3KAEA

Cdc27 n-terminus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
225
Chain Sequence
SKLIGKICKSIRYRDYETAIFLAACLLEYRMLMSIVLYLNGEYTRALFHLHKLNTCTSKYYESLCYKKKKDYKKAIKSLESILEGKVERDPDVDARIQEMFVDPGDEEFFESLLGDLCTLSGYREEGIGHYVRSFGKSFLFSPVENLLLENKVPQKRGIEEEYVSDSIEFHESLSPSLVKKYMEHVPGIGSYFISNAARRYFNLGMNDKSKACFELVRRKDPMFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of the N-terminal domain of the APC/C subunit Cdc27 reveals a homo-dimeric tetratricopeptide repeat architecture
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Protein binding
molecule keywords Possible protein of nuclear scaffold
total genus 86
structure length 225
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kaeA00
2WPVA 1NA0A 2FI7A 4U07A 3TG4A 4HOSA 1IHGA 3EDTB 2PQRA 5FJYA 2HR2A 4I1AA 5C1DA 5DBKA 3KS2A 4WUYA 4RG6A 4APOA 4UI9K 2KC7A 5CCMA 3UQ3A 4HOTA 4JA7A 4I2WA 3ASHA 2XCCA 5EKQD 4G1TA 2IFUA 4H7YA 4EQFA 5JJ6A 2LNIA 5KJLA 3CVLA 3E4BA 3RO2A 2BUGA 3CKCA 4HORA 4I2ZA 2VQ2A 4UQZA 4G25A 4U0SA 3CK9A 2XEVA 2XGSA 3SF4A 4J8EA 3URZA 3VTXA 4GCNA 4U0ZA 3U4TA 2AVPA 4CGWA 4GZ6A 1HXIA 2VSNA 1ZU2A 1NA3A 3AS8A 5ARFA 3QOUA 2PZIA 4F3VA 3UUXA 1OUVA 2J9QA 4G26A 2IF4A 3ASDA 3MEKA 2UWJG 3MV3B 2YHCA 4JHRA 5EX3A 3S7DA 2YQ8A 5CHEE 5G04J 4GA0A 4KYOB 5LCWJ 3KAEA 4GYWA 1HZ4A 2XGMA 1A17A 2HO1A 2KATA 1FCHA 2WQHA 3OXGA 3PDNA 4Y6CA 3ZPJA 2FBNA 5G05C 3FP3A 3TAXA 3PE3A 4GA1A 4GZ5A 3ZFWA 3ZHEB 4AY5A 5LCWC 3ULQA 3CVPA 3QWVA 4NQ0A 2VSYA 5A7DB 4BTBA 4G23A 2VYIA 4NRHB 2V5FA 3AS5A 3QKYA 4N2QA 2R5SA 1PC2A 2I6HA 4JL0A 5HQ8A 2NC9A 3GZ1A 4LEUA 5FZSA 4I9CA 3GZ2A 5A6CA 3S7BA 5FZRA 4CGVA 3LY9A 5ARGA 2C2LA 4RG9A 4N3AA 4AIFA 3UPVA 5JJ7A 1P5QA 3NF1A 5DIZA 4WNDA 3QWPA 4YVOA 1WAO1 3CK8A 3S7FA 2UY1A 3ASGA 1E96B 4UI9C 4BT9A 1W3BA 3FFLA 3MKRA 4HOUA 1ZBPA 3LPZA 3CK7A 1QQEA 1Y8MA 3LCAA 4GYYA 3VTYA 3HYMB 3CVNA 5HI7A 5BW8C 2PL2A 4WNFA 2KCVA 3ZGQA 4AM9A 4BT8A 4AY6A 3GYZA 4BWRA 3SZ7A 1WM5A 2FF4A 3LKUA 2E2EA 4J8FA 5D0OD 2XPIA 3GW4A 2UY1B 3ASFA 4KXKB 5BT1A 4O6FA 4N39A 4UQYA 2OOEA 1XNFA 4B94A 4KBQA 4Y6WA 2L6JA 3ZHEA 5JJTA 4UQXA 3LYAA 5KJMA 3PE4A 4GA2A 4J0UA 4ME2A 4N3BA 4H7XA 4YNDA 4GPKA 4XI0A 1ELWA 4G24A 1TJCA 3ESKA 3Q4AB 4BTAA 4J8DA 1IYGA 3RKVA 5D0QD 3O48A 3RU0A 2GW1A 3WXXA 1NZNA 5M72A 1HH8A 3N71A 2Y4TA 3KD7A 2LSUA 4GYOA 4YVQC 4WNGA 3QWWA 3AS4A 4GZ3A 3RIBA 2MHKA 3OXFA 1ELRA 2PQNA 2KCKA 2VGYA 5FTPA 2XGOA 2VGXA 3CV0A 5AYWD 2XCBA 3Q49B 4G2VA 5BNWA 3MA5A 3Q5MA 2C0LA 4U04A 4XIFA 5CCLA 5KJKA 4N2SA 4N5CA 2C0MA 3LY7A 4XI9A 3JYSA 5G05J 2DBAA 3OXLA 3ZN3A 3TGOA 2LSVA 4UI9J 4WNEA 2FO7A 4I9EA 2P58C 2QFCA 3CKBA 3Q47B 3CEQA 1QZ2A 3QDNA 3FWVA 4U0UA 5FT9A 2VGXB 1KLXA 3RO3A 1B89A 4A1SA 3RJVA 4CDRA 5KJNA 3MV2B 3TG5A 2HYZA 3U3WA 3BEEA 3K9IA 4N3CA 2FEZA 3IEGA 4W9RA 4IN3B 2KCLA 5G04C 5FZQA 4I17A 1KT0A 2Y4UA 1YA0A 1KT1A 2Q7FA 3CVQA 3Q15A 3S7JA 4GCOA 4HOQA 5EX0A 3LY8A 2ONDA 2JLBA 3R9AB 4ABNA 4JA9A
chains in the Genus database with same CATH superfamily
3RSEG 3PZ4A 5C1DA 3KS2A 5BV1A 2XRZA 3ASHA 1H2VC 2KZTA 4AXHA 4DLOA 4PS8A 4U0ZA 1NP7A 5ARFA 2IF4A 2B0OE 3BG1B 3L9TA 5G04J 3QB2A 3MZLB 4KVOA 3DRAA 1V55E 4GZCA 5C2YA 3E33A 4BSXA 1W3BA 2LO6A 3LCAA 4HOTA 2L0TB 2PL2A 4B0ZA 3D9HA 1JPLA 1S63A 4CDNA 2Y69E 4J0UA 4GAAA 4DRXE 3EU9A 3ESKA 3FH7A 3RKVA 3UMVA 1L5JA 3FTZA 5J08A 3VLEA 2RKKA 2MHKA 2PQNA 3T8KA 3T9KA 4IRUA 1FT2A 3UIPC 3ABLE 4XIFA 2HM8A 4C0MA 3RO3A 4L7TA 3BEEA 3CHOA 1MYOA 3B95A 4DUIA 3UTMA 1JWGA 3S7JA 2ONDA 4APOA 4JA9A 3G2UA 2PQRA 1E8XA 2VSOE 3IXEA 4KZ0A 1N11A 4XE0A 4BFRA 1LF8A 4KVMA 2WXLA 4HORA 1YMPA 4K03A 5JMND 3ZYLA 3X2QE 1XGWA 2H6GA 4CDMA 3FU3A 4C0EA 3WG7E 3TXMA 1ELKA 4A3TA 2RD0A 3DPDA 2R03A 3TAXA 1OCRE 4HLEA 3QWVA 3PREA 4G23A 3QKYA 2H6HA 4LEUA 5A6CA 3HG0D 4RG9A 3OAWA 3UPVA 5DIZA 3RRMB 5LFAA 3TWVA 1O1SA 4I1MA 4AJWA 4JW1A 5T3RA 3PZ3A 3TWWA 4BWRA 4N39A 2DZOA 4RSYA 5FINA 3PE4A 3FEYA 2J4BA 1IQUA 3W9GA 5M72A 3L16A 4GMRA 2GRRB 3ZNGA 2VGXA 3AU5A 2RFAA 4HRLA 2X3MA 3V2XA 3TGOA 2WMOA 4DX7D 4MS6A 5BPPA 2BKGA 2AXUA 3ZYKA 2LAHA 3TG5A 4F53A 1MHQA 3K9IA 5HKPA 1N52A 1O1RA 4F1PA 3AG3E 3E32A 5DBKA 2WXNA 3T8MA 4L23A 2YINA 3HDXA 3AU4A 1YCSB 2GGFA 3DPYA 3B7RL 2XGSA 4FC8A 3B13A 3U4TA 5H7PA 2J9QA 4GTQA 2NXPA 1OY3D 1OWOA 3ZPJA 3E34A 4URKA 5G2NA 3JUIA 2R5SA 1N4QA 5AQ7A 1TR4A 3FDHA 3JXJA 4AIFA 4TXRA 2X6HA 1UN8A 1ZBPA 2IEJA 5JA4D 2KCVA 2WXHA 4B8CB 4U96D 3Q79A 1N9AA 3LYAA 2DCPA 1PY1A 1SA4A 3CSFA 5AARA 3EHRA 3ONLA 4LSZE 1TJFA 2PNNA 3JYSA 4ATZD 1UJKA 2P9NG 3FUHA 1JCSA 2ETCA 2AXVA 3C3RA 4TUUA 3MV2B 3CVWA 3VLDA 4ACKA 4J7WA 3ESLA 3ZUVB 5HI7A 1H6KA 3APFA 3L08A 2WPVA 3TG4A 4HOSA 4IULA 3CLJA 2KC7A 4XZ4A 3CVLA 3CKCA 3EHNA 3L82A 3C3OA 4U7EB 3SF4A 4PS7A 3EJNA 1NA3A 3SO8A 5CHEE 2OVFA 3HRAA 4MBGA 4U63A 1KPSB 2H6FA 4ZHBA 3TWUA 4DK5A 1TNZA 4NRHB 3DWLG 3FTSA 1QNFA 2V8SE 4WNDA 3QWPA 1N95A 3S7FA 3BQOA 2A4ZA 4BT9A 3HXCA 1QQEA 4CT0A 3PZDA 4JXTA 3C3QA 4HFGA 4Y6WA 1G3NB 2OEVA 4I43A 5AENA 4HRMB 4LCTA 5J90A 3RK6A 2WXJA 4ANUA 2GRLA 2DVWA 2XGOA 5AYWD 2C0LA 1BPOA 3SGHA 4EBAG 2Y0BG 4JC8A 1N94A 4EBAA 1EPUA 4QFVA 1TN6A 3CGHA 3AAAC 3EHQA 1AP7A 4HQDA 2XQ0A 1UJJA 5BXUA 3RRUA 4WUYA 2XHEA 3G2SA 3EHMA 3PS6A 2ETBA 5KBAA 4XKBA 3PEVB 3QC1A 4WWPA 3UXGA 4FU3A 4J8YA 4J8EA 3CHRA 4F3VA 3QOUA 3UI2A 3FUMA 5EX3A 4CZ2D 4KYOB 5LCWJ 3JXIA 4Q69A 1OCCE 4CYMD 4YDWA 1IKND 4HI8A 2IONA 5G05C 5LP0A 1HF8A 3ML9A 4BTBA 1N4SA 4JL0A 4B8AA 1ZB1A 3GZ1A 2KBXA 2ZIRA 3FTVA 4J8SA 1N54A 3KSLA 5LX8A 3D9OA 2F8XK 4GU5A 4DJAA 4OAUC 4WNFA 