3KAEA

Cdc27 n-terminus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
225
Chain Sequence
SKLIGKICKSIRYRDYETAIFLAACLLEYRMLMSIVLYLNGEYTRALFHLHKLNTCTSKYYESLCYKKKKDYKKAIKSLESILEGKVERDPDVDARIQEMFVDPGDEEFFESLLGDLCTLSGYREEGIGHYVRSFGKSFLFSPVENLLLENKVPQKRGIEEEYVSDSIEFHESLSPSLVKKYMEHVPGIGSYFISNAARRYFNLGMNDKSKACFELVRRKDPMFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Possible protein of nuclear scaffold
publication title Molecular structure of the N-terminal domain of the APC/C subunit Cdc27 reveals a homo-dimeric tetratricopeptide repeat architecture
pubmed doi rcsb
source organism Encephalitozoon cuniculi
total genus 86
structure length 225
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kaeA00
2UWJG 2KCVA 3UQ3A 3QKYA 3URZA 3ZFWA 4YVOA 1ELWA 3LY9A 3ASFA 3OXLA 4I2ZA 3Q49B 3CVLA 4YNDA 4AM9A 4XI0A 2LSUA 3FFLA 5CHEE 3RJVA 2P58C 4WNFA 4BTBA 5KJKA 5JJ7A 3GZ1A 3R9AB 1IYGA 2XGMA 4O6FA 3S7BA 4WNEA 4CGVA 4KBQA 2C0LA 3ASGA 3ZHEA 4YVQC 2KCLA 4GZ3A 3RKVA 2KATA 1IHGA 3TGOA 4UQZA 4LEUA 4AIFA 3Q47B 4GA1A 2IFUA 4BWRA 4H7XA 5DIZA 3TG4A 4Y6WA 2XCBA 2R5SA 2VYIA 3N71A 2FI7A 3MA5A 2AVPA 1KT0A 4GPKA 4U0UA 4J8EA 5M72A 2LNIA 2Y4UA 3PDNA 3QDNA 1W3BA 4UI9C 3LCAA 3Q4AB 3LYAA 3Q15A 1E96B 1ZU2A 1QZ2A 5ARGA 2XEVA 2Y4TA 4JL0A 5EX0A 4IN3B 3WXXA 5CCLA 2XPIA 4UQYA 4CDRA 3CK8A 4GYOA 4B94A 3NF1A 4WUYA 4HOTA 2GW1A 2IF4A 3QWWA 2FEZA 5KJNA 3FWVA 2V5FA 2FBNA 3ZHEB 4N3AA 2HYZA 5A6CA 4I17A 4GYYA 3CKCA 2VGXB 3TAXA 4HOSA 4AY6A 5C1DA 5LCWJ 3VTYA 2UY1B 4RG6A 5KJLA 3ESKA 3O48A 2VSNA 3Q5MA 3E4BA 1PC2A 3SF4A 1Y8MA 3TG5A 3IEGA 4J8FA 3ASHA 1WAO1 2NC9A 2VGXA 4BTAA 3GW4A 3SZ7A 4ABNA 2YHCA 2WQHA 4G23A 2YQ8A 5FZSA 2PQRA 5G05J 3PE4A 5G04J 2UY1A 3EDTB 3KD7A 1YA0A 2QFCA 2MHKA 3RU0A 3UUXA 4I9EA 5EX3A 4HORA 4U04A 4N5CA 4JA7A 4NRHB 5JJ6A 3LY7A 4H7YA 4Y6CA 3RIBA 4W9RA 3RO3A 3KS2A 3OXFA 4NQ0A 3UPVA 3ASDA 4N2SA 3ZGQA 3CKBA 5D0OD 4GZ6A 5AYWD 2BUGA 3HYMB 3K9IA 4AY5A 4N39A 4BT9A 4UI9J 2VSYA 3BEEA 2PQNA 3KAEA 2Q7FA 4J0UA 3QWPA 3QOUA 3U4TA 3JYSA 4G25A 2FF4A 1KT1A 4GA2A 2KCKA 1QQEA 3CK7A 3ULQA 4U07A 4GCNA 1NA3A 2VGYA 1ZBPA 3LY8A 4UQXA 3MV3B 4RG9A 3U3WA 3MV2B 4KXKB 2XGOA 1B89A 4JA9A 3AS8A 4GA0A 3CK9A 5FZRA 4JHRA 2VQ2A 4ME2A 1FCHA 2C2LA 5HQ8A 2DBAA 3S7JA 2JLBA 4G2VA 5G05C 4CGWA 5G04C 1P5QA 2WPVA 2J9QA 3GZ2A 3LPZA 3PE3A 5DBKA 4I9CA 2LSVA 1WM5A 2ONDA 2OOEA 5FTPA 3QWVA 5KJMA 4XIFA 1XNFA 5D0QD 4J8DA 3CV0A 4KYOB 4WNDA 2HR2A 4WNGA 4N3BA 4G1TA 3ZPJA 4EQFA 3VTXA 4U0SA 1TJCA 5EKQD 3FP3A 5BNWA 5A7DB 4F3VA 1NA0A 5FZQA 4GYWA 3AS5A 1OUVA 3S7DA 4N3CA 2KC7A 4A1SA 5FT9A 4HOQA 2C0MA 3CEQA 1HXIA 2PZIA 4BT8A 4APOA 2XGSA 3ZN3A 3RO2A 5BT1A 1KLXA 5HI7A 3S7FA 1NZNA 4G26A 4GZ5A 3MEKA 2HO1A 3GYZA 4I1AA 2PL2A 1A17A 1HZ4A 4G24A 5CCMA 3AS4A 3CVPA 2FO7A 5LCWC 5FJYA 4XI9A 5ARFA 5BW8C 4U0ZA 2E2EA 4N2QA 1HH8A 5JJTA 2XCCA 2L6JA 1ELRA 4I2WA 3CVQA 3LKUA 3OXGA 4HOUA 2I6HA 4UI9K 4GCOA 3MKRA 3CVNA
chains in the Genus database with same CATH superfamily
2UWJG 2LAHA 4HBDA 3UQ3A 3QKYA 3URZA 1IQUA 3HRAA 3ZFWA 1ELWA 3LY9A 2WXPA 4J7WA 3ASFA 3Q49B 4YNDA 1RW2A 1D9SA 4XI0A 2LSUA 2XEHA 3ZW3A 1MX6A 2J8SD 3RJVA 1N95A 4WWPA 1K1AA 3HVEA 5JJ7A 3V2OA 4WWOA 4GTOA 4K5BA 3S7BA 3BG0B 4KBQA 4JHJA 1X5BA 4GZ3A 2A4ZA 2I1JA 1IHGA 3ONLA 5KCMA 1OWOA 4AXHA 1UOHA 2OEWA 5JMND 3TWSA 3SY2A 1JPLA 4LEUA 4AIFA 1S64A 1YMPA 4BWRA 3T8KA 2XPYA 3UKRG 2DWZA 3PZDA 5FQ8A 4I6GA 3HDXA 5FQ6A 2KZTA 5JHAA 2WXRA 3HXFA 2LNIA 4F1PA 1O1SA 3QDNA 5ITZF 4UI9C 3QJZA 3U9WA 1MX4A 2R05A 2XHEA 1OCCE 2M63A 5EX0A 4IN3B 5CCLA 1LF8A 2XPIA 4GYOA 4WUYA 2CHZA 3U64A 2ZIRA 1TNZA 5KJNA 1WY6A 1Q2ZA 4C48B 5AN8A 3MKQB 2FBNA 5JA4D 4HRNA 3KSLA 1MJ0A 1NI1A 3B7UX 3FUNA 4YDEA 2J09A 4GYYA 4J8SA 4HOSA 4KMOA 2IO2C 1DC2A 4BY6A 2BTDA 4ILGA 4ANWA 3PEVB 2IEJA 4RG6A 3UT8A 3ESKA 2DIWA 4LG6A 2VSNA 1HF8A 2X6IA 3GZSA 1PC2A 2X3MA 3SGHA 4O1PA 1PY1A 3B95A 4L2YA 2CG3A 1SZAA 3ONKA 3ASHA 2LXLA 1WAO1 4A1GA 4FJYA 2NC9A 1N94A 4K5CA 4BTAA 3L54A 4ABNA 2QY7A 5FZSA 4HS2A 3DPYA 3UM0A 2MHKA 3RU0A 2HM8A 4I9EA 5EX3A 4HORA 4DI3A 2IU1A 4ACLA 3RIBA 4CT0A 4NQ0A 4UWFA 1D8EA 4U8HA 1X81A 4AVXA 1OXJA 3ASDA 3ZGQA 3SBSA 5T8IA 3FUJA 3FUEA 3FEXA 3J5PA 3HYMB 4IULA 3K9IA 3G2VA 1OWNA 4AY5A 1N9AA 1OWMA 2P9KG 4N39A 5B3SE 4EBAA 2H6IA 4BT9A 3KAEA 3EU9A 4J0UA 3QOUA 3AAAC 4G25A 3QNKA 5EN5D 4GA2A 1QQEA 2BKKB 2QYJA 4U07A 5AJDA 1FT1A 4A3VA 4EZLA 1NA3A 4MBGA 4F6RD 1Z3XA 2WXOA 4TUUA 2VGYA 3ZUVB 3UKUG 4HNAD 4F7AA 1B89A 5BV1A 3T5XA 2E0IA 5FZRA 2VQ2A 3OTNA 4XE0A 1FCHA 4PH4B 3S7JA 1NP7A 3ULEG 3DBSA 3D9PA 5G04C 5ENRD 3PE3A 4CDNA 3VLFA 3NOCD 3NZUA 1HX8A 2IOSA 2OOEA 1JWFA 1L5JA 1TNYA 3I4RB 2OVFA 4B93B 5CBOA 1O5MA 3CV0A 3EHNA 1BD8A 2EILE 1HU3A 2HR2A 3E30A 2J4BA 3D9HA 4WNGA 4G1TA 4R7LA 4QQIA 3ZPJA 3MJWA 4TXRA 4PS8A 3VTXA 5HS0A 4U0SA 4EZJA 2XRYA 3FTZA 5A7DB 2V0PA 4BETA 2OCCE 3QARA 4YDWA 3AS5A 4HB5A 4G8LA 3S7DA 4ANVA 3CVYA 3TL5A 5FT9A 4HOQA 3APDA 3CEQA 1HXIA 3DWLG 4B89A 1SVXA 4BT8A 5KWDA 2KBXA 4BEPA 2VJ8A 2H6HA 3GYZA 2OVBA 4I1AA 1WG0A 1A17A 1HZ4A 4V3IA 4JZYA 5AJLA 1U3DA 1LD8A 3CVPA 4ILHB 2ETAA 3OAWA 3C72A 4GTPA 3C3RA 4PS3A 2R17C 5EDSA 3HVEB 1D8DA 4OYSA 5J08A 1HH8A 4ACKA 3R7QA 3IHVA 4I2WA 3IBEA 3LKUA 3OXGA 2VSOE 4HOUA 2I6HA 1K3ZD 3LVQE 4B8CB 4LSZE 4I6JA 4GZDA 3Q78A 2PM7A 4YVOA 2WMOA 2IO3C 1FVHA 1DCEA 2L9BA 5T3RA 3DSUA 5HKPA 3FEYA 1V55E 1JWGA 2J49A 2YHEA 4GU5A 2WXIA 4ATZD 2XGMA 2RG8A 5KNHD 2ZU6B 2DVWA 2JEKA 2EIKE 3EHMA 4YVQC 2KCLA 3W9GA 2VTBA 1AWCB 3AG3E 3PZ1A 3CHOA 3EUVA 