB 5KJLA 2XGOA 5DBKA 2NC9A 3CVNA 2XGSA 2VGXB 4UI9K 5EX0A 3VTYA 3Q47B 4HOUA 5BNWA 2I6HA 4A1SA 4ME2A 4KYOB 3ESKA 2OOEA 3TG5A 2KCLA 3GYZA 2PQNA 3CK7A 3TG4A 2Q7FA 3RO2A 4G24A 4I9CA 1ELRA 4G23A 3ASDA 3GZ1A 4BWRA 3PE3A 3PDNA 1P5QA 4N3CA 4U0ZA 4BTBA 5BW8C 4Y6CA 3K9IA 4HOQA 4IN3B 2AVPA 4GZ5A 1NA0A 4GA0A 3RO3A 3CVPA 3CEQA 3FFLA 5EKQD 2XCBA 3PE4A 3LCAA 2XCCA 3CKCA 4WUYA 4GYOA 4YVOA 5FZRA 4U0SA 1QZ2A 4H7YA 5KJKA 4JA9A 4N2QA 1A17A 2V5FA 3UQ3A 2KCKA 3Q49B 4YVQC 4N39A 2UY1A 3AS5A 3UUXA 2VSNA 4N5CA 2LSUA 3QKYA 3CVQA 4HOSA 3R9AB 3ASHA 4JL0A 3AS4A 2KC7A 4GYYA 4BT8A 3GW4A 3OXGA 3Q5MA 3QWWA 4G2VA 3OXFA 1W3BA 2UY1B 3LY9A 2KATA 5M72A 4CDRA 3MV2B 3RU0A 2UWJG 3WXXA 4KXKB 3QOUA 4F3VA 5EX3A 4GPKA 3MV3B 3N71A 4XI0A 3S7DA 4I2ZA 5AYWD 2Y4TA 5BT1A 3NF1A 4CGVA 2LNIA 2WPVA 5CCMA 3Q15A 1TJCA 3IEGA 3MKRA 4G26A 4GA2A 5ARGA 1E96B 3QWVA 2PL2A 4UQZA 5G05J 2FEZA 3LY7A 4GZ3A 1KLXA 1B89A 4RG9A 4I9EA 5KJNA 2YQ8A 4O6FA 3ASGA 5FZSA 4HORA 2FF4A 3KS2A 4GCOA 3U3WA 5D0QD 4XIFA 3ZHEA 4APOA 4AM9A 4NQ0A 3Q4AB 2VSYA 3SF4A 4XI9A 3CVLA 4GCNA 4U04A 2HR2A 2VGYA 4YNDA 4CGWA 2WQHA 5G04C 1KT0A 3LKUA 2GW1A 3ZHEB 1NZNA 4UQXA 2JLBA 5FJYA 5FTPA 2ONDA 2R5SA 2P58C 3BEEA 4UI9C 3TAXA 3ZPJA 2C2LA 1ELWA 5LCWJ 4EQFA 3ULQA 2J9QA 3CV0A 4AY5A 3U4TA
chains in the Genus database with same CATH superfamily
3RIBA 2IEJA 5KNHD 1IQRA 3AAAC 3FH5A 4B94A 2ZIRA 4XX5A 5C1DA 4RQIA 3EHNA 3ZYQA 4AIFA 2L0IA 3L54A 4UWKA 1L5JA 3HYMB 2WXQA 3RJVA 4F1SA 2GRLA 3SBSA 4DX1A 4KZ0A 3URZA 4L9PA 2IY0C 1IHGA 3QNKA 4L2YA 1D8DA 3J5QB 5FQ6A 4ACLA 2WXIA 4K5CA 3KEZA 4PDXA 3C3QA 1SW6A 4HRLA 1ZBPA 4YDYA 2WXNA 3ZRHA 2BEDA 2DCPA 5BV1A 3UT7A 4JB8P 2IFUA 2B0OE 1YA0A 3QWPA 4I43A 3VTXA 4LG6A 5AN8A 3O48A 4Q69A 5J08A 4B0ZA 2WXKA 1H2VC 1IYGA 4O60A 1O1RA 1TEZA 4I17A 4WWNA 2WXOA 2VQ2A 1E8XA 3UI2A 4RG6A 2HYZA 4WNGA 1XNFA 4ILIA 3EJNA 3ABLE 3Q73A 4HNAD 2WXJA 5KBAA 5T8IA 4AY6A 4I6GA 4JEUA 2FBNA 5B3SE 3L22A 2Y3AA 2YNQA 2J09A 4WNFA 3ASNE 2XHEA 1SZAA 2A4ZA 3SNXA 3L6AA 4HLEA 4G1TA 2WM9A 3UT4A 3CR3A 3UM3A 4GA1A 4UI9J 4CT0A 1O5MA 2QYUA 4I2WA 4O1PA 5CRUA 3OXLA 5A7DB 2BUGA 2EINE 5LCWC 3HHMA 2F8XK 5HI7A 3LVQE 4ANWA 1ELKA 1WY6A 1YCSB 4G8KA 4N2SA 4DUIA 3FUEA 3PNLB 2IOLA 5AQBA 5AJLA 2V0PA 3I3NA 4WWPA 4JXTA 2WB2A 3PREA 1OCCE 5BNWA 2IO2C 4IRUA 3S2AA 3RAUA 4LNUD 2KCLA 4GZDA 2Q7FA 4I1MA 2FULA 3RO2A 3DSSA 2AJAA 2CFUA 2ZXWE 4LNBA 1BD8A 2WMOA 4OVUA 3LDZA 4DLQA 4BWRA 1JWGA 1P5QA 3HVEB 2J4DA 4QQIA 3CQGB 4RSYA 5EYPF 1TJFA 4L1BA 4HOQA 3Q7AA 3FTUA 4G11A 3CHQA 1SVXA 3I4GA 4GA0A 3TL5A 3W9FA 3RO3A 3UKUG 5G55A 3UX4A 1LF8A 3DEPA 1AP7A 3C5RA 2H6IA 3CEQA 3FFLA 3AU4A 3JUEA 2XZTG 3PE4A 4HB5A 4LNGA 4NACA 4DX7D 5C2YA 3FUJA 3TWSA 5HRYA 4DI4A 4WUYA 2DYSE 4GYOA 4YVOA 2XQ0A 4TV3A 4U0SA 4GTSA 5FQ8A 4L7TA 3ML9A 4JA9A 1E8WA 3MKQB 3UINC 3EHQA 1TNYA 4F1PA 3DSXA 3JXJA 2VSNA 3DSUA 4N5CA 1HS6A 1MYOA 5ENPD 3T8KA 2KZTB 2R17C 3QK0A 4U8VD 1YMPA 2KC7A 3F6QA 3TWUA 3Q5MA 4G2VA 1U2VG 3OXFA 1N4PA 3FU5A 3LY9A 4HS2A 3FU3A 5CMWA 1E7UA 1MZCA 1N94A 4GTTA 3WXXA 2P9PG 5AENA 3D9IA 1BI7B 4TXRA 4C0MA 5EX3A 5CEDB 3MV3B 3N71A 1BU9A 4XI0A 1FT2A 2HE0A 4B8CB 5BXUA 1EPUA 4FULA 3HXEA 3B7UX 4UWGA 4DK5A 1N95A 4G26A 4GA2A 4GTOA 2L0TB 3MJWA 2PNNA 4AV7A 4G8LA 3D9MA 1KLXA 5KJNA 4O6FA 3UIPC 4GCOA 4CDNA 2P9SG 3DRAA 3ZHEA 3HG0D 4NQ0A 3D3MA 3CHPA 3SF4A 2ETBA 5LP0A 4J8SA 3ZUVB 3PEVB 3TXMA 3CVLA 4GCNA 4IYPA 2HR2A 2I9CA 3HXBA 3Q7FA 4DI3A 2VGYA 3V2XA 2WQHA 2EIME 3CIAA 1H19A 1KT0A 3LKUA 2GW1A 3ZXSA 5CERB 5FJYA 1PAQA 1LD8A 3FULA 4UI9C 5JHAA 3FUMA 4XKBA 1ELWA 5LCWJ 4EQFA 4AVXA 2J9QA 2MOWA 1N0RA 3U4TA 4MBGA 3VLFA 5E75A 3KD7A 5KJMA 3V2OA 3LJNA 3DSVA 1NL4A 2WXGA 2L6JA 3GZ2A 5HS0A 3V30A 4FHJA 1KZPA 3D9KA 4EBAA 3RRMB 1NA3A 3RKVA 1DNPA 4AXHA 4HOTA 5D2MC 1SZ9A 4N3BA 4OAVB 4RVBA 4U8HA 3ZVVA 1G3NB 4F6RD 1HF8A 1S0PA 3KSLA 1WAO1 1MQSA 4WNEA 4GZ6A 2WXHA 3R7QA 3CSTA 3ONKA 3SQVA 2MHKA 3Q79A 3FEXA 3L82A 3ZN3A 5ITZF 4RLYA 4AEZC 3D9PA 1IQUA 1SA4A 1N4SA 5ENTD 1HXIA 5LFAA 4HI9A 5AAOA 4K5AB 3LPZA 1Z5SC 2WVIA 5JJTA 4J0UA 5KCMA 2XRYA 2YHCA 2DBAA 1A5EA 4C0EA 3FY4A 3TWQA 4YDOA 4I1AA 3UM2A 2VSOE 4KMOA 3HIZA 5BXOA 4R7LA 5AIJA 3APCA 2GRNB 1E7VA 4PS3A 2CG3A 2PQRA 3QC1A 1N52A 4Y6WA 3G2VA 1Z3XA 4J7WA 5BPPA 2BTDA 1E8YA 4BESA 3B7RL 3LXUX 4M3OA 3D9NA 4DRXE 1HZ4A 2WMNA 2Y4UA 2IF4A 4C9BB 4K0RA 2VGXA 1S63A 3D9HA 2I1KA 2VGEA 2RG8A 3UPVA 3JYSA 2VJ8A 4GYWA 2LSVA 3CSFA 1E8ZA 1Q2ZA 1EF1C 3S7BA 3PZ1A 4JHRA 1FPPA 2NC9A 3NBNB 4UI9K 5EX0A 2WQ6A 2Y69E 3E37A 1MJ0A 3Q47B 5EIBE 5AQ7A 4BEPA 2DIWA 3SI5A 4A1SA 3UXGA 2KBXA 4KYOB 5CECB 3ESKA 3DBSA 2R05A 4MLPA 3JCKC 4ZFHA 3EIJA 3FDHA 3RRUA 4Q96A 1H6PA 3LVRE 4I9CA 3QAQA 3FTVA 1UW4B 4G23A 3C3OA 3AG4E 4APFA 1H6KA 3CQCB 3L08A 3PE3A 2BF0X 3ABKE 2AXUA 2A5UA 4U0ZA 2GRQB 2WQ7A 4BTBA 5BW8C 2AW6A 1JUQA 4YDEA 3CVPA 2V8SE 2WXLA 5EKQD 3LCAA 1IXVA 3BU8A 3PUJA 3CHRA 3DWLG 3FUKA 1HG2A 2GRRB 3PZ4A 1OWOA 2DVWA 3E33A 1QZ2A 5LOZA 4H7YA 3L9TA 3IKOB 1HE8A 3P2BA 1N4RA 4E85A 2OV8A 2J07A 3JQ1A 3IXEA 4D10C 3G2UA 2X6FA 1IKND 3UUXA 2IU1A 3BUAA 1UN8A 3CLJA 3D9LA 3ESLA 4GMLA 2VSXE 3ASHA 2R03A 3EUVA 3PNTB 4GYYA 4BT8A 3OXGA 1W3BA 4OVVA 4GZCA 5CMYA 3Q78A 1K1AA 3ZYLA 3IBEA 1Z6TA 5JMND 1V55E 4DX2A 3DEOA 4GPKA 3AJIA 3S7DA 1UN9A 2Y4TA 4X8QA 2EQXA 2R59A 3PEUB 3Q15A 5BUZA 4DLOA 3IEGA 1NP7A 