1LD8A 4KXKB 3RRNB 3ZHEA 5KJMA 3SNXA 3L22A 2CHZA 2XZTG 3PZ2A 2VTBA 3N71A 4HI9A 3CVVA 4TXPA 4YVQC 3FH5A 1DCEA 4DX6D 3ZEFA 4CT4A 2WXRA 2EIKE 5ENRD 1JCRA 4DI3A 2LSVA 4ACLA 4YDEA 4NIKA 1UG3A 4N3CA 4W9RA 4L2YA 4ANXA 4GCOA 3HXBA 2J49A 2JLBA 2FI7A 4MLPA 2MOWA 2CFUA 1E8WA 3CHMA 4JA7A 5CEAA 2LNIA 4JPSA 2XEVA 3MEKA 2UWJG 2V4LA 3IHYA 1BU9A 1HZ4A 1MX2A 3PRZA 4V3IA 3SFXA 5FQ4A 2CFZA 3ISMC 4NQ0A 2R05A 2V5FA 2RG8A 3DSSA 5EDSA 3V30A 2C2LA 2X6FA 2WB2A 2LAIA 3Q73A 5A23A 4LUNU 3CK8A 4GTOA 1OWNA 4DPRA 3HYMB 3G2VA 3ASFA 1MX4A 4O6FA 4UQYA 1E8YA 4GA2A 5AIJA 4ME2A 1ELWA 1INZA 3C72A 3WXXA 1HH8A 3D9KA 3FY4A 3AS4A 2WXPA 3TWSA 4Q96A 5CBOA 4JHJA 1TNUA 3NQPA 3QJZA 3T5VA 4CCAA 5ENPD 4UUCA 2HE0A 4DX1A 4YDOA 4AV7A 3CEQA 1Y6IA 2I1JA 3FU5A 3RJVA 1SA5A 2I9CA 3L13A 4E6HA 3MCXA 4LNGA 2V4HC 2Q7FA 3Q15A 4K0RA 3TWTA 4OVVA 5AJLA 1HG5A 3CK9A 1FT1A 4GCNA 2QC9A 1VDYA 3AS8A 2MRIA 3FEXA 4DI4A 3AJIA 4LRZA 2ZGDA 4UWKA 4BX9A 5EYPF 3ZFWA 4GTRA 2DYSE 3CVYA 5ENQD 2EQXA 2ZU6B 3ZKJA 4HOUA 3LEWA 5AAOA 2DWZA 3ZGQA 4BT8A 1WM5A 2DZNA 2CG3A 4FULA 4I1OB 4WWOA 3SBSA 4GPKA 1DNPA 4N3BA 4GMLA 1BI7B 5ANRA 3TL5A 3S2AA 5FTPA 3U64A 1JUQA 4G2VA 5BNWA 2KZTB 1NL4A 3OXLA 3ZU7B 3SFYA 2EILE 1QZ2A 3ABKE 2P9IG 1U3DA 4MRUA 3CR3A 1E90A 2KCLA 4FJYA 1N0RA 5FJYA 2QYUA 3DSUA 4BESA 4G11A 3FTWA 4G8LA 4UI9K 3B7BA 2XCCA 2IFUA 3ZXPA 5JJ6A 3I5PA 3D9JA 4N5QA 4DLQA 1Z5SC 3Q7AA 5CERB 4JVSA 4PUCA 2PZIA 2GRQB 1JCQA 2YQ8A 3KAEA 4GYWA 1JWFA 1AWCB 2WQHA 3Q75A 2AJAA 3HIZA 2P9SG 3BUAA 3MKQA 4XEIG 2I1KA 4I9CA 2H6IA 5T4YA 4IYPA 4CGVA 2WMNA 3NF1A 4B89A 3G2TA 3ZIMA 5AQBA 4ILHB 1SVXA 4AM9A 3FUIA 2FF4A 3FU0A 1K3ZD 1Z3YA 3FH8A 4KBQA 2L6JA 3CQCB 4TXQA 2I2OA 4G24A 1TJCA 3Q4AB 4J8DA 5D0QD 3JCKC 3FHEA 1NZNA 1BD8A 1SZAA 3KEZA 4GZ3A 3OXFA 4C48B 4EPZA 2EIME 1NFIE 3ZYQA 3D9PA 3I4GA 1FPPA 2P2CP 1IHBA 4JHKA 2IU1A 4XX5A 5G05J 5EIDA 3ZVVA 1KZPA 3HVEA 3Q47B 4NACA 4ANWA 3U3WA 2A5UA 4A1GA 3AG2E 3EUVA 3IBEA 3Q9NC 1IHGA 3EDTB 2YNQA 2J8SD 4U95D 1N4PA 3DXKG 4EQFA 2PM6A 3NBNB 3LVQE 3J5QB 2IQCA 3VTXA 4RLYA 3QAQA 5CMWA 1S64A 3ASDA 4L1BA 1EDUA 3DSVA 2LXLA 4D10C 2FBNA 2AW6A 3IHVA 3TWQA 5LCWC 4E85A 3ULQA 1BI8B 2WXMA 5HQ8A 4OAVB 3GZ2A 4O1PA 5ARGA 2LUHA 3MJWA 4N3AA 3UM2A 1TEZA 4YVOA 3C5RA 2WQ6A 3VTYA 3FUJA 4EECA 3FUKA 3NZSA 2UY1B 3C98A 4B94A 2L0IA 3FU6A 2P9UG 1HG2A 3ZYMA 3UT4A 2OEWA 4UWLA 2Y4TA 3KD7A 3UT8A 3HXDA 3FTYA 1ELRA 3PUKA 3CVUA 4HNAD 2QYJA 2WXFA 4N5CA 2DBAA 2EINE 2M63A 5B1BE 5G04C 4I17A 1MQSA 3FUNA 3PZ1A 5E75A 2LXMA 1IQRA 2VGEA 5FWQA 2WXQA 1U2VG 2GRNB 3RO2A 2BUGA 1OCZE 4TUMA 2WQ7A 4O1OA 3CHPA 3L17A 3DSTA 1X81A 3I4RB 4JHRA 3L6AA 3LJ3A 1LD7A 5HRYA 4U8YD 3FP3A 3PE3A 2F37A 2I6HA 2RFMA 3TJPA 2J07A 4GTVA 2NSZA 3S7BA 1OWMA 1K8KG 3LY9A 5CMYA 2FULA 2X6JA 5JHBA 3MKRA 3CVNA 4M7CA 2VSXE 4APFA 4NURA 2KXPC 5BT1A 4HS2A 3R9MA 2R17C 4YNDA 4XI0A 3BU8A 3DEPA 4FHKA 3FUFA 4GYOA 1MZCA 5FIOA 2XZDG 3NAWA 3Q49B 3MA5A 3U9WA 3ZW3A 4N2SA 1H6OA 3ZN3A 4HVBA 5ENTD 3ONKA 2HYZA 3D9LA 4G8KA 2FEZA 3B7TA 4L2LA 5FZQA 3ULYA 4HOQA 1UW4B 1NA0A 2J08A 4UWHA 4U8VD 5HS0A 3ML8A 3TWXA 4X8QA 3UQ3A 4I2WA 1HX8A 2OV8A 3R7QA 4RVBA 1X5BA 1PAQA 2R59A 3AG1E 1MX6A 3ULEG 2VSNA 4HLLA 4FA6A 4GA0A 3SI5A 2HO1A 2A5EA 2YHEA 3OXGA 5CECB 2X6IA 1QYMA 3ABME 3PEUB 5JHAA 2VSYA 1FVFA 4GTMA 3DSWA 5KCMA 3V31A 1SW6A 3MKQB 3ZRHA 2QZAA 4GYYA 1Y8MA 3SZ7A 4J8FA 4ZFHA 5KWDA 1Z6TA 2ILRA 4PDXA 4B93B 1IYGA 3SQVA 5BV0A 2PM7A 1H0AA 2L6BA 4R7LA 2WXOA 3V79K 3HVEB 3TWRA 1WG0A 4LG6A 1EYHA 5KJKA 3QARA 4XI9A 4I9EA 3CKBA 2WXKA 3FWVA 4HBDA 3FTXA 1D8EA 4CEMA 2BEDA 4A3VA 4JD2G 3LY8A 4LNBA 1N4RA 2OCCE 4U07A 1WY6A 3HHMA 3UKUG 5EKQD 4G1TA 5AQAA 5KJLA 2F8YA 3E4BA 4I2ZA 5EYLA 5CEDB 2F0YA 1HFAA 3VLFA 3UX4A 2E0IA 3FUDA 3CSTA 3DSXA 5B3SE 2DYRE 1Q2ZA 4GZ5A 3CVPA 4RQIA 2VYIA 1A5EA 1PC2A 2ZISA 5FZSA 4GB9A 3MGBA 1H2TC 1MJ0A 4HXIA 4K5AB 3U66A 5JJ7A 1KZOA 3AG4E 3OTNA 3R7RA 2FO1E 1NI1A 3LPZA 3JQ1A 3NOCD 5EIBE 3GYZA 3E37A 3CQGB 5T8IA 4O60A 1D8DA 3PVLA 3E30A 3MX3A 4UQXA 3SFZA 4OYSA 4KT6B 1U3CA 3J5PA 1YYHA 3P1UA 1TYQG 3SD5A 4GTTA 3QWWA 5KNHD 3T5XA 4DX2A 4ILIA 1D9SA 2VGYA 4EZLA 4BSZB 4P29A 3B7UX 3Q5MA 5B1AE 2ZGGA 3LJNA 2VJ8A 5D2MC 4UI9J 4WNEA 3JQ0A 1O1TA 5ITZF 4HB5A 1KT0A 2XS1A 3L54A 3FUEA 3QNKA 3O4ZA 2HR2A 2CG2A 3D9MA 2MYOA 5ANLA 4I6GA 3URZA 1O5MA 2YHCA 2R2LA 4EZJA 2JEKA 1S70B 3APDA 3JUEA 4WWNA 1RZ4A 3AS5A 2P9PG 3NOGD 2NC9A 3ASNE 4L9PA 1P5QA 5BXOA 4KMOA 1WAO1 1HE8A 5CRVA 3CK7A 4BETA 4AOFA 2XPZA 3LKUA 4JB8P 5BUZA 1XNFA 1E7UA 4M3OA 3QK0A 4JEHA 2IO3C 1LTXA 3O48A 3RU0A 2CHWA 3NZUA 4ATGA 1E8ZA 2ETAA 4A63B 3SHFA 4FLHA 5LOZA 2IJGX 2XRYA 5FQ8A 3UM0A 2XS8A 3LY7A 4AP2A 4K5BA 2VGXB 5FT9A 4AVXA 4EZKA 2WXGA 3EU5A 2Y4UA 1YA0A 3Q78A 1KT1A 2GROB 4GTSA 3RAUA 5EX0A 3D3MA 1EF1C 3CVXA 4ANVA 5CCMA 4H7YA 1DCQA 3BG0B 4FJZA 4U8HA 4UQZA 4G25A 3IV0A 3KSQA 2WXIA 4GPMA 1ZU2A 2V0PA 5KNGA 1OUVA 2CHXA 3MV3B 4GMJA 2KATA 1FCHA 4HRNA 4LERA 4AEZC 5ENSD 1BLXB 1TNOA 1GW6A 3DXMG 4PH4B 4UWGA 5FZRA 3DEOA 1K1AA 1OCOE 3HXFA 4A55A 3MYVA 2UY1A 1OWPA 3FFLA 1V54E 3UT7A 2B6CA 4KZCA 3F6QA 5BW8C 4AY6A 5D0OD 4BERA 2XPIA 4I6EA 3LXUX 3PNTB 4JZYA 4GZDA 1DC2A 4PS3A 2J4DA 1S0PA 4UWFA 4ILGA 2XEHA 4Z68A 2OVBA 2ZXWE 2L9BA 3ENEA 5AQ9A 3FTUA 2KCKA 1Z3XA 4BY6A 2J09A 2XCBA 1HO8A 5CCLA 3SY2A 2GRPB 4CRWA 1FVHA 4TRQA 2P58C 4U0UA 1KLXA 2AXZA 4BX8A 2IY0C 2V5QC 3IEGA 2X6KA 3UM1A 4IN3B 3KEAA 3CVQA 2P9LG 3R9AB 1H19A 4ABNA 2Y1LE 3UIOC 4I1AA 4WAFA 1IXVA 4RG6A 3D9IA 3PNLB 3CIAA 2WM9A 3UKRG 4FHJA 3CHQA 3UINC 3Q7FA 2VQ2A 5ENNA 5G55A 