2VQ2A

Crystal structure of pilw, widely conserved type iv pilus biogenesis factor
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
220
structure length
220
Chain Sequence
ANQVSNIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLCGRLNRPAESMAYFDKALADPTYPTPYIANLNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDADYYFKKYQSRVEVLQADDLLLGWKIAKALGNAQAAYEYEAQLQANFPYSEELQTVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a widely conserved type IV pilus biogenesis factor that affects the stability of secretin multimers.
pubmed doi rcsb
source organism Neisseria meningitidis
molecule tags Structural protein
molecule keywords PUTATIVE FIMBRIAL BIOGENESIS AND TWITCHING MOTILITY PROTEIN
total genus 94
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2008-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13429 TPR_15 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vq2A00
4YNDA 4J8EA 1IHGA 3O48A 4LEUA 4Y6WA 5FJYA 3ZN3A 4G26A 5HQ8A 4G1TA 4H7XA 4J8FA 5D0OD 3ZGQA 5FTPA 4HOTA 2XEVA 4APOA 2P58C 3RIBA 3TAXA 2HO1A 2PQRA 3CVNA 3KD7A 3NF1A 3UUXA 4EQFA 4F3VA 4CGVA 5KJMA 3IEGA 2FF4A 5DIZA 1WM5A 4Y6CA 3CKCA 4UI9J 1WAO1 2XCCA 4U0ZA 3OXLA 4AY5A 5C1DA 3U3WA 2YHCA 4WUYA 2XGOA 2ONDA 3MV2B 3LY9A 3GW4A 4G23A 2FI7A 2KATA 3GZ1A 4UQYA 3OXGA 4WNEA 4I9CA 5FT9A 3ZHEB 1NA3A 3N71A 2UY1B 3ASHA 5JJ7A 3AS4A 4O6FA 4B94A 2VSYA 2R5SA 1P5QA 2Y4TA 4GYYA 3OXFA 4N3BA 3ASFA 4KBQA 3RO3A 3WXXA 5LCWC 1ELWA 3E4BA 4KXKB 2UY1A 4GCNA 1TJCA 3HYMB 4I17A 2FBNA 4NQ0A 3RU0A 3TG5A 4I9EA 5CCMA 1YA0A 5G05J 3RKVA 3CV0A 2C0LA 2Q7FA 4KYOB 2PQNA 4WNFA 2KCKA 3PDNA 3ZFWA 5JJ6A 4AM9A 1XNFA 2LSUA 5G05C 1B89A 2GW1A 4RG9A 1HXIA 3FFLA 4N3AA 3CKBA 3MEKA 3S7DA 4GZ5A 3LKUA 3GZ2A 3TGOA 3GYZA 1E96B 3CVQA 3CEQA 4ABNA 3LY8A 3FP3A 4UI9C 4U07A 3CVPA 3LY7A 4YVQC 2IFUA 3ZPJA 1KT0A 5EX0A 2I6HA 3SF4A 2QFCA 3QOUA 1PC2A 1NA0A 2L6JA 2LNIA 3EDTB 4GCOA 3QWWA 2C0MA 4U0UA 4HOQA 4XI0A 5EKQD 5G04J 3URZA 4CDRA 5BT1A 4GZ6A 2JLBA 3QWVA 5ARFA 4N2QA 3MA5A 5KJLA 3JYSA 4BT8A 3BEEA 2XPIA 4W9RA 4IN3B 5ARGA 1HZ4A 4GYWA 3QDNA 3SZ7A 3CK7A 2VGYA 3S7JA 2KCVA 4UI9K 5FZSA 4AY6A 4J8DA 2HYZA 1QQEA 2KC7A 1ELRA 2C2LA 2XGMA 3ASGA 3UPVA 1KT1A 2V5FA 3Q47B 4U0SA 3MV3B 3Q4AB 3AS5A 4XIFA 2FEZA 1Y8MA 4N3CA 2NC9A 2VQ2A 4JL0A 3R9AB 2HR2A 2IF4A 4CGWA 5G04C 5FZRA 2VGXB 3CK8A 4I1AA 4UQXA 5A6CA 2VYIA 3CVLA 3KS2A 4BT9A 2E2EA 3TG4A 4RG6A 3ESKA 3PE3A 2VSNA 3QKYA 4GYOA 2VGXA 4I2ZA 5BW8C 4A1SA 2YQ8A 1QZ2A 4YVOA 2PZIA 3Q5MA 4JHRA 3PE4A 3MKRA 2DBAA 3S7BA 3Q15A 4G25A 4XI9A 5CCLA 5EX3A 2XCBA 3RJVA 3S7FA 4NRHB 4G2VA 2KCLA 5AYWD 5A7DB 1KLXA 4WNDA 5KJNA 2UWJG 3ASDA 1FCHA 3LPZA 1NZNA 3K9IA 3UQ3A 2J9QA 4UQZA 4BTBA 5KJKA 5CHEE 3QWPA 5M72A 2Y4UA 4ME2A 4GA0A 2FO7A 4JA7A 3RO2A 2WQHA 5HI7A 2XGSA 3Q49B 5D0QD 4N2SA 1W3BA 4GZ3A 5JJTA 3ZHEA 4AIFA 4GA1A 4HOSA 2PL2A 4U04A 4JA9A 1IYGA 4N5CA 4I2WA 3ULQA 1A17A 5BNWA 2MHKA 4GPKA 1ZU2A 4J0UA 3FWVA 4H7YA 4BTAA 3AS8A 4WNGA 5DBKA 2AVPA 4HOUA 3VTYA 2WPVA 3U4TA 3LYAA 2LSVA 4BWRA 3KAEA 5FZQA 3LCAA 1ZBPA 4HORA 3VTXA 4GA2A 5LCWJ 2BUGA 1HH8A 2OOEA 1OUVA 3CK9A 4G24A 4N39A
chains in the Genus database with same CATH superfamily
1IHGA 4D10C 1H6KA 3IV0A 3SO8A 3Q7FA 5LOZA 4CGVA 4RLYA 4KVMA 2VTBA 4CRWA 4WUYA 3MJWA 2DCPA 4BX9A 4AVXA 1V54E 3LVRE 2BF0X 4HS2A 4HVBA 5CCMA 5AENA 4HB5A 2ZXWE 4N2QA 3AJIA 2VGYA 3D9HA 2Y1LE 4L23A 1MX6A 2XRZA 2X38A 2HR2A 2I1KA 4FC8A 4J7WA 2MOWA 5CERB 3MGBA 3RJVA 4HNAD 3Q9NC 3HXFA 3UT4A 3EU9A 4M3OA 3MZLB 3ONLA 2FO7A 5D0QD 4I6EA 1BPOA 4GZ3A 4PH4B 1XGWA 4GA1A 3FEYA 1H19A 3FTZA 3D9PA 1DC2A 3L82A 5FQ6A 2J07A 1OCOE 4GA2A 5LCWJ 1TR4A 1HU3A 3CQCB 4OYSA 5ENOD 4G1TA 3UKUG 2A5EA 2FF4A 3SFZA 3R9MA 1YCSB 3ESLA 3GW4A 3LY9A 3ASHA 1LD7A 3OAWA 4B94A 1FT2A 2VSYA 4GU5A 2EINE 3ZXSA 4DX2A 3R7RA 3RO3A 1N11A 3CV0A 2WB2A 1OWPA 1B89A 3SNXA 1HXIA 3X2QE 3IHVA 4U8YD 2XHEA 3FUMA 4ABNA 2GRNB 2L0IA 4TXQA 3ULYA 3PEVB 2C0MA 3B7TA 4GZ6A 4O1PA 2ETCA 3APDA 3C3QA 5JMND 3U66A 2KC7A 4ILGA 4CZ2D 3UM3A 1BI7B 2WXQA 4U96D 2GRPB 1DNPA 3ABKE 1OWMA 5ENTD 2R17C 3LJ3A 4G25A 2V4HC 1HG2A 4YDYA 5A7DB 4TV3A 3NZSA 5G2NA 3DXKG 1PY1A 2UWJG 1D9SA 2Y4UA 3DSWA 3RO2A 3Q49B 3V31A 2P9SG 4HOSA 4ATZD 5DBKA 3DPDA 4JHJA 3D9JA 3CR3A 4QQIA 2EQXA 2BUGA 2OOEA 4BETA 4CDNA 2WXIA 4LRZA 4N5QA 2XEVA 4APOA 2WXRA 3HXCA 1AWCB 5HKPA 4WWOA 2XGOA 3SD5A 3JXIA 5A23A 1EDUA 2WXJA 3UM0A 4K03A 3FTSA 4K5AB 3LKUA 3ZVVA 3QNKA 1BU9A 5C1DA 2VSXE 5HRYA 1D8EA 3FY4A 5BPPA 3FUFA 1EF1C 5E76A 3ASGA 3MV3B 3Q4AB 4JD2G 4CGWA 1HE8A 2IF4A 3UM2A 4B93B 3CHQA 3MX3A 2YINA 4AEZC 2L6BA 3EJNA 3Q9UC 4GYOA 3PS6A 1QZ2A 4HFGA 4YVOA 4GTQA 2X6JA 3ABME 4NRHB 4U63A 3P1UA 3ASDA 3UQ3A 3JQ1A 5H7PA 3EHMA 3FU3A 3UXGA 4BERA 3PNLB 3CHOA 2IO2C 1K1AA 1HO8A 3ZKJA 3ULQA 4EECA 4J6IA 2DYSE 3FTXA 3D3MA 2X6HA 4HORA 1HH8A 3BQOA 2GGFA 2ZISA 2CFUA 3D9IA 3SGHA 4YNDA 3DSVA 2R59A 3FULA 3EUVA 4ANUA 1A5EA 3UUXA 4F3VA 2H6GA 1OWOA 3UKRG 3LVQE 4G23A 3ZHEB 3J5QB 2YHEA 1S63A 2XZDG 1QYMA 3OXFA 5FIOA 3KSLA 4KBQA 3WXXA 3PUJA 2RFAA 1Z6TA 3TWWA 4FULA 4XZ4A 1XNFA 3RRNB 5BV1A 3FUEA 3CEQA 4UI9C 2KZTA 1E7VA 1O1RA 4GTRA 4JHKA 3C3RA 2WMNA 4W9RA 2VGEA 4F53A 4TXRA 2CG3A 1U3DA 3L9TA 4C9BB 5J90A 2VYIA 2BKKB 2ETAA 2QYUA 3NB2A 2QY7A 5AQ9A 4LNGA 2R05A 1RZ4A 3UINC 3AAAC 1JUQA 2OVBA 3FTUA 4WNDA 1FCHA 4JVSA 3QJZA 3Q78A 5CBNA 3ZU7B 4RVBA 4CEMA 2ILRA 3IKOB 4L7TA 1JPLA 4O60A 2R02A 3QC1A 3ML8A 5B1BE 2X6IA 2KM4A 3CVUA 4AV7A 4I43A 4C48B 5C2YA 2XCCA 4AY5A 4JZYA 1SZ9A 2FO1E 1VDYA 2AW6A 4N3BA 5AN8A 