3BEEA

Crystal structure of putative yfre protein from vibrio parahaemolyticus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
NAVTATQLAAKATTLYYLHKQAMTDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRVTIIESINKAKKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of putative YfrE protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Structural genomics, unknown function
molecule keywords Putative YfrE protein
total genus 32
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3beeA00
2UY1B 1KLXA 2E2EA 4NRHB 4U0UA 2XGMA 4GZ5A 4GPKA 2PZIA 2UWJG 3K9IA 3CK9A 5DBKA 5FJYA 1XNFA 2Y4TA 3RU0A 1ELWA 1W3BA 3MEKA 2KC7A 3LKUA 3CVQA 4G25A 3SZ7A 3LYAA 2ONDA 1QQEA 3ZFWA 4Y6CA 2VSNA 1HH8A 2HO1A 2PQRA 4GCOA 3N71A 3QWWA 4GA2A 4UQXA 4UQZA 4YVQC 4A1SA 5KJMA 4U04A 5KJKA 4HOSA 1HZ4A 3OXLA 5G04J 3UUXA 5BNWA 4HOTA 4KYOB 2XCBA 1QZ2A 1B89A 2LSVA 4N3AA 4WNGA 4AM9A 5HQ8A 4XIFA 5FZSA 1HXIA 3GW4A 2C0MA 3CK7A 3KD7A 3Q15A 3QOUA 5CHEE 3QWVA 4GCNA 5FZQA 3ASGA 3TGOA 2WQHA 2VQ2A 4G1TA 1NA0A 4GYOA 3OXGA 4GYWA 3LY7A 2NC9A 4CGVA 1Y8MA 3TAXA 4KBQA 2C0LA 2VGXA 4N3BA 5G05C 1KT0A 5JJTA 2LNIA 2DBAA 5JJ6A 5JJ7A 3PDNA 3RIBA 4B94A 1NZNA 3MKRA 2FI7A 3ULQA 3UQ3A 5CCLA 4N3CA 3CEQA 2VGYA 3CK8A 3OXFA 3WXXA 2BUGA 4GA0A 2PQNA 2PL2A 5FZRA 2FF4A 3U4TA 4I17A 4J0UA 4U0SA 5KJNA 4I2ZA 3TG4A 1KT1A 3FFLA 2JLBA 4UI9K 1ZU2A 2KATA 3QKYA 5G04C 2XGOA 5HI7A 3CVPA 4HORA 5CCMA 3RKVA 3U3WA 2XGSA 3RJVA 3ZHEA 4UI9C 3ZPJA 3IEGA 3ASDA 2UY1A 2V5FA 3GYZA 3KS2A 3QDNA 4J8FA 4XI9A 1TJCA 2MHKA 4ME2A 1FCHA 2YQ8A 4HOUA 5D0QD 4JHRA 1WAO1 3CVLA 3AS8A 3AS4A 4H7XA 4ABNA 3CKCA 3KAEA 4G23A 5FTPA 3BEEA 4BTAA 4G26A 4RG9A 1ELRA 2FEZA 4I9CA 3Q4AB 1ZBPA 5G05J 5EX0A 1OUVA 3CKBA 3NF1A 4GA1A 3LCAA 4IN3B 3HYMB 3LPZA 5AYWD 2Y4UA 2KCVA 4UQYA 4J8DA 3S7DA 3Q5MA 3ZN3A 3ESKA 2QFCA 3Q49B 4GZ3A 4BT8A 3VTYA 5DIZA 3S7JA 3S7BA 3MA5A 2I6HA 4J8EA 4U0ZA 3ZHEB 2KCKA 5C1DA 4G24A 2IF4A 4U07A 3ASFA 2R5SA 5ARFA 3O48A 4JA7A 4AIFA 4XI0A 2VYIA 4AY5A 1NA3A 4BTBA 4N2QA 2WPVA 1P5QA 2C2LA 2VGXB 3PE3A 3JYSA 4F3VA 4AY6A 2XEVA 2FBNA 2LSUA 4I1AA 4WNDA 4Y6WA 4YVOA 2Q7FA 3RO2A 4I2WA 3TG5A 2AVPA 4N5CA 1PC2A 4N39A 1IYGA 2VSYA 2FO7A 2P58C 1IHGA 3E4BA 4GYYA 4BWRA 3QWPA 2OOEA 3GZ2A 5A7DB 4JL0A 3GZ1A 4EQFA 4G2VA 4CGWA 2KCLA 3SF4A 4N2SA 2L6JA 3MV2B 3PE4A 2IFUA 4CDRA 4LEUA 4HOQA 4WNFA 3CV0A 3ZGQA 2GW1A 4YNDA 5EX3A 5BT1A 3RO3A 3FWVA 1YA0A 5EKQD 4RG6A 4H7YA 4NQ0A 5D0OD 5ARGA 3MV3B 3AS5A 4I9EA 3CVNA 4WUYA 3R9AB 3VTXA 5A6CA 5KJLA 3Q47B 3EDTB 1WM5A 4BT9A 1A17A 5LCWC 5FT9A 5M72A 2YHCA 4GZ6A 3ASHA 2HYZA 4JA9A 2J9QA 4UI9J 4W9RA 4WNEA 3LY9A 3URZA 3FP3A 5BW8C 3S7FA 5LCWJ 2XCCA 2HR2A 2XPIA 3LY8A 4O6FA 4KXKB 4APOA 3UPVA 1E96B
chains in the Genus database with same CATH superfamily
4GTPA 4HI8A 5EN5D 3UT4A 2P9KG 2QYJA 4K03A 5ANRA 5AQBA 3CLJA 4XIFA 3NQPA 2VGEA 3JXJA 3FTUA 2EIKE 3FY4A 3APFA 3SNXA 3UX4A 1BI8B 1OCCE 4OAUC 2PQNA 4FC8A 2WXLA 4I6GA 3TG4A 4DX5D 4CT4A 3HVEB 1H2UA 1NP7A 3ASDA 4J8FA 1HS6A 2V0PA 3P1UA 4NIKA 3AS8A 2J07A 2R02A 1SW6A 3HRAA 4J6IA 1ZBPA 3QAQA 3NF1A 4ANWA 4BT8A 3EIQC 3E33A 2OVBA 2BF0X 4AIFA 4TXQA 2M63A 4WNDA 3MCXA 4YDYA 3TWWA 4BWRA 4JHJA 2KCLA 2IFUA 3FTZA 2ZGDA 5KJLA 4BT9A 4J8YA 3CHMA 4O6FA 3ZUVB 4GMJA 5CRUA 4GPKA 4U0UA 3CK9A 3FTSA 2AWIA 3KSLA 2DYSE 1H19A 1TNUA 2P9LG 2WXKA 2X6JA 5HRYA 3J5QB 1EF1C 2XEHA 3ZIMA 1V54E 3LY7A 1S63A 1N4QA 3SO8A 2A5EA 3PDNA 4JB8P 2JABA 2VGYA 1DCEA 3E32A 1JPLA 4JHRA 2XPYA 4HI9A 1N54A 3J5PA 2JEKA 4I9CA 3BG1B 5JA4D 3PVLA 2GRNB 3LPZA 4TV3A 1OWNA 3DSSA 1BI7B 3ESKA 3DRAA 2IO2C 4A3TA 3FH8A 1MX2A 1O1RA 1TR4A 4KMOA 4QFVA 5T3RA 4AY6A 5CEAA 3ULYA 1N52A 3QWPA 2RFAA 2YNQA 4LG6A 2IY0C 2I1KA 4CDRA 5EYPF 4YDEA 1QNFA 1AP7A 2NXPA 4WWNA 3ZYMA 2J9QA 4ACKA 1S0PA 3Q9UC 2XPIA 2QZAA 1OWMA 1KLXA 1UG3A 5D2MC 2QYUA 4JEUA 2MRIA 3G2WA 3AG4E 3UUXA 2X6HA 2AXVA 5B1BE 3QB2A 3TGOA 2WQHA 2P9IG 2VTBB 4ANVA 3IHYA 3ULQA 1LD7A 3OXFA 4GA0A 4URKA 4FADA 3D9NA 1U3CA 2WXMA 5LP0A 3IEGA 2UY1A 4C48B 5A7DB 4LERA 4H7XA 2IOLA 1N9AA 3G2UA 3PRZA 4RQIA 4A1GA 3KSQA 3ESLA 4FJZA 1WG0A 4ILIA 4TUMA 1PAQA 4G24A 3CVXA 4U07A 3Q73A 4JA7A 1FVFA 3ZKJA 4GZCA 2VGXB 3L6AA 3PE3A 2LSUA 4HNAD 2Q7FA 3CQCB 3FTVA 3SF4A 2GW1A 4LCTA 1OCRE 5A6CA 2ZIRA 3LJ3A 3ML8A 1E8ZA 5KNHD 3QC1A 4CCAA 4YDOA 1E96B 3CR3A 4FU3A 1A5EA 2GRLA 3VLFA 3GZSA 2DVWA 1D8EA 4YVQC 3N71A 3PEVB 2XS1A 1TEZA 1HZ4A 1DCQA 3QARA 3QNKA 4DUIA 1BU9A 5EIBE 4GMLA 2LO6A 1HG2A 3ASGA 3TXNA 5ENTD 4XKCA 3V79K 3PNLB 3L08A 1KT0A 1HO8A 1KPSB 2WMNA 1UJJA 3Q79A 4NACA 3SFXA 3C3RA 3JUEA 1SA4A 1KT1A 3FFLA 1MYOA 4RVBA 2IJGX 4XI9A 2XZTG 2WXRA 4HOUA 4U95D 3CVLA 4M7CA 3KAEA 3FUKA 2FEZA 4DK5A 2XS8A 4MKTA 2AXZA 2CHXA 5AYWD 5A23A 1NFIE 2J8SD 2WXPA 1SVXA 3UINC 2IU1A 5LX8A 5C2YA 2ZXWE 1U2VG 2GRQB 3O48A 1FT2A 3NOGD 2J4DA 5FQ7A 2WXJA 1TNOA 4XKBA 3TWRA 2OEWA 1O5MA 3UM1A 4LNBA 4CT0A 4U63A 3UT7A 2XRZA 3AS5A 4K0RA 4WNEA 5FIOA 1OWOA 3SI5A 2E2EA 4DI3A 3ABLE 4DRXE 3K9IA 5DBKA 1JUQA 4GA2A 2V4LA 1N95A 4BSXA 2KBXA 2XCBA 1N94A 1JWGA 3FUDA 1HXIA 2C0MA 3QWVA 1QYMA 4GCNA 1Z3YA 1WY6A 5KBAA 2VGXA 3DEPA 2LNIA 3CHQA 3JCKC 3DPYA 1NZNA 4B94A 1KZOA 2L9BA 4EECA 5FWQA 2JLBA 1ZU2A 2IQCA 2WXIA 4DPRA 2DCPA 3TJPA 3KEAA 3FTWA 3ZXSA 4DX7D 1SZ9A 3PZ1A 3HVEA 1RW2A 3BG0B 1Z6TA 3PREA 4OYSA 3S7JA 3MA5A 2I6HA 1BLXB 5JHAA 1TNBA 3EJNA 1TN7A 4BEPA 2X3MA 1MZCA 2F37A 2PM7A 3NB2A 5JMND 4Z68A 3UM3A 3ASNE 3AU4A 4HOQA 3T5XA 4U8HA 5EX3A 4KVOA 3EHQA 1A17A 2WB2A 4KZ0A 4ILGA 5LCWJ 