3NB2A 1TN7A 2AVPA 4XKCA 4CGWA 1HXIA 1UOHA 3PUJA 3DBSA 4OVUA 2XENA 3UM3A 2X38A 2IOSA 3ZHEB 3G2WA 4FP7A 2VTBB 3HXEA 4QQIA 4YDYA 1E96B 4UI9C 3V2OA 4FADA 1OXJA 3LVRE 3LDZA 1OT8A 5JJTA 4Q94A 1E7VA 5CBNA 4H7XA 4C9BB 4BTAA 1SZ9A 2GW1A 2IO2C 4TV3A 4WNGA 4BEPA 3RIBA 2KM4A 1WDYA 1H6PA 3I3NA 4U04A 1TN8A 2Y3AA 2C0MA 2R02A 3FULA 2XEEA 4FLBA 3ZXSA 4A1SA 5KJNA 4DX5D 5E76A 5EILA 5AJDA 3TXNA 5AN8A 3SBTB 4J6IA 4MKTA 2WVIA 4U0SA 3CHSA 5EN5D 4GZ6A 4LNUD 3UUXA 4G26A 1HS6A 3S7DA 1HU3A 4F1SA 2XGMA 4K5CA 1A17A 4Y6CA 1UN9A 3PDNA 4I6JA 4GA1A 1H2UA 5A7DB 3LS8A 3EIQC 2IOLA 4N2QA 4F6RD 5IY5E 1TNYA 2DIWA 1SQMA 3P2BA 5FQ6A 3ASGA 2P9KG 1K1BA 2E2EA 2AWIA 1OWLA 3GW4A 4F7AA 2OOEA 3W9FA 2NYJA 1RW2A 3IKOB 2BTDA 3D9NA 4JEUA 3B7SA 5CRUA 2GRMA 4GTPA 1TNBA 2LSUA 1DVPA 3Q9UC 1N0QA 2EIJE 5FQ7A 3CV0A 2JABA 2BKKB 4EHMA 1QBQA 2QY7A 2BF0X 5D66A 3EIJA 2FO7A 2QFCA 4AY5A 3QDNA 3PH0C 4CDRA 5ENOD 1B89A 3GZSA 2XPYA 3ASOE 3APCA
chains in the Genus database with same CATH topology
3FUEA 4A1GA 3IBEA 1IHGA 3RRUA 3EDTB 3QNKA 2YNQA 3O4ZA 2HR2A 5C1DA 3KS2A 4WUYA 5BV1A 2XHEA 3G2SA 2XRZA 2CG2A 3EHMA 3ASHA 3PS6A 4EQFA 4XKBA 2PM6A 3D9MA 3PEVB 3QC1A 3LVQE 1H2VC 2KZTA 4AXHA 4WWPA 2IQCA 4FU3A 5ANLA 4I6GA 4DLOA 4J8EA 3URZA 3VTXA 4PS8A 4U0ZA 1NP7A 3CHRA 5ARFA 3QOUA 4F3VA 3QAQA 5CMWA 2IF4A 3ASDA 3FUMA 5EX3A 2YHCA 3BG1B 5G04J 4EZJA 3QB2A 4KYOB 5LCWJ 3MZLB 4L1BA 2JEKA 4KVOA 4Q69A 1EDUA 3APDA 4WWNA 4D10C 2FBNA 2IONA 5G05C 5LP0A 2AW6A 3IHVA 5LCWC 1HF8A 3ML9A 3ULQA 4BTBA 4E85A 4GZCA 3AS5A 2WXMA 4JL0A 4B8AA 5C2YA 2NC9A 3GZ1A 5HQ8A 3GZ2A 5ARGA 3MJWA 4N3AA 3FTVA 4BSXA 1P5QA 4KMOA 1TEZA 4YVOA 1WAO1 4J8SA 1N54A 5LX8A 2WQ6A 1HE8A 3D9OA 1W3BA 2LO6A 3CK7A 3LCAA 3VTYA 4GU5A 4HOTA 3FUJA 4DJAA 2L0TB 2PL2A 4WNFA 4AOFA 4ANXA 2XPZA 4B0ZA 3FUKA 4EECA 3LKUA 3NZSA 1JPLA 2UY1B 3C98A 4KXKB 4CDNA 3RRNB 5BUZA 1XNFA 4B94A 1E7UA 2L0IA 3FU6A 3ZHEA 5KJMA 3SNXA 3L22A 4J0UA 4GAAA 4M3OA 1HG2A 3ZYMA 2CHZA 3ESKA 3QK0A 4JEHA 3FH7A 3UT4A 3RKVA 3O48A 3RU0A 3UMVA 1L5JA 2CHWA 2VTBA 3FTZA 5J08A 3N71A 4UWLA 2Y4TA 3KD7A 3VLEA 3CVVA 3NZUA 4ATGA 4YVQC 3FH5A 1E8ZA 3UT8A 3FTYA 3ZEFA 2MHKA 1ELRA 2PQNA 3PUKA 4CT4A 2WXRA 3SHFA 4FLHA 5LOZA 2IJGX 3CVUA 2XRYA 5FQ8A 4IRUA 2WXFA 4N5CA 3LY7A 4AP2A 2DBAA 2M63A 4DI3A 2LSVA 4XIFA 2HM8A 4C0MA 4ACLA 3RO3A 5FT9A 2VGXB 4AVXA 4EZKA 2WXGA 4L7TA 3BEEA 1UG3A 4N3CA 3CHOA 4W9RA 5G04C 4I17A 2Y4UA 1YA0A 4L2YA 1KT1A 1JWGA 4GCOA 3S7JA 2J49A 3D3MA 2ONDA 2JLBA 1MQSA 3FUNA 5EX0A 4APOA 4JA9A 1EF1C 5E75A 2FI7A 3G2UA 4MLPA 3CVXA 2MOWA 1IQRA 2PQRA 4ANVA 2CFUA 1E8XA 2VSOE 5FWQA 1E8WA 3CHMA 5CCMA 4JA7A 4KZ0A 4XE0A 2WXQA 4H7YA 4BFRA 2LNIA 1LF8A 4KVMA 2WXLA 3RO2A 2BUGA 4HORA 3BG0B 4K03A 2WQ7A 4FJZA 4U8HA 4UQZA 4G25A 4JPSA 2XEVA 3ZYLA 3IV0A 3CHPA 3L17A 1XGWA 2WXIA 4CDMA 1ZU2A 2V0PA 1OUVA 3MEKA 2CHXA 2UWJG 2V4LA 3FU3A 3I4RB 3MV3B 4GMJA 4JHRA 4C0EA 3TXMA 1ELKA 3L6AA 4A3TA 3IHYA 2RD0A 3DPDA 3LJ3A 1HZ4A 3PRZA 2KATA 1FCHA 4V3IA 5FQ4A 3FP3A 3TAXA 2CFZA 3PE3A 4LERA 4AEZC 4HLEA 4NQ0A 3QWVA 3PREA 4G23A 2V5FA 3QKYA 2I6HA 2RG8A 4LEUA 3TJPA 2J07A 5A6CA 2NSZA 3S7BA 1OWMA 1GW6A 4PH4B 4UWGA 3LY9A 5FZRA 5EDSA 2C2LA 5CMYA 2X6FA 4RG9A 3OAWA 2WB2A 3UPVA 2LAIA 2FULA 2X6JA 4LUNU 5DIZA 4A55A 5A23A 3RRMB 3CK8A 3MYVA 2UY1A 5LFAA 5JHBA 4I1MA 4AJWA 1OWPA 1OWNA 3FFLA 3MKRA 4JW1A 4KZCA 3UT7A 4DPRA 5T3RA 3HYMB 3CVNA 5BW8C 3G2VA 4AY6A 4BWRA 5D0OD 2VSXE 2XPIA 3ASFA 4I6EA 4APFA 4NURA 5BT1A 3LXUX 4O6FA 4N39A 3PNTB 4HS2A 4UQYA 4JZYA 4GZDA 4PS3A 2J4DA 1E8YA 4RSYA 1S0PA 4UWFA 3PE4A 2R17C 4GA2A 4ME2A 4YNDA 3FEYA 5AIJA 4XI0A 1ELWA 4ILGA 2J4BA 1IQUA 3FUFA 4FHKA 2OVBA 1INZA 3WXXA 5M72A 3L16A 1HH8A 3D9KA 3FY4A 4GYOA 3AS4A 2L9BA 3ENEA 2WXPA 3FTUA 2KCKA 1Z3XA 4BY6A 4Q96A 2VGXA 2J09A 4JHJA 3AU5A 2XCBA 3Q49B 3MA5A 3U9WA 3NQPA 3QJZA 1HO8A 5CCLA 3T5VA 3ZW3A 4N2SA 2X3MA 4CCAA 4CRWA 1FVHA 3TGOA 2WMOA 3ZN3A 4HVBA 4TRQA 2P58C 4MS6A 4U0UA 3CEQA 4AV7A 5BPPA 1Y6IA 2I1JA 2AXUA 1KLXA 2AXZA 3FU5A 3ONKA 3RJVA 3ZYKA 2LAHA 2I9CA 3TG5A 4BX8A 2HYZA 3D9LA 4F53A 1MHQA 3K9IA 2FEZA 2X6KA 3IEGA 3L13A 4IN3B 4E6HA 3MCXA 3B7TA 4L2LA 5FZQA 1N52A 2Q7FA 3CVQA 3Q15A 4HOQA 3R9AB 1H19A 4ABNA 1UW4B 1NA0A 2J08A 4K0RA 4UWHA 4I1AA 5DBKA 2WXNA 4RG6A 4WAFA 3ML8A 3D9IA 3PNLB 3T8MA 4OVVA 3CIAA 4L23A 5AJLA 3UQ3A 4I2WA 1HX8A 2YINA 1HG5A 2WM9A 3HDXA 3AU4A 2OV8A 4FHJA 3CHQA 3R7QA 2GGFA 4RVBA 2VQ2A 1X5BA 5ENNA 3B7RL 3CK9A 5G55A 2XGSA 4FC8A 3B13A 4GCNA 1PAQA 3U4TA 2AVPA 4XKCA 4CGWA 2R59A 1HXIA 1VDYA 2VSNA 3AS8A 2MRIA 3FEXA 2J9QA 4DI4A 3PUJA 4FA6A 4LRZA 3DBSA 4OVUA 4UWKA 4GA0A 2NXPA 4BX9A 3SI5A 2HO1A 2X38A 1OWOA 2YHEA 3ZPJA 3OXGA 2X6IA 4URKA 5G2NA 2IOSA 3ZFWA 3ZHEB 3PEUB 3JUIA 3G2WA 5JHAA 2VSYA 1FVFA 2R5SA 5KCMA 4FP7A 2VTBB 3FDHA 3CVYA 4AIFA 2X6HA 3MKQB 2EQXA 3ZRHA 1E96B 4UI9C 2ZU6B 4HOUA 1UN8A 1ZBPA 4GYYA 1Y8MA 3LEWA 3ZGQA 2KCVA 4BT8A 4FADA 3SZ7A 2WXHA 1WM5A 4J8FA 4B8CB 3LVRE 1Z6TA 2CG3A 3LDZA 4FULA 2ILRA 4I1OB 4PDXA 5JJTA 4WWOA 3LYAA 4Q94A 1E7VA 3SBSA 4GPKA 1DNPA 4N3BA 4H7XA 4GMLA 2DCPA 4C9BB 4BTAA 1IYGA 1SZ9A 5BV0A 5ANRA 1PY1A 3TL5A 2GW1A 3CSFA 2PM7A 1H0AA 4R7LA 4TV3A 4WNGA 2WXOA 3ONLA 3RIBA 3S2AA 3HVEB 5FTPA 1TJFA 2KM4A 3U64A 1JUQA 4G2VA 5BNWA 3I3NA 4U04A 1EYHA 5KJKA 2KZTB 2Y3AA 3QARA 2C0MA 4XI9A 3JYSA 3FULA 1UJKA 3FUHA 3OXLA 4FLBA 3ZXSA 4I9EA 3CKBA 1QZ2A 2WXKA 3FWVA 3FTXA 4A1SA 5KJNA 2AXVA 4TUUA 4CEMA 3MV2B 1U3DA 3CVWA 4MRUA 3VLDA 3CR3A 4ACKA 1E90A 5E76A 2KCLA 3ESLA 4FJYA 4A3VA 5AJDA 3LY8A 5HI7A 3TXNA 1H6KA 3APFA 