3BEEA

Crystal structure of putative yfre protein from vibrio parahaemolyticus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
NAVTATQLAAKATTLYYLHKQAMTDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRVTIIESINKAKKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative YfrE protein
publication title Crystal structure of putative YfrE protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
molecule tags Structural genomics, unknown function
total genus 32
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3beeA00
2Y4TA 3LY9A 4N3AA 4HOUA 1KT0A 3PE3A 5LCWC 4BTBA 4I9EA 4ABNA 3UPVA 1KT1A 3SZ7A 3UUXA 5G04J 2FI7A 4WNGA 5JJ6A 4O6FA 3GZ2A 4JL0A 4N5CA 3CEQA 5G05C 4GZ5A 3OXLA 2KATA 1ELWA 2PQNA 4BT8A 4U0ZA 1HZ4A 3CKCA 4N39A 2JLBA 4CDRA 3QWPA 2E2EA 2AVPA 4N2QA 1IHGA 4I9CA 5EKQD 4H7XA 4LEUA 4F3VA 2XCBA 2LSUA 4BT9A 4WUYA 3AS8A 4GPKA 3Q47B 4KXKB 1XNFA 5C1DA 3ASFA 5JJTA 4N3BA 3AS5A 4GA0A 5EX3A 1HH8A 3R9AB 2NC9A 4B94A 3MV2B 4AY5A 2PQRA 2FBNA 4UI9K 5BW8C 4U0UA 1NZNA 2ONDA 5FZRA 1NA3A 3KD7A 3U3WA 4GYYA 4A1SA 4YNDA 1QZ2A 2KC7A 3FFLA 3LYAA 2P58C 2XGSA 2VGYA 1Y8MA 3FP3A 4U0SA 2IF4A 1IYGA 2XCCA 4KYOB 2HR2A 2YQ8A 3ZN3A 3S7JA 4I2ZA 2FO7A 3VTYA 1QQEA 2XPIA 3UQ3A 2HO1A 4KBQA 4GZ6A 4ME2A 5G05J 3QWWA 3SF4A 3GYZA 5JJ7A 1TJCA 3RIBA 3ASHA 4HORA 4JA9A 2MHKA 5BNWA 3EDTB 5KJMA 4J0UA 3MEKA 4UQZA 2UY1A 2Y4UA 2UY1B 4JA7A 3ZFWA 2BUGA 3ESKA 3MKRA 2IFUA 3Q49B 1B89A 4WNFA 4GYOA 2J9QA 1W3BA 4JHRA 5CCLA 2KCLA 2VQ2A 1NA0A 3JYSA 3MA5A 3AS4A 5ARGA 5HI7A 5KJKA 2C0LA 2FEZA 1PC2A 2DBAA 3LKUA 5D0QD 4N3CA 4HOQA 4U07A 5AYWD 3TAXA 3TG5A 3ASDA 3U4TA 3QOUA 4N2SA 3QKYA 4AY6A 2LSVA 4H7YA 4U04A 3CVPA 3CK9A 2WPVA 4G25A 5EX0A 1WM5A 4I2WA 3ZHEB 4APOA 3E4BA 4G2VA 2KCVA 3CK8A 1OUVA 2UWJG 1ZU2A 3ZGQA 4EQFA 3CVNA 5DIZA 5ARFA 4J8DA 4NRHB 4UQYA 1ZBPA 4Y6WA 2QFCA 4UQXA 2C2LA 3K9IA 3RO2A 1P5QA 3LY7A 1WAO1 3CKBA 2VSNA 3Q5MA 5KJNA 3CV0A 5BT1A 3ULQA 3O48A 2KCKA 5FZSA 3ZPJA 4UI9C 2XGOA 3HYMB 2YHCA 4CGVA 4G23A 2PZIA 2VSYA 3IEGA 3FWVA 5DBKA 4XIFA 4G24A 2L6JA 4YVQC 5A6CA 3OXGA 5CHEE 2LNIA 3PE4A 4HOSA 5A7DB 4GA1A 1E96B 4AM9A 2V5FA 5FT9A 5M72A 3URZA 4BTAA 3PDNA 2FF4A 5HQ8A 2HYZA 2Q7FA 3N71A 4WNDA 4YVOA 4J8EA 2XEVA 3RO3A 4HOTA 5CCMA 4NQ0A 3S7FA 4GCNA 5FZQA 4I17A 3ZHEA 2VYIA 3KS2A 3QDNA 3LCAA 5G04C 4GYWA 4RG9A 3ASGA 3MV3B 4GA2A 4GCOA 3S7DA 1A17A 4CGWA 2WQHA 4WNEA 3LPZA 1ELRA 4I1AA 3RKVA 1YA0A 4UI9J 3TG4A 4W9RA 5FTPA 4GZ3A 4J8FA 2R5SA 4XI9A 3VTXA 3BEEA 3GZ1A 4IN3B 4RG6A 3WXXA 2GW1A 2I6HA 2VGXA 2VGXB 4XI0A 4AIFA 3RU0A 4BWRA 5KJLA 2OOEA 2C0MA 1KLXA 3CVLA 3NF1A 2XGMA 5LCWJ 4G26A 3LY8A 3KAEA 3Q4AB 5FJYA 3TGOA 3GW4A 3RJVA 3CK7A 4G1TA 3Q15A 4Y6CA 1FCHA 5D0OD 3S7BA 3CVQA 1HXIA 3OXFA 3QWVA 2PL2A
chains in the Genus database with same CATH superfamily
2Y4TA 3QJZA 1KT0A 3PE3A 5LCWC 5EIBE 1KT1A 3LJ3A 3SZ7A 3Q7AA 3HRAA 4L9PA 1MQSA 3L22A 3QAQA 2L0TB 1UN8A 3ONKA 5G05C 5CECB 3AG2E 3V79K 1D8EA 4QFVA 1ELWA 4U0ZA 2WXHA 3Q73A 4FULA 2P9PG 4CT4A 4TUUA 2EIJE 4CDRA 1SA4A 2E2EA 4GMJA 1FT2A 2ZU6B 5EKQD 3ZYQA 2V8SE 3J5QB 4LUNU 1H19A 4WUYA 4GPKA 4KXKB 3ZEFA 4B89A 3TWSA 1TN7A 3PZ1A 3ASFA 5JJTA 2XEHA 3QC1A 3G2TA 3ULEG 3ZXSA 5CBNA 1EYHA 2P9SG 5LFAA 4XZ4A 2XRYA 4O1PA 4B94A 4AY5A 4EPZA 4KVOA 2X6IA 4JHJA 5BW8C 3R7QA 3TWTA 3QNKA 3TWXA 3FU5A 3KD7A 5CRUA 3SGHA 4LNGA 4A1SA 4LCTA 3MKQB 4PUCA 1S63A 2L0IA 3HG0D 4A1GA 3FFLA 2AW6A 2WXQA 3SQVA 2I1JA 2ETAA 1IYGA 2XCCA 2I9CA 4KYOB 3C3QA 2YQ8A 3ZXPA 3ZN3A 3B13A 1HS6A 3G2SA 5T8IA 1QQEA 4AJWA 2R02A 1IKND 2J07A 2IOSA 2IO3C 5A23A 5CEDB 2X3MA 3GYZA 3HXDA 5ENQD 3RIBA 2H6HA 4XX5A 4HORA 3CHMA 1HO8A 3L08A 3ENEA 3B7BA 5KJMA 4NIKA 3LXUX 2UY1B 2BUGA 4K5CA 3SHFA 5ENSD 1H0AA 5AQAA 4FADA 4DJAA 4M3OA 5JHBA 2J9QA 3OTNA 2KCLA 2X6KA 3ASOE 5ARGA 5HI7A 2FULA 4TUMA 5J08A 4N3CA 4GMRA 3HHMA 3AU4A 4EBAG 5B1AE 3HVEA 4HBDA 4AY6A 2LSVA 4H7YA 3FU3A 2WXLA 1QYMA 5EX0A 4JHKA 2MYOA 3PEVB 3EIJA 1H2TC 5AAOA 4HVBA 1OUVA 1BU9A 1H2UA 4EQFA 3X2QE 2DIWA 3E34A 2WXNA 3PEUB 3NOGD 1Z6TA 2XS1A 4Y6WA 3DSXA 4BEPA 2KBXA 4B8AA 2F37A 2C2LA 3BUAA 3CVUA 1WAO1 2HE0A 2DCPA 3I4RB 3T5VA 1Q2ZA 4Q94A 2P9IG 1YYHA 3FTWA 5AQBA 3NBNB 1AP7A 4UI9C 1SW6A 3HYMB 2YHCA 2M63A 3LEWA 4BFRA 4OAUC 1H6OA 3B7TA 2VGEA 4G8KA 3PZDA 3CSFA 5HKPA 3BQOA 1TR4A 5KBAA 3OXGA 3G2VA 4J8YA 3RK6A 4FA6A 4CYMD 5D2MC 3L6AA 3JXJA 1E96B 4AM9A 2P9KG 2WB2A 2V5FA 3SFYA 2CHXA 1E8ZA 5M72A 4KT6B 3D9LA 3PDNA 4AVXA 4F53A 2LUHA 3P1UA 3VLFA 4CT0A 1JWFA 2P9UG 2HYZA 4G11A 4DI4A 5BXOA 3V30A 2XEVA 4NQ0A 1TN8A 4GTOA 3ZHEA 5ENPD 5G55A 3UI2A 1HE8A 1JUQA 3JXIA 4ZFHA 3E30A 3ULYA 2WQHA 2OEWA 5C2YA 2BKKB 3TG4A 3DSTA 4A63B 4J8FA 3T5XA 1RW2A 1NL4A 3VTXA 3R7RA 5EN5D 2MRIA 1OWMA 4GTTA 3FUEA 2J49A 4BERA 2GW1A 1LD7A 2RG8A 4GB9A 3SI5A 3ZYMA 3TXNA 4XI0A 1MZCA 3ZNGA 3EHRA 3C98A 3EHNA 3DPDA 2Y1LE 4G26A 3DSWA 3UTMA 3GZSA 3J5PA 1N54A 5HRYA 1H6PA 4D10C 4Y6CA 5D0OD 4PS8A 2WQ6A 2VSOE 5LX8A 4P29A 1TNBA 2XZDG 2NSZA 3QWVA 2R05A 3T8KA 1IQUA 1IHBA 3LY9A 4N3AA 4L1BA 4I9EA 3FTSA 3JQ0A 1UOHA 3TWWA 5ITZF 4MS6A 3E37A 2B0OE 4F1SA 1NI1A 2V0PA 4O6FA 3GZ2A 4JL0A 4C0MA 2AXVA 5BUZA 3D9MA 1U2VG 4GZ5A 4GU5A 2BEDA 3L82A 2PQNA 3L9TA 1HZ4A 3DPYA 4JW1A 3KSLA 3CKCA 4UUCA 2IOLA 5T4YA 4BX8A 4KZCA 1LF8A 4N2QA 1BI7B 1IHGA 2AXUA 1EF1C 1E7UA 4LEUA 2IEJA 2XCBA 4BT9A 3MJWA 2HM8A 3AS8A 3HVEB 2XPZA 3V31A 1A5EA 4TXQA 3LVRE 4N3BA 2F8XK 1BD8A 4YDOA 4GA0A 1K1BA 3NZUA 1SA5A 2NC9A 4ANXA 3MV2B 2WMOA 2PQRA 1O1SA 4FU3A 4L7TA 2LAHA 3U3WA 