1KZPA 1EF1C 3TGOA 4UQZA 5AIJA 4FC8A 2IFUA 2PM6A 1NFIE 4H7XA 3CSFA 3CHPA 2IQCA 3RRMB 3TG4A 5BXUA 3AG4E 3NQPA 4C0EA 2R5SA 4JB8P 2V4HC 3N71A 2AXVA 1ELKA 3QC1A 4D10C 2AVPA 5LOZA 3AU5A 3FTXA 4U0UA 4J8EA 1H6PA 1JUQA 3UIOC 3PDNA 2OEVA 1TN8A 2P9NG 3IV0A 5KBAA 3Q4AB 2ILRA 3NBNB 3Q15A 3ML8A 1QZ2A 2Y4TA 3PUJA 4CYMD 4C0MA 3EHRA 4LNBA 3U66A 4JC8A 4GMRA 3Q9NC 1FVFA 1H6KA 3TWUA 3CVUA 2V8SE 1TN6A 1OCRE 3CK8A 4C9BB 4HQDA 1TNOA 4CT4A 4GTSA 3ABKE 3G2WA 2FEZA 4TRQA 3CVWA 1VDYA 4XKBA 1N0QA 2ZGGA 3ZHEB 1EPUA 4N3AA 4JD2G 1ZB1A 3Q79A 4MKTA 5A6CA 2WXNA 3FTUA 4I17A 5C1DA 3E33A 5AENA 1H0AA 3VTYA 5KJLA 1JCQA 2PNNA 3D9LA 3PVLA 3RK6A 3ULYA 5FQ7A 1Y8MA 1FPPA 4HI9A 3TG5A 4Q96A 3ZKJA 3DSSA 2CG2A 1FT2A 2VGXA 4JEHA 4U7EB 2YHCA 2WQHA 4G23A 2YQ8A 3IHYA 1H2VC 2WXMA 5CMYA 2UY1A 5G04J 3Q7AA 3EDTB 3KD7A 3FDHA 3UIPC 4DLOA 3LJ3A 3TWRA 2WB2A 1OCOE 3LY7A 3PS6A 3SO8A 4E85A 3ZXPA 3RAUA 3RO3A 2DCPA 3KS2A 2AW6A 4KVOA 1S70B 4U96D 3TWQA 4O1OA 3UM2A 5J90A 4N2SA 4FU3A 3D9NA 2L0TB 2GROB 4RLYA 4HFGA 2CHXA 3FUDA 4L7TA 5E76A 4L9PA 4OAUC 1K8KG 4L23A 2XQ0A 4DX6D 4PDXA 2Q7FA 4FLHA 4GMLA 1OWPA 3JYSA 2WVIA 1OT8A 1S0PA 3MGBA 1N0RA 1LD7A 2KCKA 1UJJA 3ULQA 4UWHA 3FTYA 1AP7A 4ZFHA 2J08A 3ML9A 3ZRHA 4DPRA 4DK5A 2MYOA 4UQXA 4IRUA 3D3MA 4KXKB 2XGOA 3QB2A 4JA9A 3TXMA 3UM3A 3WG7E 3AS8A 4NURA 3UMVA 3PREA 3QAQA 2P9IG 4FP7A 3NOGD 3DPDA 3KEAA 5AQ7A 2DBAA 1SW6A 2JLBA 4U8YD 5G05C 1TJFA 4CGWA 3DSXA 3PZ4A 1BI7B 2P2CP 2J9QA 3LPZA 5DBKA 3L82A 4GMJA 3UI2A 3ASOE 3JUEA 1WM5A 2L6BA 1SA5A 1HFAA 4FA6A 4GTTA 3JCKC 1YYHA 4L1BA 4J8DA 2XS1A 4DJAA 2R2LA 4N3BA 1UG3A 4HXIA 3Q7FA 3EU5A 3Q73A 3IXEA 2WXQA 2P9SG 1S63A 1MHQA 2NSZA 3ZU7B 2DZNA 3J5QB 2XZDG 1NA0A 3BUAA 5FZQA 2Y69E 4ZHBA 5E75A 1N4SA 4MLPA 3HXEA 4A1SA 1Z6TA 2NXPA 5B1AE 4A63B 4GZCA 1V54E 2XGSA 4JVSA 3ZN3A 3RO2A 2QC9A 5BT1A 3LS8A 5HI7A 3S7FA 4EPZA 3S2AA 3MEKA 5ENTD 3EIQC 1IHBA 4EBAG 3R9MA 2WXKA 2LAIA 2FO7A 4WWNA 4XEIG 4HLLA 1TN7A 4FULA 4UWGA 3B7SA 4E6HA 4CEMA 4OAVB 3D9KA 1MZCA 4JHKA 4N2QA 2WQ6A 3ZYMA 3SFYA 4KZ0A 4MS6A 2P9PG 2XCCA 3T9KA 3CVQA 2YINA 4GCOA 2F0YA 1N4RA 3MKRA 2ETCA 2ZGDA 2KCVA 5ENOD 2VTBB 5ANLA 1N11A 4DI4A 1WDYA 5CECB 3OXLA 3NAWA 4AM9A 4ANUA 5CEDB 2AWIA 2X6FA 4WNFA 4BTBA 5LX8A 5AQ9A 3AG1E 3KEZA 3JXJA 2WM9A 4WNEA 4CGVA 2Y3AA 3CGHA 3ASGA 3CR3A 4M3OA 2QZAA 3RKVA 4KT6B 3DRAA 3KSQA 5EYPF 2I2OA 2ETBA 3VLDA 3Q47B 3CHQA 3RSEG 2RFAA 4RSYA 5DIZA 2LUHA 5C2YA 3JQ0A 5ENNA 4IYPA 4I1OB 2R02A 3PZ3A 1E90A 3D9JA 1W3BA 3TJPA 3TWVA 3BU8A 3CLJA 3PEUB 4TV3A 1NL4A 5ARGA 4AEZC 2P9LG 4G8KA 3I3NA 2I9CA 2XEVA 4CCAA 1Y6IA 3Q75A 3UINC 3UXGA 4JL0A 4YDOA 2GGFA 3FTSA 1O1TA 2GRMA 4HRMB 5ANRA 5AQBA 1H6OA 4HOTA 3LVRE 2AXZA 2IF4A 3QWWA 4CRWA 4JPSA 3FWVA 4I43A 2V5FA 4CDMA 1YCSB 1RZ4A 3FUKA 2CFZA 3B13A 3C3OA 2HYZA 1E8ZA 3CQGB 4B8AA 3CKCA 2VGXB 3TAXA 4AY6A 3SD5A 2ZISA 4BFRA 4FJZA 4EZKA 5CRUA 2UY1B 4G11A 4OVUA 5IY5E 1K1BA 4LUNU 3T5VA 3ESLA 3CVXA 2KZTB 3UX4A 2NYJA 4GTVA 3Q5MA 1OWLA 2GRPB 4GTRA 3LDZA 3FUIA 3SF4A 3ZYKA 3B7BA 3HXDA 4CZ2D 2X6HA 2QYUA 4UWKA 2V5QC 4NIKA 5CMWA 3V30A 2VSXE 1BU9A 3GW4A 3SZ7A 3TXNA 4FHJA 3T8MA 4A3TA 2PQRA 5G05J 3PE4A 3JUIA 4I6EA 1UW4B 3L08A 2QFCA 4TXQA 3CHRA 1E8YA 4LRZA 3EIJA 3UUXA 4U04A 3LEWA 4N5CA 3DSTA 4JA7A 3V31A 1TEZA 4NACA 5EIDA 4H7YA 4Y6CA 4RQIA 4W9RA 2F37A 1HG5A 3SQVA 3SNXA 1OY3D 3UT7A 2B0OE 3ISMC 2LXMA 3CKBA 3ABME 3HIZA 1MQSA 4A55A 5AYWD 3HXCA 4DX2A 3FHEA 4Q69A 3DSWA 4FLBA 3SFXA 1IXVA 2VSYA 2PQNA 3FUFA 2RKKA 3QWPA 3U4TA 4O60A 2FF4A 5JHBA 1H2UA 4Q94A 1EDUA 3CK7A 1TNUA 5BPPA 3PUKA 4HRLA 3SBTB 1UN9A 3F6QA 3LY8A 3HHMA 3MV3B 3U3WA 1UJKA 3MV2B 4KVMA 5LP0A 5CRVA 1H2TC 2YNQA 5ENPD 2C2LA 3D9OA 4XKCA 2L0IA 4G2VA 4LCTA 3L6AA 3I4GA 1P5QA 2WPVA 3P1UA 3DEPA 5FINA 3UT4A 2BKGA 3E32A 4I9CA 1KPSB 2J4DA 4MRUA 5FTPA 4K0RA 4F53A 4XIFA 1U3CA 1XNFA 5FIOA 1SA4A 2WMNA 3L9TA 4WNDA 2GRQB 2KM4A 2Y0BG 4TUMA 2AXUA 2HE0A 1QYMA 3PNLB 1TJCA 5EKQD 3FP3A 5BNWA 3FUMA 4PUCA 4TXPA 2RFMA 3FULA 3ZYQA 4GYWA 1OUVA 4JEUA 4BSXA 1EYHA 1TYQG 4AV7A 4FADA 4EHMA 4LNUD 4APOA 3LXUX 4XZ4A 1E7VA 3P2BA 4G26A 4GZ5A 3MZLB 5ENSD 3ASNE 3TWXA 4G24A 3AS4A 5EYLA 3G2SA 5FJYA 5ARFA 5AAOA 1DCQA 3FTWA 3JQ1A 2R59A 3FUHA 2OV8A 1H19A 5T4YA 2BF0X 4P29A 4BESA 2P9UG 5JJTA 4AOFA 4APFA 1BPOA 1ELRA 5H7PA 4B0ZA 1Z5SC 5D66A 4YDYA 1OCZE 2XS8A 4BERA 5A23A 3W9FA 4N5QA 3HG0D 3PNTB 2X38A 4FHKA 1HG2A 4I2ZA 3CVLA 1G3NB 5G2NA 4HLEA 3FFLA 3EHQA 5CHEE 2P58C 3PH0C 5KJKA 1KZOA 4UUCA 2XZTG 3GZ1A 4DX5D 3R9AB 1IYGA 1BLXB 2RD0A 4O6FA 3CHSA 4KZCA 3BQOA 2XENA 2J07A 2C0LA 3ZHEA 3IKOB 5BUZA 2X6KA 3I5PA 2IONA 2KATA 2H6FA 2F8XK 5CEAA 3MX3A 4GA1A 2KXPC 3L17A 4M7CA 4DX7D 3V79K 4Y6WA 4HVBA 2XCBA 2FULA 5LFAA 1A5EA 2VYIA 1QBQA 2FI7A 3FU0A 3MA5A 3SI5A 1KT0A 4GPMA 4GPKA 3D9IA 3PRZA 5M72A 2Y4UA 1TNBA 3LCAA 3Q9UC 3LYAA 5D2MC 2DYRE 1E96B 4BSZB 1ZU2A 3RRNB 3V2XA 3HXBA 1UN8A 3WXXA 5G55A 1PAQA 1INZA 5AQAA 3FU6A 1E7UA 1DVPA 3DXMG 4UQYA 4CDRA 4B94A 2EINE 3NF1A 2GW1A 1HE8A 2V4LA 1E8WA 3L22A 4F1SA 1SZ9A 4WAFA 5ENQD 3NZSA 5EILA 3SFZA 3UM1A 1JCRA 2WQ7A 3FU5A 5B1BE 3CHMA 3B7TA 3ZEFA 3TWWA 5LCWJ 4U8VD 4DX1A 3CIAA 4Z68A 4XX5A 4JW1A 4HI8A 2EIJE 4GAAA 3O48A 5FQ4A 3FH7A 3L13A 4I1MA 4DLQA 2H6GA 2WXFA 3E4BA 3QK0A 2CFUA 3IEGA 2F8YA 3MKQA 4J8FA 3DXKG 4DUIA 2EIME 1BI8B 4U63A 2R03A 3L16A 2Y1LE 2WXHA 1U2VG 2AJAA 4ILIA 4L2LA 4K5AB 1YA0A 1DNPA 3ABLE 2XEEA 4BX9A 3G2UA 2BEDA 3AU4A 4NRHB 5JJ6A 1O1RA 2GRNB 2MRIA 3OXFA 3DEOA 3APCA 3UPVA 3APFA 4LERA 1MYOA 4ANXA 2VGEA 3ZYLA 3E37A 5D0OD 4GZ6A 1HS6A 