3L08A 2WPVA 4U07A 3TG4A 4HOSA 5FJYA 4IULA 3SBTB 4J6IA 4G11A 3CLJA 3FTWA 1WY6A 4UI9K 2KC7A 3HHMA 5EKQD 4MKTA 2XCCA 4G1TA 2IFUA 4XZ4A 5JJ6A 2WVIA 3CVLA 5KJLA 3E4BA 3CKCA 3EHNA 4I2ZA 3I5PA 3D9JA 4U0SA 4DLQA 3CHSA 3SF4A 1HFAA 4PS7A 3VLFA 3UX4A 4GZ6A 3EJNA 4JVSA 4PUCA 1NA3A 2PZIA 3UUXA 2E0IA 4G26A 1HS6A 3S7DA 2YQ8A 2OVFA 5CHEE 3FUDA 3KAEA 4GYWA 1HU3A 4U63A 4F1SA 3CSTA 1JWFA 2XGMA 1A17A 4Y6CA 2WQHA 1UN9A 3PDNA 3HIZA 4I6JA 4GA1A 4GZ5A 1H2UA 4DK5A 3CVPA 5A7DB 3LS8A 3EIQC 2VYIA 4NRHB 2IOLA 3MKQA 4N2QA 1PC2A 2I1KA 3FTSA 1QNFA 5FZSA 4GB9A 3MGBA 4I9CA 1H2TC 5T4YA 2DIWA 4IYPA 4CGVA 4HXIA 2WMNA 3U66A 1SQMA 5JJ7A 2V8SE 3NF1A 3R7RA 3OTNA 3P2BA 4WNDA 3QWPA 5FQ6A 3S7FA 4B89A 3ASGA 2A4ZA 4BT9A 3G2TA 3ZIMA 3LPZA 4ILHB 1QQEA 3JQ1A 4CT0A 4AM9A 3FUIA 3GYZA 3PZDA 4JXTA 2FF4A 2E2EA 2AWIA 1OWLA 3GW4A 3CQGB 5T8IA 3FU0A 4F7AA 2OOEA 3PVLA 1Z3YA 4HFGA 3FH8A 4KBQA 2L6JA 3CQCB 3MX3A 4UQXA 4Y6WA 4I43A 3SFZA 4OYSA 4KT6B 2I2OA 1U3CA 4G24A 3IKOB 1TJCA 3Q4AB 2BTDA 5AENA 4J8DA 4LCTA 5J90A 3D9NA 5D0QD 3JCKC 3B7SA 3FHEA 4JEUA 3P1UA 2GRMA 1NZNA 3SD5A 3RK6A 2WXJA 1SZAA 2LSUA 3QWWA 1DVPA 3KEZA 4GZ3A 3T5XA 4ANUA 3OXFA 4ILIA 4EPZA 2VGYA 2GRLA 4EZLA 2XGOA 5FQ7A 3ZYQA 4P29A 3CV0A 3D9PA 5AYWD 3I4GA 3B7UX 3Q5MA 2C0LA 4JHKA 2IU1A 4XX5A 1BPOA 5G05J 2QY7A 2VJ8A 2BF0X 4UI9J 3EIJA 2FO7A 3HVEA 4WNEA 2QFCA 3SGHA 3Q47B 3ZVVA 3QDNA 4AY5A 4EBAG 3PH0C 3JQ0A 4CDRA 1B89A 4NACA 4ANWA 3GZSA 4JC8A 3U3WA 2A5UA 2XPYA 4EBAA 1EPUA 4QFVA 1KT0A 3CGHA 3APCA 2XQ0A 3L54A 1UJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPV A;  1NA0 A;  2FI7 A;  4U07 A;  3TG4 A;  4HOS A;  1IHG A;  3EDT B;  2PQR A;  5FJY A;  2HR2 A;  4I1A A;  5C1D A;  5DBK A;  3KS2 A;  4WUY A;  4RG6 A;  4APO A;  4UI9 K;  2KC7 A;  5CCM A;  3UQ3 A;  4HOT A;  4JA7 A;  4I2W A;  3ASH A;  2XCC A;  5EKQ D;  4G1T A;  2IFU A;  4H7Y A;  4EQF A;  5JJ6 A;  2LNI A;  5KJL A;  3CVL A;  3E4B A;  3RO2 A;  2BUG A;  3CKC A;  4HOR A;  4I2Z A;  2VQ2 A;  4UQZ A;  4G25 A;  4U0S A;  3CK9 A;  2XEV A;  2XGS A;  3SF4 A;  4J8E A;  3URZ A;  3VTX A;  4GCN A;  4U0Z A;  3U4T A;  2AVP A;  4CGW A;  4GZ6 A;  1HXI A;  2VSN A;  1ZU2 A;  1NA3 A;  3AS8 A;  5ARF A;  3QOU A;  2PZI A;  4F3V A;  3UUX A;  1OUV A;  2J9Q A;  4G26 A;  2IF4 A;  3ASD A;  3MEK A;  2UWJ G;  3MV3 B;  2YHC A;  4JHR A;  5EX3 A;  3S7D A;  2YQ8 A;  5CHE E;  5G04 J;  4GA0 A;  4KYO B;  5LCW J;  3KAE A;  4GYW A;  1HZ4 A;  2XGM A;  1A17 A;  2HO1 A;  2KAT A;  1FCH A;  2WQH A;  3OXG A;  3PDN A;  4Y6C A;  3ZPJ A;  2FBN A;  5G05 C;  3FP3 A;  3TAX A;  3PE3 A;  4GA1 A;  4GZ5 A;  3ZFW A;  3ZHE B;  4AY5 A;  5LCW C;  3ULQ A;  3CVP A;  3QWV A;  4NQ0 A;  2VSY A;  5A7D B;  4BTB A;  4G23 A;  2VYI A;  4NRH B;  2V5F A;  3AS5 A;  3QKY A;  4N2Q A;  2R5S A;  1PC2 A;  2I6H A;  4JL0 A;  5HQ8 A;  2NC9 A;  3GZ1 A;  4LEU A;  5FZS A;  4I9C A;  3GZ2 A;  5A6C A;  3S7B A;  5FZR A;  4CGV A;  3LY9 A;  5ARG A;  2C2L A;  4RG9 A;  4N3A A;  4AIF A;  3UPV A;  5JJ7 A;  1P5Q A;  3NF1 A;  5DIZ A;  4WND A;  3QWP A;  4YVO A;  1WAO 1;  3CK8 A;  3S7F A;  2UY1 A;  3ASG A;  1E96 B;  4UI9 C;  4BT9 A;  1W3B A;  3FFL A;  3MKR A;  4HOU A;  1ZBP A;  3LPZ A;  3CK7 A;  1QQE A;  1Y8M A;  3LCA A;  4GYY A;  3VTY A;  3HYM B;  3CVN A;  5HI7 A;  5BW8 C;  2PL2 A;  4WNF A;  2KCV A;  3ZGQ A;  4AM9 A;  4BT8 A;  4AY6 A;  3GYZ A;  4BWR A;  3SZ7 A;  1WM5 A;  2FF4 A;  3LKU A;  2E2E A;  4J8F A;  5D0O D;  2XPI A;  3GW4 A;  2UY1 B;  3ASF A;  4KXK B;  5BT1 A;  4O6F A;  4N39 A;  4UQY A;  2OOE A;  1XNF A;  4B94 A;  4KBQ A;  4Y6W A;  2L6J A;  3ZHE A;  5JJT A;  4UQX A;  3LYA A;  5KJM A;  3PE4 A;  4GA2 A;  4J0U A;  4ME2 A;  4N3B A;  4H7X A;  4YND A;  4GPK A;  4XI0 A;  1ELW A;  4G24 A;  1TJC A;  3ESK A;  3Q4A B;  4BTA A;  4J8D A;  1IYG A;  3RKV A;  5D0Q D;  3O48 A;  3RU0 A;  2GW1 A;  3WXX A;  1NZN A;  5M72 A;  1HH8 A;  3N71 A;  2Y4T A;  3KD7 A;  2LSU A;  4GYO A;  4YVQ C;  4WNG A;  3QWW A;  3AS4 A;  4GZ3 A;  3RIB A;  2MHK A;  3OXF A;  1ELR A;  2PQN A;  2KCK A;  2VGY A;  5FTP A;  2XGO A;  2VGX A;  3CV0 A;  5AYW D;  2XCB A;  3Q49 B;  4G2V A;  5BNW A;  3MA5 A;  3Q5M A;  2C0L A;  4U04 A;  4XIF A;  5CCL A;  5KJK A;  4N2S A;  4N5C A;  2C0M A;  3LY7 A;  4XI9 A;  3JYS A;  5G05 J;  2DBA A;  3OXL A;  3ZN3 A;  3TGO A;  2LSV A;  4UI9 J;  4WNE A;  2FO7 A;  4I9E A;  2P58 C;  2QFC A;  3CKB A;  3Q47 B;  3CEQ A;  1QZ2 A;  3QDN A;  3FWV A;  4U0U A;  5FT9 A;  2VGX B;  1KLX A;  3RO3 A;  1B89 A;  4A1S A;  3RJV A;  4CDR A;  5KJN A;  3MV2 B;  3TG5 A;  2HYZ A;  3U3W A;  3BEE A;  3K9I A;  4N3C A;  2FEZ A;  3IEG A;  4W9R A;  4IN3 B;  2KCL A;  5G04 C;  5FZQ A;  4I17 A;  1KT0 A;  2Y4U A;  1YA0 A;  1KT1 A;  2Q7F A;  3CVQ A;  3Q15 A;  3S7J A;  4GCO A;  4HOQ A;  5EX0 A;  3LY8 A;  2OND A;  2JLB A;  3R9A B;  4ABN A;  4JA9 A; 
#chains in the Genus database with same CATH topology
