3BEEA

Crystal structure of putative yfre protein from vibrio parahaemolyticus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
92
structure length
92
Chain Sequence
NAVTATQLAAKATTLYYLHKQAMTDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRVTIIESINKAKKLM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Putative YfrE protein
publication title Crystal structure of putative YfrE protein from Vibrio parahaemolyticus.
rcsb
source organism Vibrio parahaemolyticus rimd 2210633
total genus 32
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3beeA00
5CCMA 4H7YA 4GA0A 4WNDA 3OXLA 2LNIA 3Q5MA 2WPVA 5DBKA 2WQHA 3TG5A 2KC7A 2XPIA 3RO3A 3RIBA 4N2QA 4I2WA 3VTYA 3GW4A 3LY8A 4O6FA 4WNFA 2FEZA 3IEGA 5FJYA 1NA3A 4IN3B 2Y4UA 1HH8A 4G26A 2PQNA 3LPZA 2KCKA 4CGVA 5KJMA 2AVPA 3LY9A 3FP3A 3GZ2A 2JLBA 3ZHEB 4GZ6A 4UI9J 4J0UA 1B89A 1ELWA 1A17A 4GA2A 5ARFA 3AS5A 2QFCA 2VGXB 3CK9A 2DBAA 4YVQC 2UWJG 3AS8A 1FCHA 3URZA 4WNEA 2XCCA 3RKVA 4UI9K 2LSVA 1PC2A 3CKCA 1YA0A 1WM5A 3NF1A 3U4TA 4U0UA 3SF4A 4XI9A 4G2VA 2YHCA 4G23A 4N3CA 4UQZA 4UI9C 4UQYA 1QZ2A 4YVOA 4WUYA 1IYGA 3FFLA 5HI7A 3QKYA 4Y6CA 2KATA 4HOQA 2XGSA 3CK7A 3KAEA 1IHGA 3ESKA 2FI7A 5A6CA 2ONDA 4U04A 2YQ8A 4N5CA 2XGOA 5FZRA 4F3VA 1KT1A 2UY1B 3S7JA 5FT9A 5FTPA 2GW1A 5FZSA 3PDNA 3Q15A 1E96B 3Q47B 5BNWA 2XEVA 2VSNA 2XCBA 3RJVA 3ASDA 3TAXA 1P5QA 4LEUA 1ZBPA 4NQ0A 4RG9A 3E4BA 4UQXA 2C0MA 2VGYA 5C1DA 3CV0A 4KYOB 5D0OD 3MV3B 5G05J 5LCWJ 3ZHEA 4HOSA 2VSYA 4N3BA 2E2EA 4GCNA 3ZGQA 5ARGA 5CHEE 5DIZA 4A1SA 5G04J 4HORA 4G1TA 4EQFA 4W9RA 4H7XA 5BW8C 2VGXA 4GPKA 4J8FA 2KCVA 3UUXA 2HYZA 4AM9A 3UPVA 3RO2A 2MHKA 1HZ4A 4XIFA 5JJ7A 4HOUA 4YNDA 4N3AA 3LY7A 4ABNA 3QOUA 5A7DB 1WAO1 2BUGA 2OOEA 2P58C 4WNGA 1XNFA 3ASFA 3N71A 3RU0A 3EDTB 2KCLA 3KS2A 5G05C 5LCWC 3ZFWA 4JHRA 4NRHB 5AYWD 1Y8MA 4KBQA 3U3WA 4JA7A 2FF4A 2J9QA 1HXIA 1NA0A 2FBNA 2V5FA 1ELRA 4GYWA 4AY5A 3OXFA 4I2ZA 4JA9A 3QWPA 3CVPA 4XI0A 4GZ3A 5M72A 2Y4TA 3CEQA 2Q7FA 2PZIA 5FZQA 2UY1A 4CDRA 5KJLA 3ZPJA 4GCOA 3MEKA 2NC9A 4CGWA 3CVLA 3QWVA 3OXGA 2FO7A 2C0LA 3CK8A 2HO1A 4BTAA 3TG4A 3CKBA 1QQEA 4U0SA 2C2LA 3SZ7A 3ASGA 4AIFA 3S7BA 4GYYA 4BT9A 3QWWA 3CVNA 2IF4A 4Y6WA 4N39A 4G24A 1W3BA 1ZU2A 1TJCA 1OUVA 3ASHA 3QDNA 3UQ3A 2PQRA 4I1AA 3CVQA 4GZ5A 4JL0A 5BT1A 2PL2A 4GA1A 3LCAA 2LSUA 5HQ8A 4BTBA 3GYZA 3MKRA 4BT8A 4HOTA 4U0ZA 4J8EA 4J8DA 4RG6A 5CCLA 3Q49B 3Q4AB 2VYIA 4APOA 3MA5A 3VTXA 5EX3A 5JJTA 3AS4A 2IFUA 5EX0A 1KT0A 2R5SA 2XGMA 3PE4A 3WXXA 3MV2B 4G25A 5KJKA 4AY6A 1NZNA 3GZ1A 3LKUA 3S7DA 2HR2A 4N2SA 3FWVA 3R9AB 4BWRA 5JJ6A 2L6JA 5D0QD 4B94A 3LYAA 2I6HA 2VQ2A 5G04C 3TGOA 3ZN3A 4I9EA 5EKQD 3S7FA 3JYSA 3ULQA 3K9IA 4GYOA 4KXKB 3BEEA 3O48A 4U07A 4I17A 3PE3A 3HYMB 4I9CA 4ME2A 3KD7A 1KLXA 5KJNA
chains in the Genus database with same CATH superfamily
4Z68A 2XS1A 4GA0A 4B0ZA 5CBOA 3IHYA 2LNIA 3PVLA 3HVEA 3D9NA 3RIBA 3ABKE 4N2QA 4I2WA 4JPSA 2RD0A 4LRZA 2YNQA 4O6FA 3APFA 5BXOA 3IBEA 3AU5A 1INZA 1O1RA 5CRUA 3HXBA 4J8SA 3V30A 3FTUA 1LD7A 5FQ4A 4UWLA 3UIPC 3CHPA 4UI9J 3APCA 2X6KA 4ATZD 3JCKC 2P9UG 1D8EA 2CFUA 5ARFA 2WXHA 3ASOE 4YVQC 3FUHA 4I6JA 3HXFA 5EDSA 4GTRA 2HM8A 1E7UA 3RKVA 2XPYA 1SZAA 5JA4D 1PC2A 1YA0A 1MHQA 1WM5A 1ELKA 3SGHA 3VLDA 3Q9NC 3U4TA 3D9PA 3OTNA 3D3MA 3JUEA 4FJZA 3ZXPA 3RK6A 4G23A 4N3CA 4G8LA 2FULA 4LCTA 4UQYA 1HG2A 4ILGA 2IOLA 5FQ7A 1D8DA 3P2BA 1H6OA 4CYMD 4EPZA 3LDZA 5HI7A 3QKYA 4Y6CA 4HOQA 1HS6A 3CHQA 2FI7A 3ABME 3CHRA 4MBGA 1KT1A 3S7JA 1FT1A 5FT9A 3B7TA 4CZ2D 3JXIA 4BSXA 2XCBA 2GRMA 2R17C 4NACA 3EU5A 4L9PA 3DBSA 4NQ0A 5FQ8A 3CIAA 4K5BA 4EZLA 3ZNGA 5IY5E 4UQXA 3L17A 1O1TA 3ENEA 5C1DA 1RW2A 3QAQA 4KYOB 5G05J 1OXJA 4DLOA 3ZHEA 2P9LG 4L2LA 2VSYA 2P9PG 4A3TA 5ARGA 5CHEE 3ZU7B 3HIZA 5DIZA 4XZ4A 5ENQD 4EQFA 3B7RL 4HQDA 4GPKA 5BPPA 4YDWA 1MX4A 3QK0A 4AM9A 2AXZA 2WXMA 5JJ7A 3Q78A 5B1AE 3SBTB 3L6AA 2Y0BG 4N3AA 3ZYKA 2F8XK 5A7DB 2BUGA 3B7BA 1TYQG 1AP7A 4OAUC 3UKRG 1SZ9A 2B0OE 4LNGA 4EECA 3F6QA 2LO6A 4KBQA 3ZYLA 1HXIA 4A3VA 1NA0A 2ILRA 2WXRA 4HRNA 4GYWA 3PH0C 2DZOA 4TXRA 2H6GA 4JA9A 3QWPA 5T3RA 2B6CA 4HBDA 3LVRE 1TNUA 1MQSA 3D9HA 5BUZA 5FZQA 3QARA 2UY1A 3ZPJA 4EHMA 3CVXA 4Q96A 3FUFA 3OXGA 5AJDA 1H2UA 5AQAA 4BTAA 4GTSA 2CG2A 1XGWA 3TWWA 4PH4B 3ULEG 4XEIG 5B3SE 1OWNA 2IF4A 2BKKB 3AU4A 4AOFA 4M7CA 4AV7A 2RG8A 4G24A 4B89A 3CVYA 1FT2A 1OUVA 4APFA 3MCXA 3ZXSA 3LS8A 1Z3XA 3DSTA 4HLLA 4CEMA 4DLQA 5BV1A 1Z5SC 3FU5A 3ZIMA 2AWIA 4OYSA 3UIOC 3I4GA 1TN8A 2WXQA 1FVFA 3TWVA 3W9GA 4IRUA 2CHWA 3C5RA 4KMOA 2IO3C 4J8EA 3CHOA 5G55A 2QYUA 4FHKA 4KVOA 3NZSA 4ZHBA 3VTXA 5EX3A 2WXLA 2IEJA 2MYOA 3HXDA 3PUJA 4GZDA 3PE4A 3EHRA 5ENOD 3JXJA 3RSEG 1NZNA 4I1OB 3I4RB 3SFXA 3S7DA 2J4BA 2QZAA 1K8KG 3ONKA 3SFZA 2HR2A 3AG4E 3ZRHA 3G2VA 3FUJA 5JJ6A 3SQVA 3L82A 5D0QD 2BEDA 3RRNB 3ZUVB 2X6HA 2R2LA 1EYHA 3TGOA 2WB2A 1LTXA 3PNTB 4TXPA 4I9EA 4LG6A 3S7FA 2XS8A 3ULQA 4CCAA 3BEEA 3X2QE 5EYLA 3O48A 1HFAA 5ENNA 4HNAD 3FUIA 5EIBE 2NYJA 4ME2A 1NP7A 2LXLA 3NZUA 1KLXA 5KJNA 2XZDG 4ANWA 1K1BA 3E30A 1BU9A 4QQIA 2RFAA 4URKA 3OXLA 3Q5MA 2BKGA 1BI8B 4HRMB 5FINA 3GW4A 2KBXA 1JUQA 3IEGA 4WNFA 4LUNU 3CHMA 1NA3A 3ZKJA 4TUMA 4IULA 4N5QA 2AXUA 2QY7A 5KJMA 5EYPF 2L0IA 3ULYA 3LY9A 3Q7FA 3DSXA 2J4DA 4GZ6A 4GTQA 5E75A 2L6BA 4L2YA 1YCSB 2J8SD 3MX3A 5HRYA 3C98A 2AW6A 2P9IG 1A17A 4GA2A 1D9SA 4GB9A 1DCEA 5FIOA 3TWXA 2VGXB 3CK9A 3UT4A 4FULA 3WG7E 1FCHA 3IXEA 4GPMA 4CDNA 3UT8A 2DVWA 3URZA 2EIME 2XCCA 4FP7A 2X6JA 2OVBA 3PZ3A 