3BEEA

Crystal structure of putative yfre protein from vibrio parahaemolyticus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
NAVTATQLAAKATTLYYLHKQAMTDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRVTIIESINKAKKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of putative YfrE protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Structural genomics, unknown function
molecule keywords Putative YfrE protein
total genus 32
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3beeA00
2LNIA 3MV2B 2E2EA 2Y4TA 4O6FA 3URZA 4I9CA 1E96B 4GCOA 3CVQA 5D0OD 3RO2A 4AM9A 5C1DA 4IN3B 5AYWD 3S7FA 1KT0A 3Q49B 1IHGA 4I2ZA 3AS8A 3SZ7A 5KJNA 1NA0A 4G2VA 4H7YA 2QFCA 2C2LA 4XI9A 3RKVA 2J9QA 2UY1B 2YHCA 4GYOA 4A1SA 3ZPJA 3RU0A 2OOEA 3FWVA 3Q47B 1TJCA 4GZ3A 4NRHB 3KAEA 4YVQC 3PE4A 3N71A 4Y6WA 4ME2A 3TG5A 2KC7A 4UQZA 4BTBA 4AIFA 3ZHEA 2XEVA 5HI7A 1WM5A 3CVLA 2C0MA 3FP3A 3K9IA 3MEKA 3RIBA 4AY5A 2FF4A 4RG9A 4U0UA 2YQ8A 4N2QA 3CVNA 2XPIA 2AVPA 3KD7A 3S7JA 5DBKA 5CCMA 3Q15A 3U4TA 4GPKA 3ULQA 3GYZA 3QKYA 4U07A 4W9RA 5JJTA 2UWJG 4BWRA 4HOSA 3QWVA 3GZ2A 4KXKB 5EX3A 3NF1A 2WQHA 3ASHA 5ARGA 3SF4A 4G26A 3Q5MA 2IF4A 3ESKA 3LPZA 3O48A 4UI9C 5FTPA 5CCLA 4N2SA 2XGOA 2UY1A 3UQ3A 2FO7A 5G04J 2KCKA 3LCAA 3OXGA 1YA0A 2P58C 3CK7A 3E4BA 5FT9A 5A7DB 3TGOA 1OUVA 2R5SA 2BUGA 4N5CA 2GW1A 2LSVA 4J8EA 2PL2A 4U0ZA 3TAXA 4J8FA 1ZBPA 5JJ6A 4GYWA 4GCNA 4WNFA 5D0QD 2XGSA 5KJLA 1P5QA 3ASDA 5FJYA 5FZQA 3LY8A 4U04A 3EDTB 3OXLA 3ZFWA 4HOUA 5BNWA 2VSNA 4GZ6A 3QWWA 4KBQA 4YVOA 3CKBA 2WPVA 3UPVA 1NA3A 3LKUA 4GA0A 3U3WA 3QDNA 3WXXA 1WAO1 2NC9A 1KT1A 3OXFA 4N39A 3Q4AB 2VGXA 3UUXA 5CHEE 2FBNA 3LY9A 4H7XA 4J8DA 3TG4A 3MV3B 1PC2A 3CV0A 4I2WA 3ZN3A 4BTAA 4N3CA 4I1AA 5G05J 5M72A 3GW4A 4G24A 2V5FA 3CKCA 2JLBA 3JYSA 3PE3A 3VTYA 1HZ4A 4J0UA 1IYGA 5EKQD 1ELRA 2XCCA 3BEEA 4HOQA 4WNGA 3ASFA 1ZU2A 4WUYA 4Y6CA 4KYOB 5FZRA 5BW8C 3S7DA 4BT8A 4CGVA 3LYAA 4NQ0A 3MKRA 2C0LA 4UI9K 4BT9A 4G23A 1HXIA 5LCWJ 3IEGA 2I6HA 3GZ1A 3LY7A 4GYYA 4XI0A 4JA7A 2FEZA 2PQRA 2Y4UA 4I17A 3CK8A 4I9EA 3HYMB 3RJVA 4N3BA 5HQ8A 2VQ2A 2ONDA 2VSYA 5G05C 5LCWC 4N3AA 3PDNA 3ZGQA 2L6JA 1Y8MA 3ASGA 2KCVA 4CGWA 4GA2A 1KLXA 5G04C 4GZ5A 4APOA 4G1TA 3KS2A 2VGXB 5JJ7A 4HORA 3R9AB 1QZ2A 3FFLA 4EQFA 1A17A 1W3BA 5EX0A 4B94A 1FCHA 5KJMA 2PQNA 3CVPA 4JHRA 1QQEA 4YNDA 4HOTA 2XGMA 2LSUA 4CDRA 4RG6A 1NZNA 4LEUA 3AS4A 2VGYA 4WNEA 5DIZA 5A6CA 5BT1A 1HH8A 4U0SA 4ABNA 2HR2A 5KJKA 2KATA 4UQYA 3QWPA 3MA5A 3AS5A 3QOUA 3CK9A 4UQXA 4WNDA 3S7BA 2MHKA 3VTXA 3ZHEB 4AY6A 1XNFA 1ELWA 4JA9A 4UI9J 3RO3A 4XIFA 5FZSA 3CEQA 4G25A 2HYZA 2HO1A 2FI7A 4F3VA 2IFUA 2PZIA 2KCLA 5ARFA 2XCBA 2Q7FA 2VYIA 4GA1A 4JL0A 1B89A 2DBAA
chains in the Genus database with same CATH superfamily
3MV2B 2VJ8A 5ENRD 1N4QA 3AG1E 1S0PA 4C9BB 1SW6A 4U07A 2I1KA 4FLHA 2DCPA 3O48A 5KNGA 3UQ3A 2RFAA 2P9LG 3DXMG 4K5CA 3EHRA 3QAQA 5A7DB 3FTYA 3ZEFA 3FHEA 2OEWA 1K3ZD 4CZ2D 3E37A 3TWTA 1BU9A 1JPLA 2FULA 1AWCB 2KZTB 4H7XA 2EIME 3NQPA 3CHOA 3FTWA 3MX3A 4BT9A 3IEGA 3LY7A 2H6FA 2WXRA 3QJZA 2Y4UA 3RJVA 3PZDA 4N3BA 3IBEA 3PEUB 5AJDA 5FQ8A 2CFUA 2R2LA 4BEPA 1OY3D 3ZYQA 2NXPA 2WXQA 3CVPA 4F1PA 2XGMA 4GZDA 2J07A 3DSSA 5A6CA 3CK9A 5FZSA 1TNBA 4JC8A 2E2EA 1BLXB 1E90A 3ABME 3TWXA 4H7YA 1UJJA 2WQ6A 3FWVA 3Q47B 3N71A 3UM3A 3NAWA 3ENEA 2R17C 1WM5A 2BKKB 1E8YA 2YQ8A 5FQ7A 3B7TA 4GU5A 3LEWA 3ZVVA 3ULQA 1H6OA 2EIJE 2WXKA 3DBSA 5JHBA 2WMOA 1MYOA 3Q79A 1G3NB 1N4SA 3UTMA 4EBAG 3C3RA 2GW1A 2A5UA 3TAXA 2VTBA 4GPMA 5BUZA 3EDTB 2WQ7A 3D9PA 2GROB 5CEAA 4YDOA 4HRLA 1S70B 3FU0A 4JVSA 5BW8C 4CGVA 4ZFHA 2WVIA 3G2TA 2ZISA 4I17A 2ZIRA 3CVVA 3I3NA 3CQGB 2KZTA 1DC2A 2NYJA 1WG0A 5D2MC 2PQNA 1RW2A 3CQCB 4CDRA 3SFZA 3UT7A 1Z6TA 2IU1A 4M7CA 2IFUA 2H6IA 2JEKA 4IULA 1OWOA 3TWSA 3AS8A 2QFCA 3ZRHA 3JQ0A 2J9QA 3Q78A 2LO6A 3RU0A 3Q7FA 2OOEA 4GZ3A 3DSWA 4AEZC 4BTBA 3BU8A 4GMLA 3CHMA 4A63B 4N2QA 1MJ0A 4G8LA 5DBKA 1L5JA 1NFIE 1N9AA 2WMNA 3AG3E 4E6HA 4RVBA 4DLOA 4B8CB 4CYMD 3PNTB 1SQMA 3FTZA 5EYPF 4KVMA 3FUEA 1BI8B 4RLYA 4U0ZA 3PH0C 4EZKA 1ZBPA 4GCNA 3UMVA 3ASDA 2ZGGA 3D9IA 3T5VA 3G2WA 1V54E 4GA0A 1OWMA 3Q9UC 1DNPA 3GW4A 3JYSA 3HHMA 1HZ4A 3EHQA 2XCCA 5E76A 4HOQA 5B1AE 3ASFA 4Y6CA 4BT8A 1BD8A 1X5BA 2R59A 3B13A 4XE0A 3PS6A 5FWQA 3PNLB 3RRMB 2L0TB 4FHJA 3KS2A 2V4HC 1XGWA 1ZB1A 3ZYLA 2XHEA 1W3BA 5LX8A 1HU3A 3L17A 4V3IA 3ZIMA 4MKTA 4KZ0A 2LXMA 3QWPA 3SY2A 3JUIA 4EPZA 3UT8A 3SO8A 3KEZA 4XZ4A 2LNIA 4FP7A 3RO2A 3SZ7A 1MX6A 4YVQC 3WG7E 3V79K 3RIBA 3NOCD 3QNKA 3U4TA 3FH7A 2VSXE 2WXIA 2J09A 4BWRA 4HOSA 2R02A 1OCOE 4G26A 3FU3A 2X6KA 3RRUA 4HRNA 1E8WA 2H6HA 3HRAA 2IEJA 5LFAA 2XGSA 4KVOA 1P5QA 3L16A 1Y6IA 3LY8A 1DCQA 4HVBA 4GZ6A 3CKBA 1NA3A 3WXXA 3FEXA 1KT1A 4Q69A 4J8DA 3W9GA 4TXQA 1PC2A 3ZN3A 4N3CA 4I1AA 1N11A 4U8YD 3CKCA 2JLBA 3I4RB 3PEVB 4M3OA 1ZU2A 2X6JA 4NQ0A 2F37A 2EILE 4KT6B 2L9BA 2ONDA 2V4LA 4L9PA 3B95A 3CHRA 4HORA 4HB5A 4JHRA 2LSUA 4D10C 4HLLA 5KCMA 4WNDA 5AQAA 3TL5A 2HO1A 1LD7A 4ILHB 2CG2A 2VYIA 1U2VG 2DBAA 1OXJA 4LNUD 3S7FA 3UIPC 2J08A 5ANRA 1NA0A 4G2VA 1N4RA 1SA4A 3DSTA 3U66A 3ZW3A 4Y6WA 2KBXA 3ZU7B 5AAOA 4U0UA 3CVNA 4ILGA 3KD7A 4B8AA 3D9OA 3CHQA 5ARGA 2WQHA 2GRQB 4OAUC 4U7EB 2P58C 4L1BA 2R5SA 1S63A 2PL2A 4GTOA 1E8ZA 3EIQC 2X6HA 2I1JA 2V5QC 4I43A 3QWWA 2BKGA 4FJZA 3UI2A 3QDNA 4TUUA 2DYRE 4O1OA 3EHNA 3OXFA 1HF8A 1TNZA 2HM8A 3MV3B 1K1BA 3FTUA 1KZPA 4WUYA 2X6IA 3LYAA 4ATGA 2B0OE 3MKRA 4UI9K 3PREA 4CT4A 1VDYA 3DXKG 