2J4DA 2WXHA 2MYOA 4KZ0A 4RSYA 3R7QA 2RG8A 4N3AA 5ANRA 3S7DA 3PZ2A 2IFUA 3SF4A 4OVVA 2LNIA 1NA0A 1Z3YA 3FUHA 3TG4A 2RKKA 3ZNGA 1FVFA 3SZ7A 4A3VA 5BUZA 4AP2A 2PNNA 4JB8P 4DUIA 1Z5SC 2R03A 5A6CA 3CVLA 1S70B 3QKYA 3FH5A 2YQ8A 3TL5A 2QC9A 3OTNA 5CCLA 3LXUX 3ASOE 3T5VA 1G3NB 1JCRA 2LAIA 5CECB 3DPYA 2WQHA 3F6QA 1W3BA 3PRZA 1TNBA 2VJ8A 2XQ0A 2V5QC 1BD8A 4JXTA 3HXDA 4APFA 4J8EA 2ZGGA 4IRUA 3G2TA 4G26A 4HI8A 1N94A 2WXNA 3TAXA 3G2VA 4ANWA 1SA5A 4ZHBA 1WAO1 3GZ1A 4WNEA 3FU5A 5T3RA 5FT9A 4TRQA 4CT0A 4GYYA 2Y4TA 4GTTA 5ITZF 3UI2A 2FBNA 1HG5A 4U8VD 4GMJA 4WWNA 4KYOB 4AXHA 3PDNA 4G8KA 3V79K 3D9NA 1X81A 3LY7A 3QOUA 4B0ZA 1LF8A 3G2WA 4K0RA 1KZOA 2I2OA 1SQMA 3EIJA 4MKTA 1HZ4A 3FUDA 4J8DA 1TNUA 2Y69E 3Q47B 3AS5A 3ZPJA 2XRYA 5FQ7A 4C0MA 2M63A 3B7UX 4BT9A 3KEAA 2VGXA 4XEIG 3TWQA 2PZIA 3Q5MA 4TUUA 3PE4A 3Q79A 5AYWD 3V2XA 2AXVA 4NIKA 1OWLA 2J9QA 2JABA 4N2SA 5G55A 2J4BA 4EPZA 3LJNA 1RW2A 2MHKA 4HBDA 4WNGA 3J5PA 4DK5A 3ASNE 5FZQA 1U3CA 4WAFA 4I6GA 4CT4A 4AJWA 3U3WA 1X5BA 2KXPC 4HRLA 2L0TB 4F6RD 4UI9J 1N0QA 5AQ7A 3UM1A 3FU0A 4GB9A 2LO6A 3AS4A 3BU8A 4O6FA 3EHNA 5KNGA 3CHSA 1MZCA 1N9AA 5LX8A 4BSZB 3RKVA 2H6HA 4AM9A 1WG0A 1O5MA 2X6FA 2CHWA 4CDMA 4U95D 4GCOA 1IQUA 3CVWA 1O1TA 3B7RL 4BT8A 4IN3B 4WWPA 1ELKA 3EIQC 4EZJA 4U8HA 2HYZA 1SW6A 2P9IG 2VQ2A 4JL0A 3FDHA 4AOFA 5G04C 4J8SA 4L2LA 4JHRA 4BY6A 3I5PA 1OCZE 1H6PA 3AU4A 4I6JA 3LS8A 1N52A 4HXIA 2J8SD 1N0RA 1AP7A 3FTWA 4BEPA 4I1MA 1ZB1A 2XPYA 5AQBA 2DIWA 3FUNA 3CK9A 2V4LA 2RD0A 4GTVA 4HOTA 3SBSA 3L13A 3DSUA 1WDYA 3SY2A 4Y6CA 4OVUA 5JHBA 4KZCA 3I3NA 2V0PA 3E34A 1E8WA 4UQYA 4EZLA 5JJ7A 3JUIA 2ZU6B 1HX8A 5D2MC 1JWGA 1JCSA 2P2CP 2C0LA 2I1JA 4RG9A 4BFRA 1JWFA 1IHBA 4V3IA 4HRMB 2LUHA 4CCAA 2B0OE 2I6HA 3UX4A 2I9CA 4UWLA 3CGHA 4DLQA 4GZDA 4MRUA 4UI9K 3EU5A 3IXEA 4ACLA 3FUKA 5FZRA 4UQXA 4A63B 5CMWA 3DWLG 1BLXB 4E6HA 4PS3A 3EHRA 1V55E 2PM7A 1SA4A 3C3OA 5EX3A 4KT6B 4LERA 4NACA 5KJNA 5CBOA 4GMRA 4TXPA 5CHEE 3QWPA 3SBTB 1UN8A 5CEAA 2IONA 2WVIA 2ZGDA 5ENNA 4GTSA 3ZHEA 3TXMA 2OVFA 4IYPA 4BTAA 4YDEA 2EILE 3FH7A 5FINA 2QYJA 3ZW3A 1E8ZA 3ZGQA 4XKCA 1LTXA 5DIZA 1WM5A 4TUMA 4I9CA 2JEKA 5IY5E 3ASFA 2V8SE 4P29A 2F8XK 4I9EA 4FP7A 2KCKA 4HLEA 3B13A 3CKBA 3D9MA 3TGOA 5KBAA 4L2YA 4FLBA 1KT0A 5KCMA 3DSTA 1DVPA 3AU5A 3JYSA 1IKND 2DZNA 3W9FA 4X8QA 4GYWA 3CK7A 2ETBA 4U0SA 1H2UA 3TWXA 2Y3AA 5AIJA 3PNTB 4BX8A 3KS2A 3ESKA 3PE3A 2KZTB 1U2VG 2WXFA 4EBAA 3PZ1A 2L9BA 3E30A 3UT8A 3UMVA 2AWIA 4QFVA 1KLXA 5KJKA 3MCXA 4ILIA 2Y0BG 5AARA 3JCKC 2EIKE 3JQ0A 5ENRD 2IEJA 5BNWA 3TWUA 2XEEA 2AVPA 4HOUA 2WPVA 3LDZA 3CVVA 1FVHA 5FQ8A 3HHMA 3QARA 3O48A 3QB2A 5FJYA 1EPUA 3RRMB 3ULEG 4EQFA 3AG3E 1HS6A 2ONDA 2KATA 2LXMA 3N71A 2UY1B 3VLEA 1NFIE 4KXKB 4GCNA 5EIDA 4WNFA 4HRNA 3TJPA 5T4YA 4Q94A 3FP3A 3C72A 3APCA 3I4GA 4U0UA 4YDOA 4XI0A 2B6CA 2CHXA 2WXLA 4CDRA 4XX5A 5BT1A 3ISMC 5J08A 1N4RA 2KCVA 2RFMA 2H6IA 3WG7E 1KT1A 3CK8A 3CVXA 2IQCA 3V30A 1D8DA 4G2VA 3Q7AA 3G2SA 4ANXA 2XGSA 2XPZA 4LNUD 3SFXA 5JJTA 3FWVA 4DX6D 3U4TA 3LYAA 2DVWA 4LNBA 1N4SA 5AJLA 1TN8A 4HLLA 2LXLA 4LEUA 4Y6WA 2P9PG 3RIBA 3HIZA 3Q75A 4FA6A 1TN7A 2EIJE 4DX5D 3CKCA 4PS8A 4U0ZA 4CYMD 5D66A 3URZA 5FWQA 3PREA 3RRUA 2OV8A 5LFAA 1TJFA 1NP7A 2QZAA 5T8IA 3PH0C 5LCWC 3RU0A 2Q7FA 2PQNA 4GAAA 4A55A 3P2BA 3RSEG 3AG2E 3C98A 2XEHA 4LCTA 5KNHD 4L9PA 2DZOA 5G05C 4UWHA 4HOQA 2WXGA 3MA5A 2F37A 3B7SA 4ILHB 3L6AA 4ZFHA 3IHYA 2VSOE 4OAUC 1ELRA 2XGMA 3PEUB 5EN5D 4N3CA 3R9AB 3BG1B 3ZYKA 5BW8C 4A1SA 1DCEA 5CRVA 5AJDA 1TNYA 4XI9A 2WM9A 2XCBA 3FU6A 4DI3A 4UWKA 1GW6A 1UG3A 1TNZA 3AG1E 4OAVB 4U04A 3ZRHA 3VTYA 1OCRE 2X3MA 3VTXA 1SZAA 2DYRE 3T8MA 2PQRA 3CVNA 3C5RA 4E85A 3APFA 1MYOA 3GZSA 2GRRB 1NA3A 1UW4B 1TYQG 4PS7A 2WXMA 3FEXA 3HYMB 3ZEFA 5BXOA 3FUIA 3HDXA 4M7CA 4GZ5A 2FULA 2LAHA 4B89A 4GMLA 4JPSA 3KEZA 2KBXA 4EBAG 5EKQD 2OEWA 3NAWA 2JLBA 5EYPF 3QDNA 3ZYLA 1QQEA 3ENEA 3UPVA 2NSZA 2V5FA 2HM8A 3NOGD 1TEZA 1KZPA 2J08A 5EIBE 3LEWA 4JW1A 1MX2A 3PUKA 3DEOA 3UIOC 2BEDA 1NL4A 4EHMA 4F7AA 1H2TC 3S7FA 1QNFA 3QAQA 1NZNA 5B1AE 4J8YA 3UT7A 4GTMA 3L08A 3JUEA 1IQRA 4RQIA 1N4QA 3DSSA 2PL2A 1IYGA 4H7YA 4Q69A 4ATGA 4F1PA 4LSZE 4BWRA 3KAEA 3NOCD 3MKQB 3PZ4A 4DRXE 4N39A 2OEVA 4J8FA 5ANLA 4JEUA 2VTBB 4FJZA 3KD7A 4B8CB 3IEGA 3CIAA 3OXGA 1N4PA 4Z68A 1S0PA 4UWFA 1E8XA 1P5QA 2P9NG 3E4BA 4A3TA 1OWNA 4I17A 1FT1A 1K1BA 5G05J 3ZFWA 2LSUA 2GW1A 5KWDA 1PAQA 3FFLA 4DI4A 1E96B 3LY8A 3L22A 2CG2A 4HI9A 3T9KA 1WY6A 4PDXA 2QFCA 3NBNB 2H6FA 3B7BA 1DCQA 5G04J 2P9KG 3NZUA 1EYHA 4XIFA 2FEZA 1Y8MA 2F0YA 2OCCE 3TWSA 2EIME 4LG6A 3SHFA 4I2ZA 2IJGX 5BV0A 2F8YA 4I1OB 3ZYMA 5AAOA 3TXNA 4KMOA 3E37A 3HRAA 4I2WA 3FH8A 3FHEA 4O1OA 3FUJA 5EILA 3IBEA 5EDSA 4KVOA 5ENQD 1OUVA 3D9LA 3ZN3A 2DWZA 5FTPA 4GTOA 4DPRA 2WQ6A 2P58C 5KJMA 3T5XA 3OXLA 1L5JA 1S64A 3RAUA 3MV2B 5E75A 3L54A 2YNQA 2R5SA 1QBQA 1MX4A 5CRUA 2ZIRA 4AY6A 2UY1A 4NQ0A 3TG5A 3ONKA 4IULA 2HE0A 3HXEA 4B8AA 1H0AA 2XS8A 3KSQA 1H6OA 3MEKA 3GZ2A 3GYZA 1JCQA 2WXOA 3DEPA 1YMPA 2AXUA 3CVPA 4YVQC 1PC2A 4AIFA 4F1SA 5CEDB 3UTMA 3MKQA 5ARFA 3QWVA 1O1SA 5KJLA 1Z3XA 4G8LA 3U9WA 3S7JA 2CHZA 1KPSB 2NYJA 4MS6A 4R7LA 2VGXB 4I1AA 1YYHA 3SI5A 3HVEA 3E32A 2NXPA 1E8YA 4RG6A 3ZUVB 3Q15A 1H2VC 3L16A 2IOLA 3LPZA 1IXVA 4ACKA 5HS0A 2A4ZA 4FJYA 3VLFA 4FHKA 3BUAA 2XZTG 1INZA 1N95A 3HVEB 3FTVA 2WQ7A 2AXZA 5JA4D 1K8KG 1UJKA 2XS1A 3ABLE 2MRIA 5AQAA 4A1GA 1A17A 3V2OA 4J0UA 4G11A 2LSVA 1LD8A 4UUCA 2R2LA 4URKA 4FU3A 4G24A 1MQSA 1MHQA 3UIPC 4FADA 2J49A 2HO1A 2X6KA 3PVLA 3CVYA 4FLHA 2YHCA 