 3RSE G;  3PZ4 A;  5C1D A;  3KS2 A;  5BV1 A;  2XRZ A;  3ASH A;  1H2V C;  2KZT A;  4AXH A;  4DLO A;  4PS8 A;  4U0Z A;  1NP7 A;  5ARF A;  2IF4 A;  2B0O E;  3BG1 B;  3L9T A;  5G04 J;  3QB2 A;  3MZL B;  4KVO A;  3DRA A;  1V55 E;  4GZC A;  5C2Y A;  3E33 A;  4BSX A;  1W3B A;  2LO6 A;  3LCA A;  4HOT A;  2L0T B;  2PL2 A;  4B0Z A;  3D9H A;  1JPL A;  1S63 A;  4CDN A;  2Y69 E;  4J0U A;  4GAA A;  4DRX E;  3EU9 A;  3ESK A;  3FH7 A;  3RKV A;  3UMV A;  1L5J A;  3FTZ A;  5J08 A;  3VLE A;  2RKK A;  2MHK A;  2PQN A;  3T8K A;  3T9K A;  4IRU A;  1FT2 A;  3UIP C;  3ABL E;  4XIF A;  2HM8 A;  4C0M A;  3RO3 A;  4L7T A;  3BEE A;  3CHO A;  1MYO A;  3B95 A;  4DUI A;  3UTM A;  1JWG A;  3S7J A;  2OND A;  4APO A;  4JA9 A;  3G2U A;  2PQR A;  1E8X A;  2VSO E;  3IXE A;  4KZ0 A;  1N11 A;  4XE0 A;  4BFR A;  1LF8 A;  4KVM A;  2WXL A;  4HOR A;  1YMP A;  4K03 A;  5JMN D;  3ZYL A;  3X2Q E;  1XGW A;  2H6G A;  4CDM A;  3FU3 A;  4C0E A;  3WG7 E;  3TXM A;  1ELK A;  4A3T A;  2RD0 A;  3DPD A;  2R03 A;  3TAX A;  1OCR E;  4HLE A;  3QWV A;  3PRE A;  4G23 A;  3QKY A;  2H6H A;  4LEU A;  5A6C A;  3HG0 D;  4RG9 A;  3OAW A;  3UPV A;  5DIZ A;  3RRM B;  5LFA A;  3TWV A;  1O1S A;  4I1M A;  4AJW A;  4JW1 A;  5T3R A;  3PZ3 A;  3TWW A;  4BWR A;  4N39 A;  2DZO A;  4RSY A;  5FIN A;  3PE4 A;  3FEY A;  2J4B A;  1IQU A;  3W9G A;  5M72 A;  3L16 A;  4GMR A;  2GRR B;  3ZNG A;  2VGX A;  3AU5 A;  2RFA A;  4HRL A;  2X3M A;  3V2X A;  3TGO A;  2WMO A;  4DX7 D;  4MS6 A;  5BPP A;  2BKG A;  2AXU A;  3ZYK A;  2LAH A;  3TG5 A;  4F53 A;  1MHQ A;  3K9I A;  5HKP A;  1N52 A;  1O1R A;  4F1P A;  3AG3 E;  3E32 A;  5DBK A;  2WXN A;  3T8M A;  4L23 A;  2YIN A;  3HDX A;  3AU4 A;  1YCS B;  2GGF A;  3DPY A;  3B7R L;  2XGS A;  4FC8 A;  3B13 A;  3U4T A;  5H7P A;  2J9Q A;  4GTQ A;  2NXP A;  1OY3 D;  1OWO A;  3ZPJ A;  3E34 A;  4URK A;  5G2N A;  3JUI A;  2R5S A;  1N4Q A;  5AQ7 A;  1TR4 A;  3FDH A;  3JXJ A;  4AIF A;  4TXR A;  2X6H A;  1UN8 A;  1ZBP A;  2IEJ A;  5JA4 D;  2KCV A;  2WXH A;  4B8C B;  4U96 D;  3Q79 A;  1N9A A;  3LYA A;  2DCP A;  1PY1 A;  1SA4 A;  3CSF A;  5AAR A;  3EHR A;  3ONL A;  4LSZ E;  1TJF A;  2PNN A;  3JYS A;  4ATZ D;  1UJK A;  2P9N G;  3FUH A;  1JCS A;  2ETC A;  2AXV A;  3C3R A;  4TUU A;  3MV2 B;  3CVW A;  3VLD A;  4ACK A;  4J7W A;  3ESL A;  3ZUV B;  5HI7 A;  1H6K A;  3APF A;  3L08 A;  2WPV A;  3TG4 A;  4HOS A;  4IUL A;  3CLJ A;  2KC7 A;  4XZ4 A;  3CVL A;  3CKC A;  3EHN A;  3L82 A;  3C3O A;  4U7E B;  3SF4 A;  4PS7 A;  3EJN A;  1NA3 A;  3SO8 A;  5CHE E;  2OVF A;  3HRA A;  4MBG A;  4U63 A;  1KPS B;  2H6F A;  4ZHB A;  3TWU A;  4DK5 A;  1TNZ A;  4NRH B;  3DWL G;  3FTS A;  1QNF A;  2V8S E;  4WND A;  3QWP A;  1N95 A;  3S7F A;  3BQO A;  2A4Z A;  4BT9 A;  3HXC A;  1QQE A;  4CT0 A;  3PZD A;  4JXT A;  3C3Q A;  4HFG A;  4Y6W A;  1G3N B;  2OEV A;  4I43 A;  5AEN A;  4HRM B;  4LCT A;  5J90 A;  3RK6 A;  2WXJ A;  4ANU A;  2GRL A;  2DVW A;  2XGO A;  5AYW D;  2C0L A;  1BPO A;  3SGH A;  4EBA G;  2Y0B G;  4JC8 A;  1N94 A;  4EBA A;  1EPU A;  4QFV A;  1TN6 A;  3CGH A;  3AAA C;  3EHQ A;  1AP7 A;  4HQD A;  2XQ0 A;  1UJJ A;  5BXU A;  3RRU A;  4WUY A;  2XHE A;  3G2S A;  3EHM A;  3PS6 A;  2ETB A;  5KBA A;  4XKB A;  3PEV B;  3QC1 A;  4WWP A;  3UXG A;  4FU3 A;  4J8Y A;  4J8E A;  3CHR A;  4F3V A;  3QOU A;  3UI2 A;  3FUM A;  5EX3 A;  4CZ2 D;  4KYO B;  5LCW J;  3JXI A;  4Q69 A;  1OCC E;  4CYM D;  4YDW A;  1IKN D;  4HI8 A;  2ION A;  5G05 C;  5LP0 A;  1HF8 A;  3ML9 A;  4BTB A;  1N4S A;  4JL0 A;  4B8A A;  1ZB1 A;  3GZ1 A;  2KBX A;  2ZIR A;  3FTV A;  4J8S A;  1N54 A;  3KSL A;  5LX8 A;  3D9O A;  2F8X K;  4GU5 A;  4DJA A;  4OAU C;  4WNF A;  1LD8 A;  4KXK B;  3RRN B;  3ZHE A;  5KJM A;  3SNX A;  3L22 A;  2CHZ A;  2XZT G;  3PZ2 A;  2VTB A;  3N71 A;  4HI9 A;  3CVV A;  4TXP A;  4YVQ C;  3FH5 A;  1DCE A;  4DX6 D;  3ZEF A;  4CT4 A;  2WXR A;  2EIK E;  5ENR D;  1JCR A;  4DI3 A;  2LSV A;  4ACL A;  4YDE A;  4NIK A;  1UG3 A;  4N3C A;  4W9R A;  4L2Y A;  4ANX A;  4GCO A;  3HXB A;  2J49 A;  2JLB A;  2FI7 A;  4MLP A;  2MOW A;  2CFU A;  1E8W A;  3CHM A;  4JA7 A;  5CEA A;  2LNI A;  4JPS A;  2XEV A;  3MEK A;  2UWJ G;  2V4L A;  3IHY A;  1BU9 A;  1HZ4 A;  1MX2 A;  3PRZ A;  4V3I A;  3SFX A;  5FQ4 A;  2CFZ A;  3ISM C;  4NQ0 A;  2R05 A;  2V5F A;  2RG8 A;  3DSS A;  5EDS A;  3V30 A;  2C2L A;  2X6F A;  2WB2 A;  2LAI A;  3Q73 A;  5A23 A;  4LUN U;  3CK8 A;  4GTO A;  1OWN A;  4DPR A;  3HYM B;  3G2V A;  3ASF A;  1MX4 A;  4O6F A;  4UQY A;  1E8Y A;  4GA2 A;  5AIJ A;  4ME2 A;  1ELW A;  1INZ A;  3C72 A;  3WXX A;  1HH8 A;  3D9K A;  3FY4 A;  3AS4 A;  2WXP A;  3TWS A;  4Q96 A;  5CBO A;  4JHJ A;  1TNU A;  3NQP A;  3QJZ A;  3T5V A;  4CCA A;  5ENP D;  4UUC A;  2HE0 A;  4DX1 A;  4YDO A;  4AV7 A;  3CEQ A;  1Y6I A;  2I1J A;  3FU5 A;  3RJV A;  1SA5 A;  2I9C A;  3L13 A;  4E6H A;  3MCX A;  4LNG A;  2V4H C;  2Q7F A;  3Q15 A;  4K0R A;  3TWT A;  4OVV A;  5AJL A;  1HG5 A;  3CK9 A;  1FT1 A;  4GCN A;  2QC9 A;  1VDY A;  3AS8 A;  2MRI A;  3FEX A;  4DI4 A;  3AJI A;  4LRZ A;  2ZGD A;  4UWK A;  4BX9 A;  5EYP F;  3ZFW A;  4GTR A;  2DYS E;  3CVY A;  5ENQ D;  2EQX A;  2ZU6 B;  3ZKJ A;  4HOU A;  3LEW A;  5AAO A;  2DWZ A;  3ZGQ A;  4BT8 A;  1WM5 A;  2DZN A;  2CG3 A;  4FUL A;  4I1O B;  4WWO A;  3SBS A;  4GPK A;  1DNP A;  4N3B A;  4GML A;  1BI7 B;  5ANR A;  3TL5 A;  3S2A A;  5FTP A;  3U64 A;  1JUQ A;  4G2V A;  5BNW A;  2KZT B;  1NL4 A;  3OXL A;  3ZU7 B;  3SFY A;  2EIL E;  1QZ2 A;  3ABK E;  2P9I G;  1U3D A;  4MRU A;  3CR3 A;  1E90 A;  2KCL A;  4FJY A;  1N0R A;  5FJY A;  2QYU A;  3DSU A;  4BES A;  4G11 A;  3FTW A;  4G8L A;  4UI9 K;  3B7B A;  2XCC A;  2IFU A;  3ZXP A;  5JJ6 A;  3I5P A;  3D9J A;  4N5Q A;  4DLQ A;  1Z5S C;  3Q7A A;  5CER B;  4JVS A;  4PUC A;  2PZI A;  2GRQ B;  1JCQ A;  2YQ8 A;  3KAE A;  4GYW A;  1JWF A;  1AWC B;  2WQH A;  3Q75 A;  2AJA A;  3HIZ A;  2P9S G;  3BUA A;  3MKQ A;  4XEI G;  2I1K A;  4I9C A;  2H6I A;  5T4Y A;  