2J49A 2X6JA 1RW2A 2P9IG 1TNBA 4JEHA 1OCOE 3T5VA 2VTBA 1OWPA 4UQZA 2FEZA 3KEAA 1N11A 3LY7A 4GZ3A 5CBNA 2CHXA 3BG0B 4DJAA 1O1SA 3LJ3A 2FF4A 3KS2A 3CVUA 4APOA 1Z3YA 3ASOE 3E32A 4U7EB 3ULEG 5AJDA 2IQCA 1YYHA 2AXZA 4HFGA 4AOFA 2KXPC 4U04A 3T5XA 1TNUA 3NZSA 1JCRA 3ZHEB 4UQXA 2JLBA 2AXVA 4HRMB 4GTRA 4LCTA 5E76A 1QNFA 2ONDA 4ANVA 3TWRA 3JXIA 4CEMA 2C2LA 2WXPA 4JPSA 2CFZA 5ENSD 3P1UA 3U9WA 1TR4A 4LUNU 4A1GA 5DIZA 2EILE 3CHMA 3AG3E 2DYRE 1XGWA 5FQ7A 1LD7A 2XPYA 2F37A 2XGMA 4EBAG 1QYMA 5CEAA 2E2EA 3D9OA 3C98A 5HQ8A 2OCCE 3QDNA 1U3DA 5KWDA 3PS6A 4MS6A 3QJZA 3LEWA 1TN8A 3SO8A 2XZDG 3ZYKA 4XEIG 2YHEA 3MZLB 4HBDA 3SY2A 5FZQA 4WNDA 2KCVA 2VYIA 4ABNA 4KBQA 3AS8A 3TGOA 2IONA 1FVFA 2HO1A 2A5EA 3O4ZA 2XEEA 4J8EA 4O1OA 3I5PA 5EDSA 5FINA 3MGBA 4KVMA 4JHKA 4J8DA 4F53A 5LX8A 3TWVA 3CK8A 4E6HA 3E4BA 3OTNA 3EU5A 3ZNGA 3S7JA 1OY3D 1OWNA 3QARA 4J8FA 3D9JA 3FWVA 3KSQA 5CHEE 1FT1A 4ANUA 1DVPA 5H7PA 2NXPA 2V4LA 4GMRA 4J8YA 3EIQC 1MX2A 3LY8A 1OCZE 3CVWA 1BPOA 1HH8A 1QQEA 1WG0A 3LYAA 3ZYMA 3CK9A 3ENEA 5ANRA 4BX9A 1DCQA 5FT9A 3CKBA 3EDTB 3TXNA 4M7CA 4GTPA 5ARFA 3IHVA 4PS7A 4IULA 3J5PA 3U66A 2XS8A 4FHKA 4CYMD 3PUKA 3B13A 3U64A 2C0LA 4JA7A 3C3RA 5KJLA 2XEHA 5DBKA 3CVNA 4F7AA 2XGSA 2VGXB 1K3ZD 1D8EA 3LS8A 5G2NA 3RSEG 2L6BA 5FQ4A 3VTYA 4HOUA 2OEWA 2I6HA 2F0YA 4ME2A 4WWOA 4FLBA 4UWHA 2QZAA 2OOEA 3JQ0A 4TUMA 3L13A 2J08A 5AQAA 4UUCA 3FTXA 1BI8B 3NB2A 4G24A 3MYVA 4ATGA 3ABME 3ASDA 3FUHA 2NSZA 3GZ1A 2XRZA 1DC2A 3FUIA 4CRWA 1FVHA 1H0AA 2HM8A 4Y6CA 2QC9A 2AWIA 3K9IA 3DXMG 1N9AA 2AVPA 1NA0A 3FUFA 4CDMA 3ZKJA 1S64A 3CGHA 3UMVA 4HQDA 4XKCA 4XZ4A 4KT6B 2X6IA 3HRAA 1LTXA 2H6GA 2XCBA 2XCCA 2X38A 4U8YD 2XENA 5BV0A 2QYJA 3FTZA 1VDYA 2EIJE 4QFVA 4CZ2D 3BQOA 4N2QA 2BKKB 2MRIA 2LXMA 2F8YA 2V5QC 2KCKA 4I6EA 5D66A 3Q49B 1ZB1A 3B7BA 4YVQC 3SGHA 4N39A 2UY1A 2WXMA 4GPMA 4MRUA 3TWWA 1EYHA 1INZA 4MKTA 3CVQA 4HOSA 3R9AB 4JL0A 4AP2A 2ETCA 3AU5A 5ANLA 2ZGGA 4DX5D 5IY5E 4FC8A 4A3TA 3FUNA 2RFMA 3PVLA 4Q94A 3MV2B 1UOHA 4DX6D 3SFZA 4XE0A 4J6IA 2B6CA 4KXKB 4CT4A 4LRZA 3QOUA 3SFXA 5ENRD 4I2ZA 3W9GA 3FTWA 2WXFA 4CGVA 3ZXPA 2LNIA 5CCMA 3Q9NC 4EHMA 4A3VA 4BY6A 3RRNB 1E96B 4ACKA 2Y0BG 3I4RB 2NYJA 4GB9A 1HFAA 1OCRE 2J8SD 3MX3A 4I9EA 4PUCA 4TRQA 3ASGA 3UM1A 4HORA 3PH0C 2LUHA 3U3WA 1V54E 3SD5A 1MX4A 4AM9A 5JHBA 4FA6A 2VSYA 3ISMC 2GROB 2VTBB 4HI8A 2DZOA 4B89A 4BERA 2RFAA 3GZSA 5T4YA 1RZ4A 1TNOA 1N0QA 4TXPA 5EILA 3ZEFA 4CGWA 2H6FA 3SFYA 4K03A 1NZNA 3IHYA 3ONLA 2P9KG 3BEEA 3SBTB 3RK6A 3AG1E 3UIOC 1SQMA 4AY5A 4URKA 2Y1LE 1NI1A 3ZGQA 2OVBA 3FUDA 3HXCA 3V79K 2ETAA 3KAEA 4C48B 4TXQA 1U3CA 1Y8MA 3ASFA 4U0UA 5D0OD 3X2QE 2PZIA 2RD0A 3PZ2A 1X81A 4GTQA 4W9RA 4HLLA 5JJ7A 2E0IA 4LEUA 3EU9A 3SZ7A 4G25A 4A55A 3NZUA 3CVVA 2FO7A 2IOSA 3PRZA 3FU6A 4ATZD 4GTVA 4GAAA 2DZNA 1KT1A 4UQYA 4JD2G 4UWLA 1PC2A 5EN5D 3FP3A 1UJJA 1OT8A 1KPSB 3APFA 1Y6IA 4I6JA 1EDUA 1MX6A 5A23A 2J4BA 4EZLA 2XS1A 3BG1B 1N4QA 3HXDA 3MEKA 4ILHB 4JHJA 4U07A 2X6HA 3T8MA 5CCLA 2LAIA 3CVXA 4TUUA 2IJGX 3L16A 3FH7A 4KZCA 5G05C 4JW1A 3MA5A 1H2UA 1JCQA 2C0MA 2WXRA 2X6KA 4K5BA 3S7FA 2LAHA 1H2TC 3UTMA 2QFCA 4H7XA 4L2LA 5KNGA 4N3AA 3ZFWA 2QY7A 1HO8A 4BT9A 3SHFA 1K8KG 1QBQA 2H6HA 5G04J 4Z68A 2CG2A 2GRMA 3DSTA 4LERA 2MYOA 4HXIA 2XEVA 2GGFA 1TNZA 2LO6A 3FTSA 4I1OB 5EYLA 1UG3A 3FHEA 4FU3A 4HRNA 3QB2A 4AJWA 3IV0A 2DWZA 4B8AA 1D9SA 5CBOA 2V4HC 1FCHA 1NFIE 2R02A 2XPIA 5AARA 1WM5A 2FI7A 3G2TA 1X5BA 3DXKG 4BTAA 4U96D 2OVFA 5JJ6A 3ULYA 5A6CA 1OUVA 1ZU2A 4NRHB 2XGOA 2IO3C 2OEVA 3EHRA 3DSWA 2P9UG 3NAWA 4BETA 3VLDA 3DPDA 4KVOA 4FP7A 2P9LG 3TG5A 4U63A 2I1JA 3GYZA 3TWTA 2ZISA 2PQNA 3EHMA 3HVEA 3CK7A 3WG7E 3TG4A 3CHSA 2FO1E 2RKKA 5ENNA 3UKRG 3OAWA 3NQPA 4A63B 1ELRA 2P9NG 4JVSA 1HU3A 3AG2E 4BSZB 4CCAA 1OWLA 1SA5A 4PS8A 3PDNA 2PM7A 3NOCD 2I2OA 4N3CA 1E90A 2BKGA 3PZDA 1JWFA 1KZOA 3HDXA 4FADA 2JABA 4IN3B 2X3MA 4OAUC 4GZ5A 2JEKA 1S70B 3L17A 1AWCB 3MKQA 1TYQG 5FWQA 1JPLA 3UM0A 4YDWA 2R2LA 4P29A 2YINA 4ILGA 3CVYA 1WDYA 3CKCA 4V3IA 4OYSA 5FZRA 3TJPA 3JUIA 4DPRA 2CHWA 3ML8A 4BX8A 5ENQD 5KJKA 2KZTA 1TN7A 1A17A 5B1BE 2V5FA 3APDA 3UQ3A 2XPZA 2GRPB 4UWFA 4L23A 4GMJA 3AS5A 1JCSA 3R9MA 3Q9UC 3NOGD 2ZU6B 2PM6A 3G2WA 2P2CP 1H6OA 3MCXA 5ENOD 2LSUA 3QKYA 2CHZA 3UT8A 4U95D 3ZW3A 3AS4A 3GW4A 5FIOA 1MHQA 1IHBA 3QWWA 2KM4A 2UY1B 3B7SA 5M72A 2KATA 4CDRA 4EZKA 3E34A 5T3RA 3RU0A 3CHOA 2UWJG 3B95A 1PY1A 2LXLA 1GW6A 1HX8A 5HKPA 2ZGDA 3VLEA 4F3VA 4EECA 5AYWD 3TWXA 3FEYA 4ANXA 5BT1A 3NF1A 5J90A 2EIKE 2WPVA 1TJCA 3FH8A 3MKRA 5B1AE 5ARGA 4HVBA 4WAFA 3QWVA 5CRVA 2PL2A 4N5QA 5G05J 4NIKA 4JC8A 1O1TA 3G2SA 2M63A 4BSXA 1B89A 4RG9A 3ZU7B 2YQ8A 3V31A 4GTMA 5FZSA 3B7TA 3PZ3A 4JZYA 3FU0A 4FLHA 5D0QD 4XIFA 4BFRA 1UJKA 3Q4AB 3DPYA 5AQ9A 2ILRA 2L9BA 4NURA 1OXJA 1K1BA 4PH4B 3R7RA 4XI9A 1BLXB 5EIDA 1OWMA 3ZIMA 1DCEA 4LSZE 3T9KA 4GU5A 3E30A 4YNDA 1TN6A 4B93B 4FJZA 5G04C 1N54A 3Q75A 4EZJA 5FTPA 2R5SA 5JA4D 2P58C 3C72A 4FJYA 3TAXA 3ZPJA 3FTYA 4EPZA 3ULQA 4ZHBA 3CV0A 3HXFA 1HG5A
chains in the Genus database with same CATH topology