2FI7A 3CSTA 5JHAA 3VLDA 3B95A 1K3ZD 1MJ0A 3HXBA 4BESA 4C0EA 4FHJA 5HQ8A 1OT8A 1UN9A 1YA0A 2IO3C 5JJ6A 3SQVA 3CHRA 4GTPA 4U07A 5EX0A 4XE0A 2PM6A 4ANVA 2L6JA 3EDTB 3QWWA 3RK6A 3DXMG 3I4RB 4UWGA 3BEEA 1TN6A 3DSXA 3G2UA 5B3SE 2A5UA 2J09A 3AG4E 2NC9A 3D9OA 3QK0A 3TWRA 3ZXPA 1BI8B 2E2EA 2VSNA 1HF8A 3DRAA 1OXJA 5ENPD 2GRQB 3CLJA 2DBAA 3S7BA 2IOSA 1E90A 4UQZA 3L17A 5M72A 1OY3D 4ME2A 4GA0A 2GRLA 3EHQA 1HFAA 1NI1A 4LUNU 2IY0C 3MYVA 4JA9A 4JEHA 3LCAA 2P9LG 3JXJA 4H7XA 5D0OD 3NF1A 2WXKA 1SVXA 3CHMA 3T8KA 3BG0B 1Y6IA 2BKGA 3CSFA 4NURA 3CHPA 1ELWA 1TJCA 1UOHA 4K5BA 2IU1A 4BTBA 3NQPA 1FPPA 4BSXA 5FQ4A 3U64A 4MBGA 2XENA 3CVQA 3CQGB 4GPMA 3PZ3A 5EYLA 2WMOA 3ZIMA 4YDWA 1OCCE 2XPIA 3W9GA 5ARGA 4EZKA 1Q2ZA 5FZSA 4DLOA 3ZYQA 2WXPA 4Q96A 1N54A 3O4ZA 2C2LA 3FTYA 5CMYA 4HQDA 5BXUA 4L1BA 1TNOA 4XKBA 4DX1A 3SFYA 3MKRA 4K5CA 3Q73A 2KCLA 3D9KA 3HG0D 3TWVA 3S2AA 3K9IA 1E7UA 3DBSA 3TWTA 1UJJA 5ENSD 4PUCA 2CFZA 4JA7A 5HI7A 2E0IA 3ML9A 4DJAA 4JC8A 2GRMA 4U7EB 4MLPA 4N5CA 2GROB 5LP0A 3E33A 1ZU2A 2P9UG 4GPKA 2BTDA 3AS8A 4GZCA 4DX7D 1ZBPA 3PZDA 2AJAA
chains in the Genus database with same CATH topology
4AV7A 1IHGA 4J8FA 1E8ZA 3ZGQA 4I43A 4D10C 5ANLA 4JEUA 1H6KA 4XKCA 2VTBB 4FJZA 3IV0A 3KD7A 5LOZA 4B8CB 4CGVA 3IEGA 5DIZA 5C2YA 1WM5A 3CIAA 4KVMA 2XCCA 4AY5A 2VTBA 4CRWA 4WUYA 4JZYA 3MJWA 2DCPA 4BX9A 1SZ9A 4AVXA 3OXGA 4I9CA 2JEKA 1S0PA 1VDYA 4UWFA 2AW6A 1E8XA 3LVRE 4N3BA 1P5QA 2BF0X 4HS2A 3ASFA 2V8SE 2J4DA 3E4BA 4P29A 2WXHA 4A3TA 1OWNA 4I17A 4HVBA 4KZ0A 4I9EA 4RSYA 5CCMA 5G05J 5AENA 4FP7A 3R7QA 3ZFWA 2KCKA 2RG8A 4HLEA 2LSUA 2GW1A 3B13A 1PAQA 3FFLA 4N3AA 3CKBA 5ANRA 4DI4A 3S7DA 3D9MA 3TGOA 1E96B 3LY8A 4L2YA 3L22A 2CG2A 2IFUA 4FLBA 1KT0A 1WY6A 4PDXA 4OVVA 2QFCA 3SF4A 1Z3YA 1NA0A 2LNIA 3FUHA 5KCMA 3TG4A 5G04J 1DVPA 4N2QA 3AU5A 1FVFA 3JYSA 4GYWA 3SZ7A 3CK7A 2VGYA 4A3VA 5BUZA 4AP2A 3NZUA 1EYHA 4L23A 4U0SA 4XIFA 2XRZA 2FEZA 1H2UA 1Y8MA 2Y3AA 2X38A 2HR2A 2I1KA 4FC8A 3PNTB 5AIJA 3SHFA 5A6CA 4BX8A 3CVLA 3KS2A 2MOWA 3ESKA 3PE3A 3QKYA 4I2ZA 2KZTB 3FH5A 2YQ8A 2WXFA 3MGBA 3TL5A 4EBAA 2IJGX 2L9BA 3OTNA 5BV0A 3UT8A 5CCLA 3UMVA 3LXUX 2AWIA 4QFVA 3RJVA 4I1OB 3ZYMA 1KLXA 3T5VA 5KJKA 3TXNA 3UT4A 3MCXA 4M3OA 2LAIA 3MZLB 3ONLA 4ILIA 4KMOA 2FO7A 3JCKC 2WQHA 5D0QD 1W3BA 3PRZA 4I6EA 1BPOA 4GZ3A 4PH4B 3JQ0A 1XGWA 4GA1A 2VJ8A 2XQ0A 4I2WA 5BNWA 3FH8A 3FEYA 3FHEA 1H19A 3FTZA 3FUJA 2AVPA 3D9PA 4HOUA 2WPVA 3LDZA 3IBEA 5EDSA 4JXTA 3CVVA 1FVHA 5FQ6A 2J07A 4GA2A 4KVOA 5LCWJ 4APFA 1HU3A 1OUVA 3D9LA 3HHMA 3CQCB 4OYSA 3QARA 5FQ8A 4J8EA 3O48A 3QB2A 5FJYA 3ZN3A 4IRUA 3G2TA 1EPUA 4G26A 4G1TA 5FTPA 4DPRA 2WQ6A 2WXNA 2P58C 3TAXA 3RRMB 3G2VA 5KJMA 4EQFA 4ANWA 2FF4A 3T5XA 1HS6A 1WAO1 3OXLA 1L5JA 2ONDA 3MV2B 3LY9A 3ESLA 3GW4A 3SFZA 2KATA 3GZ1A 4WNEA 3FU5A 5T3RA 5FT9A 5E75A 3N71A 2UY1B 3ASHA 3L54A 3VLEA 2YNQA 3OAWA 4B94A 2VSYA 4TRQA 2R5SA 4GYYA 2Y4TA 4GU5A 3ZXSA 4CT0A 3R7RA 3RO3A 4KXKB 4AY6A 2UY1A 4GCNA 4NQ0A 2FBNA 1HG5A 3TG5A 4GMJA 4WWNA 3ONKA 4IULA 3CV0A 4KYOB 4AXHA 4WNFA 2WB2A 1OWPA 3PDNA 4B8AA 1H0AA 1B89A 3SNXA 1HXIA 3TJPA 3D9NA 3MEKA 3IHVA 2XHEA 3GZ2A 3GYZA 3FUMA 5T4YA 4Q94A 4ABNA 2WXOA 3FP3A 2AXUA 3CVPA 3LY7A 4YVQC 3APCA 2L0IA 3I4GA 3QOUA 1PC2A 4U0UA 4AIFA 1LF8A 4B0ZA 3PEVB 4XI0A 2C0MA 2CHXA 4F1SA 2WXLA 3G2WA 3MKQA 4XX5A 3B7TA 4GZ6A 4K0RA 3QWVA 5ARFA 4CDRA 5BT1A 5KJLA 2I2OA 3APDA 5J08A 1Z3XA 3U9WA 1SQMA 3EIJA 4MKTA 1HZ4A 3U66A 3S7JA 2CHZA 2KCVA 3FUDA 4J8DA 2KC7A 4ILGA 1KT1A 2WXQA 3Q47B 4MS6A 4R7LA 3AS5A 3ZPJA 2XRYA 5FQ7A 4C0MA 2M63A 2VGXB 3CK8A 3B7UX 4I1AA 3SI5A 3CVXA 4BT9A 3HVEA 4RG6A 2NXPA 1E8YA 2IQCA 2VGXA 1DNPA 2PZIA 3Q5MA 4TUUA 3PE4A 1OWMA 2R17C 3LJ3A 3Q15A 4G25A 1H2VC 3L16A 1HG2A 4G2VA 5AYWD 5A7DB 4TV3A 3NZSA 5G2NA 2AXVA 2IOLA 1PY1A 2UWJG 1OWLA 3LPZA 2J9QA 4ACKA 2A4ZA 4FJYA 3VLFA 2Y4UA 3G2SA 4FHKA 4ANXA 1INZA 3RO2A 4N2SA 2XGSA 2XPZA 3Q49B 3HVEB 3FTVA 2WQ7A 5G55A 2J4BA 2AXZA 5JJTA 4EPZA 4HOSA 1UJKA 2MRIA 4A1GA 1A17A 2MHKA 4J0UA 3FWVA 4WNGA 5DBKA 3DPDA 4G11A 3U4TA 4JHJA 3D9JA 3LYAA 2LSVA 3CR3A 4DK5A 5FZQA 2EQXA 1U3CA 2BUGA 4URKA 2OOEA 4WAFA 4I6GA 4CT4A 4AJWA 4FU3A 4G24A 3U3WA 5AJLA 1X5BA 4CDNA 4Y6WA 1MQSA 1MHQA 4LEUA 2WXIA 4LRZA 2L0TB 2XEVA 4APOA 3RIBA 4FADA 2J49A 2HO1A 2X6KA 2WXRA 3HIZA 3PVLA 4FA6A 3CVYA 3CKCA 4FLHA 4WWOA 4PS8A 4U0ZA 4UI9J 3FU0A 2YHCA 3URZA 2XGOA 4GB9A 5FWQA 2FI7A 3PREA 3SD5A 3CSTA 5JHAA 3RRUA 2OV8A 5LFAA 1TJFA 1NP7A 3VLDA 5A23A 2LO6A 3AS4A 4O6FA 3EHNA 5T8IA 4C0EA 3PH0C 1EDUA 4FHJA 3CHSA 2WXJA 5LCWC 5HQ8A 3RU0A 5LX8A 1UN9A 1YA0A 3RKVA 2Q7FA 2PQNA 4GAAA 4K03A 4AM9A 4A55A 3P2BA 5JJ6A 3FTSA 2X6FA 2CHWA 3LKUA 4CDMA 3CHRA 3ZVVA 3C98A 3QNKA 4U07A 4LCTA 5EX0A 4XE0A 2PM6A 4ANVA 4GCOA 2L6JA 5G05C 1IQUA 3EDTB 3QWWA 4UWHA 3RK6A 4HOQA 5C1DA 2WXGA 3CVWA 2VSXE 3B7RL 3MA5A 3I4RB 4UWGA 4BT8A 3FY4A 3BEEA 3B7SA 4IN3B 4ILHB 4WWPA 3L6AA 1ELKA 3EIQC 3IHYA 4EZJA 4U8HA 5BPPA 2VSOE 2HYZA 3G2UA 3FUFA 1EF1C 1ELRA 2XGMA 3PEUB 2A5UA 2J09A 3ASGA 5E76A 3MV3B 3Q4AB 4N3CA 4CGWA 2NC9A 2VQ2A 4JL0A 1HE8A 2IF4A 3FDHA 3R9AB 5G04C 4AOFA 3D9OA 3QK0A 4J8SA 3CHQA 2E2EA 3MX3A 3BG1B 4L2LA 2VSNA 2YINA 3ZYKA 1HF8A 3EJNA 4GYOA 4AEZC 5BW8C 4A1SA 3PS6A 1QZ2A 4HFGA 4JHRA 4YVOA 4BY6A 3I5PA 3CLJA 2DBAA 5AJDA 3S7BA 4XI9A 2X6JA 2WM9A 2XCBA 2IOSA 3FU6A 4NRHB 4U63A 4DI3A 4UWKA 3AU4A 3P1UA 3ASDA 3UQ3A 1E90A 1GW6A 4UQZA 4I6JA 3JQ1A 1UG3A 3L17A 1N52A 3LS8A 5M72A 3EHMA 4ME2A 3FU3A 4GA0A 2GRLA 3PNLB 4HXIA 1HFAA 3CHOA 3FTWA 4I1MA 4LUNU 3MYVA 4U04A 1HO8A 4JA9A 3ULQA 