3HXDA 4GZ5A 5BPPA 4DI3A 2YHEA 1UG3A 4LEUA 4JHKA 3IXEA 4AIFA 4UQXA 1H6KA 4DLQA 4XIFA 3CEQA 1UJKA 2CFZA 3NB2A 4U63A 1UW4B 3SHFA 2LXLA 5BNWA 2DVWA 1IKND 3AU4A 3TG5A 1H2UA 4G11A 5KNHD 3ABKE 4JEUA 4A3TA 4RG9A 5EN5D 2XEEA 5EIBE 1MQSA 4FHKA 3NF1A 3ESKA 3PZ3A 4LUNU 3CSTA 2KCKA 2P2CP 4JW1A 3E4BA 3TGOA 1TNYA 4X8QA 5D0QD 5KJLA 2AXUA 4FA6A 4EZJA 3LY9A 3AU5A 4FU3A 3B7SA 4TXPA 1ELRA 4BESA 1HX8A 4F7AA 4AP2A 3CVUA 1FVHA 4PS3A 2XQ0A 4Q96A 4NACA 1JWFA 4I1OB 2IQCA 2V0PA 4L2YA 4GA2A 5G04C 1UOHA 3FUNA 3ULYA 2KM4A 3TWUA 2VGYA 5EILA 3QOUA 3S7BA 5D66A 4UI9J 4JA9A 5AQ9A 1FVFA 4J8SA 2ZU6B 1JCQA 4FULA 3NBNB 3CVYA 3L22A 3D9LA 5A23A 2DWZA 3APCA 2JABA 3D9HA 4XI9A 5CRVA 3UKRG 3ZPJA 3R7QA 2DZOA 1H2VC 2KC7A 5ENPD 3IKOB 1MX2A 2R03A 1KZOA 1EPUA 3ZYMA 4KXKB 3EUVA 4N2SA 3JUEA 2WXHA 4KMOA 5AIJA 3EU9A 3LVRE 1Z3YA 3VLDA 3DEOA 3F6QA 5EIDA 1YYHA 5FZQA 4UWKA 3LJNA 3OXLA 4YVOA 1N4PA 3FUJA 4GMRA 5FIOA 2BEDA 5M72A 2V5FA 4QFVA 5ENOD 1HFAA 2BF0X 4WNGA 4CGWA 4KYOB 3S7DA 3T8KA 2P9UG 5T8IA 1O1TA 2CHWA 2IONA 4A55A 3U64A 2YNQA 4QQIA 3ZGQA 1NL4A 3ASGA 3VLEA 4URKA 2ZXWE 4C0MA 4G1TA 3DSVA 3TXNA 2RFMA 3Q7AA 5BT1A 3MA5A 2FO1E 2F0YA 3PUJA 4G25A 4BFRA 4ATZD 4F3VA 3MCXA 3ASNE 4O6FA 4F6RD 5D0OD 1E96B 1D8DA 3RSEG 3UINC 3ZKJA 5BXOA 4GTVA 3FU5A 2UY1B 3U9WA 3AJIA 1EDUA 1QYMA 4GTQA 2IJGX 1NI1A 2XEVA 3ASOE 2X6FA 3B7UX 3MYVA 3Q15A 2GRPB 3NOGD 4LNBA 3KSLA 2Y0BG 5FINA 5LOZA 3LPZA 4O1PA 2WXLA 4PS8A 4OYSA 3HG0D 4AJWA 3D9MA 1HO8A 5FJYA 1IHBA 5HRYA 5CEDB 4U04A 2XRYA 2VSNA 3EHMA 1Q2ZA 3ONLA 2NC9A 3FUDA 3QC1A 4LSZE 3IHYA 3NZUA 1OWPA 1SZ9A 3JCKC 3R9MA 3D9KA 3HXEA 1S64A 2J49A 1H6PA 4GTRA 4G23A 1HXIA 4JPSA 5CBNA 5LCWJ 4JD2G 4BX9A 3BG0B 3E33A 5G05C 1O1SA 5HKPA 4DX5D 3JXJA 4HS2A 4C48B 3FFLA 4EQFA 3GZSA 3FTSA 2HR2A 4HI8A 5CCMA 4OVVA 4TRQA 3ZHEB 4DX1A 5JHAA 2MHKA 3QARA 3HXBA 1QNFA 4HBDA 2Y4TA 3LDZA 4FLBA 4GCOA 3L82A 4AM9A 3HIZA 1E8XA 4GYOA 5AN8A 1O1RA 5FQ4A 4AOFA 4XKBA 3CIAA 2C0MA 4MBGA 4DX2A 3KEAA 1OCCE 3FU6A 2E0IA 3SFYA 4APFA 4ACLA 3ASHA 2UY1A 2XS1A 2OVFA 4DUIA 1RZ4A 4N39A 2WXOA 3UUXA 3PRZA 5KWDA 3VTYA 1O5MA 5FQ6A 5FZRA 5E75A 1U3CA 2AXVA 3PZ4A 3SD5A 2I6HA 4BY6A 1MX4A 4JA7A 2PQRA 3HYMB 5T4YA 3J5PA 3PDNA 2XPYA 1K8KG 4IRUA 3HXCA 1A5EA 4RSYA 2P9PG 2LAIA 3SNXA 4ANWA 2RG8A 4ZHBA 4ACKA 2KXPC 3T9KA 3G2VA 2KCLA 5G55A 4YDWA 3ABLE 3QB2A 2A4ZA 2YHCA 4XKCA 3DEPA 1HE8A 2DZNA 2A5EA 4MRUA 3ZHEA 1OCZE 1V55E 1FT1A 3RAUA 2XPIA 3AG2E 1N54A 2WXGA 4GPKA 4WWNA 5JJTA 5AQ7A 4K5BA 5EX3A 5EDSA 4JEHA 3OXGA 3RRNB 1YA0A 5FT9A 1DVPA 1OCRE 2ETAA 1FPPA 4OVUA 5T3RA 1N95A 4BX8A 4NIKA 4KBQA 3UPVA 3UX4A 1HS6A 3RK6A 4FC8A 3Q4AB 3FTXA 4BTAA 3CV0A 4I2WA 1TJFA 4FADA 4BSXA 1FT2A 4MS6A 2X38A 4UWFA 2H6GA 1LD8A 3DSUA 1OWLA 4N3AA 1DCEA 2WXMA 3E30A 1KLXA 2VSOE 3FUKA 3R9AB 2VGEA 1BPOA 4B93B 1JUQA 4I6EA 4U8VD 4RG6A 3I5PA 4UWLA 4WNEA 2CG3A 4U0SA 4ABNA 5KJKA 3B7RL 4GTPA 1ELWA 2HYZA 4L23A 1HG5A 4HQDA 4LG6A 2YINA 3QK0A 4HI9A 2AWIA 5C1DA 3Q49B 5C2YA 4LERA 2L6BA 4NRHB 3CGHA 2NSZA 5BV1A 3SGHA 3K9IA 2I9CA 3SBTB 4BSZB 2EINE 3QKYA 3FUFA 4P29A 1Z3XA 1TNOA 3VLFA 5FTPA 1IXVA 4DI4A 2GRNB 2AW6A 5CBOA 2EQXA 3P1UA 5ENNA 2LSVA 3UIOC 1JCSA 4GYWA 4WNFA 2OEVA 3CVXA 5JMND 4DX6D 2RKKA 3LKUA 1WY6A 4JHJA 2VGXA 5H7PA 5HS0A 1E7UA 3TG4A 4ANUA 2I2OA 3CSFA 2LUHA 4G24A 3B7BA 5CMWA 4CEMA 2XPZA 4ILIA 1TEZA 2R05A 3FUHA 3ZYKA 2GRLA 3UM1A 2FEZA 3ONKA 2J8SD 4YDEA 2OV8A 1INZA 4GTTA 2KCVA 2VGXB 4CRWA 3CHPA 5JJ7A 4LNGA 1A17A 3TXMA 3TJPA 2P9NG 3LJ3A 3PZ2A 1QBQA 5DIZA 3D9NA 2DYSE 2KATA 3D3MA 1PY1A 2IO3C 3L54A 3LXUX 5ARFA 4PS7A 4BETA 1JWGA 1B89A 1FCHA 1LF8A 2WXPA 3L9TA 1UN9A 3FH8A 2MYOA 3FTVA 3LS8A 4IN3B 5AYWD 1KT0A 4I2ZA 2RD0A 1N0QA 3TWWA 3P2BA 3ESLA 4B89A 4DJAA 4UQZA 2V8SE 3CVLA 4MLPA 3CVWA 4AY5A 3HVEA 3FDHA 3DSXA 3C72A 4W9RA 3SF4A 4A3VA 4FJYA 2IF4A 5CCLA 2WXFA 2XGOA 2FO7A 5G04J 3EJNA 3TWQA 1OUVA 2BUGA 1TN7A 2QYUA 3CLJA 5ITZF 2AJAA 3HVEB 3FUIA 2PM7A 4TV3A 3FEYA 3DPDA 1K1AA 1OT8A 2FBNA 3W9FA 3S2AA 4K03A 4J0UA 3APFA 3L08A 4PH4B 3Q9NC 5EYLA 1H19A 3FY4A 2CHXA 5B1BE 2IOSA 4L2LA 4XI0A 3V30A 4GTMA 3CK8A 4I9EA 4WAFA 4CCAA 2VQ2A 2XZDG 1Y8MA 3TWVA 4HRMB 2WM9A 2QZAA 4B94A 2J4BA 4YNDA 1HH8A 1TYQG 4JXTA 1XNFA 4WWPA 5AJLA 4U95D 4RQIA 4GA1A 3IHVA 3UXGA 5KJMA 4GZCA 3D9JA 5KJNA 4ANVA 4AV7A 3KAEA 3V31A 3FP3A 3MEKA 1EF1C 4TUMA 3T8MA 5B3SE 2UWJG 3QWVA 4HNAD 3LCAA 3CK7A 5IY5E 4JB8P 3FUMA 2L0IA 1JCRA 4I6GA 2P9SG 2M63A 4HLEA 1H2TC 2WPVA 1E7VA 3G2UA 3I4GA 4DPRA 1TNUA 1WAO1 5CHEE 2VTBB 1N94A 5G05J 5ANLA 3PE3A 3PZ1A 1PAQA 1SA5A 3BEEA 1ELKA 3ZNGA 4LRZA 2Y1LE 1UN8A 2ETBA 4XEIG 3GZ1A 2PM6A 4I1MA 1N0RA 2ZGDA 2LAHA 1U3DA 3PUKA 3IV0A 3MKQB 5J08A 4APOA 3UT4A 3BQOA 4UWHA 4HOTA 3L6AA 2IY0C 3X2QE 1NZNA 3AS4A 2F8YA 2QYJA 2QY7A 3Q73A 4UQYA 3C3QA 3AS5A 5ENQD 2P9IG 1YCSB 4L7TA 2XCBA 5LP0A 2WXJA 3CVQA 2Y3AA 3ZXSA 1IHGA 4BERA 4A1SA 5KBAA 5CECB 4CDMA 1BI7B 2XEHA 2FF4A 2GRRB 3E34A 4B0ZA 1GW6A 2ETCA 2AVPA 3UM2A 3ZUVB 4IYPA 1MHQA 3DPYA 4J8EA 3ML8A 4J8FA 1IQUA 3OAWA 4JZYA 3MGBA 4PDXA 4Q94A 4I6JA 1MZCA 3E32A 2P9KG 5AENA 3OTNA 4K0RA 4U8HA 3ML9A 1WDYA 5EKQD 1KPSB 3T5XA 3ZFWA 2C0LA 1N52A 4AXHA 3FULA 1TN8A 4GTSA 5HQ8A 4EZLA 2Y69E 4CT0A 2IOLA 2ILRA 2IO2C 2EIKE 1Z5SC 3Q75A 4HFGA 3C3OA 2GGFA 3RO3A 2CHZA 1D9SA 4DX7D 2J4DA 3SFXA 3MKQA 3BUAA 4A1GA 3RKVA 3C5RA 1NP7A 4PUCA 4DRXE 5CMYA 1TJCA 3PE4A 4LCTA 4ME2A 3ULEG 5HI7A 5J90A 3AAAC 3S7JA 3GZ2A 4ANXA 2XRZA 2B6CA 4UWGA 3APDA 1TN6A 2XZTG 2GRMA 5CRUA 3JQ1A 2X3MA 4F53A 4NURA 3LVQE 5G2NA 4O60A 4UUCA 3FH5A 3SI5A 3U3WA 4Z68A 4EBAA 3NZSA 3L13A 4HXIA 3HXFA 3ZXPA 3HDXA 4YDYA 2XENA 4GYYA 3EU5A 3J5QB 3MJWA 3BG1B 2VSYA 4DK5A 4OAVB 4AVXA 3ISMC 1HG2A 3V2XA 5ENTD 2MRIA 4EHMA 1QZ2A 5JA4D 4GB9A 5EX0A 1EYHA 2PNNA 1QQEA 1AP7A 4N5QA 3MZLB 3O4ZA 2OVBA 3VTXA 3UKUG 2HE0A 4K5AB 2PZIA 4KZCA 4JL0A 3EIJA 4HOUA 3URZA 4I9CA 3SQVA 2WB2A 2C2LA 3UM0A 4E85A 3CR3A 4G8KA 1H0AA 3PVLA 1YMPA 1SZAA 1OWNA 3C98A 3DWLG 3GYZA 2MOWA 4TXRA 2XS8A 1TR4A 3Q5MA 4UI9C 3TWRA 5AQBA 5AARA 4EECA 4GMJA 4N5CA 2AXZA 5JJ6A 3R7RA 4GAAA 4U96D 4WWOA 3CHSA 5ENSD 5CERB 4J6IA 4F1SA 1IYGA 3JXIA 1SVXA 3KSQA 2QC9A 5BXUA 2BTDA 3SBSA 4J8YA 1D8EA 3DRAA 2DIWA 2OCCE 5LCWC 2L6JA 4C0EA 1LTXA 4J7WA 4R7LA 1X81A 5BV0A 2WXNA 3G2SA 4AY6A 3AG4E 1IQRA 3V2OA 2FI7A 4CDNA 2Q7FA 2F8XK 4XX5A
