3KAEA

Cdc27 n-terminus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
225
Chain Sequence
SKLIGKICKSIRYRDYETAIFLAACLLEYRMLMSIVLYLNGEYTRALFHLHKLNTCTSKYYESLCYKKKKDYKKAIKSLESILEGKVERDPDVDARIQEMFVDPGDEEFFESLLGDLCTLSGYREEGIGHYVRSFGKSFLFSPVENLLLENKVPQKRGIEEEYVSDSIEFHESLSPSLVKKYMEHVPGIGSYFISNAARRYFNLGMNDKSKACFELVRRKDPMFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible protein of nuclear scaffold
publication title Molecular structure of the N-terminal domain of the APC/C subunit Cdc27 reveals a homo-dimeric tetratricopeptide repeat architecture
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Protein binding
total genus 86
structure length 225
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kaeA00
5FJYA 3LY8A 5LCWC 3CK8A 3QWVA 4WNFA 4N3CA 4CGVA 2VSNA 5EX0A 4GPKA 4GA0A 3KS2A 4U0SA 4GYOA 3LKUA 1KLXA 1A17A 2FEZA 3S7BA 4U0ZA 4UI9K 4Y6CA 4I17A 1QQEA 4YVOA 5AYWD 3ASGA 3QDNA 3GZ2A 2YHCA 3LPZA 3E4BA 1KT0A 4ABNA 3U4TA 3Q5MA 3CKCA 3ZFWA 3RKVA 3MA5A 5FZSA 5CCMA 5BW8C 2P58C 4LEUA 3CV0A 4J8DA 2FBNA 5FZRA 4AY5A 5FZQA 2L6JA 1OUVA 4WNEA 2PQRA 3AS4A 3CEQA 2XCCA 5DIZA 4U07A 3MEKA 4BTBA 3ESKA 1NZNA 4BT9A 4I9EA 3TG4A 2C0MA 5ARGA 3CKBA 2WQHA 5CHEE 1FCHA 4KXKB 4O6FA 3LY7A 4GCOA 4GYWA 2YQ8A 5KJKA 4I1AA 3S7JA 2XEVA 2LSUA 2BUGA 2MHKA 4I2WA 5DBKA 3Q47B 2QFCA 2KCVA 3ASDA 3Q15A 5C1DA 3K9IA 5BNWA 4JL0A 4RG9A 2VGXB 4JA7A 4H7YA 2V5FA 4H7XA 4BWRA 4GA2A 2C0LA 1XNFA 5LCWJ 1ELWA 4B94A 4U0UA 3ZHEB 1TJCA 4NRHB 4HOUA 2KCKA 3GYZA 4CGWA 4IN3B 2LSVA 4RG6A 5M72A 1ZBPA 4N5CA 1WM5A 5A6CA 3HYMB 4GZ5A 3PDNA 4J8EA 5KJNA 4UI9C 4KYOB 4J8FA 4AIFA 3U3WA 1ELRA 5D0OD 3ULQA 4N39A 3PE4A 3OXLA 5A7DB 4HOSA 4KBQA 4N2QA 3Q49B 1B89A 5KJMA 2UWJG 4I9CA 2UY1B 3LY9A 4N3BA 5JJ6A 4HORA 2VGXA 2FF4A 5G05C 2Y4TA 4UQZA 4G24A 2NC9A 2I6HA 2HO1A 4YVQC 2VYIA 4AY6A 4GZ3A 4JA9A 3S7DA 4GCNA 3ZHEA 3QWPA 2XPIA 5D0QD 4N2SA 3UPVA 3CK9A 5FTPA 2IF4A 2J9QA 3N71A 4G23A 3SF4A 4G2VA 2XCBA 4CDRA 4G26A 4GZ6A 2KC7A 1W3BA 4GYYA 3RIBA 2XGSA 3LCAA 5ARFA 4APOA 2VGYA 1WAO1 2E2EA 3CK7A 3CVLA 1IHGA 4XI0A 2IFUA 5CCLA 5G04C 2JLBA 3ZPJA 2KCLA 4W9RA 2Q7FA 3RO3A 3MKRA 3R9AB 3RU0A 3GZ1A 3FFLA 4NQ0A 3UUXA 2FI7A 5JJ7A 3AS5A 4WNDA 4YNDA 2UY1A 3ASFA 2LNIA 1QZ2A 3IEGA 2HR2A 1PC2A 3CVQA 4AM9A 3CVNA 3KAEA 3FWVA 3ZGQA 4Y6WA 4A1SA 3UQ3A 4HOQA 5EX3A 3RJVA 2FO7A 2ONDA 2PL2A 4UQXA 4ME2A 4EQFA 3URZA 4F3VA 3WXXA 3VTXA 4J0UA 1YA0A 1IYGA 4UI9J 3OXFA 2R5SA 1E96B 3GW4A 3Q4AB 2C2LA 3S7FA 3ASHA 2VSYA 3JYSA 2GW1A 4BT8A 3AS8A 3QOUA 3QKYA 1ZU2A 5KJLA 5JJTA 2AVPA 3FP3A 3KD7A 3QWWA 1HXIA 4JHRA 4WUYA 4I2ZA 5EKQD 1P5QA 5G05J 3EDTB 1HH8A 2HYZA 3O48A 4G25A 4UQYA 4WNGA 4HOTA 3MV2B 5HI7A 1NA3A 3OXGA 5FT9A 2DBAA 2PZIA 3TAXA 3ZN3A 1NA0A 4U04A 3RO2A 1KT1A 2KATA 4GA1A 3TG5A 4XIFA 3MV3B 4G1TA 2WPVA 3CVPA 3VTYA 1Y8MA 3SZ7A 1HZ4A 3BEEA 2Y4UA 5G04J 4BTAA 3TGOA 2OOEA 3NF1A 2VQ2A 3LYAA 5BT1A 5HQ8A 2XGOA 2PQNA 2XGMA 3PE3A 4N3AA 4XI9A
chains in the Genus database with same CATH superfamily
5LCWC 3BG1B 3CK8A 3Q78A 4CGVA 4A3VA 1KZOA 1BLXB 3TWRA 4DLOA 4JHJA 4GYOA 1KLXA 1OY3D 1QYMA 3S7BA 4U0ZA 4UI9K 4K03A 3JQ0A 1E8WA 5AJDA 5EN5D 5CERB 1QQEA 3L9TA 1S70B 3JCKC 3QDNA 2YHCA 2DCPA 3ML9A 2V5QC 5EYLA 5A23A 3U4TA 2CG2A 2J09A 4AP2A 3V79K 3VLFA 3RKVA 4P29A 4LG6A 2QY7A 3ZYMA 5LFAA 5CCMA 3PVLA 2WXPA 5AQ9A 5HS0A 2V0PA 1OUVA 3JQ1A 5G55A 2JEKA 4TXRA 1L5JA 4GB9A 5AARA 4B89A 4AV7A 3FULA 3D3MA 3G2SA 3MEKA 4FC8A 1SA5A 1TN7A 3LXUX 3SBTB 3TG4A 2C0MA 5ARGA 4RLYA 2WQHA 5CHEE 3LY7A 4GCOA 4GTOA 3FU3A 1OXJA 4TXQA 2WQ7A 3VLEA 3CSFA 2XS1A 5DBKA 2KM4A 5JHBA 3AU5A 3LEWA 1EDUA 2I1KA 3Q15A 4ILHB 3ZNGA 3ZUVB 4RG9A 4M7CA 4JA7A 2V5FA 3R7QA 4H7XA 1IKND 3ZYKA 4UUCA 5LCWJ 2AXUA 1RW2A 3T8MA 4U0UA 3ZHEB 1TJCA 3B7RL 2KCKA 3ABLE 1LF8A 3TXNA 4J8YA 4DX7D 3GYZA 4CDNA 4HI9A 5KNGA 5M72A 3AJIA 1DCEA 4BESA 4N5CA 3MCXA 3HYMB 3PDNA 2B6CA 5ANRA 5KJNA 4UI9C 4KYOB 4UWFA 4J8FA 3LJNA 1XGWA 3UT8A 3NB2A 3JUEA 3RRNB 3E33A 1FVHA 3PE4A 3SO8A 2I2OA 4KBQA 4N2QA 4E85A 4K5AB 2UWJG 5T3RA 4I9CA 1JUQA 2UY1B 3PS6A 5CMYA 4EZJA 2VGXA 2FF4A 1H2UA 3DEPA 4GMLA 1OWOA 1N4PA 2HO1A 1TNOA 4UWLA 4YVQC 3RK6A 4AEZC 4HRMB 3UIPC 2MYOA 2J9QA 2XHEA 4CDRA 5ENTD 4G26A 1WY6A 2KC7A 2DYRE 3RIBA 3FU6A 3ZXPA 4A3TA 1RZ4A 3I3NA 3CK7A 3CVLA 4DJAA 1X81A 2V4HC 2CHWA 3IKOB 3DSUA 4U96D 5FQ4A 1KZPA 1K1BA 2VTBA 2Q7FA 1Z6TA 3FFLA 4YDEA 1OCCE 3D9LA 2YINA 1MX4A 3E30A 3W9GA 5JJ7A 2IJGX 4YNDA 3JXIA 4ILIA 4EBAG 1HX8A 1QZ2A 3IEGA 4QFVA 4HB5A 2RFAA 4GTTA 2I1JA 3Q73A 3U66A 5LP0A 5B3SE 4Y6WA 4U8YD 4HI8A 4BERA 3UQ3A 4DK5A 5KCMA 5EX3A 3ULEG 2ZGGA 3MYVA 3CHOA 4ME2A 4EQFA 4F3VA 2GRQB 3VTXA 3FUNA 4UI9J 3EHMA 3ASHA 3Q9NC 5ENPD 2R05A 3QOUA 3HG0D 1ZU2A 2WVIA 4ATGA 4OVVA 4LRZA 4F1SA 3QWWA 1HXIA 4I6EA 1HF8A 4NURA 1MX2A 3J5PA 3MKQB 4I6JA 4EBAA 3O48A 1DC2A 4WNGA 4HOTA 3UIOC 3HVEA 4MRUA 4ANXA 2PZIA 1HS6A 3TAXA 1A5EA 4EPZA 1OWNA 1HG2A 2DZNA 4G1TA 2WPVA 3EHRA 3E32A 4ILGA 5AQ7A 3O4ZA 4WWNA 4B8CB 2BKGA 3G2WA 2IOSA 2CFZA 2Y4UA 3UMVA 3CHMA 2A5EA 3TGOA 2OOEA 3NF1A 4LNGA 3UKUG 3S2AA 3FH5A 1U3DA 2IO3C 3LYAA 4G8LA 1X5BA 4F53A 2PQNA 3B7TA 5AN8A 4N3AA 3B13A 5C2YA 4XI9A 5FJYA 3LY8A 4LERA 3PZDA 2WXGA 1IQUA 1N54A 1QBQA 2L6BA 5EX0A 3D9IA 1UOHA 3T9KA 3DRAA 5B1BE 3FTZA 4K5CA 2P9IG 1HO8A 2OVFA 5AYWD 3PNTB 3PZ3A 2EILE 4LNBA 3CSTA 3GZ2A 4L9PA 4BX8A 4FULA 3BU8A 2ZU6B 2WXRA 3EUVA 3ZRHA 4BFRA 1KT0A 4JPSA 4R7LA 2R02A 3Q5MA 3CKCA 1INZA 4KMOA 4HNAD 2QYJA 3MA5A 4ZFHA 1ELKA 3B7SA 5ENQD 1Z5SC 4LEUA 3P1UA 2FBNA 