4EECA 3ZRHA 4J6IA 3FTXA 2XPYA 3D3MA 4JEHA 3VTYA 2DIWA 2X3MA 2X6HA 3LCAA 4HORA 3VTXA 1HH8A 2GGFA 1SZAA 3FUNA 3CK9A 2CFUA 3D9IA 3SGHA 2V4LA 4YNDA 2RD0A 2R59A 3FULA 4H7XA 5D0OD 4HOTA 3SBSA 4ANUA 3T8MA 3L13A 2PQRA 3CVNA 3NF1A 3UUXA 4F3VA 4E85A 1OWOA 3APFA 4OVUA 4Y6CA 5JHBA 4KZCA 2WXKA 3CHMA 3I3NA 3LVQE 2V0PA 3BG0B 3GZSA 1E8WA 4G23A 4UQYA 1Y6IA 3ZHEB 1NA3A 4EZLA 1UW4B 5JJ7A 3CSFA 2YHEA 4PS7A 3JUIA 4NURA 2WXMA 2ZU6B 3OXFA 3WXXA 4KBQA 3CHPA 1HX8A 1ELWA 3PUJA 3FEXA 1TJCA 3HYMB 1JWGA 1Z6TA 2IU1A 3ZEFA 2C0LA 2I1JA 3NQPA 4FULA 4XZ4A 4BSXA 4BTBA 1XNFA 5FQ4A 3RRNB 3U64A 4RG9A 3FUIA 3HDXA 4BFRA 1JWFA 4V3IA 4GZ5A 5BV1A 2FULA 3CVQA 3FUEA 3CEQA 2LAHA 4B89A 4UI9C 2KZTA 3CQGB 4CCAA 1E7VA 4GMLA 2I6HA 4JPSA 3KEZA 3UX4A 2I9CA 4UWLA 3CGHA 2WMOA 4JHKA 4EBAG 4DLQA 5EKQD 2JLBA 2WMNA 3ZIMA 4W9RA 2XPIA 5ARGA 4EZKA 4GZDA 3QDNA 3ZYLA 4MRUA 4UI9K 5FZSA 4DLOA 3ZYQA 2WXPA 1QQEA 1N54A 4Q96A 4F53A 3ENEA 3O4ZA 2C2LA 3FTYA 5CMYA 3FUKA 2NSZA 2V5FA 2CG3A 4ACLA 3UPVA 2HM8A 1TEZA 1U3DA 2J08A 4C9BB 3LEWA 4JW1A 5FZRA 4UQXA 5J90A 2VYIA 4L1BA 3PUKA 5CMWA 4XKBA 4E6HA 4PS3A 2PM7A 3MKRA 2QY7A 4F7AA 1H2TC 5EX3A 3S7FA 1JUQA 2KCLA 2OVBA 3D9KA 3FTUA 4KT6B 4LERA 4NACA 4WNDA 1QNFA 5KJNA 3S2AA 1FCHA 3QAQA 1NZNA 1E7UA 3DBSA 3K9IA 4JVSA 5CHEE 3UT7A 3L08A 3QWPA 3SBTB 1UJJA 1UN8A 1IQRA 3QJZA 4PUCA 2CFZA 4JA7A 2IONA 2WVIA 5HI7A 5ENNA 2E0IA 3ZHEA 3ML9A 4DJAA 4RVBA 2ILRA 4CEMA 3IKOB 4JC8A 2PL2A 2GRMA 4L7TA 1IYGA 4MLPA 1JPLA 4N5CA 3TXMA 5LP0A 1ZU2A 4GPKA 2OVFA 4IYPA 4H7YA 4BTAA 2BTDA 3AS8A 4Q69A 4GZCA 4ATGA 3QC1A 4BWRA 3KAEA 3ML8A 1ZBPA 2X6IA 3PZDA 2KM4A 3FH7A 3MKQB 3ZW3A 4N39A 3CVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YND A;  4J8E A;  1IHG A;  3O48 A;  4LEU A;  4Y6W A;  5FJY A;  3ZN3 A;  4G26 A;  5HQ8 A;  4G1T A;  4H7X A;  4J8F A;  5D0O D;  3ZGQ A;  5FTP A;  4HOT A;  2XEV A;  4APO A;  2P58 C;  3RIB A;  3TAX A;  2HO1 A;  2PQR A;  3CVN A;  3KD7 A;  3NF1 A;  3UUX A;  4EQF A;  4F3V A;  4CGV A;  5KJM A;  3IEG A;  2FF4 A;  5DIZ A;  1WM5 A;  4Y6C A;  3CKC A;  4UI9 J;  1WAO 1;  2XCC A;  4U0Z A;  3OXL A;  4AY5 A;  5C1D A;  3U3W A;  2YHC A;  4WUY A;  2XGO A;  2OND A;  3MV2 B;  3LY9 A;  3GW4 A;  4G23 A;  2FI7 A;  2KAT A;  3GZ1 A;  4UQY A;  3OXG A;  4WNE A;  4I9C A;  5FT9 A;  3ZHE B;  1NA3 A;  3N71 A;  2UY1 B;  3ASH A;  5JJ7 A;  3AS4 A;  4O6F A;  4B94 A;  2VSY A;  2R5S A;  1P5Q A;  2Y4T A;  4GYY A;  3OXF A;  4N3B A;  3ASF A;  4KBQ A;  3RO3 A;  3WXX A;  5LCW C;  1ELW A;  3E4B A;  4KXK B;  2UY1 A;  4GCN A;  1TJC A;  3HYM B;  4I17 A;  2FBN A;  4NQ0 A;  3RU0 A;  3TG5 A;  4I9E A;  5CCM A;  1YA0 A;  5G05 J;  3RKV A;  3CV0 A;  2C0L A;  2Q7F A;  4KYO B;  2PQN A;  4WNF A;  2KCK A;  3PDN A;  3ZFW A;  5JJ6 A;  4AM9 A;  1XNF A;  2LSU A;  5G05 C;  1B89 A;  2GW1 A;  4RG9 A;  1HXI A;  3FFL A;  4N3A A;  3CKB A;  3MEK A;  3S7D A;  4GZ5 A;  3LKU A;  3GZ2 A;  3TGO A;  3GYZ A;  1E96 B;  3CVQ A;  3CEQ A;  4ABN A;  3LY8 A;  3FP3 A;  4UI9 C;  4U07 A;  3CVP A;  3LY7 A;  4YVQ C;  2IFU A;  3ZPJ A;  1KT0 A;  5EX0 A;  2I6H A;  3SF4 A;  2QFC A;  3QOU A;  1PC2 A;  1NA0 A;  2L6J A;  2LNI A;  3EDT B;  4GCO A;  3QWW A;  2C0M A;  4U0U A;  4HOQ A;  4XI0 A;  5EKQ D;  5G04 J;  3URZ A;  4CDR A;  5BT1 A;  4GZ6 A;  2JLB A;  3QWV A;  5ARF A;  4N2Q A;  3MA5 A;  5KJL A;  3JYS A;  4BT8 A;  3BEE A;  2XPI A;  4W9R A;  4IN3 B;  5ARG A;  1HZ4 A;  4GYW A;  3QDN A;  3SZ7 A;  3CK7 A;  2VGY A;  3S7J A;  2KCV A;  4UI9 K;  5FZS A;  4AY6 A;  4J8D A;  2HYZ A;  1QQE A;  2KC7 A;  1ELR A;  2C2L A;  2XGM A;  3ASG A;  3UPV A;  1KT1 A;  2V5F A;  3Q47 B;  4U0S A;  3MV3 B;  3Q4A B;  3AS5 A;  4XIF A;  2FEZ A;  1Y8M A;  4N3C A;  2NC9 A;  2VQ2 A;  4JL0 A;  3R9A B;  2HR2 A;  2IF4 A;  4CGW A;  5G04 C;  5FZR A;  2VGX B;  3CK8 A;  4I1A A;  4UQX A;  5A6C A;  2VYI A;  3CVL A;  3KS2 A;  4BT9 A;  2E2E A;  3TG4 A;  4RG6 A;  3ESK A;  3PE3 A;  2VSN A;  3QKY A;  4GYO A;  2VGX A;  4I2Z A;  5BW8 C;  4A1S A;  2YQ8 A;  1QZ2 A;  4YVO A;  2PZI A;  3Q5M A;  4JHR A;  3PE4 A;  3MKR A;  2DBA A;  3S7B A;  3Q15 A;  4G25 A;  4XI9 A;  5CCL A;  5EX3 A;  2XCB A;  3RJV A;  3S7F A;  4NRH B;  4G2V A;  2KCL A;  5AYW D;  5A7D B;  1KLX A;  4WND A;  5KJN A;  2UWJ G;  3ASD A;  1FCH A;  3LPZ A;  1NZN A;  3K9I A;  3UQ3 A;  2J9Q A;  4UQZ A;  4BTB A;  5KJK A;  5CHE E;  3QWP A;  5M72 A;  2Y4U A;  4ME2 A;  4GA0 A;  2FO7 A;  4JA7 A;  3RO2 A;  2WQH A;  5HI7 A;  2XGS A;  3Q49 B;  5D0Q D;  4N2S A;  1W3B A;  4GZ3 A;  5JJT A;  3ZHE A;  4AIF A;  4GA1 A;  4HOS A;  2PL2 A;  4U04 A;  4JA9 A;  1IYG A;  4N5C A;  4I2W A;  3ULQ A;  1A17 A;  5BNW A;  2MHK A;  4GPK A;  1ZU2 A;  4J0U A;  3FWV A;  4H7Y A;  4BTA A;  3AS8 A;  4WNG A;  5DBK A;  2AVP A;  4HOU A;  3VTY A;  2WPV A;  3U4T A;  3LYA A;  2LSV A;  4BWR A;  3KAE A;  5FZQ A;  3LCA A;  1ZBP A;  4HOR A;  3VTX A;  4GA2 A;  5LCW J;  2BUG A;  1HH8 A;  2OOE A;  1OUV A;  3CK9 A;  4G24 A;  4N39 A; 
#chains in the Genus database with same CATH topology