chains in the Genus database with same CATH topology
3MV2B 2Y4TA 3LDZA 4FLBA 3D9JA 4GCOA 4AM9A 2VJ8A 3S7FA 3HIZA 5KJNA 2J08A 5ANRA 1NA0A 4ANVA 4AV7A 4G2VA 1E8XA 4GYOA 5FQ4A 3U66A 3KAEA 3ZW3A 4Y6WA 4AOFA 4XKBA 3CIAA 3FP3A 2C0MA 3MEKA 1S0PA 1EF1C 4U0UA 3CVNA 4ILGA 3KD7A 4B8AA 3T8MA 4C9BB 4U07A 3D9OA 3CHQA 2UWJG 3FU6A 2E0IA 2I1KA 3QWVA 4APFA 5ARGA 2WQHA 3ASHA 4ACLA 4FLHA 2DCPA 3O48A 3UQ3A 2UY1A 2OVFA 3LCAA 3CK7A 2P58C 3QAQA 4L1BA 5A7DB 2R5SA 3FTYA 2PL2A 3FUMA 1E8ZA 3EIQC 2L0IA 2X6HA 3ZEFA 3FHEA 2I1JA 4I43A 4I6GA 2M63A 4HLEA 3QWWA 1H2TC 4FJZA 2WPVA 1E7VA 3G2UA 3I4GA 4DPRA 3QDNA 4TUUA 1JPLA 1WAO1 2FULA 3EHNA 3OXFA 4N39A 1HF8A 2KZTB 2WXOA 3UUXA 3PRZA 5CHEE 2VTBB 4H7XA 2HM8A 3MV3B 5G05J 3FTUA 5ANLA 3NQPA 3VTYA 3PE3A 5FQ6A 3CHOA 3FTWA 1PAQA 3BEEA 4WUYA 2X6IA 3MX3A 5FZRA 5E75A 1U3CA 3LYAA 1ELKA 4ATGA 2AXVA 4LRZA 3SD5A 1UN8A 3MKRA 4UI9K 4BT9A 3IEGA 2I6HA 3GZ1A 3LY7A 2PM6A 2WXRA 4I1MA 4BY6A 4JA7A 3QJZA 2PQRA 2Y4UA 3PREA 3PZDA 3RJVA 3HYMB 2LAHA 4N3BA 5T4YA 4CT4A 1U3DA 3PUKA 3IV0A 3IBEA 3PEUB 3PDNA 2XPYA 1VDYA 5AJDA 5FQ8A 2CFUA 3MKQB 4IRUA 3ZYQA 5J08A 4GZ5A 4APOA 4RSYA 3UT4A 2NXPA 2WXQA 2LAIA 5BPPA 3SNXA 4UWHA 3CVPA 4DI3A 4HOTA 2XGMA 4GZDA 3L6AA 2J07A 4ANWA 1NZNA 2YHEA 1UG3A 2RG8A 3AS4A 4LEUA 5A6CA 2QY7A 4JHKA 4UQYA 4AIFA 3AS5A 4UQXA 1H6KA 3CK9A 4DLQA 4ACKA 4XIFA 5FZSA 3CEQA 1UJKA 2CFZA 3G2VA 4L7TA 4U63A 2KCLA 2XCBA 5G55A 4JC8A 5LP0A 1UW4B 2E2EA 2WXJA 3CVQA 1E90A 2Y3AA 3SHFA 3ZXSA 1IHGA 5BNWA 4H7YA 3QB2A 2A4ZA 2YHCA 4A1SA 1UJJA 4XKCA 2WQ6A 3FWVA 3Q47B 3AU4A 1HE8A 3TG5A 1H2UA 4CDMA 3N71A 4G11A 3ENEA 2R17C 3ZHEA 4MRUA 1WM5A 4JEUA 2FF4A 4RG9A 1E8YA 2YQ8A 4A3TA 4B0ZA 1GW6A 2XPIA 5FQ7A 2AVPA 3B7TA 4GU5A 1N54A 2WXGA 3LEWA 3ZVVA 4GPKA 3ULQA 4WWNA 4IYPA 5JJTA 1MHQA 5EX3A 1MQSA 4FHKA 3NF1A 2WXKA 3ESKA 3DBSA 5EDSA 5JHBA 2WMOA 4JEHA 4LUNU 3CSTA 2KCKA 4JW1A 3OXGA 4EBAG 3RRNB 1YA0A 3E4BA 5FT9A 3TGOA 2GW1A 4J8EA 3ML8A 1DVPA 2A5UA 3TAXA 4J8FA 2VTBA 1IQUA 3OAWA 4JZYA 4OVUA 5D0QD 5KJLA 3MGBA 5T3RA 5BUZA 4BX8A 4PDXA 3EDTB 4KBQA 3D9PA 4I6JA 4Q94A 2AXUA 3UPVA 2WQ7A 3UX4A 1HS6A 5AENA 4FA6A 3OTNA 3RK6A 4K0RA 4EZJA 4U8HA 4FC8A 3Q4AB 3FTXA 3LY9A 4BTAA 3AU5A 3CV0A 4FU3A 4I2WA 3ML9A 3FU0A 3B7SA 4JVSA 1TJFA 5EKQD 1ELRA 3T5XA 3ZFWA 4FADA 5BW8C 4BSXA 4CGVA 4MS6A 2X38A 1HX8A 4F7AA 2C0LA 1N52A 4AP2A 4AXHA 3FULA 4UWFA 2WVIA 3G2TA 3CVUA 1FVHA 4PS3A 4I17A 2XQ0A 5HQ8A 3CVVA 4Q96A 4NACA 1JWFA 3I3NA 4I1OB 1OWLA 4EZLA 2IQCA 4N3AA 4CT0A 2V0PA 4L2YA 3CQGB 2WXMA 2IOLA 4GA2A 1KLXA 5G04C 2VSOE 2KZTA 3FUKA 2ILRA 3R9AB 3FUNA 1BPOA 1JUQA 5KJMA 2PQNA 2KM4A 4I6EA 3CQCB 4CDRA 4RG6A 3SFZA 3UT7A 1Z6TA 3I5PA 2VGYA 4HFGA 2CG3A 4UWLA 4WNEA 4U0SA 4ABNA 5KJKA 3B7RL 3QOUA 3S7BA 2IU1A 4UI9J 1ELWA 4JA9A 2GGFA 3RO3A 2CHZA 2HYZA 2J4DA 1FVFA 4L23A 1HG5A 2IFUA 2YINA 4J8SA 2ZU6B 4FULA 3CVYA 3QK0A 3L22A 3D9LA 3MKQA 4XX5A 5A23A 2JEKA 4IULA 2AWIA 3APCA 1OWOA 5C1DA 3Q49B 5C2YA 3AS8A 4A1GA 4LERA 3RKVA 2QFCA 3ZRHA 3JQ0A 4XI9A 2J9QA 1NP7A 2LO6A 4PUCA 3ZPJA 3R7QA 3RU0A 2OOEA 5CMYA 4GZ3A 1TJCA 4NRHB 3PE4A 4LCTA 3CGHA 1H2VC 2KC7A 4ME2A 4AEZC 4BTBA 2NSZA 5HI7A 5BV1A 3SGHA 3K9IA 4GMLA 3IKOB 2I9CA 3CHMA 5J90A 4N2QA 3S7JA 5DBKA 1L5JA 3SBTB 2WMNA 3QKYA 3FUFA 4P29A 4E6HA 1Z3XA 4RVBA 1EPUA 3ZYMA 4DLOA 3GZ2A 4KXKB 4ANXA 2XRZA 4B8CB 3VLFA 3PNTB 5FTPA 4N2SA 1SQMA 3FTZA 4UWGA 4DI4A 4KVMA 2WXHA 3FUEA 4KMOA 2AW6A 5AIJA 3APDA 2EQXA 3P1UA 5ENNA 3LVRE 2LSVA 2GRMA 4U0ZA 1Z3YA 3PH0C 3VLDA 4EZKA 1ZBPA 3JQ1A 2X3MA 4GYWA 4GCNA 4WNFA 3UMVA 4F53A 3CVXA 3ASDA 5FZQA 4NURA 4UWKA 3LVQE 5G2NA 3OXLA 3D9IA 3T5VA 4YVOA 3G2WA 3FH5A 3SI5A 3LKUA 1OWMA 3FUJA 4GA0A 4EBAA 3U3WA 1DNPA 1WY6A 3L13A 3NZSA 4HXIA 4JHJA 2VGXA 3TG4A 1E7UA 4ANUA 5M72A 2I2OA 3CSFA 3GW4A 4G24A 2V5FA 3JYSA 3HHMA 1HZ4A 5CMWA 4QFVA 4CEMA 1HFAA 2BF0X 2XCCA 5E76A 4WNGA 4HOQA 2XPZA 3ASFA 4Y6CA 4CGWA 4KYOB 4BT8A 3S7DA 4ILIA 1TEZA 5T8IA 3FUHA 3HDXA 1X5BA 2R59A 3B13A 2CHWA 3ZYKA 4GYYA 2IONA 2GRLA 2FEZA 4A55A 4XE0A 3ONKA 3MJWA 3PS6A 3U64A 5FWQA 3BG1B 2VSYA 2YNQA 3PNLB 2OV8A 3ZGQA 4DK5A 1INZA 3RRMB 3ASGA 2KCVA 2L0TB 3VLEA 4AVXA 4URKA 4FHJA 1HG2A 4C0MA 4G1TA 3KS2A 2VGXB 4CRWA 3CHPA 1XGWA 5JJ7A 2MRIA 3ZYLA 1QZ2A 2XHEA 1A17A 1W3BA 4GB9A 5EX0A 3TXMA 3TJPA 5LX8A 1EYHA 1QQEA 1HU3A 3L17A 3LJ3A 3TXNA 4V3IA 3ZIMA 5DIZA 4MKTA 5BT1A 3D9NA 4KZ0A 3D3MA 2KATA 3MZLB 3O4ZA 2OVBA 3MA5A 3QWPA 3JUIA 3VTXA 4EPZA 3UT8A 1PY1A 3PUJA 4G25A 4BFRA 3L54A 3LXUX 4F3VA 2PZIA 5ARFA 4KZCA 4PS7A 1JWGA 3KEZA 3EIJA 4JL0A 1B89A 1FCHA 2LNIA 2WXPA 1LF8A 3MCXA 4HOUA 4O6FA 4FP7A 4XZ4A 4I9CA 1E96B 1UN9A 5D0OD 3RO2A 3URZA 3FH8A 3FTVA 3LS8A 4IN3B 5AYWD 1KT0A 3SZ7A 2WB2A 4I2ZA 2RD0A 