3CHOA 1QZ2A 3E32A 3TXMA 3Q75A 3APDA 5LP0A 4I43A 2LXLA 2CFZA 4EBAA 2VGYA 4K5BA 4JZYA 3DWLG 2IF4A 4UWKA 3QARA 3CHSA 1JWGA 4FC8A 4JB8P 3AJIA 3VLEA 4HI9A 1S0PA 4ME2A 5G05J 1O5MA 4U8HA 4KZ0A 4DX5D 1MX6A 3SF4A 5IY5E 1X5BA 2R03A 2IY0C 1MYOA 4JA9A 2GRLA 3ZVVA 5BNWA 4GZDA 4DX6D 3MEKA 4JD2G 2J4DA 2VTBA 3SFZA 1E7VA 4FLHA 4ILHB 4K0RA 3MKRA 2YHEA 2IFUA 3Q49B 3CR3A 2EINE 2DVWA 4UWGA 3PREA 3D9HA 4JHRA 2A4ZA 4BY6A 2VQ2A 3MA5A 2LXMA 4C0EA 3AS4A 4HLLA 3RRUA 2FEZA 2DBAA 3LKUA 1TN6A 1N4QA 2OCCE 4HOQA 1TNUA 5KNHD 4DRXE 3TAXA 1SVXA 3TG5A 3QOUA 4IULA 4N2SA 4G8LA 5BPPA 1LD8A 3SBTB 3Q9NC 3ZU7B 3CVPA 3TWRA 4F6RD 3FUDA 3I3NA 4DUIA 2WXIA 1WM5A 4I2WA 3ZHEB 3MGBA 3UM3A 4G2VA 3CK8A 2F8YA 2OV8A 3PNLB 3ZGQA 3KEZA 3PH0C 4J8DA 4NRHB 2GRRB 3UMVA 3PVLA 3LJNA 5KCMA 3D9PA 3Q7FA 3EUVA 3L13A 4U63A 5FIOA 3ISMC 4U96D 4UQXA 3K9IA 4EHMA 4LNUD 4ILGA 3CGHA 4F7AA 4M7CA 4J6IA 3O48A 2KCKA 3NAWA 3T8MA 2ETCA 3B95A 3HXFA 4X8QA 4GTMA 4CGVA 2QC9A 3FY4A 4ACLA 5DBKA 4XIFA 3I4GA 4G24A 3FUJA 5A6CA 3EHMA 3FUMA 3F6QA 3T9KA 4I1OB 2GGFA 3MYVA 3BG1B 3B7RL 4ANWA 3JCKC 3IV0A 1IQRA 3FUIA 4HQDA 1KZOA 2AWIA 4MBGA 1INZA 4J8EA 2IQCA 4HOTA 1N94A 3D9JA 3FUFA 4DX2A 3ML9A 4V3IA 4I17A 3AAAC 3KS2A 3QDNA 3LCAA 5G04C 3L16A 4GA2A 5T3RA 2IJGX 2QYJA 1D8DA 1DVPA 3S7DA 3I5PA 5J90A 1VDYA 1HG2A 3LPZA 1ELRA 4O1OA 1BI8B 2PNNA 1YA0A 1DC2A 2R59A 4UI9J 4W9RA 4C48B 4FHKA 2RKKA 3ZW3A 5FTPA 4GZ3A 3UT7A 2R5SA 1FPPA 2X6JA 3GZ1A 1SZ9A 3PZ4A 3IXEA 1HX8A 3WXXA 3UM0A 2YNQA 2EILE 2VGXB 3CQCB 2EIKE 1OXJA 1YCSB 1K3ZD 3SBSA 1MX2A 3CVLA 3LDZA 3MCXA 3SD5A 3KAEA 5FQ6A 3UXGA 4FHJA 4CZ2D 3RJVA 3FTVA 4RLYA 1V55E 4GPMA 4FP7A 4RVBA 3CVQA 1MHQA 2EQXA 3Q9UC 3TWQA 5ENRD 3EU5A 3UIOC 1NFIE 5EYPF 4HOUA 3AG3E 4LG6A 5FQ8A 4OVVA 4ABNA 3UPVA 4DLQA 4ATZD 3UUXA 1SQMA 2FI7A 2GRQB 3O4ZA 2QZAA 4WNGA 3CEQA 3UKRG 2KATA 4TRQA 1OCRE 3TJPA 4BT8A 4BSZB 4RQIA 3DRAA 2JLBA 1OWOA 2IONA 4I9CA 4I6EA 4H7XA 4FLBA 1XNFA 5C1DA 3EHQA 2WXFA 3D9KA 4O60A 1IXVA 4HRNA 2X6HA 2PM7A 3R9AB 3B7UX 4JC8A 4UI9K 1DCQA 1X81A 1NZNA 5AN8A 2ONDA 4OAVB 1NA3A 2GRPB 4E85A 4XE0A 3MKQA 4GYYA 4ACKA 4YNDA 1FVFA 4CDMA 2KC7A 4EZLA 3SO8A 3RAUA 3EIQC 3C3RA 3LVQE 4MKTA 4U0SA 3IHVA 2DZNA 3FDHA 3ABLE 1N4PA 1JCSA 3PS6A 3ABME 3S7JA 4DI3A 4GZCA 1QNFA 3VTYA 2XS8A 5CERB 4DX1A 2RFMA 2F0YA 3UQ3A 4KBQA 4WWPA 5JJ7A 5EIDA 3ASHA 2CHWA 4UQZA 3KEAA 2UY1A 3DEOA 4C9BB 3FUNA 2Y4UA 3FUHA 3HXBA 4JA7A 3ZFWA 1E8XA 1B89A 1V54E 2PM6A 4DPRA 2LAIA 4AV7A 1W3BA 2V4LA 5CCLA 4HFGA 2NYJA 1MX4A 3TWVA 5KJKA 4TXPA 3PNTB 3CLJA 3CVVA 1TNOA 4J7WA 3ASDA 1AWCB 4XKCA 4KVMA 3Q78A 5AJLA 5E76A 4U04A 2DZOA 4R7LA 3UX4A 4GTRA 4GTQA 3CK9A 4G25A 2XZTG 3FU6A 2WQ7A 2FO1E 3LS8A 1HG5A 2B6CA 3L54A 2KCVA 4DX7D 2BF0X 3PRZA 1ZU2A 3L17A 5G2NA 3CVNA 2WXKA 1EDUA 1K8KG 3ONLA 5DIZA 5ARFA 2P2CP 2R2LA 1U3DA 4OVUA 1ZBPA 4UQYA 5CMWA 1Z5SC 4A55A 4B93B 4TXRA 2IO2C 3FTYA 3RO2A 2A5UA 3CKBA 3MX3A 4U8YD 3UIPC 5KJNA 3CV0A 4NURA 3D9OA 3QK0A 5BT1A 3ULQA 4MLPA 5CMYA 5FZSA 2WXPA 2XGOA 1QBQA 1E8WA 3FU0A 3D9NA 5FQ4A 2VSYA 1OWPA 1ELKA 3IEGA 4WWNA 4APFA 4CCAA 1ZB1A 4DLOA 3P2BA 2KXPC 1O1TA 1YMPA 2ZXWE 4YVQC 3IKOB 4U7EB 2KM4A 1DCEA 3ASNE 2LNIA 4HOSA 5B3SE 3QB2A 3BG0B 4OYSA 5A7DB 2YINA 3PZ3A 3ZYLA 5JHAA 3CQGB 4HLEA 4BESA 3RSEG 3ZRHA 4BTAA 1TEZA 1JCRA 4BSXA 4UWLA 1E90A 2Y0BG 2J8SD 3OAWA 5KNGA 1H2VC 1S64A 1N52A 3TWUA 1E8YA 5H7PA 5AQ9A 3N71A 4WNDA 1FT1A 4YVOA 2L9BA 3RO3A 2GRNB 2H6FA 3S7FA 4GAAA 1UJKA 5FZQA 2WXGA 3C72A 5EILA 5AIJA 1L5JA 2WVIA 3UKUG 2JABA 3ASGA 3S2AA 3MV3B 3EJNA 2P9NG 4Q69A 3DEPA 1KZPA 2V5QC 3DSVA 2QYUA 4ANUA 1Y6IA 4IYPA 4EZKA 3JQ1A 3DBSA 3CVXA 4BX9A 4ANVA 3FUKA 2QY7A 1WDYA 4XI9A 5HS0A 4Z68A 2I1KA 4NACA 1N0QA 4IN3B 4XKBA 1WY6A 3UT8A 3B7SA 3FTZA 4HI8A 3NZSA 1O1RA 1OWLA 5ENOD 1KLXA 4MRUA 5CEAA 2XGMA 3FH7A 5ENTD 4PS7A 1U3CA 5ANRA 4YDEA 3Q4AB 4YDYA 3FEXA 4AP2A 2X6FA 1Z3YA 4HS2A 5FJYA 3GW4A 2ZIRA 5JA4D 2KZTA 4G1TA 3R9MA 2L6BA 4A3TA 1FCHA 2XRZA 3E33A 1HXIA 3OXFA 2XQ0A 3APCA 2WMNA 5KWDA 2MOWA 4AXHA 1SZAA 1BPOA 3EU9A 4BTBA 3HXCA 5AENA 3CVWA 5G04J 4GTPA 3DXKG 5JJ6A 3AG1E 5FWQA 4N5CA 2LO6A 3NB2A 1OWNA 3OXLA 4HB5A 3SY2A 3NOCD 1OCOE 2J08A 4JVSA 1WG0A 2CG2A 4N39A 2BTDA 3QWPA 3IBEA 1OCCE 2AVPA 1RZ4A 3UM1A 1TNZA 4F3VA 2LSUA 2ZISA 1UG3A 3Q47B 2GROB 5AARA 1HU3A 1N11A 3AS5A 1S70B 4JEUA 5EX3A 1HH8A 5ENNA 3FTUA 5FINA 3CHPA 4KMOA 3RRMB 4J8SA 5EYLA 4LSZE 1N0RA 3JUIA 1KPSB 2R17C 2RD0A 3FH8A 2FBNA 2A5EA 4U0UA 3AG4E 2V4HC 5FZRA 1FVHA 2AJAA 4ZHBA 5CBOA 4U95D 4EECA 4HRLA 1OCZE 3FTXA 2E0IA 4ATGA 4AEZC 3LYAA 2P58C 2XGSA 3D3MA 5CRVA 1Y8MA 4RSYA 3FP3A 1NP7A 3G2UA 3C3OA 2HR2A 4I2ZA 2FO7A 1TJFA 3SNXA 2XPIA 5BXUA 2ETBA 2HO1A 4GZ6A 4URKA 4GTVA 4HNAD 4F1PA 5EDSA 2OEVA 3QWWA 1UN9A 1TJCA 3HDXA 1LTXA 5JMND 2MHKA 2AXZA 3EDTB 4J0UA 3FULA 3C5RA 4TV3A 1K1AA 3D9IA 3FHEA 2VTBB 2BKGA 3ESKA 1Z3XA 3U64A 4L2LA 3SFXA 1N4SA 1PAQA 4WNFA 4GYOA 4IRUA 1NA0A 4K03A 3JYSA 4UWHA 4FJZA 1UJJA 2C0LA 1PC2A 2Y3AA 3ZYKA 4WWOA 3ABKE 4B0ZA 5D0QD 4I1MA 4U07A 5AYWD 3VLDA 3U4TA 2J4BA 3QKYA 4I6JA 5E75A 4UWFA 4LNBA 2WPVA 2VSXE 4APOA 3CIAA 2ILRA 3JUEA 2WXRA 4CDNA 3E4BA 4HXIA 2UWJG 2I2OA 2ZGDA 4WAFA 1XGWA 5ANLA 2CFUA 1OT8A 3U66A 2WXOA 3W9FA 1N95A 2J09A 5AQ7A 2P9LG 2QFCA 4PDXA 1P5QA 1PY1A 3LY7A 2OVBA 4JEHA 2VSNA 3Q5MA 3WG7E 2JEKA 2Y69E 3HIZA 3ZPJA 4BETA 3V2OA 3APFA 4G23A 3NQPA 2PZIA 3AU5A 4E6HA 2H6IA 3FWVA 3PUJA 1UW4B 2RFAA 2GRMA 2L6JA 4EZJA 3CSTA 2KZTB 5BV1A 3G2WA 1HF8A 1N4RA 5CHEE 3PE4A 2IU1A 2NXPA 2WM9A 1BLXB 3ZIMA 4U8VD 1EPUA 4GA1A 5FT9A 4GMLA 3URZA 4QQIA 3HXEA 1TYQG 2CG3A 1MJ0A 1G3NB 3TL5A 2FF4A 5HQ8A 2XPYA 1JCQA 2Q7FA 2DYSE 1N9AA 2EIME 4CRWA 3BU8A 3UT4A 5LOZA 4CEMA 5CCMA 2DWZA 2WXJA 3MZLB 4JXTA 2WXMA 3ESLA 4GCNA 4ILIA 4AOFA 1JPLA 4Q96A 3KSQA 2XENA 3PUKA 2VYIA 3V2XA 1D9SA 4GYWA 5D66A 5FQ7A 4RG9A 4FJYA 5AJDA 3UM2A 4A3VA 4GCOA 1TNYA 4XEIG 3U9WA 1A17A 3CVYA 4CGWA 3ML8A 4WNEA 4I6GA 2DYRE 4I1AA 3RKVA 3DSUA 1H6KA 5B1BE 3BEEA 3ZUVB 1GW6A 1DNPA 4JPSA 4L23A 3PZ2A 2OVFA 4LERA 4RG6A 4K5AB 2I6HA 3FH5A 1HFAA 2VGXA 2XEEA 4B8CB 2X38A 3IHYA 3W9GA 4AIFA 3RU0A 4BWRA 4PH4B 5KJLA 2OOEA 3UINC 3CHQA 2C0MA 3NF1A 4GTSA 3CHRA 5LCWJ 3LY8A 2VJ8A 4N5QA 4HRMB 4PS3A 2CHZA 3TGOA 3RRNB 1OY3D 3CK7A 3DSSA 4YDWA 3Q79A 2H6GA 4DK5A 3Q15A 3S7BA 5BV0A 2XHEA 2ZGGA 4LRZA 4L2YA 3ZKJA 3DXMG 3FEYA 2PL2A