 1IHG A;  4D10 C;  1H6K A;  3IV0 A;  3SO8 A;  3Q7F A;  5LOZ A;  4CGV A;  4RLY A;  4KVM A;  2VTB A;  4CRW A;  4WUY A;  3MJW A;  2DCP A;  4BX9 A;  4AVX A;  1V54 E;  3LVR E;  2BF0 X;  4HS2 A;  4HVB A;  5CCM A;  5AEN A;  4HB5 A;  2ZXW E;  4N2Q A;  3AJI A;  2VGY A;  3D9H A;  2Y1L E;  4L23 A;  1MX6 A;  2XRZ A;  2X38 A;  2HR2 A;  2I1K A;  4FC8 A;  4J7W A;  2MOW A;  5CER B;  3MGB A;  3RJV A;  4HNA D;  3Q9N C;  3HXF A;  3UT4 A;  3EU9 A;  4M3O A;  3MZL B;  3ONL A;  2FO7 A;  5D0Q D;  4I6E A;  1BPO A;  4GZ3 A;  4PH4 B;  1XGW A;  4GA1 A;  3FEY A;  1H19 A;  3FTZ A;  3D9P A;  1DC2 A;  3L82 A;  5FQ6 A;  2J07 A;  1OCO E;  4GA2 A;  5LCW J;  1TR4 A;  1HU3 A;  3CQC B;  4OYS A;  5ENO D;  4G1T A;  3UKU G;  2A5E A;  2FF4 A;  3SFZ A;  3R9M A;  1YCS B;  3ESL A;  3GW4 A;  3LY9 A;  3ASH A;  1LD7 A;  3OAW A;  4B94 A;  1FT2 A;  2VSY A;  4GU5 A;  2EIN E;  3ZXS A;  4DX2 A;  3R7R A;  3RO3 A;  1N11 A;  3CV0 A;  2WB2 A;  1OWP A;  1B89 A;  3SNX A;  1HXI A;  3X2Q E;  3IHV A;  4U8Y D;  2XHE A;  3FUM A;  4ABN A;  2GRN B;  2L0I A;  4TXQ A;  3ULY A;  3PEV B;  2C0M A;  3B7T A;  4GZ6 A;  4O1P A;  2ETC A;  3APD A;  3C3Q A;  5JMN D;  3U66 A;  2KC7 A;  4ILG A;  4CZ2 D;  3UM3 A;  1BI7 B;  2WXQ A;  4U96 D;  2GRP B;  1DNP A;  3ABK E;  1OWM A;  5ENT D;  2R17 C;  3LJ3 A;  4G25 A;  2V4H C;  1HG2 A;  4YDY A;  5A7D B;  4TV3 A;  3NZS A;  5G2N A;  3DXK G;  1PY1 A;  2UWJ G;  1D9S A;  2Y4U A;  3DSW A;  3RO2 A;  3Q49 B;  3V31 A;  2P9S G;  4HOS A;  4ATZ D;  5DBK A;  3DPD A;  4JHJ A;  3D9J A;  3CR3 A;  4QQI A;  2EQX A;  2BUG A;  2OOE A;  4BET A;  4CDN A;  2WXI A;  4LRZ A;  4N5Q A;  2XEV A;  4APO A;  2WXR A;  3HXC A;  1AWC B;  5HKP A;  4WWO A;  2XGO A;  3SD5 A;  3JXI A;  5A23 A;  1EDU A;  2WXJ A;  3UM0 A;  4K03 A;  3FTS A;  4K5A B;  3LKU A;  3ZVV A;  3QNK A;  1BU9 A;  5C1D A;  2VSX E;  5HRY A;  1D8E A;  3FY4 A;  5BPP A;  3FUF A;  1EF1 C;  5E76 A;  3ASG A;  3MV3 B;  3Q4A B;  4JD2 G;  4CGW A;  1HE8 A;  2IF4 A;  3UM2 A;  4B93 B;  3CHQ A;  3MX3 A;  2YIN A;  4AEZ C;  2L6B A;  3EJN A;  3Q9U C;  4GYO A;  3PS6 A;  1QZ2 A;  4HFG A;  4YVO A;  4GTQ A;  2X6J A;  3ABM E;  4NRH B;  4U63 A;  3P1U A;  3ASD A;  3UQ3 A;  3JQ1 A;  5H7P A;  3EHM A;  3FU3 A;  3UXG A;  4BER A;  3PNL B;  3CHO A;  2IO2 C;  1K1A A;  1HO8 A;  3ZKJ A;  3ULQ A;  4EEC A;  4J6I A;  2DYS E;  3FTX A;  3D3M A;  2X6H A;  4HOR A;  1HH8 A;  3BQO A;  2GGF A;  2ZIS A;  2CFU A;  3D9I A;  3SGH A;  4YND A;  3DSV A;  2R59 A;  3FUL A;  3EUV A;  4ANU A;  1A5E A;  3UUX A;  4F3V A;  2H6G A;  1OWO A;  3UKR G;  3LVQ E;  4G23 A;  3ZHE B;  3J5Q B;  2YHE A;  1S63 A;  2XZD G;  1QYM A;  3OXF A;  5FIO A;  3KSL A;  4KBQ A;  3WXX A;  3PUJ A;  2RFA A;  1Z6T A;  3TWW A;  4FUL A;  4XZ4 A;  1XNF A;  3RRN B;  5BV1 A;  3FUE A;  3CEQ A;  4UI9 C;  2KZT A;  1E7V A;  1O1R A;  4GTR A;  4JHK A;  3C3R A;  2WMN A;  4W9R A;  2VGE A;  4F53 A;  4TXR A;  2CG3 A;  1U3D A;  3L9T A;  4C9B B;  5J90 A;  2VYI A;  2BKK B;  2ETA A;  2QYU A;  3NB2 A;  2QY7 A;  5AQ9 A;  4LNG A;  2R05 A;  1RZ4 A;  3UIN C;  3AAA C;  1JUQ A;  2OVB A;  3FTU A;  4WND A;  1FCH A;  4JVS A;  3QJZ A;  3Q78 A;  5CBN A;  3ZU7 B;  4RVB A;  4CEM A;  2ILR A;  3IKO B;  4L7T A;  1JPL A;  4O60 A;  2R02 A;  3QC1 A;  3ML8 A;  5B1B E;  2X6I A;  2KM4 A;  3CVU A;  4AV7 A;  4I43 A;  4C48 B;  5C2Y A;  2XCC A;  4AY5 A;  4JZY A;  1SZ9 A;  2FO1 E;  1VDY A;  2AW6 A;  4N3B A;  5AN8 A;  2J4D A;  2WXH A;  2MYO A;  4KZ0 A;  4RSY A;  3R7Q A;  2RG8 A;  4N3A A;  5ANR A;  3S7D A;  3PZ2 A;  2IFU A;  3SF4 A;  4OVV A;  2LNI A;  1NA0 A;  1Z3Y A;  3FUH A;  3TG4 A;  2RKK A;  3ZNG A;  1FVF A;  3SZ7 A;  4A3V A;  5BUZ A;  4AP2 A;  2PNN A;  4JB8 P;  4DUI A;  1Z5S C;  2R03 A;  5A6C A;  3CVL A;  1S70 B;  3QKY A;  3FH5 A;  2YQ8 A;  3TL5 A;  2QC9 A;  3OTN A;  5CCL A;  3LXU X;  3ASO E;  3T5V A;  1G3N B;  1JCR A;  2LAI A;  5CEC B;  3DPY A;  2WQH A;  3F6Q A;  1W3B A;  3PRZ A;  1TNB A;  2VJ8 A;  2XQ0 A;  2V5Q C;  1BD8 A;  4JXT A;  3HXD A;  4APF A;  4J8E A;  2ZGG A;  4IRU A;  3G2T A;  4G26 A;  4HI8 A;  1N94 A;  2WXN A;  3TAX A;  3G2V A;  4ANW A;  1SA5 A;  4ZHB A;  1WAO 1;  3GZ1 A;  4WNE A;  3FU5 A;  5T3R A;  5FT9 A;  4TRQ A;  4CT0 A;  4GYY A;  2Y4T A;  4GTT A;  5ITZ F;  3UI2 A;  2FBN A;  1HG5 A;  4U8V D;  4GMJ A;  4WWN A;  4KYO B;  4AXH A;  3PDN A;  4G8K A;  3V79 K;  3D9N A;  1X81 A;  3LY7 A;  3QOU A;  4B0Z A;  1LF8 A;  3G2W A;  4K0R A;  1KZO A;  2I2O A;  1SQM A;  3EIJ A;  4MKT A;  1HZ4 A;  3FUD A;  4J8D A;  1TNU A;  2Y69 E;  3Q47 B;  3AS5 A;  3ZPJ A;  2XRY A;  5FQ7 A;  4C0M A;  2M63 A;  3B7U X;  4BT9 A;  3KEA A;  2VGX A;  4XEI G;  3TWQ A;  2PZI A;  3Q5M A;  4TUU A;  3PE4 A;  3Q79 A;  5AYW D;  3V2X A;  2AXV A;  4NIK A;  1OWL A;  2J9Q A;  2JAB A;  4N2S A;  5G55 A;  2J4B A;  4EPZ A;  3LJN A;  1RW2 A;  2MHK A;  4HBD A;  4WNG A;  3J5P A;  4DK5 A;  3ASN E;  5FZQ A;  1U3C A;  4WAF A;  4I6G A;  4CT4 A;  4AJW A;  3U3W A;  1X5B A;  2KXP C;  4HRL A;  2L0T B;  4F6R D;  4UI9 J;  1N0Q A;  5AQ7 A;  3UM1 A;  3FU0 A;  4GB9 A;  2LO6 A;  3AS4 A;  3BU8 A;  4O6F A;  3EHN A;  5KNG A;  3CHS A;  1MZC A;  1N9A A;  5LX8 A;  4BSZ B;  3RKV A;  2H6H A;  4AM9 A;  1WG0 A;  1O5M A;  2X6F A;  2CHW A;  4CDM A;  4U95 D;  4GCO A;  1IQU A;  3CVW A;  1O1T A;  3B7R L;  4BT8 A;  4IN3 B;  4WWP A;  1ELK A;  3EIQ C;  4EZJ A;  4U8H A;  2HYZ A;  1SW6 A;  2P9I G;  2VQ2 A;  4JL0 A;  3FDH A;  4AOF A;  5G04 C;  4J8S A;  4L2L A;  4JHR A;  4BY6 A;  3I5P A;  1OCZ E;  1H6P A;  3AU4 A;  4I6J A;  3LS8 A;  1N52 A;  4HXI A;  2J8S D;  1N0R A;  1AP7 A;  3FTW A;  4BEP A;  4I1M A;  1ZB1 A;  2XPY A;  5AQB A;  2DIW A;  3FUN A;  3CK9 A;  2V4L A;  2RD0 A;  4GTV A;  4HOT A;  3SBS A;  3L13 A;  3DSU A;  1WDY A;  3SY2 A;  4Y6C A;  4OVU A;  5JHB A;  4KZC A;  3I3N A;  2V0P A;  3E34 A;  1E8W A;  4UQY A;  4EZL A;  5JJ7 A;  3JUI A;  2ZU6 B;  1HX8 A;  5D2M C;  1JWG A;  1JCS A;  2P2C P;  