4IYP A;  4CGV A;  2WMN A;  3NF1 A;  4B89 A;  3G2T A;  3ZIM A;  5AQB A;  4ILH B;  1SVX A;  4AM9 A;  3FUI A;  2FF4 A;  3FU0 A;  1K3Z D;  1Z3Y A;  3FH8 A;  4KBQ A;  2L6J A;  3CQC B;  4TXQ A;  2I2O A;  4G24 A;  1TJC A;  3Q4A B;  4J8D A;  5D0Q D;  3JCK C;  3FHE A;  1NZN A;  1BD8 A;  1SZA A;  3KEZ A;  4GZ3 A;  3OXF A;  4C48 B;  4EPZ A;  2EIM E;  1NFI E;  3ZYQ A;  3D9P A;  3I4G A;  1FPP A;  2P2C P;  1IHB A;  4JHK A;  2IU1 A;  4XX5 A;  5G05 J;  5EID A;  3ZVV A;  1KZP A;  3HVE A;  3Q47 B;  4NAC A;  4ANW A;  3U3W A;  2A5U A;  4A1G A;  3AG2 E;  3EUV A;  3IBE A;  3Q9N C;  1IHG A;  3EDT B;  2YNQ A;  2J8S D;  4U95 D;  1N4P A;  3DXK G;  4EQF A;  2PM6 A;  3NBN B;  3LVQ E;  3J5Q B;  2IQC A;  3VTX A;  4RLY A;  3QAQ A;  5CMW A;  1S64 A;  3ASD A;  4L1B A;  1EDU A;  3DSV A;  2LXL A;  4D10 C;  2FBN A;  2AW6 A;  3IHV A;  3TWQ A;  5LCW C;  4E85 A;  3ULQ A;  1BI8 B;  2WXM A;  5HQ8 A;  4OAV B;  3GZ2 A;  4O1P A;  5ARG A;  2LUH A;  3MJW A;  4N3A A;  3UM2 A;  1TEZ A;  4YVO A;  3C5R A;  2WQ6 A;  3VTY A;  3FUJ A;  4EEC A;  3FUK A;  3NZS A;  2UY1 B;  3C98 A;  4B94 A;  2L0I A;  3FU6 A;  2P9U G;  1HG2 A;  3ZYM A;  3UT4 A;  2OEW A;  4UWL A;  2Y4T A;  3KD7 A;  3UT8 A;  3HXD A;  3FTY A;  1ELR A;  3PUK A;  3CVU A;  4HNA D;  2QYJ A;  2WXF A;  4N5C A;  2DBA A;  2EIN E;  2M63 A;  5B1B E;  5G04 C;  4I17 A;  1MQS A;  3FUN A;  3PZ1 A;  5E75 A;  2LXM A;  1IQR A;  2VGE A;  5FWQ A;  2WXQ A;  1U2V G;  2GRN B;  3RO2 A;  2BUG A;  1OCZ E;  4TUM A;  2WQ7 A;  4O1O A;  3CHP A;  3L17 A;  3DST A;  1X81 A;  3I4R B;  4JHR A;  3L6A A;  3LJ3 A;  1LD7 A;  5HRY A;  4U8Y D;  3FP3 A;  3PE3 A;  2F37 A;  2I6H A;  2RFM A;  3TJP A;  2J07 A;  4GTV A;  2NSZ A;  3S7B A;  1OWM A;  1K8K G;  3LY9 A;  5CMY A;  2FUL A;  2X6J A;  5JHB A;  3MKR A;  3CVN A;  4M7C A;  2VSX E;  4APF A;  4NUR A;  2KXP C;  5BT1 A;  4HS2 A;  3R9M A;  2R17 C;  4YND A;  4XI0 A;  3BU8 A;  3DEP A;  4FHK A;  3FUF A;  4GYO A;  1MZC A;  5FIO A;  2XZD G;  3NAW A;  3Q49 B;  3MA5 A;  3U9W A;  3ZW3 A;  4N2S A;  1H6O A;  3ZN3 A;  4HVB A;  5ENT D;  3ONK A;  2HYZ A;  3D9L A;  4G8K A;  2FEZ A;  3B7T A;  4L2L A;  5FZQ A;  3ULY A;  4HOQ A;  1UW4 B;  1NA0 A;  2J08 A;  4UWH A;  4U8V D;  5HS0 A;  3ML8 A;  3TWX A;  4X8Q A;  3UQ3 A;  4I2W A;  1HX8 A;  2OV8 A;  3R7Q A;  4RVB A;  1X5B A;  1PAQ A;  2R59 A;  3AG1 E;  1MX6 A;  3ULE G;  2VSN A;  4HLL A;  4FA6 A;  4GA0 A;  3SI5 A;  2HO1 A;  2A5E A;  2YHE A;  3OXG A;  5CEC B;  2X6I A;  1QYM A;  3ABM E;  3PEU B;  5JHA A;  2VSY A;  1FVF A;  4GTM A;  3DSW A;  5KCM A;  3V31 A;  1SW6 A;  3MKQ B;  3ZRH A;  2QZA A;  4GYY A;  1Y8M A;  3SZ7 A;  4J8F A;  4ZFH A;  5KWD A;  1Z6T A;  2ILR A;  4PDX A;  4B93 B;  1IYG A;  3SQV A;  5BV0 A;  2PM7 A;  1H0A A;  2L6B A;  4R7L A;  2WXO A;  3V79 K;  3HVE B;  3TWR A;  1WG0 A;  4LG6 A;  1EYH A;  5KJK A;  3QAR A;  4XI9 A;  4I9E A;  3CKB A;  2WXK A;  3FWV A;  4HBD A;  3FTX A;  1D8E A;  4CEM A;  2BED A;  4A3V A;  4JD2 G;  3LY8 A;  4LNB A;  1N4R A;  2OCC E;  4U07 A;  1WY6 A;  3HHM A;  3UKU G;  5EKQ D;  4G1T A;  5AQA A;  5KJL A;  2F8Y A;  3E4B A;  4I2Z A;  5EYL A;  5CED B;  2F0Y A;  1HFA A;  3VLF A;  3UX4 A;  2E0I A;  3FUD A;  3CST A;  3DSX A;  5B3S E;  2DYR E;  1Q2Z A;  4GZ5 A;  3CVP A;  4RQI A;  2VYI A;  1A5E A;  1PC2 A;  2ZIS A;  5FZS A;  4GB9 A;  3MGB A;  1H2T C;  1MJ0 A;  4HXI A;  4K5A B;  3U66 A;  5JJ7 A;  1KZO A;  3AG4 E;  3OTN A;  3R7R A;  2FO1 E;  1NI1 A;  3LPZ A;  3JQ1 A;  3NOC D;  5EIB E;  3GYZ A;  3E37 A;  3CQG B;  5T8I A;  4O60 A;  1D8D A;  3PVL A;  3E30 A;  3MX3 A;  4UQX A;  3SFZ A;  4OYS A;  4KT6 B;  1U3C A;  3J5P A;  1YYH A;  3P1U A;  1TYQ G;  3SD5 A;  4GTT A;  3QWW A;  5KNH D;  3T5X A;  4DX2 A;  4ILI A;  1D9S A;  2VGY A;  4EZL A;  4BSZ B;  4P29 A;  3B7U X;  3Q5M A;  5B1A E;  2ZGG A;  3LJN A;  2VJ8 A;  5D2M C;  4UI9 J;  4WNE A;  3JQ0 A;  1O1T A;  5ITZ F;  4HB5 A;  1KT0 A;  2XS1 A;  3L54 A;  3FUE A;  3QNK A;  3O4Z A;  2HR2 A;  2CG2 A;  3D9M A;  2MYO A;  5ANL A;  4I6G A;  3URZ A;  1O5M A;  2YHC A;  2R2L A;  4EZJ A;  2JEK A;  1S70 B;  3APD A;  3JUE A;  4WWN A;  1RZ4 A;  3AS5 A;  2P9P G;  3NOG D;  2NC9 A;  3ASN E;  4L9P A;  1P5Q A;  5BXO A;  4KMO A;  1WAO 1;  1HE8 A;  5CRV A;  3CK7 A;  4BET A;  4AOF A;  2XPZ A;  3LKU A;  4JB8 P;  5BUZ A;  1XNF A;  1E7U A;  4M3O A;  3QK0 A;  4JEH A;  2IO3 C;  1LTX A;  3O48 A;  3RU0 A;  2CHW A;  3NZU A;  4ATG A;  1E8Z A;  2ETA A;  4A63 B;  3SHF A;  4FLH A;  5LOZ A;  2IJG X;  2XRY A;  5FQ8 A;  3UM0 A;  2XS8 A;  3LY7 A;  4AP2 A;  4K5B A;  2VGX B;  5FT9 A;  4AVX A;  4EZK A;  2WXG A;  3EU5 A;  2Y4U A;  1YA0 A;  3Q78 A;  1KT1 A;  2GRO B;  4GTS A;  3RAU A;  5EX0 A;  3D3M A;  1EF1 C;  3CVX A;  4ANV A;  5CCM A;  4H7Y A;  1DCQ A;  3BG0 B;  4FJZ A;  4U8H A;  4UQZ A;  4G25 A;  3IV0 A;  3KSQ A;  2WXI A;  4GPM A;  1ZU2 A;  2V0P A;  5KNG A;  1OUV A;  2CHX A;  3MV3 B;  4GMJ A;  2KAT A;  1FCH A;  4HRN A;  4LER A;  4AEZ C;  5ENS D;  1BLX B;  1TNO A;  1GW6 A;  3DXM G;  4PH4 B;  4UWG A;  5FZR A;  3DEO A;  1K1A A;  1OCO E;  3HXF A;  4A55 A;  3MYV A;  2UY1 A;  1OWP A;  3FFL A;  1V54 E;  3UT7 A;  2B6C A;  4KZC A;  3F6Q A;  5BW8 C;  4AY6 A;  5D0O D;  4BER A;  2XPI A;  4I6E A;  3LXU X;  3PNT B;  4JZY A;  4GZD A;  1DC2 A;  4PS3 A;  2J4D A;  1S0P A;  4UWF A;  4ILG A;  2XEH A;  4Z68 A;  2OVB A;  2ZXW E;  2L9B A;  3ENE A;  5AQ9 A;  3FTU A;  2KCK A;  1Z3X A;  4BY6 A;  