2HR2A 1UN9A 4APOA 2L0IA 4GTQA 1FT1A 1SA5A 1E8WA 2P9UG 4XZ4A 3G2VA 1HH8A 3ULEG 3V30A 4UQZA 5KJMA 3LVRE 2LSVA 1E8XA 2VQ2A 2L0TB 3PH0C 3Q7FA 2NC9A 4DX2A 3E37A 4N3BA 3UMVA 4A3VA 3JXIA 3RRUA 3CSFA 4N3CA 2BUGA 3U66A 3EHRA 2ETBA 3B7BA 4PDXA 1UJKA 2Y0BG 3DSVA 4PS3A 5D66A 5HI7A 2WXHA 1EDUA 2F8XK 3CVVA 3UXGA 2ETAA 4AEZC 4GA1A 3LCAA 4FULA 2BKGA 4P29A 2OV8A 3DBSA 4DX1A 5FQ6A 1OCZE 4N2QA 4APFA 1O1TA 2FBNA 2PNNA 3PS6A 3QK0A 4I2WA 3TG5A 3R7RA 1N4RA 3TXMA 3L16A 1JCRA 1E8YA 3GZ2A 4AJWA 3D9LA 3IV0A 4O60A 1YA0A 1TN6A 1PY1A 5FQ4A 3EDTB 1WM5A 4W9RA 5BW8C 2P2CP 3UPVA 3LJNA 4GZ5A 5FJYA 2XHEA 2DYRE 2PQRA 4GAAA 2WXNA 4HOSA 4AOFA 4K5AB 4QQIA 3TWQA 4KBQA 2ILRA 3I5PA 1G3NB 2DBAA 3MKRA 2FI7A 5CCLA 3WXXA 1JCSA 4GMRA 5FZRA 2A4ZA 3U4TA 3CHOA 3L82A 5KCMA 2MOWA 3FU6A 4GTOA 4HRNA 5HS0A 5JJTA 3CKCA 1SZAA 4PS8A 1HU3A 3BEEA 4RLYA 4RG9A 4L23A 4TRQA 3IBEA 4LRZA 4MBGA 2CHZA 3DSXA 5G55A 1WDYA 3Q5MA 3DWLG 1MJ0A 4HRLA 2R03A 3S7BA 3ZW3A 2KCKA 2AW6A 5AENA 2BTDA 1NA3A 3FEXA 2WPVA 3JYSA 2XEVA 2OEVA 2AVPA 4GPMA 4L7TA 1N11A 1IYGA 2XENA 1N0RA 3GZ1A 4CGWA 1K1AA 2WXFA 3Q75A 4EHMA 3MV2B 3PE4A 2AXUA 3V2OA 4CZ2D 4UWFA 2B6CA 2EILE 2EIME 4NQ0A 2IO3C 4ZHBA 2J09A 4BERA 2F8YA 4HS2A 1DVPA 4OVUA 4EBAG 2QY7A 5CEDB 3RU0A 1XNFA 1X81A 4NURA 4DI4A 3FTYA 4JW1A 3GW4A 3QOUA 2R05A 4TXPA 4G1TA 2CHWA 3CGHA 3VLEA 2IEJA 5G05C 3Q78A 4HXIA 3UQ3A 2CFUA 4U0SA 3ONKA 4I2ZA 4F1SA 3CVPA 4U8VD 4PH4B 4AV7A 4WWOA 3ZGQA 2V5FA 2B0OE 2V4HC 3ZPJA 4ME2A 5LCWC 2Y69E 3CSTA 3JQ0A 3D9OA 3PZ3A 3FEYA 3Q49B 5DIZA 5BV1A 4JXTA 3SFYA 1MHQA 3B95A 1H0AA 2IF4A 4BESA 1K3ZD 1S64A 4AVXA 1KZPA 5LOZA 3NOCD 3TWVA 4I1AA 3UIOC 2X6FA 1IHGA 3E34A 3SY2A 2H6GA 1N4SA 3LVQE 2EIJE 3CVNA 3FU5A 3ASHA 4I1OB 3LY9A 1ZB1A 4KXKB 3BUAA 3L13A 3JUIA 2XGMA 5JHBA 3T5VA 1QQEA 4I43A 2VSNA 2GRRB 4CDNA 4IRUA 4KT6B 2HE0A 1EPUA 3WG7E 3X2QE 3AU5A 3KD7A 3SQVA 5CERB 3Q7AA 2GGFA 3OXGA 3RSEG 4E6HA 1FVHA 2PM6A 4B0ZA 4PS7A 3TWXA 5JJ7A 4CRWA 2R2LA 1OY3D 3LEWA 4L2LA 1K8KG 4U8YD 5EYLA 3RKVA 1HX8A 4M3OA 2RD0A 5KJNA 4F1PA 2WVIA 2LAIA 2J49A 5FINA 4LNGA 4I6EA 4C0EA 4IN3B 2ZISA 3RAUA 5EDSA 3ZRHA 5BUZA 4MS6A 3PEUB 1IXVA 4UWHA 3LXUX 4F3VA 4JD2G 4ATGA 2LUHA 4LNUD 4HLLA 4JL0A 1TYQG 4FHKA 4LEUA 2VJ8A 4EPZA 3MV3B 3VTXA 1MX4A 3SBTB 1TJFA 5M72A 4K5BA 3TWTA 2RFMA 2H6HA 1AWCB 3ISMC 3UIPC 3RRMB 5ANLA 4G25A 3ZFWA 4Y6CA 4UQXA 3ZVVA 4F53A 2YHEA 4U04A 5BNWA 4KYOB 5AQ7A 2DZNA 2V5QC 5FZQA 3CHPA 1NA0A 4CGVA 3ZYQA 4MRUA 2WMOA 2LXMA 3CK8A 4DX6D 4MLPA 2I2OA 3UM2A 4YDWA 1INZA 4HORA 2VSXE 3AG3E 3KS2A 3GYZA 3VLDA 3ENEA 1QBQA 3AS4A 4BTAA 4HBDA 1LTXA 4O1PA 3HYMB 2Y4UA 2KCVA 4L9PA 3C3OA 4OAVB 3DXMG 5AN8A 2XZDG 4XI0A 1UN8A 3R7QA 3RRNB 1OXJA 4UWKA 2KZTA 4N5CA 3B7TA 3BU8A 1TN8A 3SFZA 4EQFA 2MYOA 4R7LA 4C0MA 1VDYA 3D9PA 2R59A 3B7UX 4EZLA 3FWVA 1Y6IA 4H7YA 4B8AA 4I9EA 3R9AB 3CVYA 3CHRA 2HYZA 2I1JA 2Y3AA 3URZA 3FP3A 4B89A 1YYHA 4KVMA 3ABKE 3V2XA 4B93B 1NI1A 2KC7A 3CVQA 5AIJA 2H6FA 5G04J 1B89A 5J90A 4GB9A 1HFAA 4GYOA 5AJLA 5B1AE 5ENSD 3D9KA 2L6BA 3LDZA 3L22A 3CEQA 2VSOE 3D9MA 3FUEA 2NSZA 3APDA 3QKYA 2LXLA 2XRYA 1E7UA 3RJVA 3QDNA 4WAFA 2MHKA 5J08A 4JVSA 3DPDA 4UWLA 1EYHA 4N5QA 1ELRA 4DLOA 4EZJA 1OT8A 3L54A 2OVFA 3PZ4A 4K5CA 1OWPA 4J8EA 4CEMA 3T8KA 2R5SA 3FUMA 2WQ6A 3TWSA 1D8DA 3PUJA 4Y6WA 4GTMA 3ONLA 1IQUA 2F0YA 1HG5A 1S70B 4WNFA 5AAOA 4A55A 4LSZE 1H6OA 4L1BA 1Z3XA 1BPOA 2DIWA 3EU5A 5FT9A 1NL4A 3HXCA 3S7FA 2X6KA 3LY8A 5BPPA 5CBNA 3PZDA 5CBOA 2UY1B 4FA6A 2PZIA 3MJWA 2V8SE 3C5RA 3FU3A 3MEKA 3FH5A 4GU5A 3LKUA 2ONDA 4UWGA 3OXLA 3HXDA 4WNGA 4WWPA 4GTSA 3Q15A 5BXOA 4G11A 4HLEA 2C0LA 4ATZD 4TUUA 1TNYA 3HIZA 2KZTB 2XQ0A 5IY5E 4DJAA 4J0UA 3AAAC 3FTXA 2XGSA 1N0QA 5EILA 1K1BA 5FTPA 4G23A 3UTMA 1H2VC 3FULA 5CECB 5G05J 5EX0A 3JQ1A 3UM0A 2FULA 4J8DA 3G2SA 1U3DA 4EBAA 1IQRA 3FDHA 3ZHEB 1X5BA 5ENRD 3ASFA 4FLBA 4DLQA 1HF8A 3AJIA 4YVOA 2GRPB 2ZGGA 2FO7A 3E4BA 2OOEA 4Q69A 3B13A 1LD8A 3CV0A 5BT1A 3P2BA 4WUYA 3ZYKA 3OAWA 2YHCA 3C72A 4Q96A 3AG2E 5T4YA 4GZDA 3ABME 4N2SA 5BXUA 3IXEA 2I9CA 3D3MA 1N4PA 3FH7A 4A1SA 4U7EB 3MKQA 3NZSA 4I6JA 4F7AA 2HO1A 3BQOA 4L2YA 1UOHA 3SGHA 5KJKA 1FPPA 3CVUA 3B7RL 3S2AA 5FZSA 5LFAA 4AY5A 5CHEE 3CK7A 4G8KA 4I1MA 2XEEA 3DSUA 2DZOA 3RIBA 2BEDA 4BSZB 1E90A 4I17A 3ZEFA 2GRMA 5AJDA 3HG0D 3UI2A 4ABNA 1WAO1 4BETA 2HM8A 1MX6A 3EUVA 1UW4B 5BV0A 1OWLA 3HHMA 4V3IA 3ZN3A 3D9HA 2QFCA 3NZUA 4HQDA 4X8QA 3G2TA 4ACLA 1TNZA 4JEHA 2KXPC 3APCA 1PC2A 4Q94A 3UT8A 5CMWA 5E75A 3C98A 1RZ4A 4RG6A 4G8LA 3DXKG 4FP7A 4UI9J 2XCCA 5HKPA 3NAWA 2Y4TA 1ELWA 4IYPA 1O1SA 3SZ7A 3LYAA 4GTVA 3MGBA 1QZ2A 4N3AA 5HQ8A 5H7PA 2A5UA 3TAXA 3TL5A 3T8MA 2ETCA 4ZFHA 2GROB 2IOSA 1MQSA 4AXHA 3NBNB 2WXGA 3DSWA 3L17A 2FF4A 5FQ8A 3DSTA 5ENQD 3EIJA 5G04C 2XGOA 3MYVA 4JPSA 2EINE 3U3WA 3RK6A 2CFZA 2WXQA 1FCHA 2YQ8A 5D0QD 2NYJA 4TXRA 3L9TA 1OUVA 3CKBA 4J8SA 2J4BA 4UQYA 1DNPA 2FO1E 2WXOA 4U0ZA 3UKUG 1HE8A 5AARA 4BTBA 2C2LA 1IKND 3I3NA 3C3QA 3I4RB 3ZNGA 3ZXPA 5ENNA 3HXBA 4N39A 2P58C 3FUJA 4XX5A 5T8IA 2XPZA 4ANUA 2Y1LE 3OTNA 1GW6A 3RO3A 3SBSA 3HXEA 3T9KA 3V31A 4GZ6A 3W9FA 4JA9A 1Z5SC 3ML9A 3IKOB 3FUIA 3ZYLA 1D9SA 2UWJG 3CIAA 3D9JA 4GCOA 3QWWA 1YMPA 5ENPD 2ZU6B 3KEZA 4C9BB 1OCOE 2EQXA 3B7SA 3O4ZA 5AQ9A 2CG2A 3SD5A 3UKRG 4JHKA 3CVWA 4GYWA 4GTTA 1Y8MA 2VTBA 5EIDA 5JJ6A 1LF8A 2YINA 5E76A 4BY6A 1Q2ZA 2CG3A 5ENOD 4XE0A 3ZHEA 1XGWA 5KWDA 1TJCA 2R17C 3FUHA 4G26A 3EHNA 3EU9A 3Q4AB 3F6QA 3LS8A 4E85A 2KM4A 4EZKA 4GZ3A 3VTYA 2IONA 2H6IA 5C1DA 1YCSB 1JCQA 1ELKA 2VYIA 3MZLB 4AP2A 1H6PA 4JZYA 3EHMA 2WM9A 3U9WA 3FUNA 2WQ7A 4ANXA 4ILHB 2LAHA 2VSYA 4GYYA 3MX3A 4FJYA 2L6JA 3ASOE 3HXFA 4YNDA 3FUFA 3PUKA 3W9GA 3ZU7B 3TWUA 5CCMA 5ARGA 3IHVA 3Q47B 4RSYA 4AM9A 4XEIG 4BX9A 4NRHB 4BFRA 3DEOA 1W3BA 2QC9A 3PNTB 2X6IA 3FU0A 4HOTA 2P9SG 1L5JA 4FHJA 3QJZA 1JWFA 4IULA 2X38A 5G2NA 3E30A 4O1OA 5AQAA 2J08A 4CYMD 3FHEA 1E7VA 2AJAA 2OCCE 3MKQB 4D10C 5CRVA 4OVVA 4A63B 2PL2A 3Q9NC 3I4GA 4UI9K 2KATA 5KNGA 4FLHA 5CMYA 4UI9C 1BD8A 1H2TC 2RG8A 3U64A 4HB5A 2E0IA 4HRMB 3AG1E 4PUCA 4CDMA 2BKKB 4KZCA 1SQMA 3S7DA 2RKKA 3HDXA 3R9MA 2P9NG 4JC8A 4GTRA 3D9IA 5ARFA 4LUNU 1P5QA 3CQGB 1H6KA 4HFGA 4B8CB 4U96D 3RO2A 3PZ2A 4G2VA 1IHBA 4J7WA 1DC2A 3SHFA 5EKQD 4HVBA 2DWZA 5D0OD 2P9PG 4F6RD 4UUCA 5B3SE 5ITZF 1V55E 3CHSA 4BX8A