4AY5A 3EIQC 3EIJA 3OTNA 3CVUA 3KEZA 1PY1A 5AQAA 4WNEA 2PM6A 3AS4A 4EZLA 2X6JA 2HE0A 3L22A 4I9EA 3CKBA 4O6FA 4GYWA 2YQ8A 5CEDB 3S7JA 3PUJA 1O1TA 4F6RD 4ATZD 1D8EA 1S63A 3DBSA 3BG0B 4OAUC 3IBEA 4PH4B 1S0PA 4C9BB 1G3NB 5BV0A 4JL0A 4KZ0A 2WXQA 2VGXB 4GZDA 4A1GA 3IHVA 3DSXA 1H0AA 4H7YA 3OAWA 4Q94A 2V4LA 4ANUA 4BEPA 4GA2A 1ELWA 4ANVA 4JHKA 2KZTA 4B94A 4J7WA 3FUKA 3DEOA 1JPLA 4HOUA 2EIME 3SFXA 2EIJE 4CGWA 3CHQA 4GPMA 4L2LA 2KXPC 2XRYA 1WM5A 4FLHA 3FHEA 3NOCD 1JCQA 3E37A 5A6CA 3PZ1A 4J6IA 5KNHD 5FQ7A 5LOZA 5AQBA 1ELRA 4XE0A 2NXPA 3ULYA 2VTBB 5A7DB 4GMRA 3I4GA 3VLDA 3TWWA 1EYHA 1TNBA 1OT8A 2GRMA 1Z3YA 2GRRB 4JC8A 3MX3A 4I1MA 3DSWA 4ACLA 2R59A 1TNYA 3E34A 3GZSA 1OCRE 3D9MA 4GTRA 4DUIA 5G05C 3V2XA 3I5PA 1SA4A 2IONA 2XRZA 3RRUA 4B93B 2GROB 5T4YA 5D0QD 3UPVA 2Y0BG 3CK9A 4IYPA 4G23A 3SFZA 3SF4A 3TWQA 2XCBA 4HFGA 4K0RA 4TXPA 4DX1A 4GZ6A 1W3BA 4GYYA 4OVUA 1OCOE 1KPSB 1VDYA 3ENEA 1O1RA 4OAVB 4U8HA 2E2EA 2X38A 4XZ4A 4XI0A 2J4BA 5G04C 1N9AA 2IU1A 3PZ4A 2X6FA 4EECA 1NP7A 2OVBA 4W9RA 3RO3A 3MKRA 3RU0A 3GZ1A 3PEUB 4NIKA 3ASNE 3FTSA 4KT6B 2X6HA 3UX4A 3CHRA 3LS8A 2LNIA 1N95A 1U2VG 2HR2A 3HDXA 3HVEB 2LXLA 3UM0A 3NQPA 3AG2E 1FT1A 4A1SA 2YHEA 3R9MA 1E7VA 3WG7E 3B7UX 1JCRA 4XX5A 4XKBA 3FUJA 3C3QA 5FINA 2WXLA 2PL2A 4UQXA 4GTQA 2DWZA 4J0UA 2R03A 3CVXA 3ZW3A 3OXFA 1E96B 5E75A 3APDA 2VSYA 3JYSA 3QAQA 2GW1A 4U7EB 4BT8A 4BY6A 1UN9A 3C3OA 3TXMA 3ABKE 4E6HA 3FTYA 4CCAA 3SQVA 3L16A 5KJLA 1Z3XA 2AVPA 4C0MA 5AIJA 3FP3A 3PRZA 3KD7A 3HXDA 3AG1E 2B0OE 4JHRA 1YYHA 2DIWA 4FHKA 4APFA 2HM8A 2AW6A 4L1BA 5FQ8A 3TWTA 5EIDA 5G05J 1SW6A 3EDTB 1HFAA 1HH8A 2NYJA 3T5VA 2HYZA 4CDMA 4G25A 2WQ6A 1Y6IA 3HXBA 3MV2B 5HI7A 1NA3A 3OXGA 5FIOA 3D9NA 2F0YA 3L13A 4HRNA 3ZN3A 2XEEA 3V31A 2WXIA 4QQIA 4B0ZA 4XIFA 4FJZA 4ZHBA 4DX5D 2ILRA 3CVPA 1E8XA 4JZYA 4D10C 3UINC 3LVQE 3CGHA 4ANWA 3JUIA 2LAHA 3FTWA 3RRMB 2J08A 3MJWA 5G04J 3L54A 3PH0C 4FP7A 2P9LG 2VJ8A 4JXTA 1OWMA 2RKKA 2VQ2A 2E0IA 2WXMA 1TN6A 3PNLB 3UI2A 2GGFA 2XGOA 3L82A 5HQ8A 1BD8A 3D9HA 3PUKA 2H6GA 3PE3A 4GAAA 4DI4A 2MOWA 2AJAA 3QWVA 4WNFA 2VSXE 4N3CA 2VSNA 1K1AA 4GPKA 1TR4A 4GA0A 3KS2A 2J8SD 1SQMA 2ETCA 4O60A 4IULA 2R2LA 3LKUA 5BXOA 1A17A 3U64A 4HS2A 3ZEFA 2FEZA 3EU9A 3UM3A 1TNUA 4N5QA 4Y6CA 4I17A 2F37A 1D9SA 4GU5A 2J07A 3MZLB 4TUMA 3ASGA 4GTMA 1FVFA 3C72A 4HQDA 4O1PA 3FU5A 4UWGA 3CVYA 1MYOA 5T8IA 3SFYA 4BETA 5KBAA 2BF0X 3ZFWA 1O5MA 1H2TC 2NSZA 2OEWA 3W9FA 1JWGA 4OYSA 3FUEA 5FZSA 2CG3A 2P58C 4DI3A 4GMJA 2LAIA 2KZTB 5FZQA 3UXGA 3EJNA 2L6JA 4M3OA 5IY5E 5BUZA 2IEJA 3CEQA 5DIZA 3QC1A 4U07A 3ESKA 1N4SA 1NZNA 3ZKJA 1U3CA 1OCZE 3LJ3A 4PS7A 1FCHA 4LCTA 1E7UA 1HG5A 4A55A 2XEVA 1IXVA 3KSQA 2ETBA 2BUGA 5BPPA 2MHKA 4I2WA 2P2CP 2F8YA 3HXFA 2X6IA 4BSZB 4GTVA 2XQ0A 3J5QB 1ZB1A 3ASDA 1PAQA 3K9IA 5BNWA 5CMWA 4GTSA 5BV1A 1MX6A 4G8KA 2ZISA 3IHYA 3QK0A 4LSZE 4U95D 2XPZA 3ABME 5E76A 2EQXA 3D9PA 5JA4D 3IV0A 1H6OA 4IN3B 4DRXE 2PM7A 5CRUA 2QZAA 5AJLA 5BXUA 1LD7A 2ZGDA 4JVSA 3B7BA 2VGEA 2RG8A 4GZ5A 5CBOA 3L6AA 3UT4A 4AIFA 3FTVA 3SBSA 5D0OD 4N39A 3D9JA 2ZXWE 1LTXA 4HOSA 1B89A 1HE8A 5ANLA 5CEAA 3HXCA 2P9SG 3NAWA 4MBGA 4YDYA 3TJPA 3TWXA 4UQZA 3FUDA 1N94A 2NC9A 3CIAA 4JW1A 4MKTA 3I4RB 1DNPA 3CQCB 1K8KG 2VYIA 4JA9A 3S7DA 4N2SA 1FT2A 5FTPA 2DYSE 2IF4A 3NBNB 3KSLA 2CHXA 2Y3AA 4F7AA 4G2VA 1UG3A 4JEUA 3FUMA 1AWCB 4HXIA 4F1PA 5ENSD 3MGBA 3TL5A 1IHBA 3FH7A 1GW6A 3RAUA 5ARFA 4APOA 4DPRA 3SGHA 5EILA 5ITZF 1DCQA 1IHGA 3FH8A 4FU3A 3Q79A 2JLBA 2KCLA 3UTMA 3QARA 2WMNA 1EPUA 2A4ZA 4NQ0A 4CZ2D 5J08A 2FI7A 1N52A 3DPDA 3ONLA 4MLPA 3ASFA 3G2VA 3DWLG 5D66A 1PC2A 4AM9A 3CVNA 4PS8A 3KAEA 2AXVA 4Z68A 4Q96A 3NZSA 2BEDA 2X6KA 2RFMA 5ENRD 4HOQA 4TV3A 5J90A 3T5XA 3FDHA 1BPOA 1H6KA 1MJ0A 3HRAA 2ONDA 1N0RA 3ZU7B 4PUCA 3WXXA 4HRLA 1N0QA 5EYPF 2CFUA 3GW4A 1E8YA 2C2LA 2Y69E 3Q4AB 2J4DA 5KWDA 4JEHA 4MS6A 4BSXA 2H6IA 2LXMA 5JJTA 3T8KA 4WWOA 3FEYA 3D9OA 1V54E 4IRUA 4WUYA 1V55E 4I2ZA 5EIBE 1P5QA 3HHMA 3FY4A 2GRPB 4DX6D 3BQOA 4GTPA 2MRIA 2OEVA 5FT9A 2DBAA 1NA0A 3QNKA 1SZ9A 3RO2A 1KT1A 1SVXA 2KATA 4FHJA 4GA1A 3TG5A 3G2TA 2GRNB 4PS3A 3UM1A 3VTYA 2P9NG 4RVBA 3SZ7A 1HZ4A 5AENA 3BEEA 2IOLA 4WAFA 5JMND 4CRWA 4BTAA 4G11A 5JHAA 3CVVA 3G2UA 3UKRG 4FADA 1TNZA 3DXKG 4CEMA 1WG0A 2XENA 2XGMA 4HLEA 2LO6A 2KBXA 4C48B 1HU3A 4YDWA 4V3IA 4KVOA 2J49A 2WXHA 4U0SA 5EDSA 2IQCA 3LVRE 5CRVA 3SD5A 1OWLA 5ENOD 4FA6A 3AU4A 2P9PG 4YVOA 1BI7B 3APCA 5HKPA 3DSTA 4RSYA 3PEVB 3TWUA 4URKA 4Q69A 3LPZA 4HLLA 3E4BA 2P9KG 3LDZA 3F6QA 4ABNA 1E8ZA 3C98A 2Y1LE 2FO1E 1UN8A 2A5UA 4FLBA 4I43A 3NZUA 2L0TB 1E90A 5BW8C 1H2VC 5FWQA 2IO2C 3CV0A 4J8DA 5FZRA 3L17A 3APFA 1YCSB 2BKKB 4UWKA 4YDOA 3TWSA 1UJJA 2PNNA 2H6FA 2PQRA 2XCCA 1LD8A 3ZIMA 1EF1C 4BTBA 4BT9A 2WM9A 1N4QA 4KXKB 1NFIE 3AG4E 5KJKA 4I1AA 1DVPA 3PREA 3DXMG 4JB8P 4PDXA 2LSUA 2WXKA 4XEIG 3DPYA 4O1OA 3Q47B 1S64A 2QFCA 3ZYQA 3KEAA 2KCVA 3NOGD 5C1DA 2M63A 3Q75A 4FJYA 3SY2A 2WXFA 1Q2ZA 1BU9A 2EINE 1O1SA 2XPYA 4BWRA 3SI5A 2JABA 2L0IA 2C0LA 1XNFA 3BUAA 2ETAA 1MQSA 3Q9UC 4NRHB 5AAOA 2P9UG 2H6HA 4X8QA 3P2BA 3DSVA 1K3ZD 3EU5A 2LSVA 3FTXA 4RG6A 4HVBA 4UWHA 1ZBPA 5CBNA 3AAAC 3AG3E 4AJWA 4L7TA 4J8EA 3CR3A 5ENNA 5CECB 3EHNA 3X2QE 3U3WA 3ULQA 1TEZA 1BI8B 2FULA 4L23A 3CVWA 3OXLA 2OCCE 3CHSA 3UT7A 4AVXA 3Q49B 5KJMA 4KVMA 2XZTG 4CYMD 3LY9A 4N3BA 5JJ6A 4HORA 3ISMC 2Y4TA 4TUUA 4NACA 4G24A 4CT0A 2I6HA 1NI1A 3HIZA 3ONKA 4EHMA 4AY6A 4GZ3A 3ZHEA 4GCNA 3QWPA 2XPIA 1WDYA 2RD0A 4I6GA 3N71A 3CQGB 4XKCA 4J8SA 2EIKE 1IQRA 1D8DA 