2C2LA 3FU5A 2UY1B 3CR3A 4E85A 1H0AA 3PVLA 3U9WA 4YVQC 1EDUA 3P2BA 2IJGX 3ESLA 4B89A 4DJAA 4UQZA 1SZAA 1OWNA 2XEVA 2V8SE 3CVLA 3C98A 4MLPA 3RIBA 3CVWA 4AY5A 2X6FA 3B7UX 3HVEA 3FDHA 3MYVA 3QNKA 3Q15A 3U4TA 3FH7A 2VSXE 3GYZA 2WXIA 4W9RA 2MOWA 2J09A 4BWRA 4HOSA 3SF4A 5LOZA 4A3VA 4FJYA 3Q5MA 2IF4A 4G26A 3LPZA 4UI9C 5CCLA 2WXFA 2XGOA 3FU3A 2FO7A 2X6KA 5G04J 4EECA 3EJNA 4GMJA 2WXLA 4PS8A 3RRUA 4OYSA 1E8WA 4AJWA 3D9MA 1OUVA 4N5CA 2BUGA 2AXZA 3CLJA 1HO8A 5JJ6A 5LFAA 3R7RA 2XGSA 4KVOA 1P5QA 4GAAA 5FJYA 3HVEB 1Y6IA 3L16A 3LY8A 4U04A 3FUIA 4HVBA 2XRYA 2VSNA 4GZ6A 4WWOA 3EHMA 2PM7A 3CHSA 3CKBA 4TV3A 1NA3A 3WXXA 3FEYA 3ONLA 3DPDA 3FEXA 2NC9A 1KT1A 3FUDA 3QC1A 2FBNA 3IHYA 4J8DA 4Q69A 4J6IA 3S2AA 1PC2A 3NZUA 3ZN3A 1OWPA 4F1SA 4N3CA 4I1AA 1SZ9A 4K03A 3CKCA 2JLBA 3I4RB 3JCKC 1IYGA 3PEVB 3APFA 3L08A 4J0UA 3D9KA 4M3OA 4PH4B 1ZU2A 1H19A 2X6JA 3FY4A 4NQ0A 2BTDA 2CHXA 3SBSA 2J49A 4G23A 1HXIA 2IOSA 4JPSA 5LCWJ 4L2LA 4XI0A 4KT6B 2L9BA 4BX9A 2DIWA 3BG0B 3CK8A 4I9EA 4WAFA 4CCAA 2VQ2A 2ONDA 5G05C 5LCWC 2L6JA 1Y8MA 2V4LA 3CHRA 2WM9A 4C0EA 4HS2A 4HORA 3FFLA 4EQFA 4B94A 2J4BA 4JHRA 4YNDA 2LSUA 4R7LA 3GZSA 4D10C 5KCMA 3FTSA 1HH8A 2WXNA 5BV0A 2HR2A 3G2SA 5CCMA 4OVVA 4TRQA 4WNDA 3ZHEB 5JHAA 2MHKA 4JXTA 4AY6A 1XNFA 4WWPA 5AJLA 1IQRA 3QARA 3TL5A 2HO1A 2FI7A 4CDNA 4ILHB 2CG2A 2Q7FA 2VYIA 3IHVA 4GA1A 1QNFA 4GZCA 2DBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNI A;  3MV2 B;  2E2E A;  2Y4T A;  4O6F A;  3URZ A;  4I9C A;  1E96 B;  4GCO A;  3CVQ A;  5D0O D;  3RO2 A;  4AM9 A;  5C1D A;  4IN3 B;  5AYW D;  3S7F A;  1KT0 A;  3Q49 B;  1IHG A;  4I2Z A;  3AS8 A;  3SZ7 A;  5KJN A;  1NA0 A;  4G2V A;  4H7Y A;  2QFC A;  2C2L A;  4XI9 A;  3RKV A;  2J9Q A;  2UY1 B;  2YHC A;  4GYO A;  4A1S A;  3ZPJ A;  3RU0 A;  2OOE A;  3FWV A;  3Q47 B;  1TJC A;  4GZ3 A;  4NRH B;  3KAE A;  4YVQ C;  3PE4 A;  3N71 A;  4Y6W A;  4ME2 A;  3TG5 A;  2KC7 A;  4UQZ A;  4BTB A;  4AIF A;  3ZHE A;  2XEV A;  5HI7 A;  1WM5 A;  3CVL A;  2C0M A;  3FP3 A;  3K9I A;  3MEK A;  3RIB A;  4AY5 A;  2FF4 A;  4RG9 A;  4U0U A;  2YQ8 A;  4N2Q A;  3CVN A;  2XPI A;  2AVP A;  3KD7 A;  3S7J A;  5DBK A;  5CCM A;  3Q15 A;  3U4T A;  4GPK A;  3ULQ A;  3GYZ A;  3QKY A;  4U07 A;  4W9R A;  5JJT A;  2UWJ G;  4BWR A;  4HOS A;  3QWV A;  3GZ2 A;  4KXK B;  5EX3 A;  3NF1 A;  2WQH A;  3ASH A;  5ARG A;  3SF4 A;  4G26 A;  3Q5M A;  2IF4 A;  3ESK A;  3LPZ A;  3O48 A;  4UI9 C;  5FTP A;  5CCL A;  4N2S A;  2XGO A;  2UY1 A;  3UQ3 A;  2FO7 A;  5G04 J;  2KCK A;  3LCA A;  3OXG A;  1YA0 A;  2P58 C;  3CK7 A;  3E4B A;  5FT9 A;  5A7D B;  3TGO A;  1OUV A;  2R5S A;  2BUG A;  4N5C A;  2GW1 A;  2LSV A;  4J8E A;  2PL2 A;  4U0Z A;  3TAX A;  4J8F A;  1ZBP A;  5JJ6 A;  4GYW A;  4GCN A;  4WNF A;  5D0Q D;  2XGS A;  5KJL A;  1P5Q A;  3ASD A;  5FJY A;  5FZQ A;  3LY8 A;  4U04 A;  3EDT B;  3OXL A;  3ZFW A;  4HOU A;  5BNW A;  2VSN A;  4GZ6 A;  3QWW A;  4KBQ A;  4YVO A;  3CKB A;  2WPV A;  3UPV A;  1NA3 A;  3LKU A;  4GA0 A;  3U3W A;  3QDN A;  3WXX A;  1WAO 1;  2NC9 A;  1KT1 A;  3OXF A;  4N39 A;  3Q4A B;  2VGX A;  3UUX A;  5CHE E;  2FBN A;  3LY9 A;  4H7X A;  4J8D A;  3TG4 A;  3MV3 B;  1PC2 A;  3CV0 A;  4I2W A;  3ZN3 A;  4BTA A;  4N3C A;  4I1A A;  5G05 J;  5M72 A;  3GW4 A;  4G24 A;  2V5F A;  3CKC A;  2JLB A;  3JYS A;  3PE3 A;  3VTY A;  1HZ4 A;  4J0U A;  1IYG A;  5EKQ D;  1ELR A;  2XCC A;  3BEE A;  4HOQ A;  4WNG A;  3ASF A;  1ZU2 A;  4WUY A;  4Y6C A;  4KYO B;  5FZR A;  5BW8 C;  3S7D A;  4BT8 A;  4CGV A;  3LYA A;  4NQ0 A;  3MKR A;  2C0L A;  4UI9 K;  4BT9 A;  4G23 A;  1HXI A;  5LCW J;  3IEG A;  2I6H A;  3GZ1 A;  3LY7 A;  4GYY A;  4XI0 A;  4JA7 A;  2FEZ A;  2PQR A;  2Y4U A;  4I17 A;  3CK8 A;  4I9E A;  3HYM B;  3RJV A;  4N3B A;  5HQ8 A;  2VQ2 A;  2OND A;  2VSY A;  5G05 C;  5LCW C;  4N3A A;  3PDN A;  3ZGQ A;  2L6J A;  1Y8M A;  3ASG A;  2KCV A;  4CGW A;  4GA2 A;  1KLX A;  5G04 C;  4GZ5 A;  4APO A;  4G1T A;  3KS2 A;  2VGX B;  5JJ7 A;  4HOR A;  3R9A B;  1QZ2 A;  3FFL A;  4EQF A;  1A17 A;  1W3B A;  5EX0 A;  4B94 A;  1FCH A;  5KJM A;  2PQN A;  3CVP A;  4JHR A;  1QQE A;  4YND A;  4HOT A;  2XGM A;  2LSU A;  4CDR A;  4RG6 A;  1NZN A;  4LEU A;  3AS4 A;  2VGY A;  4WNE A;  5DIZ A;  5A6C A;  5BT1 A;  1HH8 A;  4U0S A;  4ABN A;  2HR2 A;  5KJK A;  2KAT A;  4UQY A;  3QWP A;  3MA5 A;  3AS5 A;  3QOU A;  3CK9 A;  4UQX A;  4WND A;  3S7B A;  2MHK A;  3VTX A;  3ZHE B;  4AY6 A;  1XNF A;  1ELW A;  4JA9 A;  4UI9 J;  3RO3 A;  4XIF A;  5FZS A;  3CEQ A;  4G25 A;  2HYZ A;  2HO1 A;  2FI7 A;  4F3V A;  2IFU A;  2PZI A;  2KCL A;  5ARF A;  2XCB A;  2Q7F A;  2VYI A;  4GA1 A;  4JL0 A;  1B89 A;  2DBA A; 
#chains in the Genus database with same CATH topology