1H0AA 2EQXA 3NF1A 4U0UA 3TWTA 2A4ZA 1DC2A 1OCRE 2V5QC 3PZ4A 3HXEA 3V31A 3CSTA 3V2XA 2F37A 1E8WA 1HE8A 1JCSA 3MKQB 1QNFA 4WUYA 3TXNA 4L7TA 2ZU6B 2WMNA 2XQ0A 3TWUA 3DSVA 4F1PA 1N4SA 2RFMA 3FFLA 3ABLE 4O1OA 4GTOA 3KAEA 3T5VA 3HG0D 3ZYMA 1NI1A 2J09A 2GRQB 1G3NB 5A6CA 3ASNE 2VTBB 4NURA 2KM4A 4N5CA 2ZISA 1OCOE 2XGOA 3SO8A 3ONLA 4PS7A 4WAFA 3PDNA 2I2OA 3NOGD 4PS3A 2GRRB 3Q47B 2H6FA 2VSNA 3I3NA 3OAWA 3FTWA 4RVBA 3G2SA 3ASDA 4FLHA 1P5QA 5LOZA 1O5MA 5HS0A 2A5UA 4JB8P 1SVXA 3FEXA 3E4BA 3S2AA 2P9SG 1PY1A 1Y6IA 4R7LA 2YINA 4CDMA 3CV0A 2R03A 4F7AA 1KZPA 3T8KA 2X3MA 3G2TA 4QFVA 4DK5A 5D0OD 1N11A 1TN7A 2NXPA 4HOSA 1EF1C 1EDUA 4N3BA 2CFZA 2E2EA 4GCNA 2CG3A 2IONA 1IXVA 1YMPA 3FH5A 5AQBA 4HORA 1JCRA 5AAOA 4BETA 3E32A 1DVPA 5CEAA 5HKPA 3LEWA 2WQ7A 3EHNA 3UUXA 3Q9UC 4JEUA 3UPVA 3PUKA 2MHKA 3FUNA 4GTMA 2OVFA 4GMJA 4YNDA 4ABNA 3PNLB 2PM7A 4I43A 1IKND 1WAO1 4ILIA 1OWMA 2P58C 1S64A 2ZXWE 1HG5A 2JABA 4B93B 2WXJA 3RU0A 3EDTB 2KCLA 3Q75A 5LCWC 1N52A 3ZFWA 1N9AA 5AYWD 1Y8MA 1X81A 3C3RA 2Y1LE 3U3WA 3RRMB 4JA7A 3KEZA 2H6IA 3E33A 2FBNA 2DYSE 2BF0X 5ANRA 3KSQA 5KNGA 5KBAA 1Z6TA 4AEZC 1LD8A 3CVPA 1TR4A 3T9KA 2J49A 1MZCA 3EIQC 2I1JA 3DEPA 3CEQA 2Q7FA 3DPDA 3VLEA 3DSUA 4LNUD 3CGHA 2IU1A 1UG3A 3D9OA 3CVLA 4I1MA 2L0TB 4MLPA 2FO7A 3VLFA 2C0LA 5LX8A 3CKBA 1QQEA 4BX9A 3IKOB 4DI3A 3C3QA 4MRUA 1N4RA 1UOHA 5ENSD 1E7VA 3AJIA 4N39A 4BERA 2F8YA 2X6FA 1TEZA 4GTTA 1W3BA 2LAHA 1ZU2A 5FQ6A 1TJCA 3ASHA 5J90A 2ETAA 3NBNB 3CVQA 4GZ5A 3PEVB 4JL0A 1MX2A 2VGEA 2FO1E 4GA1A 2ETBA 3W9FA 1JWGA 2LSUA 3U9WA 1TJFA 4BTBA 3LJNA 3FEYA 3GYZA 3CQCB 3MKRA 3TXMA 2KXPC 4J8DA 2GRNB 4RG6A 3Q49B 3Q4AB 2VYIA 4APOA 3MA5A 1OCCE 3E37A 4DRXE 2P9NG 5EX0A 1BD8A 3BQOA 1IQRA 1KT0A 2R5SA 3WXXA 4A1GA 5AARA 4G25A 4XKBA 3C3OA 4AVXA 4AY6A 4WWNA 3QNKA 3BG0B 4N2SA 5B1BE 3O4ZA 4WWPA 3NQPA 4KZ0A 2L6JA 2OCCE 4HRLA 4B94A 4JXTA 2VQ2A 3ZN3A 3IHVA 2WXIA 4GU5A 1A5EA 3JYSA 3R7RA 3Q79A 2Y3AA 3KSLA 2A5EA 3LVQE 4GYOA 4JZYA 2WQ6A 2MOWA 4HLEA 2DCPA 2LAIA 4Q94A 3KD7A 4XE0A 2KZTB 5CRVA 2GGFA 3ESLA 1H2TC 5CCMA 5ENRD 1WDYA 3AG3E 3CLJA 3ML8A 5DBKA 2WQHA 3TG5A 2KC7A 5ANLA 3HHMA 3EIJA 3PZDA 3TL5A 4ZFHA 2FEZA 1N4PA 5FJYA 1U2VG 5ITZF 4JW1A 4IN3B 4NIKA 1HH8A 1N94A 1S0PA 2R59A 4G26A 2V8SE 3LPZA 4CGVA 5CERB 2AVPA 3TWQA 2NSZA 3L08A 3FP3A 3BG1B 4EBAA 4FA6A 1JWFA 2BTDA 2JLBA 1WY6A 5FWQA 4FHJA 3KEAA 1V55E 5J08A 3B7UX 3LXUX 5H7PA 1B89A 3AS5A 2QFCA 3L54A 2R02A 3L16A 3D9MA 4M3OA 4BESA 2UWJG 3NOCD 1UJKA 1IQUA 5A23A 1K3ZD 3AS8A 4RQIA 3RAUA 2IOSA 4OVUA 1NFIE 1YYHA 4E6HA 3CKCA 3SF4A 2ZGDA 4XI9A 4G2VA 3G2UA 2DYRE 4FADA 4YDYA 4A55A 3TWSA 4UI9C 1QZ2A 1HX8A 4FLBA 4C48B 4GMLA 4YDOA 1IYGA 1H6KA 4LNBA 1BI7B 3FUMA 3PZ1A 4UWKA 2XGSA 5ENPD 5JHAA 1IHGA 3RRUA 3V79K 2ONDA 2YQ8A 3R9MA 3EJNA 3FH8A 4F3VA 4PDXA 2V0PA 5FZSA 2XEEA 3G2WA 4PUCA 5AIJA 1TNBA 3FULA 1O1SA 3DPYA 3UM1A 2XEVA 3DSSA 2YHEA 4C9BB 4YDEA 2IY0C 4FJYA 2VJ8A 3DEOA 4LEUA 1FVHA 3SY2A 1ZBPA 5EN5D 2IO2C 3QC1A 1E8ZA 3MV3B 3CHSA 3AG1E 1OCZE 3R7QA 3FTYA 1JPLA 1N4QA 3SHFA 3TJPA 3UM2A 2XRYA 3ZGQA 4F6RD 4BX8A 4A1SA 3GZSA 5CBNA 4U8YD 4H7XA 2VGXA 5D2MC 4J8FA 2P9KG 4JVSA 3FTSA 3U66A 4B8CB 4CT0A 4DX1A 3FTZA 4G8KA 4AXHA 4XIFA 3B7SA 4CT4A 5LFAA 5JMND 3LY7A 3DXKG 3FTXA 4LSZE 4U63A 2OOEA 3L22A 4HFGA 3DSWA 1OWOA 2PNNA 1XNFA 3N71A 3KS2A 3TWRA 2GRPB 3JQ1A 5G05C 3HRAA 3I5PA 2J08A 4JHRA 3CSFA 1GW6A 4UWGA 3PEUB 3FH7A 2XENA 5JHBA 3MKQA 3UXGA 2FF4A 2J9QA 3SD5A 1ELRA 4L1BA 4AY5A 4I2ZA 3FUEA 1QYMA 4X8QA 3PRZA 2XRZA 2OEWA 4K03A 5CEDB 2CHZA 3UX4A 4U95D 4A63B 4BSZB 2Y4TA 2VTBA 3SNXA 3IV0A 5LP0A 4EBAG 5KJLA 4B8AA 4GCOA 3MEKA 5AQ9A 3Q73A 4F1SA 2I9CA 2AJAA 5AQ7A 4U0SA 3HVEB 2DIWA 3ASGA 4AIFA 3FY4A 3S7BA 4BT9A 4K0RA 1MX6A 2DWZA 3AG2E 1MYOA 5CMYA 3BU8A 4O60A 4WWOA 2V4HC 3MYVA 2WXGA 4EZKA 2H6HA 1HO8A 3LCAA 4BT8A 4HB5A 3UTMA 2WXNA 4HOTA 4U0ZA 4ANXA 4J8YA 3EHMA 3MGBA 5CCLA 4BFRA 3AS4A 2EIKE 1E8YA 4I6EA 1HU3A 4JC8A 3MV2B 4C0MA 2ZGGA 5KJKA 3SI5A 3LKUA 2I1KA 3FWVA 3R9AB 4BWRA 4KVMA 1DNPA 3LYAA 2I6HA 5G04C 4ANUA 3V2OA 3EHQA 4UWFA 4FC8A 5EKQD 4DX7D 2EIJE 4HI8A 1N0RA 4F53A 1MJ0A 2WM9A 4XKCA 1BLXB 1JCQA 1KZOA 3LJ3A 3DXMG 4ANVA 5CECB 1S70B 1TNZA 4I9CA 5T8IA 4GTVA 2M63A 3CR3A 1N0QA 1K1AA 1QBQA 1UN8A 2QYJA 4H7YA 2PM6A 4WNDA 1OY3D 2F0YA 2WPVA 2WXKA 2XPIA 3RO3A 1H6PA 4U96D 3VTYA 1X5BA 3C72A 3LY8A 4DX5D 2WXOA 3PREA 1BPOA 2Y4UA 3QB2A 3PZ2A 2PQNA 2RKKA 2KCKA 4TRQA 1Z3YA 5AENA 4OAVB 5KNHD 3J5QB 3CVVA 3GZ2A 1TNOA 3ZHEB 3Q7AA 4J0UA 3ZW3A 4DX6D 1FPPA 1ELWA 1H19A 3APDA 5BV0A 4L23A 2P2CP 2DZNA 1DCQA 1LF8A 4D10C 4K5CA 4P29A 2DBAA 3PS6A 3FUDA 3D9IA 3L9TA 4WNEA 4AJWA 4UI9K 2LSVA 4JHKA 4V3IA 4MS6A 4ILHB 1Q2ZA 2EINE 4U7EB 4U8VD 3B95A 2YHCA 4GAAA 4U8HA 4UQZA 3D9KA 4EZJA 1E8XA 4YVOA 5AJLA 4IYPA 5CMWA 4HI9A 4HS2A 4LERA 1EPUA 2KATA 3CK7A 5C2YA 3ESKA 2XZTG 2KZTA 4U04A 1UN9A 4JD2G 5FZRA 2Y69E 3HXCA 2UY1B 1TNYA 2E0IA 3B13A 5FTPA 2GW1A 4MKTA 3Q15A 1E96B 4K5AB 4TV3A 2LUHA 1OWLA 3UT7A 5BNWA 2AXVA 3RJVA 5KCMA 3TAXA 1L5JA 4I6GA 4GZCA 2WMOA 4RG9A 1S63A 4GTPA 4DJAA 2C0MA 2VGYA 3UMVA 3SFYA 2GRLA 3MZLB 3BUAA 3ZVVA 5LCWJ 4J6IA 4C0EA 3CVUA 3MJWA 1U3DA 1AWCB 3EU9A 1UW4B 2VSXE 4RLYA 5G04J 4HVBA 4G1TA 2WXFA 4W9RA 3ZEFA 1WG0A 4BY6A 5BW8C 2J07A 2KCVA 2X38A 4DI4A 1SA4A 2HYZA 2WXPA 2LXMA 4KZCA 3U64A 3DRAA 2IQCA 1U3CA 3RO2A 5ENTD 1HZ4A 3UINC 4HOUA 3JUIA 4UUCA 3ZYQA 4DUIA 3QOUA 4WNGA 5T4YA 3NAWA 4XX5A 1V54E 3ASFA 3UM3A 1TN6A 4RSYA 1OT8A 4NRHB 4OVVA 3EUVA 4ACKA 4G11A 2V5FA 4Q69A 