3KAEA

Cdc27 n-terminus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
225
Chain Sequence
SKLIGKICKSIRYRDYETAIFLAACLLEYRMLMSIVLYLNGEYTRALFHLHKLNTCTSKYYESLCYKKKKDYKKAIKSLESILEGKVERDPDVDARIQEMFVDPGDEEFFESLLGDLCTLSGYREEGIGHYVRSFGKSFLFSPVENLLLENKVPQKRGIEEEYVSDSIEFHESLSPSLVKKYMEHVPGIGSYFISNAARRYFNLGMNDKSKACFELVRRKDPMFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of the N-terminal domain of the APC/C subunit Cdc27 reveals a homo-dimeric tetratricopeptide repeat architecture
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Protein binding
molecule keywords Possible protein of nuclear scaffold
total genus 86
structure length 225
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kaeA00
2C2LA 3QKYA 4WNGA 4HOSA 3GYZA 5CCLA 4CGVA 1ZBPA 5FTPA 3RKVA 4U07A 4BTBA 1WM5A 3QWPA 3TG4A 3RO3A 3MKRA 5KJMA 2YQ8A 3CK7A 3S7JA 3ASDA 2KCKA 4WNDA 3Q47B 2IFUA 2VGYA 1IYGA 4J8FA 2VSYA 4XI9A 5LCWC 4UI9J 3IEGA 4Y6WA 1Y8MA 2KCLA 2UWJG 2VYIA 3UQ3A 3S7FA 1TJCA 3N71A 4CDRA 2OOEA 3CK8A 2FEZA 3ASFA 4UQYA 3CVQA 4ABNA 4AY5A 5KJNA 4I1AA 3EDTB 1A17A 2MHKA 5FZSA 4A1SA 5CCMA 5G05C 3CVPA 4GCNA 2J9QA 4I9CA 4KYOB 2GW1A 4N3BA 3CV0A 4I9EA 4KXKB 5FZQA 4BT8A 2FF4A 5A7DB 3Q5MA 5KJKA 1QZ2A 4JA9A 4Y6CA 1ZU2A 5M72A 5EKQD 3OXFA 2E2EA 1B89A 3QWWA 4W9RA 3UPVA 4GA2A 4LEUA 2FI7A 3LY7A 4WUYA 4RG6A 5D0OD 5DBKA 5HI7A 4H7YA 3TG5A 4I17A 4B94A 4HORA 5ARGA 4NRHB 1PC2A 2FBNA 2KATA 2PQRA 3AS8A 4J0UA 3VTYA 3GZ1A 5EX0A 2PZIA 3Q15A 3CVNA 4GYYA 3CKBA 2IF4A 3PE4A 3ZGQA 2DBAA 2LSUA 1IHGA 2YHCA 5AYWD 3ULQA 4F3VA 3TAXA 4J8DA 4GYWA 2VQ2A 3TGOA 1ELWA 1WAO1 1P5QA 2NC9A 4WNFA 5DIZA 5BT1A 3QDNA 2PQNA 2C0MA 1HXIA 3ZN3A 1NA3A 1W3BA 3RO2A 4HOTA 3KD7A 3O48A 4JA7A 3CVLA 4U04A 5G04C 3S7BA 4YNDA 2XCBA 3K9IA 4NQ0A 4UI9C 4U0UA 4AM9A 4APOA 4N2SA 3ASHA 5HQ8A 3KS2A 2XGMA 2LSVA 4N2QA 2XPIA 2Y4UA 2BUGA 3FFLA 3LYAA 4GZ5A 5ARFA 1ELRA 2V5FA 4G25A 3ZPJA 1NZNA 3E4BA 3LCAA 3LY8A 4G26A 1KT1A 2FO7A 4N3AA 3GW4A 4G1TA 4N39A 4WNEA 4XI0A 2I6HA 5FT9A 3RJVA 2Q7FA 4BTAA 2R5SA 4UQXA 2VSNA 3R9AB 4G24A 4G2VA 4H7XA 1XNFA 4J8EA 5JJ6A 5EX3A 3SF4A 3U4TA 2UY1B 2XGSA 3JYSA 4YVOA 2WQHA 4HOQA 4XIFA 2VGXA 2L6JA 3SZ7A 5A6CA 4GZ6A 5JJ7A 4EQFA 2XEVA 3CEQA 2HYZA 2HR2A 4IN3B 3Q4AB 4GYOA 4GCOA 3AS4A 2AVPA 3PE3A 2PL2A 4U0ZA 1FCHA 5BNWA 4HOUA 5C1DA 3RIBA 2QFCA 4CGWA 3BEEA 4GA0A 1KT0A 2HO1A 4I2WA 1QQEA 4UQZA 5CHEE 5KJLA 4YVQC 2XGOA 1HH8A 3CKCA 1KLXA 3URZA 3VTXA 3QWVA 4N5CA 3UUXA 4O6FA 3AS5A 3MA5A 3ASGA 1E96B 2UY1A 3FWVA 3PDNA 2LNIA 3Q49B 2C0LA 5BW8C 2VGXB 4JL0A 1NA0A 3QOUA 4G23A 4RG9A 5G05J 5FZRA 3U3WA 4AY6A 3RU0A 3ESKA 3MV3B 2Y4TA 3NF1A 3CK9A 5FJYA 2P58C 3LY9A 3ZHEA 4BT9A 3LKUA 3HYMB 3ZHEB 1YA0A 1OUVA 5G04J 2JLBA 4GPKA 3FP3A 3MEKA 3LPZA 2ONDA 4GA1A 4BWRA 5LCWJ 3GZ2A 2KC7A 2KCVA 3MV2B 4U0SA 2WPVA 4UI9K 3S7DA 4I2ZA 4KBQA 3WXXA 4ME2A 3OXGA 4GZ3A 2XCCA 3KAEA 3OXLA 5JJTA 5D0QD 4JHRA 4N3CA 3ZFWA 4AIFA 1HZ4A
chains in the Genus database with same CATH superfamily
2ETAA 1KPSB 1WDYA 3UMVA 2WVIA 4LNBA 3G2VA 3ONKA 1JWFA 1KZPA 5C1DA 3CGHA 3AU4A 2OOEA 3CK8A 4DI3A 3CHSA 1Z5SC 2EIME 2GW1A 5KCMA 4FP7A 4XKCA 3D9KA 2IQCA 3EUVA 5CBOA 4I17A 3ZIMA 4PDXA 4OVVA 2IF4A 2WXJA 2ZU6B 3JXIA 2VQ2A 1TN6A 5JHBA 3HDXA 4JA7A 3TXNA 4U8VD 3D9PA 3CLJA 1OT8A 3QARA 1IKND 3E4BA 3DXKG 4N3AA 1IHBA 4N39A 5T4YA 3SY2A 4F6RD 2VSNA 3KEAA 5JJ6A 4B89A 1YMPA 3FU3A 2VGXA 3CVVA 1OCCE 3Q4AB 3EHQA 3PE3A 3RIBA 4GA0A 3NAWA 4WWNA 1HH8A 4ANXA 3ZEFA 2FULA 2GRQB 4UWFA 4CDMA 2ZIRA 5E75A 1SA4A 2X38A 3CK9A 3FUDA 2P58C 3HVEB 2QC9A 3UIOC 3PNLB 2Y69E 2J49A 3GZ2A 2KC7A 2KCVA 3EHMA 3MCXA 3IXEA 4WNGA 3L82A 1HF8A 3G2WA 2I9CA 3CK7A 1A5EA 4WNDA 3AG2E 1OWNA 3FH5A 4FADA 3C3OA 4AY5A 4L2LA 3P2BA 4JHJA 3CVPA 4GCNA 4KYOB 4EBAG 3ZRHA 4GAAA 4FJYA 4L2YA 4CYMD 5ENSD 4RQIA 4F1PA 2OEWA 3NBNB 3Q15A 1UG3A 3ULQA 4J8DA 3UM2A 3FH7A 1ELWA 2DCPA 3BG0B 4O1OA 3HVEA 1H6KA 4ACKA 3C5RA 2I6HA 5EX3A 4L7TA 3AU5A 3L54A 1MQSA 2WXPA 5KNGA 3AS4A 2CHXA 2R2LA 3BEEA 3C98A 1IXVA 2J09A 3DWLG 3ML9A 5G05J 3SGHA 4KZ0A 2OVFA 5EYLA 3TWUA 3FUMA 1DCEA 2DZNA 5JA4D 4I1OB 4BX8A 3Q9NC 3OXGA 1JCQA 2V0PA 2VJ8A 3DPDA 1SW6A 4EZLA 5HS0A 4I6GA 2R59A 4BTBA 2XEEA 4GTTA 2P9NG 1L5JA 1WG0A 4LNUD 3ASDA 3FTUA 3Q47B 3Q73A 3NOCD 3IKOB 4JPSA 3L16A 5G05C 2DWZA 3FDHA 1E7UA 3FTZA 4JA9A 1Y6IA 4TXPA 3I4GA 4L1BA 4WUYA 2CG2A 2WQ6A 2VSXE 3CKBA 1FT2A 3R7QA 2P9KG 2FO1E 3PVLA 3V30A 3ZN3A 4HOTA 2J08A 3CVLA 3HXFA 3CIAA 1EDUA 3UKRG 4I43A 1ELRA 2V5FA 3LY8A 2PM6A 3RJVA 3PREA 4G1TA 4JEUA 4G24A 4C48B 3UPVA 4BX9A 5EIDA 2UY1B 2R05A 3CR3A 2L6JA 3SZ7A 3CSFA 3MX3A 2DZOA 4WWOA 3T8MA 5FQ4A 5BW8C 4J8YA 1N4SA 3UKUG 3LY9A 3LKUA 4L23A 3BG1B 1EPUA 1V55E 2XZDG 4BWRA 2KZTA 4KBQA 3E34A 3D9JA 5KBAA 4B0ZA 4AJWA 4GB9A 4CCAA 4HXIA 2DIWA 5E76A 5AQAA 2IOSA 4J8FA 4GTVA 4GPMA 5LCWC 4Y6WA 1S70B 2KM4A 3CVUA 2L0IA 2I1JA 3ZXPA 4LSZE 5H7PA 3PNTB 4HB5A 2X6IA 4BETA 2R17C 3PS6A 4B8CB 1JCRA 3QNKA 5FQ8A 1NL4A 2P9PG 2X3MA 3TWVA 2BTDA 3AG3E 3TAXA 2ZISA 4BEPA 3B7TA 1SVXA 4JXTA 