 3MV2 B;  2VJ8 A;  5ENR D;  1N4Q A;  3AG1 E;  1S0P A;  4C9B B;  1SW6 A;  4U07 A;  2I1K A;  4FLH A;  2DCP A;  3O48 A;  5KNG A;  3UQ3 A;  2RFA A;  2P9L G;  3DXM G;  4K5C A;  3EHR A;  3QAQ A;  5A7D B;  3FTY A;  3ZEF A;  3FHE A;  2OEW A;  1K3Z D;  4CZ2 D;  3E37 A;  3TWT A;  1BU9 A;  1JPL A;  2FUL A;  1AWC B;  2KZT B;  4H7X A;  2EIM E;  3NQP A;  3CHO A;  3FTW A;  3MX3 A;  4BT9 A;  3IEG A;  3LY7 A;  2H6F A;  2WXR A;  3QJZ A;  2Y4U A;  3RJV A;  3PZD A;  4N3B A;  3IBE A;  3PEU B;  5AJD A;  5FQ8 A;  2CFU A;  2R2L A;  4BEP A;  1OY3 D;  3ZYQ A;  2NXP A;  2WXQ A;  3CVP A;  4F1P A;  2XGM A;  4GZD A;  2J07 A;  3DSS A;  5A6C A;  3CK9 A;  5FZS A;  1TNB A;  4JC8 A;  2E2E A;  1BLX B;  1E90 A;  3ABM E;  3TWX A;  4H7Y A;  1UJJ A;  2WQ6 A;  3FWV A;  3Q47 B;  3N71 A;  3UM3 A;  3NAW A;  3ENE A;  2R17 C;  1WM5 A;  2BKK B;  1E8Y A;  2YQ8 A;  5FQ7 A;  3B7T A;  4GU5 A;  3LEW A;  3ZVV A;  3ULQ A;  1H6O A;  2EIJ E;  2WXK A;  3DBS A;  5JHB A;  2WMO A;  1MYO A;  3Q79 A;  1G3N B;  1N4S A;  3UTM A;  4EBA G;  3C3R A;  2GW1 A;  2A5U A;  3TAX A;  2VTB A;  4GPM A;  5BUZ A;  3EDT B;  2WQ7 A;  3D9P A;  2GRO B;  5CEA A;  4YDO A;  4HRL A;  1S70 B;  3FU0 A;  4JVS A;  5BW8 C;  4CGV A;  4ZFH A;  2WVI A;  3G2T A;  2ZIS A;  4I17 A;  2ZIR A;  3CVV A;  3I3N A;  3CQG B;  2KZT A;  1DC2 A;  2NYJ A;  1WG0 A;  5D2M C;  2PQN A;  1RW2 A;  3CQC B;  4CDR A;  3SFZ A;  3UT7 A;  1Z6T A;  2IU1 A;  4M7C A;  2IFU A;  2H6I A;  2JEK A;  4IUL A;  1OWO A;  3TWS A;  3AS8 A;  2QFC A;  3ZRH A;  3JQ0 A;  2J9Q A;  3Q78 A;  2LO6 A;  3RU0 A;  3Q7F A;  2OOE A;  4GZ3 A;  3DSW A;  4AEZ C;  4BTB A;  3BU8 A;  4GML A;  3CHM A;  4A63 B;  4N2Q A;  1MJ0 A;  4G8L A;  5DBK A;  1L5J A;  1NFI E;  1N9A A;  2WMN A;  3AG3 E;  4E6H A;  4RVB A;  4DLO A;  4B8C B;  4CYM D;  3PNT B;  1SQM A;  3FTZ A;  5EYP F;  4KVM A;  3FUE A;  1BI8 B;  4RLY A;  4U0Z A;  3PH0 C;  4EZK A;  1ZBP A;  4GCN A;  3UMV A;  3ASD A;  2ZGG A;  3D9I A;  3T5V A;  3G2W A;  1V54 E;  4GA0 A;  1OWM A;  3Q9U C;  1DNP A;  3GW4 A;  3JYS A;  3HHM A;  1HZ4 A;  3EHQ A;  2XCC A;  5E76 A;  4HOQ A;  5B1A E;  3ASF A;  4Y6C A;  4BT8 A;  1BD8 A;  1X5B A;  2R59 A;  3B13 A;  4XE0 A;  3PS6 A;  5FWQ A;  3PNL B;  3RRM B;  2L0T B;  4FHJ A;  3KS2 A;  2V4H C;  1XGW A;  1ZB1 A;  3ZYL A;  2XHE A;  1W3B A;  5LX8 A;  1HU3 A;  3L17 A;  4V3I A;  3ZIM A;  4MKT A;  4KZ0 A;  2LXM A;  3QWP A;  3SY2 A;  3JUI A;  4EPZ A;  3UT8 A;  3SO8 A;  3KEZ A;  4XZ4 A;  2LNI A;  4FP7 A;  3RO2 A;  3SZ7 A;  1MX6 A;  4YVQ C;  3WG7 E;  3V79 K;  3RIB A;  3NOC D;  3QNK A;  3U4T A;  3FH7 A;  2VSX E;  2WXI A;  2J09 A;  4BWR A;  4HOS A;  2R02 A;  1OCO E;  4G26 A;  3FU3 A;  2X6K A;  3RRU A;  4HRN A;  1E8W A;  2H6H A;  3HRA A;  2IEJ A;  5LFA A;  2XGS A;  4KVO A;  1P5Q A;  3L16 A;  1Y6I A;  3LY8 A;  1DCQ A;  4HVB A;  4GZ6 A;  3CKB A;  1NA3 A;  3WXX A;  3FEX A;  1KT1 A;  4Q69 A;  4J8D A;  3W9G A;  4TXQ A;  1PC2 A;  3ZN3 A;  4N3C A;  4I1A A;  1N11 A;  4U8Y D;  3CKC A;  2JLB A;  3I4R B;  3PEV B;  4M3O A;  1ZU2 A;  2X6J A;  4NQ0 A;  2F37 A;  2EIL E;  4KT6 B;  2L9B A;  2OND A;  2V4L A;  4L9P A;  3B95 A;  3CHR A;  4HOR A;  4HB5 A;  4JHR A;  2LSU A;  4D10 C;  4HLL A;  5KCM A;  4WND A;  5AQA A;  3TL5 A;  2HO1 A;  1LD7 A;  4ILH B;  2CG2 A;  2VYI A;  1U2V G;  2DBA A;  1OXJ A;  4LNU D;  3S7F A;  3UIP C;  2J08 A;  5ANR A;  1NA0 A;  4G2V A;  1N4R A;  1SA4 A;  3DST A;  3U66 A;  3ZW3 A;  4Y6W A;  2KBX A;  3ZU7 B;  5AAO A;  4U0U A;  3CVN A;  4ILG A;  3KD7 A;  4B8A A;  3D9O A;  3CHQ A;  5ARG A;  2WQH A;  2GRQ B;  4OAU C;  4U7E B;  2P58 C;  4L1B A;  2R5S A;  1S63 A;  2PL2 A;  4GTO A;  1E8Z A;  3EIQ C;  2X6H A;  2I1J A;  2V5Q C;  4I43 A;  3QWW A;  2BKG A;  4FJZ A;  3UI2 A;  3QDN A;  4TUU A;  2DYR E;  4O1O A;  3EHN A;  3OXF A;  1HF8 A;  1TNZ A;  2HM8 A;  3MV3 B;  1K1B A;  3FTU A;  1KZP A;  4WUY A;  2X6I A;  3LYA A;  4ATG A;  2B0O E;  3MKR A;  4UI9 K;  3PRE A;  4CT4 A;  1VDY A;  3DXK G;  3HXD A;  4GZ5 A;  5BPP A;  4DI3 A;  2YHE A;  1UG3 A;  4LEU A;  4JHK A;  3IXE A;  4AIF A;  4UQX A;  1H6K A;  4DLQ A;  4XIF A;  3CEQ A;  1UJK A;  2CFZ A;  3NB2 A;  4U63 A;  1UW4 B;  3SHF A;  2LXL A;  5BNW A;  2DVW A;  1IKN D;  3AU4 A;  3TG5 A;  1H2U A;  4G11 A;  5KNH D;  3ABK E;  4JEU A;  4A3T A;  4RG9 A;  5EN5 D;  2XEE A;  5EIB E;  1MQS A;  4FHK A;  3NF1 A;  3ESK A;  3PZ3 A;  4LUN U;  3CST A;  2KCK A;  2P2C P;  4JW1 A;  3E4B A;  3TGO A;  1TNY A;  4X8Q A;  5D0Q D;  5KJL A;  2AXU A;  4FA6 A;  4EZJ A;  3LY9 A;  3AU5 A;  4FU3 A;  3B7S A;  4TXP A;  1ELR A;  4BES A;  1HX8 A;  4F7A A;  4AP2 A;  3CVU A;  1FVH A;  4PS3 A;  2XQ0 A;  4Q96 A;  4NAC A;  1JWF A;  4I1O B;  2IQC A;  2V0P A;  4L2Y A;  4GA2 A;  5G04 C;  1UOH A;  3FUN A;  3ULY A;  2KM4 A;  3TWU A;  2VGY A;  5EIL A;  3QOU A;  3S7B A;  5D66 A;  4UI9 J;  4JA9 A;  5AQ9 A;  1FVF A;  4J8S A;  2ZU6 B;  1JCQ A;  4FUL A;  3NBN B;  3CVY A;  3L22 A;  3D9L A;  5A23 A;  2DWZ A;  3APC A;  2JAB A;  3D9H A;  4XI9 A;  5CRV A;  3UKR G;  3ZPJ A;  3R7Q A;  2DZO A;  1H2V C;  2KC7 A;  5ENP D;  3IKO B;  1MX2 A;  2R03 A;  1KZO A;  1EPU A;  3ZYM A;  4KXK B;  3EUV A;  4N2S A;  3JUE A;  2WXH A;  4KMO A;  5AIJ A;  3EU9 A;  3LVR E;  1Z3Y A;  3VLD A;  3DEO A;  3F6Q A;  5EID A;  1YYH A;  5FZQ A;  4UWK A;  3LJN A;  3OXL A;  4YVO A;  1N4P A;  3FUJ A;  4GMR A;  5FIO A;  2BED A;  5M72 A;  2V5F A;  4QFV A;  5ENO D;  1HFA A;  2BF0 X;  4WNG A;  4CGW A;  4KYO B;  3S7D A;  3T8K A;  2P9U G;  5T8I A;  1O1T A;  2CHW A;  2ION A;  4A55 A;  3U64 A;  2YNQ A;  4QQI A;  3ZGQ A;  1NL4 A;  3ASG A;  3VLE A;  4URK A;  2ZXW E;  4C0M A;  4G1T A;  3DSV A;  3TXN A;  2RFM A;  3Q7A A;  5BT1 A;  3MA5 A;  2FO1 E;  2F0Y A;  3PUJ A;  4G25 A;  4BFR A;  4ATZ D;  4F3V A;  3MCX A;  3ASN E;  4O6F A;  4F6R D;  5D0O D;  1E96 B;  1D8D A;  3RSE G;  3UIN C;  3ZKJ A;  5BXO A;  4GTV A;  3FU5 A;  2UY1 B;  3U9W A;  3AJI A;  1EDU A;  1QYM A;  4GTQ A;  2IJG X;  1NI1 A;  2XEV A;  3ASO E;  2X6F A;  3B7U X;  3MYV A;  3Q15 A;  2GRP B;  3NOG D;  4LNB A;  3KSL A;  2Y0B G;  5FIN A;  5LOZ A;  3LPZ A;  4O1P A;  2WXL A;  4PS8 A;  4OYS A;  3HG0 D;  4AJW A;  3D9M A;  1HO8 A;  5FJY A;  1IHB A;  5HRY A;  5CED B;  4U04 A;  2XRY A;  2VSN A;  3EHM A;  1Q2Z A;  3ONL A;  2NC9 A;  3FUD A;  3QC1 A;  4LSZ E;  3IHY A;  3NZU A;  1OWP A;  1SZ9 A;  3JCK C;  3R9M A;  3D9K A;  3HXE A;  1S64 A;  2J49 A;  1H6P A;  4GTR A;  4G23 A;  1HXI A;  4JPS A;  5CBN A;  5LCW J;  4JD2 G;  4BX9 A;  3BG0 B;  3E33 A;  5G05 C;  1O1S A;  5HKP A;  4DX5 D;  3JXJ A;  4HS2 A;  4C48 B;  3FFL A;  4EQF A;  3GZS A;  3FTS A;  2HR2 A;  4HI8 A;  5CCM A;  4OVV A;  4TRQ A;  3ZHE B;  4DX1 A;  5JHA A;  2MHK A;  3QAR A;  3HXB A;  1QNF A;  4HBD A;  2Y4T A;  3LDZ A;  4FLB A;  4GCO A;  3L82 A;  4AM9 A;  3HIZ A;  1E8X A;  4GYO A;  5AN8 A;  1O1R A;  5FQ4 A;  4AOF A;  4XKB A;  3CIA A;  2C0M A;  4MBG A;  4DX2 A;  3KEA A;  1OCC E;  3FU6 A;  2E0I A;  3SFY A;  4APF A;  4ACL A;  3ASH A;  2UY1 A;  2XS1 A;  2OVF A;  4DUI A;  1RZ4 A;  4N39 A;  2WXO A;  3UUX A;  3PRZ A;  5KWD A;  3VTY A;  1O5M A;  5FQ6 A;  5FZR A;  5E75 A;  1U3C A;  2AXV A;  3PZ4 A;  3SD5 A;  2I6H A;  4BY6 A;  1MX4 A;  4JA7 A;  2PQR A;  3HYM B;  5T4Y A;  3J5P A;  3PDN A;  2XPY A;  1K8K G;  4IRU A;  3HXC A;  1A5E A;  4RSY A;  2P9P G;  2LAI A;  3SNX A;  4ANW A;  2RG8 A;  4ZHB A;  4ACK A;  2KXP C;  3T9K A;  3G2V A;  2KCL A;  5G55 A;  4YDW A;  3ABL E;  3QB2 A;  2A4Z A;  2YHC A;  4XKC A;  3DEP A;  1HE8 A;  2DZN A;  2A5E A;  4MRU A;  3ZHE A;  1OCZ E;  1V55 E;  1FT1 A;  3RAU A;  2XPI A;  3AG2 E;  1N54 A;  2WXG A;  4GPK A;  4WWN A;  5JJT A;  5AQ7 A;  4K5B A;  5EX3 A;  5EDS A;  4JEH A;  3OXG A;  3RRN B;  1YA0 A;  5FT9 A;  1DVP A;  1OCR E;  2ETA A;  1FPP A;  4OVU A;  5T3R A;  1N95 A;  4BX8 A;  4NIK A;  4KBQ A;  3UPV A;  3UX4 A;  1HS6 A;  3RK6 A;  4FC8 A;  3Q4A B;  3FTX A;  4BTA A;  3CV0 A;  4I2W A;  1TJF A;  4FAD A;  4BSX A;  1FT2 A;  4MS6 A;  2X38 A;  4UWF A;  2H6G A;  1LD8 A;  3DSU A;  1OWL A;  4N3A A;  1DCE A;  2WXM A;  3E30 A;  1KLX A;  2VSO E;  3FUK A;  3R9A B;  2VGE A;  1BPO A;  4B93 B;  1JUQ A;  4I6E A;  4U8V D;  4RG6 A;  3I5P A;  4UWL A;  4WNE A;  2CG3 A;  4U0S A;  4ABN A;  5KJK A;  3B7R L;  4GTP A;  1ELW A;  2HYZ A;  4L23 A;  1HG5 A;  4HQD A;  4LG6 A;  2YIN A;  3QK0 A;  4HI9 A;  2AWI A;  5C1D A;  3Q49 B;  5C2Y A;  4LER A;  2L6B A;  4NRH B;  3CGH A;  2NSZ A;  5BV1 A;  3SGH A;  3K9I A;  2I9C A;  3SBT B;  4BSZ B;  2EIN E;  3QKY A;  3FUF A;  4P29 A;  1Z3X A;  1TNO A;  3VLF A;  5FTP A;  1IXV A;  4DI4 A;  2GRN B;  2AW6 A;  5CBO A;  2EQX A;  3P1U A;  5ENN A;  2LSV A;  3UIO C;  1JCS A;  4GYW A;  4WNF A;  2OEV A;  3CVX A;  5JMN D;  4DX6 D;  2RKK A;  3LKU A;  1WY6 A;  4JHJ A;  2VGX A;  5H7P A;  5HS0 A;  1E7U A;  3TG4 A;  4ANU A;  2I2O A;  3CSF A;  2LUH A;  4G24 A;  3B7B A;  5CMW A;  4CEM A;  2XPZ A;  4ILI A;  1TEZ A;  2R05 A;  3FUH A;  3ZYK A;  2GRL A;  3UM1 A;  2FEZ A;  3ONK A;  2J8S D;  4YDE A;  2OV8 A;  1INZ A;  4GTT A;  2KCV A;  2VGX B;  4CRW A;  3CHP A;  5JJ7 A;  4LNG A;  1A17 A;  3TXM A;  3TJP A;  2P9N G;  3LJ3 A;  3PZ2 A;  1QBQ A;  5DIZ A;  3D9N A;  2DYS E;  2KAT A;  3D3M A;  1PY1 A;  2IO3 C;  3L54 A;  3LXU X;  5ARF A;  4PS7 A;  4BET A;  1JWG A;  1B89 A;  1FCH A;  1LF8 A;  2WXP A;  3L9T A;  1UN9 A;  3FH8 A;  2MYO A;  3FTV A;  3LS8 A;  4IN3 B;  5AYW D;  1KT0 A;  4I2Z A;  2RD0 A;  1N0Q A;  3TWW A;  3P2B A;  3ESL A;  4B89 A;  4DJA A;  4UQZ A;  2V8S E;  3CVL A;  4MLP A;  3CVW A;  4AY5 A;  3HVE A;  3FDH A;  3DSX A;  3C72 A;  4W9R A;  3SF4 A;  4A3V A;  4FJY A;  2IF4 A;  5CCL A;  2WXF A;  2XGO A;  2FO7 A;  5G04 J;  3EJN A;  3TWQ A;  1OUV A;  2BUG A;  1TN7 A;  2QYU A;  3CLJ A;  5ITZ F;  2AJA A;  3HVE B;  3FUI A;  2PM7 A;  4TV3 A;  3FEY A;  3DPD A;  1K1A A;  1OT8 A;  2FBN A;  3W9F A;  3S2A A;  4K03 A;  4J0U A;  3APF A;  3L08 A;  4PH4 B;  3Q9N C;  5EYL A;  1H19 A;  3FY4 A;  2CHX A;  5B1B E;  2IOS A;  4L2L A;  4XI0 A;  3V30 A;  4GTM A;  3CK8 A;  4I9E A;  4WAF A;  4CCA A;  2VQ2 A;  2XZD G;  1Y8M A;  3TWV A;  4HRM B;  2WM9 A;  2QZA A;  4B94 A;  2J4B A;  4YND A;  1HH8 A;  1TYQ G;  4JXT A;  1XNF A;  4WWP A;  5AJL A;  4U95 D;  4RQI A;  4GA1 A;  3IHV A;  3UXG A;  5KJM A;  4GZC A;  3D9J A;  5KJN A;  4ANV A;  4AV7 A;  3KAE A;  3V31 A;  3FP3 A;  3MEK A;  1EF1 C;  4TUM A;  3T8M A;  5B3S E;  2UWJ G;  3QWV A;  4HNA D;  3LCA A;  3CK7 A;  5IY5 E;  4JB8 P;  3FUM A;  2L0I A;  1JCR A;  4I6G A;  2P9S G;  2M63 A;  4HLE A;  1H2T C;  2WPV A;  1E7V A;  3G2U A;  3I4G A;  4DPR A;  1TNU A;  1WAO 1;  5CHE E;  2VTB B;  1N94 A;  5G05 J;  5ANL A;  3PE3 A;  3PZ1 A;  1PAQ A;  1SA5 A;  3BEE A;  1ELK A;  3ZNG A;  4LRZ A;  2Y1L E;  1UN8 A;  2ETB A;  4XEI G;  3GZ1 A;  2PM6 A;  4I1M A;  1N0R A;  2ZGD A;  2LAH A;  1U3D A;  3PUK A;  3IV0 A;  3MKQ B;  5J08 A;  4APO A;  3UT4 A;  3BQO A;  4UWH A;  4HOT A;  3L6A A;  2IY0 C;  3X2Q E;  1NZN A;  3AS4 A;  2F8Y A;  2QYJ A;  2QY7 A;  3Q73 A;  4UQY A;  3C3Q A;  3AS5 A;  5ENQ D;  2P9I G;  1YCS B;  4L7T A;  2XCB A;  5LP0 A;  2WXJ A;  3CVQ A;  2Y3A A;  3ZXS A;  1IHG A;  4BER A;  4A1S A;  5KBA A;  5CEC B;  4CDM A;  1BI7 B;  2XEH A;  2FF4 A;  2GRR B;  3E34 A;  4B0Z A;  1GW6 A;  2ETC A;  2AVP A;  3UM2 A;  3ZUV B;  4IYP A;  1MHQ A;  3DPY A;  4J8E A;  3ML8 A;  4J8F A;  1IQU A;  3OAW A;  4JZY A;  3MGB A;  4PDX A;  4Q94 A;  4I6J A;  1MZC A;  3E32 A;  2P9K G;  5AEN A;  3OTN A;  4K0R A;  4U8H A;  3ML9 A;  1WDY A;  