4BEPA 3CVWA 3OXFA 4PS8A 4HXIA 3FU0A 2V4LA 1SA5A 2HE0A 4GZ3A 4XI0A 5M72A 3E34A 5EILA 3FU3A 2EILE 2XHEA 3D9JA 1PAQA 3NB2A 1UJJA 1VDYA 2PZIA 4E85A 2VSOE 4CDRA 2XPZA 1H2VC 4O1PA 1NL4A 2NC9A 3ML9A 4JEHA 4CGWA 5G2NA 3QWVA 3D9LA 3CK8A 2HO1A 3TG4A 3UKUG 2C2LA 3SZ7A 5EIDA 2X6IA 3FUKA 2R05A 4GYYA 3FDHA 3QWWA 3CVNA 4Y6WA 3FU6A 4GMRA 1E90A 2ZIRA 3CQGB 3SBSA 3FHEA 2WVIA 5E76A 2QC9A 4JHJA 3QDNA 3UQ3A 2PQRA 4I1AA 4ATGA 4ACLA 3ISMC 4TXQA 5BT1A 2PL2A 2L9BA 4J7WA 5HQ8A 1KPSB 1N95A 1SW6A 2OEVA 4KT6B 4DPRA 1HF8A 3UI2A 5JJTA 2GROB 5BXUA 2IFUA 3JQ0A 4DX2A 2JEKA 5KWDA 3HDXA 3P1UA 2XGMA 2CHXA 1RZ4A 4FU3A 5D66A 3UM0A 1SQMA 3L13A 3GZ1A 4UWHA 2MRIA 3AAAC 3J5PA 1IHBA 3T5XA 2OV8A 1OWPA 2XEHA 1ZB1A 2IJGX 3QJZA 3K9IA 4KXKB 1N54A 2ETCA 4TUUA 3FTVA 4AP2A 3T8MA 4U07A 4I17A 3PE3A 3HYMB 5AN8A 4CRWA 3DWLG
chains in the Genus database with same CATH topology
4FA6A 5CCMA 4H7YA 2PM6A 4ANWA 4GA0A 4WNDA 4B0ZA 4URKA 3CLJA 3IHYA 3OXLA 2LNIA 3Q5MA 2WPVA 3ML8A 3PVLA 2WQHA 5DBKA 3HVEA 3TG5A 2WXKA 2KC7A 2XPIA 5ANLA 3RO3A 3D9NA 3RIBA 4N2QA 4I2WA 4JPSA 3VTYA 2RD0A 3HHMA 3GW4A 3EIJA 3PZDA 2YNQA 4LRZA 1X5BA 3TL5A 3LY8A 2WXOA 3PREA 4O6FA 1JUQA 1BPOA 2FEZA 3IEGA 4WNFA 4LUNU 5FJYA 3CHMA 1NA3A 4JW1A 3APFA 4IN3B 2Y4UA 1HH8A 3QB2A 1S0PA 2R59A 4IULA 3IBEA 3AU5A 4G26A 2V8SE 1INZA 2PQNA 3LPZA 2AXUA 2QY7A 2KCKA 4CGVA 5KJMA 4TRQA 1Z3YA 5AENA 4J8SA 2AVPA 3FTUA 2L0IA 5FQ4A 3LY9A 2NSZA 3L08A 3CVVA 3FP3A 3BG1B 4EBAA 3GZ2A 1JWFA 2BTDA 2JLBA 2J4DA 4UWLA 3CHPA 1WY6A 4GZ6A 4UI9J 5FWQA 3ZHEB 4FHJA 3APCA 2X6KA 5E75A 5J08A 3B7UX 4J0UA 3JCKC 3ZW3A 4L2YA 3LXUX 1B89A 2CFUA 3MX3A 3C98A 2AW6A 1ELWA 1H19A 3APDA 5BV0A 1A17A 4GA2A 4L23A 5ARFA 4GB9A 1LF8A 4D10C 3AS5A 2QFCA 2VGXB 4P29A 3L54A 3CK9A 2DBAA 2WXHA 3L16A 3PS6A 3D9MA 4M3OA 3FUDA 3D9IA 2UWJG 4FULA 4YVQC 3FUHA 1UJKA 4I6JA 3UT4A 1IQUA 5A23A 3AS8A 1FCHA 5EDSA 2HM8A 2IOSA 4CDNA 3UT8A 1E7UA 4OVUA 3URZA 4WNEA 2XCCA 4FP7A 4E6HA 4AJWA 3RKVA 2XPYA 4UI9K 2X6JA 1SZAA 2OVBA 2LSVA 1PC2A 1H0AA 3CKCA 1YA0A 4JHKA 4V3IA 1MHQA 4MS6A 1WM5A 4ILHB 2EQXA 1ELKA 3NF1A 3SGHA 3VLDA 3U4TA 4U0UA 3SF4A 3D9PA 3OTNA 3D3MA 4FJZA 2A4ZA 4XI9A 3RK6A 4G2VA 3G2UA 2YHCA 4GAAA 4G23A 4FADA 4A55A 4U8HA 3CSTA 4N3CA 4UQZA 1E8WA 4UI9C 3D9KA 2FULA 1E8XA 1HE8A 4LCTA 4UQYA 4EZJA 1QZ2A 3MKQB 4YVOA 1HG2A 1HX8A 4FLBA 5AJLA 4IYPA 4ILGA 2IOLA 5FQ7A 5CMWA 4GMLA 1QNFA 4WUYA 3TXNA 1IYGA 3P2BA 2ZU6B 4L7TA 2WMNA 2XQ0A 1H6KA 4HS2A 3LDZA 4LERA 4EPZA 3FFLA 5HI7A 3FUMA 3QKYA 4Y6CA 1EPUA 2KATA 4HOQA 4UWKA 2XGSA 1HS6A 3CK7A 3CHQA 3KAEA 5JHAA 3T5VA 1IHGA 5C2YA 3RRUA 3ESKA 3ZYMA 2KZTA 2J09A 2FI7A 5A6CA 2ONDA 4U04A 2VTBB 2YQ8A 4NURA 1UN9A 2KM4A 4N5CA 2XGOA 3EJNA 3FH8A 3ONLA 5JJ7A 4PS7A 5FZRA 4F3VA 3CHRA 4PDXA 1KT1A 2UY1B 2V0PA 2E0IA 3S7JA 4WAFA 3B13A 5FT9A 5FTPA 2GW1A 5FZSA 3PDNA 4MKTA 3B7TA 2I2OA 3Q15A 1E96B 3G2WA 4PUCA 4PS3A 4TV3A 5AIJA 1OWLA 3UT7A 3Q47B 3FULA 5BNWA 2XEVA 2VSNA 3I3NA 2AXVA 3FTWA 3OAWA 4BSXA 4RVBA 2XCBA 2GRMA 2YHEA 3G2SA 3RJVA 2R17C 4NACA 3ASDA 4C9BB 5KCMA 3TAXA 4FLHA 4FJYA 2VJ8A 1P5QA 1L5JA 4LEUA 5LOZA 1FVHA 2A5UA 3DBSA 4I6GA 4GZCA 1ZBPA 2WMOA 4NQ0A 3FEXA 4RG9A 5FQ8A 3CIAA 3E4BA 3S2AA 4EZLA 3QC1A 1PY1A 4UQXA 3L17A 4DJAA 1Y6IA 2C0MA 2VGYA 2YINA 3ENEA 4R7LA 3CV0A 3UMVA 4CDMA 5C1DA 2GRLA 3QAQA 4F7AA 2X3MA 4KYOB 3G2TA 1E8ZA 4QFVA 4DK5A 3MZLB 3MV3B 5D0OD 5G05J 2NXPA 3CHSA 3ZVVA 5LCWJ 4DLOA 3R7QA 4J6IA 4C0EA 3ZHEA 3CVUA 3MJWA 3FTYA 4L2LA 4HOSA 1JPLA 2VSYA 1EF1C 1U3DA 1EDUA 4N3BA 2CFZA 3SHFA 3TJPA 2XRYA 2E2EA 1UW4B 4GCNA 3ZGQA 4A3TA 4BX8A 2CG3A 2IONA 5ARGA 5CHEE 2VSXE 3HIZA 5DIZA 4A1SA 4XZ4A 3GZSA 5G04J 4HVBA 3FH5A 4HORA 4G1TA 4EQFA 2WXFA 4W9RA 3B7RL 4H7XA 3ZEFA 1DVPA 4BY6A 5BW8C 2VGXA 4GPKA 4J8FA 3LEWA 2J07A 2KCVA 2X38A 3FTSA 4JVSA 3U66A 2WQ7A 4B8CB 3EHNA 5BPPA 3UUXA 4CT0A 2HYZA 4DI4A 2WXPA 3QK0A 4AM9A 4KZCA 4JEUA 3U64A 3UPVA 2IQCA 3FTZA 3PUKA 1U3CA 3RO2A 2MHKA 1HZ4A 2AXZA 2WXMA 3B7SA 3FUNA 4HOUA 4XIFA 4AXHA 2OVFA 3JUIA 3SBTB 4CT4A 3L6AA 4GMJA 5LFAA 4YNDA 4N3AA 3LY7A 3ZYKA 4ABNA 3ZYQA 3PNLB 2PM7A 4I43A 3FTXA 4U63A 3QOUA 5A7DB 1WAO1 2BUGA 2OOEA 4ILIA 3L22A 4HFGA 1OWMA 2P58C 1OWOA 4WNGA 1HG5A 5T4YA 1XNFA 4XX5A 3ASFA 3N71A 2WXJA 1SZ9A 3RU0A 4EECA 3EDTB 2KCLA 3KS2A 4RSYA 3JQ1A 5G05C 5LCWC 1N52A 3I5PA 3ZFWA 2LO6A 2J08A 4JHRA 3CSFA 4NRHB 5AYWD 1GW6A 1Y8MA 4KBQA 4OVVA 3U3WA 4UWGA 3PEUB 3FH7A 3RRMB 4ACKA 4JA7A 3MKQA 4G11A 3KEZA 2FF4A 2J9QA 3ZYLA 1HXIA 4A3VA 1NA0A 2FBNA 2V5FA 2ILRA 2WXRA 3SD5A 4Q69A 1ELRA 4L1BA 4GYWA 4AY5A 3PH0C 3CVWA 3OXFA 4PS8A 2BF0X 4I2ZA 3FUEA 5ANRA 4HXIA 3PRZA 3QWPA 4JA9A 4K03A 1Z6TA 3FU0A 5T3RA 4AEZC 2CHZA 2XRZA 3CVPA 2V4LA 4XI0A 4GZ3A 3UX4A 5M72A 2J49A 3LVRE 3FU3A 1MQSA 2XHEA 3D9JA 3EIQC 1PAQA 2I1JA 2Y4TA 3CEQA 3SNXA 2VTBA 1UJJA 1VDYA 5BUZA 2Q7FA 2PZIA 3DPDA 3VLEA 4E85A 2VSOE 5FZQA 3IV0A 3QARA 2UY1A 4CDRA 5LP0A 4EBAG 5KJLA 3ZPJA 2XPZA 1H2VC 3CGHA 4B8AA 2IU1A 1UG3A 3D9OA 4GCOA 3MEKA 2NC9A 3ML9A 4JEHA 4CGWA 3CVXA 5G2NA 4F1SA 3CVLA 3QWVA 4I1MA 2L0TB 4Q96A 3FUFA 4MLPA 2I9CA 3D9LA 3OXGA 2FO7A 3VLFA 2C0LA 3CK8A 2HO1A 5AJDA 1H2UA 4BTAA 3TG4A 5LX8A 3CKBA 1QQEA 2CG2A 4U0SA 3HVEB 2C2LA 4BX9A 3IKOB 1XGWA 2DIWA 3SZ7A 4DI3A 3ASGA 4AIFA 2X6IA 4PH4B 3FUKA 3FY4A 3S7BA 4GYYA 4MRUA 3FDHA 4BT9A 3QWWA 3CVNA 1OWNA 2IF4A 4K0RA 4Y6WA 3FU6A 1E90A 3CQGB 3AU4A 3SBSA 4AOFA 3FHEA 2WVIA 1E7VA 4N39A 4AV7A 2RG8A 4G24A 2X6FA 4B89A 1TEZA 1W3BA 2LAHA 1ZU2A 5E76A 3CVYA 5FQ6A 1TJCA 1OUVA 3ASHA 4JHJA 3QDNA 3UQ3A 2PQRA 5J90A 4I1AA 4APFA 3MCXA 5CMYA 4WWOA 3MYVA 4ACLA 4ATGA 3CVQA 3ZXSA 2WXGA 4GZ5A 3PEVB 4JL0A 3LS8A 5BT1A 4EZKA 2PL2A 2L9BA 4GA1A 1Z3XA 1HO8A 4CEMA 4DLQA 1JWGA 2LSUA 3LCAA 5BV1A 5HQ8A 3FU5A 3ZIMA 2AWIA 1TJFA 4OYSA 3U9WA 4BTBA 3FEYA 3GYZA 3I4GA 2WXQA 1FVFA 3CQCB 3MKRA 3TXMA 4IRUA 2CHWA 4BT8A 4KMOA 4KT6B 4HOTA 2WXNA 4DPRA 4U0ZA 4J8EA 3CHOA 4J8DA 5G55A 4ANXA 4FHKA 1HF8A 3EHMA 4KVOA 3NZSA 3MGBA 4RG6A 3Q49B 5CCLA 3Q4AB 2VYIA 4APOA 4BFRA 3MA5A 3VTXA 5EX3A 5JJTA 3AS4A 2IFUA 2WXLA 3JQ0A 1E8YA 5EX0A 1IQRA 2JEKA 4I6EA 1KT0A 3HDXA 3PUJA 3P1UA 4GZDA 2R5SA 2XGMA 1HU3A 3PE4A 2CHXA 4JC8A 3WXXA 3MV2B 4A1GA 4FU3A 4G25A 4C0MA 4XKBA 4AVXA 5KJKA 5JHBA 3SI5A 1SQMA 4AY6A 1NZNA 3L13A 4I1OB 3GZ1A 3I4RB 4WWNA 3LKUA 2J4BA 3S7DA 3QNKA 4UWHA 3ONKA 3SFZA 2I1KA 3BG0B 2HR2A 2MRIA 4N2SA 3O4ZA 3ZRHA 4WWPA 3FWVA 3R9AB 4BWRA 3NQPA 3G2VA 4KZ0A 3FUJA 5JJ6A 4KVMA 2L6JA 5D0QD 1DNPA 4B94A 3LYAA 3RRNB 4JXTA 2X6HA 2I6HA 2VQ2A 5G04C 1EYHA 4ANUA 3TGOA 3ZN3A 3IHVA 2WB2A 2WXIA 4UWFA 3T5XA 2OV8A 1OWPA 3PNTB 4FC8A 4GU5A 4I9EA 5EKQD 2IJGX 3S7FA 3JYSA 3R7RA 3QJZA 3ULQA 4CCAA 2Y3AA 3K9IA 3LVQE 4GYOA 4KXKB 4F53A 2WM9A 4JZYA 3BEEA 1N54A 4XKCA 4TUUA 3FTVA 3O48A 4AP2A 1HFAA 3LJ3A 5ENNA 3T8MA 3FUIA 4U07A 4I17A 4ANVA 3PE3A 3HYMB 2WQ6A 2MOWA 4I9CA 5T8IA 4ME2A 4CRWA 4HLEA 2DCPA 2LAIA 1NP7A 4Q94A 2M63A 3CR3A 3KD7A 4XE0A 2KZTB 3NZUA 2GGFA 3ESLA 1KLXA 5KJNA 1UN8A 1H2TC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCM A;  4H7Y A;  4GA0 A;  4WND A;  3OXL A;  2LNI A;  3Q5M A;  2WPV A;  5DBK A;  2WQH A;  3TG5 A;  2KC7 A;  2XPI A;  3RO3 A;  3RIB A;  4N2Q A;  4I2W A;  3VTY A;  3GW4 A;  3LY8 A;  4O6F A;  4WNF A;  2FEZ A;  3IEG A;  5FJY A;  1NA3 A;  4IN3 B;  2Y4U A;  1HH8 A;  4G26 A;  2PQN A;  3LPZ A;  2KCK A;  4CGV A;  5KJM A;  2AVP A;  3LY9 A;  3FP3 A;  3GZ2 A;  2JLB A;  3ZHE B;  4GZ6 A;  4UI9 J;  4J0U A;  1B89 A;  1ELW A;  1A17 A;  4GA2 A;  5ARF A;  3AS5 A;  2QFC A;  2VGX B;  3CK9 A;  2DBA A;  4YVQ C;  2UWJ G;  3AS8 A;  1FCH A;  3URZ A;  4WNE A;  2XCC A;  3RKV A;  4UI9 K;  2LSV A;  1PC2 A;  3CKC A;  1YA0 A;  1WM5 A;  3NF1 A;  3U4T A;  4U0U A;  3SF4 A;  4XI9 A;  4G2V A;  2YHC A;  4G23 A;  4N3C A;  4UQZ A;  4UI9 C;  4UQY A;  1QZ2 A;  4YVO A;  4WUY A;  1IYG A;  3FFL A;  5HI7 A;  3QKY A;  4Y6C A;  2KAT A;  4HOQ A;  2XGS A;  3CK7 A;  3KAE A;  1IHG A;  3ESK A;  2FI7 A;  5A6C A;  2OND A;  4U04 A;  2YQ8 A;  4N5C A;  2XGO A;  5FZR A;  4F3V A;  1KT1 A;  2UY1 B;  3S7J A;  5FT9 A;  5FTP A;  2GW1 A;  5FZS A;  3PDN A;  3Q15 A;  1E96 B;  3Q47 B;  5BNW A;  2XEV A;  2VSN A;  2XCB A;  3RJV A;  3ASD A;  3TAX A;  1P5Q A;  4LEU A;  1ZBP A;  4NQ0 A;  4RG9 A;  3E4B A;  4UQX A;  2C0M A;  2VGY A;  5C1D A;  3CV0 A;  4KYO B;  5D0O D;  3MV3 B;  5G05 J;  5LCW J;  3ZHE A;  4HOS A;  2VSY A;  4N3B A;  2E2E A;  4GCN A;  3ZGQ A;  5ARG A;  5CHE E;  5DIZ A;  4A1S A;  5G04 J;  4HOR A;  4G1T A;  4EQF A;  4W9R A;  4H7X A;  5BW8 C;  2VGX A;  4GPK A;  4J8F A;  2KCV A;  3UUX A;  2HYZ A;  4AM9 A;  3UPV A;  3RO2 A;  2MHK A;  1HZ4 A;  4XIF A;  5JJ7 A;  4HOU A;  4YND A;  4N3A A;  3LY7 A;  4ABN A;  3QOU A;  5A7D B;  1WAO 1;  2BUG A;  2OOE A;  2P58 C;  4WNG A;  1XNF A;  3ASF A;  3N71 A;  3RU0 A;  3EDT B;  2KCL A;  3KS2 A;  5G05 C;  5LCW C;  3ZFW A;  4JHR A;  4NRH B;  5AYW D;  1Y8M A;  4KBQ A;  3U3W A;  4JA7 A;  2FF4 A;  2J9Q A;  1HXI A;  1NA0 A;  2FBN A;  2V5F A;  1ELR A;  4GYW A;  4AY5 A;  3OXF A;  4I2Z A;  4JA9 A;  3QWP A;  3CVP A;  4XI0 A;  4GZ3 A;  5M72 A;  2Y4T A;  3CEQ A;  2Q7F A;  2PZI A;  5FZQ A;  2UY1 A;  4CDR A;  5KJL A;  3ZPJ A;  4GCO A;  3MEK A;  2NC9 A;  4CGW A;  3CVL A;  3QWV A;  3OXG A;  2FO7 A;  2C0L A;  3CK8 A;  2HO1 A;  4BTA A;  3TG4 A;  3CKB A;  1QQE A;  4U0S A;  2C2L A;  3SZ7 A;  3ASG A;  4AIF A;  3S7B A;  4GYY A;  4BT9 A;  3QWW A;  3CVN A;  2IF4 A;  4Y6W A;  4N39 A;  4G24 A;  1W3B A;  1ZU2 A;  1TJC A;  1OUV A;  3ASH A;  3QDN A;  3UQ3 A;  2PQR A;  4I1A A;  3CVQ A;  4GZ5 A;  4JL0 A;  5BT1 A;  2PL2 A;  4GA1 A;  3LCA A;  2LSU A;  5HQ8 A;  4BTB A;  3GYZ A;  3MKR A;  4BT8 A;  4HOT A;  4U0Z A;  4J8E A;  4J8D A;  4RG6 A;  5CCL A;  3Q49 B;  3Q4A B;  2VYI A;  4APO A;  3MA5 A;  3VTX A;  5EX3 A;  5JJT A;  3AS4 A;  2IFU A;  5EX0 A;  1KT0 A;  2R5S A;  2XGM A;  3PE4 A;  3WXX A;  3MV2 B;  4G25 A;  5KJK A;  4AY6 A;  1NZN A;  3GZ1 A;  3LKU A;  3S7D A;  2HR2 A;  4N2S A;  3FWV A;  3R9A B;  4BWR A;  5JJ6 A;  2L6J A;  5D0Q D;  4B94 A;  3LYA A;  2I6H A;  2VQ2 A;  5G04 C;  3TGO A;  3ZN3 A;  4I9E A;  5EKQ D;  3S7F A;  3JYS A;  3ULQ A;  3K9I A;  4GYO A;  4KXK B;  3BEE A;  3O48 A;  4U07 A;  4I17 A;  3PE3 A;  3HYM B;  4I9C A;  4ME2 A;  3KD7 A;  1KLX A;  5KJN A; 
#chains in the Genus database with same CATH topology