3RIBA 3VLFA 4LUNU 5E75A 3ZGQA 5DIZA 4A1GA 1IQRA 3CHMA 3FH5A 4B94A 2OVBA 3FUDA 3KD7A 4XX5A 5KJMA 1XGWA 5FQ7A 2XPYA 3KAEA 5C1DA 1U3CA 3EHNA 3ZYQA 2XGMA 4EBAG 4AIFA 1Y8MA 3ASFA 4U0UA 2E2EA 2L0IA 3C98A 3D9OA 3L54A 5D0OD 5HQ8A 2PZIA 4UWKA 2WXGA 2L6JA 2RD0A 1L5JA 3GZ2A 3HYMB 2WXQA 3QDNA 1U3DA 3RJVA 4F1SA 2GRLA 3PS6A 3SBSA 4MS6A 4FHJA 3D9KA 4W9RA 4EBAA 5JJ7A 2E0IA 3QJZA 3LEWA 4KZ0A 4LEUA 3URZA 3RRMB 3SZ7A 4G25A 1IHGA 3QNKA 3ZYKA 1NA3A 4L2YA 3RKVA 4A55A 3NZUA 1DNPA 4AXHA 2YHEA 3MZLB 3CVVA 2FO7A 2IOSA 4HOTA 5FQ6A 3PRZA 4ACLA 2WXIA 5FZQA 4WNDA 3FU6A 2KCVA 2VYIA 1SZ9A 4ABNA 4GAAA 4KBQA 4N3BA 3AS8A 1KT1A 3TGOA 2IONA 1FVFA 2HO1A 3KEZA 4UQYA 4UWLA 4RVBA 1PC2A 4U8HA 3FP3A 4PDXA 3ZVVA 3O4ZA 1UJJA 1HF8A 1S0PA 4J8EA 1ZBPA 3APFA 2WXNA 1WAO1 1Y6IA 1MQSA 4I6JA 1EDUA 3ZRHA 2DCPA 3I5PA 4WNEA 5A23A 5BV1A 3UT7A 2J4BA 5EDSA 4EZLA 3BG1B 4GZ6A 2IFUA 2WXHA 3MEKA 1YA0A 3MGBA 4ILHB 4JHJA 4KVMA 3R7QA 3QWPA 4I43A 4U07A 3CSTA 4JHKA 3VTXA 4J8DA 4F53A 5LX8A 3ONKA 3O48A 2X6HA 4Q69A 5J08A 4B0ZA 2MHKA 3T8MA 3FEXA 2WXKA 3CK8A 1H2VC 5CCLA 2LAIA 4E6HA 3CVXA 3E4BA 3OTNA 4TUUA 3ZN3A 4AEZC 2IJGX 3D9PA 1IQUA 3L16A 3FH7A 1IYGA 4KZCA 5G05C 4JW1A 4I17A 3MA5A 1TEZA 1H2UA 3S7JA 1HXIA 2C0MA 5LFAA 2WXRA 4WWNA 2WXOA 2X6KA 1OWNA 2VQ2A 1E8XA 3LPZA 3QARA 2WVIA 4J8FA 5JJTA 4J0UA 3D9JA 4RG6A 5KCMA 3FWVA 2HYZA 3S7FA 2XRYA 2LAHA 1H2TC 2YHCA 2DBAA 5CHEE 4ANUA 1DVPA 4C0EA 3FY4A 4WNGA 2QFCA 1XNFA 4I1AA 4ILIA 3EJNA 2NXPA 2VSOE 2V4LA 4H7XA 4L2LA 4KMOA 3HIZA 2WXJA 4N3AA 3ZFWA 2QY7A 1HO8A 5T8IA 4AY6A 4R7LA 3EIQC 5AIJA 4I6GA 4JEUA 2FBNA 3LY8A 3L22A 2Y3AA 4BT9A 3SHFA 2YNQA 2J09A 4WNFA 3APCA 3CVWA 1BPOA 1HH8A 1QQEA 2XHEA 5G04J 1E7VA 1SZAA 2A4ZA 3LYAA 4PS3A 3SNXA 3ZYMA 3CK9A 2CG2A 2GRMA 4LERA 3L6AA 2CG3A 2PQRA 3QC1A 4HXIA 4HLEA 2XEVA 3ENEA 5ANRA 1N52A 2GGFA 4G1TA 4Y6WA 2WM9A 3UT4A 2LO6A 3CR3A 3G2VA 4GA1A 1Z3XA 3FTSA 4UI9J 5FT9A 4BX9A 4CT0A 5BPPA 2BTDA 3CKBA 1E8YA 4I2WA 3B7RL 3LXUX 4I1OB 3OXLA 3EDTB 4M3OA 5A7DB 1UG3A 3D9NA 2BUGA 3FHEA 1HZ4A 3TXNA 5LCWC 2WMNA 2Y4UA 2IF4A 4FU3A 3HHMA 3QB2A 4AJWA 5ARFA 3IV0A 4K0RA 4C9BB 2VGXA 4B8AA 3IHVA 4PS7A 5HI7A 2I1KA 3LVQE 2RG8A 4ANWA 1ELKA 1WY6A 3UPVA 3JYSA 1FCHA 2XPIA 1WM5A 2VJ8A 4IULA 4GYWA 2LSVA 2FI7A 3G2TA 1X5BA 3CSFA 1E8ZA 4BTAA 3U66A 4FHKA 2OVFA 5JJ6A 5A6CA 4N2SA 3PUKA 1EF1C 3B13A 3U64A 3S7BA 3FUEA 2C0LA 1OUVA 4JHRA 4JA7A 1ZU2A 3PNLB 4NRHB 2IOLA 5KJLA 2XGOA 5DBKA 2NC9A 3CVNA 4F7AA 2XGSA 5AJLA 2VGXB 4UI9K 5EX0A 2WQ6A 3LS8A 5G2NA 2V0PA 5FQ4A 3I3NA 4WWPA 3VTYA 3Q47B 4HOUA 4JXTA 2WB2A 3PREA 5BNWA 2DIWA 3SI5A 4IRUA 2I6HA 3VLDA 3S2AA 4A1SA 4ME2A 4KYOB 4WWOA 4FLBA 4UWHA 3ESKA 3DPDA 3DBSA 2OOEA 4KVOA 4FP7A 3JQ0A 3JCKC 4MLPA 3TG5A 2KCLA 3L13A 3EIJA 2I1JA 2J08A 3GYZA 4U63A 3FDHA 4URKA 2PQNA 3EHMA 3HVEA 3CK7A 3RRUA 4Q96A 3TG4A 3CHSA 3FTXA 4GZDA 2Q7FA 5ENNA 4I1MA 2FULA 3OAWA 3RO2A 3LVRE 3NQPA 4G24A 3MYVA 4I9CA 4ATGA 1ELRA 3QAQA 3FTVA 4JVSA 1HU3A 1UW4B 4G23A 2CFUA 3ASDA 3FUHA 4CCAA 1OWLA 2NSZA 4APFA 1H6KA 3GZ1A 2WMOA 3CQCB 4PS8A 3LDZA 4OVUA 4DLQA 3L08A 2XRZA 4BWRA 3PE3A 3PDNA 3FUIA 2BF0X 2PM7A 4CRWA 2AXUA 1JWGA 2I2OA 1P5QA 4N3CA 2A5UA 3HVEB 1E90A 1FVHA 1H0AA 2HM8A 2J4DA 3PZDA 4U0ZA 2WQ7A 1JWFA 4BTBA 3CQGB 4RSYA 5BW8C 4Y6CA 3HDXA 4FADA 1TJFA 2AW6A 4L1BA 2AWIA 3K9IA 4HOQA 4IN3B 3FTUA 1JUQA 4G11A 3CHQA 2X3MA 2AVPA 4GZ5A 1NA0A 2JEKA 3FUFA 3I4GA 4GA0A 3TL5A 4CDMA 3L17A 3RO3A 5G55A 3UX4A 3CGHA 1LF8A 3CVPA 3UMVA 3MKQA 2V8SE 3CEQA 3FFLA 4XKCA 2WXLA 4XZ4A 3AU4A 4KT6B 2X6IA 5FWQA 1JPLA 5EKQD 2XCBA 3PE4A 3LCAA 2XCCA 4P29A 2X38A 2YINA 4ILGA 4NACA 3PUJA 5C2YA 3CVYA 3FUJA 3CHRA 4DI4A 3FUKA 3CKCA 4WUYA 1HG2A 4V3IA 4OYSA 5BV0A 4GYOA 1OWOA 3FTZA 1VDYA 4YVOA 2XQ0A 5FZRA 3TJPA 3JUIA 4QFVA 4TV3A 4DPRA 4U0SA 1QZ2A 2CHWA 3ML8A 5LOZA 4BX8A 4H7YA 5KJKA 2KZTA 3IKOB 5FQ8A 1HE8A 4L7TA 3ML9A 3P2BA 4JA9A 1E8WA 3MKQB 1A17A 2MRIA 4E85A 2OV8A 4N2QA 2J07A 2V5FA 3APDA 3UQ3A 2XPZA 3JQ1A 2KCKA 4I6EA 4UWFA 3Q49B 4YVQC 4L23A 3SGHA 4GMJA 4D10C 3G2UA 2X6FA 4N39A 2UY1A 3AS5A 2WXMA 2ZU6B 4MRUA 2PM6A 3G2WA 3UUXA 2IU1A 2VSNA 4N5CA 1HS6A 1EYHA 1UN8A 3MCXA 3CLJA 1INZA 3D9LA 2LSUA 4MKTA 3QKYA 3ESLA 3CVQA 4HOSA 2KZTB 3R9AB 4GMLA 2R17C 2VSXE 3ASHA 3QK0A 4JL0A 4AP2A 2CHZA 3UT8A 3PNTB 3ZW3A 3AU5A 3AS4A 2KC7A 4GYYA 4BT8A 3GW4A 3OXGA 3Q5MA 1MHQA 3QWWA 5ANLA 4G2VA 2KM4A 3OXFA 4FC8A 1W3BA 3FU5A 2UY1B 3B7SA 4OVVA 3LY9A 2KATA 4A3TA 5M72A 3FUNA 4HS2A 3PVLA 4CDRA 4GZCA 5CMYA 3FU3A 4EZKA 4Q94A 5CMWA 5T3RA 1E7UA 3MV2B 3ZYLA 3RU0A 3CHOA 2UWJG 3IBEA 1PY1A 3SFZA 3WXXA 4XE0A 1GW6A 1HX8A 4J6IA 4KXKB 4CT4A 5AENA 3D9IA 4LRZA 3QOUA 1Z6TA 3VLEA 4C0MA 4F3VA 4EECA 5EX3A 4GPKA 3MV3B 3N71A 4XI0A 3S7DA 4I2ZA 5AYWD 1UN9A 3FTWA 2Y4TA 3FEYA 4B8CB 4ANXA 2WXFA 5BT1A 3NF1A 5J90A 4CGVA 1EPUA 4FULA 2EQXA 2LNIA 2WPVA 2R59A 3B7UX 5CCMA 3PEUB 3Q15A 1TJCA 4UWGA 4DK5A 5BUZA 4DLOA 3IEGA 4A3VA 3FH8A 1NP7A 3MKRA 2J49A 2X6JA 4BY6A 4G26A 3RRNB 4GA2A 5ARGA 4HVBA 2L0TB 4WAFA 1E96B 3QWVA 3MJWA 4JEHA 4ACKA 4AV7A 3T5VA 3D9MA 2PL2A 1OWPA 3I4RB 4UQZA 5G05J 2VTBA 2FEZA 4JC8A 3LY7A 3G2SA 2M63A 4GZ3A 4GB9A 1HFAA 1KLXA 4BSXA 1B89A 4RG9A 2CHXA 3MX3A 4I9EA 5KJNA 3BG0B 4PUCA 2YQ8A 4TRQA 4DJAA 4O6FA 3ASGA 5FZSA 3B7TA 3LJ3A 4HORA 3PH0C 2FF4A 3KS2A 4GCOA 4JZYA 4CDNA 3FU0A 4FLHA 3U3WA 5D0QD 4XIFA 3CVUA 3SD5A 3ZHEA 4APOA 1Z3YA 4BFRA 4AM9A 4NQ0A 5JHBA 4FA6A 1UJKA 3D3MA 3Q4AB 3CHPA 2VSYA 2ILRA 3SF4A 2L9BA 5LP0A 4J8SA 5AJDA 2VTBB 4NURA 3PEVB 2IQCA 4B89A 4PH4B 3R7RA 3TXMA 4XI9A 2AXZA 4HFGA 4AOFA 3CVLA 