2BUGA 1Z3YA 1N54A 4GTMA 1JCSA 2DYSE 3O4ZA 4JXTA 3ENEA 3FY4A 4GB9A 4UI9J 3BEEA 1E8XA 2DZOA 4X8QA 1IKND 3RRUA 2ZXWE 2A5UA 2I1KA 4U95D 1KT1A 2GRRB 2WXGA 3FH8A 3C3QA 2LO6A 4ATGA 1N4PA 2WXLA 3LJNA 4GCNA 2XPZA 5BXOA 3ZVVA 3UTMA 3D9MA 3EJNA 1ZBPA 4EECA 4RG9A 5BV0A 4K03A 1QNFA 4GA0A 3CK9A 3B7RL 4JHRA 2GRLA 4ME2A 5HQ8A 2IOLA 5KNGA 3G2TA 1IQRA 1LTXA 3GZ2A 3BG1B 2CHWA 3FTVA 5EIBE 1HO8A 2LSVA 3ZNGA 2ONDA 5HRYA 3C98A 1XGWA 5CBNA 3QWVA 5KJMA 3TWTA 5D0QD 4KYOB 2WXJA 3X2QE 3SHFA 2A5EA 3CQCB 3MCXA 3AG2E 4OVVA 2JABA 4AJWA 2MOWA 4EQFA 3AJIA 1TR4A 4F3VA 5FWQA 4J8YA 4URKA 4N3CA 1SQMA 2KC7A 2IY0C 3FH5A 2C0MA 1MX2A 2PZIA 5CERB 3JXIA 1KLXA 3R7RA 4QFVA 1NZNA 2IJGX 4J6IA 3PZ2A 5AARA 2HO1A 3ZXSA 4UWLA 2PL2A 5CCMA 5LCWC 4XI9A 3ZIMA 5BW8C 4AP2A 2FO1E 4U0ZA 2E2EA 3E34A 4BX8A 4GTQA 4RVBA 3VLEA 3MYVA 1N52A 4DRXE 3FU3A 3DSVA 2XRZA 2L6JA 1GW6A 3CVVA 2X6JA 2B6CA 3C5RA 1N4QA 3NB2A 3CSTA 4LNGA 4PS7A 4UI9K 2EQXA 3CVNA
chains in the Genus database with same CATH topology
2UWJG 2KCVA 4I6JA 2VTBB 4GZDA 5ANLA 3PNTB 2LAHA 3UQ3A 3QKYA 2X38A 3URZA 4DI4A 1IQUA 2PM7A 3ZFWA 4YVOA 1ELWA 3LY9A 4FHKA 2WXPA 3ASFA 3OXLA 1HG2A 4I2ZA 2WMOA 3Q49B 3CVLA 4YNDA 4AM9A 4ANUA 1FVHA 2L9BA 5G2NA 5T3RA 4XI0A 2LSUA 4HLEA 3ZW3A 2AWIA 2X6FA 3FFLA 3FEYA 5CHEE 3RJVA 1JWGA 2P58C 3PH0C 4WWPA 4WNFA 4BTBA 5LX8A 2J49A 5KJKA 2YHEA 4GU5A 3HVEA 5JJ7A 3GZ1A 3R9AB 1IYGA 2WXIA 3KEZA 4WWOA 2RD0A 2XGMA 2WM9A 4O6FA 3S7BA 2RG8A 4WNEA 3BG0B 2ZU6B 4CGVA 3CHSA 4KZCA 2Y3AA 2JEKA 4KBQA 2J07A 3CGHA 2C0LA 3EHMA 3ASGA 3ZHEA 3CR3A 4YVQC 3IKOB 4M3OA 4JHJA 5BUZA 1X5BA 2KCLA 2X6KA 2VTBA 3I5PA 4GZ3A 4KT6B 3RKVA 2IONA 2A4ZA 2I1JA 2KATA 1IHGA 3ONLA 3CHOA 2I2OA 1OWOA 5KCMA 3VLDA 4AXHA 1EF1C 3TGOA 4UQZA 5AIJA 1JPLA 4LEUA 3MX3A 4AIFA 3Q47B 4GA1A 3CHQA 4FC8A 2IFUA 2PM6A 4BWRA 2XPYA 3L17A 4RSYA 4H7XA 5DIZA 3CSFA 3CHPA 2IQCA 5C2YA 3RRMB 4Y6WA 3PZDA 3TG4A 4HVBA 2XCBA 3JQ0A 3NQPA 5ENNA 2FULA 4C0EA 5LFAA 2R5SA 4IYPA 5FQ8A 2VYIA 3N71A 2AXVA 1ELKA 2FI7A 3HDXA 3QC1A 4I6GA 3FU0A 4D10C 3MA5A 4I1OB 5FQ6A 2AVPA 5LOZA 3SI5A 1KT0A 2KZTA 3AU5A 3FTXA 2WXRA 3D9IA 4U0UA 5JHAA 4GPKA 3PRZA 4J8EA 5M72A 2LNIA 2Y4UA 1E90A 1JUQA 3D9JA 3PDNA 3QDNA 1W3BA 4UI9C 3IV0A 3LCAA 3QJZA 3TJPA 3CLJA 3Q4AB 3PEUB 4TV3A 2ILRA 3LYAA 3Q15A 1E96B 1ZU2A 3ML8A 1QZ2A 3RRNB 5ARGA 3U9WA 4AEZC 3I3NA 2I9CA 2XEVA 2Y4TA 4CCAA 1Y6IA 3PUJA 2XHEA 4C0MA 2M63A 3U66A 4JC8A 1UN8A 4JL0A 5EX0A 4IN3B 3WXXA 2GGFA 3FTSA 5G55A 1PAQA 2GRMA 1FVFA 5CCLA 1INZA 1H6KA 5ANRA 1LF8A 3FU6A 3CVUA 1E7UA 1DVPA 2V8SE 2XPIA 4UQYA 4CDRA 3CK8A 4GYOA 4B94A 4C9BB 3NF1A 4CT4A 4WUYA 2CHZA 3LVRE 4HOTA 2GW1A 2AXZA 2IF4A 3U64A 3QWWA 3G2WA 4CRWA 2FEZA 5KJNA 1HE8A 4JPSA 1WY6A 3FWVA 4TRQA 2V4LA 4I43A 1E8WA 2V5FA 3L22A 4CDMA 3CVWA 4F1SA 1SZ9A 4WAFA 1VDYA 3MKQB 4XKBA 2FBNA 3ZHEB 1EPUA 3FUKA 3NZSA 4N3AA 2CFZA 3B13A 3SFZA 2HYZA 4MKTA 1E8ZA 5A6CA 3CQGB 3B7UX 2WXNA 3FUNA 4B8AA 3FTUA 2J09A 4GYYA 4I17A 4J8SA 3CKCA 2VGXB 3TAXA 4HOSA 4AY6A 2WQ7A 3FU5A 5C1DA 4KMOA 3SD5A 3CHMA 3B7TA 3ZEFA 5AENA 1H0AA 4BY6A 4BFRA 2BTDA 4ILGA 4ANWA 5LCWJ 3PEVB 3CIAA 4FJZA 4XX5A 4EZKA 4JW1A 3VTYA 2UY1B 4RG6A 4G11A 5KJLA 4OVUA 4LUNU 3UT8A 3T5VA 4GAAA 3ESKA 2DIWA 3ESLA 3O48A 5FQ4A 3CVXA 3D9LA 2KZTB 3PVLA 3UX4A 2VSNA 3FH7A 1HF8A 2X6IA 3L13A 3GZSA 4I1MA 3Q5MA 3RK6A 4DLQA 1OWLA 2WXFA 3E4BA 1PC2A 2X3MA 3LDZA 3SGHA 3FUIA 3QK0A 3SF4A 5FQ7A 1Y8MA 3ZYKA 1PY1A 2CFUA 3IEGA 4L2YA 2CG3A 1SZAA 3ONKA 3TG5A 3MKQA 4J8FA 2X6HA 3ASHA 1WAO1 4Q96A 4UWKA 4A1GA 4FJYA 2NC9A 2CG2A 5CMWA 2VGXA 2VSXE 4JEHA 4BTAA 4U63A 3GW4A 3L16A 3SZ7A 3TXNA 4FHJA 3L54A 4ABNA 2YHCA 2QY7A 2WQHA 4G23A 2YQ8A 3IHYA 5FZSA 3T8MA 4A3TA 2PQRA 5G05J 4HS2A 1H2VC 2WXMA 3PE4A 2UY1A 2WXHA 3JUIA 5CMYA 5G04J 3EDTB 3KD7A 4I6EA 4ILIA 4L2LA 1UW4B 1YA0A 3L08A 2QFCA 2MHKA 3FDHA 3RU0A 1DNPA 4BX9A 2HM8A 1E8YA 3CHRA 4LRZA 3G2UA 3EIJA 3UUXA 4I9EA 5EX3A 4HORA 4DLOA 4U04A 3LEWA 4DI3A 4N5CA 3AU4A 2IU1A 4ACLA 3LJ3A 4JA7A 1TEZA 4NRHB 5JJ6A 2WB2A 4NACA 3LY7A 3PS6A 4E85A 4H7YA 4Y6CA 3RIBA 4CT0A 4W9RA 3RO3A 2DCPA 2MRIA 3KS2A 2AW6A 3OXFA 1HG5A 4KVOA 4NQ0A 4UWFA 3APCA 3SNXA 3UPVA 4U8HA 3APFA 4LERA 3UT7A 4AVXA 4ANXA 3ASDA 5J90A 4N2SA 3ZGQA 3CKBA 3SBSA 3HIZA 4FU3A 3ZYLA 1MQSA 5T8IA 3D9NA 3FUJA 2L0TB 3FUEA 5D0OD 4GZ6A 2CHXA 3FEXA 4HFGA 5AYWD 4A55A 1HS6A 2BUGA 1Z3YA 3FUDA 1N54A 4L7TA 3HYMB 4IULA 3K9IA 3G2VA 1OWNA 5E76A 4AY5A 3O4ZA 4JXTA 1OWMA 3FHEA 3ENEA 4Q69A 3FY4A 4N39A 4EBAA 4FLBA 4GB9A 4L23A 2XQ0A 4BT9A 4UI9J 2VSYA 3BEEA 2PQNA 3KAEA 3FUFA 4PDXA 2Q7FA 4FLHA 1E8XA 1OWPA 4GMLA 3QWPA 4J0UA 3QOUA 3U4TA 3JYSA 4G25A 2FF4A 2WVIA 3RRUA 1S0PA 3MGBA 5JHBA 2A5UA 2I1KA 1KT1A 1H2UA 3QNKA 4Q94A 1EDUA 4GA2A 2KCKA 1QQEA 2WXGA 3FH8A 3CK7A 1UJJA 3ULQA 4U07A 4UWHA 5AJDA 2LO6A 4ATGA 3FTYA 2WXLA 4A3VA 5BPPA 4EZLA 4GCNA 1NA3A 2XPZA 3PUKA 3ZVVA 1Z3XA 3D9MA 3SBTB 3EJNA 1UN9A 2J08A 2WXOA 4TUUA 2VGYA 3ML9A 3ZRHA 4DPRA 1ZBPA 3LY8A 4DK5A 4EECA 4UQXA 3HHMA 3MV3B 4IRUA 4RG9A 3U3WA 1UJKA 5BV0A 3MV2B 3D3MA 4KXKB 2XGOA 1B89A 3QB2A 4JA9A 4KVMA 3T5XA 3TXMA 4F7AA 5BV1A 4K03A 3AS8A 5LP0A 4NURA 3UMVA 1QNFA 3PREA 3CK9A 2E0IA 1H2TC 3QAQA 4GA0A 2YNQA 3B7RL 5FZRA 4FP7A 4JHRA 2GRLA 2VQ2A 4ME2A 3DPDA 3OTNA 4XE0A 1FCHA 2C2LA 4PH4B 5HQ8A 3D9OA 2DBAA 4XKCA 2IOLA 3S7JA 2JLBA 2L0IA 1NP7A 4G2VA 1TJFA 4LCTA 5G05C 3DBSA 3D9PA 5G04C 4CGWA 3G2TA 3I4GA 3L6AA 1IQRA 1P5QA 2WPVA 2J9QA 3GZ2A 3LPZA 3PE3A 3BG1B 3P1UA 5DBKA 4CDNA 4GMJA 2CHWA 3FTVA 3UT4A 3VLFA 1HO8A 3NZUA 4I9CA 2LSVA 2J4DA 