2C0MA 4V3IA 5EYPF 1INZA 1SQMA 3KD7A 3PZ3A 4NQ0A 3FTYA 1BPOA 4APOA 2LSVA 1OCZE 1UOHA 5FIOA 4ZFHA 4G25A 2WXRA 3R9AB 2JEKA 1O1SA 4HBDA 3L22A 3LJ3A 1HO8A 2WXFA 1FVFA 2XEVA 1UJKA 1FCHA 5BNWA 5CMWA 4TUMA 3Q9UC 3URZA 4CDNA 3UUXA 3ASGA 2R03A 5FWQA 5EN5D 4JL0A 2LAHA 3HIZA 1TN8A 4BT9A 3MKQB 5LCWJ 3Q75A 4BSXA 4GZ3A 3UT8A 4FLBA 4JHRA 4TUUA 2CHZA 1NFIE 3MJWA 4HI9A 5D66A 1E8WA 3MKRA 3FU6A 2VGYA 3SFXA 5EILA 1TJCA 1HE8A 1FPPA 3FU5A 3TWWA 3SQVA 5M72A 5JMND 4KVMA 4U7EB 1B89A 4RG6A 1D8DA 2PNNA 4K5CA 2MRIA 1EYHA 3V31A 2YHCA 1IHGA 5AQBA 2AJAA 2X6JA 4F7AA 5DIZA 1JUQA 4JHKA 5ENQD 4DX5D 4FULA 4K0RA 5ARFA 3T5XA 3NOGD 4LNGA 3RK6A 1V54E 3U4TA 1H6PA 4HOQA 4URKA 5AARA 3ULEG 1DNPA 4F1SA 2PL2A 1PAQA 2XRYA 4FHJA 4GMJA 3FWVA 4EBAA 4JW1A 4DLQA 2CHWA 3QC1A 1UW4B 2NSZA 3TWXA 1K3ZD 3MEKA 2PM7A 5CRVA 4U0SA 4UI9K 4DLOA 3KAEA 1MYOA 4GMRA 4A63B 3SFZA 4ILIA 5FTPA 3T5VA 3RO3A 3S7JA 4WAFA 2EIKE 3SBSA 2UWJG 5CECB 3FTSA 4N3BA 4I9CA 2J9QA 3ML8A 3G2TA 5FZQA 3QWWA 3CHOA 2FI7A 5HI7A 4HORA 3RRMB 5LP0A 2Y1LE 3CHRA 5KWDA 3DRAA 1TJFA 3D9HA 2Y0BG 3E30A 1UJJA 3TGOA 4WNFA 1N4QA 1MZCA 5T3RA 1NA3A 2WXMA 3KS2A 2J4DA 4HI8A 1VDYA 4DUIA 3DSWA 3L17A 3HRAA 2NXPA 1N9AA 1MX4A 4H7XA 3PUJA 3UXGA 1ELKA 1S63A 3BUAA 4KVOA 4IN3B 1U2VG 2P9SG 5LOZA 5CHEE 5J90A 3CKCA 1UN8A 3FU0A 3MA5A 2ZGGA 3KEZA 3PDNA 2CG3A 1Z3XA 3RU0A 3ESKA 2P9UG 2KBXA 2V4LA 1JCSA 3S7DA 1Z6TA 4LG6A 5AJDA 5ENNA 4IRUA 3QJZA 3ZFWA 3EIJA 3KSQA 1O1RA 4BFRA 3UTMA 2YQ8A 4J7WA 2IFUA 2YHEA 4XEIG 3S7FA 4ABNA 3ABLE 3SHFA 4ATZD 4OAUC 4I9EA 4YDEA 3Q5MA 5CEDB 4FJZA 3D9NA 1DCQA 4HLLA 5LFAA 5EIBE 1N95A 2KZTB 3ABKE 4GU5A 2DVWA 4JVSA 4GYWA 2LXMA 5AENA 2QZAA 1TNZA 1SZAA 2F0YA 3FFLA 4EPZA 1U3DA 2Q7FA 3APFA 1E8ZA 3UX4A 2RFMA 1Z3YA 2ZXWE 4LRZA 3MZLB 5JJ7A 2L0TB 3T8KA 2KXPC 5BPPA 4Q94A 1U3CA 4U95D 3VLEA 2HO1A 1H19A 4AP2A 4IULA 4C0MA 2XGOA 4E6HA 4TXQA 3QWVA 1H6OA 4LERA 1OY3D 2VGXB 3FEXA 4ANVA 4J8SA 3UINC 4CRWA 5FJYA 3SBTB 4IYPA 4N5QA 5G04J 2BEDA 4G8LA 1O1TA 3AJIA 2XCCA 5D0QD 1TN7A 5AQ7A 3F6QA 2C2LA 1ZBPA 4CEMA 4B8AA 4FLHA 3L08A 3IEGA 4CDRA 1D9SA 1IQUA 3LJNA 3JQ1A 3RSEG 1UN9A 3CV0A 4QFVA 2WM9A 3Q7AA 5EKQD 2E2EA 3FUFA 2XPZA 3V2OA 3TG5A 1PC2A 2PQRA 4HRLA 3EU9A 2PZIA 3PE4A 1X5BA 4J6IA 1BI7B 1SZ9A 3TWTA 3D9LA 2EIJE 4U04A 5G04C 5KNHD 3LEWA 4GTSA 4TV3A 2WB2A 2AWIA 3CSTA 4HQDA 2J07A 4UQXA 1XNFA 2GGFA 1O5MA 2AVPA 3QB2A 5ANRA 4ATGA 4A1GA 4O6FA 2WXQA 5AN8A 2ETBA 3U3WA 2ILRA 5FQ6A 2E0IA 3MGBA 3RRUA 1WY6A 3CHPA 4ME2A 5CMYA 4JD2G 3ULYA 2V4HC 3G2SA 4UWLA 3RKVA 1WM5A 2AXUA 2J8SD 3UT4A 1H0AA 5G55A 4Z68A 4UI9J 3L6AA 5BV0A 4NIKA 4DX2A 1TNBA 3DEPA 2WXLA 3SNXA 3DEOA 2F37A 2OCCE 2WXGA 4HVBA 5D0OD 3D9OA 4NRHB 2RD0A 4DPRA 1N11A 4OAVB 3SO8A 2NC9A 3MKQA 3HXEA 4UI9C 4AM9A 3J5PA 4UWHA 1NP7A 5B1AE 4AXHA 3LDZA 1KT1A 4XI0A 4U8HA 5LX8A 3IHYA 3NZSA 3VLFA 4JB8P 1OCRE 3FHEA 2HYZA 2HR2A 4CGWA 3G2UA 4JEHA 4YVQC 4AEZC 4Q96A 4C0EA 4A3TA 4GTOA 3JUEA 2UY1A 2LNIA 2XQ0A 3ZHEA 2XZTG 1RW2A 4GA1A 3I4RB 2OV8A 3WXXA 4HRMB 4GTPA 4YDWA 4N3CA 3ZYKA 4G11A 3U64A 1H2TC 4ANUA 5J08A 1N0RA 5ENOD 1TR4A 4AV7A 1QZ2A 3OXFA 2A4ZA 4W9RA 1S64A 3PZ2A 4A3VA 5DBKA 4H7YA 2GRPB 1N4PA 3ZGQA 2DBAA 3ZVVA 4O60A 4UUCA 4JC8A 2I1KA 5G2NA 2WXNA 3UM3A 3B7BA 3DSXA 1W3BA 3ZNGA 4TRQA 1E90A 3T9KA 3LYAA 3ZPJA 4I1MA 5BT1A 3PRZA 5ANLA 4MBGA 4G2VA 2DYSE 3SF4A 3JYSA 1AWCB 2AW6A 4HOUA 3HXDA 1ZB1A 3FULA 3SD5A 1FVHA 1E96B 3FUIA 4RG9A 1LD7A 3SI5A 3D9IA 1YA0A 4OYSA 3B13A 1H2VC 3OXLA 4AIFA 4I6EA 4RSYA 5CCLA 1MX2A 2X6HA 2BKGA 1IYGA 4AVXA 4XI9A 1RZ4A 5BXOA 3UQ3A 4U8YD 3ZYLA 1TNUA 1OWOA 3RRNB 4A1SA 1OCOE 3U66A 4Y6CA 1PY1A 2XEHA 4GA2A 4LEUA 3ASNE 4NURA 4L9PA 2KATA 3VTYA 1K1BA 3GZ1A 4CZ2D 1AP7A 2LSUA 5AYWD 3NZUA 2QYJA 4GTQA 3LXUX 4NACA 3O48A 1FT1A 2Y3AA 4YNDA 3S7BA 3K9IA 2Y4UA 3PEUB 2RFAA 4BTAA 4EHMA 5BXUA 3FUHA 5IY5E 2WQHA 1OWLA 3EU5A 5A6CA 2IOLA 4U63A 4GYOA 3JCKC 3J5QB 3UI2A 5A23A 4FHKA 3CHQA 1QQEA 2XENA 4N5CA 5B3SE 3Q49B 2P2CP 2R02A 3CVWA 3QOUA 4GZDA 2IO3C 3NQPA 2P9LG 4PS8A 4PS7A 4PUCA 3TWQA 3EIQC 3B7SA 2IU1A 4HOSA 2YINA 3C3RA 4U07A 1SA5A 1H2UA 3HHMA 3HXBA 3EHRA 1N0QA 5CERB 3CVYA 4I1AA 3AG1E 1GW6A 4BT8A 1ZU2A 3ZW3A 4ILGA 2WMOA 5T8IA 3B7RL 1MJ0A 3L9TA 1K1AA 4GYYA 3CVNA 4PS3A 2GRMA 3LVRE 2LO6A 3E37A 2B6CA 1BD8A 4C9BB 3FUNA 2H6FA 2XCBA 2XGMA 2A5UA 3TJPA 1HS6A 4G26A 4X8QA 3OAWA 2FO7A 2VSOE 3C72A 3GW4A 3U9WA 2IONA 2WXHA 1E7VA 2GRLA 5AAOA 4XE0A 4DK5A 4E85A 3DSUA 4UQZA 3E32A 4GZCA 4XX5A 4DX7D 1MX6A 3AS5A 1G3NB 1E8YA 2H6IA 5ENTD 3HYMB 2JLBA 2EINE 2ONDA 3PH0C 5D2MC 4M3OA 4I2ZA 3IV0A 5JJTA 2DYRE 3DXMG 3O4ZA 1HG2A 2VGEA 4BESA 3BQOA 4F53A 3MYVA 4ILHB 2WMNA 3DBSA 2KCKA 4KMOA 3FUKA 4BSZB 3EHNA 2FEZA 3D3MA 3FTVA 1JPLA 2MHKA 1IQRA 5A7DB 4HLEA 2GROB 4O1PA 1K8KG 2QY7A 5ITZF 4LCTA 1LF8A 3ASOE 3WG7E 2FBNA 3Q79A 3D9MA 3JXJA 4AOFA 5FQ7A 3CVXA 3QDNA 5HKPA 4HNAD 3ZUVB 2I2OA 3IHVA 2VTBB 4APFA 2H6GA 2IO2C 3HXCA 1NI1A 2JABA 2B0OE 3QK0A 3ONLA 2GRRB 3NB2A 1NZNA 1YYHA 4WNEA 5KJMA 4YDOA 1DC2A 2R5SA 4J8EA 1KZOA 4I6JA 4YDYA 4GTRA 2LUHA 