5EKQ D;  1KPS B;  3T5X A;  3ZFW A;  2C0L A;  1N52 A;  4AXH A;  3FUL A;  1TN8 A;  4GTS A;  5HQ8 A;  4EZL A;  2Y69 E;  4CT0 A;  2IOL A;  2ILR A;  2IO2 C;  2EIK E;  1Z5S C;  3Q75 A;  4HFG A;  3C3O A;  2GGF A;  3RO3 A;  2CHZ A;  1D9S A;  4DX7 D;  2J4D A;  3SFX A;  3MKQ A;  3BUA A;  4A1G A;  3RKV A;  3C5R A;  1NP7 A;  4PUC A;  4DRX E;  5CMY A;  1TJC A;  3PE4 A;  4LCT A;  4ME2 A;  3ULE G;  5HI7 A;  5J90 A;  3AAA C;  3S7J A;  3GZ2 A;  4ANX A;  2XRZ A;  2B6C A;  4UWG A;  3APD A;  1TN6 A;  2XZT G;  2GRM A;  5CRU A;  3JQ1 A;  2X3M A;  4F53 A;  4NUR A;  3LVQ E;  5G2N A;  4O60 A;  4UUC A;  3FH5 A;  3SI5 A;  3U3W A;  4Z68 A;  4EBA A;  3NZS A;  3L13 A;  4HXI A;  3HXF A;  3ZXP A;  3HDX A;  4YDY A;  2XEN A;  4GYY A;  3EU5 A;  3J5Q B;  3MJW A;  3BG1 B;  2VSY A;  4DK5 A;  4OAV B;  4AVX A;  3ISM C;  1HG2 A;  3V2X A;  5ENT D;  2MRI A;  4EHM A;  1QZ2 A;  5JA4 D;  4GB9 A;  5EX0 A;  1EYH A;  2PNN A;  1QQE A;  1AP7 A;  4N5Q A;  3MZL B;  3O4Z A;  2OVB A;  3VTX A;  3UKU G;  2HE0 A;  4K5A B;  2PZI A;  4KZC A;  4JL0 A;  3EIJ A;  4HOU A;  3URZ A;  4I9C A;  3SQV A;  2WB2 A;  2C2L A;  3UM0 A;  4E85 A;  3CR3 A;  4G8K A;  1H0A A;  3PVL A;  1YMP A;  1SZA A;  1OWN A;  3C98 A;  3DWL G;  3GYZ A;  2MOW A;  4TXR A;  2XS8 A;  1TR4 A;  3Q5M A;  4UI9 C;  3TWR A;  5AQB A;  5AAR A;  4EEC A;  4GMJ A;  4N5C A;  2AXZ A;  5JJ6 A;  3R7R A;  4GAA A;  4U96 D;  4WWO A;  3CHS A;  5ENS D;  5CER B;  4J6I A;  4F1S A;  1IYG A;  3JXI A;  1SVX A;  3KSQ A;  2QC9 A;  5BXU A;  2BTD A;  3SBS A;  4J8Y A;  1D8E A;  3DRA A;  2DIW A;  2OCC E;  5LCW C;  2L6J A;  4C0E A;  1LTX A;  4J7W A;  4R7L A;  1X81 A;  5BV0 A;  2WXN A;  3G2S A;  4AY6 A;  3AG4 E;  1IQR A;  3V2O A;  2FI7 A;  4CDN A;  2Q7F A;  2F8X K;  4XX5 A; 
#chains in the Genus database with same CATH homology
 3MV2 B;  2Y4T A;  3LDZ A;  4FLB A;  3D9J A;  4GCO A;  4AM9 A;  2VJ8 A;  3S7F A;  3HIZ A;  5KJN A;  2J08 A;  5ANR A;  1NA0 A;  4ANV A;  4AV7 A;  4G2V A;  1E8X A;  4GYO A;  5FQ4 A;  3U66 A;  3KAE A;  3ZW3 A;  4Y6W A;  4AOF A;  4XKB A;  3CIA A;  3FP3 A;  2C0M A;  3MEK A;  1S0P A;  1EF1 C;  4U0U A;  3CVN A;  4ILG A;  3KD7 A;  4B8A A;  3T8M A;  4C9B B;  4U07 A;  3D9O A;  3CHQ A;  2UWJ G;  3FU6 A;  2E0I A;  2I1K A;  3QWV A;  4APF A;  5ARG A;  2WQH A;  3ASH A;  4ACL A;  4FLH A;  2DCP A;  3O48 A;  3UQ3 A;  2UY1 A;  2OVF A;  3LCA A;  3CK7 A;  2P58 C;  3QAQ A;  4L1B A;  5A7D B;  2R5S A;  3FTY A;  2PL2 A;  3FUM A;  1E8Z A;  3EIQ C;  2L0I A;  2X6H A;  3ZEF A;  3FHE A;  2I1J A;  4I43 A;  4I6G A;  2M63 A;  4HLE A;  3QWW A;  1H2T C;  4FJZ A;  2WPV A;  1E7V A;  3G2U A;  3I4G A;  4DPR A;  3QDN A;  4TUU A;  1JPL A;  1WAO 1;  2FUL A;  3EHN A;  3OXF A;  4N39 A;  1HF8 A;  2KZT B;  2WXO A;  3UUX A;  3PRZ A;  5CHE E;  2VTB B;  4H7X A;  2HM8 A;  3MV3 B;  5G05 J;  3FTU A;  5ANL A;  3NQP A;  3VTY A;  3PE3 A;  5FQ6 A;  3CHO A;  3FTW A;  1PAQ A;  3BEE A;  4WUY A;  2X6I A;  3MX3 A;  5FZR A;  5E75 A;  1U3C A;  3LYA A;  1ELK A;  4ATG A;  2AXV A;  4LRZ A;  3SD5 A;  1UN8 A;  3MKR A;  4UI9 K;  4BT9 A;  3IEG A;  2I6H A;  3GZ1 A;  3LY7 A;  2PM6 A;  2WXR A;  4I1M A;  4BY6 A;  4JA7 A;  3QJZ A;  2PQR A;  2Y4U A;  3PRE A;  3PZD A;  3RJV A;  3HYM B;  2LAH A;  4N3B A;  5T4Y A;  4CT4 A;  1U3D A;  3PUK A;  3IV0 A;  3IBE A;  3PEU B;  3PDN A;  2XPY A;  1VDY A;  5AJD A;  5FQ8 A;  2CFU A;  3MKQ B;  4IRU A;  3ZYQ A;  5J08 A;  4GZ5 A;  4APO A;  4RSY A;  3UT4 A;  2NXP A;  2WXQ A;  2LAI A;  5BPP A;  3SNX A;  4UWH A;  3CVP A;  4DI3 A;  4HOT A;  2XGM A;  4GZD A;  3L6A A;  2J07 A;  4ANW A;  1NZN A;  2YHE A;  1UG3 A;  2RG8 A;  3AS4 A;  4LEU A;  5A6C A;  2QY7 A;  4JHK A;  4UQY A;  4AIF A;  3AS5 A;  4UQX A;  1H6K A;  3CK9 A;  4DLQ A;  4ACK A;  4XIF A;  5FZS A;  3CEQ A;  1UJK A;  2CFZ A;  3G2V A;  4L7T A;  4U63 A;  2KCL A;  2XCB A;  5G55 A;  4JC8 A;  5LP0 A;  1UW4 B;  2E2E A;  2WXJ A;  3CVQ A;  1E90 A;  2Y3A A;  3SHF A;  3ZXS A;  1IHG A;  5BNW A;  4H7Y A;  3QB2 A;  2A4Z A;  2YHC A;  4A1S A;  1UJJ A;  4XKC A;  2WQ6 A;  3FWV A;  3Q47 B;  3AU4 A;  1HE8 A;  3TG5 A;  1H2U A;  4CDM A;  3N71 A;  4G11 A;  3ENE A;  2R17 C;  3ZHE A;  4MRU A;  1WM5 A;  4JEU A;  2FF4 A;  4RG9 A;  1E8Y A;  2YQ8 A;  4A3T A;  4B0Z A;  1GW6 A;  2XPI A;  5FQ7 A;  2AVP A;  3B7T A;  4GU5 A;  1N54 A;  2WXG A;  3LEW A;  3ZVV A;  4GPK A;  3ULQ A;  4WWN A;  4IYP A;  5JJT A;  1MHQ A;  5EX3 A;  1MQS A;  4FHK A;  3NF1 A;  2WXK A;  3ESK A;  3DBS A;  5EDS A;  5JHB A;  2WMO A;  4JEH A;  4LUN U;  3CST A;  2KCK A;  4JW1 A;  3OXG A;  4EBA G;  3RRN B;  1YA0 A;  3E4B A;  5FT9 A;  3TGO A;  2GW1 A;  4J8E A;  3ML8 A;  1DVP A;  2A5U A;  3TAX A;  4J8F A;  2VTB A;  1IQU A;  3OAW A;  4JZY A;  4OVU A;  5D0Q D;  5KJL A;  3MGB A;  5T3R A;  5BUZ A;  4BX8 A;  4PDX A;  3EDT B;  4KBQ A;  3D9P A;  4I6J A;  4Q94 A;  2AXU A;  3UPV A;  2WQ7 A;  3UX4 A;  1HS6 A;  5AEN A;  4FA6 A;  3OTN A;  3RK6 A;  4K0R A;  4EZJ A;  4U8H A;  4FC8 A;  3Q4A B;  3FTX A;  3LY9 A;  4BTA A;  3AU5 A;  3CV0 A;  4FU3 A;  4I2W A;  3ML9 A;  3FU0 A;  3B7S A;  4JVS A;  1TJF A;  5EKQ D;  1ELR A;  3T5X A;  3ZFW A;  4FAD A;  5BW8 C;  4BSX A;  4CGV A;  4MS6 A;  2X38 A;  1HX8 A;  4F7A A;  2C0L A;  1N52 A;  4AP2 A;  4AXH A;  3FUL A;  4UWF A;  2WVI A;  3G2T A;  3CVU A;  1FVH A;  4PS3 A;  4I17 A;  2XQ0 A;  5HQ8 A;  3CVV A;  4Q96 A;  4NAC A;  1JWF A;  3I3N A;  4I1O B;  