1HX8A 1WM5A 2IOSA 2OOEA 2ONDA 4MRUA 1HFAA 1JWFA 1L5JA 3C98A 4FA6A 1XGWA 5FTPA 4B8CB 3JCKC 3I4RB 4K0RA 3QWVA 4F53A 5KJMA 2OVFA 4XIFA 1U3CA 1XNFA 4L1BA 5D0QD 4J8DA 2WMNA 3CV0A 3EHNA 4KYOB 2WXJA 4WNDA 3SHFA 1HU3A 2HR2A 2KM4A 3CQCB 3MCXA 2J4BA 4DJAA 4WNGA 4N3BA 1UG3A 4G1TA 4HXIA 4R7LA 3ZPJA 2AXUA 4OVVA 4AJWA 2WXQA 2MOWA 3MJWA 3PNLB 4PS8A 4EQFA 1MHQA 2NSZA 3VTXA 4U0SA 4EZJA 2XRYA 1TJCA 5EKQD 3FP3A 5BNWA 3FUMA 4PUCA 3FTZA 5A7DB 4F3VA 2V0PA 5FWQA 3FULA 1NA0A 3QARA 5FZQA 3ZYQA 4GYWA 3AS5A 5E75A 1OUVA 4URKA 4JEUA 4N3CA 3S7DA 1SQMA 4MLPA 1EYHA 2KC7A 4A1SA 1Z6TA 3TL5A 4ANVA 2NXPA 5FT9A 4AV7A 3CVYA 4HOQA 3FH5A 2C0MA 4FADA 3APDA 4GZCA 3CEQA 1HXIA 2PZIA 4B89A 4BT8A 4APOA 2XGSA 4JVSA 3LXUX 4XZ4A 3ZN3A 3RO2A 5BT1A 1E7VA 1KLXA 3R7RA 4QFVA 3LS8A 5HI7A 3P2BA 3S7FA 4EPZA 1NZNA 4G26A 2VJ8A 3S2AA 2IJGX 4GZ5A 4J6IA 3MEKA 2HO1A 3GYZA 3EIQC 3MZLB 4BSXA 2OVBA 4I1AA 4UWLA 2PL2A 3ZXSA 1A17A 1HZ4A 4V3IA 4EBAG 4G24A 4JZYA 5CCMA 3AS4A 2WXKA 1U3DA 5AJLA 3CVPA 2LAIA 3G2SA 2FO7A 4ILHB 4WWNA 5LCWC 5FJYA 4XI9A 3OAWA 5ARFA 4FULA 3ZIMA 4UWGA 5BW8C 4AP2A 3B7SA 4PS3A 4E6HA 4CEMA 4U0ZA 2R17C 3FTWA 3JQ1A 2R59A 3FUHA 2E2EA 2OV8A 3D9KA 4BX8A 5EDSA 4RVBA 3HVEB 4OYSA 3VLEA 3MYVA 5J08A 1H19A 5T4YA 2BF0X 4JHKA 4N2QA 1HH8A 1N52A 4P29A 4ACKA 2WQ6A 3R7QA 3FU3A 3ZYMA 4KZ0A 4MS6A 5JJTA 4AOFA 2XRZA 2XCCA 2L6JA 1GW6A 1BPOA 4APFA 3CVVA 1ELRA 2X6JA 3IHVA 4I2WA 3CVQA 2YINA 3IBEA 3LKUA 4B0ZA 3OXGA 2VSOE 4HOUA 2I6HA 3CSTA 4PS7A 4UI9K 4GCOA 2EQXA 3MKRA 5A23A 3LVQE 3CVNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWJ G;  2KCV A;  3UQ3 A;  3QKY A;  3URZ A;  3ZFW A;  4YVO A;  1ELW A;  3LY9 A;  3ASF A;  3OXL A;  4I2Z A;  3Q49 B;  3CVL A;  4YND A;  4AM9 A;  4XI0 A;  2LSU A;  3FFL A;  5CHE E;  3RJV A;  2P58 C;  4WNF A;  4BTB A;  5KJK A;  5JJ7 A;  3GZ1 A;  3R9A B;  1IYG A;  2XGM A;  4O6F A;  3S7B A;  4WNE A;  4CGV A;  4KBQ A;  2C0L A;  3ASG A;  3ZHE A;  4YVQ C;  2KCL A;  4GZ3 A;  3RKV A;  2KAT A;  1IHG A;  3TGO A;  4UQZ A;  4LEU A;  4AIF A;  3Q47 B;  4GA1 A;  2IFU A;  4BWR A;  4H7X A;  5DIZ A;  3TG4 A;  4Y6W A;  2XCB A;  2R5S A;  2VYI A;  3N71 A;  2FI7 A;  3MA5 A;  2AVP A;  1KT0 A;  4GPK A;  4U0U A;  4J8E A;  5M72 A;  2LNI A;  2Y4U A;  3PDN A;  3QDN A;  1W3B A;  4UI9 C;  3LCA A;  3Q4A B;  3LYA A;  3Q15 A;  1E96 B;  1ZU2 A;  1QZ2 A;  5ARG A;  2XEV A;  2Y4T A;  4JL0 A;  5EX0 A;  4IN3 B;  3WXX A;  5CCL A;  2XPI A;  4UQY A;  4CDR A;  3CK8 A;  4GYO A;  4B94 A;  3NF1 A;  4WUY A;  4HOT A;  2GW1 A;  2IF4 A;  3QWW A;  2FEZ A;  5KJN A;  3FWV A;  2V5F A;  2FBN A;  3ZHE B;  4N3A A;  2HYZ A;  5A6C A;  4I17 A;  4GYY A;  3CKC A;  2VGX B;  3TAX A;  4HOS A;  4AY6 A;  5C1D A;  5LCW J;  3VTY A;  2UY1 B;  4RG6 A;  5KJL A;  3ESK A;  3O48 A;  2VSN A;  3Q5M A;  3E4B A;  1PC2 A;  3SF4 A;  1Y8M A;  3TG5 A;  3IEG A;  4J8F A;  3ASH A;  1WAO 1;  2NC9 A;  2VGX A;  4BTA A;  3GW4 A;  3SZ7 A;  4ABN A;  2YHC A;  2WQH A;  4G23 A;  2YQ8 A;  5FZS A;  2PQR A;  5G05 J;  3PE4 A;  5G04 J;  2UY1 A;  3EDT B;  3KD7 A;  1YA0 A;  2QFC A;  2MHK A;  3RU0 A;  3UUX A;  4I9E A;  5EX3 A;  4HOR A;  4U04 A;  4N5C A;  4JA7 A;  4NRH B;  5JJ6 A;  3LY7 A;  4H7Y A;  4Y6C A;  3RIB A;  4W9R A;  3RO3 A;  3KS2 A;  3OXF A;  4NQ0 A;  3UPV A;  3ASD A;  4N2S A;  3ZGQ A;  3CKB A;  5D0O D;  4GZ6 A;  5AYW D;  2BUG A;  3HYM B;  3K9I A;  4AY5 A;  4N39 A;  4BT9 A;  4UI9 J;  2VSY A;  3BEE A;  2PQN A;  3KAE A;  2Q7F A;  4J0U A;  3QWP A;  3QOU A;  3U4T A;  3JYS A;  4G25 A;  2FF4 A;  1KT1 A;  4GA2 A;  2KCK A;  1QQE A;  3CK7 A;  3ULQ A;  4U07 A;  4GCN A;  1NA3 A;  2VGY A;  1ZBP A;  3LY8 A;  4UQX A;  3MV3 B;  4RG9 A;  3U3W A;  3MV2 B;  4KXK B;  2XGO A;  1B89 A;  4JA9 A;  3AS8 A;  4GA0 A;  3CK9 A;  5FZR A;  4JHR A;  2VQ2 A;  4ME2 A;  1FCH A;  2C2L A;  5HQ8 A;  2DBA A;  3S7J A;  2JLB A;  4G2V A;  5G05 C;  4CGW A;  5G04 C;  1P5Q A;  2WPV A;  2J9Q A;  3GZ2 A;  3LPZ A;  3PE3 A;  5DBK A;  4I9C A;  2LSV A;  1WM5 A;  2OND A;  2OOE A;  5FTP A;  3QWV A;  5KJM A;  4XIF A;  1XNF A;  5D0Q D;  4J8D A;  3CV0 A;  4KYO B;  4WND A;  2HR2 A;  4WNG A;  4N3B A;  4G1T A;  3ZPJ A;  4EQF A;  3VTX A;  4U0S A;  1TJC A;  5EKQ D;  3FP3 A;  5BNW A;  5A7D B;  4F3V A;  1NA0 A;  5FZQ A;  4GYW A;  3AS5 A;  1OUV A;  3S7D A;  4N3C A;  2KC7 A;  4A1S A;  5FT9 A;  4HOQ A;  2C0M A;  3CEQ A;  1HXI A;  2PZI A;  4BT8 A;  4APO A;  2XGS A;  3ZN3 A;  3RO2 A;  5BT1 A;  1KLX A;  5HI7 A;  3S7F A;  1NZN A;  4G26 A;  4GZ5 A;  3MEK A;  2HO1 A;  3GYZ A;  4I1A A;  2PL2 A;  1A17 A;  1HZ4 A;  4G24 A;  5CCM A;  3AS4 A;  3CVP A;  2FO7 A;  5LCW C;  5FJY A;  4XI9 A;  5ARF A;  5BW8 C;  4U0Z A;  2E2E A;  4N2Q A;  1HH8 A;  5JJT A;  2XCC A;  2L6J A;  1ELR A;  4I2W A;  3CVQ A;  3LKU A;  3OXG A;  4HOU A;  2I6H A;  4UI9 K;  4GCO A;  3MKR A;  3CVN A; 
#chains in the Genus database with same CATH topology