chains in the Genus database with same CATH topology
3L13A 2I9CA 2E2EA 3JUIA 4DI3A 2XGMA 5JHBA 3D3MA 3K9IA 5DBKA 3UT4A 3FH7A 4A1SA 3MKQA 3NZSA 4I6JA 3T5VA 1QQEA 4I43A 1JUQA 2VSNA 2HO1A 4L2YA 4F7AA 3SGHA 4CDNA 4GA2A 5KJKA 4IRUA 2V4LA 4KT6B 4BSXA 1EPUA 4K03A 2XCBA 3CVUA 1JWGA 5ANRA 3B7RL 3AU5A 3CLJA 4XIFA 3FUDA 5FZSA 1HXIA 3S2AA 2C0MA 3CK7A 3KD7A 3NQPA 5CHEE 4AY5A 3QWVA 4GCNA 3FTUA 1Z3YA 2GGFA 3OXGA 1WY6A 4I1MA 3FY4A 4E6HA 1FVHA 2PM6A 2VGXA 3APFA 4B0ZA 3SNXA 4PS7A 2LNIA 3CHQA 5JJ7A 3JCKC 3RIBA 4B94A 1NZNA 3UX4A 4CRWA 2L9BA 3LEWA 4L2LA 4EECA 2PQNA 4FC8A 1E90A 4I17A 2WXLA 4I6GA 3ZEFA 2GRMA 3TG4A 5FWQA 2JLBA 1ZU2A 4CT4A 2IQCA 3HVEB 1H2UA 2WXIA 5AJDA 4DPRA 3RKVA 1HX8A 1NP7A 2DCPA 4M3OA 3ASDA 4J8FA 1HS6A 3TJPA 2RD0A 5KJNA 2V0PA 3P1UA 2WVIA 2LAIA 4ABNA 1WAO1 2J49A 3AS8A 3FTWA 2J07A 3ZXSA 2HM8A 1SZ9A 1UW4B 4I6EA 4J6IA 4C0EA 1ZBPA 3QAQA 5BV0A 3NF1A 4ANWA 3HVEA 4IN3B 1OWLA 3HHMA 4V3IA 3BG0B 5EDSA 3ZN3A 1Z6TA 2QFCA 3PREA 4BT8A 4OYSA 3ZRHA 3S7JA 3EIQC 3MA5A 2I6HA 3NZUA 5BUZA 3G2TA 2OVBA 4MS6A 2BF0X 3PEUB 4AIFA 4ACLA 4UWHA 5JHAA 3EJNA 3LXUX 4F3VA 4ATGA 4JEHA 2X3MA 2M63A 3APCA 4WNDA 2PM7A 3MCXA 1PC2A 4BWRA 4JHJA 4JL0A 4Q94A 2KCLA 3UT8A 5CMWA 4FHKA 5E75A 3AU4A 2IFUA 4LEUA 4HOQA 3FTZA 2VJ8A 3T5XA 3C98A 4U8HA 4KVOA 5EX3A 4EPZA 4RG6A 3MV3B 3VTXA 5KJLA 4FP7A 3SBTB 1TJFA 4BT9A 1A17A 5M72A 2WB2A 4UI9J 4KZ0A 4ILGA 5LCWJ 2XCCA 2HR2A 3CHMA 1UN9A 4O6FA 4APOA 2L0IA 4GMJA 1E8WA 4GPKA 4U0UA 4XZ4A 3CK9A 3FTSA 5ANLA 2Y4TA 3RRMB 1ELWA 2AWIA 4IYPA 4G25A 3SZ7A 3LYAA 3ZFWA 3G2VA 4Y6CA 1HH8A 4UQXA 3ZVVA 4F53A 4UQZA 2YHEA 1H19A 3MGBA 4U04A 5KJMA 5BNWA 3LVRE 4KYOB 1QZ2A 2LSVA 4N3AA 5HQ8A 2WXKA 1E8XA 2X6JA 1EF1C 5FZQA 2A5UA 3CHPA 2VQ2A 1NA0A 2L0TB 3PH0C 4UWLA 3ZIMA 3LY7A 2NC9A 4CGVA 3TAXA 3TL5A 4N3BA 3UMVA 3T8MA 3ZYQA 4A3VA 3PDNA 4MRUA 3RRUA 3CSFA 2WMOA 2IOSA 1MQSA 4AXHA 4N3CA 3CK8A 2VGYA 2WXGA 2BUGA 3U66A 4MLPA 3L17A 2FF4A 2I2OA 4PDXA 5FQ8A 1UJKA 4PS3A 3EIJA 1INZA 5G04C 2XGOA 3MYVA 5HI7A 4JPSA 4HORA 2VSXE 2WXHA 3U3WA 1EDUA 3RK6A 3KS2A 3GYZA 3VLDA 3ENEA 2CFZA 2WXQA 1FCHA 2YQ8A 1JPLA 5D0QD 4JHRA 2XPYA 3AS4A 4BTAA 1N54A 2JEKA 3CVVA 4I9CA 4AEZC 3BG1B 1OUVA 3CKBA 4GA1A 3LCAA 3PVLA 4J8SA 2J4BA 4FULA 3HYMB 3LPZA 4P29A 2Y4UA 1DNPA 2KCVA 1OWNA 2OV8A 2WXOA 4UQYA 4TV3A 3ESKA 4A3TA 3FH8A 4U0ZA 3DBSA 5FQ6A 1HE8A 4XI0A 4BTBA 4N2QA 1UN8A 2C2LA 4KMOA 4QFVA 3R7QA 4APFA 3RRNB 3I3NA 5T3RA 4AY6A 2FBNA 3I4RB 3PS6A 3QK0A 4UWKA 5ENNA 4I2WA 3TG5A 3R7RA 2KZTA 4N5CA 1N52A 4N39A 2P58C 3B7TA 3TXMA 3FUJA 3L16A 3QWPA 1E8YA 4XX5A 5T8IA 3GZ2A 4AJWA 3SFZA 4EQFA 2XPZA 4R7LA 4C0MA 1VDYA 2YNQA 3D9PA 2I1KA 4CDRA 2R59A 4ANUA 3OTNA 3B7UX 3D9LA 1GW6A 4EZLA 3IV0A 3RO3A 3FWVA 1QNFA 1Y6IA 1YA0A 4H7YA 2NXPA 4B8AA 4I9EA 3R9AB 1PY1A 3SBSA 3CVYA 3CHRA 5FQ4A 3EDTB 1WM5A 4WWNA 3ZYMA 4GZ6A 2HYZA 2I1JA 2J9QA 4JA9A 4W9RA 2Y3AA 3URZA 3FP3A 5BW8C 4B89A 4ACKA 1S0PA 3ML9A 4KVMA 2XPIA 1OWMA 3UPVA 3IKOB 1KLXA 3FUIA 1UG3A 4GZ5A 3ZYLA 2UWJG 5FJYA 3CIAA 4JEUA 2KC7A 3CVQA 2MRIA 3G2WA 5AIJA 2XHEA 2PQRA 3D9JA 4GCOA 3QWWA 2WXNA 4GAAA 4HOSA 2ZU6B 3KEZA 4C9BB 5G04J 3UUXA 4AOFA 1B89A 5J90A 2X6HA 2EQXA 3B7SA 2AXVA 3O4ZA 3QB2A 4GB9A 2CG2A 3SD5A 3TGOA 2WQHA 4JHKA 1HFAA 4GYOA 3CVWA 4GYWA 5AJLA 2VTBB 1Y8MA 2VTBA 4KBQA 2ILRA 3I5PA 3D9KA 4ANVA 2DBAA 5JJ6A 1LF8A 3IHYA 3MKRA 2FI7A 3ULQA 3LDZA 5CCLA 2YINA 3L22A 5E76A 4BY6A 3CEQA 3WXXA 3OXFA 4GA0A 2CG3A 5FZRA 4URKA 2VSOE 4FADA 2A4ZA 3D9MA 3FUEA 2NSZA 3APDA 3U4TA 3D9NA 3CHOA 5KCMA 1U3CA 2WXMA 3QKYA 4XE0A 2MOWA 3FU6A 2XRYA 3ZHEA 1E7UA 1XGWA 3RJVA 5LP0A 3IEGA 2UY1A 3QDNA 4WAFA 1TJCA 2MHKA 5A7DB 5JJTA 5J08A 2R17C 4JVSA 4LERA 3DPDA 4H7XA 3CKCA 1SZAA 1EYHA 1HU3A 3BEEA 2IOLA 3FUHA 4G26A 4PS8A 1ELRA 3EHNA 4L23A 4RG9A 4TRQA 4DLOA 3IBEA 4LRZA 3G2UA 3Q4AB 4EZJA 3PRZA 3LS8A 3L54A 4A1GA 2CHZA 2OVFA 4E85A 5G55A 3Q5MA 2KM4A 3ESLA 1OWPA 4GZ3A 4EZKA 3VTYA 4FJZA 3S7BA 2IONA 3ZW3A 4J8EA 4CEMA 4ILIA 2KCKA 1PAQA 5C1DA 4G24A 2AW6A 3CVXA 4U07A 2R5SA 4JA7A 3FUMA 5AENA 1ELKA 2BTDA 2VYIA 1NA3A 3FEXA 2WQ6A 1FVFA 2WPVA 3MZLB 4AP2A 4GZCA 2VGXB 3L6AA 3JYSA 3PE3A 3EHMA 4JZYA 2WM9A 2XEVA 3U9WA 2LSUA 3PUJA 4Y6WA 3FUNA 2WQ7A 2Q7FA 3CQCB 3ONLA 4ANXA 2AVPA 4L7TA 4ILHB 1IYGA 2LAHA 2VSYA 1IQUA 4GYYA 3FTVA 3GZ1A 3MX3A 4FJYA 4CGWA 3SF4A 1HG5A 2L6JA 2WXFA 3MV2B 3PE4A 2AXUA 4WNFA 4UWFA 2GW1A 4YNDA 4LCTA 3FUFA 4A55A 3PUKA 5CCMA 4NQ0A 5ARGA 5A6CA 3IHVA 3Q47B 4L1BA 1Z3XA 1BPOA 2DIWA 5FT9A 2J09A 3LJ3A 4RSYA 4AM9A 3S7FA 3ML8A 2X6KA 4HS2A 1DVPA 3LY8A 1E8ZA 5BPPA 3QC1A 4CCAA 4BX9A 1E96B 3PZDA 2UY1B 4NRHB 4OVUA 3CR3A 4EBAG 2QY7A 4FA6A 2PZIA 3MJWA 4BFRA 4FU3A 2V8SE 3RU0A 1XNFA 3FU3A 3MEKA 1W3BA 