5ENPD 1KT0A 4ANWA 4BY6A 1XGWA 4OVUA 3L13A 4MRUA 2F8XK 1D8EA 4EZKA 3EJNA 5CRUA 3SFYA 3FY4A 3OTNA 3ZHEB 5AJLA 3LPZA 1X81A 2WPVA 4DI4A 1N54A 3R7RA 3GYZA 3ZXSA 2X6FA 2X6KA 1LTXA 1TNYA 3FUJA 3ZYMA 2MYOA 2WQ7A 3APDA 2VYIA 2KCLA 3N71A 5KJNA 5C2YA 2RG8A 2YNQA 5CBNA 2NYJA 2FF4A 3LS8A 4K5AB 3PZDA 4UWKA 1JWGA 2CFZA 4B93B 2WXIA 1S0PA 3UM1A 3AS8A 4J0UA 5EX0A 2AXVA 3ESLA 4M7CA 3ISMC 3LVQE 1HG5A 1WAO1 2LAIA 2WXKA 3RO2A 3ZYQA 4N2SA 3V79K 1N4RA 3ASHA 4N2QA 1QBQA 3FEYA 4GZ5A 3CQGB 3LCAA 3HG0D 4FU3A 4K03A 2GRNB 2H6HA 2XGSA 2RKKA 5ENRD 2CFUA 3Q7FA 3FTXA 3FTWA 4GCOA 4U0ZA 5FINA 3I3NA 4KT6B 5KJLA 1HX8A 3AG4E 1BU9A 4R7LA 3TXMA 4G23A 3MV3B 2HE0A 2Y4TA 4GPKA 3FP3A 4LUNU 4HFGA 3Q78A 3PZ4A 5B1BE 4DX1A 1BI8B 1HZ4A 3QKYA 3UIPC 4HS2A 4CGVA 3BU8A 1DVPA 2BF0X 2MOWA 1QYMA 2VSYA 1MHQA 1Y8MA 4K5BA 4D10C 3ASFA 4UQYA 3CVQA 2IEJA 3UT7A 5AQ9A 5FZSA 3W9GA 4KXKB 5KJKA 3R9MA 2WXOA 3ZKJA 3S2AA 5AIJA 3DPYA 3FUEA 5CEAA 2ZGDA 4CT4A 3DSVA 4KZCA 3ENEA 4F3VA 2LXLA 1P5QA 3DSSA 3V2XA 3E33A 2BKKB 1TNOA 2BUGA 2XS1A 2OVBA 2AXZA 4PH4B 1OXJA 4XKBA 4XIFA 4GZ6A 2XRZA 4EQFA 4ZHBA 4EECA 2M63A 1TEZA 4DX6D 1EF1C 5EDSA 3RAUA 3AAAC 1KLXA 2EILE 5HRYA 2C0LA 1NA0A 3ABME 4AY6A 5FZRA 2V8SE 4ACLA 2QYUA 3JUIA 3JQ0A 1OUVA 4FA6A 3X2QE 2A5EA 4QQIA 3MV2B 4DJAA 1YCSB 3DSTA 4MS6A 4TXRA 3I5PA 3UM0A 2F8YA 2HM8A 4WWPA 3QWPA 3TG4A 4Q69A 1QNFA 2XPYA 2OEVA 1LD8A 3W9FA 3QAQA 3B7UX 4XZ4A 3ZU7B 3TL5A 5JHAA 2P9IG 3CQCB 3EDTB 1A17A 2ETCA 5CCMA 4EZJA 3IBEA 1Q2ZA 3FH8A 3PEVB 4MLPA 2V5QC 2VTBA 2XHEA 3GZSA 3TWSA 4G8KA 3LY7A 4B94A 5ARGA 4RLYA 1HU3A 5BUZA 4GMLA 4P29A 2J4BA 4DRXE 4UWGA 4BERA 4HRNA 1OWPA 2PQNA 1HXIA 1OWMA 4U0UA 5HQ8A 2XPIA 2L9BA 2IY0C 5FT9A 3PZ1A 1N94A 3C3QA 3KSLA 1BLXB 4A55A 4YVOA 3CEQA 2QFCA 3B95A 4I2WA 4CT0A 1TYQG 3VTXA 1E8XA 4U96D 3TWRA 2IJGX 2EQXA 4GTMA 3NF1A 3P1UA 4JZYA 1N52A 4RVBA 2L6BA 4FC8A 5BV1A 3VLDA 1HFAA 3CHMA 2XS8A 4MKTA 3APCA 3PUKA
chains in the Genus database with same CATH topology
3MJWA 3G2SA 4UWLA 3RKVA 4F53A 1WM5A 3MYVA 2AXUA 1E8WA 3MKRA 4ILHB 2WMNA 1H0AA 3UMVA 3UT4A 5G55A 3DBSA 2KCKA 2WVIA 3FU6A 4KMOA 2VGYA 3FUKA 4UI9J 3G2VA 3EHNA 3L6AA 3ONKA 1JWFA 5BV0A 5C1DA 3CGHA 1TJCA 1HE8A 3AU4A 2OOEA 3CK8A 2FEZA 3CHSA 3D3MA 4DI3A 3FTVA 1JPLA 3FU5A 2MHKA 1IQRA 2GW1A 5KCMA 5A7DB 2WXLA 4FP7A 4HLEA 4XKCA 5M72A 3D9KA 3SNXA 2IQCA 4KVMA 1B89A 2WXGA 4HVBA 2QY7A 4LCTA 5D0OD 4RG6A 1LF8A 4I17A 3ZIMA 3D9OA 4PDXA 4NRHB 2MRIA 2FBNA 4OVVA 2RD0A 4DPRA 1EYHA 2IF4A 3D9MA 2YHCA 2WXJA 1IHGA 2ZU6B 2X6JA 2VQ2A 4AOFA 4F7AA 5DIZA 2NC9A 1JUQA 5FQ7A 3CVXA 3QDNA 4JHKA 5JHBA 3HDXA 2I2OA 3MKQA 3IHVA 4JA7A 3TXNA 2VTBB 4APFA 3D9PA 4UI9C 4AM9A 3CLJA 4FULA 4K0RA 4UWHA 3QARA 3QK0A 5ARFA 1NP7A 3ONLA 3T5XA 4AXHA 1NZNA 3E4BA 3LDZA 4N3AA 4WNEA 1KT1A 5KJMA 4N39A 4XI0A 5T4YA 4U8HA 5LX8A 3IHYA 3NZSA 2R5SA 2VSNA 3RK6A 4J8EA 3VLFA 5JJ6A 4I6JA 3U4TA 4B89A 4HOQA 4URKA 3FU3A 2VGXA 3FHEA 2HYZA 1DNPA 2HR2A 3Q4AB 4F1SA 3CVVA 3PE3A 2PL2A 3RIBA 1PAQA 4CGWA 4GA0A 1KT0A 3G2UA 4JEHA 4WWNA 4YVQC 2XRYA 1HH8A 4FHJA 4AEZC 4ANWA 4ANXA 4BY6A 1XGWA 4Q96A 3ZEFA 4GMJA 2FULA 4A3TA 4C0EA 4OVUA 3L13A 2UY1A 3FWVA 4MRUA 4EBAA 4JW1A 2LNIA 4DLQA 1HG2A 2XQ0A 4UWFA 2CHWA 3QC1A 4CDMA 4EZKA 1UW4B 5E75A 3EJNA 2X38A 3CK9A 3FY4A 2P58C 3FUDA 3HVEB 3ZHEA 2NSZA 3OTNA 3ZHEB 3PNLB 3MEKA 5AJLA 3LPZA 2J49A 2PM7A 4GA1A 3I4RB 3GZ2A 2KC7A 2KCVA 2OV8A 3EHMA 2WPVA 4U0SA 4UI9K 3WXXA 4DLOA 3KAEA 3MCXA 4DI4A 4N3CA 3ZYKA 4G11A 1N54A 3R7RA 4WNGA 3GYZA 3U64A 3SFZA 3ZXSA 4ILIA 5FTPA 2X6FA 2X6KA 1H2TC 1HF8A 3T5VA 3RO3A 3G2WA 2I9CA 3FUJA 3S7JA 3CK7A 4WAFA 4ANUA 5J08A 3ZYMA 4WNDA 2WQ7A 3SBSA 1OWNA 3APDA 2VYIA 2KCLA 2UWJG 3FH5A 3N71A 4FADA 4AY5A 4L2LA 5KJNA 5C2YA 3P2BA 3FTSA 2RG8A 2YNQA 4JHJA 3CVPA 4GCNA 2J9QA 4I9CA 3ML8A 4KYOB 4N3BA 3G2TA 5FZQA 4GAAA 3ZRHA 4AV7A 2FF4A 1QZ2A 3LS8A 4FJYA 4L2YA 3OXFA 3PZDA 4UWKA 2A4ZA 3QWWA 4W9RA 3CHOA 1JWGA 2CFZA 2FI7A 5HI7A 4A3VA 4HORA 2WXIA 1S0PA 5DBKA 4H7YA 3RRMB 3AS8A 4J0UA 5LP0A 5EX0A 3Q15A 2AXVA 3CHRA 3ESLA 3ZGQA 1TJFA 1UG3A 2DBAA 3ULQA 3ZVVA 3LVQE 4J8DA 4JC8A 1UJJA 2I1KA 3FH7A 2WXNA 1HG5A 5G2NA 3TGOA 1ELWA 1WAO1 2DCPA 4WNFA 2LAIA 2WXKA 5T3RA 1NA3A 1W3BA 3BG0B 3RO2A 3HVEA 4TRQA 3ZYQA 1H6KA 4ACKA 2WXMA 4N2SA 1E90A 3ASHA 4N2QA 3KS2A 3FEYA 2J4DA 3LYAA 1VDYA 4GZ5A 3ZPJA 4I1MA 5BT1A 3CQGB 3LCAA 3L17A 3PRZA 4FU3A 2I6HA 5ANLA 2NXPA 4G2VA 4H7XA 4K03A 3SF4A 5EX3A 3PUJA 2XGSA 3AU5A 3JYSA 4L7TA 1ELKA 3L54A 1MQSA 2CFUA 2WXPA 3FTXA 4KVOA 4IN3B 3FTWA 4GCOA 3AS4A 4U0ZA 2AW6A 2CHXA 5LOZA 4HOUA 3I3NA 3BEEA 4KT6B 5CHEE 5KJLA 5J90A 3CKCA 3FULA 1HX8A 1UN8A 3FU0A 3SD5A 3MA5A 1FVHA 3C98A 1E96B 3FUIA 3KEZA 4R7LA 3PDNA 3TXMA 2J09A 3O4ZA 3ML9A 2CG3A 4G23A 4RG9A 5G05J 1Z3XA 3RU0A 3ESKA 3MV3B 3SI5A 3SGHA 2Y4TA 3D9IA 4KZ0A 2OVFA 1YA0A 2V4LA 4OYSA 3B13A 4GPKA 3FUMA 3FP3A 4LUNU 4HFGA 3S7DA 4I1OB 4BX8A 1Z6TA 3OXGA 1H2VC 5AJDA 3OXLA 5ENNA 4IRUA 2V0PA 3QJZA 3EIJA 2VJ8A 3ZFWA 4AIFA 3DPDA 4I6EA 4EZLA 1HZ4A 3QKYA 4I6GA 4RSYA 5CCLA 4BFRA 4HS2A 