 2UWJ G;  2LAH A;  4HBD A;  3UQ3 A;  3QKY A;  3URZ A;  1IQU A;  3HRA A;  3ZFW A;  1ELW A;  3LY9 A;  2WXP A;  4J7W A;  3ASF A;  3Q49 B;  4YND A;  1RW2 A;  1D9S A;  4XI0 A;  2LSU A;  2XEH A;  3ZW3 A;  1MX6 A;  2J8S D;  3RJV A;  1N95 A;  4WWP A;  1K1A A;  3HVE A;  5JJ7 A;  3V2O A;  4WWO A;  4GTO A;  4K5B A;  3S7B A;  3BG0 B;  4KBQ A;  4JHJ A;  1X5B A;  4GZ3 A;  2A4Z A;  2I1J A;  1IHG A;  3ONL A;  5KCM A;  1OWO A;  4AXH A;  1UOH A;  2OEW A;  5JMN D;  3TWS A;  3SY2 A;  1JPL A;  4LEU A;  4AIF A;  1S64 A;  1YMP A;  4BWR A;  3T8K A;  2XPY A;  3UKR G;  2DWZ A;  3PZD A;  5FQ8 A;  4I6G A;  3HDX A;  5FQ6 A;  2KZT A;  5JHA A;  2WXR A;  3HXF A;  2LNI A;  4F1P A;  1O1S A;  3QDN A;  5ITZ F;  4UI9 C;  3QJZ A;  3U9W A;  1MX4 A;  2R05 A;  2XHE A;  1OCC E;  2M63 A;  5EX0 A;  4IN3 B;  5CCL A;  1LF8 A;  2XPI A;  4GYO A;  4WUY A;  2CHZ A;  3U64 A;  2ZIR A;  1TNZ A;  5KJN A;  1WY6 A;  1Q2Z A;  4C48 B;  5AN8 A;  3MKQ B;  2FBN A;  5JA4 D;  4HRN A;  3KSL A;  1MJ0 A;  1NI1 A;  3B7U X;  3FUN A;  4YDE A;  2J09 A;  4GYY A;  4J8S A;  4HOS A;  4KMO A;  2IO2 C;  1DC2 A;  4BY6 A;  2BTD A;  4ILG A;  4ANW A;  3PEV B;  2IEJ A;  4RG6 A;  3UT8 A;  3ESK A;  2DIW A;  4LG6 A;  2VSN A;  1HF8 A;  2X6I A;  3GZS A;  1PC2 A;  2X3M A;  3SGH A;  4O1P A;  1PY1 A;  3B95 A;  4L2Y A;  2CG3 A;  1SZA A;  3ONK A;  3ASH A;  2LXL A;  1WAO 1;  4A1G A;  4FJY A;  2NC9 A;  1N94 A;  4K5C A;  4BTA A;  3L54 A;  4ABN A;  2QY7 A;  5FZS A;  4HS2 A;  3DPY A;  3UM0 A;  2MHK A;  3RU0 A;  2HM8 A;  4I9E A;  5EX3 A;  4HOR A;  4DI3 A;  2IU1 A;  4ACL A;  3RIB A;  4CT0 A;  4NQ0 A;  4UWF A;  1D8E A;  4U8H A;  1X81 A;  4AVX A;  1OXJ A;  3ASD A;  3ZGQ A;  3SBS A;  5T8I A;  3FUJ A;  3FUE A;  3FEX A;  3J5P A;  3HYM B;  4IUL A;  3K9I A;  3G2V A;  1OWN A;  4AY5 A;  1N9A A;  1OWM A;  2P9K G;  4N39 A;  5B3S E;  4EBA A;  2H6I A;  4BT9 A;  3KAE A;  3EU9 A;  4J0U A;  3QOU A;  3AAA C;  4G25 A;  3QNK A;  5EN5 D;  4GA2 A;  1QQE A;  2BKK B;  2QYJ A;  4U07 A;  5AJD A;  1FT1 A;  4A3V A;  4EZL A;  1NA3 A;  4MBG A;  4F6R D;  1Z3X A;  2WXO A;  4TUU A;  2VGY A;  3ZUV B;  3UKU G;  4HNA D;  4F7A A;  1B89 A;  5BV1 A;  3T5X A;  2E0I A;  5FZR A;  2VQ2 A;  3OTN A;  4XE0 A;  1FCH A;  4PH4 B;  3S7J A;  1NP7 A;  3ULE G;  3DBS A;  3D9P A;  5G04 C;  5ENR D;  3PE3 A;  4CDN A;  3VLF A;  3NOC D;  3NZU A;  1HX8 A;  2IOS A;  2OOE A;  1JWF A;  1L5J A;  1TNY A;  3I4R B;  2OVF A;  4B93 B;  5CBO A;  1O5M A;  3CV0 A;  3EHN A;  1BD8 A;  2EIL E;  1HU3 A;  2HR2 A;  3E30 A;  2J4B A;  3D9H A;  4WNG A;  4G1T A;  4R7L A;  4QQI A;  3ZPJ A;  3MJW A;  4TXR A;  4PS8 A;  3VTX A;  5HS0 A;  4U0S A;  4EZJ A;  2XRY A;  3FTZ A;  5A7D B;  2V0P A;  4BET A;  2OCC E;  3QAR A;  4YDW A;  3AS5 A;  4HB5 A;  4G8L A;  3S7D A;  4ANV A;  3CVY A;  3TL5 A;  5FT9 A;  4HOQ A;  3APD A;  3CEQ A;  1HXI A;  3DWL G;  4B89 A;  1SVX A;  4BT8 A;  5KWD A;  2KBX A;  4BEP A;  2VJ8 A;  2H6H A;  3GYZ A;  2OVB A;  4I1A A;  1WG0 A;  1A17 A;  1HZ4 A;  4V3I A;  4JZY A;  5AJL A;  1U3D A;  1LD8 A;  3CVP A;  4ILH B;  2ETA A;  3OAW A;  3C72 A;  4GTP A;  3C3R A;  4PS3 A;  2R17 C;  5EDS A;  3HVE B;  1D8D A;  4OYS A;  5J08 A;  1HH8 A;  4ACK A;  3R7Q A;  3IHV A;  4I2W A;  3IBE A;  3LKU A;  3OXG A;  2VSO E;  4HOU A;  2I6H A;  1K3Z D;  3LVQ E;  4B8C B;  4LSZ E;  4I6J A;  4GZD A;  3Q78 A;  2PM7 A;  4YVO A;  2WMO A;  2IO3 C;  1FVH A;  1DCE A;  2L9B A;  5T3R A;  3DSU A;  5HKP A;  3FEY A;  1V55 E;  1JWG A;  2J49 A;  2YHE A;  4GU5 A;  2WXI A;  4ATZ D;  2XGM A;  2RG8 A;  5KNH D;  2ZU6 B;  2DVW A;  2JEK A;  2EIK E;  3EHM A;  4YVQ C;  2KCL A;  3W9G A;  2VTB A;  1AWC B;  3AG3 E;  3PZ1 A;  3CHO A;  3EUV A;  1KZP A;  1EF1 C;  3TGO A;  4UQZ A;  5AIJ A;  4FC8 A;  2IFU A;  2PM6 A;  1NFI E;  4H7X A;  3CSF A;  3CHP A;  2IQC A;  3RRM B;  3TG4 A;  5BXU A;  3AG4 E;  3NQP A;  4C0E A;  2R5S A;  4JB8 P;  2V4H C;  3N71 A;  2AXV A;  1ELK A;  3QC1 A;  4D10 C;  2AVP A;  5LOZ A;  3AU5 A;  3FTX A;  4U0U A;  4J8E A;  1H6P A;  1JUQ A;  3UIO C;  3PDN A;  2OEV A;  1TN8 A;  2P9N G;  3IV0 A;  5KBA A;  3Q4A B;  2ILR A;  3NBN B;  3Q15 A;  3ML8 A;  1QZ2 A;  2Y4T A;  3PUJ A;  4CYM D;  4C0M A;  3EHR A;  4LNB A;  3U66 A;  4JC8 A;  4GMR A;  3Q9N C;  1FVF A;  1H6K A;  3TWU A;  3CVU A;  2V8S E;  1TN6 A;  1OCR E;  3CK8 A;  4C9B B;  4HQD A;  1TNO A;  4CT4 A;  4GTS A;  3ABK E;  3G2W A;  2FEZ A;  4TRQ A;  3CVW A;  1VDY A;  4XKB A;  1N0Q A;  2ZGG A;  3ZHE B;  1EPU A;  4N3A A;  4JD2 G;  1ZB1 A;  3Q79 A;  4MKT A;  5A6C A;  2WXN A;  3FTU A;  4I17 A;  5C1D A;  3E33 A;  5AEN A;  1H0A A;  3VTY A;  5KJL A;  1JCQ A;  2PNN A;  3D9L A;  3PVL A;  3RK6 A;  3ULY A;  5FQ7 A;  1Y8M A;  1FPP A;  4HI9 A;  3TG5 A;  4Q96 A;  3ZKJ A;  3DSS A;  2CG2 A;  1FT2 A;  2VGX A;  4JEH A;  4U7E B;  2YHC A;  2WQH A;  4G23 A;  2YQ8 A;  3IHY A;  1H2V C;  2WXM A;  5CMY A;  2UY1 A;  5G04 J;  3Q7A A;  3EDT B;  3KD7 A;  3FDH A;  3UIP C;  4DLO A;  3LJ3 A;  3TWR A;  2WB2 A;  1OCO E;  3LY7 A;  3PS6 A;  3SO8 A;  4E85 A;  3ZXP A;  3RAU A;  3RO3 A;  2DCP A;  3KS2 A;  2AW6 A;  4KVO A;  1S70 B;  4U96 D;  3TWQ A;  4O1O A;  3UM2 A;  5J90 A;  4N2S A;  4FU3 A;  3D9N A;  2L0T B;  2GRO B;  4RLY A;  4HFG A;  2CHX A;  3FUD A;  4L7T A;  5E76 A;  4L9P A;  4OAU C;  1K8K G;  4L23 A;  2XQ0 A;  4DX6 D;  4PDX A;  2Q7F A;  4FLH A;  4GML A;  1OWP A;  3JYS A;  2WVI A;  1OT8 A;  1S0P A;  3MGB A;  1N0R A;  1LD7 A;  2KCK A;  1UJJ A;  3ULQ A;  4UWH A;  3FTY A;  1AP7 A;  4ZFH A;  2J08 A;  3ML9 A;  3ZRH A;  4DPR A;  4DK5 A;  2MYO A;  4UQX A;  4IRU A;  3D3M A;  4KXK B;  2XGO A;  3QB2 A;  4JA9 A;  3TXM A;  3UM3 A;  3WG7 E;  3AS8 A;  4NUR A;  3UMV A;  3PRE A;  3QAQ A;  2P9I G;  4FP7 A;  3NOG D;  3DPD A;  3KEA A;  5AQ7 A;  2DBA A;  1SW6 A;  2JLB A;  4U8Y D;  5G05 C;  1TJF A;  4CGW A;  3DSX A;  3PZ4 A;  1BI7 B;  2P2C P;  2J9Q A;  3LPZ A;  5DBK A;  3L82 A;  4GMJ A;  3UI2 A;  3ASO E;  3JUE A;  1WM5 A;  2L6B A;  1SA5 A;  1HFA A;  4FA6 A;  4GTT A;  3JCK