 4Z68 A;  2XS1 A;  4GA0 A;  4B0Z A;  5CBO A;  3IHY A;  2LNI A;  3PVL A;  3HVE A;  3D9N A;  3RIB A;  3ABK E;  4N2Q A;  4I2W A;  4JPS A;  2RD0 A;  4LRZ A;  2YNQ A;  4O6F A;  3APF A;  5BXO A;  3IBE A;  3AU5 A;  1INZ A;  1O1R A;  5CRU A;  3HXB A;  4J8S A;  3V30 A;  3FTU A;  1LD7 A;  5FQ4 A;  4UWL A;  3UIP C;  3CHP A;  4UI9 J;  3APC A;  2X6K A;  4ATZ D;  3JCK C;  2P9U G;  1D8E A;  2CFU A;  5ARF A;  2WXH A;  3ASO E;  4YVQ C;  3FUH A;  4I6J A;  3HXF A;  5EDS A;  4GTR A;  2HM8 A;  1E7U A;  3RKV A;  2XPY A;  1SZA A;  5JA4 D;  1PC2 A;  1YA0 A;  1MHQ A;  1WM5 A;  1ELK A;  3SGH A;  3VLD A;  3Q9N C;  3U4T A;  3D9P A;  3OTN A;  3D3M A;  3JUE A;  4FJZ A;  3ZXP A;  3RK6 A;  4G23 A;  4N3C A;  4G8L A;  2FUL A;  4LCT A;  4UQY A;  1HG2 A;  4ILG A;  2IOL A;  5FQ7 A;  1D8D A;  3P2B A;  1H6O A;  4CYM D;  4EPZ A;  3LDZ A;  5HI7 A;  3QKY A;  4Y6C A;  4HOQ A;  1HS6 A;  3CHQ A;  2FI7 A;  3ABM E;  3CHR A;  4MBG A;  1KT1 A;  3S7J A;  1FT1 A;  5FT9 A;  3B7T A;  4CZ2 D;  3JXI A;  4BSX A;  2XCB A;  2GRM A;  2R17 C;  4NAC A;  3EU5 A;  4L9P A;  3DBS A;  4NQ0 A;  5FQ8 A;  3CIA A;  4K5B A;  4EZL A;  3ZNG A;  5IY5 E;  4UQX A;  3L17 A;  1O1T A;  3ENE A;  5C1D A;  1RW2 A;  3QAQ A;  4KYO B;  5G05 J;  1OXJ A;  4DLO A;  3ZHE A;  2P9L G;  4L2L A;  2VSY A;  2P9P G;  4A3T A;  5ARG A;  5CHE E;  3ZU7 B;  3HIZ A;  5DIZ A;  4XZ4 A;  5ENQ D;  4EQF A;  3B7R L;  4HQD A;  4GPK A;  5BPP A;  4YDW A;  1MX4 A;  3QK0 A;  4AM9 A;  2AXZ A;  2WXM A;  5JJ7 A;  3Q78 A;  5B1A E;  3SBT B;  3L6A A;  2Y0B G;  4N3A A;  3ZYK A;  2F8X K;  5A7D B;  2BUG A;  3B7B A;  1TYQ G;  1AP7 A;  4OAU C;  3UKR G;  1SZ9 A;  2B0O E;  4LNG A;  4EEC A;  3F6Q A;  2LO6 A;  4KBQ A;  3ZYL A;  1HXI A;  4A3V A;  1NA0 A;  2ILR A;  2WXR A;  4HRN A;  4GYW A;  3PH0 C;  2DZO A;  4TXR A;  2H6G A;  4JA9 A;  3QWP A;  5T3R A;  2B6C A;  4HBD A;  3LVR E;  1TNU A;  1MQS A;  3D9H A;  5BUZ A;  5FZQ A;  3QAR A;  2UY1 A;  3ZPJ A;  4EHM A;  3CVX A;  4Q96 A;  3FUF A;  3OXG A;  5AJD A;  1H2U A;  5AQA A;  4BTA A;  4GTS A;  2CG2 A;  1XGW A;  3TWW A;  4PH4 B;  3ULE G;  4XEI G;  5B3S E;  1OWN A;  2IF4 A;  2BKK B;  3AU4 A;  4AOF A;  4M7C A;  4AV7 A;  2RG8 A;  4G24 A;  4B89 A;  3CVY A;  1FT2 A;  1OUV A;  4APF A;  3MCX A;  3ZXS A;  3LS8 A;  1Z3X A;  3DST A;  4HLL A;  4CEM A;  4DLQ A;  5BV1 A;  1Z5S C;  3FU5 A;  3ZIM A;  2AWI A;  4OYS A;  3UIO C;  3I4G A;  1TN8 A;  2WXQ A;  1FVF A;  3TWV A;  3W9G A;  4IRU A;  2CHW A;  3C5R A;  4KMO A;  2IO3 C;  4J8E A;  3CHO A;  5G55 A;  2QYU A;  4FHK A;  4KVO A;  3NZS A;  4ZHB A;  3VTX A;  5EX3 A;  2WXL A;  2IEJ A;  2MYO A;  3HXD A;  3PUJ A;  4GZD A;  3PE4 A;  3EHR A;  5ENO D;  3JXJ A;  3RSE G;  1NZN A;  4I1O B;  3I4R B;  3SFX A;  3S7D A;  2J4B A;  2QZA A;  1K8K G;  3ONK A;  3SFZ A;  2HR2 A;  3AG4 E;  3ZRH A;  3G2V A;  3FUJ A;  5JJ6 A;  3SQV A;  3L82 A;  5D0Q D;  2BED A;  3RRN B;  3ZUV B;  2X6H A;  2R2L A;  1EYH A;  3TGO A;  2WB2 A;  1LTX A;  3PNT B;  4TXP A;  4I9E A;  4LG6 A;  3S7F A;  2XS8 A;  3ULQ A;  4CCA A;  3BEE A;  3X2Q E;  5EYL A;  3O48 A;  1HFA A;  5ENN A;  4HNA D;  3FUI A;  5EIB E;  2NYJ A;  4ME2 A;  1NP7 A;  2LXL A;  3NZU A;  1KLX A;  5KJN A;  2XZD G;  4ANW A;  1K1B A;  3E30 A;  1BU9 A;  4QQI A;  2RFA A;  4URK A;  3OXL A;  3Q5M A;  2BKG A;  1BI8 B;  4HRM B;  5FIN A;  3GW4 A;  2KBX A;  1JUQ A;  3IEG A;  4WNF A;  4LUN U;  3CHM A;  1NA3 A;  3ZKJ A;  4TUM A;  4IUL A;  4N5Q A;  2AXU A;  2QY7 A;  5KJM A;  5EYP F;  2L0I A;  3ULY A;  3LY9 A;  3Q7F A;  3DSX A;  2J4D A;  4GZ6 A;  4GTQ A;  5E75 A;  2L6B A;  4L2Y A;  1YCS B;  2J8S D;  3MX3 A;  5HRY A;  3C98 A;  2AW6 A;  2P9I G;  1A17 A;  4GA2 A;  1D9S A;  4GB9 A;  1DCE A;  5FIO A;  3TWX A;  2VGX B;  3CK9 A;  3UT4 A;  4FUL A;  3WG7 E;  1FCH A;  3IXE A;  4GPM A;  4CDN A;  3UT8 A;  2DVW A;  3URZ A;  2EIM E;  2XCC A;  4FP7 A;  2X6J A;  2OVB A;  3PZ3 A;  1H0A A;  2EQX A;  3NF1 A;  4U0U A;  3TWT A;  2A4Z A;  1DC2 A;  1OCR E;  2V5Q C;  3PZ4 A;  3HXE A;  3V31 A;  3CST A;  3V2X A;  2F37 A;  1E8W A;  1HE8 A;  1JCS A;  3MKQ B;  1QNF A;  4WUY A;  3TXN A;  4L7T A;  2ZU6 B;  2WMN A;  2XQ0 A;  3TWU A;  3DSV A;  4F1P A;  1N4S A;  2RFM A;  3FFL A;  3ABL E;  4O1O A;  4GTO A;  3KAE A;  3T5V A;  3HG0 D;  3ZYM A;  1NI1 A;  2J09 A;  2GRQ B;  1G3N B;  5A6C A;  3ASN E;  2VTB B;  4NUR A;  2KM4 A;  4N5C A;  2ZIS A;  1OCO E;  2XGO A;  3SO8 A;  3ONL A;  4PS7 A;  4WAF A;  3PDN A;  2I2O A;  3NOG D;  4PS3 A;  2GRR B;  3Q47 B;  2H6F A;  2VSN A;  3I3N A;  3OAW A;  3FTW A;  4RVB A;  3G2S A;  3ASD A;  4FLH A;  1P5Q A;  5LOZ A;  1O5M A;  5HS0 A;  2A5U A;  4JB8 P;  1SVX A;  3FEX A;  3E4B A;  3S2A A;  2P9S G;  1PY1 A;  1Y6I A;  4R7L A;  2YIN A;  4CDM A;  3CV0 A;  2R03 A;  4F7A A;  1KZP A;  3T8K A;  2X3M A;  3G2T A;  4QFV A;  4DK5 A;  5D0O D;  1N11 A;  1TN7 A;  2NXP A;  4HOS A;  1EF1 C;  1EDU A;  4N3B A;  2CFZ A;  2E2E A;  4GCN A;  2CG3 A;  2ION A;  1IXV A;  1YMP A;  3FH5 A;  5AQB A;  4HOR A;  1JCR A;  5AAO A;  4BET A;  3E32 A;  1DVP A;  5CEA A;  5HKP A;  3LEW A;  2WQ7 A;  3EHN A;  3UUX A;  3Q9U C;  4JEU A;  3UPV A;  3PUK A;  2MHK A;  3FUN A;  4GTM A;  2OVF A;  4GMJ A;  4YND A;  4ABN A;  3PNL B;  2PM7 A;  4I43 A;  1IKN D;  1WAO 1;  4ILI A;  1OWM A;  2P58 C;  1S64 A;  2ZXW E;  1HG5 A;  2JAB A;  4B93 B;  2WXJ A;  3RU0 A;  3EDT B;  2KCL A;  3Q75 A;  5LCW C;  1N52 A;  3ZFW A;  1N9A A;  5AYW D;  1Y8M A;  1X81 A;  3C3R A;  2Y1L E;  3U3W A;  3RRM B;  4JA7 A;  3KEZ A;  2H6I A;  3E33 A;  2FBN A;  2DYS E;  2BF0 X;  5ANR A;  3KSQ A;  5KNG A;  5KBA A;  1Z6T A;  4AEZ C;  1LD8 A;  3CVP A;  1TR4 A;  3T9K A;  2J49 A;  1MZC A;  3EIQ C;  2I1J A;  3DEP A;  3CEQ A;  2Q7F A;  3DPD A;  3VLE A;  3DSU A;  4LNU D;  3CGH A;  2IU1 A;  1UG3 A;  3D9O A;  3CVL A;  4I1M A;  2L0T B;  4MLP A;  2FO7 A;  3VLF A;  2C0L A;  5LX8 A;  3CKB A;  1QQE A;  4BX9 A;  3IKO B;  4DI3 A;  3C3Q A;  4MRU A;  1N4R A;  1UOH A;  5ENS D;  1E7V A;  3AJI A;  4N39 A;  4BER A;  2F8Y A;  2X6F A;  1TEZ A;  4GTT A;  1W3B A;  2LAH A;  1ZU2 A;  