3JXJA 3SNXA 3SHFA 3UM2A 1N4RA 2I9CA 2WXOA 2XGSA 2XZDG 2R17C 3LCAA 1NL4A 3FEXA 2VGYA 1WAO1 3TWVA 3D9KA 2IFUA 4DX2A 2WXNA 5CCLA 4C0EA 3ZPJA 3Q7FA 3QJZA 2AXZA 3CHPA 3R9AB 3ZXSA 3C5RA 3UUXA 3R7RA 3AS5A 3B95A 2ZIRA 4WNDA 3DSSA 2UY1A 3C3RA 1MZCA 4GZCA 2BTDA 3CVQA 3Q7AA 2QC9A 3L08A 2AWIA 1AP7A 2YNQA 2F8XK 3FU0A 2V8SE 3FWVA 4A63B 4B8AA 3ZGQA 4TRQA 1JCSA 2WXJA 5B1AE 1H19A 2LUHA 3RJVA 5H7PA 2FO7A 5FQ6A 1H6PA 3RSEG 3URZA 4K5BA 2X3MA 4KZCA 4L2YA 1YA0A 3FUHA 4BX9A 4LNUD 2R5SA 3S7FA 3V30A 3ASOE 2VSOE 3AS8A 5G2NA 3QKYA 1JWFA 4RQIA 2QYUA 5HRYA 2XS8A 3PZ2A 3ML8A 3HXEA 1UJKA 3ZVVA 2OV8A 1QNFA 4I1OB 5EKQD 1OWPA 3EHQA 1TYQG 5D2MC 4UQYA 4DLQA 2IY0C 2CHZA 4U04A 3IXEA 3V2OA 4AOFA 3MV3B 3U9WA 1N11A 2L9BA 4WWPA 3FUFA 1YMPA 1FPPA 3ESLA 4AXHA 1TJFA 3FTUA 1Y8MA 4U63A 2DZOA 2XEHA 4CT4A 4ACKA 1MHQA 3CLJA 4EZKA 5LX8A 4JD2G 3ZYLA 2GRLA 5BT1A 4U8VD 3FUIA 2DVWA 2WB2A 1TN8A 1SZAA 1UW4B 3QB2A 3MKQA 4HBDA 2WMOA 4LUNU 1IYGA
chains in the Genus database with same CATH topology
5FJYA 3LY8A 5LCWC 3BG1B 1HU3A 4LERA 2MOWA 3CK8A 3PZDA 3QWVA 2WXGA 4WNFA 1IQUA 2VSXE 4V3IA 1N54A 4N3CA 4CGVA 4KVOA 2VSNA 5EX0A 4GPKA 3D9IA 4GA0A 2J49A 3KS2A 4A3VA 2WXHA 1SQMA 4U0SA 4DLOA 4JHJA 4IULA 4GYOA 3LKUA 1KLXA 1A17A 3FTZA 3U64A 4HS2A 2IQCA 5EDSA 3LVRE 3ZEFA 2FEZA 3S7BA 1OWLA 3SD5A 4U0ZA 4UI9K 4FA6A 3AU4A 1HO8A 4K03A 3JQ0A 1E8WA 4I17A 4Y6CA 5AJDA 4GU5A 2J07A 2OVFA 1QQEA 4YVOA 5AYWD 3MZLB 3PNTB 3APCA 3ASGA 1FVFA 3JCKC 3CSTA 4RSYA 3PEVB 3QDNA 3FU5A 2YHCA 3GZ2A 4Q69A 2DCPA 4URKA 3LPZA 4UWGA 3CVYA 4BX8A 3ML9A 3E4BA 4FULA 2ZU6B 2WXRA 3LDZA 3ZRHA 4BFRA 5A23A 1KT0A 4JPSA 4ABNA 3U4TA 1E8ZA 2CG2A 2J09A 4R7LA 4AP2A 3C98A 5T8IA 3Q5MA 3CKCA 1INZA 2BF0X 3ZFWA 1UN8A 1H2TC 2NSZA 4KMOA 3VLFA 2A5UA 4FLBA 3RKVA 4P29A 2QY7A 1JWGA 4I43A 3ZYMA 5LFAA 4OYSA 3NZUA 3MA5A 3FUEA 5FZSA 1ELKA 2L0TB 5CCMA 1E90A 3B7SA 2CG3A 1H2VC 2P58C 3PVLA 5BW8C 4DI3A 5FWQA 4GMJA 2LAIA 2WXPA 3CV0A 3P1UA 4LEUA 4J8DA 2FBNA 5FZRA 2KZTB 4AY5A 2V0PA 5FZQA 3EIQC 3EJNA 3EIJA 3OTNA 2L6JA 3CVUA 3L17A 3APFA 3KEZA 1OUVA 4UWKA 1UJJA 3JQ1A 1PY1A 5G55A 2JEKA 4M3OA 1L5JA 4WNEA 5BUZA 2PQRA 2PM6A 3AS4A 4GB9A 3CEQA 2XCCA 4B89A 4AV7A 4EZLA 3FULA 5DIZA 3D3MA 2X6JA 3G2SA 3MEKA 3QC1A 4FC8A 4U07A 3ZIMA 1EF1C 4BTBA 3ESKA 3L22A 1NZNA 2WM9A 4BT9A 3LXUX 4I9EA 3SBTB 1U3CA 3TG4A 2C0MA 5ARGA 3CKBA 3LJ3A 2WQHA 1FCHA 4PS7A 3LY7A 4KXKB 4O6FA 4LCTA 5CHEE 4GCOA 1E7UA 4GYWA 2YQ8A 1HG5A 3FU3A 4A55A 5KJKA 4I1AA 1DVPA 3PREA 2XEVA 3S7JA 3PUJA 2WQ7A 3VLEA 4PDXA 2LSUA 3CSFA 2BUGA 5JJTA 5BPPA 2MHKA 2WXKA 4I2WA 5DBKA 2KM4A 2X6IA 3DBSA 3BG0B 3Q47B 2QFCA 2XQ0A 3ZYQA 5JHBA 3IBEA 3AU5A 4PH4B 2KCVA 1EDUA 3LEWA 1S0PA 2I1KA 3ASDA 3Q15A 4C9BB 1PAQA 3K9IA 4ILHB 5C1DA 2M63A 5BNWA 5CMWA 5BV0A 4JL0A 4RG9A 4KZ0A 2WXQA 5BV1A 2VGXB 4GZDA 4A1GA 3IHVA 4FJYA 2WXFA 4JA7A 1H0AA 4H7YA 3OAWA 4Q94A 2V5FA 2V4LA 3IHYA 3R7QA 4ANUA 4H7XA 2XPYA 4BWRA 3QK0A 4GA2A 3SI5A 2L0IA 3ZYKA 2C0LA 1XNFA 2XPZA 5LCWJ 2AXUA 1ELWA 4ANVA 4JHKA 2KZTA 3T8MA 4B94A 4U0UA 3ZHEB 1MQSA 5E76A 1TJCA 2EQXA 3D9PA 3FUKA 1JPLA 3B7RL 4HOUA 4NRHB 2KCKA 3IV0A 1LF8A 3TXNA 3P2BA 3GYZA 4CGWA 4IN3B 4CDNA 2LSVA 3FTXA 4RG6A 4HVBA 3CHQA 2PM7A 5M72A 4UWHA 4L2LA 1ZBPA 2XRYA 4N5CA 1WM5A 3MCXA 4AJWA 4L7TA 5AJLA 4FLHA 3FHEA 5A6CA 4JVSA 4J6IA 3HYMB 2RG8A 4GZ5A 3PDNA 4J8EA 5ANRA 5KJNA 5FQ7A 3L6AA 4UI9C 4KYOB 4UWFA 5LOZA 4J8FA 3CR3A 5ENNA 3EHNA 3UT4A 4AIFA 3FTVA 3U3WA 3SBSA 1ELRA 1XGWA 5D0OD 3ULQA 3UT8A 1TEZA 2FULA 4XE0A 3RRNB 2NXPA 4N39A 1FVHA 3PE4A 4L23A 3CVWA 3D9JA 3OXLA 2VTBB 5A7DB 3I4GA 3CHSA 3VLDA 4HOSA 3UT7A 1EYHA 2I2OA 4KBQA 4AVXA 4N2QA 3Q49B 1B89A 4E85A 1HE8A 1Z3YA 2GRMA 5KJMA 4KVMA 5ANLA 4JC8A 3MX3A 2UWJG 4I1MA 5T3RA 4I9CA 1JUQA 2UY1B 4ACLA 2R59A 3LY9A 4N3BA 3PS6A 5CMYA 5JJ6A 3TJPA 4EZJA 4HORA 3GZSA 3D9MA 2VGXA 2FF4A 5G05C 2Y4TA 1H2UA 4UQZA 3FUDA 4TUUA 4GMLA 4NACA 4G24A 4CT0A 1OWOA 3CIAA 2NC9A 2I6HA 3I5PA 3HIZA 4JW1A 4MKTA 3I4RB 3ONKA 1DNPA 2HO1A 3CQCB 4UWLA 4YVQC 2VYIA 2IONA 3RK6A 4AEZC 3RRUA 2XRZA 4AY6A 4GZ3A 4JA9A 3S7DA 4GCNA 3ZHEA 3QWPA 2XPIA 2RD0A 5D0QD 5T4YA 4I6GA 3UPVA 3CK9A 5FTPA 4N2SA 2IF4A 2J9QA 2XHEA 4IYPA 2CHXA 3N71A 2Y3AA 4G23A 3SF4A 4G2VA 3CQGB 3SFZA 4XKCA 4F7AA 4J8SA 2XCBA 1UG3A 4JEUA 1IQRA 4HFGA 4K0RA 4CDRA 3FUMA 4G26A 4GZ6A 1WY6A 2KC7A 1W3BA 4GYYA 4OVUA 3SNXA 3SHFA 4HXIA 2I9CA 3RIBA 3FU6A 3MGBA 3TL5A 3FH7A 1GW6A 2WXOA 2XGSA 1VDYA 2R17C 3LCAA 3FEXA 4A3TA 5ARFA 3ENEA 2VGYA 4APOA 4DPRA 4U8HA 1WAO1 3SGHA 2E2EA 3I3NA 3CK7A 2X38A 4XZ4A 3CVLA 3D9KA 4DJAA 1IHGA 4XI0A 3FH8A 2IFUA 2J4BA 4FU3A 2WXNA 5CCLA 4C0EA 5G04C 2CHWA 2JLBA 3IKOB 3ZPJA 2IU1A 5FQ4A 2KCLA 2X6FA 4EECA 1NP7A 2OVBA 4W9RA 3QJZA 2VTBA 2Q7FA 3RO3A 2AXZA 3MKRA 3CHPA 1Z6TA 3QARA 2WMNA 3R9AB 3RU0A 3GZ1A 3PEUB 3ZXSA 1EPUA 2A4ZA 3FFLA 4NQ0A 3UUXA 5J08A 2FI7A 3FTSA 1N52A 3DPDA 4KT6B 3D9LA 3R7RA 3ONLA 2YINA 5JJ7A 3AS5A 2IJGX 2X6HA 4MLPA 4WNDA 4YNDA 2UY1A 3ASFA 4ILIA 3G2VA 3UX4A 3CHRA 3LS8A 4EBAG 1HX8A 2LNIA 1QZ2A 3IEGA 2HR2A 1PC2A 2BTDA 3CVQA 4GZCA 3L08A 4AM9A 3CVNA 2AWIA 4QFVA 2YNQA 3HDXA 3HVEB 4PS8A 3FU0A 2V8SE 3KAEA 3NQPA 2AXVA 3FWVA 4B8AA 2I1JA 3ZGQA 4Q96A 3NZSA 3U66A 5LP0A 4Y6WA 2YHEA 4A1SA 4TRQA 1E7VA 2X6KA 3B7UX 2WXJA 3UQ3A 4HOQA 1H19A 4TV3A 4DK5A 5J90A 3T5XA 3FDHA 5KCMA 4XX5A 5EX3A 3RJVA 1BPOA 4XKBA 1H6KA 2FO7A 3FUJA 5FQ6A 3MYVA 2ONDA 3CHOA 2WXLA 2PL2A 4UQXA 4ME2A 4EQFA 3URZA 4F3VA 4PUCA 3WXXA 2X3MA 4KZCA 3FUNA 4J0UA 1YA0A 4L2YA 3FUHA 3VTXA 4BX9A 1IYGA 4UI9J 3CVXA 3ZW3A 