chains in the Genus database with same CATH topology
2Y4TA 2MOWA 3LY9A 1SZAA 4N3AA 4AXHA 1BPOA 3QJZA 1KT0A 3PE3A 4HOUA 5LCWC 4L1BA 4BTBA 4I9EA 5FQ8A 3FTSA 4OVVA 3JQ0A 4ABNA 3UPVA 4DLQA 1KT1A 3LJ3A 5AENA 3SZ7A 3UUXA 3CVWA 5G04J 1MQSA 1SQMA 2FI7A 4MS6A 3O4ZA 4WNGA 4F1SA 3L22A 5JJ6A 3QAQA 5FWQA 2V0PA 4O6FA 3GZ2A 4JL0A 4N5CA 2L0TB 1UN8A 3CEQA 3ONKA 2LO6A 5G05C 4C0MA 2AXVA 5BUZA 3D9MA 4GZ5A 1OWNA 3OXLA 4GU5A 4QFVA 2KATA 1ELWA 2PQNA 4TRQA 3TJPA 4BT8A 4U0ZA 2J08A 2WXHA 4FULA 1HZ4A 4JVSA 4CT4A 4JW1A 4TUUA 2CG2A 3CKCA 4N39A 2IOLA 2JLBA 4CDRA 1OWOA 2BTDA 3QWPA 3IBEA 5T4YA 4BX8A 4KZCA 1LF8A 2E2EA 2AVPA 4GMJA 2IONA 4N2QA 2ZU6B 1IHGA 2AXUA 4I9CA 5EKQD 1EF1C 4I6EA 3ZYQA 1E7UA 4H7XA 2V8SE 4LEUA 4F3VA 2XCBA 4LUNU 1H19A 2LSUA 4WUYA 4BT9A 1UG3A 2HM8A 3MJWA 4FLBA 3AS8A 4GPKA 3Q47B 4KXKB 3HVEB 1XNFA 1HU3A 3ZEFA 4B89A 5C1DA 2XPZA 2WXFA 3D9KA 3LVRE 3ASFA 5JJTA 4N3BA 3AS5A 3QC1A 3G2TA 4JEUA 3ZXSA 4GA0A 2X6HA 5EX3A 1HH8A 1EYHA 5ENNA 5LFAA 2PM7A 3FTUA 3CHPA 3NZUA 4KMOA 4XZ4A 3R9AB 3RRMB 2XRYA 4J8SA 3JUIA 2NC9A 4ANXA 4B94A 3MV2B 4AY5A 2R17C 4EPZA 2RD0A 2WMOA 2PQRA 2X6IA 3B7UX 3FH8A 4KVOA 2FBNA 4FU3A 4JC8A 4UI9K 4JHJA 5BW8C 3R7QA 3QNKA 4L7TA 4U0UA 1NZNA 2ONDA 5FZRA 3FU5A 1FVHA 1NA3A 2LAHA 3KD7A 3SGHA 4EECA 4E85A 4XE0A 3MKQA 3U3WA 4GYYA 4A1SA 4LCTA 4ACKA 4YNDA 1FVFA 3MKQB 4PUCA 3CHOA 1QZ2A 3FTXA 3TXMA 4CDMA 2E0IA 2KC7A 4EZLA 2L0IA 3APDA 4ATGA 5LP0A 4AEZC 4A1GA 3FFLA 3LYAA 2AW6A 2P58C 2XGSA 4I43A 3D3MA 2CFZA 4EBAA 2VGYA 2WXQA 3EIQC 4JZYA 2I1JA 1Y8MA 4RSYA 3FP3A 3LVQE 1NP7A 4MKTA 3G2UA 4U0SA 2IF4A 3IHVA 4UWKA 3QARA 3FDHA 3CHSA 1JWGA 2I9CA 2XCCA 4KYOB 1IYGA 2HR2A 2YQ8A 4FC8A 3ZN3A 3PS6A 4DI3A 3S7JA 4GZCA 3B13A 1HS6A 1QNFA 2FO7A 3G2SA 4I2ZA 3VLEA 3VTYA 1TJFA 5T8IA 3SNXA 1QQEA 2XPIA 4AJWA 3UQ3A 1S0PA 2HO1A 4KBQA 4GZ6A 4ME2A 4URKA 5G05J 4U8HA 4KZ0A 2J07A 4WWPA 5EDSA 2IOSA 5A23A 2X3MA 3QWWA 3SF4A 3GYZA 1UN9A 5JJ7A 1TJCA 3RIBA 1X5BA 3HDXA 3ASHA 4XX5A 4HORA 4JA9A 2GRLA 3ZVVA 2CHWA 2MHKA 3CHMA 1HO8A 2AXZA 5BNWA 3L08A 3ENEA 4GZDA 3EDTB 5KJMA 4J0UA 3FULA 3MEKA 3LXUX 4UQZA 4TV3A 2J4DA 2VTBA 2UY1A 3SFZA 3D9IA 4C9BB 3FHEA 2VTBB 3FUNA 2Y4UA 2UY1B 1E7VA 3FUHA 4JA7A 2BUGA 4FLHA 4ILHB 3ZFWA 3ESKA 4K0RA 3MKRA 1Z3XA 2YHEA 2IFUA 3SHFA 3U64A 1E8XA 3CR3A 1B89A 1H0AA 3Q49B 4L2LA 2PM6A 1PAQA 4WNFA 4UWGA 4FADA 4DPRA 3PREA 4DJAA 4GYOA 4M3OA 2LAIA 5JHBA 2J9QA 4AV7A 1W3BA 2V4LA 3OTNA 4JHRA 5CCLA 2A4ZA 4IRUA 4BY6A 2KCLA 2VQ2A 1NA0A 2X6KA 3JYSA 3MA5A 4K03A 4UWHA 3AS4A 4C0EA 4HFGA 4FJZA 5ARGA 5HI7A 3RRUA 1UJJA 2C0LA 2FEZA 5KJKA 1PC2A 2Y3AA 3ZYKA 3PNTB 2DBAA 3CLJA 3LKUA 3CVVA 2FULA 4WWOA 5J08A 4I1MA 4N3CA 5D0QD 4HOQA 4U07A 5AYWD 3HHMA 4B0ZA 3TAXA 3TG5A 3ASDA 3U4TA 3VLDA 3AU4A 4EBAG 3QOUA 4IULA 4XKCA 4KVMA 4N2SA 5AJLA 2J4BA 3QKYA 3HVEA 5BPPA 4AY6A 2LSVA 5E76A 3SBTB 4H7YA 3FU3A 4U04A 3CVPA 4I6JA 5E75A 3FUDA 2WXLA 4R7LA 4UWFA 3UX4A 3I3NA 2WXIA 3CK9A 2WPVA 4G25A 2VSXE 5EX0A 1WM5A 4I2WA 4JHKA 3FU6A 3MGBA 3PEVB 3ZHEB 4APOA 3EIJA 2WQ7A 3CIAA 1H2TC 2ILRA 3LS8A 4CDNA 2WXRA 1HG5A 3E4BA 3L54A 4G2VA 2KCVA 4HXIA 3CK8A 2BF0X 4HVBA 1OUVA 2I2OA 2OV8A 2UWJG 3PRZA 3PNLB 4WAFA 1ZU2A 3ZGQA 3KEZA 1H2UA 1XGWA 4EQFA 3L17A 5G2NA 3PH0C 5ANLA 2DIWA 3CVNA 2CFUA 2WXKA 1EDUA 3ONLA 5DIZA 5ARFA 3U66A 2WXNA 2WXOA 4J8DA 3PEUB 1U3DA 4NRHB 4OVUA 1ZBPA 4UQYA 3UMVA 1Z6TA 2J09A 5CMWA 3PVLA 4Y6WA 4A55A 5KCMA 3D9PA 4U63A 3L13A 2QFCA 4B8AA 4PDXA 3FTYA 4UQXA 2C2LA 3K9IA 3RO2A 1P5QA 1PY1A 3LY7A 2A5UA 3CVUA 1WAO1 2DCPA 2OVBA 3CKBA 4JEHA 3I4RB 2VSNA 3MX3A 3Q5MA 4ILGA 3CGHA 3T5VA 4F7AA 4Q94A 5KJNA 3CV0A 4NURA 3D9OA 3QK0A 5BT1A 2JEKA 3FTWA 4J6IA 3ULQA 4MLPA 5CMYA 3O48A 3HIZA 2KCKA 5FZSA 2WXPA 3ZPJA 3T8MA 4UI9C 2XGOA 3HYMB 2YHCA 3APFA 1E8WA 3FU0A 4CGVA 2M63A 3FY4A 3D9NA 3NQPA 3LEWA 4G23A 2PZIA 3AU5A 5FQ4A 2VSYA 1OWPA 4ACLA 4BFRA 4E6HA 3B7TA 1ELKA 3IEGA 3FWVA 3PUJA 5DBKA 4XIFA 3PZDA 3CSFA 3I4GA 4WWNA 4APFA 4CCAA 4DLOA 3P2BA 4G24A 3FUJA 1UW4B 2GRMA 2L6JA 4YVQC 4EZJA 5A6CA 3CSTA 3OXGA 2KZTB 5BV1A 3G2WA 3G2VA 3IKOB 2KM4A 1HF8A 5CHEE 3RK6A 3EHMA 3FUMA 2LNIA 3PE4A 2IU1A 4FA6A 2NXPA 4HOSA 2WM9A 3L6AA 3ZIMA 3QB2A 1EPUA 3BG0B 4OYSA 4GA1A 2YINA 5A7DB 1E96B 4I1OB 3ZYLA 5JHAA 3CQGB 4AM9A 2WB2A 2GGFA 4HLEA 2V5FA 5FT9A 2CHXA 1E8ZA 5M72A 4GMLA 3URZA 3MYVA 3BG1B 3B7RL 4KT6B 3ZRHA 4ANWA 4BTAA 3JCKC 1TEZA 3D9LA 2CG3A 3PDNA 3IV0A 4BSXA 1IQRA 4UWLA 4AVXA 4F53A 1E90A 3FUIA 3P1UA 3VLFA 3OAWA 4CT0A 3TL5A 1H2VC 2AWIA 1JWFA 2FF4A 1N52A 5HQ8A 2HYZA 2XPYA 1E8YA 2Q7FA 4G11A 3N71A 4WNDA 1INZA 4DI4A 4YVOA 4CRWA 4J8EA 2L9BA 2XEVA 3RO3A 2IQCA 3UT4A 5LOZA 4HOTA 4CEMA 3D9JA 5CCMA 2WXJA 3MZLB 4NQ0A 3S7FA 