4CGVA 2R59A 4BTBA 2X6HA 1L5JA 1DVPA 2BF0X 2YQ8A 2MOWA 3ASDA 3FTUA 2IFUA 3Q47B 2YHEA 4AVXA 1IYGA 2VSYA 4XI9A 1MHQA 3UQ3A 1Y8MA 3S7FA 4D10C 3IKOB 4JPSA 4ABNA 3ASFA 4UQYA 3ZYLA 3CVQA 1OWOA 3L16A 3UT7A 3RRNB 5FZSA 4A1SA 5G05C 3SHFA 3U66A 3FDHA 4I9EA 4KXKB 3Q5MA 5KJKA 1E7UA 3FTZA 4JA9A 4Y6CA 4FJZA 1Y6IA 1PY1A 3D9NA 3I4GA 4L1BA 2WXOA 4GA2A 4LEUA 3S2AA 5AIJA 5LFAA 4WUYA 3FUEA 4NURA 2CG2A 2WQ6A 2VSXE 2KATA 3VTYA 4CT4A 2KZTB 3GZ1A 3CKBA 4KZCA 3ENEA 2LSUA 4GU5A 5AYWD 3R7QA 4F3VA 3NZUA 4JVSA 4GYWA 3PVLA 1P5QA 5AENA 3ZN3A 4HOTA 2J08A 3LXUX 4NACA 1SZAA 3O48A 3CVLA 2Y3AA 4YNDA 3S7BA 3CIAA 3K9IA 1EDUA 2Y4UA 3FFLA 2BUGA 3PEUB 4I43A 1ELRA 2V5FA 3LY8A 4EPZA 2PM6A 3RJVA 3PREA 4G1TA 4BTAA 1U3DA 2Q7FA 4JEUA 3APFA 1E8ZA 3FUHA 2OVBA 4G24A 3UX4A 3UPVA 4BX9A 2AXZA 1Z3YA 2UY1B 4PH4B 2WQHA 4XKBA 3CR3A 4LRZA 4XIFA 3MZLB 2L6JA 3SZ7A 4GZ6A 1OWLA 5JJ7A 4EQFA 2XRZA 2L0TB 5A6CA 2IOLA 3CSFA 4GYOA 3JCKC 4U63A 3MX3A 4EECA 2M63A 5BPPA 4Q94A 1TEZA 1EF1C 1U3CA 3VLEA 5A23A 5EDSA 2HO1A 1H19A 3CHQA 1QQEA 4FHKA 4AP2A 4IULA 4C0MA 2XGOA 4E6HA 1KLXA 3QWVA 4N5CA 4WWOA 3T8MA 3Q49B 4LERA 2C0LA 5FQ4A 5BW8C 2VGXB 3CVWA 1NA0A 3QOUA 3FEXA 4GZDA 4AY6A 5FZRA 2V8SE 4ANVA 4J8SA 4ACLA 4CRWA 3NQPA 5FJYA 3SBTB 3LY9A 4IYPA 4PS8A 3LKUA 3JUIA 4L23A 3JQ0A 1OUVA 3BG1B 5G04J 1EPUA 4FA6A 4PS7A 4BWRA 4PUCA 3MV2B 4DJAA 2KZTA 4KBQA 3EIQC 2XCCA 4MS6A 5D0QD 3D9JA 3B7SA 2IU1A 3I5PA 2C2LA 4B0ZA 4EBAG 4AJWA 4HOSA 2YINA 2HM8A 1ZBPA 4GB9A 4U07A 4WWPA 4CCAA 3QWPA 1H2UA 4HXIA 2DIWA 4CEMA 3HHMA 3TG4A 1QNFA 5E76A 4Q69A 2XPYA 4B8AA 4FLHA 2IOSA 3QAQA 4J8FA 5LCWC 3L08A 3B7UX 4XZ4A 3IEGA 4Y6WA 3TL5A 4CDRA 3CVYA 1IQUA 2KM4A 5JHAA 3CVUA 3JQ1A 3CQCB 4I1AA 3EDTB 1UN9A 1A17A 2I1JA 2L0IA 5CCMA 4EZJA 3CV0A 1GW6A 3IBEA 2WM9A 4QFVA 4BT8A 3FH8A 3PEVB 1ZU2A 3PNTB 5EKQD 4MLPA 3ZW3A 2E2EA 2X6IA 2VTBA 2XHEA 4ILGA 2R17C 3FUFA 3GZSA 2XPZA 3PS6A 4B8CB 2WMOA 3LY7A 3QNKA 4B94A 5FQ8A 3TG5A 5T8IA 5ARGA 1PC2A 2PQRA 3B7RL 2PZIA 4GYYA 1HU3A 2BTDA 2X3MA 3CVNA 4PS3A 2GRMA 3PE4A 5BUZA 1X5BA 4GMLA 3LVRE 4J6IA 4P29A 2J4BA 3TAXA 4UWGA 1SZ9A 2LO6A 3B7TA 3D9LA 1OWPA 2C0MA 2PQNA 1HXIA 4JXTA 4V3IA 4C9BB 3FUNA 1OWMA 1INZA 1SQMA 3KD7A 4U04A 5G04C 2XCBA 4NQ0A 3FTYA 4U0UA 1BPOA 4APOA 5HQ8A 2XGMA 2LSVA 3LEWA 2A5UA 2XPIA 2L9BA 3TJPA 1HS6A 4G25A 4G26A 3OAWA 2FO7A 2VSOE 2WXRA 3GW4A 4TV3A 5FT9A 2WB2A 2AWIA 3CSTA 2J07A 4UQXA 3R9AB 2JEKA 3U9WA 1XNFA 4A55A 2IONA 3L22A 2GGFA 4YVOA 3LJ3A 2WXHA 1HO8A 2WXFA 1FVFA 1E7VA 2XEVA 1UJKA 2GRLA 3CEQA 2AVPA 1FCHA 5BNWA 3QB2A 4XE0A 5ANRA 4DK5A 2QFCA 4E85A 5CMWA 4I2WA 4ATGA 4UQZA 4CT0A 4GZCA 4XX5A 3VTXA 3URZA 4CDNA 3UUXA 4A1GA 4O6FA 3AS5A 1E8XA 1E8YA 2WXQA 3ASGA 5FWQA 2IJGX 4JL0A 3U3WA 2LAHA 2EQXA 3HIZA 2ILRA 3NF1A 3P1UA 4JZYA 5FQ6A 2E0IA 3MKQB 1N52A 4BT9A 3HYMB 4RVBA 4FC8A 3MGBA 2JLBA 1WY6A 3RRUA 3CHPA 2ONDA 5LCWJ 3PH0C 3VLDA 5BV1A 4M3OA 4I2ZA 4BSXA 4ME2A 4GZ3A 5CMYA 3UT8A 3IV0A 1HFAA 3CHMA 4FLBA 5JJTA 4JHRA 4TUUA 2CHZA 4MKTA 3APCA 3PUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2L A;  3QKY A;  4WNG A;  4HOS A;  3GYZ A;  5CCL A;  4CGV A;  1ZBP A;  5FTP A;  3RKV A;  4U07 A;  4BTB A;  1WM5 A;  3QWP A;  3TG4 A;  3RO3 A;  3MKR A;  5KJM A;  2YQ8 A;  3CK7 A;  3S7J A;  3ASD A;  2KCK A;  4WND A;  3Q47 B;  2IFU A;  2VGY A;  1IYG A;  4J8F A;  2VSY A;  4XI9 A;  5LCW C;  4UI9 J;  3IEG A;  4Y6W A;  1Y8M A;  2KCL A;  2UWJ G;  2VYI A;  3UQ3 A;  3S7F A;  1TJC A;  3N71 A;  4CDR A;  2OOE A;  3CK8 A;  2FEZ A;  3ASF A;  4UQY A;  3CVQ A;  4ABN A;  4AY5 A;  5KJN A;  4I1A A;  3EDT B;  1A17 A;  2MHK A;  5FZS A;  4A1S A;  5CCM A;  5G05 C;  3CVP A;  4GCN A;  2J9Q A;  4I9C A;  4KYO B;  2GW1 A;  4N3B A;  3CV0 A;  4I9E A;  4KXK B;  5FZQ A;  4BT8 A;  2FF4 A;  5A7D B;  3Q5M A;  5KJK A;  1QZ2 A;  4JA9 A;  4Y6C A;  1ZU2 A;  5M72 A;  5EKQ D;  3OXF A;  2E2E A;  1B89 A;  3QWW A;  4W9R A;  3UPV A;  4GA2 A;  4LEU A;  2FI7 A;  3LY7 A;  4WUY A;  4RG6 A;  5D0O D;  5DBK A;  5HI7 A;  4H7Y A;  3TG5 A;  4I17 A;  4B94 A;  4HOR A;  5ARG A;  4NRH B;  1PC2 A;  2FBN A;  2KAT A;  2PQR A;  3AS8 A;  4J0U A;  3VTY A;  3GZ1 A;  5EX0 A;  2PZI A;  3Q15 A;  3CVN A;  4GYY A;  3CKB A;  2IF4 A;  3PE4 A;  3ZGQ A;  2DBA A;  2LSU A;  1IHG A;  2YHC A;  5AYW D;  3ULQ A;  4F3V A;  3TAX A;  4J8D A;  4GYW A;  2VQ2 A;  3TGO A;  1ELW A;  1WAO 1;  1P5Q A;  2NC9 A;  4WNF A;  5DIZ A;  5BT1 A;  3QDN A;  2PQN A;  2C0M A;  1HXI A;  3ZN3 A;  1NA3 A;  1W3B A;  3RO2 A;  4HOT A;  3KD7 A;  3O48 A;  4JA7 A;  3CVL A;  4U04 A;  5G04 C;  3S7B A;  4YND A;  2XCB A;  3K9I A;  4NQ0 A;  4UI9 C;  4U0U A;  4AM9 A;  4APO A;  4N2S A;  3ASH A;  5HQ8 A;  3KS2 A;  2XGM A;  2LSV A;  4N2Q A;  2XPI A;  2Y4U A;  2BUG A;  3FFL A;  3LYA A;  4GZ5 A;  5ARF A;  1ELR A;  2V5F A;  4G25 A;  3ZPJ A;  1NZN A;  3E4B A;  3LCA A;  3LY8 A;  4G26 A;  1KT1 A;  2FO7 A;  4N3A A;  3GW4 A;  4G1T A;  4N39 A;  4WNE A;  4XI0 A;  2I6H A;  5FT9 A;  3RJV A;  2Q7F A;  4BTA A;  2R5S A;  4UQX