2C0L A;  2I1J A;  4RG9 A;  4BFR A;  1JWF A;  1IHB A;  4V3I A;  4HRM B;  2LUH A;  4CCA A;  2B0O E;  2I6H A;  3UX4 A;  2I9C A;  4UWL A;  3CGH A;  4DLQ A;  4GZD A;  4MRU A;  4UI9 K;  3EU5 A;  3IXE A;  4ACL A;  3FUK A;  5FZR A;  4UQX A;  4A63 B;  5CMW A;  3DWL G;  1BLX B;  4E6H A;  4PS3 A;  3EHR A;  1V55 E;  2PM7 A;  1SA4 A;  3C3O A;  5EX3 A;  4KT6 B;  4LER A;  4NAC A;  5KJN A;  5CBO A;  4GMR A;  4TXP A;  5CHE E;  3QWP A;  3SBT B;  1UN8 A;  5CEA A;  2ION A;  2WVI A;  2ZGD A;  5ENN A;  4GTS A;  3ZHE A;  3TXM A;  2OVF A;  4IYP A;  4BTA A;  4YDE A;  2EIL E;  3FH7 A;  5FIN A;  2QYJ A;  3ZW3 A;  1E8Z A;  3ZGQ A;  4XKC A;  1LTX A;  5DIZ A;  1WM5 A;  4TUM A;  4I9C A;  2JEK A;  5IY5 E;  3ASF A;  2V8S E;  4P29 A;  2F8X K;  4I9E A;  4FP7 A;  2KCK A;  4HLE A;  3B13 A;  3CKB A;  3D9M A;  3TGO A;  5KBA A;  4L2Y A;  4FLB A;  1KT0 A;  5KCM A;  3DST A;  1DVP A;  3AU5 A;  3JYS A;  1IKN D;  2DZN A;  3W9F A;  4X8Q A;  4GYW A;  3CK7 A;  2ETB A;  4U0S A;  1H2U A;  3TWX A;  2Y3A A;  5AIJ A;  3PNT B;  4BX8 A;  3KS2 A;  3ESK A;  3PE3 A;  2KZT B;  1U2V G;  2WXF A;  4EBA A;  3PZ1 A;  2L9B A;  3E30 A;  3UT8 A;  3UMV A;  2AWI A;  4QFV A;  1KLX A;  5KJK A;  3MCX A;  4ILI A;  2Y0B G;  5AAR A;  3JCK C;  2EIK E;  3JQ0 A;  5ENR D;  2IEJ A;  5BNW A;  3TWU A;  2XEE A;  2AVP A;  4HOU A;  2WPV A;  3LDZ A;  3CVV A;  1FVH A;  5FQ8 A;  3HHM A;  3QAR A;  3O48 A;  3QB2 A;  5FJY A;  1EPU A;  3RRM B;  3ULE G;  4EQF A;  3AG3 E;  1HS6 A;  2OND A;  2KAT A;  2LXM A;  3N71 A;  2UY1 B;  3VLE A;  1NFI E;  4KXK B;  4GCN A;  5EID A;  4WNF A;  4HRN A;  3TJP A;  5T4Y A;  4Q94 A;  3FP3 A;  3C72 A;  3APC A;  3I4G A;  4U0U A;  4YDO A;  4XI0 A;  2B6C A;  2CHX A;  2WXL A;  4CDR A;  4XX5 A;  5BT1 A;  3ISM C;  5J08 A;  1N4R A;  2KCV A;  2RFM A;  2H6I A;  3WG7 E;  1KT1 A;  3CK8 A;  3CVX A;  2IQC A;  3V30 A;  1D8D A;  4G2V A;  3Q7A A;  3G2S A;  4ANX A;  2XGS A;  2XPZ A;  4LNU D;  3SFX A;  5JJT A;  3FWV A;  4DX6 D;  3U4T A;  3LYA A;  2DVW A;  4LNB A;  1N4S A;  5AJL A;  1TN8 A;  4HLL A;  2LXL A;  4LEU A;  4Y6W A;  2P9P G;  3RIB A;  3HIZ A;  3Q75 A;  4FA6 A;  1TN7 A;  2EIJ E;  4DX5 D;  3CKC A;  4PS8 A;  4U0Z A;  4CYM D;  5D66 A;  3URZ A;  5FWQ A;  3PRE A;  3RRU A;  2OV8 A;  5LFA A;  1TJF A;  1NP7 A;  2QZA A;  5T8I A;  3PH0 C;  5LCW C;  3RU0 A;  2Q7F A;  2PQN A;  4GAA A;  4A55 A;  3P2B A;  3RSE G;  3AG2 E;  3C98 A;  2XEH A;  4LCT A;  5KNH D;  4L9P A;  2DZO A;  5G05 C;  4UWH A;  4HOQ A;  2WXG A;  3MA5 A;  2F37 A;  3B7S A;  4ILH B;  3L6A A;  4ZFH A;  3IHY A;  2VSO E;  4OAU C;  1ELR A;  2XGM A;  3PEU B;  5EN5 D;  4N3C A;  3R9A B;  3BG1 B;  3ZYK A;  5BW8 C;  4A1S A;  1DCE A;  5CRV A;  5AJD A;  1TNY A;  4XI9 A;  2WM9 A;  2XCB A;  3FU6 A;  4DI3 A;  4UWK A;  1GW6 A;  1UG3 A;  1TNZ A;  3AG1 E;  4OAV B;  4U04 A;  3ZRH A;  3VTY A;  1OCR E;  2X3M A;  3VTX A;  1SZA A;  2DYR E;  3T8M A;  2PQR A;  3CVN A;  3C5R A;  4E85 A;  3APF A;  1MYO A;  3GZS A;  2GRR B;  1NA3 A;  1UW4 B;  1TYQ G;  4PS7 A;  2WXM A;  3FEX A;  3HYM B;  3ZEF A;  5BXO A;  3FUI A;  3HDX A;  4M7C A;  4GZ5 A;  2FUL A;  2LAH A;  4B89 A;  4GML A;  4JPS A;  3KEZ A;  2KBX A;  4EBA G;  5EKQ D;  2OEW A;  3NAW A;  2JLB A;  5EYP F;  3QDN A;  3ZYL A;  1QQE A;  3ENE A;  3UPV A;  2NSZ A;  2V5F A;  2HM8 A;  3NOG D;  1TEZ A;  1KZP A;  2J08 A;  5EIB E;  3LEW A;  4JW1 A;  1MX2 A;  3PUK A;  3DEO A;  3UIO C;  2BED A;  1NL4 A;  4EHM A;  4F7A A;  1H2T C;  3S7F A;  1QNF A;  3QAQ A;  1NZN A;  5B1A E;  4J8Y A;  3UT7 A;  4GTM A;  3L08 A;  3JUE A;  1IQR A;  4RQI A;  1N4Q A;  3DSS A;  2PL2 A;  1IYG A;  4H7Y A;  4Q69 A;  4ATG A;  4F1P A;  4LSZ E;  4BWR A;  3KAE A;  3NOC D;  3MKQ B;  3PZ4 A;  4DRX E;  4N39 A;  2OEV A;  4J8F A;  5ANL A;  4JEU A;  2VTB B;  4FJZ A;  3KD7 A;  4B8C B;  3IEG A;  3CIA A;  3OXG A;  1N4P A;  4Z68 A;  1S0P A;  4UWF A;  1E8X A;  1P5Q A;  2P9N G;  3E4B A;  4A3T A;  1OWN A;  4I17 A;  1FT1 A;  1K1B A;  5G05 J;  3ZFW A;  2LSU A;  2GW1 A;  5KWD A;  1PAQ A;  3FFL A;  4DI4 A;  1E96 B;  3LY8 A;  3L22 A;  2CG2 A;  4HI9 A;  3T9K A;  1WY6 A;  4PDX A;  2QFC A;  3NBN B;  2H6F A;  3B7B A;  1DCQ A;  5G04 J;  2P9K G;  3NZU A;  1EYH A;  4XIF A;  2FEZ A;  1Y8M A;  2F0Y A;  2OCC E;  3TWS A;  2EIM E;  4LG6 A;  3SHF A;  4I2Z A;  2IJG X;  5BV0 A;  2F8Y A;  4I1O B;  3ZYM A;  5AAO A;  3TXN A;  4KMO A;  3E37 A;  3HRA A;  4I2W A;  3FH8 A;  3FHE A;  4O1O A;  3FUJ A;  5EIL A;  3IBE A;  5EDS A;  4KVO A;  5ENQ D;  1OUV A;  3D9L A;  3ZN3 A;  2DWZ A;  5FTP A;  4GTO A;  4DPR A;  2WQ6 A;  2P58 C;  5KJM A;  3T5X A;  3OXL A;  1L5J A;  1S64 A;  3RAU A;  3MV2 B;  5E75 A;  3L54 A;  2YNQ A;  2R5S A;  1QBQ A;  1MX4 A;  5CRU A;  2ZIR A;  4AY6 A;  2UY1 A;  4NQ0 A;  3TG5 A;  3ONK A;  4IUL A;  2HE0 A;  3HXE A;  4B8A A;  1H0A A;  2XS8 A;  3KSQ A;  1H6O A;  3MEK A;  3GZ2 A;  3GYZ A;  1JCQ A;  2WXO A;  3DEP A;  1YMP A;  2AXU A;  3CVP A;  4YVQ C;  1PC2 A;  4AIF A;  4F1S A;  5CED B;  3UTM A;  3MKQ A;  5ARF A;  3QWV A;  1O1S A;  5KJL A;  1Z3X A;  4G8L A;  3U9W A;  3S7J A;  2CHZ A;  1KPS B;  2NYJ A;  4MS6 A;  4R7L A;  2VGX B;  4I1A A;  1YYH A;  3SI5 A;  3HVE A;  3E32 A;  2NXP A;  1E8Y A;  4RG6 A;  3ZUV B;  3Q15 A;  1H2V C;  3L16 A;  2IOL A;  3LPZ A;  1IXV A;  4ACK A;  5HS0 A;  2A4Z A;  4FJY A;  3VLF A;  4FHK A;  3BUA A;  2XZT G;  1INZ A;  1N95 A;  3HVE B;  3FTV A;  2WQ7 A;  2AXZ A;  5JA4 D;  1K8K G;  1UJK A;  2XS1 A;  3ABL E;  