3OXFA 2R5SA 3EHMA 1E96B 2CFUA 3GW4A 1E8YA 2C2LA 3APDA 3Q4AB 3ASHA 5E75A 3S7FA 2J4DA 2VSYA 3JYSA 3QAQA 2GW1A 2VSOE 4JEHA 4BT8A 4MS6A 1UN9A 4BY6A 3AS8A 3QOUA 5G2NA 3QKYA 1JWFA 3TXMA 4BSXA 4E6HA 3FTYA 1ZU2A 4CCAA 3L16A 5KJLA 1Z3XA 2AVPA 2WVIA 4ATGA 3FP3A 4C0MA 4OVVA 3PRZA 4LRZA 4F1SA 3ML8A 3KD7A 4WWOA 1UJKA 3QWWA 1HXIA 4I6EA 1HF8A 4JHRA 4NURA 2DIWA 3ZVVA 3FEYA 4FHKA 2OV8A 3D9OA 4APFA 2HM8A 2AW6A 4IRUA 4L1BA 3MKQB 4WUYA 5FQ8A 1QNFA 4I1OB 4I2ZA 4I6JA 5EKQD 1OWPA 1P5QA 5G05J 3HHMA 4EBAA 3EDTB 1HFAA 3FY4A 1HH8A 3T5VA 2HYZA 4CDMA 3O48A 4G25A 4UQYA 4WNGA 2WQ6A 4HOTA 1Y6IA 2MRIA 3MV2B 5HI7A 1NA3A 3HVEA 4DLQA 3OXGA 5FT9A 4MRUA 2DBAA 4ANXA 2PZIA 1HS6A 5AIJA 3D9NA 3TAXA 2CHZA 3L13A 3ZN3A 1NA0A 4U04A 3QNKA 2WXIA 1SZ9A 4EPZA 3RO2A 1KT1A 1OWNA 2KATA 1HG2A 4B0ZA 4FHJA 4GA1A 3TG5A 4AOFA 4XIFA 3MV3B 4G1TA 3U9WA 4FJZA 2WPVA 3G2TA 2ILRA 2L9BA 4WWPA 3CVPA 3FUFA 4PS3A 1E8XA 4JZYA 4D10C 4ILGA 3ESLA 4AXHA 3O4ZA 3LVQE 4WWNA 1TJFA 3CGHA 4B8CB 3FTUA 4ANWA 3JUIA 3VTYA 2LAHA 1Y8MA 4RVBA 3SZ7A 1HZ4A 3FTWA 3G2WA 5AENA 2IOSA 2CFZA 3BEEA 3RRMB 2IOLA 4U63A 2J08A 4CT4A 4ACKA 1MHQA 3CLJA 2Y4UA 3UMVA 3CHMA 3MJWA 4WAFA 3L54A 5G04J 3PH0C 4FP7A 4CRWA 4BTAA 3TGOA 4G11A 2VJ8A 4JXTA 1OWMA 2OOEA 3NF1A 4EZKA 5JHAA 5LX8A 2VQ2A 3S2AA 3CVVA 3G2UA 3FH5A 4FADA 1U3DA 2E0IA 2WXMA 3LYAA 3ZYLA 2GRLA 5BT1A 3FUIA 3PNLB 5HQ8A 2GGFA 2XGOA 2WB2A 4CEMA 1X5BA 3PUKA 1SZAA 1UW4B 4F53A 2PQNA 3QB2A 3B7TA 2XGMA 3PE3A 3MKQA 4N3AA 4GAAA 4DI4A 2WMOA 4HLEA 2LO6A 3B13A 4LUNU 5C2YA 4XI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJY A;  3LY8 A;  5LCW C;  3CK8 A;  3QWV A;  4WNF A;  4N3C A;  4CGV A;  2VSN A;  5EX0 A;  4GPK A;  4GA0 A;  3KS2 A;  4U0S A;  4GYO A;  3LKU A;  1KLX A;  1A17 A;  2FEZ A;  3S7B A;  4U0Z A;  4UI9 K;  4Y6C A;  4I17 A;  1QQE A;  4YVO A;  5AYW D;  3ASG A;  3QDN A;  3GZ2 A;  2YHC A;  3LPZ A;  3E4B A;  1KT0 A;  4ABN A;  3U4T A;  3Q5M A;  3CKC A;  3ZFW A;  3RKV A;  3MA5 A;  5FZS A;  5CCM A;  5BW8 C;  2P58 C;  4LEU A;  3CV0 A;  4J8D A;  2FBN A;  5FZR A;  4AY5 A;  5FZQ A;  2L6J A;  1OUV A;  4WNE A;  2PQR A;  3AS4 A;  3CEQ A;  2XCC A;  5DIZ A;  4U07 A;  3MEK A;  4BTB A;  3ESK A;  1NZN A;  4BT9 A;  4I9E A;  3TG4 A;  2C0M A;  5ARG A;  3CKB A;  2WQH A;  5CHE E;  1FCH A;  4KXK B;  4O6F A;  3LY7 A;  4GCO A;  4GYW A;  2YQ8 A;  5KJK A;  4I1A A;  3S7J A;  2XEV A;  2LSU A;  2BUG A;  2MHK A;  4I2W A;  5DBK A;  3Q47 B;  2QFC A;  2KCV A;  3ASD A;  3Q15 A;  5C1D A;  3K9I A;  5BNW A;  4JL0 A;  4RG9 A;  2VGX B;  4JA7 A;  4H7Y A;  2V5F A;  4H7X A;  4BWR A;  4GA2 A;  2C0L A;  1XNF A;  5LCW J;  1ELW A;  4B94 A;  4U0U A;  3ZHE B;  1TJC A;  4NRH B;  4HOU A;  2KCK A;  3GYZ A;  4CGW A;  4IN3 B;  2LSV A;  4RG6 A;  5M72 A;  1ZBP A;  4N5C A;  1WM5 A;  5A6C A;  3HYM B;  4GZ5 A;  3PDN A;  4J8E A;  5KJN A;  4UI9 C;  4KYO B;  4J8F A;  4AIF A;  3U3W A;  1ELR A;  5D0O D;  3ULQ A;  4N39 A;  3PE4 A;  3OXL A;  5A7D B;  4HOS A;  4KBQ A;  4N2Q A;  3Q49 B;  1B89 A;  5KJM A;  2UWJ G;  4I9C A;  2UY1 B;  3LY9 A;  4N3B A;  5JJ6 A;  4HOR A;  2VGX A;  2FF4 A;  5G05 C;  2Y4T A;  4UQZ A;  4G24 A;  2NC9 A;  2I6H A;  2HO1 A;  4YVQ C;  2VYI A;  4AY6 A;  4GZ3 A;  4JA9 A;  3S7D A;  4GCN A;  3ZHE A;  3QWP A;  2XPI A;  5D0Q D;  4N2S A;  3UPV A;  3CK9 A;  5FTP A;  2IF4 A;  2J9Q A;  3N71 A;  4G23 A;  3SF4 A;  4G2V A;  2XCB A;  4CDR A;  4G26 A;  4GZ6 A;  2KC7 A;  1W3B A;  4GYY A;  3RIB A;  2XGS A;  3LCA A;  5ARF A;  4APO A;  2VGY A;  1WAO 1;  2E2E A;  3CK7 A;  3CVL A;  1IHG A;  4XI0 A;  2IFU A;  5CCL A;  5G04 C;  2JLB A;  3ZPJ A;  2KCL A;  4W9R A;  2Q7F A;  3RO3 A;  3MKR A;  3R9A B;  3RU0 A;  3GZ1 A;  3FFL A;  4NQ0 A;  3UUX A;  2FI7 A;  5JJ7 A;  3AS5 A;  4WND A;  4YND A;  2UY1 A;  3ASF A;  2LNI A;  1QZ2 A;  3IEG A;  2HR2 A;  1PC2 A;  3CVQ A;  4AM9 A;  3CVN A;  3KAE A;  3FWV A;  3ZGQ A;  4Y6W A;  4A1S A;  3UQ3 A;  4HOQ A;  5EX3 A;  3RJV A;  2FO7 A;  2OND A;  2PL2 A;  4UQX A;  4ME2 A;  4EQF A;  3URZ A;  4F3V A;  3WXX A;  3VTX A;  4J0U A;  1YA0 A;  1IYG A;  4UI9 J;  3OXF A;  2R5S A;  1E96 B;  3GW4 A;  3Q4A B;  2C2L A;  3S7F A;  3ASH A;  2VSY A;  3JYS A;  2GW1 A;  4BT8 A;  3AS8 A;  3QOU A;  3QKY A;  1ZU2 A;  5KJL A;  5JJT A;  2AVP A;  3FP3 A;  3KD7 A;  3QWW A;  1HXI A;  4JHR A;  4WUY A;  4I2Z A;  5EKQ D;  1P5Q A;  5G05 J;  3EDT B;  1HH8 A;  2HYZ A;  3O48 A;  4G25 A;  4UQY A;  4WNG A;  4HOT A;  3MV2 B;  5HI7 A;  1NA3 A;  3OXG A;  5FT9 A;  2DBA A;  2PZI A;  3TAX A;  3ZN3 A;  1NA0 A;  4U04 A;  3RO2 A;  1KT1 A;  2KAT A;  4GA1 A;  3TG5 A;  4XIF A;  3MV3 B;  4G1T A;  2WPV A;  3CVP A;  3VTY A;  1Y8M A;  3SZ7 A;  1HZ4 A;  3BEE A;  2Y4U A;  5G04 J;  4BTA A;  3TGO A;  2OOE A;  3NF1 A;  2VQ2 A;  3LYA A;  5BT1 A;  5HQ8 A;  2XGO A;  2PQN A;  2XGM A;  3PE3 A;  4N3A A;  4XI9 A; 
#chains in the Genus database with same CATH topology