4JXTA 2WXMA 3ESLA 3FUFA 4GAAA 4GCNA 1UJKA 5FZQA 2WXGA 4ILIA 4AOFA 3ML9A 4V3IA 1JPLA 4Q96A 4I17A 5AIJA 3ZHEA 1L5JA 2VYIA 3KS2A 3PUKA 2WVIA 3QDNA 5G55A 3LCAA 5G04C 4GYWA 3L16A 5FQ7A 4RG9A 4FJYA 3ASGA 3S2AA 3MV3B 5AJDA 4GA2A 5T3RA 1HE8A 4A3VA 1JUQA 3EJNA 2IJGX 4Q69A 4GCOA 1DVPA 3U9WA 3S7DA 1A17A 3I5PA 4CGWA 5J90A 2WQHA 3ML8A 1VDYA 3CVYA 1HG2A 4WNEA 3LPZA 4I6GA 4ANUA 1ELRA 1Y6IA 4IYPA 4I1AA 3RKVA 5C2YA 4EZKA 1YA0A 2R59A 4UI9J 3TG4A 3JQ1A 3DBSA 4W9RA 4FHKA 3ZW3A 5FTPA 4BX9A 3CVXA 4GZ3A 4ANVA 3FUKA 4J8FA 3UT7A 2R5SA 2QY7A 1H6KA 3T5XA 4XI9A 3R7RA 3VTXA 2I1KA 3BEEA 4NACA 2X6JA 3GZ1A 1GW6A 2MRIA 1SZ9A 1DNPA 4JPSA 1OWMA 4IN3B 3FUEA 1HX8A 4L23A 2J49A 2OVFA 4LERA 4RG6A 3WXXA 2GW1A 4XKBA 2I6HA 2YNQA 1HFAA 3FH5A 2VGXA 1WY6A 2VGXB 2RG8A 4GB9A 3SI5A 2X38A 3CQCB 4B8CB 3UT8A 3B7SA 3TXNA 3ZYMA 3FTZA 3IHYA 3NZSA 4XI0A 4AIFA 3RU0A 4BWRA 1OWLA 4PH4B 5KJLA 2OOEA 3SBSA 3CHQA 2C0MA 1KLXA 3C98A 3CVLA 3EHNA 3NF1A 2XGMA 4MRUA 3FH7A 3LDZA 3DPDA 4PS7A 3CHRA 3MCXA 5LCWJ 1U3CA 4G26A 5ANRA 3LY8A 3SD5A 3KAEA 3Q4AB 2VJ8A 3FEXA 4AP2A 3GZSA 2X6FA 5FQ6A 1Z3YA 4HS2A 1N54A 4FHJA 5FJYA 4PS3A 2CHZA 3TGOA 3GW4A 3RJVA 3RRNB 3FTVA 3CK7A 2KZTA 4G1TA 4FP7A 4DK5A 3Q15A 4D10C 4A3TA 4Y6CA 1FCHA 4RVBA 5D0OD 4PS8A 2XRZA 2WQ6A 3S7BA 3CVQA 1MHQA 5BV0A 2EQXA 2VSOE 2XHEA 5LX8A 4P29A 1HXIA 4LRZA 2NSZA 3OXFA 2XQ0A 4L2YA 3APCA 3QWVA 2WMNA 3FEYA 2PL2A 1IQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4T A;  3LY9 A;  4N3A A;  4HOU A;  1KT0 A;  3PE3 A;  5LCW C;  4BTB A;  4I9E A;  4ABN A;  3UPV A;  1KT1 A;  3SZ7 A;  3UUX A;  5G04 J;  2FI7 A;  4WNG A;  5JJ6 A;  4O6F A;  3GZ2 A;  4JL0 A;  4N5C A;  3CEQ A;  5G05 C;  4GZ5 A;  3OXL A;  2KAT A;  1ELW A;  2PQN A;  4BT8 A;  4U0Z A;  1HZ4 A;  3CKC A;  4N39 A;  2JLB A;  4CDR A;  3QWP A;  2E2E A;  2AVP A;  4N2Q A;  1IHG A;  4I9C A;  5EKQ D;  4H7X A;  4LEU A;  4F3V A;  2XCB A;  2LSU A;  4BT9 A;  4WUY A;  3AS8 A;  4GPK A;  3Q47 B;  4KXK B;  1XNF A;  5C1D A;  3ASF A;  5JJT A;  4N3B A;  3AS5 A;  4GA0 A;  5EX3 A;  1HH8 A;  3R9A B;  2NC9 A;  4B94 A;  3MV2 B;  4AY5 A;  2PQR A;  2FBN A;  4UI9 K;  5BW8 C;  4U0U A;  1NZN A;  2OND A;  5FZR A;  1NA3 A;  3KD7 A;  3U3W A;  4GYY A;  4A1S A;  4YND A;  1QZ2 A;  2KC7 A;  3FFL A;  3LYA A;  2P58 C;  2XGS A;  2VGY A;  1Y8M A;  3FP3 A;  4U0S A;  2IF4 A;  1IYG A;  2XCC A;  4KYO B;  2HR2 A;  2YQ8 A;  3ZN3 A;  3S7J A;  4I2Z A;  2FO7 A;  3VTY A;  1QQE A;  2XPI A;  3UQ3 A;  2HO1 A;  4KBQ A;  4GZ6 A;  4ME2 A;  5G05 J;  3QWW A;  3SF4 A;  3GYZ A;  5JJ7 A;  1TJC A;  3RIB A;  3ASH A;  4HOR A;  4JA9 A;  2MHK A;  5BNW A;  3EDT B;  5KJM A;  4J0U A;  3MEK A;  4UQZ A;  2UY1 A;  2Y4U A;  2UY1 B;  4JA7 A;  3ZFW A;  2BUG A;  3ESK A;  3MKR A;  2IFU A;  3Q49 B;  1B89 A;  4WNF A;  4GYO A;  2J9Q A;  1W3B A;  4JHR A;  5CCL A;  2KCL A;  2VQ2 A;  1NA0 A;  3JYS A;  3MA5 A;  3AS4 A;  5ARG A;  5HI7 A;  5KJK A;  2C0L A;  2FEZ A;  1PC2 A;  2DBA A;  3LKU A;  5D0Q D;  4N3C A;  4HOQ A;  4U07 A;  5AYW D;  3TAX A;  3TG5 A;  3ASD A;  3U4T A;  3QOU A;  4N2S A;  3QKY A;  4AY6 A;  2LSV A;  4H7Y A;  4U04 A;  3CVP A;  3CK9 A;  2WPV A;  4G25 A;  5EX0 A;  1WM5 A;  4I2W A;  3ZHE B;  4APO A;  3E4B A;  4G2V A;  2KCV A;  3CK8 A;  1OUV A;  2UWJ G;  1ZU2 A;  3ZGQ A;  4EQF A;  3CVN A;  5DIZ A;  5ARF A;  4J8D A;  4NRH B;  4UQY A;  1ZBP A;  4Y6W A;  2QFC A;  4UQX A;  2C2L A;  3K9I A;  3RO2 A;  1P5Q A;  3LY7 A;  1WAO 1;  3CKB A;  2VSN A;  3Q5M A;  5KJN A;  3CV0 A;  5BT1 A;  3ULQ A;  3O48 A;  2KCK A;  5FZS A;  3ZPJ A;  4UI9 C;  2XGO A;  3HYM B;  2YHC A;  4CGV A;  4G23 A;  2PZI A;  2VSY A;  3IEG A;  3FWV A;  5DBK A;  4XIF A;  4G24 A;  2L6J A;  4YVQ C;  5A6C A;  3OXG A;  5CHE E;  2LNI A;  3PE4 A;  4HOS A;  5A7D B;  4GA1 A;  1E96 B;  4AM9 A;  2V5F A;  5FT9 A;  5M72 A;  3URZ A;  4BTA A;  3PDN A;  2FF4 A;  5HQ8 A;  2HYZ A;  2Q7F A;  3N71 A;  4WND A;  4YVO A;  4J8E A;  2XEV A;  3RO3 A;  4HOT A;  5CCM A;  4NQ0 A;  3S7F A;  4GCN A;  5FZQ A;  4I17 A;  3ZHE A;  2VYI A;  3KS2 A;  3QDN A;  3LCA A;  5G04 C;  4GYW A;  4RG9 A;  3ASG A;  3MV3 B;  4GA2 A;  4GCO A;  3S7D A;  1A17 A;  4CGW A;  2WQH A;  4WNE A;  3LPZ A;  1ELR A;  4I1A A;  3RKV A;  1YA0 A;  4UI9 J;  3TG4 A;  4W9R A;  5FTP A;  4GZ3 A;  4J8F A;  2R5S A;  4XI9 A;  3VTX A;  3BEE A;  3GZ1 A;  4IN3 B;  4RG6 A;  3WXX A;  2GW1 A;  2I6H A;  2VGX A;  2VGX B;  4XI0 A;  4AIF A;  3RU0 A;  4BWR A;  5KJL A;  2OOE A;  2C0M A;  1KLX A;  3CVL A;  3NF1 A;  2XGM A;  5LCW J;  4G26 A;  3LY8 A;  3KAE A;  3Q4A B;  5FJY A;  3TGO A;  3GW4 A;  3RJV A;  3CK7 A;  4G1T A;  3Q15 A;  4Y6C A;  1FCH A;  5D0O D;  3S7B A;  3CVQ A;  1HXI A;  3OXF A;  3QWV A;  2PL2 A; 
#chains in the Genus database with same CATH topology