1OWL A;  4EZL A;  2IQC A;  4N3A A;  4CT0 A;  2V0P A;  4L2Y A;  3CQG B;  2WXM A;  2IOL A;  4GA2 A;  1KLX A;  5G04 C;  2VSO E;  2KZT A;  3FUK A;  2ILR A;  3R9A B;  3FUN A;  1BPO A;  1JUQ A;  5KJM A;  2PQN A;  2KM4 A;  4I6E A;  3CQC B;  4CDR A;  4RG6 A;  3SFZ A;  3UT7 A;  1Z6T A;  3I5P A;  2VGY A;  4HFG A;  2CG3 A;  4UWL A;  4WNE A;  4U0S A;  4ABN A;  5KJK A;  3B7R L;  3QOU A;  3S7B A;  2IU1 A;  4UI9 J;  1ELW A;  4JA9 A;  2GGF A;  3RO3 A;  2CHZ A;  2HYZ A;  2J4D A;  1FVF A;  4L23 A;  1HG5 A;  2IFU A;  2YIN A;  4J8S A;  2ZU6 B;  4FUL A;  3CVY A;  3QK0 A;  3L22 A;  3D9L A;  3MKQ A;  4XX5 A;  5A23 A;  2JEK A;  4IUL A;  2AWI A;  3APC A;  1OWO A;  5C1D A;  3Q49 B;  5C2Y A;  3AS8 A;  4A1G A;  4LER A;  3RKV A;  2QFC A;  3ZRH A;  3JQ0 A;  4XI9 A;  2J9Q A;  1NP7 A;  2LO6 A;  4PUC A;  3ZPJ A;  3R7Q A;  3RU0 A;  2OOE A;  5CMY A;  4GZ3 A;  1TJC A;  4NRH B;  3PE4 A;  4LCT A;  3CGH A;  1H2V C;  2KC7 A;  4ME2 A;  4AEZ C;  4BTB A;  2NSZ A;  5HI7 A;  5BV1 A;  3SGH A;  3K9I A;  4GML A;  3IKO B;  2I9C A;  3CHM A;  5J90 A;  4N2Q A;  3S7J A;  5DBK A;  1L5J A;  3SBT B;  2WMN A;  3QKY A;  3FUF A;  4P29 A;  4E6H A;  1Z3X A;  4RVB A;  1EPU A;  3ZYM A;  4DLO A;  3GZ2 A;  4KXK B;  4ANX A;  2XRZ A;  4B8C B;  3VLF A;  3PNT B;  5FTP A;  4N2S A;  1SQM A;  3FTZ A;  4UWG A;  4DI4 A;  4KVM A;  2WXH A;  3FUE A;  4KMO A;  2AW6 A;  5AIJ A;  3APD A;  2EQX A;  3P1U A;  5ENN A;  3LVR E;  2LSV A;  2GRM A;  4U0Z A;  1Z3Y A;  3PH0 C;  3VLD A;  4EZK A;  1ZBP A;  3JQ1 A;  2X3M A;  4GYW A;  4GCN A;  4WNF A;  3UMV A;  4F53 A;  3CVX A;  3ASD A;  5FZQ A;  4NUR A;  4UWK A;  3LVQ E;  5G2N A;  3OXL A;  3D9I A;  3T5V A;  4YVO A;  3G2W A;  3FH5 A;  3SI5 A;  3LKU A;  1OWM A;  3FUJ A;  4GA0 A;  4EBA A;  3U3W A;  1DNP A;  1WY6 A;  3L13 A;  3NZS A;  4HXI A;  4JHJ A;  2VGX A;  3TG4 A;  1E7U A;  4ANU A;  5M72 A;  2I2O A;  3CSF A;  3GW4 A;  4G24 A;  2V5F A;  3JYS A;  3HHM A;  1HZ4 A;  5CMW A;  4QFV A;  4CEM A;  1HFA A;  2BF0 X;  2XCC A;  5E76 A;  4WNG A;  4HOQ A;  2XPZ A;  3ASF A;  4Y6C A;  4CGW A;  4KYO B;  4BT8 A;  3S7D A;  4ILI A;  1TEZ A;  5T8I A;  3FUH A;  3HDX A;  1X5B A;  2R59 A;  3B13 A;  2CHW A;  3ZYK A;  4GYY A;  2ION A;  2GRL A;  2FEZ A;  4A55 A;  4XE0 A;  3ONK A;  3MJW A;  3PS6 A;  3U64 A;  5FWQ A;  3BG1 B;  2VSY A;  2YNQ A;  3PNL B;  2OV8 A;  3ZGQ A;  4DK5 A;  1INZ A;  3RRM B;  3ASG A;  2KCV A;  2L0T B;  3VLE A;  4AVX A;  4URK A;  4FHJ A;  1HG2 A;  4C0M A;  4G1T A;  3KS2 A;  2VGX B;  4CRW A;  3CHP A;  1XGW A;  5JJ7 A;  2MRI A;  3ZYL A;  1QZ2 A;  2XHE A;  1A17 A;  1W3B A;  4GB9 A;  5EX0 A;  3TXM A;  3TJP A;  5LX8 A;  1EYH A;  1QQE A;  1HU3 A;  3L17 A;  3LJ3 A;  3TXN A;  4V3I A;  3ZIM A;  5DIZ A;  4MKT A;  5BT1 A;  3D9N A;  4KZ0 A;  3D3M A;  2KAT A;  3MZL B;  3O4Z A;  2OVB A;  3MA5 A;  3QWP A;  3JUI A;  3VTX A;  4EPZ A;  3UT8 A;  1PY1 A;  3PUJ A;  4G25 A;  4BFR A;  3L54 A;  3LXU X;  4F3V A;  2PZI A;  5ARF A;  4KZC A;  4PS7 A;  1JWG A;  3KEZ A;  3EIJ A;  4JL0 A;  1B89 A;  1FCH A;  2LNI A;  2WXP A;  1LF8 A;  3MCX A;  4HOU A;  4O6F A;  4FP7 A;  4XZ4 A;  4I9C A;  1E96 B;  1UN9 A;  5D0O D;  3RO2 A;  3URZ A;  3FH8 A;  3FTV A;  3LS8 A;  4IN3 B;  5AYW D;  1KT0 A;  3SZ7 A;  2WB2 A;  4I2Z A;  2RD0 A;  2C2L A;  3FU5 A;  2UY1 B;  3CR3 A;  4E85 A;  1H0A A;  3PVL A;  3U9W A;  4YVQ C;  1EDU A;  3P2B A;  2IJG X;  3ESL A;  4B89 A;  4DJA A;  4UQZ A;  1SZA A;  1OWN A;  2XEV A;  2V8S E;  3CVL A;  3C98 A;  4MLP A;  3RIB A;  3CVW A;  4AY5 A;  2X6F A;  3B7U X;  3HVE A;  3FDH A;  3MYV A;  3QNK A;  3Q15 A;  3U4T A;  3FH7 A;  2VSX E;  3GYZ A;  2WXI A;  4W9R A;  2MOW A;  2J09 A;  4BWR A;  4HOS A;  3SF4 A;  5LOZ A;  4A3V A;  4FJY A;  3Q5M A;  2IF4 A;  4G26 A;  3LPZ A;  4UI9 C;  5CCL A;  2WXF A;  2XGO A;  3FU3 A;  2FO7 A;  2X6K A;  5G04 J;  4EEC A;  3EJN A;  4GMJ A;  2WXL A;  4PS8 A;  3RRU A;  4OYS A;  1E8W A;  4AJW A;  3D9M A;  1OUV A;  4N5C A;  2BUG A;  2AXZ A;  3CLJ A;  1HO8 A;  5JJ6 A;  5LFA A;  3R7R A;  2XGS A;  4KVO A;  1P5Q A;  4GAA A;  5FJY A;  3HVE B;  1Y6I A;  3L16 A;  3LY8 A;  4U04 A;  3FUI A;  4HVB A;  2XRY A;  2VSN A;  4GZ6 A;  4WWO A;  3EHM A;  2PM7 A;  3CHS A;  3CKB A;  4TV3 A;  1NA3 A;  3WXX A;  3FEY A;  3ONL A;  3DPD A;  3FEX A;  2NC9 A;  1KT1 A;  3FUD A;  3QC1 A;  2FBN A;  3IHY A;  4J8D A;  4Q69 A;  4J6I A;  3S2A A;  1PC2 A;  3NZU A;  3ZN3 A;  1OWP A;  4F1S A;  4N3C A;  4I1A A;  1SZ9 A;  4K03 A;  3CKC A;  2JLB A;  3I4R B;  3JCK C;  1IYG A;  3PEV B;  3APF A;  3L08 A;  4J0U A;  3D9K A;  4M3O A;  4PH4 B;  1ZU2 A;  1H19 A;  2X6J A;  3FY4 A;  4NQ0 A;  2BTD A;  2CHX A;  3SBS A;  2J49 A;  4G23 A;  1HXI A;  2IOS A;  4JPS A;  5LCW J;  4L2L A;  4XI0 A;  4KT6 B;  2L9B A;  4BX9 A;  2DIW A;  3BG0 B;  3CK8 A;  4I9E A;  4WAF A;  4CCA A;  2VQ2 A;  2OND A;  5G05 C;  5LCW C;  2L6J A;  1Y8M A;  2V4L A;  3CHR A;  2WM9 A;  4C0E A;  4HS2 A;  4HOR A;  3FFL A;  4EQF A;  4B94 A;  2J4B A;  4JHR A;  4YND A;  2LSU A;  4R7L A;  3GZS A;  4D10 C;  5KCM A;  3FTS A;  1HH8 A;  2WXN A;  5BV0 A;  2HR2 A;  3G2S A;  5CCM A;  4OVV A;  4TRQ A;  4WND A;  3ZHE B;  5JHA A;  2MHK A;  4JXT A;  4AY6 A;  1XNF A;  4WWP A;  5AJL A;  1IQR A;  3QAR A;  3TL5 A;  2HO1 A;  2FI7 A;  4CDN A;  4ILH B;  2CG2 A;  2Q7F A;  2VYI A;  3IHV A;  4GA1 A;  1QNF A;  4GZC A;  2DBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...