C;  1YYH A;  4L1B A;  4J8D A;  2XS1 A;  4DJA A;  2R2L A;  4N3B A;  1UG3 A;  4HXI A;  3Q7F A;  3EU5 A;  3Q73 A;  3IXE A;  2WXQ A;  2P9S G;  1S63 A;  1MHQ A;  2NSZ A;  3ZU7 B;  2DZN A;  3J5Q B;  2XZD G;  1NA0 A;  3BUA A;  5FZQ A;  2Y69 E;  4ZHB A;  5E75 A;  1N4S A;  4MLP A;  3HXE A;  4A1S A;  1Z6T A;  2NXP A;  5B1A E;  4A63 B;  4GZC A;  1V54 E;  2XGS A;  4JVS A;  3ZN3 A;  3RO2 A;  2QC9 A;  5BT1 A;  3LS8 A;  5HI7 A;  3S7F A;  4EPZ A;  3S2A A;  3MEK A;  5ENT D;  3EIQ C;  1IHB A;  4EBA G;  3R9M A;  2WXK A;  2LAI A;  2FO7 A;  4WWN A;  4XEI G;  4HLL A;  1TN7 A;  4FUL A;  4UWG A;  3B7S A;  4E6H A;  4CEM A;  4OAV B;  3D9K A;  1MZC A;  4JHK A;  4N2Q A;  2WQ6 A;  3ZYM A;  3SFY A;  4KZ0 A;  4MS6 A;  2P9P G;  2XCC A;  3T9K A;  3CVQ A;  2YIN A;  4GCO A;  2F0Y A;  1N4R A;  3MKR A;  2ETC A;  2ZGD A;  2KCV A;  5ENO D;  2VTB B;  5ANL A;  1N11 A;  4DI4 A;  1WDY A;  5CEC B;  3OXL A;  3NAW A;  4AM9 A;  4ANU A;  5CED B;  2AWI A;  2X6F A;  4WNF A;  4BTB A;  5LX8 A;  5AQ9 A;  3AG1 E;  3KEZ A;  3JXJ A;  2WM9 A;  4WNE A;  4CGV A;  2Y3A A;  3CGH A;  3ASG A;  3CR3 A;  4M3O A;  2QZA A;  3RKV A;  4KT6 B;  3DRA A;  3KSQ A;  5EYP F;  2I2O A;  2ETB A;  3VLD A;  3Q47 B;  3CHQ A;  3RSE G;  2RFA A;  4RSY A;  5DIZ A;  2LUH A;  5C2Y A;  3JQ0 A;  5ENN A;  4IYP A;  4I1O B;  2R02 A;  3PZ3 A;  1E90 A;  3D9J A;  1W3B A;  3TJP A;  3TWV A;  3BU8 A;  3CLJ A;  3PEU B;  4TV3 A;  1NL4 A;  5ARG A;  4AEZ C;  2P9L G;  4G8K A;  3I3N A;  2I9C A;  2XEV A;  4CCA A;  1Y6I A;  3Q75 A;  3UIN C;  3UXG A;  4JL0 A;  4YDO A;  2GGF A;  3FTS A;  1O1T A;  2GRM A;  4HRM B;  5ANR A;  5AQB A;  1H6O A;  4HOT A;  3LVR E;  2AXZ A;  2IF4 A;  3QWW A;  4CRW A;  4JPS A;  3FWV A;  4I43 A;  2V5F A;  4CDM A;  1YCS B;  1RZ4 A;  3FUK A;  2CFZ A;  3B13 A;  3C3O A;  2HYZ A;  1E8Z A;  3CQG B;  4B8A A;  3CKC A;  2VGX B;  3TAX A;  4AY6 A;  3SD5 A;  2ZIS A;  4BFR A;  4FJZ A;  4EZK A;  5CRU A;  2UY1 B;  4G11 A;  4OVU A;  5IY5 E;  1K1B A;  4LUN U;  3T5V A;  3ESL A;  3CVX A;  2KZT B;  3UX4 A;  2NYJ A;  4GTV A;  3Q5M A;  1OWL A;  2GRP B;  4GTR A;  3LDZ A;  3FUI A;  3SF4 A;  3ZYK A;  3B7B A;  3HXD A;  4CZ2 D;  2X6H A;  2QYU A;  4UWK A;  2V5Q C;  4NIK A;  5CMW A;  3V30 A;  2VSX E;  1BU9 A;  3GW4 A;  3SZ7 A;  3TXN A;  4FHJ A;  3T8M A;  4A3T A;  2PQR A;  5G05 J;  3PE4 A;  3JUI A;  4I6E A;  1UW4 B;  3L08 A;  2QFC A;  4TXQ A;  3CHR A;  1E8Y A;  4LRZ A;  3EIJ A;  3UUX A;  4U04 A;  3LEW A;  4N5C A;  3DST A;  4JA7 A;  3V31 A;  1TEZ A;  4NAC A;  5EID A;  4H7Y A;  4Y6C A;  4RQI A;  4W9R A;  2F37 A;  1HG5 A;  3SQV A;  3SNX A;  1OY3 D;  3UT7 A;  2B0O E;  3ISM C;  2LXM A;  3CKB A;  3ABM E;  3HIZ A;  1MQS A;  4A55 A;  5AYW D;  3HXC A;  4DX2 A;  3FHE A;  4Q69 A;  3DSW A;  4FLB A;  3SFX A;  1IXV A;  2VSY A;  2PQN A;  3FUF A;  2RKK A;  3QWP A;  3U4T A;  4O60 A;  2FF4 A;  5JHB A;  1H2U A;  4Q94 A;  1EDU A;  3CK7 A;  1TNU A;  5BPP A;  3PUK A;  4HRL A;  3SBT B;  1UN9 A;  3F6Q A;  3LY8 A;  3HHM A;  3MV3 B;  3U3W A;  1UJK A;  3MV2 B;  4KVM A;  5LP0 A;  5CRV A;  1H2T C;  2YNQ A;  5ENP D;  2C2L A;  3D9O A;  4XKC A;  2L0I A;  4G2V A;  4LCT A;  3L6A A;  3I4G A;  1P5Q A;  2WPV A;  3P1U A;  3DEP A;  5FIN A;  3UT4 A;  2BKG A;  3E32 A;  4I9C A;  1KPS B;  2J4D A;  4MRU A;  5FTP A;  4K0R A;  4F53 A;  4XIF A;  1U3C A;  1XNF A;  5FIO A;  1SA4 A;  2WMN A;  3L9T A;  4WND A;  2GRQ B;  2KM4 A;  2Y0B G;  4TUM A;  2AXU A;  2HE0 A;  1QYM A;  3PNL B;  1TJC A;  5EKQ D;  3FP3 A;  5BNW A;  3FUM A;  4PUC A;  4TXP A;  2RFM A;  3FUL A;  3ZYQ A;  4GYW A;  1OUV A;  4JEU A;  4BSX A;  1EYH A;  1TYQ G;  4AV7 A;  4FAD A;  4EHM A;  4LNU D;  4APO A;  3LXU X;  4XZ4 A;  1E7V A;  3P2B A;  4G26 A;  4GZ5 A;  3MZL B;  5ENS D;  3ASN E;  3TWX A;  4G24 A;  3AS4 A;  5EYL A;  3G2S A;  5FJY A;  5ARF A;  5AAO A;  1DCQ A;  3FTW A;  3JQ1 A;  2R59 A;  3FUH A;  2OV8 A;  1H19 A;  5T4Y A;  2BF0 X;  4P29 A;  4BES A;  2P9U G;  5JJT A;  4AOF A;  4APF A;  1BPO A;  1ELR A;  5H7P A;  4B0Z A;  1Z5S C;  5D66 A;  4YDY A;  1OCZ E;  2XS8 A;  4BER A;  5A23 A;  3W9F A;  4N5Q A;  3HG0 D;  3PNT B;  2X38 A;  4FHK A;  1HG2 A;  4I2Z A;  3CVL A;  1G3N B;  5G2N A;  4HLE A;  3FFL A;  3EHQ A;  5CHE E;  2P58 C;  3PH0 C;  5KJK A;  1KZO A;  4UUC A;  2XZT G;  3GZ1 A;  4DX5 D;  3R9A B;  1IYG A;  1BLX B;  2RD0 A;  4O6F A;  3CHS A;  4KZC A;  3BQO A;  2XEN A;  2J07 A;  2C0L A;  3ZHE A;  3IKO B;  5BUZ A;  2X6K A;  3I5P A;  2ION A;  2KAT A;  2H6F A;  2F8X K;  5CEA A;  3MX3 A;  4GA1 A;  2KXP C;  3L17 A;  4M7C A;  4DX7 D;  3V79 K;  4Y6W A;  4HVB A;  2XCB A;  2FUL A;  5LFA A;  1A5E A;  2VYI A;  1QBQ A;  2FI7 A;  3FU0 A;  3MA5 A;  3SI5 A;  1KT0 A;  4GPM A;  4GPK A;  3D9I A;  3PRZ A;  5M72 A;  2Y4U A;  1TNB A;  3LCA A;  3Q9U C;  3LYA A;  5D2M C;  2DYR E;  1E96 B;  4BSZ B;  1ZU2 A;  3RRN B;  3V2X A;  3HXB A;  1UN8 A;  3WXX A;  5G55 A;  1PAQ A;  1INZ A;  5AQA A;  3FU6 A;  1E7U A;  1DVP A;  3DXM G;  4UQY A;  4CDR A;  4B94 A;  2EIN E;  3NF1 A;  2GW1 A;  1HE8 A;  2V4L A;  1E8W A;  3L22 A;  4F1S A;  1SZ9 A;  4WAF A;  5ENQ D;  3NZS A;  5EIL A;  3SFZ A;  3UM1 A;  1JCR A;  2WQ7 A;  3FU5 A;  5B1B E;  3CHM A;  3B7T A;  3ZEF A;  3TWW A;  5LCW J;  4U8V D;  4DX1 A;  3CIA A;  4Z68 A;  4XX5 A;  4JW1 A;  4HI8 A;  2EIJ E;  4GAA A;  3O48 A;  5FQ4 A;  3FH7 A;  3L13 A;  4I1M A;  4DLQ A;  2H6G A;  2WXF A;  3E4B A;  3QK0 A;  2CFU A;  3IEG A;  2F8Y A;  