 5LCW C;  3BG1 B;  3CK8 A;  3Q78 A;  4CGV A;  4A3V A;  1KZO A;  1BLX B;  3TWR A;  4DLO A;  4JHJ A;  4GYO A;  1KLX A;  1OY3 D;  1QYM A;  3S7B A;  4U0Z A;  4UI9 K;  4K03 A;  3JQ0 A;  1E8W A;  5AJD A;  5EN5 D;  5CER B;  1QQE A;  3L9T A;  1S70 B;  3JCK C;  3QDN A;  2YHC A;  2DCP A;  3ML9 A;  2V5Q C;  5EYL A;  5A23 A;  3U4T A;  2CG2 A;  2J09 A;  4AP2 A;  3V79 K;  3VLF A;  3RKV A;  4P29 A;  4LG6 A;  2QY7 A;  3ZYM A;  5LFA A;  5CCM A;  3PVL A;  2WXP A;  5AQ9 A;  5HS0 A;  2V0P A;  1OUV A;  3JQ1 A;  5G55 A;  2JEK A;  4TXR A;  1L5J A;  4GB9 A;  5AAR A;  4B89 A;  4AV7 A;  3FUL A;  3D3M A;  3G2S A;  3MEK A;  4FC8 A;  1SA5 A;  1TN7 A;  3LXU X;  3SBT B;  3TG4 A;  2C0M A;  5ARG A;  4RLY A;  2WQH A;  5CHE E;  3LY7 A;  4GCO A;  4GTO A;  3FU3 A;  1OXJ A;  4TXQ A;  2WQ7 A;  3VLE A;  3CSF A;  2XS1 A;  5DBK A;  2KM4 A;  5JHB A;  3AU5 A;  3LEW A;  1EDU A;  2I1K A;  3Q15 A;  4ILH B;  3ZNG A;  3ZUV B;  4RG9 A;  4M7C A;  4JA7 A;  2V5F A;  3R7Q A;  4H7X A;  1IKN D;  3ZYK A;  4UUC A;  5LCW J;  2AXU A;  1RW2 A;  3T8M A;  4U0U A;  3ZHE B;  1TJC A;  3B7R L;  2KCK A;  3ABL E;  1LF8 A;  3TXN A;  4J8Y A;  4DX7 D;  3GYZ A;  4CDN A;  4HI9 A;  5KNG A;  5M72 A;  3AJI A;  1DCE A;  4BES A;  4N5C A;  3MCX A;  3HYM B;  3PDN A;  2B6C A;  5ANR A;  5KJN A;  4UI9 C;  4KYO B;  4UWF A;  4J8F A;  3LJN A;  1XGW A;  3UT8 A;  3NB2 A;  3JUE A;  3RRN B;  3E33 A;  1FVH A;  3PE4 A;  3SO8 A;  2I2O A;  4KBQ A;  4N2Q A;  4E85 A;  4K5A B;  2UWJ G;  5T3R A;  4I9C A;  1JUQ A;  2UY1 B;  3PS6 A;  5CMY A;  4EZJ A;  2VGX A;  2FF4 A;  1H2U A;  3DEP A;  4GML A;  1OWO A;  1N4P A;  2HO1 A;  1TNO A;  4UWL A;  4YVQ C;  3RK6 A;  4AEZ C;  4HRM B;  3UIP C;  2MYO A;  2J9Q A;  2XHE A;  4CDR A;  5ENT D;  4G26 A;  1WY6 A;  2KC7 A;  2DYR E;  3RIB A;  3FU6 A;  3ZXP A;  4A3T A;  1RZ4 A;  3I3N A;  3CK7 A;  3CVL A;  4DJA A;  1X81 A;  2V4H C;  2CHW A;  3IKO B;  3DSU A;  4U96 D;  5FQ4 A;  1KZP A;  1K1B A;  2VTB A;  2Q7F A;  1Z6T A;  3FFL A;  4YDE A;  1OCC E;  3D9L A;  2YIN A;  1MX4 A;  3E30 A;  3W9G A;  5JJ7 A;  2IJG X;  4YND A;  3JXI A;  4ILI A;  4EBA G;  1HX8 A;  1QZ2 A;  3IEG A;  4QFV A;  4HB5 A;  2RFA A;  4GTT A;  2I1J A;  3Q73 A;  3U66 A;  5LP0 A;  5B3S E;  4Y6W A;  4U8Y D;  4HI8 A;  4BER A;  3UQ3 A;  4DK5 A;  5KCM A;  5EX3 A;  3ULE G;  2ZGG A;  3MYV A;  3CHO A;  4ME2 A;  4EQF A;  4F3V A;  2GRQ B;  3VTX A;  3FUN A;  4UI9 J;  3EHM A;  3ASH A;  3Q9N C;  5ENP D;  2R05 A;  3QOU A;  3HG0 D;  1ZU2 A;  2WVI A;  4ATG A;  4OVV A;  4LRZ A;  4F1S A;  3QWW A;  1HXI A;  4I6E A;  1HF8 A;  4NUR A;  1MX2 A;  3J5P A;  3MKQ B;  4I6J A;  4EBA A;  3O48 A;  1DC2 A;  4WNG A;  4HOT A;  3UIO C;  3HVE A;  4MRU A;  4ANX A;  2PZI A;  1HS6 A;  3TAX A;  1A5E A;  4EPZ A;  1OWN A;  1HG2 A;  2DZN A;  4G1T A;  2WPV A;  3EHR A;  3E32 A;  4ILG A;  5AQ7 A;  3O4Z A;  4WWN A;  4B8C B;  2BKG A;  3G2W A;  2IOS A;  2CFZ A;  2Y4U A;  3UMV A;  3CHM A;  2A5E A;  3TGO A;  2OOE A;  3NF1 A;  4LNG A;  3UKU G;  3S2A A;  3FH5 A;  1U3D A;  2IO3 C;  3LYA A;  4G8L A;  1X5B A;  4F53 A;  2PQN A;  3B7T A;  5AN8 A;  4N3A A;  3B13 A;  5C2Y A;  4XI9 A;  5FJY A;  3LY8 A;  4LER A;  3PZD A;  2WXG A;  1IQU A;  1N54 A;  1QBQ A;  2L6B A;  5EX0 A;  3D9I A;  1UOH A;  3T9K A;  3DRA A;  5B1B E;  3FTZ A;  4K5C A;  2P9I G;  1HO8 A;  2OVF A;  5AYW D;  3PNT B;  3PZ3 A;  2EIL E;  4LNB A;  3CST A;  3GZ2 A;  4L9P A;  4BX8 A;  4FUL A;  3BU8 A;  2ZU6 B;  2WXR A;  3EUV A;  3ZRH A;  4BFR A;  1KT0 A;  4JPS A;  4R7L A;  2R02 A;  3Q5M A;  3CKC A;  1INZ A;  4KMO A;  4HNA D;  2QYJ A;  3MA5 A;  4ZFH A;  1ELK A;  3B7S A;  5ENQ D;  1Z5S C;  4LEU A;  3P1U A;  2FBN A;  4AY5 A;  3EIQ C;  3EIJ A;  3OTN A;  3CVU A;  3KEZ A;  1PY1 A;  5AQA A;  4WNE A;  2PM6 A;  3AS4 A;  4EZL A;  2X6J A;  2HE0 A;  3L22 A;  4I9E A;  3CKB A;  4O6F A;  4GYW A;  2YQ8 A;  5CED B;  3S7J A;  3PUJ A;  1O1T A;  4F6R D;  4ATZ D;  1D8E A;  1S63 A;  3DBS A;  3BG0 B;  4OAU C;  3IBE A;  4PH4 B;  1S0P A;  4C9B B;  1G3N B;  5BV0 A;  4JL0 A;  4KZ0 A;  2WXQ A;  2VGX B;  4GZD A;  4A1G A;  3IHV A;  3DSX A;  1H0A A;  4H7Y A;  3OAW A;  4Q94 A;  2V4L A;  4ANU A;  4BEP A;  4GA2 A;  1ELW A;  4ANV A;  4JHK A;  2KZT A;  4B94 A;  4J7W A;  3FUK A;  3DEO A;  1JPL A;  4HOU A;  2EIM E;  3SFX A;  2EIJ E;  4CGW A;  3CHQ A;  4GPM A;  4L2L A;  2KXP C;  2XRY A;  1WM5 A;  4FLH A;  3FHE A;  3NOC D;  1JCQ A;  3E37 A;  5A6C A;  3PZ1 A;  4J6I A;  5KNH D;  5FQ7 A;  5LOZ A;  5AQB A;  1ELR A;  4XE0 A;  2NXP A;  3ULY A;  2VTB B;  5A7D B;  4GMR A;  3I4G A;  3VLD A;  3TWW A;  1EYH A;  1TNB A;  1OT8 A;  2GRM A;  1Z3Y A;  2GRR B;  4JC8 A;  3MX3 A;  4I1M A;  3DSW A;  4ACL A;  2R59 A;  1TNY A;  3E34 A;  3GZS A;  1OCR E;  3D9M A;  4GTR A;  4DUI A;  5G05 C;  3V2X A;  3I5P A;  1SA4 A;  2ION A;  2XRZ A;  3RRU A;  4B93 B;  2GRO B;  5T4Y A;  5D0Q D;  3UPV A;  2Y0B G;  3CK9 A;  4IYP A;  4G23 A;  3SFZ A;  3SF4 A;  3TWQ A;  2XCB A;  4HFG A;  4K0R A;  4TXP A;  4DX1 A;  4GZ6 A;  1W3B A;  4GYY A;  4OVU A;  1OCO E;  1KPS B;  1VDY A;  3ENE A;  1O1R A;  4OAV B;  4U8H A;  2E2E A;  2X38 A;  4XZ4 A;  4XI0 A;  2J4B A;  5G04 C;  1N9A A;  2IU1 A;  3PZ4 A;  2X6F A;  4EEC A;  1NP7 A;  2OVB A;  4W9R A;  3RO3 A;  3MKR A;  3RU0 A;  3GZ1 A;  3PEU B;  4NIK A;  3ASN E;  3FTS A;  4KT6 B;  2X6H A;  3UX4 A;  3CHR A;  3LS8 A;  2LNI A;  1N95 A;  1U2V G;  2HR2 A;  3HDX A;  3HVE B;  2LXL A;  3UM0 A;  3NQP A;  3AG2 E;  1FT1 A;  4A1S A;  2YHE A;  3R9M A;  1E7V A;  3WG7 E;  3B7U X;  1JCR A;  4XX5 A;  4XKB A;  3FUJ A;  3C3Q A;  5FIN A;  2WXL A;  2PL2 A;  4UQX A;  4GTQ A;  2DWZ A;  4J0U A;  2R03 A;  3CVX A;  3ZW3 A;  3OXF A;  1E96 B;  5E75 A;  3APD A;  2VSY A;  3JYS A;  3QAQ A;  2GW1 A;  4U7E B;  4BT8 A;  4BY6 A;  1UN9 A;  3C3O A;  3TXM A;  3ABK E;  4E6H A;  3FTY A;  4CCA A;  3SQV A;  3L16 A;  5KJL A;  1Z3X A;  2AVP A;  4C0M A;  5AIJ A;  3FP3 A;  3PRZ A;  3KD7 A;  3HXD A;  3AG1 E;  2B0O E;  4JHR A;  1YYH A;  2DIW A;  4FHK A;  4APF