A;  2VSN A;  3R9A B;  4G24 A;  4G2V A;  4H7X A;  1XNF A;  4J8E A;  5JJ6 A;  5EX3 A;  3SF4 A;  3U4T A;  2UY1 B;  2XGS A;  3JYS A;  4YVO A;  2WQH A;  4HOQ A;  4XIF A;  2VGX A;  2L6J A;  3SZ7 A;  5A6C A;  4GZ6 A;  5JJ7 A;  4EQF A;  2XEV A;  3CEQ A;  2HYZ A;  2HR2 A;  4IN3 B;  3Q4A B;  4GYO A;  4GCO A;  3AS4 A;  2AVP A;  3PE3 A;  2PL2 A;  4U0Z A;  1FCH A;  5BNW A;  4HOU A;  5C1D A;  3RIB A;  2QFC A;  4CGW A;  3BEE A;  4GA0 A;  1KT0 A;  2HO1 A;  4I2W A;  1QQE A;  4UQZ A;  5CHE E;  5KJL A;  4YVQ C;  2XGO A;  1HH8 A;  3CKC A;  1KLX A;  3URZ A;  3VTX A;  3QWV A;  4N5C A;  3UUX A;  4O6F A;  3AS5 A;  3MA5 A;  3ASG A;  1E96 B;  2UY1 A;  3FWV A;  3PDN A;  2LNI A;  3Q49 B;  2C0L A;  5BW8 C;  2VGX B;  4JL0 A;  1NA0 A;  3QOU A;  4G23 A;  4RG9 A;  5G05 J;  5FZR A;  3U3W A;  4AY6 A;  3RU0 A;  3ESK A;  3MV3 B;  2Y4T A;  3NF1 A;  3CK9 A;  5FJY A;  2P58 C;  3LY9 A;  3ZHE A;  4BT9 A;  3LKU A;  3HYM B;  3ZHE B;  1YA0 A;  1OUV A;  5G04 J;  2JLB A;  4GPK A;  3FP3 A;  3MEK A;  3LPZ A;  2OND A;  4GA1 A;  4BWR A;  5LCW J;  3GZ2 A;  2KC7 A;  2KCV A;  3MV2 B;  4U0S A;  2WPV A;  4UI9 K;  3S7D A;  4I2Z A;  4KBQ A;  3WXX A;  4ME2 A;  3OXG A;  4GZ3 A;  2XCC A;  3KAE A;  3OXL A;  5JJT A;  5D0Q D;  4JHR A;  4N3C A;  3ZFW A;  4AIF A;  1HZ4 A; 
#chains in the Genus database with same CATH topology
 2ETA A;  1KPS B;  1WDY A;  3UMV A;  2WVI A;  4LNB A;  3G2V A;  3ONK A;  1JWF A;  1KZP A;  5C1D A;  3CGH A;  3AU4 A;  2OOE A;  3CK8 A;  4DI3 A;  3CHS A;  1Z5S C;  2EIM E;  2GW1 A;  5KCM A;  4FP7 A;  4XKC A;  3D9K A;  2IQC A;  3EUV A;  5CBO A;  4I17 A;  3ZIM A;  4PDX A;  4OVV A;  2IF4 A;  2WXJ A;  2ZU6 B;  3JXI A;  2VQ2 A;  1TN6 A;  5JHB A;  3HDX A;  4JA7 A;  3TXN A;  4U8V D;  3D9P A;  3CLJ A;  1OT8 A;  3QAR A;  1IKN D;  3E4B A;  3DXK G;  4N3A A;  1IHB A;  4N39 A;  5T4Y A;  3SY2 A;  4F6R D;  2VSN A;  3KEA A;  5JJ6 A;  4B89 A;  1YMP A;  3FU3 A;  2VGX A;  3CVV A;  1OCC E;  3Q4A B;  3EHQ A;  3PE3 A;  3RIB A;  4GA0 A;  3NAW A;  4WWN A;  1HH8 A;  4ANX A;  3ZEF A;  2FUL A;  2GRQ B;  4UWF A;  4CDM A;  2ZIR A;  5E75 A;  1SA4 A;  2X38 A;  3CK9 A;  3FUD A;  2P58 C;  3HVE B;  2QC9 A;  3UIO C;  3PNL B;  2Y69 E;  2J49 A;  3GZ2 A;  2KC7 A;  2KCV A;  3EHM A;  3MCX A;  3IXE A;  4WNG A;  3L82 A;  1HF8 A;  3G2W A;  2I9C A;  3CK7 A;  1A5E A;  4WND A;  3AG2 E;  1OWN A;  3FH5 A;  4FAD A;  3C3O A;  4AY5 A;  4L2L A;  3P2B A;  4JHJ A;  3CVP A;  4GCN A;  4KYO B;  4EBA G;  3ZRH A;  4GAA A;  4FJY A;  4L2Y A;  4CYM D;  5ENS D;  4RQI A;  4F1P A;  2OEW A;  3NBN B;  3Q15 A;  1UG3 A;  3ULQ A;  4J8D A;  3UM2 A;  3FH7 A;  1ELW A;  2DCP A;  3BG0 B;  4O1O A;  3HVE A;  1H6K A;  4ACK A;  3C5R A;  2I6H A;  5EX3 A;  4L7T A;  3AU5 A;  3L54 A;  1MQS A;  2WXP A;  5KNG A;  3AS4 A;  2CHX A;  2R2L A;  3BEE A;  3C98 A;  1IXV A;  2J09 A;  3DWL G;  3ML9 A;  5G05 J;  3SGH A;  4KZ0 A;  2OVF A;  5EYL A;  3TWU A;  3FUM A;  1DCE A;  2DZN A;  5JA4 D;  4I1O B;  4BX8 A;  3Q9N C;  3OXG A;  1JCQ A;  2V0P A;  2VJ8 A;  3DPD A;  1SW6 A;  4EZL A;  5HS0 A;  4I6G A;  2R59 A;  4BTB A;  2XEE A;  4GTT A;  2P9N G;  1L5J A;  1WG0 A;  4LNU D;  3ASD A;  3FTU A;  3Q47 B;  3Q73 A;  3NOC D;  3IKO B;  4JPS A;  3L16 A;  5G05 C;  2DWZ A;  3FDH A;  1E7U A;  3FTZ A;  4JA9 A;  1Y6I A;  4TXP A;  3I4G A;  4L1B A;  4WUY A;  2CG2 A;  2WQ6 A;  2VSX E;  3CKB A;  1FT2 A;  3R7Q A;  2P9K G;  2FO1 E;  3PVL A;  3V30 A;  3ZN3 A;  4HOT A;  2J08 A;  3CVL A;  3HXF A;  3CIA A;  1EDU A;  3UKR G;  4I43 A;  1ELR A;  2V5F A;  3LY8 A;  2PM6 A;  3RJV A;  3PRE A;  4G1T A;  4JEU A;  4G24 A;  4C48 B;  3UPV A;  4BX9 A;  5EID A;  2UY1 B;  2R05 A;  3CR3 A;  2L6J A;  3SZ7 A;  3CSF A;  3MX3 A;  2DZO A;  4WWO A;  3T8M A;  5FQ4 A;  5BW8 C;  4J8Y A;  1N4S A;  3UKU G;  3LY9 A;  3LKU A;  4L23 A;  3BG1 B;  1EPU A;  1V55 E;  2XZD G;  4BWR A;  2KZT A;  4KBQ A;  3E34 A;  3D9J A;  5KBA A;  4B0Z A;  4AJW A;  4GB9 A;  4CCA A;  4HXI A;  2DIW A;  5E76 A;  5AQA A;  2IOS A;  4J8F A;  4GTV A;  4GPM A;  5LCW C;  4Y6W A;  1S70 B;  2KM4 A;  3CVU A;  2L0I A;  2I1J A;  3ZXP A;  4LSZ E;  5H7P A;  3PNT B;  4HB5 A;  2X6I A;  4BET A;  2R17 C;  3PS6 A;  4B8C B;  1JCR A;  3QNK A;  5FQ8 A;  1NL4 A;  2P9P G;  2X3M A;  3TWV A;  2BTD A;  3AG3 E;  3TAX A;  2ZIS A;  4BEP A;  3B7T A;  1SVX A;  4JXT A;  2C0M A;  4V3I A;  5EYP F;  1INZ A;  1SQM A;  3KD7 A;  3PZ3 A;  4NQ0 A;  3FTY A;  1BPO A;  4APO A;  2LSV A;  1OCZ E;  1UOH A;  5FIO A;  4ZFH A;  4G25 A;  2WXR A;  3R9A B;  2JEK A;  1O1S A;  4HBD A;  3L22 A;  3LJ3 A;  1HO8 A;  2WXF A;  1FVF A;  2XEV A;  1UJK A;  1FCH A;  5BNW A;  5CMW A;  4TUM A;  3Q9U C;  3URZ A;  4CDN A;  3UUX A;  3ASG A;  2R03 A;  5FWQ A;  5EN5 D;  4JL0 A;  2LAH A;  3HIZ A;  1TN8 A;  4BT9 A;  3MKQ B;  5LCW J;  3Q75 A;  4BSX A;  4GZ3 A;  3UT8 A;  4FLB A;  4JHR A;  4TUU A;  2CHZ A;  1NFI E;  3MJW A;  4HI9 A;  5D66 A;  1E8W A;  3MKR A;  3FU6 A;  2VGY