3MKQ A;  4J8F A;  3DXK G;  4DUI A;  2EIM E;  1BI8 B;  4U63 A;  2R03 A;  3L16 A;  2Y1L E;  2WXH A;  1U2V G;  2AJA A;  4ILI A;  4L2L A;  4K5A B;  1YA0 A;  1DNP A;  3ABL E;  2XEE A;  4BX9 A;  3G2U A;  2BED A;  3AU4 A;  4NRH B;  5JJ6 A;  1O1R A;  2GRN B;  2MRI A;  3OXF A;  3DEO A;  3APC A;  3UPV A;  3APF A;  4LER A;  1MYO A;  4ANX A;  2VGE A;  3ZYL A;  3E37 A;  5D0O D;  4GZ6 A;  1HS6 A;  2BUG A;  1Z3Y A;  1N54 A;  4GTM A;  1JCS A;  2DYS E;  3O4Z A;  4JXT A;  3ENE A;  3FY4 A;  4GB9 A;  4UI9 J;  3BEE A;  1E8X A;  2DZO A;  4X8Q A;  1IKN D;  3RRU A;  2ZXW E;  2A5U A;  2I1K A;  4U95 D;  1KT1 A;  2GRR B;  2WXG A;  3FH8 A;  3C3Q A;  2LO6 A;  4ATG A;  1N4P A;  2WXL A;  3LJN A;  4GCN A;  2XPZ A;  5BXO A;  3ZVV A;  3UTM A;  3D9M A;  3EJN A;  1ZBP A;  4EEC A;  4RG9 A;  5BV0 A;  4K03 A;  1QNF A;  4GA0 A;  3CK9 A;  3B7R L;  4JHR A;  2GRL A;  4ME2 A;  5HQ8 A;  2IOL A;  5KNG A;  3G2T A;  1IQR A;  1LTX A;  3GZ2 A;  3BG1 B;  2CHW A;  3FTV A;  5EIB E;  1HO8 A;  2LSV A;  3ZNG A;  2OND A;  5HRY A;  3C98 A;  1XGW A;  5CBN A;  3QWV A;  5KJM A;  3TWT A;  5D0Q D;  4KYO B;  2WXJ A;  3X2Q E;  3SHF A;  2A5E A;  3CQC B;  3MCX A;  3AG2 E;  4OVV A;  2JAB A;  4AJW A;  2MOW A;  4EQF A;  3AJI A;  1TR4 A;  4F3V A;  5FWQ A;  4J8Y A;  4URK A;  4N3C A;  1SQM A;  2KC7 A;  2IY0 C;  3FH5 A;  2C0M A;  1MX2 A;  2PZI A;  5CER B;  3JXI A;  1KLX A;  3R7R A;  4QFV A;  1NZN A;  2IJG X;  4J6I A;  3PZ2 A;  5AAR A;  2HO1 A;  3ZXS A;  4UWL A;  2PL2 A;  5CCM A;  5LCW C;  4XI9 A;  3ZIM A;  5BW8 C;  4AP2 A;  2FO1 E;  4U0Z A;  2E2E A;  3E34 A;  4BX8 A;  4GTQ A;  4RVB A;  3VLE A;  3MYV A;  1N52 A;  4DRX E;  3FU3 A;  3DSV A;  2XRZ A;  2L6J A;  1GW6 A;  3CVV A;  2X6J A;  2B6C A;  3C5R A;  1N4Q A;  3NB2 A;  3CST A;  4LNG A;  4PS7 A;  4UI9 K;  2EQX A;  3CVN A; 
#chains in the Genus database with same CATH homology
 2UWJ G;  2KCV A;  4I6J A;  2VTB B;  4GZD A;  5ANL A;  3PNT B;  2LAH A;  3UQ3 A;  3QKY A;  2X38 A;  3URZ A;  4DI4 A;  1IQU A;  2PM7 A;  3ZFW A;  4YVO A;  1ELW A;  3LY9 A;  4FHK A;  2WXP A;  3ASF A;  3OXL A;  1HG2 A;  4I2Z A;  2WMO A;  3Q49 B;  3CVL A;  4YND A;  4AM9 A;  4ANU A;  1FVH A;  2L9B A;  5G2N A;  5T3R A;  4XI0 A;  2LSU A;  4HLE A;  3ZW3 A;  2AWI A;  2X6F A;  3FFL A;  3FEY A;  5CHE E;  3RJV A;  1JWG A;  2P58 C;  3PH0 C;  4WWP A;  4WNF A;  4BTB A;  5LX8 A;  2J49 A;  5KJK A;  2YHE A;  4GU5 A;  3HVE A;  5JJ7 A;  3GZ1 A;  3R9A B;  1IYG A;  2WXI A;  3KEZ A;  4WWO A;  2RD0 A;  2XGM A;  2WM9 A;  4O6F A;  3S7B A;  2RG8 A;  4WNE A;  3BG0 B;  2ZU6 B;  4CGV A;  3CHS A;  4KZC A;  2Y3A A;  2JEK A;  4KBQ A;  2J07 A;  3CGH A;  2C0L A;  3EHM A;  3ASG A;  3ZHE A;  3CR3 A;  4YVQ C;  3IKO B;  4M3O A;  4JHJ A;  5BUZ A;  1X5B A;  2KCL A;  2X6K A;  2VTB A;  3I5P A;  4GZ3 A;  4KT6 B;  3RKV A;  2ION A;  2A4Z A;  2I1J A;  2KAT A;  1IHG A;  3ONL A;  3CHO A;  2I2O A;  1OWO A;  5KCM A;  3VLD A;  4AXH A;  1EF1 C;  3TGO A;  4UQZ A;  5AIJ A;  1JPL A;  4LEU A;  3MX3 A;  4AIF A;  3Q47 B;  4GA1 A;  3CHQ A;  4FC8 A;  2IFU A;  2PM6 A;  4BWR A;  2XPY A;  3L17 A;  4RSY A;  4H7X A;  5DIZ A;  3CSF A;  3CHP A;  2IQC A;  5C2Y A;  3RRM B;  4Y6W A;  3PZD A;  3TG4 A;  4HVB A;  2XCB A;  3JQ0 A;  3NQP A;  5ENN A;  2FUL A;  4C0E A;  5LFA A;  2R5S A;  4IYP A;  5FQ8 A;  2VYI A;  3N71 A;  2AXV A;  1ELK A;  2FI7 A;  3HDX A;  3QC1 A;  4I6G A;  3FU0 A;  4D10 C;  3MA5 A;  4I1O B;  5FQ6 A;  2AVP A;  5LOZ A;  3SI5 A;  1KT0 A;  2KZT A;  3AU5 A;  3FTX A;  2WXR A;  3D9I A;  4U0U A;  5JHA A;  4GPK A;  3PRZ A;  4J8E A;  5M72 A;  2LNI A;  2Y4U A;  1E90 A;  1JUQ A;  3D9J A;  3PDN A;  3QDN A;  1W3B A;  4UI9 C;  3IV0 A;  3LCA A;  3QJZ A;  3TJP A;  3CLJ A;  3Q4A B;  3PEU B;  4TV3 A;  2ILR A;  3LYA A;  3Q15 A;  1E96 B;  1ZU2 A;  3ML8 A;  1QZ2 A;  3RRN B;  5ARG A;  3U9W A;  4AEZ C;  3I3N A;  2I9C A;  2XEV A;  2Y4T A;  4CCA A;  1Y6I A;  3PUJ A;  2XHE A;  4C0M A;  2M63 A;  3U66 A;  4JC8 A;  1UN8 A;  4JL0 A;  5EX0 A;  4IN3 B;  3WXX A;  2GGF A;  3FTS A;  5G55 A;  1PAQ A;  2GRM A;  1FVF A;  5CCL A;  1INZ A;  1H6K A;  5ANR A;  1LF8 A;  3FU6 A;  3CVU A;  1E7U A;  1DVP A;  2V8S E;  2XPI A;  4UQY A;  4CDR A;  3CK8 A;  4GYO A;  4B94 A;  4C9B B;  3NF1 A;  4CT4 A;  4WUY A;  2CHZ A;  3LVR E;  4HOT A;  2GW1 A;  2AXZ A;  2IF4 A;  3U64 A;  3QWW A;  3G2W A;  4CRW A;  2FEZ A;  5KJN A;  1HE8 A;  4JPS A;  1WY6 A;  3FWV A;  4TRQ A;  2V4L A;  4I43 A;  1E8W A;  2V5F A;  3L22 A;  4CDM A;  3CVW A;  4F1S A;  1SZ9 A;  4WAF A;  1VDY A;  3MKQ B;  4XKB A;  2FBN A;  3ZHE B;  1EPU A;  3FUK A;  3NZS A;  4N3A A;  2CFZ A;  3B13 A;  3SFZ A;  2HYZ A;  4MKT A;  1E8Z A;  5A6C A;  3CQG B;  3B7U X;  2WXN A;  3FUN A;  4B8A A;  3FTU A;  2J09 A;  4GYY A;  4I17 A;  4J8S A;  3CKC A;  2VGX B;  3TAX A;  4HOS A;  4AY6 A;  2WQ7 A;  3FU5 A;  5C1D A;  4KMO A;  3SD5 A;  3CHM A;  3B7T A;  3ZEF A;  5AEN A;  1H0A A;  4BY6 A;  4BFR A;  2BTD A;  4ILG A;  4ANW A;  5LCW J;  3PEV B;  3CIA A;  4FJZ A;  4XX5 A;  4EZK A;  4JW1 A;  3VTY A;  2UY1 B;  4RG6 A;  4G11 A;  5KJL A;  4OVU A;  4LUN U;  3UT8 A;  3T5V A;  4GAA A;  3ESK A;  2DIW A;  3ESL A;  3O48 A;  5FQ4 A;  3CVX A;  3D9L A;  2KZT B;  3PVL A;  3UX4 A;  2VSN A;  3FH7 A;  1HF8 A;  2X6I A;  3L13 A;  3GZS A;  4I1M A;  3Q5M A;  3RK6 A;  4DLQ A;  1OWL A;  2WXF A;  3E4B A;  1PC2 A;  2X3M A;  3LDZ A;  3SGH A;  3FUI A;  3QK0 A;  3SF4 A;  5FQ7 A;  1Y8M A;  3ZYK