2J09 A;  2XCB A;  1HO8 A;  5CCL A;  3SY2 A;  2GRP B;  4CRW A;  1FVH A;  4TRQ A;  2P58 C;  4U0U A;  1KLX A;  2AXZ A;  4BX8 A;  2IY0 C;  2V5Q C;  3IEG A;  2X6K A;  3UM1 A;  4IN3 B;  3KEA A;  3CVQ A;  2P9L G;  3R9A B;  1H19 A;  4ABN A;  2Y1L E;  3UIO C;  4I1A A;  4WAF A;  1IXV A;  4RG6 A;  3D9I A;  3PNL B;  3CIA A;  2WM9 A;  3UKR G;  4FHJ A;  3CHQ A;  3UIN C;  3Q7F A;  2VQ2 A;  5ENN A;  5G55 A;  3NB2 A;  1TN7 A;  2AVP A;  4XKC A;  4CGW A;  1HXI A;  1UOH A;  3PUJ A;  3DBS A;  4OVU A;  2XEN A;  3UM3 A;  2X38 A;  2IOS A;  3ZHE B;  3G2W A;  4FP7 A;  2VTB B;  3HXE A;  4QQI A;  4YDY A;  1E96 B;  4UI9 C;  3V2O A;  4FAD A;  1OXJ A;  3LVR E;  3LDZ A;  1OT8 A;  5JJT A;  4Q94 A;  1E7V A;  5CBN A;  4H7X A;  4C9B B;  4BTA A;  1SZ9 A;  2GW1 A;  2IO2 C;  4TV3 A;  4WNG A;  4BEP A;  3RIB A;  2KM4 A;  1WDY A;  1H6P A;  3I3N A;  4U04 A;  1TN8 A;  2Y3A A;  2C0M A;  2R02 A;  3FUL A;  2XEE A;  4FLB A;  3ZXS A;  4A1S A;  5KJN A;  4DX5 D;  5E76 A;  5EIL A;  5AJD A;  3TXN A;  5AN8 A;  3SBT B;  4J6I A;  4MKT A;  2WVI A;  4U0S A;  3CHS A;  5EN5 D;  4GZ6 A;  4LNU D;  3UUX A;  4G26 A;  1HS6 A;  3S7D A;  1HU3 A;  4F1S A;  2XGM A;  4K5C A;  1A17 A;  4Y6C A;  1UN9 A;  3PDN A;  4I6J A;  4GA1 A;  1H2U A;  5A7D B;  3LS8 A;  3EIQ C;  2IOL A;  4N2Q A;  4F6R D;  5IY5 E;  1TNY A;  2DIW A;  1SQM A;  3P2B A;  5FQ6 A;  3ASG A;  2P9K G;  1K1B A;  2E2E A;  2AWI A;  1OWL A;  3GW4 A;  4F7A A;  2OOE A;  3W9F A;  2NYJ A;  1RW2 A;  3IKO B;  2BTD A;  3D9N A;  4JEU A;  3B7S A;  5CRU A;  2GRM A;  4GTP A;  1TNB A;  2LSU A;  1DVP A;  3Q9U C;  1N0Q A;  2EIJ E;  5FQ7 A;  3CV0 A;  2JAB A;  2BKK B;  4EHM A;  1QBQ A;  2QY7 A;  2BF0 X;  5D66 A;  3EIJ A;  2FO7 A;  2QFC A;  4AY5 A;  3QDN A;  3PH0 C;  4CDR A;  5ENO D;  1B89 A;  3GZS A;  2XPY A;  3ASO E;  3APC A; 
#chains in the Genus database with same CATH homology
 3FUE A;  4A1G A;  3IBE A;  1IHG A;  3RRU A;  3EDT B;  3QNK A;  2YNQ A;  3O4Z A;  2HR2 A;  5C1D A;  3KS2 A;  4WUY A;  5BV1 A;  2XHE A;  3G2S A;  2XRZ A;  2CG2 A;  3EHM A;  3ASH A;  3PS6 A;  4EQF A;  4XKB A;  2PM6 A;  3D9M A;  3PEV B;  3QC1 A;  3LVQ E;  1H2V C;  2KZT A;  4AXH A;  4WWP A;  2IQC A;  4FU3 A;  5ANL A;  4I6G A;  4DLO A;  4J8E A;  3URZ A;  3VTX A;  4PS8 A;  4U0Z A;  1NP7 A;  3CHR A;  5ARF A;  3QOU A;  4F3V A;  3QAQ A;  5CMW A;  2IF4 A;  3ASD A;  3FUM A;  5EX3 A;  2YHC A;  3BG1 B;  5G04 J;  4EZJ A;  3QB2 A;  4KYO B;  5LCW J;  3MZL B;  4L1B A;  2JEK A;  4KVO A;  4Q69 A;  1EDU A;  3APD A;  4WWN A;  4D10 C;  2FBN A;  2ION A;  5G05 C;  5LP0 A;  2AW6 A;  3IHV A;  5LCW C;  1HF8 A;  3ML9 A;  3ULQ A;  4BTB A;  4E85 A;  4GZC A;  3AS5 A;  2WXM A;  4JL0 A;  4B8A A;  5C2Y A;  2NC9 A;  3GZ1 A;  5HQ8 A;  3GZ2 A;  5ARG A;  3MJW A;  4N3A A;  3FTV A;  4BSX A;  1P5Q A;  4KMO A;  1TEZ A;  4YVO A;  1WAO 1;  4J8S A;  1N54 A;  5LX8 A;  2WQ6 A;  1HE8 A;  3D9O A;  1W3B A;  2LO6 A;  3CK7 A;  3LCA A;  3VTY A;  4GU5 A;  4HOT A;  3FUJ A;  4DJA A;  2L0T B;  2PL2 A;  4WNF A;  4AOF A;  4ANX A;  2XPZ A;  4B0Z A;  3FUK A;  4EEC A;  3LKU A;  3NZS A;  1JPL A;  2UY1 B;  3C98 A;  4KXK B;  4CDN A;  3RRN B;  5BUZ A;  1XNF A;  4B94 A;  1E7U A;  2L0I A;  3FU6 A;  3ZHE A;  5KJM A;  3SNX A;  3L22 A;  4J0U A;  4GAA A;  4M3O A;  1HG2 A;  3ZYM A;  2CHZ A;  3ESK A;  3QK0 A;  4JEH A;  3FH7 A;  3UT4 A;  3RKV A;  3O48 A;  3RU0 A;  3UMV A;  1L5J A;  2CHW A;  2VTB A;  3FTZ A;  5J08 A;  3N71 A;  4UWL A;  2Y4T A;  3KD7 A;  3VLE A;  3CVV A;  3NZU A;  4ATG A;  4YVQ C;  3FH5 A;  1E8Z A;  3UT8 A;  3FTY A;  3ZEF A;  2MHK A;  1ELR A;  2PQN A;  3PUK A;  4CT4 A;  2WXR A;  3SHF A;  4FLH A;  5LOZ A;  2IJG X;  3CVU A;  2XRY A;  5FQ8 A;  4IRU A;  2WXF A;  4N5C A;  3LY7 A;  4AP2 A;  2DBA A;  2M63 A;  4DI3 A;  2LSV A;  4XIF A;  2HM8 A;  4C0M A;  4ACL A;  3RO3 A;  5FT9 A;  2VGX B;  4AVX A;  4EZK A;  2WXG A;  4L7T A;  3BEE A;  1UG3 A;  4N3C A;  3CHO A;  4W9R A;  5G04 C;  4I17 A;  2Y4U A;  1YA0 A;  4L2Y A;  1KT1 A;  1JWG A;  4GCO A;  3S7J A;  2J49 A;  3D3M A;  2OND A;  2JLB A;  1MQS A;  3FUN A;  5EX0 A;  4APO A;  4JA9 A;  1EF1 C;  5E75 A;  2FI7 A;  3G2U A;  4MLP A;  3CVX A;  2MOW A;  1IQR A;  2PQR A;  4ANV A;  2CFU A;  1E8X A;  2VSO E;  5FWQ A;  1E8W A;  3CHM A;  5CCM A;  4JA7 A;  4KZ0 A;  4XE0 A;  2WXQ A;  4H7Y A;  4BFR A;  2LNI A;  1LF8 A;  4KVM A;  2WXL A;  3RO2 A;  2BUG A;  4HOR A;  3BG0 B;  4K03 A;  2WQ7 A;  4FJZ A;  4U8H A;  4UQZ A;  4G25 A;  4JPS A;  2XEV A;  3ZYL A;  3IV0 A;  3CHP A;  3L17 A;  1XGW A;  2WXI A;  4CDM A;  1ZU2 A;  2V0P A;  1OUV A;  3MEK A;  2CHX A;  2UWJ G;  2V4L A;  3FU3 A;  3I4R B;  3MV3 B;  4GMJ A;  4JHR A;  4C0E A;  3TXM A;  1ELK A;  3L6A A;  4A3T A;  3IHY A;  2RD0 A;  3DPD A;  3LJ3 A;  1HZ4 A;  3PRZ A;  2KAT A;  1FCH A;  4V3I A;  5FQ4 A;  3FP3 A;  3TAX A;  2CFZ A;  3PE3 A;  4LER A;  4AEZ C;  4HLE A;  4NQ0 A;  3QWV A;  3PRE A;  4G23 A;  2V5F A;  3QKY A;  2I6H A;  2RG8 A;  4LEU A;  3TJP A;  2J07 A;  5A6C A;  2NSZ A;  3S7B A;  1OWM A;  1GW6 A;  4PH4 B;  4UWG A;  3LY9 A;  5FZR A;  5EDS A;  2C2L A;  5CMY A;  2X6F A;  4RG9 A;  3OAW A;  2WB2 A;  3UPV A;  2LAI A;  2FUL A;  2X6J A;  4LUN U;  5DIZ A;  4A55 A;  5A23 A;  3RRM B;  3CK8 A;  3MYV A;  2UY1 A;  5LFA A;  5JHB A;  4I1M A;  4AJW A;  1OWP A;  1OWN A;  3FFL A;  3MKR A;  4JW1 A;  4KZC A;  3UT7 A;  4DPR A;  5T3R A;  3HYM B;  3CVN A;  5BW8 C;  3G2V A;  4AY6 A;  4BWR A;  5D0O