 2Y4T A;  3QJZ A;  1KT0 A;  3PE3 A;  5LCW C;  5EIB E;  1KT1 A;  3LJ3 A;  3SZ7 A;  3Q7A A;  3HRA A;  4L9P A;  1MQS A;  3L22 A;  3QAQ A;  2L0T B;  1UN8 A;  3ONK A;  5G05 C;  5CEC B;  3AG2 E;  3V79 K;  1D8E A;  4QFV A;  1ELW A;  4U0Z A;  2WXH A;  3Q73 A;  4FUL A;  2P9P G;  4CT4 A;  4TUU A;  2EIJ E;  4CDR A;  1SA4 A;  2E2E A;  4GMJ A;  1FT2 A;  2ZU6 B;  5EKQ D;  3ZYQ A;  2V8S E;  3J5Q B;  4LUN U;  1H19 A;  4WUY A;  4GPK A;  4KXK B;  3ZEF A;  4B89 A;  3TWS A;  1TN7 A;  3PZ1 A;  3ASF A;  5JJT A;  2XEH A;  3QC1 A;  3G2T A;  3ULE G;  3ZXS A;  5CBN A;  1EYH A;  2P9S G;  5LFA A;  4XZ4 A;  2XRY A;  4O1P A;  4B94 A;  4AY5 A;  4EPZ A;  4KVO A;  2X6I A;  4JHJ A;  5BW8 C;  3R7Q A;  3TWT A;  3QNK A;  3TWX A;  3FU5 A;  3KD7 A;  5CRU A;  3SGH A;  4LNG A;  4A1S A;  4LCT A;  3MKQ B;  4PUC A;  1S63 A;  2L0I A;  3HG0 D;  4A1G A;  3FFL A;  2AW6 A;  2WXQ A;  3SQV A;  2I1J A;  2ETA A;  1IYG A;  2XCC A;  2I9C A;  4KYO B;  3C3Q A;  2YQ8 A;  3ZXP A;  3ZN3 A;  3B13 A;  1HS6 A;  3G2S A;  5T8I A;  1QQE A;  4AJW A;  2R02 A;  1IKN D;  2J07 A;  2IOS A;  2IO3 C;  5A23 A;  5CED B;  2X3M A;  3GYZ A;  3HXD A;  5ENQ D;  3RIB A;  2H6H A;  4XX5 A;  4HOR A;  3CHM A;  1HO8 A;  3L08 A;  3ENE A;  3B7B A;  5KJM A;  4NIK A;  3LXU X;  2UY1 B;  2BUG A;  4K5C A;  3SHF A;  5ENS D;  1H0A A;  5AQA A;  4FAD A;  4DJA A;  4M3O A;  5JHB A;  2J9Q A;  3OTN A;  2KCL A;  2X6K A;  3ASO E;  5ARG A;  5HI7 A;  2FUL A;  4TUM A;  5J08 A;  4N3C A;  4GMR A;  3HHM A;  3AU4 A;  4EBA G;  5B1A E;  3HVE A;  4HBD A;  4AY6 A;  2LSV A;  4H7Y A;  3FU3 A;  2WXL A;  1QYM A;  5EX0 A;  4JHK A;  2MYO A;  3PEV B;  3EIJ A;  1H2T C;  5AAO A;  4HVB A;  1OUV A;  1BU9 A;  1H2U A;  4EQF A;  3X2Q E;  2DIW A;  3E34 A;  2WXN A;  3PEU B;  3NOG D;  1Z6T A;  2XS1 A;  4Y6W A;  3DSX A;  4BEP A;  2KBX A;  4B8A A;  2F37 A;  2C2L A;  3BUA A;  3CVU A;  1WAO 1;  2HE0 A;  2DCP A;  3I4R B;  3T5V A;  1Q2Z A;  4Q94 A;  2P9I G;  1YYH A;  3FTW A;  5AQB A;  3NBN B;  1AP7 A;  4UI9 C;  1SW6 A;  3HYM B;  2YHC A;  2M63 A;  3LEW A;  4BFR A;  4OAU C;  1H6O A;  3B7T A;  2VGE A;  4G8K A;  3PZD A;  3CSF A;  5HKP A;  3BQO A;  1TR4 A;  5KBA A;  3OXG A;  3G2V A;  4J8Y A;  3RK6 A;  4FA6 A;  4CYM D;  5D2M C;  3L6A A;  3JXJ A;  1E96 B;  4AM9 A;  2P9K G;  2WB2 A;  2V5F A;  3SFY A;  2CHX A;  1E8Z A;  5M72 A;  4KT6 B;  3D9L A;  3PDN A;  4AVX A;  4F53 A;  2LUH A;  3P1U A;  3VLF A;  4CT0 A;  1JWF A;  2P9U G;  2HYZ A;  4G11 A;  4DI4 A;  5BXO A;  3V30 A;  2XEV A;  4NQ0 A;  1TN8 A;  4GTO A;  3ZHE A;  5ENP D;  5G55 A;  3UI2 A;  1HE8 A;  1JUQ A;  3JXI A;  4ZFH A;  3E30 A;  3ULY A;  2WQH A;  2OEW A;  5C2Y A;  2BKK B;  3TG4 A;  3DST A;  4A63 B;  4J8F A;  3T5X A;  1RW2 A;  1NL4 A;  3VTX A;  3R7R A;  5EN5 D;  2MRI A;  1OWM A;  4GTT A;  3FUE A;  2J49 A;  4BER A;  2GW1 A;  1LD7 A;  2RG8 A;  4GB9 A;  3SI5 A;  3ZYM A;  3TXN A;  4XI0 A;  1MZC A;  3ZNG A;  3EHR A;  3C98 A;  3EHN A;  3DPD A;  2Y1L E;  4G26 A;  3DSW A;  3UTM A;  3GZS A;  3J5P A;  1N54 A;  5HRY A;  1H6P A;  4D10 C;  4Y6C A;  5D0O D;  4PS8 A;  2WQ6 A;  2VSO E;  5LX8 A;  4P29 A;  1TNB A;  2XZD G;  2NSZ A;  3QWV A;  2R05 A;  3T8K A;  1IQU A;  1IHB A;  3LY9 A;  4N3A A;  4L1B A;  4I9E A;  3FTS A;  3JQ0 A;  1UOH A;  3TWW A;  5ITZ F;  4MS6 A;  3E37 A;  2B0O E;  4F1S A;  1NI1 A;  2V0P A;  4O6F A;  3GZ2 A;  4JL0 A;  4C0M A;  2AXV A;  5BUZ A;  3D9M A;  1U2V G;  4GZ5 A;  4GU5 A;  2BED A;  3L82 A;  2PQN A;  3L9T A;  1HZ4 A;  3DPY A;  4JW1 A;  3KSL A;  3CKC A;  4UUC A;  2IOL A;  5T4Y A;  4BX8 A;  4KZC A;  1LF8 A;  4N2Q A;  1BI7 B;  1IHG A;  2AXU A;  1EF1 C;  1E7U A;  4LEU A;  2IEJ A;  2XCB A;  4BT9 A;  3MJW A;  2HM8 A;  3AS8 A;  3HVE B;  2XPZ A;  3V31 A;  1A5E A;  4TXQ A;  3LVR E;  4N3B A;  2F8X K;  1BD8 A;  4YDO A;  4GA0 A;  1K1B A;  3NZU A;  1SA5 A;  2NC9 A;  4ANX A;  3MV2 B;  2WMO A;  2PQR A;  1O1S A;  4FU3 A;  4L7T A;  2LAH A;  3U3W A;  3CHO A;  1QZ2 A;  3E32 A;  3TXM A;  3Q75 A;  3APD A;  5LP0 A;  4I43 A;  2LXL A;  2CFZ A;  4EBA A;  2VGY A;  4K5B A;  4JZY A;  3DWL G;  2IF4 A;  4UWK A;  3QAR A;  3CHS A;  1JWG A;  4FC8 A;  4JB8 P;  3AJI A;  3VLE A;  4HI9 A;  1S0P A;  4ME2 A;  5G05 J;  1O5M A;  4U8H A;  4KZ0 A;  4DX5 D;  1MX6 A;  3SF4 A;  5IY5 E;  1X5B A;  2R03 A;  2IY0 C;  1MYO A;  4JA9 A;  2GRL A;  3ZVV A;  5BNW A;  4GZD A;  4DX6 D;  3MEK A;  4JD2 G;  2J4D A;  2VTB A;  3SFZ A;  1E7V A;  4FLH A;  4ILH B;  4K0R A;  3MKR A;  2YHE A;  2IFU A;  3Q49 B;  3CR3 A;  2EIN E;  2DVW A;  4UWG A;  3PRE A;  3D9H A;  4JHR A;  2A4Z A;  4BY6 A;  2VQ2 A;  3MA5 A;  2LXM A;  4C0E A;  3AS4 A;  4HLL A;  3RRU A;  2FEZ A;  2DBA A;  3LKU A;  1TN6 A;  1N4Q A;  2OCC E;  4HOQ A;  1TNU A;  5KNH D;  4DRX E;  3TAX A;  1SVX A;  3TG5 A;  3QOU A;  4IUL A;  4N2S A;  4G8L A;  5BPP A;  1LD8 A;  3SBT B;  3Q9N C;  3ZU7 B;  3CVP A;  3TWR A;  4F6R D;  3FUD A;  3I3N A;  4DUI A;  2WXI A;  1WM5 A;  4I2W A;  3ZHE B;  3MGB A;  3UM3 A;  4G2V A;  3CK8 A;  2F8Y A;  2OV8 A;  3PNL B;  3ZGQ A;  3KEZ A;  3PH0 C;  4J8D A;  4NRH B;  2GRR B;  3UMV A;  3PVL A;  3LJN A;  5KCM A;  3D9P A;  3Q7F A;  3EUV A;  3L13 A;  4U63 A;  5FIO A;  3ISM C;  4U96 D;  4UQX A;  3K9I A;  4EHM A;  4LNU D;  4ILG A;  3CGH A;  4F7A A;  4M7C A;  4J6I A;  3O48 A;  2KCK A;  3NAW A;  3T8M A;  2ETC A;  3B95 A;  3HXF A;  4X8Q A;  4GTM A;  4CGV A;  2QC9 A;  3FY4 A;  4ACL A;  5DBK A;  4XIF A;  3I4G A;  4G24 A;  3FUJ A;  5A6C A;  3EHM A;  3FUM A;  3F6Q A;  3T9K A;  4I1O B;  2GGF A;  3MYV A;  3BG1 B;  3B7R L;  4ANW A;  3JCK C;  3IV0 A;  1IQR A;  3FUI A;  4HQD A;  1KZO A;  2AWI A;  4MBG A;  1INZ A;  4J8E A;  2IQC A;  4HOT A;  1N94 A;  3D9J A;  3FUF A;  4DX2 A;  3ML9 A;  4V3I A;  4I17 A;  3AAA C;  3KS2 A;  3QDN A;  3LCA A;  5G04 C;  3L16 A;  4GA2 A;  5T3R A;  2IJG X;  2QYJ A;  1D8D A;  1DVP A;  3S7D A;  3I5P A;  5J90 A;  1VDY A;  1HG2 A;  3LPZ A;  1ELR A;  4O1O A;  1BI8 B;  2PNN A;  1YA0 A;  1DC2 A;  2R59 A;  4UI9 J;  4W9R A;  4C48 B;  4FHK A;  2RKK A;  3ZW3 A;  5FTP A;  4GZ3 A;  3UT7 A;  2R5S A;  