A;  3SFX A;  5EIL A;  1TJC A;  1HE8 A;  1FPP A;  3FU5 A;  3TWW A;  3SQV A;  5M72 A;  5JMN D;  4KVM A;  4U7E B;  1B89 A;  4RG6 A;  1D8D A;  2PNN A;  4K5C A;  2MRI A;  1EYH A;  3V31 A;  2YHC A;  1IHG A;  5AQB A;  2AJA A;  2X6J A;  4F7A A;  5DIZ A;  1JUQ A;  4JHK A;  5ENQ D;  4DX5 D;  4FUL A;  4K0R A;  5ARF A;  3T5X A;  3NOG D;  4LNG A;  3RK6 A;  1V54 E;  3U4T A;  1H6P A;  4HOQ A;  4URK A;  5AAR A;  3ULE G;  1DNP A;  4F1S A;  2PL2 A;  1PAQ A;  2XRY A;  4FHJ A;  4GMJ A;  3FWV A;  4EBA A;  4JW1 A;  4DLQ A;  2CHW A;  3QC1 A;  1UW4 B;  2NSZ A;  3TWX A;  1K3Z D;  3MEK A;  2PM7 A;  5CRV A;  4U0S A;  4UI9 K;  4DLO A;  3KAE A;  1MYO A;  4GMR A;  4A63 B;  3SFZ A;  4ILI A;  5FTP A;  3T5V A;  3RO3 A;  3S7J A;  4WAF A;  2EIK E;  3SBS A;  2UWJ G;  5CEC B;  3FTS A;  4N3B A;  4I9C A;  2J9Q A;  3ML8 A;  3G2T A;  5FZQ A;  3QWW A;  3CHO A;  2FI7 A;  5HI7 A;  4HOR A;  3RRM B;  5LP0 A;  2Y1L E;  3CHR A;  5KWD A;  3DRA A;  1TJF A;  3D9H A;  2Y0B G;  3E30 A;  1UJJ A;  3TGO A;  4WNF A;  1N4Q A;  1MZC A;  5T3R A;  1NA3 A;  2WXM A;  3KS2 A;  2J4D A;  4HI8 A;  1VDY A;  4DUI A;  3DSW A;  3L17 A;  3HRA A;  2NXP A;  1N9A A;  1MX4 A;  4H7X A;  3PUJ A;  3UXG A;  1ELK A;  1S63 A;  3BUA A;  4KVO A;  4IN3 B;  1U2V G;  2P9S G;  5LOZ A;  5CHE E;  5J90 A;  3CKC A;  1UN8 A;  3FU0 A;  3MA5 A;  2ZGG A;  3KEZ A;  3PDN A;  2CG3 A;  1Z3X A;  3RU0 A;  3ESK A;  2P9U G;  2KBX A;  2V4L A;  1JCS A;  3S7D A;  1Z6T A;  4LG6 A;  5AJD A;  5ENN A;  4IRU A;  3QJZ A;  3ZFW A;  3EIJ A;  3KSQ A;  1O1R A;  4BFR A;  3UTM A;  2YQ8 A;  4J7W A;  2IFU A;  2YHE A;  4XEI G;  3S7F A;  4ABN A;  3ABL E;  3SHF A;  4ATZ D;  4OAU C;  4I9E A;  4YDE A;  3Q5M A;  5CED B;  4FJZ A;  3D9N A;  1DCQ A;  4HLL A;  5LFA A;  5EIB E;  1N95 A;  2KZT B;  3ABK E;  4GU5 A;  2DVW A;  4JVS A;  4GYW A;  2LXM A;  5AEN A;  2QZA A;  1TNZ A;  1SZA A;  2F0Y A;  3FFL A;  4EPZ A;  1U3D A;  2Q7F A;  3APF A;  1E8Z A;  3UX4 A;  2RFM A;  1Z3Y A;  2ZXW E;  4LRZ A;  3MZL B;  5JJ7 A;  2L0T B;  3T8K A;  2KXP C;  5BPP A;  4Q94 A;  1U3C A;  4U95 D;  3VLE A;  2HO1 A;  1H19 A;  4AP2 A;  4IUL A;  4C0M A;  2XGO A;  4E6H A;  4TXQ A;  3QWV A;  1H6O A;  4LER A;  1OY3 D;  2VGX B;  3FEX A;  4ANV A;  4J8S A;  3UIN C;  4CRW A;  5FJY A;  3SBT B;  4IYP A;  4N5Q A;  5G04 J;  2BED A;  4G8L A;  1O1T A;  3AJI A;  2XCC A;  5D0Q D;  1TN7 A;  5AQ7 A;  3F6Q A;  2C2L A;  1ZBP A;  4CEM A;  4B8A A;  4FLH A;  3L08 A;  3IEG A;  4CDR A;  1D9S A;  1IQU A;  3LJN A;  3JQ1 A;  3RSE G;  1UN9 A;  3CV0 A;  4QFV A;  2WM9 A;  3Q7A A;  5EKQ D;  2E2E A;  3FUF A;  2XPZ A;  3V2O A;  3TG5 A;  1PC2 A;  2PQR A;  4HRL A;  3EU9 A;  2PZI A;  3PE4 A;  1X5B A;  4J6I A;  1BI7 B;  1SZ9 A;  3TWT A;  3D9L A;  2EIJ E;  4U04 A;  5G04 C;  5KNH D;  3LEW A;  4GTS A;  4TV3 A;  2WB2 A;  2AWI A;  3CST A;  4HQD A;  2J07 A;  4UQX A;  1XNF A;  2GGF A;  1O5M A;  2AVP A;  3QB2 A;  5ANR A;  4ATG A;  4A1G A;  4O6F A;  2WXQ A;  5AN8 A;  2ETB A;  3U3W A;  2ILR A;  5FQ6 A;  2E0I A;  3MGB A;  3RRU A;  1WY6 A;  3CHP A;  4ME2 A;  5CMY A;  4JD2 G;  3ULY A;  2V4H C;  3G2S A;  4UWL A;  3RKV A;  1WM5 A;  2AXU A;  2J8S D;  3UT4 A;  1H0A A;  5G55 A;  4Z68 A;  4UI9 J;  3L6A A;  5BV0 A;  4NIK A;  4DX2 A;  1TNB A;  3DEP A;  2WXL A;  3SNX A;  3DEO A;  2F37 A;  2OCC E;  2WXG A;  4HVB A;  5D0O D;  3D9O A;  4NRH B;  2RD0 A;  4DPR A;  1N11 A;  4OAV B;  3SO8 A;  2NC9 A;  3MKQ A;  3HXE A;  4UI9 C;  4AM9 A;  3J5P A;  4UWH A;  1NP7 A;  5B1A E;  4AXH A;  3LDZ A;  1KT1 A;  4XI0 A;  4U8H A;  5LX8 A;  3IHY A;  3NZS A;  3VLF A;  4JB8 P;  1OCR E;  3FHE A;  2HYZ A;  2HR2 A;  4CGW A;  3G2U A;  4JEH A;  4YVQ C;  4AEZ C;  4Q96 A;  4C0E A;  4A3T A;  4GTO A;  3JUE A;  2UY1 A;  2LNI A;  2XQ0 A;  3ZHE A;  2XZT G;  1RW2 A;  4GA1 A;  3I4R B;  2OV8 A;  3WXX A;  4HRM B;  4GTP A;  4YDW A;  4N3C A;  3ZYK A;  4G11 A;  3U64 A;  1H2T C;  4ANU A;  5J08 A;  1N0R A;  5ENO D;  1TR4 A;  4AV7 A;  1QZ2 A;  3OXF A;  2A4Z A;  4W9R A;  1S64 A;  3PZ2 A;  4A3V A;  5DBK A;  4H7Y A;  2GRP B;  1N4P A;  3ZGQ A;  2DBA A;  3ZVV A;  4O60 A;  4UUC A;  4JC8 A;  2I1K A;  5G2N A;  2WXN A;  3UM3 A;  3B7B A;  3DSX A;  1W3B A;  3ZNG A;  4TRQ A;  1E90 A;  3T9K A;  3LYA A;  3ZPJ A;  4I1M A;  5BT1 A;  3PRZ A;  5ANL A;  4MBG A;  4G2V A;  2DYS E;  3SF4 A;  3JYS A;  1AWC B;  2AW6 A;  4HOU A;  3HXD A;  1ZB1 A;  3FUL A;  3SD5 A;  1FVH A;  1E96 B;  3FUI A;  4RG9 A;  1LD7 A;  3SI5 A;  3D9I A;  1YA0 A;  4OYS A;  3B13 A;  1H2V C;  3OXL A;  4AIF A;  4I6E A;  4RSY A;  5CCL A;  1MX2 A;  2X6H A;  2BKG A;  1IYG A;  4AVX A;  4XI9 A;  1RZ4 A;  5BXO A;  3UQ3 A;  4U8Y D;  3ZYL A;  1TNU A;  1OWO A;  3RRN B;  4A1S A;  1OCO E;  3U66 A;  4Y6C A;  1PY1 A;  2XEH A;  4GA2 A;  4LEU A;  3ASN E;  4NUR A;  4L9P A;  2KAT A;  3VTY A;  1K1B A;  3GZ1 A;  4CZ2 D;  1AP7 A;  2LSU A;  5AYW D;  3NZU A;  2QYJ A;  4GTQ A;  3LXU X;  4NAC A;  3O48 A;  1FT1 A;  2Y3A A;  4YND