2GRLA 3FH5A 3LKUA 3PNTB 4GU5A 3VLFA 2ONDA 2X6IA 3GZSA 4YVQC 3N71A 3PEVB 4UWGA 3FU0A 1TEZA 1HZ4A 3OXLA 4NURA 3QARA 4HOTA 3QNKA 4WNGA 4WWPA 4DI4A 1L5JA 3FTYA 4GMLA 4JW1A 4FHJA 3GW4A 3QJZA 3Q15A 3QOUA 2LO6A 1HG2A 3ASGA 1JWFA 4G1TA 2CHWA 2X38A 4IULA 3TXNA 4XKCA 5G2NA 4G11A 4HLEA 3CGHA 3VLEA 3PNLB 2C0LA 2J08A 3FHEA 3L08A 1E7VA 1KT0A 1HO8A 4TUUA 5G05C 3MKQB 4D10C 3HIZA 2WMNA 1UJJA 4HXIA 3UQ3A 2KZTB 2XQ0A 4NACA 4OVVA 2PL2A 2CFUA 4DJAA 4J0UA 4U0SA 3ONKA 4I2ZA 1KT1A 3FFLA 3I4GA 4F1SA 4UI9K 3FTXA 2KATA 3CVPA 4RVBA 4FLHA 2XGSA 4PH4B 2IJGX 4UI9C 4WWOA 4XI9A 5CMYA 2V5FA 2WXRA 3ZGQA 4AV7A 3ZPJA 5LCWC 4ME2A 4HOUA 3CVLA 1H2TC 3KAEA 2RG8A 3FUKA 4G23A 5FTPA 3U64A 1H2VC 2E0IA 3CSTA 3FULA 2FEZA 4DK5A 4PUCA 4CDMA 5G05J 5EX0A 4MKTA 3JQ1A 4KZCA 3JQ0A 1SQMA 2AXZA 2CHXA 3D9OA 5AYWD 2FULA 4J8DA 3G2SA 3S7DA 5A23A 1U3DA 3FEYA 2WXPA 3HDXA 3Q49B 4EBAA 1IQRA 3FDHA 2IU1A 5DIZA 5BV1A 5LX8A 4JXTA 1MHQA 3ZHEB 1X5BA 1H0AA 5C2YA 4JC8A 5LFAA 2IF4A 3D9IA 3ASFA 5ARFA 3O48A 4LUNU 4FLBA 4AVXA 1P5QA 5LOZA 3CQGB 1H6KA 4HFGA 4DLQA 4B8CB 2J4DA 1HF8A 4I1AA 5FQ7A 4YVOA 3RO2A 2WXJA 2X6FA 2FO7A 3E4BA 1IHGA 4XKBA 2OOEA 4Q69A 4G2VA 3B13A 4N2SA 3SHFA 3CV0A 5BT1A 3LVQE 4CT0A 4U63A 5EKQD 4HVBA 5D0OD 3UT7A 2XRZA 3P2BA 3AS5A 4WUYA 3CVNA 3FU5A 3ZYKA 3OAWA 2YHCA 3ASHA 4K0RA 4I1OB 4Q96A 3LY9A 4WNEA 1OWOA 3SI5A 3CHSA 5T4YA 4GZDA 4KXKB 4BX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UY1 B;  1KLX A;  2E2E A;  4NRH B;  4U0U A;  2XGM A;  4GZ5 A;  4GPK A;  2PZI A;  2UWJ G;  3K9I A;  3CK9 A;  5DBK A;  5FJY A;  1XNF A;  2Y4T A;  3RU0 A;  1ELW A;  1W3B A;  3MEK A;  2KC7 A;  3LKU A;  3CVQ A;  4G25 A;  3SZ7 A;  3LYA A;  2OND A;  1QQE A;  3ZFW A;  4Y6C A;  2VSN A;  1HH8 A;  2HO1 A;  2PQR A;  4GCO A;  3N71 A;  3QWW A;  4GA2 A;  4UQX A;  4UQZ A;  4YVQ C;  4A1S A;  5KJM A;  4U04 A;  5KJK A;  4HOS A;  1HZ4 A;  3OXL A;  5G04 J;  3UUX A;  5BNW A;  4HOT A;  4KYO B;  2XCB A;  1QZ2 A;  1B89 A;  2LSV A;  4N3A A;  4WNG A;  4AM9 A;  5HQ8 A;  4XIF A;  5FZS A;  1HXI A;  3GW4 A;  2C0M A;  3CK7 A;  3KD7 A;  3Q15 A;  3QOU A;  5CHE E;  3QWV A;  4GCN A;  5FZQ A;  3ASG A;  3TGO A;  2WQH A;  2VQ2 A;  4G1T A;  1NA0 A;  4GYO A;  3OXG A;  4GYW A;  3LY7 A;  2NC9 A;  4CGV A;  1Y8M A;  3TAX A;  4KBQ A;  2C0L A;  2VGX A;  4N3B A;  5G05 C;  1KT0 A;  5JJT A;  2LNI A;  2DBA A;  5JJ6 A;  5JJ7 A;  3PDN A;  3RIB A;  4B94 A;  1NZN A;  3MKR A;  2FI7 A;  3ULQ A;  3UQ3 A;  5CCL A;  4N3C A;  3CEQ A;  2VGY A;  3CK8 A;  3OXF A;  3WXX A;  2BUG A;  4GA0 A;  2PQN A;  2PL2 A;  5FZR A;  2FF4 A;  3U4T A;  4I17 A;  4J0U A;  4U0S A;  5KJN A;  4I2Z A;  3TG4 A;  1KT1 A;  3FFL A;  2JLB A;  4UI9 K;  1ZU2 A;  2KAT A;  3QKY A;  5G04 C;  2XGO A;  5HI7 A;  3CVP A;  4HOR A;  5CCM A;  3RKV A;  3U3W A;  2XGS A;  3RJV A;  3ZHE A;  4UI9 C;  3ZPJ A;  3IEG A;  3ASD A;  2UY1 A;  2V5F A;  3GYZ A;  3KS2 A;  3QDN A;  4J8F A;  4XI9 A;  1TJC A;  2MHK A;  4ME2 A;  1FCH A;  2YQ8 A;  4HOU A;  5D0Q D;  4JHR A;  1WAO 1;  3CVL A;  3AS8 A;  3AS4 A;  4H7X A;  4ABN A;  3CKC A;  3KAE A;  4G23 A;  5FTP A;  3BEE A;  4BTA A;  4G26 A;  4RG9 A;  1ELR A;  2FEZ A;  4I9C A;  3Q4A B;  1ZBP A;  5G05 J;  5EX0 A;  1OUV A;  3CKB A;  3NF1 A;  4GA1 A;  3LCA A;  4IN3 B;  3HYM B;  3LPZ A;  5AYW D;  2Y4U A;  2KCV A;  4UQY A;  4J8D A;  3S7D A;  3Q5M A;  3ZN3 A;  3ESK A;  2QFC A;  3Q49 B;  4GZ3 A;  4BT8 A;  3VTY A;  5DIZ A;  3S7J A;  3S7B A;  3MA5 A;  2I6H A;  4J8E A;  4U0Z A;  3ZHE B;  2KCK A;  5C1D A;  4G24 A;  2IF4 A;  4U07 A;  3ASF A;  2R5S A;  5ARF A;  3O48 A;  4JA7 A;  4AIF A;  4XI0 A;  2VYI A;  4AY5 A;  1NA3 A;  4BTB A;  4N2Q A;  2WPV A;  1P5Q A;  2C2L A;  2VGX B;  3PE3 A;  3JYS A;  4F3V A;  4AY6 A;  2XEV A;  2FBN A;  2LSU A;  4I1A A;  4WND A;  4Y6W A;  4YVO A;  2Q7F A;  3RO2 A;  4I2W A;  3TG5 A;  2AVP A;  4N5C A;  1PC2 A;  4N39 A;  1IYG A;  2VSY A;  2FO7 A;  2P58 C;  1IHG A;  3E4B A;  4GYY A;  4BWR A;  3QWP A;  2OOE A;  3GZ2 A;  5A7D B;  4JL0 A;  3GZ1 A;  4EQF A;  4G2V A;  4CGW A;  2KCL A;  3SF4 A;  4N2S A;  2L6J A;  3MV2 B;  3PE4 A;  2IFU A;  4CDR A;  4LEU A;  4HOQ A;  4WNF A;  3CV0 A;  3ZGQ A;  2GW1 A;  4YND A;  5EX3 A;  5BT1 A;  3RO3 A;  3FWV A;  1YA0 A;  5EKQ D;  4RG6 A;  4H7Y A;  4NQ0 A;  5D0O D;  5ARG A;  3MV3 B;  3AS5 A;  4I9E A;  3CVN A;  4WUY A;  3R9A B;  3VTX A;  5A6C A;  5KJL A;  3Q47 B;  3EDT B;  1WM5 A;  4BT9 A;  1A17 A;  5LCW C;  5FT9 A;  5M72 A;  2YHC A;  4GZ6 A;  3ASH A;  2HYZ A;  4JA9 A;  2J9Q A;  4UI9 J;  4W9R A;  4WNE A;  3LY9 A;  3URZ A;  3FP3 A;  5BW8 C;  3S7F A;  5LCW J;  2XCC A;  2HR2 A;  2XPI A;  3LY8 A;  4O6F A;  4KXK B;  4APO A;  3UPV A;  1E96 B; 
#chains in the Genus database with same CATH topology