1FPP A;  2X6J A;  3GZ1 A;  1SZ9 A;  3PZ4 A;  3IXE A;  1HX8 A;  3WXX A;  3UM0 A;  2YNQ A;  2EIL E;  2VGX B;  3CQC B;  2EIK E;  1OXJ A;  1YCS B;  1K3Z D;  3SBS A;  1MX2 A;  3CVL A;  3LDZ A;  3MCX A;  3SD5 A;  3KAE A;  5FQ6 A;  3UXG A;  4FHJ A;  4CZ2 D;  3RJV A;  3FTV A;  4RLY A;  1V55 E;  4GPM A;  4FP7 A;  4RVB A;  3CVQ A;  1MHQ A;  2EQX A;  3Q9U C;  3TWQ A;  5ENR D;  3EU5 A;  3UIO C;  1NFI E;  5EYP F;  4HOU A;  3AG3 E;  4LG6 A;  5FQ8 A;  4OVV A;  4ABN A;  3UPV A;  4DLQ A;  4ATZ D;  3UUX A;  1SQM A;  2FI7 A;  2GRQ B;  3O4Z A;  2QZA A;  4WNG A;  3CEQ A;  3UKR G;  2KAT A;  4TRQ A;  1OCR E;  3TJP A;  4BT8 A;  4BSZ B;  4RQI A;  3DRA A;  2JLB A;  1OWO A;  2ION A;  4I9C A;  4I6E A;  4H7X A;  4FLB A;  1XNF A;  5C1D A;  3EHQ A;  2WXF A;  3D9K A;  4O60 A;  1IXV A;  4HRN A;  2X6H A;  2PM7 A;  3R9A B;  3B7U X;  4JC8 A;  4UI9 K;  1DCQ A;  1X81 A;  1NZN A;  5AN8 A;  2OND A;  4OAV B;  1NA3 A;  2GRP B;  4E85 A;  4XE0 A;  3MKQ A;  4GYY A;  4ACK A;  4YND A;  1FVF A;  4CDM A;  2KC7 A;  4EZL A;  3SO8 A;  3RAU A;  3EIQ C;  3C3R A;  3LVQ E;  4MKT A;  4U0S A;  3IHV A;  2DZN A;  3FDH A;  3ABL E;  1N4P A;  1JCS A;  3PS6 A;  3ABM E;  3S7J A;  4DI3 A;  4GZC A;  1QNF A;  3VTY A;  2XS8 A;  5CER B;  4DX1 A;  2RFM A;  2F0Y A;  3UQ3 A;  4KBQ A;  4WWP A;  5JJ7 A;  5EID A;  3ASH A;  2CHW A;  4UQZ A;  3KEA A;  2UY1 A;  3DEO A;  4C9B B;  3FUN A;  2Y4U A;  3FUH A;  3HXB A;  4JA7 A;  3ZFW A;  1E8X A;  1B89 A;  1V54 E;  2PM6 A;  4DPR A;  2LAI A;  4AV7 A;  1W3B A;  2V4L A;  5CCL A;  4HFG A;  2NYJ A;  1MX4 A;  3TWV A;  5KJK A;  4TXP A;  3PNT B;  3CLJ A;  3CVV A;  1TNO A;  4J7W A;  3ASD A;  1AWC B;  4XKC A;  4KVM A;  3Q78 A;  5AJL A;  5E76 A;  4U04 A;  2DZO A;  4R7L A;  3UX4 A;  4GTR A;  4GTQ A;  3CK9 A;  4G25 A;  2XZT G;  3FU6 A;  2WQ7 A;  2FO1 E;  3LS8 A;  1HG5 A;  2B6C A;  3L54 A;  2KCV A;  4DX7 D;  2BF0 X;  3PRZ A;  1ZU2 A;  3L17 A;  5G2N A;  3CVN A;  2WXK A;  1EDU A;  1K8K G;  3ONL A;  5DIZ A;  5ARF A;  2P2C P;  2R2L A;  1U3D A;  4OVU A;  1ZBP A;  4UQY A;  5CMW A;  1Z5S C;  4A55 A;  4B93 B;  4TXR A;  2IO2 C;  3FTY A;  3RO2 A;  2A5U A;  3CKB A;  3MX3 A;  4U8Y D;  3UIP C;  5KJN A;  3CV0 A;  4NUR A;  3D9O A;  3QK0 A;  5BT1 A;  3ULQ A;  4MLP A;  5CMY A;  5FZS A;  2WXP A;  2XGO A;  1QBQ A;  1E8W A;  3FU0 A;  3D9N A;  5FQ4 A;  2VSY A;  1OWP A;  1ELK A;  3IEG A;  4WWN A;  4APF A;  4CCA A;  1ZB1 A;  4DLO A;  3P2B A;  2KXP C;  1O1T A;  1YMP A;  2ZXW E;  4YVQ C;  3IKO B;  4U7E B;  2KM4 A;  1DCE A;  3ASN E;  2LNI A;  4HOS A;  5B3S E;  3QB2 A;  3BG0 B;  4OYS A;  5A7D B;  2YIN A;  3PZ3 A;  3ZYL A;  5JHA A;  3CQG B;  4HLE A;  4BES A;  3RSE G;  3ZRH A;  4BTA A;  1TEZ A;  1JCR A;  4BSX A;  4UWL A;  1E90 A;  2Y0B G;  2J8S D;  3OAW A;  5KNG A;  1H2V C;  1S64 A;  1N52 A;  3TWU A;  1E8Y A;  5H7P A;  5AQ9 A;  3N71 A;  4WND A;  1FT1 A;  4YVO A;  2L9B A;  3RO3 A;  2GRN B;  2H6F A;  3S7F A;  4GAA A;  1UJK A;  5FZQ A;  2WXG A;  3C72 A;  5EIL A;  5AIJ A;  1L5J A;  2WVI A;  3UKU G;  2JAB A;  3ASG A;  3S2A A;  3MV3 B;  3EJN A;  2P9N G;  4Q69 A;  3DEP A;  1KZP A;  2V5Q C;  3DSV A;  2QYU A;  4ANU A;  1Y6I A;  4IYP A;  4EZK A;  3JQ1 A;  3DBS A;  3CVX A;  4BX9 A;  4ANV A;  3FUK A;  2QY7 A;  1WDY A;  4XI9 A;  5HS0 A;  4Z68 A;  2I1K A;  4NAC A;  1N0Q A;  4IN3 B;  4XKB A;  1WY6 A;  3UT8 A;  3B7S A;  3FTZ A;  4HI8 A;  3NZS A;  1O1R A;  1OWL A;  5ENO D;  1KLX A;  4MRU A;  5CEA A;  2XGM A;  3FH7 A;  5ENT D;  4PS7 A;  1U3C A;  5ANR A;  4YDE A;  3Q4A B;  4YDY A;  3FEX A;  4AP2 A;  2X6F A;  1Z3Y A;  4HS2 A;  5FJY A;  3GW4 A;  2ZIR A;  5JA4 D;  2KZT A;  4G1T A;  3R9M A;  2L6B A;  4A3T A;  1FCH A;  2XRZ A;  3E33 A;  1HXI A;  3OXF A;  2XQ0 A;  3APC A;  2WMN A;  5KWD A;  2MOW A;  4AXH A;  1SZA A;  1BPO A;  3EU9 A;  4BTB A;  3HXC A;  5AEN A;  3CVW A;  5G04 J;  4GTP A;  3DXK G;  5JJ6 A;  3AG1 E;  5FWQ A;  4N5C A;  2LO6 A;  3NB2 A;  1OWN A;  3OXL A;  4HB5 A;  3SY2 A;  3NOC D;  1OCO E;  2J08 A;  4JVS A;  1WG0 A;  2CG2 A;  4N39 A;  2BTD A;  3QWP A;  3IBE A;  1OCC E;  2AVP A;  1RZ4 A;  3UM1 A;  1TNZ A;  4F3V A;  2LSU A;  2ZIS A;  1UG3 A;  3Q47 B;  2GRO B;  5AAR A;  1HU3 A;  1N11 A;  3AS5 A;  1S70 B;  4JEU A;  5EX3 A;  1HH8 A;  5ENN A;  3FTU A;  5FIN A;  3CHP A;  4KMO A;  3RRM B;  4J8S A;  5EYL A;  4LSZ E;  1N0R A;  3JUI A;  1KPS B;  2R17 C;  2RD0 A;  3FH8 A;  2FBN A;  2A5E A;  4U0U A;  3AG4 E;  2V4H C;  5FZR A;  1FVH A;  2AJA A;  4ZHB A;  5CBO A;  4U95 D;  4EEC A;  4HRL A;  1OCZ E;  3FTX A;  2E0I A;  4ATG A;  4AEZ C;  3LYA A;  2P58 C;  2XGS A;  3D3M A;  5CRV A;  1Y8M A;  4RSY A;  3FP3 A;  1NP7 A;  3G2U A;  3C3O A;  2HR2 A;  4I2Z A;  2FO7 A;  1TJF A;  3SNX A;  2XPI A;  5BXU A;  2ETB A;  2HO1 A;  4GZ6 A;  4URK A;  4GTV A;  4HNA D;  4F1P A;  5EDS A;  2OEV A;  3QWW A;  1UN9 A;  1TJC A;  3HDX A;  1LTX A;  5JMN D;  2MHK A;  2AXZ A;  3EDT B;  4J0U A;  3FUL A;  3C5R A;  4TV3 A;  1K1A A;  3D9I A;  3FHE A;  2VTB B;  2BKG A;  3ESK A;  1Z3X A;  3U64 A;  4L2L A;  3SFX A;  1N4S A;  1PAQ A;  4WNF A;  4GYO A;  4IRU A;  1NA0 A;  4K03 A;  3JYS A;  4UWH A;  4FJZ A;  1UJJ A;  2C0L A;  1PC2 A;  2Y3A A;  3ZYK A;  4WWO A;  3ABK E;  4B0Z A;  5D0Q D;  4I1M A;  4U07 A;  5AYW D;  3VLD A;  3U4T A;  2J4B A;  3QKY A;  4I6J A;  5E75 A;  4UWF A;  4LNB A;  2WPV A;  2VSX E;  4APO A;  3CIA A;  2ILR A;  3JUE A;  2WXR A;  4CDN A;  