5FQ6 A;  1TJC A;  3ASH A;  5J90 A;  2ETA A;  3NBN B;  3CVQ A;  4GZ5 A;  3PEV B;  4JL0 A;  1MX2 A;  2VGE A;  2FO1 E;  4GA1 A;  2ETB A;  3W9F A;  1JWG A;  2LSU A;  3U9W A;  1TJF A;  4BTB A;  3LJN A;  3FEY A;  3GYZ A;  3CQC B;  3MKR A;  3TXM A;  2KXP C;  4J8D A;  2GRN B;  4RG6 A;  3Q49 B;  3Q4A B;  2VYI A;  4APO A;  3MA5 A;  1OCC E;  3E37 A;  4DRX E;  2P9N G;  5EX0 A;  1BD8 A;  3BQO A;  1IQR A;  1KT0 A;  2R5S A;  3WXX A;  4A1G A;  5AAR A;  4G25 A;  4XKB A;  3C3O A;  4AVX A;  4AY6 A;  4WWN A;  3QNK A;  3BG0 B;  4N2S A;  5B1B E;  3O4Z A;  4WWP A;  3NQP A;  4KZ0 A;  2L6J A;  2OCC E;  4HRL A;  4B94 A;  4JXT A;  2VQ2 A;  3ZN3 A;  3IHV A;  2WXI A;  4GU5 A;  1A5E A;  3JYS A;  3R7R A;  3Q79 A;  2Y3A A;  3KSL A;  2A5E A;  3LVQ E;  4GYO A;  4JZY A;  2WQ6 A;  2MOW A;  4HLE A;  2DCP A;  2LAI A;  4Q94 A;  3KD7 A;  4XE0 A;  2KZT B;  5CRV A;  2GGF A;  3ESL A;  1H2T C;  5CCM A;  5ENR D;  1WDY A;  3AG3 E;  3CLJ A;  3ML8 A;  5DBK A;  2WQH A;  3TG5 A;  2KC7 A;  5ANL A;  3HHM A;  3EIJ A;  3PZD A;  3TL5 A;  4ZFH A;  2FEZ A;  1N4P A;  5FJY A;  1U2V G;  5ITZ F;  4JW1 A;  4IN3 B;  4NIK A;  1HH8 A;  1N94 A;  1S0P A;  2R59 A;  4G26 A;  2V8S E;  3LPZ A;  4CGV A;  5CER B;  2AVP A;  3TWQ A;  2NSZ A;  3L08 A;  3FP3 A;  3BG1 B;  4EBA A;  4FA6 A;  1JWF A;  2BTD A;  2JLB A;  1WY6 A;  5FWQ A;  4FHJ A;  3KEA A;  1V55 E;  5J08 A;  3B7U X;  3LXU X;  5H7P A;  1B89 A;  3AS5 A;  2QFC A;  3L54 A;  2R02 A;  3L16 A;  3D9M A;  4M3O A;  4BES A;  2UWJ G;  3NOC D;  1UJK A;  1IQU A;  5A23 A;  1K3Z D;  3AS8 A;  4RQI A;  3RAU A;  2IOS A;  4OVU A;  1NFI E;  1YYH A;  4E6H A;  3CKC A;  3SF4 A;  2ZGD A;  4XI9 A;  4G2V A;  3G2U A;  2DYR E;  4FAD A;  4YDY A;  4A55 A;  3TWS A;  4UI9 C;  1QZ2 A;  1HX8 A;  4FLB A;  4C48 B;  4GML A;  4YDO A;  1IYG A;  1H6K A;  4LNB A;  1BI7 B;  3FUM A;  3PZ1 A;  4UWK A;  2XGS A;  5ENP D;  5JHA A;  1IHG A;  3RRU A;  3V79 K;  2OND A;  2YQ8 A;  3R9M A;  3EJN A;  3FH8 A;  4F3V A;  4PDX A;  2V0P A;  5FZS A;  2XEE A;  3G2W A;  4PUC A;  5AIJ A;  1TNB A;  3FUL A;  1O1S A;  3DPY A;  3UM1 A;  2XEV A;  3DSS A;  2YHE A;  4C9B B;  4YDE A;  2IY0 C;  4FJY A;  2VJ8 A;  3DEO A;  4LEU A;  1FVH A;  3SY2 A;  1ZBP A;  5EN5 D;  2IO2 C;  3QC1 A;  1E8Z A;  3MV3 B;  3CHS A;  3AG1 E;  1OCZ E;  3R7Q A;  3FTY A;  1JPL A;  1N4Q A;  3SHF A;  3TJP A;  3UM2 A;  2XRY A;  3ZGQ A;  4F6R D;  4BX8 A;  4A1S A;  3GZS A;  5CBN A;  4U8Y D;  4H7X A;  2VGX A;  5D2M C;  4J8F A;  2P9K G;  4JVS A;  3FTS A;  3U66 A;  4B8C B;  4CT0 A;  4DX1 A;  3FTZ A;  4G8K A;  4AXH A;  4XIF A;  3B7S A;  4CT4 A;  5LFA A;  5JMN D;  3LY7 A;  3DXK G;  3FTX A;  4LSZ E;  4U63 A;  2OOE A;  3L22 A;  4HFG A;  3DSW A;  1OWO A;  2PNN A;  1XNF A;  3N71 A;  3KS2 A;  3TWR A;  2GRP B;  3JQ1 A;  5G05 C;  3HRA A;  3I5P A;  2J08 A;  4JHR A;  3CSF A;  1GW6 A;  4UWG A;  3PEU B;  3FH7 A;  2XEN A;  5JHB A;  3MKQ A;  3UXG A;  2FF4 A;  2J9Q A;  3SD5 A;  1ELR A;  4L1B A;  4AY5 A;  4I2Z A;  3FUE A;  1QYM A;  4X8Q A;  3PRZ A;  2XRZ A;  2OEW A;  4K03 A;  5CED B;  2CHZ A;  3UX4 A;  4U95 D;  4A63 B;  4BSZ B;  2Y4T A;  2VTB A;  3SNX A;  3IV0 A;  5LP0 A;  4EBA G;  5KJL A;  4B8A A;  4GCO A;  3MEK A;  5AQ9 A;  3Q73 A;  4F1S A;  2I9C A;  2AJA A;  5AQ7 A;  4U0S A;  3HVE B;  2DIW A;  3ASG A;  4AIF A;  3FY4 A;  3S7B A;  4BT9 A;  4K0R A;  1MX6 A;  2DWZ A;  3AG2 E;  1MYO A;  5CMY A;  3BU8 A;  4O60 A;  4WWO A;  2V4H C;  3MYV A;  2WXG A;  4EZK A;  2H6H A;  1HO8 A;  3LCA A;  4BT8 A;  4HB5 A;  3UTM A;  2WXN A;  4HOT A;  4U0Z A;  4ANX A;  4J8Y A;  3EHM A;  3MGB A;  5CCL A;  4BFR A;  3AS4 A;  2EIK E;  1E8Y A;  4I6E A;  1HU3 A;  4JC8 A;  3MV2 B;  4C0M A;  2ZGG A;  5KJK A;  3SI5 A;  3LKU A;  2I1K A;  3FWV A;  3R9A B;  4BWR A;  4KVM A;  1DNP A;  3LYA A;  2I6H A;  5G04 C;  4ANU A;  3V2O A;  3EHQ A;  4UWF A;  4FC8 A;  5EKQ D;  4DX7 D;  2EIJ E;  4HI8 A;  1N0R A;  4F53 A;  1MJ0 A;  2WM9 A;  4XKC A;  1BLX B;  1JCQ A;  1KZO A;  3LJ3 A;  3DXM G;  4ANV A;  5CEC B;  1S70 B;  1TNZ A;  4I9C A;  5T8I A;  4GTV A;  2M63 A;  3CR3 A;  1N0Q A;  1K1A A;  1QBQ A;  1UN8 A;  2QYJ A;  4H7Y A;  2PM6 A;  4WND A;  1OY3 D;  2F0Y A;  2WPV A;  2WXK A;  2XPI A;  3RO3 A;  1H6P A;  4U96 D;  3VTY A;  1X5B A;  3C72 A;  3LY8 A;  4DX5 D;  2WXO A;  3PRE A;  1BPO A;  2Y4U A;  3QB2 A;  3PZ2 A;  2PQN A;  2RKK A;  2KCK A;  4TRQ A;  1Z3Y A;  5AEN A;  4OAV B;  5KNH D;  3J5Q B;  3CVV A;  3GZ2 A;  1TNO A;  3ZHE B;  3Q7A A;  4J0U A;  3ZW3 A;  4DX6 D;  1FPP A;  1ELW A;  1H19 A;  3APD A;  5BV0 A;  4L23 A;  2P2C P;  2DZN A;  1DCQ A;  1LF8 A;  4D10 C;  4K5C A;  4P29 A;  2DBA A;  3PS6 A;  3FUD A;  3D9I A;  3L9T A;  4WNE A;  4AJW A;  4UI9 K;  2LSV A;  4JHK A;  4V3I A;  4MS6 A;  4ILH B;  1Q2Z A;  2EIN E;  4U7E B;  4U8V D;  3B95 A;  2YHC A;  4GAA A;  4U8H A;  4UQZ A;  3D9K A;  4EZJ A;  1E8X A;  4YVO A;  5AJL A;  4IYP A;  5CMW A;  4HI9 A;  4HS2 A;  4LER A;  1EPU A;  2KAT A;  3CK7 A;  5C2Y A;  3ESK A;  2XZT G;  2KZT A;  4U04 A;  1UN9 A;  4JD2 G;  5FZR A;  2Y69 E;  3HXC A;  2UY1 B;  1TNY A;  2E0I A;  3B13 A;  5FTP A;  2GW1 A;  4MKT A;  3Q15 A;  1E96 B;  4K5A B;  4TV3 A;  2LUH A;  1OWL A;  3UT7 A;  5BNW A;  2AXV A;  3RJV A;  5KCM A;  3TAX A;  1L5J A;  4I6G A;  4GZC A;  2WMO A;  4RG9 A;  1S63 A;  4GTP A;  4DJA A;  2C0M A;  2VGY A;  3UMV A;  3SFY A;  2GRL A;  3MZL B;  3BUA A;  3ZVV A;  5LCW J;  4J6I A;  4C0E