4GCNA 4IYPA 3GZSA 5T4YA 4U04A 2HR2A 1OWMA 2I9CA 3ZIMA 3T5XA 4GU5A 3ZEFA 4DI3A 2VGYA 4YNDA 4CGWA 2WQHA 3CIAA 1H19A 4FJZA 5G04C 1KT0A 3LKUA 2GW1A 3NZSA 1N54A 4K03A 3ZHEB 3ZXSA 1NZNA 4UQXA 2JLBA 5FJYA 2AXVA 3IHYA 1PAQA 4LCTA 5E76A 5FTPA 4EZJA 1QNFA 3ONLA 2ONDA 2R5SA 2P58C 4ANVA 3BEEA 3FULA 4FJYA 4CEMA 4UI9C 3TAXA 3ZPJA 3FTYA 5JHAA 2C2LA 3FUMA 4XKBA 4EPZA 2WXPA 4JPSA 1ELWA 2CFZA 5LCWJ 4EQFA 3SBTB 3ULQA 4AVXA 2J9QA 3CV0A 2MOWA 3P1UA 3RK6A 1SQMA 4AY5A 3U9WA 1HG5A 3U4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIB A;  3ZGQ A;  5DIZ A;  4B94 A;  3KD7 A;  5KJM A;  5C1D A;  3KAE A;  2XGM A;  4AIF A;  1Y8M A;  3ASF A;  4U0U A;  2E2E A;  5D0O D;  5HQ8 A;  2PZI A;  2L6J A;  3GZ2 A;  3HYM B;  3QDN A;  3RJV A;  4W9R A;  5JJ7 A;  4LEU A;  3URZ A;  3SZ7 A;  4G25 A;  1IHG A;  1NA3 A;  3RKV A;  2FO7 A;  4HOT A;  5FZQ A;  4WND A;  2KCV A;  2VYI A;  4ABN A;  4KBQ A;  4N3B A;  3AS8 A;  1KT1 A;  3TGO A;  2HO1 A;  4UQY A;  1PC2 A;  3FP3 A;  4J8E A;  1ZBP A;  1WAO 1;  4WNE A;  4GZ6 A;  2IFU A;  3MEK A;  1YA0 A;  3QWP A;  4U07 A;  3VTX A;  4J8D A;  3O48 A;  2MHK A;  3CK8 A;  5CCL A;  3E4B A;  3ZN3 A;  1IYG A;  5G05 C;  4I17 A;  3MA5 A;  3S7J A;  1HXI A;  2C0M A;  2VQ2 A;  3LPZ A;  4J8F A;  5JJT A;  4J0U A;  4RG6 A;  3FWV A;  2HYZ A;  3S7F A;  2YHC A;  2DBA A;  5CHE E;  4WNG A;  2QFC A;  1XNF A;  4I1A A;  4H7X A;  4N3A A;  3ZFW A;  4AY6 A;  2FBN A;  3LY8 A;  4BT9 A;  4WNF A;  1HH8 A;  1QQE A;  5G04 J;  3LYA A;  3CK9 A;  2PQR A;  2XEV A;  4G1T A;  4Y6W A;  4GA1 A;  4UI9 J;  5FT9 A;  4I2W A;  3CKB A;  3OXL A;  3EDT B;  5A7D B;  2BUG A;  1HZ4 A;  5LCW C;  2Y4U A;  2IF4 A;  5ARF A;  2VGX A;  5HI7 A;  3UPV A;  3JYS A;  1FCH A;  2XPI A;  1WM5 A;  4GYW A;  2LSV A;  2FI7 A;  4BTA A;  5JJ6 A;  5A6C A;  4N2S A;  3S7B A;  2C0L A;  1OUV A;  4JHR A;  4JA7 A;  1ZU2 A;  4NRH B;  5KJL A;  2XGO A;  5DBK A;  2NC9 A;  3CVN A;  2XGS A;  2VGX B;  4UI9 K;  5EX0 A;  3VTY A;  3Q47 B;  4HOU A;  5BNW A;  2I6H A;  4A1S A;  4ME2 A;  4KYO B;  3ESK A;  2OOE A;  3TG5 A;  2KCL A;  3GYZ A;  2PQN A;  3CK7 A;  3TG4 A;  2Q7F A;  3RO2 A;  4G24 A;  4I9C A;  1ELR A;  4G23 A;  3ASD A;  3GZ1 A;  4BWR A;  3PE3 A;  3PDN A;  1P5Q A;  4N3C A;  4U0Z A;  4BTB A;  5BW8 C;  4Y6C A;  3K9I A;  4HOQ A;  4IN3 B;  2AVP A;  4GZ5 A;  1NA0 A;  4GA0 A;  3RO3 A;  3CVP A;  3CEQ A;  3FFL A;  5EKQ D;  2XCB A;  3PE4 A;  3LCA A;  2XCC A;  3CKC A;  4WUY A;  4GYO A;  4YVO A;  5FZR A;  4U0S A;  1QZ2 A;  4H7Y A;  5KJK A;  4JA9 A;  4N2Q A;  1A17 A;  2V5F A;  3UQ3 A;  2KCK A;  3Q49 B;  4YVQ C;  4N39 A;  2UY1 A;  3AS5 A;  3UUX A;  2VSN A;  4N5C A;  2LSU A;  3QKY A;  3CVQ A;  4HOS A;  3R9A B;  3ASH A;  4JL0 A;  3AS4 A;  2KC7 A;  4GYY A;  4BT8 A;  3GW4 A;  3OXG A;  3Q5M A;  3QWW A;  4G2V A;  3OXF A;  1W3B A;  2UY1 B;  3LY9 A;  2KAT A;  5M72 A;  4CDR A;  3MV2 B;  3RU0 A;  2UWJ G;  3WXX A;  4KXK B;  3QOU A;  4F3V A;  5EX3 A;  4GPK A;  3MV3 B;  3N71 A;  4XI0 A;  3S7D A;  4I2Z A;  5AYW D;  2Y4T A;  5BT1 A;  3NF1 A;  4CGV A;  2LNI A;  2WPV A;  5CCM A;  3Q15 A;  1TJC A;  3IEG A;  3MKR A;  4G26 A;  4GA2 A;  5ARG A;  1E96 B;  3QWV A;  2PL2 A;  4UQZ A;  5G05 J;  2FEZ A;  3LY7 A;  4GZ3 A;  1KLX A;  1B89 A;  4RG9 A;  4I9E A;  5KJN A;  2YQ8 A;  4O6F A;  3ASG A;  5FZS A;  4HOR A;  2FF4 A;  3KS2 A;  4GCO A;  3U3W A;  5D0Q D;  4XIF A;  3ZHE A;  4APO A;  4AM9 A;  4NQ0 A;  3Q4A B;  2VSY A;  3SF4 A;  4XI9 A;  3CVL A;  4GCN A;  4U04 A;  2HR2 A;  2VGY A;  4YND A;  4CGW A;  2WQH A;  5G04 C;  1KT0 A;  3LKU A;  2GW1 A;  3ZHE B;  1NZN A;  4UQX A;  2JLB A;  5FJY A;  5FTP A;  2OND A;  2R5S A;  2P58 C;  3BEE A;  4UI9 C;  3TAX A;  3ZPJ A;  2C2L A;  1ELW A;  5LCW J;  4EQF A;  3ULQ A;  2J9Q A;  3CV0 A;  4AY5 A;  3U4T A; 
#chains in the Genus database with same CATH topology
 3RIB A;  2IEJ A;  5KNH D;  1IQR A;  3AAA C;  3FH5 A;  4B94 A;  2ZIR A;  4XX5 A;  5C1D A;  4RQI A;  3EHN A;  3ZYQ A;  4AIF A;  2L0I A;  3L54 A;  4UWK A;  1L5J A;  3HYM B;  2WXQ A;  3RJV A;  4F1S A;  2GRL A;  3SBS A;  4DX1 A;  4KZ0 A;  3URZ A;  4L9P A;  2IY0 C;  1IHG A;  3QNK A;  4L2Y A;  1D8D A;  3J5Q B;  5FQ6 A;  4ACL A;  2WXI A;  4K5C A;  3KEZ A;  4PDX A;  3C3Q A;  1SW6 A;  4HRL A;  1ZBP A;  4YDY A;  2WXN A;  3ZRH A;  2BED A;  2DCP A;  5BV1 A;  3UT7 A;  4JB8 P;  2IFU A;  2B0O E;  1YA0 A;  3QWP A;  4I43 A;  3VTX A;  4LG6 A;  5AN8 A;  3O48 A;  4Q69 A;  5J08 A;  4B0Z A;  2WXK A;  1H2V C;  1IYG A;  4O60 A;  1O1R A;  1TEZ A;  4I17 A;  4WWN A;  2WXO A;  2VQ2 A;  1E8X A;  3UI2 A;  4RG6 A;  2HYZ A;  4WNG A;  1XNF A;  4ILI A;  3EJN A;  3ABL E;  3Q73 A;  4HNA D;  2WXJ A;  5KBA A;  5T8I A;  4AY6 A;  4I6G A;  4JEU A;  2FBN A;  5B3S E;  3L22 A;  2Y3A A;  2YNQ A;  2J09 A;  4WNF A;  3ASN E;  2XHE A;  1SZA A;  2A4Z A;  3SNX A;  3L6A A;  4HLE A;  4G1T A;  2WM9 A;  3UT4 A;  3CR3 A;  3UM3 A;  4GA1 A;  4UI9 J;  4CT0 A;  1O5M A;  2QYU A;  4I2W A;  4O1P A;  5CRU A;  3OXL A;  5A7D B;  2BUG A;  2EIN E;  5LCW C;  3HHM A;  2F8X K;  5HI7 A;  3LVQ E;  4ANW A;  1ELK A;  1WY6 A;  1YCS B;  4G8K A;  4N2S A;  4DUI A;  3FUE A;  3PNL B;  2IOL A;  5AQB A;  5AJL A;  2V0P A;  3I3N A;  4WWP A;  4JXT A;  2WB2 A;  3PRE A;  1OCC E;  5BNW A;  2IO2 C;  4IRU A;  3S2A A;  3RAU A;  4LNU D;  2KCL A;  4GZD A;  2Q7F A;  4I1M A;  2FUL A;  3RO2 A;  3DSS A;  2AJA A;  2CFU A;  2ZXW E;  4LNB A;  1BD8 A;  2WMO A;  4OVU A;  3LDZ A;  4DLQ A;  4BWR A;  1JWG A;  1P5Q A;  3HVE B;  2J4D A;  4QQI A;  3CQG B;  4RSY A;  5EYP F;  1TJF A;  4L1B A;  4HOQ A;  3Q7A A;  3FTU A;  4G11 A;  3CHQ A;  1SVX A;  3I4G A;  4GA0 A;  3TL5 A;  3W9F A;  3RO3 A;  3UKU G;  5G55 A;  3UX4 A;  1LF8 A;  3DEP A;  1AP7 A;  3C5R A;  2H6I A;  3CEQ A;  3FFL A;  3AU4 A;  3JUE A;  2XZT G;  3PE4 A;  4HB5 A;  4LNG A;  4NAC A;  4DX7 D;  5C2Y A;  3FUJ A;  3TWS A;  5HRY A;  4DI4 A;  4WUY A;  2DYS E;  4GYO A;  4YVO A;  2XQ0 A;  4TV3 A;  4U0S A;  4GTS A;  5FQ8 A;  4L7T A;  3ML9 A;  4JA9 A;  1E8W A;  3MKQ B;  3UIN C;  3EHQ A;  1TNY A;  4F1P A;  3DSX A;  3JXJ A;  2VSN A;  3DSU A;  4N5C A;  1HS6 A;  1MYO A;  5ENP D;  3T8K A;  2KZT B;  2R17 C;  3QK0 A;  4U8V D;  1YMP A;  2KC7 A;  3F6Q A;  3TWU A;  3Q5M A;  4G2V A;  1U2V G;  3OXF A;  1N4P A;  3FU5 A;  3LY9 A;  4HS2 A;  3FU3 A;  5CMW A;  1E7U A;  1MZC A;  1N94 A;  4GTT A;  3WXX A;  2P9P G;  5AEN A;  3D9I A;  1BI7 B;  4TXR A;  4C0M A;  5EX3 A;  5CED B;  3MV3 B;  3N71 A;  1BU9 A;  4XI0 A;  1FT2 A;  2HE0 A;  4B8C B;  5BXU A;  1EPU A;  4FUL A;  3HXE A;  3B7U X;  4UWG A;  4DK5 A;  1N95 A;  4G26 A;  4GA2 A;  4GTO A;  2L0T B;  3MJW A;  2PNN A;  4AV7 A;  4G8L A;  3D9M A;  1KLX A;  5KJN A;  4O6F A;  3UIP C;  4GCO A;  4CDN A;  2P9S G;  3DRA A;  3ZHE A;  3HG0 D;  4NQ0 A;  3D3M A;  3CHP A;  3SF4 A;  2ETB A;  5LP0 A;  4J8S A;  3ZUV B;  3PEV B;  3TXM A;  3CVL A;  4GCN A;  4IYP A;  2HR2 A;  2I9C A;  3HXB A;  3Q7F A;  4DI3 A;  2VGY A;  3V2X A;  2WQH A;  2EIM E;  3CIA A;  1H19 A;  1KT0 A;  3LKU A;  2GW1 A;  3ZXS A;  5CER B;  5FJY A;  1PAQ A;  1LD8 A;  3FUL A;  4UI9 C;  5JHA A;  3FUM A;  4XKB A;  1ELW A;  5LCW J;  4EQF A;  4AVX A;  2J9Q A;  2MOW A;  1N0R A;  3U4T A;  4MBG A;  3VLF A;  5E75 A;  3KD7 A;  5KJM A;  3V2O A;  3LJN A;  3DSV A;  1NL4 A;  2WXG A;  2L6J A;  3GZ2 A;  5HS0 A;  3V30 A;  4FHJ A;  1KZP A;  3D9K A;  4EBA A;  3RRM B;  1NA3 A;  3RKV A;  1DNP A;  4AXH A;  4HOT A;  5D2M C;  1SZ9 A;  4N3B A;  4OAV B;  4RVB A;  4U8H A;  3ZVV A;  1G3N B;  4F6R D;  1HF8 A;  1S0P A;  3KSL A;  1WAO 1;  1MQS A;  4WNE A;  4GZ6 A;  2WXH A;  3R7Q A;  3CST A;  3ONK A;  3SQV A;  2MHK A;  3Q79 A;  3FEX A;  3L82 A;  3ZN3 A;  5ITZ F;  4RLY A;  4AEZ C;  3D9P A;  1IQU A;  1SA4 A;  1N4S A;  5ENT D;  1HXI A;  5LFA A;  4HI9 A;  5AAO A;  4K5A B;  3LPZ A;  1Z5S C;  2WVI A;  5JJT A;  4J0U A;  5KCM A;  2XRY A;  2YHC A;  2DBA A;  1A5E A;  4C0E A;  3FY4 A;  3TWQ A;  4YDO A;  4I1A A;  3UM2 A;  2VSO E;  4KMO A;  3HIZ A;  5BXO A;  4R7L A;  5AIJ A;  3APC A;  2GRN B;  1E7V A;  4PS3 A;  2CG3 A;  2PQR A;  3QC1 A;  1N52 A;  4Y6W A;  3G2V A;  1Z3X A;  4J7W A;  5BPP A;  2BTD A;  1E8Y A;  4BES A;  3B7R L;  3LXU X;  4M3O A;  3D9N A;  4DRX E;  1HZ4 A;  2WMN A;  2Y4U A;  2IF4 A;  4C9B B;  4K0R A;  2VGX A;  1S63 A;  3D9H A;  2I1K A;  2VGE A;  2RG8 A;  3UPV A;  3JYS A;  2VJ8 A;  4GYW A;  2LSV A;  3CSF A;  1E8Z A;  1Q2Z A;  1EF1 C;  3S7B A;  3PZ1 A;  4JHR A;  1FPP A;  2NC9 A;  3NBN B;  4UI9 K;  5EX0 A;  2WQ6 A;  2Y69 E;  3E37 A;  1MJ0 A;  3Q47 B;  5EIB E;  5AQ7 A;  4BEP A;  2DIW A;  3SI5 A;  4A1S A;  3UXG A;  2KBX A;  4KYO B;  5CEC B;  3ESK A;  3DBS A;  2R05 A;  4MLP A;  3JCK C;  4ZFH A;  3EIJ A;  3FDH A;  3RRU A;  4Q96 A;  1H6P A;  3LVR E;  4I9C A;  3QAQ A;  3FTV A;  1UW4 B;  4G23 A;  3C3O A;  3AG4 E;  4APF A;  1H6K A;  3CQC B;  3L08 A;  3PE3 A;  2BF0 X;  3ABK E;  2AXU A;  2A5U A;  4U0Z A;  2GRQ B;  2WQ7 A;  4BTB A;  5BW8 C;  2AW6 A;  1JUQ A;  4YDE A;  3CVP A;  2V8S E;  2WXL A;  5EKQ D;  3LCA A;  1IXV A;  3BU8 A;  3PUJ A;  3CHR A;  3DWL G;  3FUK A;  1HG2 A;  2GRR B;  3PZ4 A;  1OWO A;  2DVW A;  3E33 A;  1QZ2 A;  5LOZ A;  4H7Y A;  3L9T A;  3IKO B;  1HE8 A;  3P2B A;  1N4R A;  4E85 A;  2OV8 A;  2J07 A;  3JQ1 A;  3IXE A;  4D10 C;  3G2U A;  2X6F A;  1IKN D;  3UUX A;  2IU1 A;  3BUA A;  1UN8 A;  3CLJ A;  3D9L A;  3ESL A;  4GML A;  2VSX E;  3ASH A;  2R03 A;  3EUV A;  3PNT B;  4GYY A;  4BT8 A;  3OXG A;  1W3B A;  4OVV A;  4GZC A;  5CMY A;  3Q78 A;  1K1A A;  3ZYL A;  3IBE A;  1Z6T A;  5JMN D;  1V55 E;  4DX2 A;  3DEO A;  4GPK A;  3AJI A;  3S7D A;  1UN9 A;  2Y4T A;  4X8Q A;  2EQX A;  2R59 A;  3PEU B;  3Q15 A;  5BUZ A;  4DLO A;  3IEG A;  1NP7 A;  2J49 A;  2X6J A;  1RW2 A;  2P9I G;  1TNB A;  4JEH A;  1OCO E;  3T5V A;  2VTB A;  1OWP A;  4UQZ A;  2FEZ A;  3KEA A;  1N11 A;  3LY7 A;  4GZ3 A;  5CBN A;  2CHX A;  3BG0 B;  4DJA A;  1O1S A;  3LJ3 A;  2FF4 A;  3KS2 A;  3CVU A;  4APO A;  1Z3Y A;  3ASO E;  3E32 A;  4U7E B;  3ULE G;  5AJD A;  2IQC A;  1YYH A;  2AXZ A;  4HFG A;  4AOF A;  2KXP C;  4U04 A;  3T5X A;  1TNU A;  3NZS A;  1JCR A;  3ZHE B;  4UQX A;  2JLB A;  2AXV A;  4HRM B;  4GTR A;  4LCT A;  5E76 A;  1QNF A;  2OND A;  4ANV A;  3TWR A;  3JXI A;  4CEM A;  2C2L A;  2WXP A;  4JPS A;  2CFZ A;  5ENS D;  3P1U A;  3U9W A;  1TR4 A;  4LUN U;  4A1G A;  5DIZ A;  2EIL E;  3CHM A;  3AG3 E;  2DYR E;  1XGW A;  5FQ7 A;  1LD7 A;  2XPY A;  2F37 A;  2XGM A;  4EBA G;  1QYM A;  5CEA