2MRI A;  5AQA A;  4A1G A;  1A17 A;  3V2O A;  4J0U A;  4G11 A;  2LSV A;  1LD8 A;  4UUC A;  2R2L A;  4URK A;  4FU3 A;  4G24 A;  1MQS A;  1MHQ A;  3UIP C;  4FAD A;  2J49 A;  2HO1 A;  2X6K A;  3PVL A;  3CVY A;  4FLH A;  2YHC A;  2FI7 A;  3CST A;  5JHA A;  3VLD A;  3B95 A;  1K3Z D;  1MJ0 A;  3HXB A;  4BES A;  4C0E A;  4FHJ A;  5HQ8 A;  1OT8 A;  1UN9 A;  1YA0 A;  2IO3 C;  5JJ6 A;  3SQV A;  3CHR A;  4GTP A;  4U07 A;  5EX0 A;  4XE0 A;  2PM6 A;  4ANV A;  2L6J A;  3EDT B;  3QWW A;  3RK6 A;  3DXM G;  3I4R B;  4UWG A;  3BEE A;  1TN6 A;  3DSX A;  3G2U A;  5B3S E;  2A5U A;  2J09 A;  3AG4 E;  2NC9 A;  3D9O A;  3QK0 A;  3TWR A;  3ZXP A;  1BI8 B;  2E2E A;  2VSN A;  1HF8 A;  3DRA A;  1OXJ A;  5ENP D;  2GRQ B;  3CLJ A;  2DBA A;  3S7B A;  2IOS A;  1E90 A;  4UQZ A;  3L17 A;  5M72 A;  1OY3 D;  4ME2 A;  4GA0 A;  2GRL A;  3EHQ A;  1HFA A;  1NI1 A;  4LUN U;  2IY0 C;  3MYV A;  4JA9 A;  4JEH A;  3LCA A;  2P9L G;  3JXJ A;  4H7X A;  5D0O D;  3NF1 A;  2WXK A;  1SVX A;  3CHM A;  3T8K A;  3BG0 B;  1Y6I A;  2BKG A;  3CSF A;  4NUR A;  3CHP A;  1ELW A;  1TJC A;  1UOH A;  4K5B A;  2IU1 A;  4BTB A;  3NQP A;  1FPP A;  4BSX A;  5FQ4 A;  3U64 A;  4MBG A;  2XEN A;  3CVQ A;  3CQG B;  4GPM A;  3PZ3 A;  5EYL A;  2WMO A;  3ZIM A;  4YDW A;  1OCC E;  2XPI A;  3W9G A;  5ARG A;  4EZK A;  1Q2Z A;  5FZS A;  4DLO A;  3ZYQ A;  2WXP A;  4Q96 A;  1N54 A;  3O4Z A;  2C2L A;  3FTY A;  5CMY A;  4HQD A;  5BXU A;  4L1B A;  1TNO A;  4XKB A;  4DX1 A;  3SFY A;  3MKR A;  4K5C A;  3Q73 A;  2KCL A;  3D9K A;  3HG0 D;  3TWV A;  3S2A A;  3K9I A;  1E7U A;  3DBS A;  3TWT A;  1UJJ A;  5ENS D;  4PUC A;  2CFZ A;  4JA7 A;  5HI7 A;  2E0I A;  3ML9 A;  4DJA A;  4JC8 A;  2GRM A;  4U7E B;  4MLP A;  4N5C A;  2GRO B;  5LP0 A;  3E33 A;  1ZU2 A;  2P9U G;  4GPK A;  2BTD A;  3AS8 A;  4GZC A;  4DX7 D;  1ZBP A;  3PZD A;  2AJA A; 
#chains in the Genus database with same CATH homology
 4AV7 A;  1IHG A;  4J8F A;  1E8Z A;  3ZGQ A;  4I43 A;  4D10 C;  5ANL A;  4JEU A;  1H6K A;  4XKC A;  2VTB B;  4FJZ A;  3IV0 A;  3KD7 A;  5LOZ A;  4B8C B;  4CGV A;  3IEG A;  5DIZ A;  5C2Y A;  1WM5 A;  3CIA A;  4KVM A;  2XCC A;  4AY5 A;  2VTB A;  4CRW A;  4WUY A;  4JZY A;  3MJW A;  2DCP A;  4BX9 A;  1SZ9 A;  4AVX A;  3OXG A;  4I9C A;  2JEK A;  1S0P A;  1VDY A;  4UWF A;  2AW6 A;  1E8X A;  3LVR E;  4N3B A;  1P5Q A;  2BF0 X;  4HS2 A;  3ASF A;  2V8S E;  2J4D A;  3E4B A;  4P29 A;  2WXH A;  4A3T A;  1OWN A;  4I17 A;  4HVB A;  4KZ0 A;  4I9E A;  4RSY A;  5CCM A;  5G05 J;  5AEN A;  4FP7 A;  3R7Q A;  3ZFW A;  2KCK A;  2RG8 A;  4HLE A;  2LSU A;  2GW1 A;  3B13 A;  1PAQ A;  3FFL A;  4N3A A;  3CKB A;  5ANR A;  4DI4 A;  3S7D A;  3D9M A;  3TGO A;  1E96 B;  3LY8 A;  4L2Y A;  3L22 A;  2CG2 A;  2IFU A;  4FLB A;  1KT0 A;  1WY6 A;  4PDX A;  4OVV A;  2QFC A;  3SF4 A;  1Z3Y A;  1NA0 A;  2LNI A;  3FUH A;  5KCM A;  3TG4 A;  5G04 J;  1DVP A;  4N2Q A;  3AU5 A;  1FVF A;  3JYS A;  4GYW A;  3SZ7 A;  3CK7 A;  2VGY A;  4A3V A;  5BUZ A;  4AP2 A;  3NZU A;  1EYH A;  4L23 A;  4U0S A;  4XIF A;  2XRZ A;  2FEZ A;  1H2U A;  1Y8M A;  2Y3A A;  2X38 A;  2HR2 A;  2I1K A;  4FC8 A;  3PNT B;  5AIJ A;  3SHF A;  5A6C A;  4BX8 A;  3CVL A;  3KS2 A;  2MOW A;  3ESK A;  3PE3 A;  3QKY A;  4I2Z A;  2KZT B;  3FH5 A;  2YQ8 A;  2WXF A;  3MGB A;  3TL5 A;  4EBA A;  2IJG X;  2L9B A;  3OTN A;  5BV0 A;  3UT8 A;  5CCL A;  3UMV A;  3LXU X;  2AWI A;  4QFV A;  3RJV A;  4I1O B;  3ZYM A;  1KLX A;  3T5V A;  5KJK A;  3TXN A;  3UT4 A;  3MCX A;  4M3O A;  2LAI A;  3MZL B;  3ONL A;  4ILI A;  4KMO A;  2FO7 A;  3JCK C;  2WQH A;  5D0Q D;  1W3B A;  3PRZ A;  4I6E A;  1BPO A;  4GZ3 A;  4PH4 B;  3JQ0 A;  1XGW A;  4GA1 A;  2VJ8 A;  2XQ0 A;  4I2W A;  5BNW A;  3FH8 A;  3FEY A;  3FHE A;  1H19 A;  3FTZ A;  3FUJ A;  2AVP A;  3D9P A;  4HOU A;  2WPV A;  3LDZ A;  3IBE A;  5EDS A;  4JXT A;  3CVV A;  1FVH A;  5FQ6 A;  2J07 A;  4GA2 A;  4KVO A;  5LCW J;  4APF A;  1HU3 A;  1OUV A;  3D9L A;  3HHM A;  3CQC B;  4OYS A;  3QAR A;  5FQ8 A;  4J8E A;  3O48 A;  3QB2 A;  5FJY A;  3ZN3 A;  4IRU A;  3G2T A;  1EPU A;  4G26 A;  4G1T A;  5FTP A;  4DPR A;  2WQ6 A;  2WXN A;  2P58 C;  3TAX A;  3RRM B;  3G2V A;  5KJM A;  4EQF A;  4ANW A;  2FF4 A;  3T5X A;  1HS6 A;  1WAO 1;  3OXL A;  1L5J A;  2OND A;  3MV2 B;  3LY9 A;  3ESL A;  3GW4 A;  3SFZ A;  2KAT A;  3GZ1 A;  4WNE A;  3FU5 A;  5T3R A;  5FT9 A;  5E75 A;  3N71 A;  2UY1 B;  3ASH A;  3L54 A;  3VLE A;  2YNQ A;  3OAW A;  4B94 A;  2VSY A;  4TRQ A;  2R5S A;  4GYY A;  2Y4T A;  4GU5 A;  3ZXS A;  4CT0 A;  3R7R A;  3RO3 A;  4KXK B;  4AY6 A;  2UY1 A;  4GCN A;  4NQ0 A;  2FBN A;  1HG5 A;  3TG5 A;  4GMJ A;  4WWN A;  3ONK A;  4IUL A;  3CV0 A;  4KYO B;  4AXH A;  4WNF A;  2WB2 A;  1OWP A;  3PDN A;  4B8A A;  1H0A A;  1B89 A;  3SNX A;  1HXI A;  3TJP A;  3D9N A;  3MEK A;  3IHV A;  2XHE A;  3GZ2 A;  3GYZ A;  3FUM A;  5T4Y A;  4Q94 A;  4ABN A;  2WXO A;  3FP3 A;  2AXU A;  3CVP A;  3LY7 A;  4YVQ C;  3APC A;  2L0I A;  3I4G A;  3QOU A;  1PC2 A;  4U0U A;  4AIF A;  1LF8 A;  4B0Z A;  3PEV B;  4XI0 A;  2C0M A;  2CHX A;  4F1S A;  2WXL A;  3G2W A;  3MKQ A;  4XX5 A;  3B7T A;  4GZ6 A;  4K0R A;  3QWV A;  5ARF A;  4CDR A;  5BT1 A;  5KJL A;  2I2O A;  3APD A;  5J08 A;  1Z3X A;  3U9W A;  1SQM A;  3EIJ A;  4MKT A;  1HZ4 A;  3U66 A;  3S7J A;  2CHZ A;  2KCV A;  3FUD A;  4J8D A;  2KC7 A;  4ILG A;  1KT1 A;  2WXQ A;  3Q47 B;  4MS6 A;  4R7L A;  3AS5 A;  3ZPJ A;  2XRY