3E4B A;  4HXI A;  2UWJ G;  2I2O A;  2ZGD A;  4WAF A;  1XGW A;  5ANL A;  2CFU A;  1OT8 A;  3U66 A;  2WXO A;  3W9F A;  1N95 A;  2J09 A;  5AQ7 A;  2P9L G;  2QFC A;  4PDX A;  1P5Q A;  1PY1 A;  3LY7 A;  2OVB A;  4JEH A;  2VSN A;  3Q5M A;  3WG7 E;  2JEK A;  2Y69 E;  3HIZ A;  3ZPJ A;  4BET A;  3V2O A;  3APF A;  4G23 A;  3NQP A;  2PZI A;  3AU5 A;  4E6H A;  2H6I A;  3FWV A;  3PUJ A;  1UW4 B;  2RFA A;  2GRM A;  2L6J A;  4EZJ A;  3CST A;  2KZT B;  5BV1 A;  3G2W A;  1HF8 A;  1N4R A;  5CHE E;  3PE4 A;  2IU1 A;  2NXP A;  2WM9 A;  1BLX B;  3ZIM A;  4U8V D;  1EPU A;  4GA1 A;  5FT9 A;  4GML A;  3URZ A;  4QQI A;  3HXE A;  1TYQ G;  2CG3 A;  1MJ0 A;  1G3N B;  3TL5 A;  2FF4 A;  5HQ8 A;  2XPY A;  1JCQ A;  2Q7F A;  2DYS E;  1N9A A;  2EIM E;  4CRW A;  3BU8 A;  3UT4 A;  5LOZ A;  4CEM A;  5CCM A;  2DWZ A;  2WXJ A;  3MZL B;  4JXT A;  2WXM A;  3ESL A;  4GCN A;  4ILI A;  4AOF A;  1JPL A;  4Q96 A;  3KSQ A;  2XEN A;  3PUK A;  2VYI A;  3V2X A;  1D9S A;  4GYW A;  5D66 A;  5FQ7 A;  4RG9 A;  4FJY A;  5AJD A;  3UM2 A;  4A3V A;  4GCO A;  1TNY A;  4XEI G;  3U9W A;  1A17 A;  3CVY A;  4CGW A;  3ML8 A;  4WNE A;  4I6G A;  2DYR E;  4I1A A;  3RKV A;  3DSU A;  1H6K A;  5B1B E;  3BEE A;  3ZUV B;  1GW6 A;  1DNP A;  4JPS A;  4L23 A;  3PZ2 A;  2OVF A;  4LER A;  4RG6 A;  4K5A B;  2I6H A;  3FH5 A;  1HFA A;  2VGX A;  2XEE A;  4B8C B;  2X38 A;  3IHY A;  3W9G A;  4AIF A;  3RU0 A;  4BWR A;  4PH4 B;  5KJL A;  2OOE A;  3UIN C;  3CHQ A;  2C0M A;  3NF1 A;  4GTS A;  3CHR A;  5LCW J;  3LY8 A;  2VJ8 A;  4N5Q A;  4HRM B;  4PS3 A;  2CHZ A;  3TGO A;  3RRN B;  1OY3 D;  3CK7 A;  3DSS A;  4YDW A;  3Q79 A;  2H6G A;  4DK5 A;  3Q15 A;  3S7B A;  5BV0 A;  2XHE A;  2ZGG A;  4LRZ A;  4L2Y A;  3ZKJ A;  3DXM G;  3FEY A;  2PL2 A; 
#chains in the Genus database with same CATH homology
 2Y4T A;  2MOW A;  3LY9 A;  1SZA A;  4N3A A;  4AXH A;  1BPO A;  3QJZ A;  1KT0 A;  3PE3 A;  4HOU A;  5LCW C;  4L1B A;  4BTB A;  4I9E A;  5FQ8 A;  3FTS A;  4OVV A;  3JQ0 A;  4ABN A;  3UPV A;  4DLQ A;  1KT1 A;  3LJ3 A;  5AEN A;  3SZ7 A;  3UUX A;  3CVW A;  5G04 J;  1MQS A;  1SQM A;  2FI7 A;  4MS6 A;  3O4Z A;  4WNG A;  4F1S A;  3L22 A;  5JJ6 A;  3QAQ A;  5FWQ A;  2V0P A;  4O6F A;  3GZ2 A;  4JL0 A;  4N5C A;  2L0T B;  1UN8 A;  3CEQ A;  3ONK A;  2LO6 A;  5G05 C;  4C0M A;  2AXV A;  5BUZ A;  3D9M A;  4GZ5 A;  1OWN A;  3OXL A;  4GU5 A;  4QFV A;  2KAT A;  1ELW A;  2PQN A;  4TRQ A;  3TJP A;  4BT8 A;  4U0Z A;  2J08 A;  2WXH A;  4FUL A;  1HZ4 A;  4JVS A;  4CT4 A;  4JW1 A;  4TUU A;  2CG2 A;  3CKC A;  4N39 A;  2IOL A;  2JLB A;  4CDR A;  1OWO A;  2BTD A;  3QWP A;  3IBE A;  5T4Y A;  4BX8 A;  4KZC A;  1LF8 A;  2E2E A;  2AVP A;  4GMJ A;  2ION A;  4N2Q A;  2ZU6 B;  1IHG A;  2AXU A;  4I9C A;  5EKQ D;  1EF1 C;  4I6E A;  3ZYQ A;  1E7U A;  4H7X A;  2V8S E;  4LEU A;  4F3V A;  2XCB A;  4LUN U;  1H19 A;  2LSU A;  4WUY A;  4BT9 A;  1UG3 A;  2HM8 A;  3MJW A;  4FLB A;  3AS8 A;  4GPK A;  3Q47 B;  4KXK B;  3HVE B;  1XNF A;  1HU3 A;  3ZEF A;  4B89 A;  5C1D A;  2XPZ A;  2WXF A;  3D9K A;  3LVR E;  3ASF A;  5JJT A;  4N3B A;  3AS5 A;  3QC1 A;  3G2T A;  4JEU A;  3ZXS A;  4GA0 A;  2X6H A;  5EX3 A;  1HH8 A;  1EYH A;  5ENN A;  5LFA A;  2PM7 A;  3FTU A;  3CHP A;  3NZU A;  4KMO A;  4XZ4 A;  3R9A B;  3RRM B;  2XRY A;  4J8S A;  3JUI A;  2NC9 A;  4ANX A;  4B94 A;  3MV2 B;  4AY5 A;  2R17 C;  4EPZ A;  2RD0 A;  2WMO A;  2PQR A;  2X6I A;  3B7U X;  3FH8 A;  4KVO A;  2FBN A;  4FU3 A;  4JC8 A;  4UI9 K;  4JHJ A;  5BW8 C;  3R7Q A;  3QNK A;  4L7T A;  4U0U A;  1NZN A;  2OND A;  5FZR A;  3FU5 A;  1FVH A;  1NA3 A;  2LAH A;  3KD7 A;  3SGH A;  4EEC A;  4E85 A;  4XE0 A;  3MKQ A;  3U3W A;  4GYY A;  4A1S A;  4LCT A;  4ACK A;  4YND A;  1FVF A;  3MKQ B;  4PUC A;  3CHO A;  1QZ2 A;  3FTX A;  3TXM A;  4CDM A;  2E0I A;  2KC7 A;  4EZL A;  2L0I A;  3APD A;  4ATG A;  5LP0 A;  4AEZ C;  4A1G A;  3FFL A;  3LYA A;  2AW6 A;  2P58 C;  2XGS A;  4I43 A;  3D3M A;  2CFZ A;  4EBA A;  2VGY A;  2WXQ A;  3EIQ C;  4JZY A;  2I1J A;  1Y8M A;  4RSY A;  3FP3 A;  3LVQ E;  1NP7 A;  4MKT A;  3G2U A;  4U0S A;  2IF4 A;  3IHV A;  4UWK A;  3QAR A;  3FDH A;  3CHS A;  1JWG A;  2I9C A;  2XCC A;  4KYO B;  1IYG A;  2HR2 A;  2YQ8 A;  4FC8 A;  3ZN3 A;  3PS6 A;  4DI3 A;  3S7J A;  4GZC A;  3B13 A;  1HS6 A;  1QNF A;  2FO7 A;  3G2S A;  4I2Z A;  3VLE A;  3VTY A;  1TJF A;  5T8I A;  3SNX A;  1QQE A;  2XPI A;  4AJW A;  3UQ3 A;  1S0P A;  2HO1 A;  4KBQ A;  4GZ6 A;  4ME2 A;  4URK A;  5G05 J;  4U8H A;  4KZ0 A;  2J07 A;  4WWP A;  5EDS A;  2IOS A;  5A23 A;  2X3M A;  3QWW A;  3SF4 A;  3GYZ A;  1UN9 A;  5JJ7 A;  1TJC A;  3RIB A;  1X5B A;  3HDX A;  3ASH A;  4XX5 A;  4HOR A;  4JA9 A;  2GRL A;  3ZVV A;  2CHW A;  2MHK A;  3CHM A;  1HO8 A;  2AXZ A;  5BNW A;  3L08 A;  3ENE A;  4GZD A;  3EDT B;  5KJM A;  4J0U A;  3FUL A;  3MEK A;  3LXU X;  4UQZ A;  4TV3 A;  2J4D A;  2VTB A;  2UY1 A;  3SFZ A;  3D9I A;  4C9B B;  3FHE A;  2VTB B;  3FUN A;  2Y4U A;  2UY1 B;  1E7V A;  3FUH A;  4JA7 A;  2BUG A;  4FLH A;  4ILH B;  3ZFW A;  3ESK A;  4K0R A;  3MKR A;  1Z3X A;  2YHE A;  2IFU A;  3SHF A;  3U64 A;  1E8X A;  3CR3 A;  1B89 A;  1H0A A;  3Q49 B;  4L2L A;  2PM6 A;  1PAQ A;  4WNF A;  4UWG A;  4FAD A;  4DPR A;  3PRE A;  4DJA A;  4GYO A;  4M3O A;  2LAI A;  5JHB A;  2J9Q A;  4AV7 A;  1W3B A;  2V4L A;  3OTN A;  4JHR A;  5CCL A;  2A4Z A;  4IRU A;  4BY6 