A;  2HM8 A;  2AW6 A;  4L1B A;  5FQ8 A;  3TWT A;  5EID A;  5G05 J;  1SW6 A;  3EDT B;  1HFA A;  1HH8 A;  2NYJ A;  3T5V A;  2HYZ A;  4CDM A;  4G25 A;  2WQ6 A;  1Y6I A;  3HXB A;  3MV2 B;  5HI7 A;  1NA3 A;  3OXG A;  5FIO A;  3D9N A;  2F0Y A;  3L13 A;  4HRN A;  3ZN3 A;  2XEE A;  3V31 A;  2WXI A;  4QQI A;  4B0Z A;  4XIF A;  4FJZ A;  4ZHB A;  4DX5 D;  2ILR A;  3CVP A;  1E8X A;  4JZY A;  4D10 C;  3UIN C;  3LVQ E;  3CGH A;  4ANW A;  3JUI A;  2LAH A;  3FTW A;  3RRM B;  2J08 A;  3MJW A;  5G04 J;  3L54 A;  3PH0 C;  4FP7 A;  2P9L G;  2VJ8 A;  4JXT A;  1OWM A;  2RKK A;  2VQ2 A;  2E0I A;  2WXM A;  1TN6 A;  3PNL B;  3UI2 A;  2GGF A;  2XGO A;  3L82 A;  5HQ8 A;  1BD8 A;  3D9H A;  3PUK A;  2H6G A;  3PE3 A;  4GAA A;  4DI4 A;  2MOW A;  2AJA A;  3QWV A;  4WNF A;  2VSX E;  4N3C A;  2VSN A;  1K1A A;  4GPK A;  1TR4 A;  4GA0 A;  3KS2 A;  2J8S D;  1SQM A;  2ETC A;  4O60 A;  4IUL A;  2R2L A;  3LKU A;  5BXO A;  1A17 A;  3U64 A;  4HS2 A;  3ZEF A;  2FEZ A;  3EU9 A;  3UM3 A;  1TNU A;  4N5Q A;  4Y6C A;  4I17 A;  2F37 A;  1D9S A;  4GU5 A;  2J07 A;  3MZL B;  4TUM A;  3ASG A;  4GTM A;  1FVF A;  3C72 A;  4HQD A;  4O1P A;  3FU5 A;  4UWG A;  3CVY A;  1MYO A;  5T8I A;  3SFY A;  4BET A;  5KBA A;  2BF0 X;  3ZFW A;  1O5M A;  1H2T C;  2NSZ A;  2OEW A;  3W9F A;  1JWG A;  4OYS A;  3FUE A;  5FZS A;  2CG3 A;  2P58 C;  4DI3 A;  4GMJ A;  2LAI A;  2KZT B;  5FZQ A;  3UXG A;  3EJN A;  2L6J A;  4M3O A;  5IY5 E;  5BUZ A;  2IEJ A;  3CEQ A;  5DIZ A;  3QC1 A;  4U07 A;  3ESK A;  1N4S A;  1NZN A;  3ZKJ A;  1U3C A;  1OCZ E;  3LJ3 A;  4PS7 A;  1FCH A;  4LCT A;  1E7U A;  1HG5 A;  4A55 A;  2XEV A;  1IXV A;  3KSQ A;  2ETB A;  2BUG A;  5BPP A;  2MHK A;  4I2W A;  2P2C P;  2F8Y A;  3HXF A;  2X6I A;  4BSZ B;  4GTV A;  2XQ0 A;  3J5Q B;  1ZB1 A;  3ASD A;  1PAQ A;  3K9I A;  5BNW A;  5CMW A;  4GTS A;  5BV1 A;  1MX6 A;  4G8K A;  2ZIS A;  3IHY A;  3QK0 A;  4LSZ E;  4U95 D;  2XPZ A;  3ABM E;  5E76 A;  2EQX A;  3D9P A;  5JA4 D;  3IV0 A;  1H6O A;  4IN3 B;  4DRX E;  2PM7 A;  5CRU A;  2QZA A;  5AJL A;  5BXU A;  1LD7 A;  2ZGD A;  4JVS A;  3B7B A;  2VGE A;  2RG8 A;  4GZ5 A;  5CBO A;  3L6A A;  3UT4 A;  4AIF A;  3FTV A;  3SBS A;  5D0O D;  4N39 A;  3D9J A;  2ZXW E;  1LTX A;  4HOS A;  1B89 A;  1HE8 A;  5ANL A;  5CEA A;  3HXC A;  2P9S G;  3NAW A;  4MBG A;  4YDY A;  3TJP A;  3TWX A;  4UQZ A;  3FUD A;  1N94 A;  2NC9 A;  3CIA A;  4JW1 A;  4MKT A;  3I4R B;  1DNP A;  3CQC B;  1K8K G;  2VYI A;  4JA9 A;  3S7D A;  4N2S A;  1FT2 A;  5FTP A;  2DYS E;  2IF4 A;  3NBN B;  3KSL A;  2CHX A;  2Y3A A;  4F7A A;  4G2V A;  1UG3 A;  4JEU A;  3FUM A;  1AWC B;  4HXI A;  4F1P A;  5ENS D;  3MGB A;  3TL5 A;  1IHB A;  3FH7 A;  1GW6 A;  3RAU A;  5ARF A;  4APO A;  4DPR A;  3SGH A;  5EIL A;  5ITZ F;  1DCQ A;  1IHG A;  3FH8 A;  4FU3 A;  3Q79 A;  2JLB A;  2KCL A;  3UTM A;  3QAR A;  2WMN A;  1EPU A;  2A4Z A;  4NQ0 A;  4CZ2 D;  5J08 A;  2FI7 A;  1N52 A;  3DPD A;  3ONL A;  4MLP A;  3ASF A;  3G2V A;  3DWL G;  5D66 A;  1PC2 A;  4AM9 A;  3CVN A;  4PS8 A;  3KAE A;  2AXV A;  4Z68 A;  4Q96 A;  3NZS A;  2BED A;  2X6K A;  2RFM A;  5ENR D;  4HOQ A;  4TV3 A;  5J90 A;  3T5X A;  3FDH A;  1BPO A;  1H6K A;  1MJ0 A;  3HRA A;  2OND A;  1N0R A;  3ZU7 B;  4PUC A;  3WXX A;  4HRL A;  1N0Q A;  5EYP F;  2CFU A;  3GW4 A;  1E8Y A;  2C2L A;  2Y69 E;  3Q4A B;  2J4D A;  5KWD A;  4JEH A;  4MS6 A;  4BSX A;  2H6I A;  2LXM A;  5JJT A;  3T8K A;  4WWO A;  3FEY A;  3D9O A;  1V54 E;  4IRU A;  4WUY A;  1V55 E;  4I2Z A;  5EIB E;  1P5Q A;  3HHM A;  3FY4 A;  2GRP B;  4DX6 D;  3BQO A;  4GTP A;  2MRI A;  2OEV A;  5FT9 A;  2DBA A;  1NA0 A;  3QNK A;  1SZ9 A;  3RO2 A;  1KT1 A;  1SVX A;  2KAT A;  4FHJ A;  4GA1 A;  3TG5 A;  3G2T A;  2GRN B;  4PS3 A;  3UM1 A;  3VTY A;  2P9N G;  4RVB A;  3SZ7 A;  1HZ4 A;  5AEN A;  3BEE A;  2IOL A;  4WAF A;  5JMN D;  4CRW A;  4BTA A;  4G11 A;  5JHA A;  3CVV A;  3G2U A;  3UKR G;  4FAD A;  1TNZ A;  3DXK G;  4CEM A;  1WG0 A;  2XEN A;  2XGM A;  4HLE A;  2LO6 A;  2KBX A;  4C48 B;  1HU3 A;  4YDW A;  4V3I A;  4KVO A;  2J49 A;  2WXH A;  4U0S A;  5EDS A;  2IQC A;  3LVR E;  5CRV A;  3SD5 A;  1OWL A;  5ENO D;  4FA6 A;  3AU4 A;  2P9P G;  4YVO A;  1BI7 B;  3APC A;  5HKP A;  3DST A;  4RSY A;  3PEV B;  3TWU A;  4URK A;  4Q69 A;  3LPZ A;  4HLL A;  3E4B A;  2P9K G;  3LDZ A;  3F6Q A;  4ABN A;  1E8Z A;  3C98 A;  2Y1L E;  2FO1 E;  1UN8 A;  2A5U A;  4FLB A;  4I43 A;  3NZU A;  2L0T B;  1E90 A;  5BW8 C;  1H2V C;  5FWQ A;  2IO2 C;  3CV0 A;  4J8D A;  5FZR A;  3L17 A;  3APF A;  1YCS B;  2BKK B;  4UWK A;  4YDO A;  3TWS A;  1UJJ A;  2PNN A;  2H6F A;  2PQR A;  2XCC A;  1LD8 A;  3ZIM A;  1EF1 C;  4BTB A;  4BT9 A;  2WM9 A;  1N4Q A;  4KXK B;  1NFI E;  3AG4 E;  5KJK A;  4I1A A;  1DVP A;  3PRE A;  3DXM G;  4JB8 P;  4PDX A;  2LSU A;  2WXK A;  4XEI G;  3DPY A;  4O1O A;  3Q47 B;  1S64 A;  2QFC A;  3ZYQ A;  3KEA A;  2KCV A;  3NOG D;  5C1D A;  2M63 A;  3Q75 A;  4FJY A;  3SY2 A;  2WXF A;  1Q2Z A;  1BU9 A;  2EIN E;  1O1S A;  2XPY A;  4BWR A;  3SI5 A;  2JAB A;  2L0I A;  2C0L A;  1XNF A;  3BUA A;  2ETA A;  1MQS A;  3Q9U C;  4NRH B;  5AAO A;  2P9U G;  2H6H A;  4X8Q A;  3P2B A;  3DSV A;  1K3Z D;  3EU5 A;  2LSV A;  3FTX A;  4RG6 A;  4HVB A;  4UWH A;  1ZBP A;  5CBN A;  3AAA C;  3AG3 E;  4AJW A;  4L7T A;  4J8E A;  3CR3 A;  5ENN A;  5CEC B;  3EHN A;  3X2Q E;  3U3W A;  3ULQ A;  1TEZ A;  1BI8 B;  2FUL A;  4L23 A;  