A;  5FQ7 A;  4C0M A;  2M63 A;  2VGX B;  3CK8 A;  3B7U X;  4I1A A;  3SI5 A;  3CVX A;  4BT9 A;  3HVE A;  4RG6 A;  2NXP A;  1E8Y A;  2IQC A;  2VGX A;  1DNP A;  2PZI A;  3Q5M A;  4TUU A;  3PE4 A;  1OWM A;  2R17 C;  3LJ3 A;  3Q15 A;  4G25 A;  1H2V C;  3L16 A;  1HG2 A;  4G2V A;  5AYW D;  5A7D B;  4TV3 A;  3NZS A;  5G2N A;  2AXV A;  2IOL A;  1PY1 A;  2UWJ G;  1OWL A;  3LPZ A;  2J9Q A;  4ACK A;  2A4Z A;  4FJY A;  3VLF A;  2Y4U A;  3G2S A;  4FHK A;  4ANX A;  1INZ A;  3RO2 A;  4N2S A;  2XGS A;  2XPZ A;  3Q49 B;  3HVE B;  3FTV A;  2WQ7 A;  5G55 A;  2J4B A;  2AXZ A;  5JJT A;  4EPZ A;  4HOS A;  1UJK A;  2MRI A;  4A1G A;  1A17 A;  2MHK A;  4J0U A;  3FWV A;  4WNG A;  5DBK A;  3DPD A;  4G11 A;  3U4T A;  4JHJ A;  3D9J A;  3LYA A;  2LSV A;  3CR3 A;  4DK5 A;  5FZQ A;  2EQX A;  1U3C A;  2BUG A;  4URK A;  2OOE A;  4WAF A;  4I6G A;  4CT4 A;  4AJW A;  4FU3 A;  4G24 A;  3U3W A;  5AJL A;  1X5B A;  4CDN A;  4Y6W A;  1MQS A;  1MHQ A;  4LEU A;  2WXI A;  4LRZ A;  2L0T B;  2XEV A;  4APO A;  3RIB A;  4FAD A;  2J49 A;  2HO1 A;  2X6K A;  2WXR A;  3HIZ A;  3PVL A;  4FA6 A;  3CVY A;  3CKC A;  4FLH A;  4WWO A;  4PS8 A;  4U0Z A;  4UI9 J;  3FU0 A;  2YHC A;  3URZ A;  2XGO A;  4GB9 A;  5FWQ A;  2FI7 A;  3PRE A;  3SD5 A;  3CST A;  5JHA A;  3RRU A;  2OV8 A;  5LFA A;  1TJF A;  1NP7 A;  3VLD A;  5A23 A;  2LO6 A;  3AS4 A;  4O6F A;  3EHN A;  5T8I A;  4C0E A;  3PH0 C;  1EDU A;  4FHJ A;  3CHS A;  2WXJ A;  5LCW C;  5HQ8 A;  3RU0 A;  5LX8 A;  1UN9 A;  1YA0 A;  3RKV A;  2Q7F A;  2PQN A;  4GAA A;  4K03 A;  4AM9 A;  4A55 A;  3P2B A;  5JJ6 A;  3FTS A;  2X6F A;  2CHW A;  3LKU A;  4CDM A;  3CHR A;  3ZVV A;  3C98 A;  3QNK A;  4U07 A;  4LCT A;  5EX0 A;  4XE0 A;  2PM6 A;  4ANV A;  4GCO A;  2L6J A;  5G05 C;  1IQU A;  3EDT B;  3QWW A;  4UWH A;  3RK6 A;  4HOQ A;  5C1D A;  2WXG A;  3CVW A;  2VSX E;  3B7R L;  3MA5 A;  3I4R B;  4UWG A;  4BT8 A;  3FY4 A;  3BEE A;  3B7S A;  4IN3 B;  4ILH B;  4WWP A;  3L6A A;  1ELK A;  3EIQ C;  3IHY A;  4EZJ A;  4U8H A;  5BPP A;  2VSO E;  2HYZ A;  3G2U A;  3FUF A;  1EF1 C;  1ELR A;  2XGM A;  3PEU B;  2A5U A;  2J09 A;  3ASG A;  5E76 A;  3MV3 B;  3Q4A B;  4N3C A;  4CGW A;  2NC9 A;  2VQ2 A;  4JL0 A;  1HE8 A;  2IF4 A;  3FDH A;  3R9A B;  5G04 C;  4AOF A;  3D9O A;  3QK0 A;  4J8S A;  3CHQ A;  2E2E A;  3MX3 A;  3BG1 B;  4L2L A;  2VSN A;  2YIN A;  3ZYK A;  1HF8 A;  3EJN A;  4GYO A;  4AEZ C;  5BW8 C;  4A1S A;  3PS6 A;  1QZ2 A;  4HFG A;  4JHR A;  4YVO A;  4BY6 A;  3I5P A;  3CLJ A;  2DBA A;  5AJD A;  3S7B A;  4XI9 A;  2X6J A;  2WM9 A;  2XCB A;  2IOS A;  3FU6 A;  4NRH B;  4U63 A;  4DI3 A;  4UWK A;  3AU4 A;  3P1U A;  3ASD A;  3UQ3 A;  1E90 A;  1GW6 A;  4UQZ A;  4I6J A;  3JQ1 A;  1UG3 A;  3L17 A;  1N52 A;  3LS8 A;  5M72 A;  3EHM A;  4ME2 A;  3FU3 A;  4GA0 A;  2GRL A;  3PNL B;  4HXI A;  1HFA A;  3CHO A;  3FTW A;  4I1M A;  4LUN U;  3MYV A;  4U04 A;  1HO8 A;  4JA9 A;  3ULQ A;  4EEC A;  3ZRH A;  4J6I A;  3FTX A;  2XPY A;  3D3M A;  4JEH A;  3VTY A;  2DIW A;  2X3M A;  2X6H A;  3LCA A;  4HOR A;  3VTX A;  1HH8 A;  2GGF A;  1SZA A;  3FUN A;  3CK9 A;  2CFU A;  3D9I A;  3SGH A;  2V4L A;  4YND A;  2RD0 A;  2R59 A;  3FUL A;  4H7X A;  5D0O D;  4HOT A;  3SBS A;  4ANU A;  3T8M A;  3L13 A;  2PQR A;  3CVN A;  3NF1 A;  3UUX A;  4F3V A;  4E85 A;  1OWO A;  3APF A;  4OVU A;  4Y6C A;  5JHB A;  4KZC A;  2WXK A;  3CHM A;  3I3N A;  3LVQ E;  2V0P A;  3BG0 B;  3GZS A;  1E8W A;  4G23 A;  4UQY A;  1Y6I A;  3ZHE B;  1NA3 A;  4EZL A;  1UW4 B;  5JJ7 A;  3CSF A;  2YHE A;  4PS7 A;  3JUI A;  4NUR A;  2WXM A;  2ZU6 B;  3OXF A;  3WXX A;  4KBQ A;  3CHP A;  1HX8 A;  1ELW A;  3PUJ A;  3FEX A;  1TJC A;  3HYM B;  1JWG A;  1Z6T A;  2IU1 A;  3ZEF A;  2C0L A;  2I1J A;  3NQP A;  4FUL A;  4XZ4 A;  4BSX A;  4BTB A;  1XNF A;  5FQ4 A;  3RRN B;  3U64 A;  4RG9 A;  3FUI A;  3HDX A;  4BFR A;  1JWF A;  4V3I A;  4GZ5 A;  5BV1 A;  2FUL A;  3CVQ A;  3FUE A;  3CEQ A;  2LAH A;  4B89 A;  4UI9 C;  2KZT A;  3CQG B;  4CCA A;  1E7V A;  4GML A;  2I6H A;  4JPS A;  3KEZ A;  3UX4 A;  2I9C A;  4UWL A;  3CGH A;  2WMO A;  4JHK A;  4EBA G;  4DLQ A;  5EKQ D;  2JLB A;  2WMN A;  3ZIM A;  4W9R A;  2XPI A;  5ARG A;  4EZK A;  4GZD A;  3QDN A;  3ZYL A;  4MRU A;  4UI9 K;  5FZS A;  4DLO A;  3ZYQ A;  2WXP A;  1QQE A;  1N54 A;  4Q96 A;  4F53 A;  3ENE A;  3O4Z A;  2C2L A;  3FTY A;  5CMY A;  3FUK A;  2NSZ A;  2V5F A;  2CG3 A;  4ACL A;  3UPV A;  2HM8 A;  1TEZ A;  1U3D A;  2J08 A;  4C9B B;  3LEW A;  4JW1 A;  5FZR A;  4UQX A;  5J90 A;  2VYI A;  4L1B A;  3PUK A;  5CMW A;  4XKB A;  4E6H A;  4PS3 A;  2PM7 A;  3MKR A;  2QY7 A;  4F7A A;  1H2T C;  5EX3 A;  3S7F A;  1JUQ A;  2KCL A;  2OVB A;  3D9K A;  3FTU A;  4KT6 B;  4LER A;  4NAC A;  4WND A;  1QNF A;  5KJN A;  3S2A A;  1FCH A;  3QAQ A;  1NZN A;  1E7U A;  3DBS A;  3K9I A;  4JVS A;  5CHE E;  3UT7 A;  3L08 A;  3QWP A;  3SBT B;  1UJJ A;  1UN8 A;  1IQR A;  3QJZ A;  4PUC A;  2CFZ A;  4JA7 A;  2ION A;  2WVI A;  5HI7 A;  5ENN A;  2E0I A;  3ZHE A;  3ML9 A;  4DJA A;  4RVB A;  2ILR A;  4CEM A;  3IKO B;  4JC8 A;  2PL2 A;  2GRM A;  4L7T A;  1IYG A;  4MLP A;  1JPL A;  4N5C A;  3TXM A;  5LP0 A;  1ZU2 A;  4GPK A;  2OVF A;  4IYP A;  4H7Y A;  4BTA A;  2BTD A;  3AS8 A;  4Q69 A;  4GZC A;  4ATG A;  3QC1 A;  4BWR A;  3KAE A;  3ML8 A;  1ZBP A;  2X6I A;  3PZD A;  2KM4 A;  3FH7 A;  3MKQ B;  3ZW3 A;  4N39 A;  3CVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...