A;  2E2E A;  3D9O A;  3C98 A;  5HQ8 A;  2OCC E;  3QDN A;  1U3D A;  5KWD A;  3PS6 A;  4MS6 A;  3QJZ A;  3LEW A;  1TN8 A;  3SO8 A;  2XZD G;  3ZYK A;  4XEI G;  2YHE A;  3MZL B;  4HBD A;  3SY2 A;  5FZQ A;  4WND A;  2KCV A;  2VYI A;  4ABN A;  4KBQ A;  3AS8 A;  3TGO A;  2ION A;  1FVF A;  2HO1 A;  2A5E A;  3O4Z A;  2XEE A;  4J8E A;  4O1O A;  3I5P A;  5EDS A;  5FIN A;  3MGB A;  4KVM A;  4JHK A;  4J8D A;  4F53 A;  5LX8 A;  3TWV A;  3CK8 A;  4E6H A;  3E4B A;  3OTN A;  3EU5 A;  3ZNG A;  3S7J A;  1OY3 D;  1OWN A;  3QAR A;  4J8F A;  3D9J A;  3FWV A;  3KSQ A;  5CHE E;  1FT1 A;  4ANU A;  1DVP A;  5H7P A;  2NXP A;  2V4L A;  4GMR A;  4J8Y A;  3EIQ C;  1MX2 A;  3LY8 A;  1OCZ E;  3CVW A;  1BPO A;  1HH8 A;  1QQE A;  1WG0 A;  3LYA A;  3ZYM A;  3CK9 A;  3ENE A;  5ANR A;  4BX9 A;  1DCQ A;  5FT9 A;  3CKB A;  3EDT B;  3TXN A;  4M7C A;  4GTP A;  5ARF A;  3IHV A;  4PS7 A;  4IUL A;  3J5P A;  3U66 A;  2XS8 A;  4FHK A;  4CYM D;  3PUK A;  3B13 A;  3U64 A;  2C0L A;  4JA7 A;  3C3R A;  5KJL A;  2XEH A;  5DBK A;  3CVN A;  4F7A A;  2XGS A;  2VGX B;  1K3Z D;  1D8E A;  3LS8 A;  5G2N A;  3RSE G;  2L6B A;  5FQ4 A;  3VTY A;  4HOU A;  2OEW A;  2I6H A;  2F0Y A;  4ME2 A;  4WWO A;  4FLB A;  4UWH A;  2QZA A;  2OOE A;  3JQ0 A;  4TUM A;  3L13 A;  2J08 A;  5AQA A;  4UUC A;  3FTX A;  1BI8 B;  3NB2 A;  4G24 A;  3MYV A;  4ATG A;  3ABM E;  3ASD A;  3FUH A;  2NSZ A;  3GZ1 A;  2XRZ A;  1DC2 A;  3FUI A;  4CRW A;  1FVH A;  1H0A A;  2HM8 A;  4Y6C A;  2QC9 A;  2AWI A;  3K9I A;  3DXM G;  1N9A A;  2AVP A;  1NA0 A;  3FUF A;  4CDM A;  3ZKJ A;  1S64 A;  3CGH A;  3UMV A;  4HQD A;  4XKC A;  4XZ4 A;  4KT6 B;  2X6I A;  3HRA A;  1LTX A;  2H6G A;  2XCB A;  2XCC A;  2X38 A;  4U8Y D;  2XEN A;  5BV0 A;  2QYJ A;  3FTZ A;  1VDY A;  2EIJ E;  4QFV A;  4CZ2 D;  3BQO A;  4N2Q A;  2BKK B;  2MRI A;  2LXM A;  2F8Y A;  2V5Q C;  2KCK A;  4I6E A;  5D66 A;  3Q49 B;  1ZB1 A;  3B7B A;  4YVQ C;  3SGH A;  4N39 A;  2UY1 A;  2WXM A;  4GPM A;  4MRU A;  3TWW A;  1EYH A;  1INZ A;  4MKT A;  3CVQ A;  4HOS A;  3R9A B;  4JL0 A;  4AP2 A;  2ETC A;  3AU5 A;  5ANL A;  2ZGG A;  4DX5 D;  5IY5 E;  4FC8 A;  4A3T A;  3FUN A;  2RFM A;  3PVL A;  4Q94 A;  3MV2 B;  1UOH A;  4DX6 D;  3SFZ A;  4XE0 A;  4J6I A;  2B6C A;  4KXK B;  4CT4 A;  4LRZ A;  3QOU A;  3SFX A;  5ENR D;  4I2Z A;  3W9G A;  3FTW A;  2WXF A;  4CGV A;  3ZXP A;  2LNI A;  5CCM A;  3Q9N C;  4EHM A;  4A3V A;  4BY6 A;  3RRN B;  1E96 B;  4ACK A;  2Y0B G;  3I4R B;  2NYJ A;  4GB9 A;  1HFA A;  1OCR E;  2J8S D;  3MX3 A;  4I9E A;  4PUC A;  4TRQ A;  3ASG A;  3UM1 A;  4HOR A;  3PH0 C;  2LUH A;  3U3W A;  1V54 E;  3SD5 A;  1MX4 A;  4AM9 A;  5JHB A;  4FA6 A;  2VSY A;  3ISM C;  2GRO B;  2VTB B;  4HI8 A;  2DZO A;  4B89 A;  4BER A;  2RFA A;  3GZS A;  5T4Y A;  1RZ4 A;  1TNO A;  1N0Q A;  4TXP A;  5EIL A;  3ZEF A;  4CGW A;  2H6F A;  3SFY A;  4K03 A;  1NZN A;  3IHY A;  3ONL A;  2P9K G;  3BEE A;  3SBT B;  3RK6 A;  3AG1 E;  3UIO C;  1SQM A;  4AY5 A;  4URK A;  2Y1L E;  1NI1 A;  3ZGQ A;  2OVB A;  3FUD A;  3HXC A;  3V79 K;  2ETA A;  3KAE A;  4C48 B;  4TXQ A;  1U3C A;  1Y8M A;  3ASF A;  4U0U A;  5D0O D;  3X2Q E;  2PZI A;  2RD0 A;  3PZ2 A;  1X81 A;  4GTQ A;  4W9R A;  4HLL A;  5JJ7 A;  2E0I A;  4LEU A;  3EU9 A;  3SZ7 A;  4G25 A;  4A55 A;  3NZU A;  3CVV A;  2FO7 A;  2IOS A;  3PRZ A;  3FU6 A;  4ATZ D;  4GTV A;  4GAA A;  2DZN A;  1KT1 A;  4UQY A;  4JD2 G;  4UWL A;  1PC2 A;  5EN5 D;  3FP3 A;  1UJJ A;  1OT8 A;  1KPS B;  3APF A;  1Y6I A;  4I6J A;  1EDU A;  1MX6 A;  5A23 A;  2J4B A;  4EZL A;  2XS1 A;  3BG1 B;  1N4Q A;  3HXD A;  3MEK A;  4ILH B;  4JHJ A;  4U07 A;  2X6H A;  3T8M A;  5CCL A;  2LAI A;  3CVX A;  4TUU A;  2IJG X;  3L16 A;  3FH7 A;  4KZC A;  5G05 C;  4JW1 A;  3MA5 A;  1H2U A;  1JCQ A;  2C0M A;  2WXR A;  2X6K A;  4K5B A;  3S7F A;  2LAH A;  1H2T C;  3UTM A;  2QFC A;  4H7X A;  4L2L A;  5KNG A;  4N3A A;  3ZFW A;  2QY7 A;  1HO8 A;  4BT9 A;  3SHF A;  1K8K G;  1QBQ A;  2H6H A;  5G04 J;  4Z68 A;  2CG2 A;  2GRM A;  3DST A;  4LER A;  2MYO A;  4HXI A;  2XEV A;  2GGF A;  1TNZ A;  2LO6 A;  3FTS A;  4I1O B;  5EYL A;  1UG3 A;  3FHE A;  4FU3 A;  4HRN A;  3QB2 A;  4AJW A;  3IV0 A;  2DWZ A;  4B8A A;  1D9S A;  5CBO A;  2V4H C;  1FCH A;  1NFI E;  2R02 A;  2XPI A;  5AAR A;  1WM5 A;  2FI7 A;  3G2T A;  1X5B A;  3DXK G;  4BTA A;  4U96 D;  2OVF A;  5JJ6 A;  3ULY A;  5A6C A;  1OUV A;  1ZU2 A;  4NRH B;  2XGO A;  2IO3 C;  2OEV A;  3EHR A;  3DSW A;  2P9U G;  3NAW A;  4BET A;  3VLD A;  3DPD A;  4KVO A;  4FP7 A;  2P9L G;  3TG5 A;  4U63 A;  2I1J A;  3GYZ A;  3TWT A;  2ZIS A;  2PQN A;  3EHM A;  3HVE A;  3CK7 A;  3WG7 E;  3TG4 A;  3CHS A;  2FO1 E;  2RKK A;  5ENN A;  3UKR G;  3OAW A;  3NQP A;  4A63 B;  1ELR A;  2P9N G;  4JVS A;  1HU3 A;  3AG2 E;  4BSZ B;  4CCA A;  1OWL A;  1SA5 A;  4PS8 A;  3PDN A;  2PM7 A;  3NOC D;  2I2O A;  4N3C A;  1E90 A;  2BKG A;  3PZD A;  1JWF A;  1KZO A;  3HDX A;  4FAD A;  2JAB A;  4IN3 B;  2X3M A;  4OAU C;  4GZ5 A;  2JEK A;  1S70 B;  3L17 A;  1AWC B;  3MKQ A;  1TYQ G;  5FWQ A;  1JPL A;  3UM0 A;  4YDW A;  2R2L A;  4P29 A;  2YIN A;  4ILG A;  3CVY A;  1WDY A;  3CKC A;  4V3I A;  4OYS A;  5FZR A;  3TJP A;  3JUI A;  4DPR A;  