A;  3S7B A;  3K9I A;  2Y4U A;  3PEU B;  2RFA A;  4BTA A;  4EHM A;  5BXU A;  3FUH A;  5IY5 E;  2WQH A;  1OWL A;  3EU5 A;  5A6C A;  2IOL A;  4U63 A;  4GYO A;  3JCK C;  3J5Q B;  3UI2 A;  5A23 A;  4FHK A;  3CHQ A;  1QQE A;  2XEN A;  4N5C A;  5B3S E;  3Q49 B;  2P2C P;  2R02 A;  3CVW A;  3QOU A;  4GZD A;  2IO3 C;  3NQP A;  2P9L G;  4PS8 A;  4PS7 A;  4PUC A;  3TWQ A;  3EIQ C;  3B7S A;  2IU1 A;  4HOS A;  2YIN A;  3C3R A;  4U07 A;  1SA5 A;  1H2U A;  3HHM A;  3HXB A;  3EHR A;  1N0Q A;  5CER B;  3CVY A;  4I1A A;  3AG1 E;  1GW6 A;  4BT8 A;  1ZU2 A;  3ZW3 A;  4ILG A;  2WMO A;  5T8I A;  3B7R L;  1MJ0 A;  3L9T A;  1K1A A;  4GYY A;  3CVN A;  4PS3 A;  2GRM A;  3LVR E;  2LO6 A;  3E37 A;  2B6C A;  1BD8 A;  4C9B B;  3FUN A;  2H6F A;  2XCB A;  2XGM A;  2A5U A;  3TJP A;  1HS6 A;  4G26 A;  4X8Q A;  3OAW A;  2FO7 A;  2VSO E;  3C72 A;  3GW4 A;  3U9W A;  2ION A;  2WXH A;  1E7V A;  2GRL A;  5AAO A;  4XE0 A;  4DK5 A;  4E85 A;  3DSU A;  4UQZ A;  3E32 A;  4GZC A;  4XX5 A;  4DX7 D;  1MX6 A;  3AS5 A;  1G3N B;  1E8Y A;  2H6I A;  5ENT D;  3HYM B;  2JLB A;  2EIN E;  2OND A;  3PH0 C;  5D2M C;  4M3O A;  4I2Z A;  3IV0 A;  5JJT A;  2DYR E;  3DXM G;  3O4Z A;  1HG2 A;  2VGE A;  4BES A;  3BQO A;  4F53 A;  3MYV A;  4ILH B;  2WMN A;  3DBS A;  2KCK A;  4KMO A;  3FUK A;  4BSZ B;  3EHN A;  2FEZ A;  3D3M A;  3FTV A;  1JPL A;  2MHK A;  1IQR A;  5A7D B;  4HLE A;  2GRO B;  4O1P A;  1K8K G;  2QY7 A;  5ITZ F;  4LCT A;  1LF8 A;  3ASO E;  3WG7 E;  2FBN A;  3Q79 A;  3D9M A;  3JXJ A;  4AOF A;  5FQ7 A;  3CVX A;  3QDN A;  5HKP A;  4HNA D;  3ZUV B;  2I2O A;  3IHV A;  2VTB B;  4APF A;  2H6G A;  2IO2 C;  3HXC A;  1NI1 A;  2JAB A;  2B0O E;  3QK0 A;  3ONL A;  2GRR B;  3NB2 A;  1NZN A;  1YYH A;  4WNE A;  5KJM A;  4YDO A;  1DC2 A;  2R5S A;  4J8E A;  1KZO A;  4I6J A;  4YDY A;  4GTR A;  2LUH A;  5ENP D;  1KT0 A;  4ANW A;  4BY6 A;  1XGW A;  4OVU A;  3L13 A;  4MRU A;  2F8X K;  1D8E A;  4EZK A;  3EJN A;  5CRU A;  3SFY A;  3FY4 A;  3OTN A;  3ZHE B;  5AJL A;  3LPZ A;  1X81 A;  2WPV A;  4DI4 A;  1N54 A;  3R7R A;  3GYZ A;  3ZXS A;  2X6F A;  2X6K A;  1LTX A;  1TNY A;  3FUJ A;  3ZYM A;  2MYO A;  2WQ7 A;  3APD A;  2VYI A;  2KCL A;  3N71 A;  5KJN A;  5C2Y A;  2RG8 A;  2YNQ A;  5CBN A;  2NYJ A;  2FF4 A;  3LS8 A;  4K5A B;  3PZD A;  4UWK A;  1JWG A;  2CFZ A;  4B93 B;  2WXI A;  1S0P A;  3UM1 A;  3AS8 A;  4J0U A;  5EX0 A;  2AXV A;  3ESL A;  4M7C A;  3ISM C;  3LVQ E;  1HG5 A;  1WAO 1;  2LAI A;  2WXK A;  3RO2 A;  3ZYQ A;  4N2S A;  3V79 K;  1N4R A;  3ASH A;  4N2Q A;  1QBQ A;  3FEY A;  4GZ5 A;  3CQG B;  3LCA A;  3HG0 D;  4FU3 A;  4K03 A;  2GRN B;  2H6H A;  2XGS A;  2RKK A;  5ENR D;  2CFU A;  3Q7F A;  3FTX A;  3FTW A;  4GCO A;  4U0Z A;  5FIN A;  3I3N A;  4KT6 B;  5KJL A;  1HX8 A;  3AG4 E;  1BU9 A;  4R7L A;  3TXM A;  4G23 A;  3MV3 B;  2HE0 A;  2Y4T A;  4GPK A;  3FP3 A;  4LUN U;  4HFG A;  3Q78 A;  3PZ4 A;  5B1B E;  4DX1 A;  1BI8 B;  1HZ4 A;  3QKY A;  3UIP C;  4HS2 A;  4CGV A;  3BU8 A;  1DVP A;  2BF0 X;  2MOW A;  1QYM A;  2VSY A;  1MHQ A;  1Y8M A;  4K5B A;  4D10 C;  3ASF A;  4UQY A;  3CVQ A;  2IEJ A;  3UT7 A;  5AQ9 A;  5FZS A;  3W9G A;  4KXK B;  5KJK A;  3R9M A;  2WXO A;  3ZKJ A;  3S2A A;  5AIJ A;  3DPY A;  3FUE A;  5CEA A;  2ZGD A;  4CT4 A;  3DSV A;  4KZC A;  3ENE A;  4F3V A;  2LXL A;  1P5Q A;  3DSS A;  3V2X A;  3E33 A;  2BKK B;  1TNO A;  2BUG A;  2XS1 A;  2OVB A;  2AXZ A;  4PH4 B;  1OXJ A;  4XKB A;  4XIF A;  4GZ6 A;  2XRZ A;  4EQF A;  4ZHB A;  4EEC A;  2M63 A;  1TEZ A;  4DX6 D;  1EF1 C;  5EDS A;  3RAU A;  3AAA C;  1KLX A;  2EIL E;  5HRY A;  2C0L A;  1NA0 A;  3ABM E;  4AY6 A;  5FZR A;  2V8S E;  4ACL A;  2QYU A;  3JUI A;  3JQ0 A;  1OUV A;  4FA6 A;  3X2Q E;  2A5E A;  4QQI A;  3MV2 B;  4DJA A;  1YCS B;  3DST A;  4MS6 A;  4TXR A;  3I5P A;  3UM0 A;  2F8Y A;  2HM8 A;  4WWP A;  3QWP A;  3TG4 A;  4Q69 A;  1QNF A;  2XPY A;  2OEV A;  1LD8 A;  3W9F A;  3QAQ A;  3B7U X;  4XZ4 A;  3ZU7 B;  3TL5 A;  5JHA A;  2P9I G;  3CQC B;  3EDT B;  1A17 A;  2ETC A;  5CCM A;  4EZJ A;  3IBE A;  1Q2Z A;  3FH8 A;  3PEV B;  4MLP A;  2V5Q C;  2VTB A;  2XHE A;  3GZS A;  3TWS A;  4G8K A;  3LY7 A;  4B94 A;  5ARG A;  4RLY A;  1HU3 A;  5BUZ A;  4GML A;  4P29 A;  2J4B A;  4DRX E;  4UWG A;  4BER A;  4HRN A;  1OWP A;  2PQN A;  1HXI A;  1OWM A;  4U0U A;  5HQ8 A;  2XPI A;  2L9B A;  2IY0 C;  5FT9 A;  3PZ1 A;  1N94 A;  3C3Q A;  3KSL A;  1BLX B;  4A55 A;  4YVO A;  3CEQ A;  2QFC A;  3B95 A;  4I2W A;  4CT0 A;  1TYQ G;  3VTX A;  1E8X A;  4U96 D;  3TWR A;  2IJG X;  2EQX A;  4GTM A;  3NF1 A;  3P1U A;  4JZY A;  1N52 A;  4RVB A;  2L6B A;  4FC8 A;  5BV1 A;  3VLD A;  1HFA A;  3CHM A;  2XS8 A;  4MKT A;  3APC A;  3PUK A; 
#chains in the Genus database with same CATH homology