 4GTP A;  4HI8 A;  5EN5 D;  3UT4 A;  2P9K G;  2QYJ A;  4K03 A;  5ANR A;  5AQB A;  3CLJ A;  4XIF A;  3NQP A;  2VGE A;  3JXJ A;  3FTU A;  2EIK E;  3FY4 A;  3APF A;  3SNX A;  3UX4 A;  1BI8 B;  1OCC E;  4OAU C;  2PQN A;  4FC8 A;  2WXL A;  4I6G A;  3TG4 A;  4DX5 D;  4CT4 A;  3HVE B;  1H2U A;  1NP7 A;  3ASD A;  4J8F A;  1HS6 A;  2V0P A;  3P1U A;  4NIK A;  3AS8 A;  2J07 A;  2R02 A;  1SW6 A;  3HRA A;  4J6I A;  1ZBP A;  3QAQ A;  3NF1 A;  4ANW A;  4BT8 A;  3EIQ C;  3E33 A;  2OVB A;  2BF0 X;  4AIF A;  4TXQ A;  2M63 A;  4WND A;  3MCX A;  4YDY A;  3TWW A;  4BWR A;  4JHJ A;  2KCL A;  2IFU A;  3FTZ A;  2ZGD A;  5KJL A;  4BT9 A;  4J8Y A;  3CHM A;  4O6F A;  3ZUV B;  4GMJ A;  5CRU A;  4GPK A;  4U0U A;  3CK9 A;  3FTS A;  2AWI A;  3KSL A;  2DYS E;  1H19 A;  1TNU A;  2P9L G;  2WXK A;  2X6J A;  5HRY A;  3J5Q B;  1EF1 C;  2XEH A;  3ZIM A;  1V54 E;  3LY7 A;  1S63 A;  1N4Q A;  3SO8 A;  2A5E A;  3PDN A;  4JB8 P;  2JAB A;  2VGY A;  1DCE A;  3E32 A;  1JPL A;  4JHR A;  2XPY A;  4HI9 A;  1N54 A;  3J5P A;  2JEK A;  4I9C A;  3BG1 B;  5JA4 D;  3PVL A;  2GRN B;  3LPZ A;  4TV3 A;  1OWN A;  3DSS A;  1BI7 B;  3ESK A;  3DRA A;  2IO2 C;  4A3T A;  3FH8 A;  1MX2 A;  1O1R A;  1TR4 A;  4KMO A;  4QFV A;  5T3R A;  4AY6 A;  5CEA A;  3ULY A;  1N52 A;  3QWP A;  2RFA A;  2YNQ A;  4LG6 A;  2IY0 C;  2I1K A;  4CDR A;  5EYP F;  4YDE A;  1QNF A;  1AP7 A;  2NXP A;  4WWN A;  3ZYM A;  2J9Q A;  4ACK A;  1S0P A;  3Q9U C;  2XPI A;  2QZA A;  1OWM A;  1KLX A;  1UG3 A;  5D2M C;  2QYU A;  4JEU A;  2MRI A;  3G2W A;  3AG4 E;  3UUX A;  2X6H A;  2AXV A;  5B1B E;  3QB2 A;  3TGO A;  2WQH A;  2P9I G;  2VTB B;  4ANV A;  3IHY A;  3ULQ A;  1LD7 A;  3OXF A;  4GA0 A;  4URK A;  4FAD A;  3D9N A;  1U3C A;  2WXM A;  5LP0 A;  3IEG A;  2UY1 A;  4C48 B;  5A7D B;  4LER A;  4H7X A;  2IOL A;  1N9A A;  3G2U A;  3PRZ A;  4RQI A;  4A1G A;  3KSQ A;  3ESL A;  4FJZ A;  1WG0 A;  4ILI A;  4TUM A;  1PAQ A;  4G24 A;  3CVX A;  4U07 A;  3Q73 A;  4JA7 A;  1FVF A;  3ZKJ A;  4GZC A;  2VGX B;  3L6A A;  3PE3 A;  2LSU A;  4HNA D;  2Q7F A;  3CQC B;  3FTV A;  3SF4 A;  2GW1 A;  4LCT A;  1OCR E;  5A6C A;  2ZIR A;  3LJ3 A;  3ML8 A;  1E8Z A;  5KNH D;  3QC1 A;  4CCA A;  4YDO A;  1E96 B;  3CR3 A;  4FU3 A;  1A5E A;  2GRL A;  3VLF A;  3GZS A;  2DVW A;  1D8E A;  4YVQ C;  3N71 A;  3PEV B;  2XS1 A;  1TEZ A;  1HZ4 A;  1DCQ A;  3QAR A;  3QNK A;  4DUI A;  1BU9 A;  5EIB E;  4GML A;  2LO6 A;  1HG2 A;  3ASG A;  3TXN A;  5ENT D;  4XKC A;  3V79 K;  3PNL B;  3L08 A;  1KT0 A;  1HO8 A;  1KPS B;  2WMN A;  1UJJ A;  3Q79 A;  4NAC A;  3SFX A;  3C3R A;  3JUE A;  1SA4 A;  1KT1 A;  3FFL A;  1MYO A;  4RVB A;  2IJG X;  4XI9 A;  2XZT G;  2WXR A;  4HOU A;  4U95 D;  3CVL A;  4M7C A;  3KAE A;  3FUK A;  2FEZ A;  4DK5 A;  2XS8 A;  4MKT A;  2AXZ A;  2CHX A;  5AYW D;  5A23 A;  1NFI E;  2J8S D;  2WXP A;  1SVX A;  3UIN C;  2IU1 A;  5LX8 A;  5C2Y A;  2ZXW E;  1U2V G;  2GRQ B;  3O48 A;  1FT2 A;  3NOG D;  2J4D A;  5FQ7 A;  2WXJ A;  1TNO A;  4XKB A;  3TWR A;  2OEW A;  1O5M A;  3UM1 A;  4LNB A;  4CT0 A;  4U63 A;  3UT7 A;  2XRZ A;  3AS5 A;  4K0R A;  4WNE A;  5FIO A;  1OWO A;  3SI5 A;  2E2E A;  4DI3 A;  3ABL E;  4DRX E;  3K9I A;  5DBK A;  1JUQ A;  4GA2 A;  2V4L A;  1N95 A;  4BSX A;  2KBX A;  2XCB A;  1N94 A;  1JWG A;  3FUD A;  1HXI A;  2C0M A;  3QWV A;  1QYM A;  4GCN A;  1Z3Y A;  1WY6 A;  5KBA A;  2VGX A;  3DEP A;  2LNI A;  3CHQ A;  3JCK C;  3DPY A;  1NZN A;  4B94 A;  1KZO A;  2L9B A;  4EEC A;  5FWQ A;  2JLB A;  1ZU2 A;  2IQC A;  2WXI A;  4DPR A;  2DCP A;  3TJP A;  3KEA A;  3FTW A;  3ZXS A;  4DX7 D;  1SZ9 A;  3PZ1 A;  3HVE A;  1RW2 A;  3BG0 B;  1Z6T A;  3PRE A;  4OYS A;  3S7J A;  3MA5 A;  2I6H A;  1BLX B;  5JHA A;  1TNB A;  3EJN A;  1TN7 A;  4BEP A;  2X3M A;  1MZC A;  2F37 A;  2PM7 A;  3NB2 A;  5JMN D;  4Z68 A;  3UM3 A;  3ASN E;  3AU4 A;  4HOQ A;  3T5X A;  4U8H A;  5EX3 A;  4KVO A;  3EHQ A;  1A17 A;  2WB2 A;  4KZ0 A;  4ILG A;  5LCW J;  2HR2 A;  1UN9 A;  4APO A;  2L0I A;  4GTQ A;  1FT1 A;  1SA5 A;  1E8W A;  2P9U G;  4XZ4 A;  3G2V A;  1HH8 A;  3ULE G;  3V30 A;  4UQZ A;  5KJM A;  3LVR E;  2LSV A;  1E8X A;  2VQ2 A;  2L0T B;  3PH0 C;  3Q7F A;  2NC9 A;  4DX2 A;  3E37 A;  4N3B A;  3UMV A;  4A3V A;  3JXI A;  3RRU A;  3CSF A;  4N3C A;  2BUG A;  3U66 A;  3EHR A;  2ETB A;  3B7B A;  4PDX A;  1UJK A;  2Y0B G;  3DSV A;  4PS3 A;  5D66 A;  5HI7 A;  2WXH A;  1EDU A;  2F8X K;  3CVV A;  3UXG A;  2ETA A;  4AEZ C;  4GA1 A;  3LCA A;  4FUL A;  2BKG A;  4P29 A;  2OV8 A;  3DBS A;  4DX1 A;  5FQ6 A;  1OCZ E;  4N2Q A;  4APF A;  1O1T A;  2FBN A;  2PNN A;  3PS6 A;  3QK0 A;  4I2W A;  3TG5 A;  3R7R A;  1N4R A;  3TXM A;  3L16 A;  1JCR A;  1E8Y A;  3GZ2 A;  4AJW A;  3D9L A;  3IV0 A;  4O60 A;  1YA0 A;  1TN6 A;  1PY1 A;  5FQ4 A;  3EDT B;  1WM5 A;  4W9R A;  5BW8 C;  2P2C P;  3UPV A;  3LJN A;  4GZ5 A;  5FJY A;  2XHE A;  2DYR E;  2PQR A;  4GAA A;  2WXN A;  4HOS A;  4AOF A;  4K5A B;  4QQI A;  3TWQ A;  4KBQ A;  2ILR A;  3I5P A;  1G3N B;  2DBA A;  3MKR A;  2FI7 A;  5CCL A;  3WXX A;  1JCS A;  4GMR A;  5FZR A;  2A4Z A;  3U4T A;  3CHO A;  3L82 A;  5KCM A;  2MOW A;  3FU6 A;  4GTO A;  4HRN A;  5HS0 A;  5JJT A;  3CKC A;  1SZA A;  4PS8 A;  1HU3 A;  3BEE A;  4RLY A;  4RG9 A;  4L23 A;  4TRQ A;  3IBE A;  4LRZ A;  4MBG A;  2CHZ A;  3DSX A;  5G55 A;  1WDY A;  3Q5M A;  3DWL G;  1MJ0 A;  4HRL A;  2R03 A;  3S7B A;  3ZW3 A;  2KCK A;  2AW6 A;  5AEN A;  2BTD A;  1NA3 A;  3FEX A;  2WPV A;  3JYS A;  2XEV A;  2OEV A;  2AVP A;  4GPM A;  4L7T A;  1N11 A;  1IYG A;  2XEN A;  1N0R A;  3GZ1 A;  4CGW A;  1K1A A;  2WXF A;  3Q75 A;  4EHM A;  3MV2 B;  3PE4 A;  2AXU A;  3V2O A;  4CZ2 D;  4UWF A;  2B6C A;  2EIL E;  2EIM E;  4NQ0 A;  2IO3 C;  4ZHB A;  2J09 A;  4BER A;  2F8Y A;  4HS2 A;  1DVP A;  4OVU A;  4EBA G;  2QY7 A;  5CED B;  3RU0 A;  1XNF A;  1X81 A;  4NUR A;  4DI4 A;  3FTY A;  4JW1 A;  3GW4 A;  3QOU A;  2R05 A;  4TXP A;  4G1T A;  2CHW A;  3CGH A;  3VLE A;  2IEJ A;  5G05 C;  3Q78 A;  4HXI A;  3UQ3 A;  2CFU A;  4U0S A;  3ONK A;  4I2Z A;  4F1S A;  3CVP