A;  2KCL A;  2VQ2 A;  1NA0 A;  2X6K A;  3JYS A;  3MA5 A;  4K03 A;  4UWH A;  3AS4 A;  4C0E A;  4HFG A;  4FJZ A;  5ARG A;  5HI7 A;  3RRU A;  1UJJ A;  2C0L A;  2FEZ A;  5KJK A;  1PC2 A;  2Y3A A;  3ZYK A;  3PNT B;  2DBA A;  3CLJ A;  3LKU A;  3CVV A;  2FUL A;  4WWO A;  5J08 A;  4I1M A;  4N3C A;  5D0Q D;  4HOQ A;  4U07 A;  5AYW D;  3HHM A;  4B0Z A;  3TAX A;  3TG5 A;  3ASD A;  3U4T A;  3VLD A;  3AU4 A;  4EBA G;  3QOU A;  4IUL A;  4XKC A;  4KVM A;  4N2S A;  5AJL A;  2J4B A;  3QKY A;  3HVE A;  5BPP A;  4AY6 A;  2LSV A;  5E76 A;  3SBT B;  4H7Y A;  3FU3 A;  4U04 A;  3CVP A;  4I6J A;  5E75 A;  3FUD A;  2WXL A;  4R7L A;  4UWF A;  3UX4 A;  3I3N A;  2WXI A;  3CK9 A;  2WPV A;  4G25 A;  2VSX E;  5EX0 A;  1WM5 A;  4I2W A;  4JHK A;  3FU6 A;  3MGB A;  3PEV B;  3ZHE B;  4APO A;  3EIJ A;  2WQ7 A;  3CIA A;  1H2T C;  2ILR A;  3LS8 A;  4CDN A;  2WXR A;  1HG5 A;  3E4B A;  3L54 A;  4G2V A;  2KCV A;  4HXI A;  3CK8 A;  2BF0 X;  4HVB A;  1OUV A;  2I2O A;  2OV8 A;  2UWJ G;  3PRZ A;  3PNL B;  4WAF A;  1ZU2 A;  3ZGQ A;  3KEZ A;  1H2U A;  1XGW A;  4EQF A;  3L17 A;  5G2N A;  3PH0 C;  5ANL A;  2DIW A;  3CVN A;  2CFU A;  2WXK A;  1EDU A;  3ONL A;  5DIZ A;  5ARF A;  3U66 A;  2WXN A;  2WXO A;  4J8D A;  3PEU B;  1U3D A;  4NRH B;  4OVU A;  1ZBP A;  4UQY A;  3UMV A;  1Z6T A;  2J09 A;  5CMW A;  3PVL A;  4Y6W A;  4A55 A;  5KCM A;  3D9P A;  4U63 A;  3L13 A;  2QFC A;  4B8A A;  4PDX A;  3FTY A;  4UQX A;  2C2L A;  3K9I A;  3RO2 A;  1P5Q A;  1PY1 A;  3LY7 A;  2A5U A;  3CVU A;  1WAO 1;  2DCP A;  2OVB A;  3CKB A;  4JEH A;  3I4R B;  2VSN A;  3MX3 A;  3Q5M A;  4ILG A;  3CGH A;  3T5V A;  4F7A A;  4Q94 A;  5KJN A;  3CV0 A;  4NUR A;  3D9O A;  3QK0 A;  5BT1 A;  2JEK A;  3FTW A;  4J6I A;  3ULQ A;  4MLP A;  5CMY A;  3O48 A;  3HIZ A;  2KCK A;  5FZS A;  2WXP A;  3ZPJ A;  3T8M A;  4UI9 C;  2XGO A;  3HYM B;  2YHC A;  3APF A;  1E8W A;  3FU0 A;  4CGV A;  2M63 A;  3FY4 A;  3D9N A;  3NQP A;  3LEW A;  4G23 A;  2PZI A;  3AU5 A;  5FQ4 A;  2VSY A;  1OWP A;  4ACL A;  4BFR A;  4E6H A;  3B7T A;  1ELK A;  3IEG A;  3FWV A;  3PUJ A;  5DBK A;  4XIF A;  3PZD A;  3CSF A;  3I4G A;  4WWN A;  4APF A;  4CCA A;  4DLO A;  3P2B A;  4G24 A;  3FUJ A;  1UW4 B;  2GRM A;  2L6J A;  4YVQ C;  4EZJ A;  5A6C A;  3CST A;  3OXG A;  2KZT B;  5BV1 A;  3G2W A;  3G2V A;  3IKO B;  2KM4 A;  1HF8 A;  5CHE E;  3RK6 A;  3EHM A;  3FUM A;  2LNI A;  3PE4 A;  2IU1 A;  4FA6 A;  2NXP A;  4HOS A;  2WM9 A;  3L6A A;  3ZIM A;  3QB2 A;  1EPU A;  3BG0 B;  4OYS A;  4GA1 A;  2YIN A;  5A7D B;  1E96 B;  4I1O B;  3ZYL A;  5JHA A;  3CQG B;  4AM9 A;  2WB2 A;  2GGF A;  4HLE A;  2V5F A;  5FT9 A;  2CHX A;  1E8Z A;  5M72 A;  4GML A;  3URZ A;  3MYV A;  3BG1 B;  3B7R L;  4KT6 B;  3ZRH A;  4ANW A;  4BTA A;  3JCK C;  1TEZ A;  3D9L A;  2CG3 A;  3PDN A;  3IV0 A;  4BSX A;  1IQR A;  4UWL A;  4AVX A;  4F53 A;  1E90 A;  3FUI A;  3P1U A;  3VLF A;  3OAW A;  4CT0 A;  3TL5 A;  1H2V C;  2AWI A;  1JWF A;  2FF4 A;  1N52 A;  5HQ8 A;  2HYZ A;  2XPY A;  1E8Y A;  2Q7F A;  4G11 A;  3N71 A;  4WND A;  1INZ A;  4DI4 A;  4YVO A;  4CRW A;  4J8E A;  2L9B A;  2XEV A;  3RO3 A;  2IQC A;  3UT4 A;  5LOZ A;  4HOT A;  4CEM A;  3D9J A;  5CCM A;  2WXJ A;  3MZL B;  4NQ0 A;  3S7F A;  4JXT A;  2WXM A;  3ESL A;  3FUF A;  4GAA A;  4GCN A;  1UJK A;  5FZQ A;  2WXG A;  4ILI A;  4AOF A;  3ML9 A;  4V3I A;  1JPL A;  4Q96 A;  4I17 A;  5AIJ A;  3ZHE A;  1L5J A;  2VYI A;  3KS2 A;  3PUK A;  2WVI A;  3QDN A;  5G55 A;  3LCA A;  5G04 C;  4GYW A;  3L16 A;  5FQ7 A;  4RG9 A;  4FJY A;  3ASG A;  3S2A A;  3MV3 B;  5AJD A;  4GA2 A;  5T3R A;  1HE8 A;  4A3V A;  1JUQ A;  3EJN A;  2IJG X;  4Q69 A;  4GCO A;  1DVP A;  3U9W A;  3S7D A;  1A17 A;  3I5P A;  4CGW A;  5J90 A;  2WQH A;  3ML8 A;  1VDY A;  3CVY A;  1HG2 A;  4WNE A;  3LPZ A;  4I6G A;  4ANU A;  1ELR A;  1Y6I A;  4IYP A;  4I1A A;  3RKV A;  5C2Y A;  4EZK A;  1YA0 A;  2R59 A;  4UI9 J;  3TG4 A;  3JQ1 A;  3DBS A;  4W9R A;  4FHK A;  3ZW3 A;  5FTP A;  4BX9 A;  3CVX A;  4GZ3 A;  4ANV A;  3FUK A;  4J8F A;  3UT7 A;  2R5S A;  2QY7 A;  1H6K A;  3T5X A;  4XI9 A;  3R7R A;  3VTX A;  2I1K A;  3BEE A;  4NAC A;  2X6J A;  3GZ1 A;  1GW6 A;  2MRI A;  1SZ9 A;  1DNP A;  4JPS A;  1OWM A;  4IN3 B;  3FUE A;  1HX8 A;  4L23 A;  2J49 A;  2OVF A;  4LER A;  4RG6 A;  3WXX A;  2GW1 A;  4XKB A;  2I6H A;  2YNQ A;  1HFA A;  3FH5 A;  2VGX A;  1WY6 A;  2VGX B;  2RG8 A;  4GB9 A;  3SI5 A;  2X38 A;  3CQC B;  4B8C B;  3UT8 A;  3B7S A;  3TXN A;  3ZYM A;  3FTZ A;  3IHY A;  3NZS A;  4XI0 A;  4AIF A;  3RU0 A;  4BWR A;  1OWL A;  4PH4 B;  5KJL A;  2OOE A;  3SBS A;  3CHQ A;  2C0M A;  1KLX A;  3C98 A;  3CVL A;  3EHN A;  3NF1 A;  2XGM A;  4MRU A;  3FH7 A;  3LDZ A;  3DPD A;  4PS7 A;  3CHR A;  3MCX A;  5LCW J;  1U3C A;  4G26 A;  5ANR A;  3LY8 A;  3SD5 A;  3KAE A;  3Q4A B;  2VJ8 A;  3FEX A;  4AP2 A;  3GZS A;  2X6F A;  5FQ6 A;  1Z3Y A;  4HS2 A;  1N54 A;  4FHJ A;  5FJY A;  4PS3 A;  2CHZ A;  3TGO A;  3GW4 A;  3RJV A;  3RRN B;  3FTV A;  3CK7 A;  2KZT A;  4G1T A;  4FP7 A;  4DK5 A;  3Q15 A;  4D10 C;  4A3T A;  4Y6C A;  1FCH A;  4RVB A;  5D0O D;  4PS8 A;  2XRZ A;  2WQ6 A;  3S7B A;  3CVQ A;  1MHQ A;  5BV0 A;  2EQX A;  2VSO E;  2XHE A;  5LX8 A;  4P29 A;  1HXI A;  4LRZ A;  2NSZ A;  3OXF A;  2XQ0 A;  4L2Y A;  3APC A;  3QWV A;  2WMN A;  3FEY A;  2PL2 A;  1IQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...