3CVW A;  3OXL A;  2OCC E;  3CHS A;  3UT7 A;  4AVX A;  3Q49 B;  5KJM A;  4KVM A;  2XZT G;  4CYM D;  3LY9 A;  4N3B A;  5JJ6 A;  4HOR A;  3ISM C;  2Y4T A;  4TUU A;  4NAC A;  4G24 A;  4CT0 A;  2I6H A;  1NI1 A;  3HIZ A;  3ONK A;  4EHM A;  4AY6 A;  4GZ3 A;  3ZHE A;  4GCN A;  3QWP A;  2XPI A;  1WDY A;  2RD0 A;  4I6G A;  3N71 A;  3CQG B;  4XKC A;  4J8S A;  2EIK E;  1IQR A;  1D8D A;  3JXJ A;  3SNX A;  3SHF A;  3UM2 A;  1N4R A;  2I9C A;  2WXO A;  2XGS A;  2XZD G;  2R17 C;  3LCA A;  1NL4 A;  3FEX A;  2VGY A;  1WAO 1;  3TWV A;  3D9K A;  2IFU A;  4DX2 A;  2WXN A;  5CCL A;  4C0E A;  3ZPJ A;  3Q7F A;  3QJZ A;  2AXZ A;  3CHP A;  3R9A B;  3ZXS A;  3C5R A;  3UUX A;  3R7R A;  3AS5 A;  3B95 A;  2ZIR A;  4WND A;  3DSS A;  2UY1 A;  3C3R A;  1MZC A;  4GZC A;  2BTD A;  3CVQ A;  3Q7A A;  2QC9 A;  3L08 A;  2AWI A;  1AP7 A;  2YNQ A;  2F8X K;  3FU0 A;  2V8S E;  3FWV A;  4A63 B;  4B8A A;  3ZGQ A;  4TRQ A;  1JCS A;  2WXJ A;  5B1A E;  1H19 A;  2LUH A;  3RJV A;  5H7P A;  2FO7 A;  5FQ6 A;  1H6P A;  3RSE G;  3URZ A;  4K5B A;  2X3M A;  4KZC A;  4L2Y A;  1YA0 A;  3FUH A;  4BX9 A;  4LNU D;  2R5S A;  3S7F A;  3V30 A;  3ASO E;  2VSO E;  3AS8 A;  5G2N A;  3QKY A;  1JWF A;  4RQI A;  2QYU A;  5HRY A;  2XS8 A;  3PZ2 A;  3ML8 A;  3HXE A;  1UJK A;  3ZVV A;  2OV8 A;  1QNF A;  4I1O B;  5EKQ D;  1OWP A;  3EHQ A;  1TYQ G;  5D2M C;  4UQY A;  4DLQ A;  2IY0 C;  2CHZ A;  4U04 A;  3IXE A;  3V2O A;  4AOF A;  3MV3 B;  3U9W A;  1N11 A;  2L9B A;  4WWP A;  3FUF A;  1YMP A;  1FPP A;  3ESL A;  4AXH A;  1TJF A;  3FTU A;  1Y8M A;  4U63 A;  2DZO A;  2XEH A;  4CT4 A;  4ACK A;  1MHQ A;  3CLJ A;  4EZK A;  5LX8 A;  4JD2 G;  3ZYL A;  2GRL A;  5BT1 A;  4U8V D;  3FUI A;  2DVW A;  2WB2 A;  1TN8 A;  1SZA A;  1UW4 B;  3QB2 A;  3MKQ A;  4HBD A;  2WMO A;  4LUN U;  1IYG A; 
#chains in the Genus database with same CATH homology
 5FJY A;  3LY8 A;  5LCW C;  3BG1 B;  1HU3 A;  4LER A;  2MOW A;  3CK8 A;  3PZD A;  3QWV A;  2WXG A;  4WNF A;  1IQU A;  2VSX E;  4V3I A;  1N54 A;  4N3C A;  4CGV A;  4KVO A;  2VSN A;  5EX0 A;  4GPK A;  3D9I A;  4GA0 A;  2J49 A;  3KS2 A;  4A3V A;  2WXH A;  1SQM A;  4U0S A;  4DLO A;  4JHJ A;  4IUL A;  4GYO A;  3LKU A;  1KLX A;  1A17 A;  3FTZ A;  3U64 A;  4HS2 A;  2IQC A;  5EDS A;  3LVR E;  3ZEF A;  2FEZ A;  3S7B A;  1OWL A;  3SD5 A;  4U0Z A;  4UI9 K;  4FA6 A;  3AU4 A;  1HO8 A;  4K03 A;  3JQ0 A;  1E8W A;  4I17 A;  4Y6C A;  5AJD A;  4GU5 A;  2J07 A;  2OVF A;  1QQE A;  4YVO A;  5AYW D;  3MZL B;  3PNT B;  3APC A;  3ASG A;  1FVF A;  3JCK C;  3CST A;  4RSY A;  3PEV B;  3QDN A;  3FU5 A;  2YHC A;  3GZ2 A;  4Q69 A;  2DCP A;  4URK A;  3LPZ A;  4UWG A;  3CVY A;  4BX8 A;  3ML9 A;  3E4B A;  4FUL A;  2ZU6 B;  2WXR A;  3LDZ A;  3ZRH A;  4BFR A;  5A23 A;  1KT0 A;  4JPS A;  4ABN A;  3U4T A;  1E8Z A;  2CG2 A;  2J09 A;  4R7L A;  4AP2 A;  3C98 A;  5T8I A;  3Q5M A;  3CKC A;  1INZ A;  2BF0 X;  3ZFW A;  1UN8 A;  1H2T C;  2NSZ A;  4KMO A;  3VLF A;  2A5U A;  4FLB A;  3RKV A;  4P29 A;  2QY7 A;  1JWG A;  4I43 A;  3ZYM A;  5LFA A;  4OYS A;  3NZU A;  3MA5 A;  3FUE A;  5FZS A;  1ELK A;  2L0T B;  5CCM A;  1E90 A;  3B7S A;  2CG3 A;  1H2V C;  2P58 C;  3PVL A;  5BW8 C;  4DI3 A;  5FWQ A;  4GMJ A;  2LAI A;  2WXP A;  3CV0 A;  3P1U A;  4LEU A;  4J8D A;  2FBN A;  5FZR A;  2KZT B;  4AY5 A;  2V0P A;  5FZQ A;  3EIQ C;  3EJN A;  3EIJ A;  3OTN A;  2L6J A;  3CVU A;  3L17 A;  3APF A;  3KEZ A;  1OUV A;  4UWK A;  1UJJ A;  3JQ1 A;  1PY1 A;  5G55 A;  2JEK A;  4M3O A;  1L5J A;  4WNE A;  5BUZ A;  2PQR A;  2PM6 A;  3AS4 A;  4GB9 A;  3CEQ A;  2XCC A;  4B89 A;  4AV7 A;  4EZL A;  3FUL A;  5DIZ A;  3D3M A;  2X6J A;  3G2S A;  3MEK A;  3QC1 A;  4FC8 A;  4U07 A;  3ZIM A;  1EF1 C;  4BTB A;  3ESK A;  3L22 A;  1NZN A;  2WM9 A;  4BT9 A;  3LXU X;  4I9E A;  3SBT B;  1U3C A;  3TG4 A;  2C0M A;  5ARG A;  3CKB A;  3LJ3 A;  2WQH A;  1FCH A;  4PS7 A;  3LY7 A;  4KXK B;  4O6F A;  4LCT A;  5CHE E;  4GCO A;  1E7U A;  4GYW A;  2YQ8 A;  1HG5 A;  3FU3 A;  4A55 A;  5KJK A;  4I1A A;  1DVP A;  3PRE A;  2XEV A;  3S7J A;  3PUJ A;  2WQ7 A;  3VLE A;  4PDX A;  2LSU A;  3CSF A;  2BUG A;  5JJT A;  5BPP A;  2MHK A;  2WXK A;  4I2W A;  5DBK A;  2KM4 A;  2X6I A;  3DBS A;  3BG0 B;  3Q47 B;  2QFC A;  2XQ0 A;  3ZYQ A;  5JHB A;  3IBE A;  3AU5 A;  4PH4 B;  2KCV A;  1EDU A;  3LEW A;  1S0P A;  2I1K A;  3ASD A;  3Q15 A;  4C9B B;  1PAQ A;  3K9I A;  4ILH B;  5C1D A;  2M63 A;  5BNW A;  5CMW A;  5BV0 A;  4JL0 A;  4RG9 A;  4KZ0 A;  2WXQ A;  5BV1 A;  2VGX B;  4GZD A;  4A1G A;  3IHV A;  4FJY A;  2WXF A;  4JA7 A;  1H0A A;  4H7Y A;  3OAW A;  4Q94 A;  2V5F A;  2V4L A;  3IHY A;  3R7Q A;  4ANU A;  4H7X A;  2XPY A;  4BWR A;  3QK0 A;  4GA2 A;  3SI5 A;  2L0I A;  3ZYK A;  2C0L A;  1XNF A;  2XPZ A;  5LCW J;  2AXU A;  1ELW A;  4ANV A;  4JHK A;  2KZT A;  3T8M A;  4B94 A;  4U0U A;  3ZHE B;  1MQS A;  5E76 A;  1TJC A;  2EQX A;  3D9P A;  3FUK A;  1JPL A;  3B7R L;  4HOU A;  4NRH B;  2KCK A;  3IV0 A;  1LF8 A;  3TXN A;  3P2B A;  3GYZ A;  4CGW A;  4IN3 B;  4CDN A;  2LSV A;  3FTX A;  4RG6 A;  4HVB A;  3CHQ A;  2PM7 A;  5M72 A;  4UWH A;  4L2L A;  1ZBP A;  2XRY A;  4N5C A;  1WM5 A;  3MCX A;  4AJW A;  4L7T A;  5AJL A;  4FLH A;  3FHE A;  5A6C A;  4JVS A;  4J6I A;  3HYM B;  2RG8 A;  4GZ5 A;  3PDN A;  4J8E A;  5ANR A;  5KJN A;  5FQ7 A;  3L6A A;  4UI9 C;  4KYO B;  4UWF A;  5LOZ A;  4J8F A;  3CR3 A;  5ENN A;  3EHN A;  