A;  4U8V D;  4PH4 B;  4AV7 A;  4WWO A;  3ZGQ A;  2V5F A;  2B0O E;  2V4H C;  3ZPJ A;  4ME2 A;  5LCW C;  2Y69 E;  3CST A;  3JQ0 A;  3D9O A;  3PZ3 A;  3FEY A;  3Q49 B;  5DIZ A;  5BV1 A;  4JXT A;  3SFY A;  1MHQ A;  3B95 A;  1H0A A;  2IF4 A;  4BES A;  1K3Z D;  1S64 A;  4AVX A;  1KZP A;  5LOZ A;  3NOC D;  3TWV A;  4I1A A;  3UIO C;  2X6F A;  1IHG A;  3E34 A;  3SY2 A;  2H6G A;  1N4S A;  3LVQ E;  2EIJ E;  3CVN A;  3FU5 A;  3ASH A;  4I1O B;  3LY9 A;  1ZB1 A;  4KXK B;  3BUA A;  3L13 A;  3JUI A;  2XGM A;  5JHB A;  3T5V A;  1QQE A;  4I43 A;  2VSN A;  2GRR B;  4CDN A;  4IRU A;  4KT6 B;  2HE0 A;  1EPU A;  3WG7 E;  3X2Q E;  3AU5 A;  3KD7 A;  3SQV A;  5CER B;  3Q7A A;  2GGF A;  3OXG A;  3RSE G;  4E6H A;  1FVH A;  2PM6 A;  4B0Z A;  4PS7 A;  3TWX A;  5JJ7 A;  4CRW A;  2R2L A;  1OY3 D;  3LEW A;  4L2L A;  1K8K G;  4U8Y D;  5EYL A;  3RKV A;  1HX8 A;  4M3O A;  2RD0 A;  5KJN A;  4F1P A;  2WVI A;  2LAI A;  2J49 A;  5FIN A;  4LNG A;  4I6E A;  4C0E A;  4IN3 B;  2ZIS A;  3RAU A;  5EDS A;  3ZRH A;  5BUZ A;  4MS6 A;  3PEU B;  1IXV A;  4UWH A;  3LXU X;  4F3V A;  4JD2 G;  4ATG A;  2LUH A;  4LNU D;  4HLL A;  4JL0 A;  1TYQ G;  4FHK A;  4LEU A;  2VJ8 A;  4EPZ A;  3MV3 B;  3VTX A;  1MX4 A;  3SBT B;  1TJF A;  5M72 A;  4K5B A;  3TWT A;  2RFM A;  2H6H A;  1AWC B;  3ISM C;  3UIP C;  3RRM B;  5ANL A;  4G25 A;  3ZFW A;  4Y6C A;  4UQX A;  3ZVV A;  4F53 A;  2YHE A;  4U04 A;  5BNW A;  4KYO B;  5AQ7 A;  2DZN A;  2V5Q C;  5FZQ A;  3CHP A;  1NA0 A;  4CGV A;  3ZYQ A;  4MRU A;  2WMO A;  2LXM A;  3CK8 A;  4DX6 D;  4MLP A;  2I2O A;  3UM2 A;  4YDW A;  1INZ A;  4HOR A;  2VSX E;  3AG3 E;  3KS2 A;  3GYZ A;  3VLD A;  3ENE A;  1QBQ A;  3AS4 A;  4BTA A;  4HBD A;  1LTX A;  4O1P A;  3HYM B;  2Y4U A;  2KCV A;  4L9P A;  3C3O A;  4OAV B;  3DXM G;  5AN8 A;  2XZD G;  4XI0 A;  1UN8 A;  3R7Q A;  3RRN B;  1OXJ A;  4UWK A;  2KZT A;  4N5C A;  3B7T A;  3BU8 A;  1TN8 A;  3SFZ A;  4EQF A;  2MYO A;  4R7L A;  4C0M A;  1VDY A;  3D9P A;  2R59 A;  3B7U X;  4EZL A;  3FWV A;  1Y6I A;  4H7Y A;  4B8A A;  4I9E A;  3R9A B;  3CVY A;  3CHR A;  2HYZ A;  2I1J A;  2Y3A A;  3URZ A;  3FP3 A;  4B89 A;  1YYH A;  4KVM A;  3ABK E;  3V2X A;  4B93 B;  1NI1 A;  2KC7 A;  3CVQ A;  5AIJ A;  2H6F A;  5G04 J;  1B89 A;  5J90 A;  4GB9 A;  1HFA A;  4GYO A;  5AJL A;  5B1A E;  5ENS D;  3D9K A;  2L6B A;  3LDZ A;  3L22 A;  3CEQ A;  2VSO E;  3D9M A;  3FUE A;  2NSZ A;  3APD A;  3QKY A;  2LXL A;  2XRY A;  1E7U A;  3RJV A;  3QDN A;  4WAF A;  2MHK A;  5J08 A;  4JVS A;  3DPD A;  4UWL A;  1EYH A;  4N5Q A;  1ELR A;  4DLO A;  4EZJ A;  1OT8 A;  3L54 A;  2OVF A;  3PZ4 A;  4K5C A;  1OWP A;  4J8E A;  4CEM A;  3T8K A;  2R5S A;  3FUM A;  2WQ6 A;  3TWS A;  1D8D A;  3PUJ A;  4Y6W A;  4GTM A;  3ONL A;  1IQU A;  2F0Y A;  1HG5 A;  1S70 B;  4WNF A;  5AAO A;  4A55 A;  4LSZ E;  1H6O A;  4L1B A;  1Z3X A;  1BPO A;  2DIW A;  3EU5 A;  5FT9 A;  1NL4 A;  3HXC A;  3S7F A;  2X6K A;  3LY8 A;  5BPP A;  5CBN A;  3PZD A;  5CBO A;  2UY1 B;  4FA6 A;  2PZI A;  3MJW A;  2V8S E;  3C5R A;  3FU3 A;  3MEK A;  3FH5 A;  4GU5 A;  3LKU A;  2OND A;  4UWG A;  3OXL A;  3HXD A;  4WNG A;  4WWP A;  4GTS A;  3Q15 A;  5BXO A;  4G11 A;  4HLE A;  2C0L A;  4ATZ D;  4TUU A;  1TNY A;  3HIZ A;  2KZT B;  2XQ0 A;  5IY5 E;  4DJA A;  4J0U A;  3AAA C;  3FTX A;  2XGS A;  1N0Q A;  5EIL A;  1K1B A;  5FTP A;  4G23 A;  3UTM A;  1H2V C;  3FUL A;  5CEC B;  5G05 J;  5EX0 A;  3JQ1 A;  3UM0 A;  2FUL A;  4J8D A;  3G2S A;  1U3D A;  4EBA A;  1IQR A;  3FDH A;  3ZHE B;  1X5B A;  5ENR D;  3ASF A;  4FLB A;  4DLQ A;  1HF8 A;  3AJI A;  4YVO A;  2GRP B;  2ZGG A;  2FO7 A;  3E4B A;  2OOE A;  4Q69 A;  3B13 A;  1LD8 A;  3CV0 A;  5BT1 A;  3P2B A;  4WUY A;  3ZYK A;  3OAW A;  2YHC A;  3C72 A;  4Q96 A;  3AG2 E;  5T4Y A;  4GZD A;  3ABM E;  4N2S A;  5BXU A;  3IXE A;  2I9C A;  3D3M A;  1N4P A;  3FH7 A;  4A1S A;  4U7E B;  3MKQ A;  3NZS A;  4I6J A;  4F7A A;  2HO1 A;  3BQO A;  4L2Y A;  1UOH A;  3SGH A;  5KJK A;  1FPP A;  3CVU A;  3B7R L;  3S2A A;  5FZS A;  5LFA A;  4AY5 A;  5CHE E;  3CK7 A;  4G8K A;  4I1M A;  2XEE A;  3DSU A;  2DZO A;  3RIB A;  2BED A;  4BSZ B;  1E90 A;  4I17 A;  3ZEF A;  2GRM A;  5AJD A;  3HG0 D;  3UI2 A;  4ABN A;  1WAO 1;  4BET A;  2HM8 A;  1MX6 A;  3EUV A;  1UW4 B;  5BV0 A;  1OWL A;  3HHM A;  4V3I A;  3ZN3 A;  3D9H A;  2QFC A;  3NZU A;  4HQD A;  4X8Q A;  3G2T A;  4ACL A;  1TNZ A;  4JEH A;  2KXP C;  3APC A;  1PC2 A;  4Q94 A;  3UT8 A;  5CMW A;  5E75 A;  3C98 A;  1RZ4 A;  4RG6 A;  4G8L A;  3DXK G;  4FP7 A;  4UI9 J;  2XCC A;  5HKP A;  3NAW A;  2Y4T A;  1ELW A;  4IYP A;  1O1S A;  3SZ7 A;  3LYA A;  4GTV A;  3MGB A;  1QZ2 A;  4N3A A;  5HQ8 A;  5H7P A;  2A5U A;  3TAX A;  3TL5 A;  3T8M A;  2ETC A;  4ZFH A;  2GRO B;  2IOS A;  1MQS A;  4AXH A;  3NBN B;  2WXG A;  3DSW A;  3L17 A;  2FF4 A;  5FQ8 A;  3DST A;  5ENQ D;  3EIJ A;  5G04 C;  2XGO A;  3MYV A;  4JPS A;  2EIN E;  3U3W A;  3RK6 A;  2CFZ A;  2WXQ A;  1FCH A;  2YQ8 A;  5D0Q D;  2NYJ A;  4TXR A;  3L9T A;  1OUV A;  3CKB A;  4J8S A;  2J4B A;  4UQY A;  1DNP A;  2FO1 E;  2WXO A;  4U0Z A;  3UKU G;  1HE8 A;  5AAR A;  4BTB A;  2C2L A;  1IKN D;  3I3N A;  3C3Q A;  3I4R B;  3ZNG A;  3ZXP A;  5ENN A;  3HXB A;  4N39 A;  2P58 C;  3FUJ A;  4XX5 A;  5T8I A;  2XPZ A;  4ANU A;  2Y1L E;  3OTN A;  1GW6 A;  3RO3 A;  3SBS A;  3HXE A;  3T9K A;  3V31 A;  4GZ6 A;  3W9F A;  