D;  2VSX E;  2XPI A;  3ASF A;  4I6E A;  4APF A;  4NUR A;  5BT1 A;  3LXU X;  4O6F A;  4N39 A;  3PNT B;  4HS2 A;  4UQY A;  4JZY A;  4GZD A;  4PS3 A;  2J4D A;  1E8Y A;  4RSY A;  1S0P A;  4UWF A;  3PE4 A;  2R17 C;  4GA2 A;  4ME2 A;  4YND A;  3FEY A;  5AIJ A;  4XI0 A;  1ELW A;  4ILG A;  2J4B A;  1IQU A;  3FUF A;  4FHK A;  2OVB A;  1INZ A;  3WXX A;  5M72 A;  3L16 A;  1HH8 A;  3D9K A;  3FY4 A;  4GYO A;  3AS4 A;  2L9B A;  3ENE A;  2WXP A;  3FTU A;  2KCK A;  1Z3X A;  4BY6 A;  4Q96 A;  2VGX A;  2J09 A;  4JHJ A;  3AU5 A;  2XCB A;  3Q49 B;  3MA5 A;  3U9W A;  3NQP A;  3QJZ A;  1HO8 A;  5CCL A;  3T5V A;  3ZW3 A;  4N2S A;  2X3M A;  4CCA A;  4CRW A;  1FVH A;  3TGO A;  2WMO A;  3ZN3 A;  4HVB A;  4TRQ A;  2P58 C;  4MS6 A;  4U0U A;  3CEQ A;  4AV7 A;  5BPP A;  1Y6I A;  2I1J A;  2AXU A;  1KLX A;  2AXZ A;  3FU5 A;  3ONK A;  3RJV A;  3ZYK A;  2LAH A;  2I9C A;  3TG5 A;  4BX8 A;  2HYZ A;  3D9L A;  4F53 A;  1MHQ A;  3K9I A;  2FEZ A;  2X6K A;  3IEG A;  3L13 A;  4IN3 B;  4E6H A;  3MCX A;  3B7T A;  4L2L A;  5FZQ A;  1N52 A;  2Q7F A;  3CVQ A;  3Q15 A;  4HOQ A;  3R9A B;  1H19 A;  4ABN A;  1UW4 B;  1NA0 A;  2J08 A;  4K0R A;  4UWH A;  4I1A A;  5DBK A;  2WXN A;  4RG6 A;  4WAF A;  3ML8 A;  3D9I A;  3PNL B;  3T8M A;  4OVV A;  3CIA A;  4L23 A;  5AJL A;  3UQ3 A;  4I2W A;  1HX8 A;  2YIN A;  1HG5 A;  2WM9 A;  3HDX A;  3AU4 A;  2OV8 A;  4FHJ A;  3CHQ A;  3R7Q A;  2GGF A;  4RVB A;  2VQ2 A;  1X5B A;  5ENN A;  3B7R L;  3CK9 A;  5G55 A;  2XGS A;  4FC8 A;  3B13 A;  4GCN A;  1PAQ A;  3U4T A;  2AVP A;  4XKC A;  4CGW A;  2R59 A;  1HXI A;  1VDY A;  2VSN A;  3AS8 A;  2MRI A;  3FEX A;  2J9Q A;  4DI4 A;  3PUJ A;  4FA6 A;  4LRZ A;  3DBS A;  4OVU A;  4UWK A;  4GA0 A;  2NXP A;  4BX9 A;  3SI5 A;  2HO1 A;  2X38 A;  1OWO A;  2YHE A;  3ZPJ A;  3OXG A;  2X6I A;  4URK A;  5G2N A;  2IOS A;  3ZFW A;  3ZHE B;  3PEU B;  3JUI A;  3G2W A;  5JHA A;  2VSY A;  1FVF A;  2R5S A;  5KCM A;  4FP7 A;  2VTB B;  3FDH A;  3CVY A;  4AIF A;  2X6H A;  3MKQ B;  2EQX A;  3ZRH A;  1E96 B;  4UI9 C;  2ZU6 B;  4HOU A;  1UN8 A;  1ZBP A;  4GYY A;  1Y8M A;  3LEW A;  3ZGQ A;  2KCV A;  4BT8 A;  4FAD A;  3SZ7 A;  2WXH A;  1WM5 A;  4J8F A;  4B8C B;  3LVR E;  1Z6T A;  2CG3 A;  3LDZ A;  4FUL A;  2ILR A;  4I1O B;  4PDX A;  5JJT A;  4WWO A;  3LYA A;  4Q94 A;  1E7V A;  3SBS A;  4GPK A;  1DNP A;  4N3B A;  4H7X A;  4GML A;  2DCP A;  4C9B B;  4BTA A;  1IYG A;  1SZ9 A;  5BV0 A;  5ANR A;  1PY1 A;  3TL5 A;  2GW1 A;  3CSF A;  2PM7 A;  1H0A A;  4R7L A;  4TV3 A;  4WNG A;  2WXO A;  3ONL A;  3RIB A;  3S2A A;  3HVE B;  5FTP A;  1TJF A;  2KM4 A;  3U64 A;  1JUQ A;  4G2V A;  5BNW A;  3I3N A;  4U04 A;  1EYH A;  5KJK A;  2KZT B;  2Y3A A;  3QAR A;  2C0M A;  4XI9 A;  3JYS A;  3FUL A;  1UJK A;  3FUH A;  3OXL A;  4FLB A;  3ZXS A;  4I9E A;  3CKB A;  1QZ2 A;  2WXK A;  3FWV A;  3FTX A;  4A1S A;  5KJN A;  2AXV A;  4TUU A;  4CEM A;  3MV2 B;  1U3D A;  3CVW A;  4MRU A;  3VLD A;  3CR3 A;  4ACK A;  1E90 A;  5E76 A;  2KCL A;  3ESL A;  4FJY A;  4A3V A;  5AJD A;  3LY8 A;  5HI7 A;  3TXN A;  1H6K A;  3APF A;  3L08 A;  2WPV A;  4U07 A;  3TG4 A;  4HOS A;  5FJY A;  4IUL A;  3SBT B;  4J6I A;  4G11 A;  3CLJ A;  3FTW A;  1WY6 A;  4UI9 K;  2KC7 A;  3HHM A;  5EKQ D;  4MKT A;  2XCC A;  4G1T A;  2IFU A;  4XZ4 A;  5JJ6 A;  2WVI A;  3CVL A;  5KJL A;  3E4B A;  3CKC A;  3EHN A;  4I2Z A;  3I5P A;  3D9J A;  4U0S A;  4DLQ A;  3CHS A;  3SF4 A;  1HFA A;  4PS7 A;  3VLF A;  3UX4 A;  4GZ6 A;  3EJN A;  4JVS A;  4PUC A;  1NA3 A;  2PZI A;  3UUX A;  2E0I A;  4G26 A;  1HS6 A;  3S7D A;  2YQ8 A;  2OVF A;  5CHE E;  3FUD A;  3KAE A;  4GYW A;  1HU3 A;  4U63 A;  4F1S A;  3CST A;  1JWF A;  2XGM A;  1A17 A;  4Y6C A;  2WQH A;  1UN9 A;  3PDN A;  3HIZ A;  4I6J A;  4GA1 A;  4GZ5 A;  1H2U A;  4DK5 A;  3CVP A;  5A7D B;  3LS8 A;  3EIQ C;  2VYI A;  4NRH B;  2IOL A;  3MKQ A;  4N2Q A;  1PC2 A;  2I1K A;  3FTS A;  1QNF A;  5FZS A;  4GB9 A;  3MGB A;  4I9C A;  1H2T C;  5T4Y A;  2DIW A;  4IYP A;  4CGV A;  4HXI A;  2WMN A;  3U66 A;  1SQM A;  5JJ7 A;  2V8S E;  3NF1 A;  3R7R A;  3OTN A;  3P2B A;  4WND A;  3QWP A;  5FQ6 A;  3S7F A;  4B89 A;  3ASG A;  2A4Z A;  4BT9 A;  3G2T A;  3ZIM A;  3LPZ A;  4ILH B;  1QQE A;  3JQ1 A;  4CT0 A;  4AM9 A;  3FUI A;  3GYZ A;  3PZD A;  4JXT A;  2FF4 A;  2E2E A;  2AWI A;  1OWL A;  3GW4 A;  3CQG B;  5T8I A;  3FU0 A;  4F7A A;  2OOE A;  3PVL A;  1Z3Y A;  4HFG A;  3FH8 A;  4KBQ A;  2L6J A;  3CQC B;  3MX3 A;  4UQX A;  4Y6W A;  4I43 A;  3SFZ A;  4OYS A;  4KT6 B;  2I2O A;  1U3C A;  4G24 A;  3IKO B;  1TJC A;  3Q4A B;  2BTD A;  5AEN A;  4J8D A;  4LCT A;  5J90 A;  3D9N A;  5D0Q D;  3JCK C;  3B7S A;  3FHE A;  4JEU A;  3P1U A;  2GRM A;  1NZN A;  3SD5 A;  3RK6 A;  2WXJ A;  1SZA A;  2LSU A;  3QWW A;  1DVP A;  3KEZ A;  4GZ3 A;  3T5X A;  4ANU A;  3OXF A;  4ILI A;  4EPZ A;  2VGY A;  2GRL A;  4EZL A;  2XGO A;  5FQ7 A;  3ZYQ A;  4P29 A;  3CV0 A;  3D9P A;  5AYW D;  3I4G A;  3B7U X;  3Q5M A;  2C0L A;  4JHK A;  2IU1 A;  4XX5 A;  1BPO A;  5G05 J;  2QY7 A;  2VJ8 A;  2BF0 X;  4UI9 J;  3EIJ A;  2FO7 A;  3HVE A;  4WNE A;  2QFC A;  3SGH A;  3Q47 B;  3ZVV A;  3QDN A;  4AY5 A;  4EBA G;  3PH0 C;  3JQ0 A;  4CDR A;  1B89 A;  4NAC A;  4ANW A;  3GZS A;  4JC8 A;  3U3W A;  2A5U A;  2XPY A;  4EBA A;  1EPU A;  4QFV A;  1KT0 A;  3CGH A;  3APC A;  2XQ0 A;  3L54 A;  1UJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...