2CHW A;  3ML8 A;  4BX8 A;  5ENQ D;  5KJK A;  2KZT A;  1TN7 A;  1A17 A;  5B1B E;  2V5F A;  3APD A;  3UQ3 A;  2XPZ A;  2GRP B;  4UWF A;  4L23 A;  4GMJ A;  3AS5 A;  1JCS A;  3R9M A;  3Q9U C;  3NOG D;  2ZU6 B;  2PM6 A;  3G2W A;  2P2C P;  1H6O A;  3MCX A;  5ENO D;  2LSU A;  3QKY A;  2CHZ A;  3UT8 A;  4U95 D;  3ZW3 A;  3AS4 A;  3GW4 A;  5FIO A;  1MHQ A;  1IHB A;  3QWW A;  2KM4 A;  2UY1 B;  3B7S A;  5M72 A;  2KAT A;  4CDR A;  4EZK A;  3E34 A;  5T3R A;  3RU0 A;  3CHO A;  2UWJ G;  3B95 A;  1PY1 A;  2LXL A;  1GW6 A;  1HX8 A;  5HKP A;  2ZGD A;  3VLE A;  4F3V A;  4EEC A;  5AYW D;  3TWX A;  3FEY A;  4ANX A;  5BT1 A;  3NF1 A;  5J90 A;  2EIK E;  2WPV A;  1TJC A;  3FH8 A;  3MKR A;  5B1A E;  5ARG A;  4HVB A;  4WAF A;  3QWV A;  5CRV A;  2PL2 A;  4N5Q A;  5G05 J;  4NIK A;  4JC8 A;  1O1T A;  3G2S A;  2M63 A;  4BSX A;  1B89 A;  4RG9 A;  3ZU7 B;  2YQ8 A;  3V31 A;  4GTM A;  5FZS A;  3B7T A;  3PZ3 A;  4JZY A;  3FU0 A;  4FLH A;  5D0Q D;  4XIF A;  4BFR A;  1UJK A;  3Q4A B;  3DPY A;  5AQ9 A;  2ILR A;  2L9B A;  4NUR A;  1OXJ A;  1K1B A;  4PH4 B;  3R7R A;  4XI9 A;  1BLX B;  5EID A;  1OWM A;  3ZIM A;  1DCE A;  4LSZ E;  3T9K A;  4GU5 A;  3E30 A;  4YND A;  1TN6 A;  4B93 B;  4FJZ A;  5G04 C;  1N54 A;  3Q75 A;  4EZJ A;  5FTP A;  2R5S A;  5JA4 D;  2P58 C;  3C72 A;  4FJY A;  3TAX A;  3ZPJ A;  3FTY A;  4EPZ A;  3ULQ A;  4ZHB A;  3CV0 A;  3HXF A;  1HG5 A; 
#chains in the Genus database with same CATH homology
 3RIB A;  3VLF A;  4LUN U;  5E75 A;  3ZGQ A;  5DIZ A;  4A1G A;  1IQR A;  3CHM A;  3FH5 A;  4B94 A;  2OVB A;  3FUD A;  3KD7 A;  4XX5 A;  5KJM A;  1XGW A;  5FQ7 A;  2XPY A;  3KAE A;  5C1D A;  1U3C A;  3EHN A;  3ZYQ A;  2XGM A;  4EBA G;  4AIF A;  1Y8M A;  3ASF A;  4U0U A;  2E2E A;  2L0I A;  3C98 A;  3D9O A;  3L54 A;  5D0O D;  5HQ8 A;  2PZI A;  4UWK A;  2WXG A;  2L6J A;  2RD0 A;  1L5J A;  3GZ2 A;  3HYM B;  2WXQ A;  3QDN A;  1U3D A;  3RJV A;  4F1S A;  2GRL A;  3PS6 A;  3SBS A;  4MS6 A;  4FHJ A;  3D9K A;  4W9R A;  4EBA A;  5JJ7 A;  2E0I A;  3QJZ A;  3LEW A;  4KZ0 A;  4LEU A;  3URZ A;  3RRM B;  3SZ7 A;  4G25 A;  1IHG A;  3QNK A;  3ZYK A;  1NA3 A;  4L2Y A;  3RKV A;  4A55 A;  3NZU A;  1DNP A;  4AXH A;  2YHE A;  3MZL B;  3CVV A;  2FO7 A;  2IOS A;  4HOT A;  5FQ6 A;  3PRZ A;  4ACL A;  2WXI A;  5FZQ A;  4WND A;  3FU6 A;  2KCV A;  2VYI A;  1SZ9 A;  4ABN A;  4GAA A;  4KBQ A;  4N3B A;  3AS8 A;  1KT1 A;  3TGO A;  2ION A;  1FVF A;  2HO1 A;  3KEZ A;  4UQY A;  4UWL A;  4RVB A;  1PC2 A;  4U8H A;  3FP3 A;  4PDX A;  3ZVV A;  3O4Z A;  1UJJ A;  1HF8 A;  1S0P A;  4J8E A;  1ZBP A;  3APF A;  2WXN A;  1WAO 1;  1Y6I A;  1MQS A;  4I6J A;  1EDU A;  3ZRH A;  2DCP A;  3I5P A;  4WNE A;  5A23 A;  5BV1 A;  3UT7 A;  2J4B A;  5EDS A;  4EZL A;  3BG1 B;  4GZ6 A;  2IFU A;  2WXH A;  3MEK A;  1YA0 A;  3MGB A;  4ILH B;  4JHJ A;  4KVM A;  3R7Q A;  3QWP A;  4I43 A;  4U07 A;  3CST A;  4JHK A;  3VTX A;  4J8D A;  4F53 A;  5LX8 A;  3ONK A;  3O48 A;  2X6H A;  4Q69 A;  5J08 A;  4B0Z A;  2MHK A;  3T8M A;  3FEX A;  2WXK A;  3CK8 A;  1H2V C;  5CCL A;  2LAI A;  4E6H A;  3CVX A;  3E4B A;  3OTN A;  4TUU A;  3ZN3 A;  4AEZ C;  2IJG X;  3D9P A;  1IQU A;  3L16 A;  3FH7 A;  1IYG A;  4KZC A;  5G05 C;  4JW1 A;  4I17 A;  3MA5 A;  1TEZ A;  1H2U A;  3S7J A;  1HXI A;  2C0M A;  5LFA A;  2WXR A;  4WWN A;  2WXO A;  2X6K A;  1OWN A;  2VQ2 A;  1E8X A;  3LPZ A;  3QAR A;  2WVI A;  4J8F A;  5JJT A;  4J0U A;  3D9J A;  4RG6 A;  5KCM A;  3FWV A;  2HYZ A;  3S7F A;  2XRY A;  2LAH A;  1H2T C;  2YHC A;  2DBA A;  5CHE E;  4ANU A;  1DVP A;  4C0E A;  3FY4 A;  4WNG A;  2QFC A;  1XNF A;  4I1A A;  4ILI A;  3EJN A;  2NXP A;  2VSO E;  2V4L A;  4H7X A;  4L2L A;  4KMO A;  3HIZ A;  2WXJ A;  4N3A A;  3ZFW A;  2QY7 A;  1HO8 A;  5T8I A;  4AY6 A;  4R7L A;  3EIQ C;  5AIJ A;  4I6G A;  4JEU A;  2FBN A;  3LY8 A;  3L22 A;  2Y3A A;  4BT9 A;  3SHF A;  2YNQ A;  2J09 A;  4WNF A;  3APC A;  3CVW A;  1BPO A;  1HH8 A;  1QQE A;  2XHE A;  5G04 J;  1E7V A;  1SZA A;  2A4Z A;  3LYA A;  4PS3 A;  3SNX A;  3ZYM A;  3CK9 A;  2CG2 A;  2GRM A;  4LER A;  3L6A A;  2CG3 A;  2PQR A;  3QC1 A;  4HXI A;  4HLE A;  2XEV A;  3ENE A;  5ANR A;  1N52 A;  2GGF A;  4G1T A;  4Y6W A;  2WM9 A;  3UT4 A;  2LO6 A;  3CR3 A;  3G2V A;  4GA1 A;  1Z3X A;  3FTS A;  4UI9 J;  5FT9 A;  4BX9 A;  4CT0 A;  5BPP A;  2BTD A;  3CKB A;  1E8Y A;  4I2W A;  3B7R L;  3LXU X;  4I1O B;  3OXL A;  3EDT B;  4M3O A;  5A7D B;  1UG3 A;  3D9N A;  2BUG A;  3FHE A;  1HZ4 A;  3TXN A;  5LCW C;  2WMN A;  2Y4U A;  2IF4 A;  4FU3 A;  3HHM A;  3QB2 A;  4AJW A;  5ARF A;  3IV0 A;  4K0R A;  4C9B B;  2VGX A;  4B8A A;  3IHV A;  4PS7 A;  5HI7 A;  2I1K A;  3LVQ E;  2RG8 A;  4ANW A;  1ELK A;  1WY6 A;  3UPV A;  3JYS A;  1FCH A;  2XPI A;  1WM5 A;  2VJ8 A;  4IUL A;  4GYW A;  2LSV A;  2FI7 A;  3G2T A;  1X5B A;  3CSF A;  1E8Z A;  4BTA A;  3U66 A;  4FHK A;  2OVF A;  5JJ6 A;  5A6C A;  4N2S A;  3PUK A;  1EF1 C;  3B13 A;  3U64 A;  3S7B A;  3FUE A;  2C0L A;  1OUV A;  4JHR A;  4JA7 A;  1ZU2 A;  3PNL B;  4NRH B;  2IOL A;  5KJL A;  2XGO A;  5DBK A;  2NC9 A;  3CVN A;  4F7A A;  2XGS A;  5AJL A;  2VGX B;  4UI9 K;  5EX0 A;  2WQ6 A;  3LS8 A;  5G2N A;  2V0P A;  5FQ4 A;  3I3N A;  