4JA9 A;  1Z5S C;  3ML9 A;  3IKO B;  3FUI A;  3ZYL A;  1D9S A;  2UWJ G;  3CIA A;  3D9J A;  4GCO A;  3QWW A;  1YMP A;  5ENP D;  2ZU6 B;  3KEZ A;  4C9B B;  1OCO E;  2EQX A;  3B7S A;  3O4Z A;  5AQ9 A;  2CG2 A;  3SD5 A;  3UKR G;  4JHK A;  3CVW A;  4GYW A;  4GTT A;  1Y8M A;  2VTB A;  5EID A;  5JJ6 A;  1LF8 A;  2YIN A;  5E76 A;  4BY6 A;  1Q2Z A;  2CG3 A;  5ENO D;  4XE0 A;  3ZHE A;  1XGW A;  5KWD A;  1TJC A;  2R17 C;  3FUH A;  4G26 A;  3EHN A;  3EU9 A;  3Q4A B;  3F6Q A;  3LS8 A;  4E85 A;  2KM4 A;  4EZK A;  4GZ3 A;  3VTY A;  2ION A;  2H6I A;  5C1D A;  1YCS B;  1JCQ A;  1ELK A;  2VYI A;  3MZL B;  4AP2 A;  1H6P A;  4JZY A;  3EHM A;  2WM9 A;  3U9W A;  3FUN A;  2WQ7 A;  4ANX A;  4ILH B;  2LAH A;  2VSY A;  4GYY A;  3MX3 A;  4FJY A;  2L6J A;  3ASO E;  3HXF A;  4YND A;  3FUF A;  3PUK A;  3W9G A;  3ZU7 B;  3TWU A;  5CCM A;  5ARG A;  3IHV A;  3Q47 B;  4RSY A;  4AM9 A;  4XEI G;  4BX9 A;  4NRH B;  4BFR A;  3DEO A;  1W3B A;  2QC9 A;  3PNT B;  2X6I A;  3FU0 A;  4HOT A;  2P9S G;  1L5J A;  4FHJ A;  3QJZ A;  1JWF A;  4IUL A;  2X38 A;  5G2N A;  3E30 A;  4O1O A;  5AQA A;  2J08 A;  4CYM D;  3FHE A;  1E7V A;  2AJA A;  2OCC E;  3MKQ B;  4D10 C;  5CRV A;  4OVV A;  4A63 B;  2PL2 A;  3Q9N C;  3I4G A;  4UI9 K;  2KAT A;  5KNG A;  4FLH A;  5CMY A;  4UI9 C;  1BD8 A;  1H2T C;  2RG8 A;  3U64 A;  4HB5 A;  2E0I A;  4HRM B;  3AG1 E;  4PUC A;  4CDM A;  2BKK B;  4KZC A;  1SQM A;  3S7D A;  2RKK A;  3HDX A;  3R9M A;  2P9N G;  4JC8 A;  4GTR A;  3D9I A;  5ARF A;  4LUN U;  1P5Q A;  3CQG B;  1H6K A;  4HFG A;  4B8C B;  4U96 D;  3RO2 A;  3PZ2 A;  4G2V A;  1IHB A;  4J7W A;  1DC2 A;  3SHF A;  5EKQ D;  4HVB A;  2DWZ A;  5D0O D;  2P9P G;  4F6R D;  4UUC A;  5B3S E;  5ITZ F;  1V55 E;  3CHS A;  4BX8 A; 
#chains in the Genus database with same CATH homology
 3L13 A;  2I9C A;  2E2E A;  3JUI A;  4DI3 A;  2XGM A;  5JHB A;  3D3M A;  3K9I A;  5DBK A;  3UT4 A;  3FH7 A;  4A1S A;  3MKQ A;  3NZS A;  4I6J A;  3T5V A;  1QQE A;  4I43 A;  1JUQ A;  2VSN A;  2HO1 A;  4L2Y A;  4F7A A;  3SGH A;  4CDN A;  4GA2 A;  5KJK A;  4IRU A;  2V4L A;  4KT6 B;  4BSX A;  1EPU A;  4K03 A;  2XCB A;  3CVU A;  1JWG A;  5ANR A;  3B7R L;  3AU5 A;  3CLJ A;  4XIF A;  3FUD A;  5FZS A;  1HXI A;  3S2A A;  2C0M A;  3CK7 A;  3KD7 A;  3NQP A;  5CHE E;  4AY5 A;  3QWV A;  4GCN A;  3FTU A;  1Z3Y A;  2GGF A;  3OXG A;  1WY6 A;  4I1M A;  3FY4 A;  4E6H A;  1FVH A;  2PM6 A;  2VGX A;  3APF A;  4B0Z A;  3SNX A;  4PS7 A;  2LNI A;  3CHQ A;  5JJ7 A;  3JCK C;  3RIB A;  4B94 A;  1NZN A;  3UX4 A;  4CRW A;  2L9B A;  3LEW A;  4L2L A;  4EEC A;  2PQN A;  4FC8 A;  1E90 A;  4I17 A;  2WXL A;  4I6G A;  3ZEF A;  2GRM A;  3TG4 A;  5FWQ A;  2JLB A;  1ZU2 A;  4CT4 A;  2IQC A;  3HVE B;  1H2U A;  2WXI A;  5AJD A;  4DPR A;  3RKV A;  1HX8 A;  1NP7 A;  2DCP A;  4M3O A;  3ASD A;  4J8F A;  1HS6 A;  3TJP A;  2RD0 A;  5KJN A;  2V0P A;  3P1U A;  2WVI A;  2LAI A;  4ABN A;  1WAO 1;  2J49 A;  3AS8 A;  3FTW A;  2J07 A;  3ZXS A;  2HM8 A;  1SZ9 A;  1UW4 B;  4I6E A;  4J6I A;  4C0E A;  1ZBP A;  3QAQ A;  5BV0 A;  3NF1 A;  4ANW A;  3HVE A;  4IN3 B;  1OWL A;  3HHM A;  4V3I A;  3BG0 B;  5EDS A;  3ZN3 A;  1Z6T A;  2QFC A;  3PRE A;  4BT8 A;  4OYS A;  3ZRH A;  3S7J A;  3EIQ C;  3MA5 A;  2I6H A;  3NZU A;  5BUZ A;  3G2T A;  2OVB A;  4MS6 A;  2BF0 X;  3PEU B;  4AIF A;  4ACL A;  4UWH A;  5JHA A;  3EJN A;  3LXU X;  4F3V A;  4ATG A;  4JEH A;  2X3M A;  2M63 A;  3APC A;  4WND A;  2PM7 A;  3MCX A;  1PC2 A;  4BWR A;  4JHJ A;  4JL0 A;  4Q94 A;  2KCL A;  3UT8 A;  5CMW A;  4FHK A;  5E75 A;  3AU4 A;  2IFU A;  4LEU A;  4HOQ A;  3FTZ A;  2VJ8 A;  3T5X A;  3C98 A;  4U8H A;  4KVO A;  5EX3 A;  4EPZ A;  4RG6 A;  3MV3 B;  3VTX A;  5KJL A;  4FP7 A;  3SBT B;  1TJF A;  4BT9 A;  1A17 A;  5M72 A;  2WB2 A;  4UI9 J;  4KZ0 A;  4ILG A;  5LCW J;  2XCC A;  2HR2 A;  3CHM A;  1UN9 A;  4O6F A;  4APO A;  2L0I A;  4GMJ A;  1E8W A;  4GPK A;  4U0U A;  4XZ4 A;  3CK9 A;  3FTS A;  5ANL A;  2Y4T A;  3RRM B;  1ELW A;  2AWI A;  4IYP A;  4G25 A;  3SZ7 A;  3LYA A;  3ZFW A;  3G2V A;  4Y6C A;  1HH8 A;  4UQX A;  3ZVV A;  4F53 A;  4UQZ A;  2YHE A;  1H19 A;  3MGB A;  4U04 A;  5KJM A;  5BNW A;  3LVR E;  4KYO B;  1QZ2 A;  2LSV A;  4N3A A;  5HQ8 A;  2WXK A;  1E8X A;  2X6J A;  1EF1 C;  5FZQ A;  2A5U A;  3CHP A;  2VQ2 A;  1NA0 A;  2L0T B;  3PH0 C;  4UWL A;  3ZIM A;  3LY7 A;  2NC9 A;  4CGV A;  3TAX A;  3TL5 A;  4N3B A;  3UMV A;  3T8M A;  3ZYQ A;  4A3V A;  3PDN A;  4MRU A;  3RRU A;  3CSF A;  2WMO A;  2IOS A;  1MQS A;  4AXH A;  4N3C A;  3CK8 A;  2VGY A;  2WXG A;  2BUG A;  3U66 A;  4MLP A;  3L17 A;  2FF4 A;  2I2O A;  4PDX A;  5FQ8 A;  1UJK A;  4PS3 A;  3EIJ A;  1INZ A;  5G04 C;  2XGO A;  3MYV A;  5HI7 A;  4JPS A;  4HOR A;  2VSX E;  2WXH A;  3U3W A;  1EDU A;  3RK6 A;  3KS2 A;  3GYZ A;  3VLD A;  3ENE A;  2CFZ A;  2WXQ A;  1FCH A;  2YQ8 A;  1JPL A;  5D0Q D;  4JHR A;  2XPY A;  3AS4 A;  4BTA A;  1N54 A;  2JEK A;  3CVV A;  4I9C A;  4AEZ C;  3BG1 B;  1OUV A;  3CKB A;  4GA1 A;  3LCA A;  3PVL A;  4J8S A;  2J4B A;  4FUL A;  3HYM B;  3LPZ A;  4P29 A;  2Y4U A;  1DNP A;  2KCV A;  1OWN A;  2OV8 A;  2WXO A;  4UQY A;  4TV3 A;  3ESK A;  4A3T A;  3FH8 A;  4U0Z A;  3DBS A;  5FQ6 A;  1HE8 A;  4XI0 A;  4BTB A;  4N2Q A;  1UN8 A;  2C2L A;  4KMO A;  4QFV A;  3R7Q A;  4APF A;  3RRN B;  3I3N A;  5T3R A;  4AY6 A;  2FBN A;  3I4R B;  3PS6 A;  