A;  3CVU A;  3MJW A;  1U3D A;  1AWC B;  3EU9 A;  1UW4 B;  2VSX E;  4RLY A;  5G04 J;  4HVB A;  4G1T A;  2WXF A;  4W9R A;  3ZEF A;  1WG0 A;  4BY6 A;  5BW8 C;  2J07 A;  2KCV A;  2X38 A;  4DI4 A;  1SA4 A;  2HYZ A;  2WXP A;  2LXM A;  4KZC A;  3U64 A;  3DRA A;  2IQC A;  1U3C A;  3RO2 A;  5ENT D;  1HZ4 A;  3UIN C;  4HOU A;  3JUI A;  4UUC A;  3ZYQ A;  4DUI A;  3QOU A;  4WNG A;  5T4Y A;  3NAW A;  4XX5 A;  1V54 E;  3ASF A;  3UM3 A;  1TN6 A;  4RSY A;  1OT8 A;  4NRH B;  4OVV A;  3EUV A;  4ACK A;  4G11 A;  2V5F A;  4Q69 A;  4BEP A;  3CVW A;  3OXF A;  4PS8 A;  4HXI A;  3FU0 A;  2V4L A;  1SA5 A;  2HE0 A;  4GZ3 A;  4XI0 A;  5M72 A;  3E34 A;  5EIL A;  3FU3 A;  2EIL E;  2XHE A;  3D9J A;  1PAQ A;  3NB2 A;  1UJJ A;  1VDY A;  2PZI A;  4E85 A;  2VSO E;  4CDR A;  2XPZ A;  1H2V C;  4O1P A;  1NL4 A;  2NC9 A;  3ML9 A;  4JEH A;  4CGW A;  5G2N A;  3QWV A;  3D9L A;  3CK8 A;  2HO1 A;  3TG4 A;  3UKU G;  2C2L A;  3SZ7 A;  5EID A;  2X6I A;  3FUK A;  2R05 A;  4GYY A;  3FDH A;  3QWW A;  3CVN A;  4Y6W A;  3FU6 A;  4GMR A;  1E90 A;  2ZIR A;  3CQG B;  3SBS A;  3FHE A;  2WVI A;  5E76 A;  2QC9 A;  4JHJ A;  3QDN A;  3UQ3 A;  2PQR A;  4I1A A;  4ATG A;  4ACL A;  3ISM C;  4TXQ A;  5BT1 A;  2PL2 A;  2L9B A;  4J7W A;  5HQ8 A;  1KPS B;  1N95 A;  1SW6 A;  2OEV A;  4KT6 B;  4DPR A;  1HF8 A;  3UI2 A;  5JJT A;  2GRO B;  5BXU A;  2IFU A;  3JQ0 A;  4DX2 A;  2JEK A;  5KWD A;  3HDX A;  3P1U A;  2XGM A;  2CHX A;  1RZ4 A;  4FU3 A;  5D66 A;  3UM0 A;  1SQM A;  3L13 A;  3GZ1 A;  4UWH A;  2MRI A;  3AAA C;  3J5P A;  1IHB A;  3T5X A;  2OV8 A;  1OWP A;  2XEH A;  1ZB1 A;  2IJG X;  3QJZ A;  3K9I A;  4KXK B;  1N54 A;  2ETC A;  4TUU A;  3FTV A;  4AP2 A;  3T8M A;  4U07 A;  4I17 A;  3PE3 A;  3HYM B;  5AN8 A;  4CRW A;  3DWL G; 
#chains in the Genus database with same CATH homology
 4FA6 A;  5CCM A;  4H7Y A;  2PM6 A;  4ANW A;  4GA0 A;  4WND A;  4B0Z A;  4URK A;  3CLJ A;  3IHY A;  3OXL A;  2LNI A;  3Q5M A;  2WPV A;  3ML8 A;  3PVL A;  2WQH A;  5DBK A;  3HVE A;  3TG5 A;  2WXK A;  2KC7 A;  2XPI A;  5ANL A;  3RO3 A;  3D9N A;  3RIB A;  4N2Q A;  4I2W A;  4JPS A;  3VTY A;  2RD0 A;  3HHM A;  3GW4 A;  3EIJ A;  3PZD A;  2YNQ A;  4LRZ A;  1X5B A;  3TL5 A;  3LY8 A;  2WXO A;  3PRE A;  4O6F A;  1JUQ A;  1BPO A;  2FEZ A;  3IEG A;  4WNF A;  4LUN U;  5FJY A;  3CHM A;  1NA3 A;  4JW1 A;  3APF A;  4IN3 B;  2Y4U A;  1HH8 A;  3QB2 A;  1S0P A;  2R59 A;  4IUL A;  3IBE A;  3AU5 A;  4G26 A;  2V8S E;  1INZ A;  2PQN A;  3LPZ A;  2AXU A;  2QY7 A;  2KCK A;  4CGV A;  5KJM A;  4TRQ A;  1Z3Y A;  5AEN A;  4J8S A;  2AVP A;  3FTU A;  2L0I A;  5FQ4 A;  3LY9 A;  2NSZ A;  3L08 A;  3CVV A;  3FP3 A;  3BG1 B;  4EBA A;  3GZ2 A;  1JWF A;  2BTD A;  2JLB A;  2J4D A;  4UWL A;  3CHP A;  1WY6 A;  4GZ6 A;  4UI9 J;  5FWQ A;  3ZHE B;  4FHJ A;  3APC A;  2X6K A;  5E75 A;  5J08 A;  3B7U X;  4J0U A;  3JCK C;  3ZW3 A;  4L2Y A;  3LXU X;  1B89 A;  2CFU A;  3MX3 A;  3C98 A;  2AW6 A;  1ELW A;  1H19 A;  3APD A;  5BV0 A;  1A17 A;  4GA2 A;  4L23 A;  5ARF A;  4GB9 A;  1LF8 A;  4D10 C;  3AS5 A;  2QFC A;  2VGX B;  4P29 A;  3L54 A;  3CK9 A;  2DBA A;  2WXH A;  3L16 A;  3PS6 A;  3D9M A;  4M3O A;  3FUD A;  3D9I A;  2UWJ G;  4FUL A;  4YVQ C;  3FUH A;  1UJK A;  4I6J A;  3UT4 A;  1IQU A;  5A23 A;  3AS8 A;  1FCH A;  5EDS A;  2HM8 A;  2IOS A;  4CDN A;  3UT8 A;  1E7U A;  4OVU A;  3URZ A;  4WNE A;  2XCC A;  4FP7 A;  4E6H A;  4AJW A;  3RKV A;  2XPY A;  4UI9 K;  2X6J A;  1SZA A;  2OVB A;  2LSV A;  1PC2 A;  1H0A A;  3CKC A;  1YA0 A;  4JHK A;  4V3I A;  1MHQ A;  4MS6 A;  1WM5 A;  4ILH B;  2EQX A;  1ELK A;  3NF1 A;  3SGH A;  3VLD A;  3U4T A;  4U0U A;  3SF4 A;  3D9P A;  3OTN A;  3D3M A;  4FJZ A;  2A4Z A;  4XI9 A;  3RK6 A;  4G2V A;  3G2U A;  2YHC A;  4GAA A;  4G23 A;  4FAD A;  4A55 A;  4U8H A;  3CST A;  4N3C A;  4UQZ A;  1E8W A;  4UI9 C;  3D9K A;  2FUL A;  1E8X A;  1HE8 A;  4LCT A;  4UQY A;  4EZJ A;  1QZ2 A;  3MKQ B;  4YVO A;  1HG2 A;  1HX8 A;  4FLB A;  5AJL A;  4IYP A;  4ILG A;  2IOL A;  5FQ7 A;  5CMW A;  4GML A;  1QNF A;  4WUY A;  3TXN A;  1IYG A;  3P2B A;  2ZU6 B;  4L7T A;  2WMN A;  2XQ0 A;  1H6K A;  4HS2 A;  3LDZ A;  4LER A;  4EPZ A;  3FFL A;  5HI7 A;  3FUM A;  3QKY A;  4Y6C A;  1EPU A;  2KAT A;  4HOQ A;  4UWK A;  2XGS A;  1HS6 A;  3CK7 A;  3CHQ A;  3KAE A;  5JHA A;  3T5V A;  1IHG A;  5C2Y A;  3RRU A;  3ESK A;  3ZYM A;  2KZT A;  2J09 A;  2FI7 A;  5A6C A;  2OND A;  4U04 A;  2VTB B;  2YQ8 A;  4NUR A;  1UN9 A;  2KM4 A;  4N5C A;  2XGO A;  3EJN A;  3FH8 A;  3ONL A;  5JJ7 A;  4PS7 A;  5FZR A;  4F3V A;  3CHR A;  4PDX A;  1KT1 A;  2UY1 B;  2V0P A;  2E0I A;  3S7J A;  4WAF A;  3B13 A;  5FT9 A;  5FTP A;  2GW1 A;  5FZS A;  3PDN A;  4MKT A;  3B7T A;  2I2O A;  3Q15 A;  1E96 B;  3G2W A;  4PUC A;  4PS3 A;  4TV3 A;  5AIJ A;  1OWL A;  3UT7 A;  3Q47 B;  3FUL A;  5BNW A;  2XEV A;  2VSN A;  3I3N A;  2AXV A;  3FTW A;  3OAW A;  4BSX A;  4RVB A;  2XCB A;  2GRM A;  2YHE A;  3G2S A;  3RJV A;  2R17 C;  4NAC A;  3ASD A;  4C9B B;  5KCM A;  3TAX A;  4FLH A;  4FJY A;  2VJ8 A;  1P5Q A;  1L5J A;  4LEU A;  5LOZ A;  1FVH A;  2A5U A;  3DBS A;  4I6G A;  4GZC A;  1ZBP A;  2WMO A;  4NQ0 A;  3FEX A;  4RG9 A;  5FQ8 A;  3CIA A;  3E4B A;  3S2A A;  4EZL A;  3QC1 A;  1PY1 A;  4UQX A;  3L17 A;  4DJA A;  1Y6I A;  2C0M A;  2VGY A;  2YIN A;  3ENE A;  4R7L A;  3CV0 A;  3UMV A;  4CDM A;  5C1D A;  2GRL A;  3QAQ A;  4F7A A;  2X3M A;  4KYO B;  3G2T A;  1E8Z A;  4QFV A;  4DK5 A;  3MZL B;  3MV3 B;  5D0O D;  5G05 J;  2NXP A;  3CHS A;  3ZVV A;  5LCW J;  4DLO A;  3R7Q A;  4J6I A;  4C0E A;  3ZHE A;  3CVU A;  3MJW A;  3FTY A;  4L2L A;  4HOS A;  1JPL A;  2VSY A;  1EF1 C;  1U3D A;  1EDU A;  4N3B A;  2CFZ A;  3SHF A;  3TJP A;  2XRY A;  2E2E A;  1UW4 B;  4GCN A;  3ZGQ A;  4A3T A;  4BX8 A;  2CG3 A;  2ION A;  5ARG A;  5CHE E;  2VSX E;  3HIZ A;  5DIZ A;  4A1S A;  4XZ4 A;  3GZS A;  5G04 J;  4HVB A;  3FH5 A;  4HOR A;  4G1T A;  4EQF A;  2WXF A;  4W9R A;  3B7R L;  4H7X A;  3ZEF A;  1DVP A;  4BY6 A;  5BW8 C;  2VGX A;  4GPK A;  4J8F A;  3LEW A;  2J07 A;  2KCV A;  2X38 A;  3FTS A;  4JVS A;  3U66 A;  2WQ7 A;  4B8C B;  3EHN A;  5BPP A;  3UUX A;  4CT0 A;  2HYZ A;  4DI4 A;  2WXP A;  3QK0 A;  4AM9 A;  4KZC A;  4JEU A;  3U64 A;  3UPV A;  2IQC A;  3FTZ A;  3PUK A;  1U3C A;  3RO2 A;  2MHK A;  1HZ4 A;  2AXZ A;  2WXM A;  3B7S A;  3FUN A;  4HOU A;  4XIF A;  4AXH A;  2OVF A;  3JUI A;  3SBT B;  4CT4 A;  3L6A A;  4GMJ A;  5LFA A;  4YND A;  4N3A A;  3LY7 A;  3ZYK A;  4ABN A;  3ZYQ A;  3PNL B;  2PM7 A;  4I43 A;  3FTX A;  4U63 A;  3QOU A;  5A7D B;  1WAO 1;  2BUG A;  2OOE A;  4ILI A;  3L22 A;  4HFG A;  1OWM A;  2P58 C;  1OWO A;  4WNG A;  1HG5 A;  5T4Y A;  1XNF A;  4XX5 A;  3ASF A;  3N71 A;  2WXJ A;  1SZ9 A;  3RU0 A;  4EEC A;  3EDT B;  2KCL A;  3KS2 A;  4RSY A;  3JQ1 A;  5G05 C;  5LCW C;  1N52 A;  3I5P A;  3ZFW A;  2LO6 A;  2J08 A;  4JHR A;  3CSF A;  4NRH B;  5AYW D;  1GW6 A;  1Y8M A;  4KBQ A;  4OVV A;  3U3W A;  4UWG A;  3PEU B;  3FH7 A;  3RRM B;  4ACK A;  4JA7 A;  3MKQ A;  4G11 A;  3KEZ A;  2FF4 A;  2J9Q A;  3ZYL A;  1HXI A;  4A3V A;  1NA0 A;  2FBN A;  2V5F A;  2ILR A;  2WXR A;  3SD5 A;  4Q69 A;  1ELR A;  4L1B A;  4GYW A;  4AY5 A;  3PH0 C;  3CVW A;  3OXF A;  4PS8 A;  2BF0 X;  4I2Z A;  3FUE A;  5ANR A;  4HXI A;  3PRZ A;  3QWP A;  4JA9 A;  4K03 A;  1Z6T A;  3FU0 A;  5T3R A;  4AEZ C;  2CHZ A;  2XRZ A;  3CVP A;  2V4L A;  4XI0 A;  4GZ3 A;  3UX4 A;  5M72 A;  2J49 A;  3LVR E;  3FU3 A;  1MQS A;  2XHE A;  3D9J A;  3EIQ C;  1PAQ A;  2I1J A;  2Y4T A;  3CEQ A;  3SNX A;  2VTB A;  1UJJ A;  1VDY A;  5BUZ A;  2Q7F A;  2PZI A;  3DPD A;  3VLE A;  4E85 A;  2VSO E;  5FZQ A;  3IV0 A;  3QAR A;  2UY1 A;  4CDR A;  5LP0 A;  4EBA G;  5KJL A;  3ZPJ A;  2XPZ A;  1H2V C;  3CGH A;  4B8A A;  2IU1 A;  1UG3 A;  3D9O A;  4GCO A;  3MEK A;  2NC9 A;  3ML9 A;  4JEH A;  4CGW A;  3CVX A;  5G2N A;  4F1S A;  3CVL A;  3QWV A;  4I1M A;  2L0T B;  4Q96 A;  3FUF A;  4MLP A;  2I9C A;  3D9L A;  3OXG A;  2FO7 A;  3VLF A;  2C0L A;  3CK8 A;  2HO1 A;  5AJD A;  1H2U A;  4BTA A;  3TG4 A;  5LX8 A;  3CKB A;  1QQE A;  2CG2 A;  4U0S A;  3HVE B;  2C2L A;  4BX9 A;  3IKO B;  1XGW A;  2DIW A;  3SZ7 A;  4DI3 A;  3ASG A;  4AIF A;  2X6I A;  4PH4 B;  3FUK A;  3FY4 A;  3S7B A;  4GYY A;  4MRU A;  3FDH A;  4BT9 A;  3QWW A;  3CVN A;  1OWN A;  2IF4 A;  4K0R A;  4Y6W A;  3FU6 A;  1E90 A;  3CQG B;  3AU4 A;  3SBS A;  4AOF A;  3FHE A;  2WVI A;  1E7V A;  4N39 A;  4AV7 A;  2RG8 A;  4G24 A;  2X6F A;  4B89 A;  1TEZ A;  1W3B A;  2LAH A;  1ZU2 A;  5E76 A;  3CVY A;  5FQ6 A;  1TJC A;  1OUV A;  3ASH A;  4JHJ A;  3QDN A;  3UQ3 A;  2PQR A;  5J90 A;  4I1A A;  4APF A;  3MCX A;  5CMY A;  4WWO A;  3MYV A;  4ACL A;  4ATG A;  3CVQ A;  3ZXS A;  2WXG A;  4GZ5 A;  3PEV B;  4JL0 A;  3LS8 A;  5BT1 A;  4EZK A;  2PL2 A;  2L9B A;  4GA1 A;  1Z3X A;  1HO8 A;  4CEM A;  4DLQ A;  1JWG A;  2LSU A;  3LCA A;  5BV1 A;  5HQ8 A;  3FU5 A;  3ZIM A;  2AWI A;  1TJF A;  4OYS A;  3U9W A;  4BTB A;  3FEY A;  3GYZ A;  3I4G A;  2WXQ A;  1FVF A;  3CQC B;  3MKR A;  3TXM A;  4IRU A;  2CHW A;  4BT8 A;  4KMO A;  4KT6 B;  4HOT A;  2WXN A;  4DPR A;  4U0Z A;  4J8E A;  3CHO A;  4J8D A;  5G55 A;  4ANX A;  4FHK A;  1HF8 A;  3EHM A;  4KVO A;  3NZS A;  3MGB A;  4RG6 A;  3Q49 B;  5CCL A;  3Q4A B;  2VYI A;  4APO A;  4BFR A;  3MA5 A;  3VTX A;  5EX3 A;  5JJT A;  3AS4 A;  2IFU A;  2WXL A;  3JQ0 A;  1E8Y A;  5EX0 A;  1IQR A;  2JEK A;  4I6E A;  1KT0 A;  3HDX A;  3PUJ A;  3P1U A;  4GZD A;  2R5S A;  2XGM A;  1HU3 A;  3PE4 A;  2CHX A;  4JC8 A;  3WXX A;  3MV2 B;  4A1G A;  4FU3 A;  4G25 A;  4C0M A;  4XKB A;  4AVX A;  5KJK A;  5JHB A;  3SI5 A;  1SQM A;  4AY6 A;  1NZN A;  3L13 A;  4I1O B;  3GZ1 A;  3I4R B;  4WWN A;  3LKU A;  2J4B A;  3S7D A;  3QNK A;  4UWH A;  3ONK A;  3SFZ A;  2I1K A;  3BG0 B;  2HR2 A;  2MRI A;  4N2S A;  3O4Z A;  3ZRH A;  4WWP A;  3FWV A;  3R9A B;  4BWR A;  3NQP A;  3G2V A;  4KZ0 A;  3FUJ A;  5JJ6 A;  4KVM A;  2L6J A;  5D0Q D;  1DNP A;  4B94 A;  3LYA A;  3RRN B;  4JXT A;  2X6H A;  2I6H A;  2VQ2 A;  5G04 C;  1EYH A;  4ANU A;  3TGO A;  3ZN3 A;  3IHV A;  2WB2 A;  2WXI A;  4UWF A;  3T5X A;  2OV8 A;  1OWP A;  3PNT B;  4FC8 A;  4GU5 A;  4I9E A;  5EKQ D;  2IJG X;  3S7F A;  3JYS A;  3R7R A;  3QJZ A;  3ULQ A;  4CCA A;  2Y3A A;  3K9I A;  3LVQ E;  4GYO A;  4KXK B;  4F53 A;  2WM9 A;  4JZY A;  3BEE A;  1N54 A;  4XKC A;  4TUU A;  3FTV A;  3O48 A;  4AP2 A;  1HFA A;  3LJ3 A;  5ENN A;  3T8M A;  3FUI A;  4U07 A;  4I17 A;  4ANV A;  3PE3 A;  3HYM B;  2WQ6 A;  2MOW A;  4I9C A;  5T8I A;  4ME2 A;  4CRW A;  4HLE A;  2DCP A;  2LAI A;  1NP7 A;  4Q94 A;  2M63 A;  3CR3 A;  3KD7 A;  4XE0 A;  2KZT B;  3NZU A;  2GGF A;  3ESL A;  1KLX A;  5KJN A;  1UN8 A;  1H2T C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...