A;  1PY1 A;  2CFU A;  3IEG A;  4L2Y A;  2CG3 A;  1SZA A;  3ONK A;  3TG5 A;  3MKQ A;  4J8F A;  2X6H A;  3ASH A;  1WAO 1;  4Q96 A;  4UWK A;  4A1G A;  4FJY A;  2NC9 A;  2CG2 A;  5CMW A;  2VGX A;  2VSX E;  4JEH A;  4BTA A;  4U63 A;  3GW4 A;  3L16 A;  3SZ7 A;  3TXN A;  4FHJ A;  3L54 A;  4ABN A;  2YHC A;  2QY7 A;  2WQH A;  4G23 A;  2YQ8 A;  3IHY A;  5FZS A;  3T8M A;  4A3T A;  2PQR A;  5G05 J;  4HS2 A;  1H2V C;  2WXM A;  3PE4 A;  2UY1 A;  2WXH A;  3JUI A;  5CMY A;  5G04 J;  3EDT B;  3KD7 A;  4I6E A;  4ILI A;  4L2L A;  1UW4 B;  1YA0 A;  3L08 A;  2QFC A;  2MHK A;  3FDH A;  3RU0 A;  1DNP A;  4BX9 A;  2HM8 A;  1E8Y A;  3CHR A;  4LRZ A;  3G2U A;  3EIJ A;  3UUX A;  4I9E A;  5EX3 A;  4HOR A;  4DLO A;  4U04 A;  3LEW A;  4DI3 A;  4N5C A;  3AU4 A;  2IU1 A;  4ACL A;  3LJ3 A;  4JA7 A;  1TEZ A;  4NRH B;  5JJ6 A;  2WB2 A;  4NAC A;  3LY7 A;  3PS6 A;  4E85 A;  4H7Y A;  4Y6C A;  3RIB A;  4CT0 A;  4W9R A;  3RO3 A;  2DCP A;  2MRI A;  3KS2 A;  2AW6 A;  3OXF A;  1HG5 A;  4KVO A;  4NQ0 A;  4UWF A;  3APC A;  3SNX A;  3UPV A;  4U8H A;  3APF A;  4LER A;  3UT7 A;  4AVX A;  4ANX A;  3ASD A;  5J90 A;  4N2S A;  3ZGQ A;  3CKB A;  3SBS A;  3HIZ A;  4FU3 A;  3ZYL A;  1MQS A;  5T8I A;  3D9N A;  3FUJ A;  2L0T B;  3FUE A;  5D0O D;  4GZ6 A;  2CHX A;  3FEX A;  4HFG A;  5AYW D;  4A55 A;  1HS6 A;  2BUG A;  1Z3Y A;  3FUD A;  1N54 A;  4L7T A;  3HYM B;  4IUL A;  3K9I A;  3G2V A;  1OWN A;  5E76 A;  4AY5 A;  3O4Z A;  4JXT A;  1OWM A;  3FHE A;  3ENE A;  4Q69 A;  3FY4 A;  4N39 A;  4EBA A;  4FLB A;  4GB9 A;  4L23 A;  2XQ0 A;  4BT9 A;  4UI9 J;  2VSY A;  3BEE A;  2PQN A;  3KAE A;  3FUF A;  4PDX A;  2Q7F A;  4FLH A;  1E8X A;  1OWP A;  4GML A;  3QWP A;  4J0U A;  3QOU A;  3U4T A;  3JYS A;  4G25 A;  2FF4 A;  2WVI A;  3RRU A;  1S0P A;  3MGB A;  5JHB A;  2A5U A;  2I1K A;  1KT1 A;  1H2U A;  3QNK A;  4Q94 A;  1EDU A;  4GA2 A;  2KCK A;  1QQE A;  2WXG A;  3FH8 A;  3CK7 A;  1UJJ A;  3ULQ A;  4U07 A;  4UWH A;  5AJD A;  2LO6 A;  4ATG A;  3FTY A;  2WXL A;  4A3V A;  5BPP A;  4EZL A;  4GCN A;  1NA3 A;  2XPZ A;  3PUK A;  3ZVV A;  1Z3X A;  3D9M A;  3SBT B;  3EJN A;  1UN9 A;  2J08 A;  2WXO A;  4TUU A;  2VGY A;  3ML9 A;  3ZRH A;  4DPR A;  1ZBP A;  3LY8 A;  4DK5 A;  4EEC A;  4UQX A;  3HHM A;  3MV3 B;  4IRU A;  4RG9 A;  3U3W A;  1UJK A;  5BV0 A;  3MV2 B;  3D3M A;  4KXK B;  2XGO A;  1B89 A;  3QB2 A;  4JA9 A;  4KVM A;  3T5X A;  3TXM A;  4F7A A;  5BV1 A;  4K03 A;  3AS8 A;  5LP0 A;  4NUR A;  3UMV A;  1QNF A;  3PRE A;  3CK9 A;  2E0I A;  1H2T C;  3QAQ A;  4GA0 A;  2YNQ A;  3B7R L;  5FZR A;  4FP7 A;  4JHR A;  2GRL A;  2VQ2 A;  4ME2 A;  3DPD A;  3OTN A;  4XE0 A;  1FCH A;  2C2L A;  4PH4 B;  5HQ8 A;  3D9O A;  2DBA A;  4XKC A;  2IOL A;  3S7J A;  2JLB A;  2L0I A;  1NP7 A;  4G2V A;  1TJF A;  4LCT A;  5G05 C;  3DBS A;  3D9P A;  5G04 C;  4CGW A;  3G2T A;  3I4G A;  3L6A A;  1IQR A;  1P5Q A;  2WPV A;  2J9Q A;  3GZ2 A;  3LPZ A;  3PE3 A;  3BG1 B;  3P1U A;  5DBK A;  4CDN A;  4GMJ A;  2CHW A;  3FTV A;  3UT4 A;  3VLF A;  1HO8 A;  3NZU A;  4I9C A;  2LSV A;  2J4D A;  1HX8 A;  1WM5 A;  2IOS A;  2OOE A;  2OND A;  4MRU A;  1HFA A;  1JWF A;  1L5J A;  3C98 A;  4FA6 A;  1XGW A;  5FTP A;  4B8C B;  3JCK C;  3I4R B;  4K0R A;  3QWV A;  4F53 A;  5KJM A;  2OVF A;  4XIF A;  1U3C A;  1XNF A;  4L1B A;  5D0Q D;  4J8D A;  2WMN A;  3CV0 A;  3EHN A;  4KYO B;  2WXJ A;  4WND A;  3SHF A;  1HU3 A;  2HR2 A;  2KM4 A;  3CQC B;  3MCX A;  2J4B A;  4DJA A;  4WNG A;  4N3B A;  1UG3 A;  4G1T A;  4HXI A;  4R7L A;  3ZPJ A;  2AXU A;  4OVV A;  4AJW A;  2WXQ A;  2MOW A;  3MJW A;  3PNL B;  4PS8 A;  4EQF A;  1MHQ A;  2NSZ A;  3VTX A;  4U0S A;  4EZJ A;  2XRY A;  1TJC A;  5EKQ D;  3FP3 A;  5BNW A;  3FUM A;  4PUC A;  3FTZ A;  5A7D B;  4F3V A;  2V0P A;  5FWQ A;  3FUL A;  1NA0 A;  3QAR A;  5FZQ A;  3ZYQ A;  4GYW A;  3AS5 A;  5E75 A;  1OUV A;  4URK A;  4JEU A;  4N3C A;  3S7D A;  1SQM A;  4MLP A;  1EYH A;  2KC7 A;  4A1S A;  1Z6T A;  3TL5 A;  4ANV A;  2NXP A;  5FT9 A;  4AV7 A;  3CVY A;  4HOQ A;  3FH5 A;  2C0M A;  4FAD A;  3APD A;  4GZC A;  3CEQ A;  1HXI A;  2PZI A;  4B89 A;  4BT8 A;  4APO A;  2XGS A;  4JVS A;  3LXU X;  4XZ4 A;  3ZN3 A;  3RO2 A;  5BT1 A;  1E7V A;  1KLX A;  3R7R A;  4QFV A;  3LS8 A;  5HI7 A;  3P2B A;  3S7F A;  4EPZ A;  1NZN A;  4G26 A;  2VJ8 A;  3S2A A;  2IJG X;  4GZ5 A;  4J6I A;  3MEK A;  2HO1 A;  3GYZ A;  3EIQ C;  3MZL B;  4BSX A;  2OVB A;  4I1A A;  4UWL A;  2PL2 A;  3ZXS A;  1A17 A;  1HZ4 A;  4V3I A;  4EBA G;  4G24 A;  4JZY A;  5CCM A;  3AS4 A;  2WXK A;  1U3D A;  5AJL A;  3CVP A;  2LAI A;  3G2S A;  2FO7 A;  4ILH B;  4WWN A;  5LCW C;  5FJY A;  4XI9 A;  3OAW A;  5ARF A;  4FUL A;  3ZIM A;  4UWG A;  5BW8 C;  4AP2 A;  3B7S A;  4PS3 A;  4E6H A;  4CEM A;  4U0Z A;  2R17 C;  3FTW A;  3JQ1 A;  2R59 A;  3FUH A;  2E2E A;  2OV8 A;  3D9K A;  4BX8 A;  5EDS A;  4RVB A;  3HVE B;  4OYS A;  3VLE A;  3MYV A;  5J08 A;  1H19 A;  5T4Y A;  2BF0 X;  4JHK A;  4N2Q A;  1HH8 A;  1N52 A;  4P29 A;  4ACK A;  2WQ6 A;  3R7Q A;  3FU3 A;  3ZYM A;  4KZ0 A;  4MS6 A;  5JJT A;  4AOF A;  2XRZ A;  2XCC A;  2L6J A;  1GW6 A;  1BPO A;  4APF A;  3CVV A;  1ELR A;  2X6J A;  3IHV A;  4I2W A;  3CVQ A;  2YIN A;  3IBE A;  3LKU A;  4B0Z A;  3OXG A;  2VSO E;  4HOU A;  2I6H A;  3CST A;  4PS7 A;  4UI9 K;  4GCO A;  2EQX A;  3MKR A;  5A23 A;  3LVQ E;  3CVN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...