3QK0 A;  4UWK A;  5ENN A;  4I2W A;  3TG5 A;  3R7R A;  2KZT A;  4N5C A;  1N52 A;  4N39 A;  2P58 C;  3B7T A;  3TXM A;  3FUJ A;  3L16 A;  3QWP A;  1E8Y A;  4XX5 A;  5T8I A;  3GZ2 A;  4AJW A;  3SFZ A;  4EQF A;  2XPZ A;  4R7L A;  4C0M A;  1VDY A;  2YNQ A;  3D9P A;  2I1K A;  4CDR A;  2R59 A;  4ANU A;  3OTN A;  3B7U X;  3D9L A;  1GW6 A;  4EZL A;  3IV0 A;  3RO3 A;  3FWV A;  1QNF A;  1Y6I A;  1YA0 A;  4H7Y A;  2NXP A;  4B8A A;  4I9E A;  3R9A B;  1PY1 A;  3SBS A;  3CVY A;  3CHR A;  5FQ4 A;  3EDT B;  1WM5 A;  4WWN A;  3ZYM A;  4GZ6 A;  2HYZ A;  2I1J A;  2J9Q A;  4JA9 A;  4W9R A;  2Y3A A;  3URZ A;  3FP3 A;  5BW8 C;  4B89 A;  4ACK A;  1S0P A;  3ML9 A;  4KVM A;  2XPI A;  1OWM A;  3UPV A;  3IKO B;  1KLX A;  3FUI A;  1UG3 A;  4GZ5 A;  3ZYL A;  2UWJ G;  5FJY A;  3CIA A;  4JEU A;  2KC7 A;  3CVQ A;  2MRI A;  3G2W A;  5AIJ A;  2XHE A;  2PQR A;  3D9J A;  4GCO A;  3QWW A;  2WXN A;  4GAA A;  4HOS A;  2ZU6 B;  3KEZ A;  4C9B B;  5G04 J;  3UUX A;  4AOF A;  1B89 A;  5J90 A;  2X6H A;  2EQX A;  3B7S A;  2AXV A;  3O4Z A;  3QB2 A;  4GB9 A;  2CG2 A;  3SD5 A;  3TGO A;  2WQH A;  4JHK A;  1HFA A;  4GYO A;  3CVW A;  4GYW A;  5AJL A;  2VTB B;  1Y8M A;  2VTB A;  4KBQ A;  2ILR A;  3I5P A;  3D9K A;  4ANV A;  2DBA A;  5JJ6 A;  1LF8 A;  3IHY A;  3MKR A;  2FI7 A;  3ULQ A;  3LDZ A;  5CCL A;  2YIN A;  3L22 A;  5E76 A;  4BY6 A;  3CEQ A;  3WXX A;  3OXF A;  4GA0 A;  2CG3 A;  5FZR A;  4URK A;  2VSO E;  4FAD A;  2A4Z A;  3D9M A;  3FUE A;  2NSZ A;  3APD A;  3U4T A;  3D9N A;  3CHO A;  5KCM A;  1U3C A;  2WXM A;  3QKY A;  4XE0 A;  2MOW A;  3FU6 A;  2XRY A;  3ZHE A;  1E7U A;  1XGW A;  3RJV A;  5LP0 A;  3IEG A;  2UY1 A;  3QDN A;  4WAF A;  1TJC A;  2MHK A;  5A7D B;  5JJT A;  5J08 A;  2R17 C;  4JVS A;  4LER A;  3DPD A;  4H7X A;  3CKC A;  1SZA A;  1EYH A;  1HU3 A;  3BEE A;  2IOL A;  3FUH A;  4G26 A;  4PS8 A;  1ELR A;  3EHN A;  4L23 A;  4RG9 A;  4TRQ A;  4DLO A;  3IBE A;  4LRZ A;  3G2U A;  3Q4A B;  4EZJ A;  3PRZ A;  3LS8 A;  3L54 A;  4A1G A;  2CHZ A;  2OVF A;  4E85 A;  5G55 A;  3Q5M A;  2KM4 A;  3ESL A;  1OWP A;  4GZ3 A;  4EZK A;  3VTY A;  4FJZ A;  3S7B A;  2ION A;  3ZW3 A;  4J8E A;  4CEM A;  4ILI A;  2KCK A;  1PAQ A;  5C1D A;  4G24 A;  2AW6 A;  3CVX A;  4U07 A;  2R5S A;  4JA7 A;  3FUM A;  5AEN A;  1ELK A;  2BTD A;  2VYI A;  1NA3 A;  3FEX A;  2WQ6 A;  1FVF A;  2WPV A;  3MZL B;  4AP2 A;  4GZC A;  2VGX B;  3L6A A;  3JYS A;  3PE3 A;  3EHM A;  4JZY A;  2WM9 A;  2XEV A;  3U9W A;  2LSU A;  3PUJ A;  4Y6W A;  3FUN A;  2WQ7 A;  2Q7F A;  3CQC B;  3ONL A;  4ANX A;  2AVP A;  4L7T A;  4ILH B;  1IYG A;  2LAH A;  2VSY A;  1IQU A;  4GYY A;  3FTV A;  3GZ1 A;  3MX3 A;  4FJY A;  4CGW A;  3SF4 A;  1HG5 A;  2L6J A;  2WXF A;  3MV2 B;  3PE4 A;  2AXU A;  4WNF A;  4UWF A;  2GW1 A;  4YND A;  4LCT A;  3FUF A;  4A55 A;  3PUK A;  5CCM A;  4NQ0 A;  5ARG A;  5A6C A;  3IHV A;  3Q47 B;  4L1B A;  1Z3X A;  1BPO A;  2DIW A;  5FT9 A;  2J09 A;  3LJ3 A;  4RSY A;  4AM9 A;  3S7F A;  3ML8 A;  2X6K A;  4HS2 A;  1DVP A;  3LY8 A;  1E8Z A;  5BPP A;  3QC1 A;  4CCA A;  4BX9 A;  1E96 B;  3PZD A;  2UY1 B;  4NRH B;  4OVU A;  3CR3 A;  4EBA G;  2QY7 A;  4FA6 A;  2PZI A;  3MJW A;  4BFR A;  4FU3 A;  2V8S E;  3RU0 A;  1XNF A;  3FU3 A;  3MEK A;  1W3B A;  2GRL A;  3FH5 A;  3LKU A;  3PNT B;  4GU5 A;  3VLF A;  2OND A;  2X6I A;  3GZS A;  4YVQ C;  3N71 A;  3PEV B;  4UWG A;  3FU0 A;  1TEZ A;  1HZ4 A;  3OXL A;  4NUR A;  3QAR A;  4HOT A;  3QNK A;  4WNG A;  4WWP A;  4DI4 A;  1L5J A;  3FTY A;  4GML A;  4JW1 A;  4FHJ A;  3GW4 A;  3QJZ A;  3Q15 A;  3QOU A;  2LO6 A;  1HG2 A;  3ASG A;  1JWF A;  4G1T A;  2CHW A;  2X38 A;  4IUL A;  3TXN A;  4XKC A;  5G2N A;  4G11 A;  4HLE A;  3CGH A;  3VLE A;  3PNL B;  2C0L A;  2J08 A;  3FHE A;  3L08 A;  1E7V A;  1KT0 A;  1HO8 A;  4TUU A;  5G05 C;  3MKQ B;  4D10 C;  3HIZ A;  2WMN A;  1UJJ A;  4HXI A;  3UQ3 A;  2KZT B;  2XQ0 A;  4NAC A;  4OVV A;  2PL2 A;  2CFU A;  4DJA A;  4J0U A;  4U0S A;  3ONK A;  4I2Z A;  1KT1 A;  3FFL A;  3I4G A;  4F1S A;  4UI9 K;  3FTX A;  2KAT A;  3CVP A;  4RVB A;  4FLH A;  2XGS A;  4PH4 B;  2IJG X;  4UI9 C;  4WWO A;  4XI9 A;  5CMY A;  2V5F A;  2WXR A;  3ZGQ A;  4AV7 A;  3ZPJ A;  5LCW C;  4ME2 A;  4HOU A;  3CVL A;  1H2T C;  3KAE A;  2RG8 A;  3FUK A;  4G23 A;  5FTP A;  3U64 A;  1H2V C;  2E0I A;  3CST A;  3FUL A;  2FEZ A;  4DK5 A;  4PUC A;  4CDM A;  5G05 J;  5EX0 A;  4MKT A;  3JQ1 A;  4KZC A;  3JQ0 A;  1SQM A;  2AXZ A;  2CHX A;  3D9O A;  5AYW D;  2FUL A;  4J8D A;  3G2S A;  3S7D A;  5A23 A;  1U3D A;  3FEY A;  2WXP A;  3HDX A;  3Q49 B;  4EBA A;  1IQR A;  3FDH A;  2IU1 A;  5DIZ A;  5BV1 A;  5LX8 A;  4JXT A;  1MHQ A;  3ZHE B;  1X5B A;  1H0A A;  5C2Y A;  4JC8 A;  5LFA A;  2IF4 A;  3D9I A;  3ASF A;  5ARF A;  3O48 A;  4LUN U;  4FLB A;  4AVX A;  1P5Q A;  5LOZ A;  3CQG B;  1H6K A;  4HFG A;  4DLQ A;  4B8C B;  2J4D A;  1HF8 A;  4I1A A;  5FQ7 A;  4YVO A;  3RO2 A;  2WXJ A;  2X6F A;  2FO7 A;  3E4B A;  1IHG A;  4XKB A;  2OOE A;  4Q69 A;  4G2V A;  3B13 A;  4N2S A;  3SHF A;  3CV0 A;  5BT1 A;  3LVQ E;  4CT0 A;  4U63 A;  5EKQ D;  4HVB A;  5D0O D;  3UT7 A;  2XRZ A;  3P2B A;  3AS5 A;  4WUY A;  3CVN A;  3FU5 A;  3ZYK A;  3OAW A;  2YHC A;  3ASH A;  4K0R A;  4I1O B;  4Q96 A;  3LY9 A;  4WNE A;  1OWO A;  3SI5 A;  3CHS A;  5T4Y A;  4GZD A;  4KXK B;  4BX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...