4WWP A;  3VTY A;  3Q47 B;  4HOU A;  4JXT A;  2WB2 A;  3PRE A;  5BNW A;  2DIW A;  3SI5 A;  4IRU A;  2I6H A;  3VLD A;  3S2A A;  4A1S A;  4ME2 A;  4KYO B;  4WWO A;  4FLB A;  4UWH A;  3ESK A;  3DPD A;  3DBS A;  2OOE A;  4KVO A;  4FP7 A;  3JQ0 A;  3JCK C;  4MLP A;  3TG5 A;  2KCL A;  3L13 A;  3EIJ A;  2I1J A;  2J08 A;  3GYZ A;  4U63 A;  3FDH A;  4URK A;  2PQN A;  3EHM A;  3HVE A;  3CK7 A;  3RRU A;  4Q96 A;  3TG4 A;  3CHS A;  3FTX A;  4GZD A;  2Q7F A;  5ENN A;  4I1M A;  2FUL A;  3OAW A;  3RO2 A;  3LVR E;  3NQP A;  4G24 A;  3MYV A;  4I9C A;  4ATG A;  1ELR A;  3QAQ A;  3FTV A;  4JVS A;  1HU3 A;  1UW4 B;  4G23 A;  2CFU A;  3ASD A;  3FUH A;  4CCA A;  1OWL A;  2NSZ A;  4APF A;  1H6K A;  3GZ1 A;  2WMO A;  3CQC B;  4PS8 A;  3LDZ A;  4OVU A;  4DLQ A;  3L08 A;  2XRZ A;  4BWR A;  3PE3 A;  3PDN A;  3FUI A;  2BF0 X;  2PM7 A;  4CRW A;  2AXU A;  1JWG A;  2I2O A;  1P5Q A;  4N3C A;  2A5U A;  3HVE B;  1E90 A;  1FVH A;  1H0A A;  2HM8 A;  2J4D A;  3PZD A;  4U0Z A;  2WQ7 A;  1JWF A;  4BTB A;  3CQG B;  4RSY A;  5BW8 C;  4Y6C A;  3HDX A;  4FAD A;  1TJF A;  2AW6 A;  4L1B A;  2AWI A;  3K9I A;  4HOQ A;  4IN3 B;  3FTU A;  1JUQ A;  4G11 A;  3CHQ A;  2X3M A;  2AVP A;  4GZ5 A;  1NA0 A;  2JEK A;  3FUF A;  3I4G A;  4GA0 A;  3TL5 A;  4CDM A;  3L17 A;  3RO3 A;  5G55 A;  3UX4 A;  3CGH A;  1LF8 A;  3CVP A;  3UMV A;  3MKQ A;  2V8S E;  3CEQ A;  3FFL A;  4XKC A;  2WXL A;  4XZ4 A;  3AU4 A;  4KT6 B;  2X6I A;  5FWQ A;  1JPL A;  5EKQ D;  2XCB A;  3PE4 A;  3LCA A;  2XCC A;  4P29 A;  2X38 A;  2YIN A;  4ILG A;  4NAC A;  3PUJ A;  5C2Y A;  3CVY A;  3FUJ A;  3CHR A;  4DI4 A;  3FUK A;  3CKC A;  4WUY A;  1HG2 A;  4V3I A;  4OYS A;  5BV0 A;  4GYO A;  1OWO A;  3FTZ A;  1VDY A;  4YVO A;  2XQ0 A;  5FZR A;  3TJP A;  3JUI A;  4QFV A;  4TV3 A;  4DPR A;  4U0S A;  1QZ2 A;  2CHW A;  3ML8 A;  5LOZ A;  4BX8 A;  4H7Y A;  5KJK A;  2KZT A;  3IKO B;  5FQ8 A;  1HE8 A;  4L7T A;  3ML9 A;  3P2B A;  4JA9 A;  1E8W A;  3MKQ B;  1A17 A;  2MRI A;  4E85 A;  2OV8 A;  4N2Q A;  2J07 A;  2V5F A;  3APD A;  3UQ3 A;  2XPZ A;  3JQ1 A;  2KCK A;  4I6E A;  4UWF A;  3Q49 B;  4YVQ C;  4L23 A;  3SGH A;  4GMJ A;  4D10 C;  3G2U A;  2X6F A;  4N39 A;  2UY1 A;  3AS5 A;  2WXM A;  2ZU6 B;  4MRU A;  2PM6 A;  3G2W A;  3UUX A;  2IU1 A;  2VSN A;  4N5C A;  1HS6 A;  1EYH A;  1UN8 A;  3MCX A;  3CLJ A;  1INZ A;  3D9L A;  2LSU A;  4MKT A;  3QKY A;  3ESL A;  3CVQ A;  4HOS A;  2KZT B;  3R9A B;  4GML A;  2R17 C;  2VSX E;  3ASH A;  3QK0 A;  4JL0 A;  4AP2 A;  2CHZ A;  3UT8 A;  3PNT B;  3ZW3 A;  3AU5 A;  3AS4 A;  2KC7 A;  4GYY A;  4BT8 A;  3GW4 A;  3OXG A;  3Q5M A;  1MHQ A;  3QWW A;  5ANL A;  4G2V A;  2KM4 A;  3OXF A;  4FC8 A;  1W3B A;  3FU5 A;  2UY1 B;  3B7S A;  4OVV A;  3LY9 A;  2KAT A;  4A3T A;  5M72 A;  3FUN A;  4HS2 A;  3PVL A;  4CDR A;  4GZC A;  5CMY A;  3FU3 A;  4EZK A;  4Q94 A;  5CMW A;  5T3R A;  1E7U A;  3MV2 B;  3ZYL A;  3RU0 A;  3CHO A;  2UWJ G;  3IBE A;  1PY1 A;  3SFZ A;  3WXX A;  4XE0 A;  1GW6 A;  1HX8 A;  4J6I A;  4KXK B;  4CT4 A;  5AEN A;  3D9I A;  4LRZ A;  3QOU A;  1Z6T A;  3VLE A;  4C0M A;  4F3V A;  4EEC A;  5EX3 A;  4GPK A;  3MV3 B;  3N71 A;  4XI0 A;  3S7D A;  4I2Z A;  5AYW D;  1UN9 A;  3FTW A;  2Y4T A;  3FEY A;  4B8C B;  4ANX A;  2WXF A;  5BT1 A;  3NF1 A;  5J90 A;  4CGV A;  1EPU A;  4FUL A;  2EQX A;  2LNI A;  2WPV A;  2R59 A;  3B7U X;  5CCM A;  3PEU B;  3Q15 A;  1TJC A;  4UWG A;  4DK5 A;  5BUZ A;  4DLO A;  3IEG A;  4A3V A;  3FH8 A;  1NP7 A;  3MKR A;  2J49 A;  2X6J A;  4BY6 A;  4G26 A;  3RRN B;  4GA2 A;  5ARG A;  4HVB A;  2L0T B;  4WAF A;  1E96 B;  3QWV A;  3MJW A;  4JEH A;  4ACK A;  4AV7 A;  3T5V A;  3D9M A;  2PL2 A;  1OWP A;  3I4R B;  4UQZ A;  5G05 J;  2VTB A;  2FEZ A;  4JC8 A;  3LY7 A;  3G2S A;  2M63 A;  4GZ3 A;  4GB9 A;  1HFA A;  1KLX A;  4BSX A;  1B89 A;  4RG9 A;  2CHX A;  3MX3 A;  4I9E A;  5KJN A;  3BG0 B;  4PUC A;  2YQ8 A;  4TRQ A;  4DJA A;  4O6F A;  3ASG A;  5FZS A;  3B7T A;  3LJ3 A;  4HOR A;  3PH0 C;  2FF4 A;  3KS2 A;  4GCO A;  4JZY A;  4CDN A;  3FU0 A;  4FLH A;  3U3W A;  5D0Q D;  4XIF A;  3CVU A;  3SD5 A;  3ZHE A;  4APO A;  1Z3Y A;  4BFR A;  4AM9 A;  4NQ0 A;  5JHB A;  4FA6 A;  1UJK A;  3D3M A;  3Q4A B;  3CHP A;  2VSY A;  2ILR A;  3SF4 A;  2L9B A;  5LP0 A;  4J8S A;  5AJD A;  2VTB B;  4NUR A;  3PEV B;  2IQC A;  4B89 A;  4PH4 B;  3R7R A;  3TXM A;  4XI9 A;  2AXZ A;  4HFG A;  4AOF A;  3CVL A;  4GCN A;  4IYP A;  3GZS A;  5T4Y A;  4U04 A;  2HR2 A;  1OWM A;  2I9C A;  3ZIM A;  3T5X A;  4GU5 A;  3ZEF A;  4DI3 A;  2VGY A;  4YND A;  4CGW A;  2WQH A;  3CIA A;  1H19 A;  4FJZ A;  5G04 C;  1KT0 A;  3LKU A;  2GW1 A;  3NZS A;  1N54 A;  4K03 A;  3ZHE B;  3ZXS A;  1NZN A;  4UQX A;  2JLB A;  5FJY A;  2AXV A;  3IHY A;  1PAQ A;  4LCT A;  5E76 A;  5FTP A;  4EZJ A;  1QNF A;  3ONL A;  2OND A;  2R5S A;  2P58 C;  4ANV A;  3BEE A;  3FUL A;  4FJY A;  4CEM A;  4UI9 C;  3TAX A;  3ZPJ A;  3FTY A;  5JHA A;  2C2L A;  3FUM A;  4XKB A;  4EPZ A;  2WXP A;  4JPS A;  1ELW A;  2CFZ A;  5LCW J;  4EQF A;  3SBT B;  3ULQ A;  4AVX A;  2J9Q A;  3CV0 A;  2MOW A;  3P1U A;  3RK6 A;  1SQM A;  4AY5 A;  3U9W A;  1HG5 A;  3U4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...