3UT4 A;  4AIF A;  3FTV A;  3U3W A;  3SBS A;  1ELR A;  1XGW A;  5D0O D;  3ULQ A;  3UT8 A;  1TEZ A;  2FUL A;  4XE0 A;  3RRN B;  2NXP A;  4N39 A;  1FVH A;  3PE4 A;  4L23 A;  3CVW A;  3D9J A;  3OXL A;  2VTB B;  5A7D B;  3I4G A;  3CHS A;  3VLD A;  4HOS A;  3UT7 A;  1EYH A;  2I2O A;  4KBQ A;  4AVX A;  4N2Q A;  3Q49 B;  1B89 A;  4E85 A;  1HE8 A;  1Z3Y A;  2GRM A;  5KJM A;  4KVM A;  5ANL A;  4JC8 A;  3MX3 A;  2UWJ G;  4I1M A;  5T3R A;  4I9C A;  1JUQ A;  2UY1 B;  4ACL A;  2R59 A;  3LY9 A;  4N3B A;  3PS6 A;  5CMY A;  5JJ6 A;  3TJP A;  4EZJ A;  4HOR A;  3GZS A;  3D9M A;  2VGX A;  2FF4 A;  5G05 C;  2Y4T A;  1H2U A;  4UQZ A;  3FUD A;  4TUU A;  4GML A;  4NAC A;  4G24 A;  4CT0 A;  1OWO A;  3CIA A;  2NC9 A;  2I6H A;  3I5P A;  3HIZ A;  4JW1 A;  4MKT A;  3I4R B;  3ONK A;  1DNP A;  2HO1 A;  3CQC B;  4UWL A;  4YVQ C;  2VYI A;  2ION A;  3RK6 A;  4AEZ C;  3RRU A;  2XRZ A;  4AY6 A;  4GZ3 A;  4JA9 A;  3S7D A;  4GCN A;  3ZHE A;  3QWP A;  2XPI A;  2RD0 A;  5D0Q D;  5T4Y A;  4I6G A;  3UPV A;  3CK9 A;  5FTP A;  4N2S A;  2IF4 A;  2J9Q A;  2XHE A;  4IYP A;  2CHX A;  3N71 A;  2Y3A A;  4G23 A;  3SF4 A;  4G2V A;  3CQG B;  3SFZ A;  4XKC A;  4F7A A;  4J8S A;  2XCB A;  1UG3 A;  4JEU A;  1IQR A;  4HFG A;  4K0R A;  4CDR A;  3FUM A;  4G26 A;  4GZ6 A;  1WY6 A;  2KC7 A;  1W3B A;  4GYY A;  4OVU A;  3SNX A;  3SHF A;  4HXI A;  2I9C A;  3RIB A;  3FU6 A;  3MGB A;  3TL5 A;  3FH7 A;  1GW6 A;  2WXO A;  2XGS A;  1VDY A;  2R17 C;  3LCA A;  3FEX A;  4A3T A;  5ARF A;  3ENE A;  2VGY A;  4APO A;  4DPR A;  4U8H A;  1WAO 1;  3SGH A;  2E2E A;  3I3N A;  3CK7 A;  2X38 A;  4XZ4 A;  3CVL A;  3D9K A;  4DJA A;  1IHG A;  4XI0 A;  3FH8 A;  2IFU A;  2J4B A;  4FU3 A;  2WXN A;  5CCL A;  4C0E A;  5G04 C;  2CHW A;  2JLB A;  3IKO B;  3ZPJ A;  2IU1 A;  5FQ4 A;  2KCL A;  2X6F A;  4EEC A;  1NP7 A;  2OVB A;  4W9R A;  3QJZ A;  2VTB A;  2Q7F A;  3RO3 A;  2AXZ A;  3MKR A;  3CHP A;  1Z6T A;  3QAR A;  2WMN A;  3R9A B;  3RU0 A;  3GZ1 A;  3PEU B;  3ZXS A;  1EPU A;  2A4Z A;  3FFL A;  4NQ0 A;  3UUX A;  5J08 A;  2FI7 A;  3FTS A;  1N52 A;  3DPD A;  4KT6 B;  3D9L A;  3R7R A;  3ONL A;  2YIN A;  5JJ7 A;  3AS5 A;  2IJG X;  2X6H A;  4MLP A;  4WND A;  4YND A;  2UY1 A;  3ASF A;  4ILI A;  3G2V A;  3UX4 A;  3CHR A;  3LS8 A;  4EBA G;  1HX8 A;  2LNI A;  1QZ2 A;  3IEG A;  2HR2 A;  1PC2 A;  2BTD A;  3CVQ A;  4GZC A;  3L08 A;  4AM9 A;  3CVN A;  2AWI A;  4QFV A;  2YNQ A;  3HDX A;  3HVE B;  4PS8 A;  3FU0 A;  2V8S E;  3KAE A;  3NQP A;  2AXV A;  3FWV A;  4B8A A;  2I1J A;  3ZGQ A;  4Q96 A;  3NZS A;  3U66 A;  5LP0 A;  4Y6W A;  2YHE A;  4A1S A;  4TRQ A;  1E7V A;  2X6K A;  3B7U X;  2WXJ A;  3UQ3 A;  4HOQ A;  1H19 A;  4TV3 A;  4DK5 A;  5J90 A;  3T5X A;  3FDH A;  5KCM A;  4XX5 A;  5EX3 A;  3RJV A;  1BPO A;  4XKB A;  1H6K A;  2FO7 A;  3FUJ A;  5FQ6 A;  3MYV A;  2OND A;  3CHO A;  2WXL A;  2PL2 A;  4UQX A;  4ME2 A;  4EQF A;  3URZ A;  4F3V A;  4PUC A;  3WXX A;  2X3M A;  4KZC A;  3FUN A;  4J0U A;  1YA0 A;  4L2Y A;  3FUH A;  3VTX A;  4BX9 A;  1IYG A;  4UI9 J;  3CVX A;  3ZW3 A;  3OXF A;  2R5S A;  3EHM A;  1E96 B;  2CFU A;  3GW4 A;  1E8Y A;  2C2L A;  3APD A;  3Q4A B;  3ASH A;  5E75 A;  3S7F A;  2J4D A;  2VSY A;  3JYS A;  3QAQ A;  2GW1 A;  2VSO E;  4JEH A;  4BT8 A;  4MS6 A;  1UN9 A;  4BY6 A;  3AS8 A;  3QOU A;  5G2N A;  3QKY A;  1JWF A;  3TXM A;  4BSX A;  4E6H A;  3FTY A;  1ZU2 A;  4CCA A;  3L16 A;  5KJL A;  1Z3X A;  2AVP A;  2WVI A;  4ATG A;  3FP3 A;  4C0M A;  4OVV A;  3PRZ A;  4LRZ A;  4F1S A;  3ML8 A;  3KD7 A;  4WWO A;  1UJK A;  3QWW A;  1HXI A;  4I6E A;  1HF8 A;  4JHR A;  4NUR A;  2DIW A;  3ZVV A;  3FEY A;  4FHK A;  2OV8 A;  3D9O A;  4APF A;  2HM8 A;  2AW6 A;  4IRU A;  4L1B A;  3MKQ B;  4WUY A;  5FQ8 A;  1QNF A;  4I1O B;  4I2Z A;  4I6J A;  5EKQ D;  1OWP A;  1P5Q A;  5G05 J;  3HHM A;  4EBA A;  3EDT B;  1HFA A;  3FY4 A;  1HH8 A;  3T5V A;  2HYZ A;  4CDM A;  3O48 A;  4G25 A;  4UQY A;  4WNG A;  2WQ6 A;  4HOT A;  1Y6I A;  2MRI A;  3MV2 B;  5HI7 A;  1NA3 A;  3HVE A;  4DLQ A;  3OXG A;  5FT9 A;  4MRU A;  2DBA A;  4ANX A;  2PZI A;  1HS6 A;  5AIJ A;  3D9N A;  3TAX A;  2CHZ A;  3L13 A;  3ZN3 A;  1NA0 A;  4U04 A;  3QNK A;  2WXI A;  1SZ9 A;  4EPZ A;  3RO2 A;  1KT1 A;  1OWN A;  2KAT A;  1HG2 A;  4B0Z A;  4FHJ A;  4GA1 A;  3TG5 A;  4AOF A;  4XIF A;  3MV3 B;  4G1T A;  3U9W A;  4FJZ A;  2WPV A;  3G2T A;  2ILR A;  2L9B A;  4WWP A;  3CVP A;  3FUF A;  4PS3 A;  1E8X A;  4JZY A;  4D10 C;  4ILG A;  3ESL A;  4AXH A;  3O4Z A;  3LVQ E;  4WWN A;  1TJF A;  3CGH A;  4B8C B;  3FTU A;  4ANW A;  3JUI A;  3VTY A;  2LAH A;  1Y8M A;  4RVB A;  3SZ7 A;  1HZ4 A;  3FTW A;  3G2W A;  5AEN A;  2IOS A;  2CFZ A;  3BEE A;  3RRM B;  2IOL A;  4U63 A;  2J08 A;  4CT4 A;  4ACK A;  1MHQ A;  3CLJ A;  2Y4U A;  3UMV A;  3CHM A;  3MJW A;  4WAF A;  3L54 A;  5G04 J;  3PH0 C;  4FP7 A;  4CRW A;  4BTA A;  3TGO A;  4G11 A;  2VJ8 A;  4JXT A;  1OWM A;  2OOE A;  3NF1 A;  4EZK A;  5JHA A;  5LX8 A;  2VQ2 A;  3S2A A;  3CVV A;  3G2U A;  3FH5 A;  4FAD A;  1U3D A;  2E0I A;  2WXM A;  3LYA A;  3ZYL A;  2GRL A;  5BT1 A;  3FUI A;  3PNL B;  5HQ8 A;  2GGF A;  2XGO A;  2WB2 A;  4CEM A;  1X5B A;  3PUK A;  1SZA A;  1UW4 B;  4F53 A;  2PQN A;  3QB2 A;  3B7T A;  2XGM A;  3PE3 A;  3MKQ A;  4N3A A;  4GAA A;  4DI4 A;  2WMO A;  4HLE A;  2LO6 A;  3B13 A;  4LUN U;  5C2Y A;  4XI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...