 3MJW A;  3G2S A;  4UWL A;  3RKV A;  4F53 A;  1WM5 A;  3MYV A;  2AXU A;  1E8W A;  3MKR A;  4ILH B;  2WMN A;  1H0A A;  3UMV A;  3UT4 A;  5G55 A;  3DBS A;  2KCK A;  2WVI A;  3FU6 A;  4KMO A;  2VGY A;  3FUK A;  4UI9 J;  3G2V A;  3EHN A;  3L6A A;  3ONK A;  1JWF A;  5BV0 A;  5C1D A;  3CGH A;  1TJC A;  1HE8 A;  3AU4 A;  2OOE A;  3CK8 A;  2FEZ A;  3CHS A;  3D3M A;  4DI3 A;  3FTV A;  1JPL A;  3FU5 A;  2MHK A;  1IQR A;  2GW1 A;  5KCM A;  5A7D B;  2WXL A;  4FP7 A;  4HLE A;  4XKC A;  5M72 A;  3D9K A;  3SNX A;  2IQC A;  4KVM A;  1B89 A;  2WXG A;  4HVB A;  2QY7 A;  4LCT A;  5D0O D;  4RG6 A;  1LF8 A;  4I17 A;  3ZIM A;  3D9O A;  4PDX A;  4NRH B;  2MRI A;  2FBN A;  4OVV A;  2RD0 A;  4DPR A;  1EYH A;  2IF4 A;  3D9M A;  2YHC A;  2WXJ A;  1IHG A;  2ZU6 B;  2X6J A;  2VQ2 A;  4AOF A;  4F7A A;  5DIZ A;  2NC9 A;  1JUQ A;  5FQ7 A;  3CVX A;  3QDN A;  4JHK A;  5JHB A;  3HDX A;  2I2O A;  3MKQ A;  3IHV A;  4JA7 A;  3TXN A;  2VTB B;  4APF A;  3D9P A;  4UI9 C;  4AM9 A;  3CLJ A;  4FUL A;  4K0R A;  4UWH A;  3QAR A;  3QK0 A;  5ARF A;  1NP7 A;  3ONL A;  3T5X A;  4AXH A;  1NZN A;  3E4B A;  3LDZ A;  4N3A A;  4WNE A;  1KT1 A;  5KJM A;  4N39 A;  4XI0 A;  5T4Y A;  4U8H A;  5LX8 A;  3IHY A;  3NZS A;  2R5S A;  2VSN A;  3RK6 A;  4J8E A;  3VLF A;  5JJ6 A;  4I6J A;  3U4T A;  4B89 A;  4HOQ A;  4URK A;  3FU3 A;  2VGX A;  3FHE A;  2HYZ A;  1DNP A;  2HR2 A;  3Q4A B;  4F1S A;  3CVV A;  3PE3 A;  2PL2 A;  3RIB A;  1PAQ A;  4CGW A;  4GA0 A;  1KT0 A;  3G2U A;  4JEH A;  4WWN A;  4YVQ C;  2XRY A;  1HH8 A;  4FHJ A;  4AEZ C;  4ANW A;  4ANX A;  4BY6 A;  1XGW A;  4Q96 A;  3ZEF A;  4GMJ A;  2FUL A;  4A3T A;  4C0E A;  4OVU A;  3L13 A;  2UY1 A;  3FWV A;  4MRU A;  4EBA A;  4JW1 A;  2LNI A;  4DLQ A;  1HG2 A;  2XQ0 A;  4UWF A;  2CHW A;  3QC1 A;  4CDM A;  4EZK A;  1UW4 B;  5E75 A;  3EJN A;  2X38 A;  3CK9 A;  3FY4 A;  2P58 C;  3FUD A;  3HVE B;  3ZHE A;  2NSZ A;  3OTN A;  3ZHE B;  3PNL B;  3MEK A;  5AJL A;  3LPZ A;  2J49 A;  2PM7 A;  4GA1 A;  3I4R B;  3GZ2 A;  2KC7 A;  2KCV A;  2OV8 A;  3EHM A;  2WPV A;  4U0S A;  4UI9 K;  3WXX A;  4DLO A;  3KAE A;  3MCX A;  4DI4 A;  4N3C A;  3ZYK A;  4G11 A;  1N54 A;  3R7R A;  4WNG A;  3GYZ A;  3U64 A;  3SFZ A;  3ZXS A;  4ILI A;  5FTP A;  2X6F A;  2X6K A;  1H2T C;  1HF8 A;  3T5V A;  3RO3 A;  3G2W A;  2I9C A;  3FUJ A;  3S7J A;  3CK7 A;  4WAF A;  4ANU A;  5J08 A;  3ZYM A;  4WND A;  2WQ7 A;  3SBS A;  1OWN A;  3APD A;  2VYI A;  2KCL A;  2UWJ G;  3FH5 A;  3N71 A;  4FAD A;  4AY5 A;  4L2L A;  5KJN A;  5C2Y A;  3P2B A;  3FTS A;  2RG8 A;  2YNQ A;  4JHJ A;  3CVP A;  4GCN A;  2J9Q A;  4I9C A;  3ML8 A;  4KYO B;  4N3B A;  3G2T A;  5FZQ A;  4GAA A;  3ZRH A;  4AV7 A;  2FF4 A;  1QZ2 A;  3LS8 A;  4FJY A;  4L2Y A;  3OXF A;  3PZD A;  4UWK A;  2A4Z A;  3QWW A;  4W9R A;  3CHO A;  1JWG A;  2CFZ A;  2FI7 A;  5HI7 A;  4A3V A;  4HOR A;  2WXI A;  1S0P A;  5DBK A;  4H7Y A;  3RRM B;  3AS8 A;  4J0U A;  5LP0 A;  5EX0 A;  3Q15 A;  2AXV A;  3CHR A;  3ESL A;  3ZGQ A;  1TJF A;  1UG3 A;  2DBA A;  3ULQ A;  3ZVV A;  3LVQ E;  4J8D A;  4JC8 A;  1UJJ A;  2I1K A;  3FH7 A;  2WXN A;  1HG5 A;  5G2N A;  3TGO A;  1ELW A;  1WAO 1;  2DCP A;  4WNF A;  2LAI A;  2WXK A;  5T3R A;  1NA3 A;  1W3B A;  3BG0 B;  3RO2 A;  3HVE A;  4TRQ A;  3ZYQ A;  1H6K A;  4ACK A;  2WXM A;  4N2S A;  1E90 A;  3ASH A;  4N2Q A;  3KS2 A;  3FEY A;  2J4D A;  3LYA A;  1VDY A;  4GZ5 A;  3ZPJ A;  4I1M A;  5BT1 A;  3CQG B;  3LCA A;  3L17 A;  3PRZ A;  4FU3 A;  2I6H A;  5ANL A;  2NXP A;  4G2V A;  4H7X A;  4K03 A;  3SF4 A;  5EX3 A;  3PUJ A;  2XGS A;  3AU5 A;  3JYS A;  4L7T A;  1ELK A;  3L54 A;  1MQS A;  2CFU A;  2WXP A;  3FTX A;  4KVO A;  4IN3 B;  3FTW A;  4GCO A;  3AS4 A;  4U0Z A;  2AW6 A;  2CHX A;  5LOZ A;  4HOU A;  3I3N A;  3BEE A;  4KT6 B;  5CHE E;  5KJL A;  5J90 A;  3CKC A;  3FUL A;  1HX8 A;  1UN8 A;  3FU0 A;  3SD5 A;  3MA5 A;  1FVH A;  3C98 A;  1E96 B;  3FUI A;  3KEZ A;  4R7L A;  3PDN A;  3TXM A;  2J09 A;  3O4Z A;  3ML9 A;  2CG3 A;  4G23 A;  4RG9 A;  5G05 J;  1Z3X A;  3RU0 A;  3ESK A;  3MV3 B;  3SI5 A;  3SGH A;  2Y4T A;  3D9I A;  4KZ0 A;  2OVF A;  1YA0 A;  2V4L A;  4OYS A;  3B13 A;  4GPK A;  3FUM A;  3FP3 A;  4LUN U;  4HFG A;  3S7D A;  4I1O B;  4BX8 A;  1Z6T A;  3OXG A;  1H2V C;  5AJD A;  3OXL A;  5ENN A;  4IRU A;  2V0P A;  3QJZ A;  3EIJ A;  2VJ8 A;  3ZFW A;  4AIF A;  3DPD A;  4I6E A;  4EZL A;  1HZ4 A;  3QKY A;  4I6G A;  4RSY A;  5CCL A;  4BFR A;  4HS2 A;  4CGV A;  2R59 A;  4BTB A;  2X6H A;  1L5J A;  1DVP A;  2BF0 X;  2YQ8 A;  2MOW A;  3ASD A;  3FTU A;  2IFU A;  3Q47 B;  2YHE A;  4AVX A;  1IYG A;  2VSY A;  4XI9 A;  1MHQ A;  3UQ3 A;  1Y8M A;  3S7F A;  4D10 C;  3IKO B;  4JPS A;  4ABN A;  3ASF A;  4UQY A;  3ZYL A;  3CVQ A;  1OWO A;  3L16 A;  3UT7 A;  3RRN B;  5FZS A;  4A1S A;  5G05 C;  3SHF A;  3U66 A;  3FDH A;  4I9E A;  4KXK B;  3Q5M A;  5KJK A;  1E7U A;  3FTZ A;  4JA9 A;  4Y6C A;  4FJZ A;  1Y6I A;  1PY1 A;  3D9N A;  3I4G A;  4L1B A;  2WXO A;  4GA2 A;  4LEU A;  3S2A A;  5AIJ A;  5LFA A;  4WUY A;  3FUE A;  4NUR A;  2CG2 A;  2WQ6 A;  2VSX E;  2KAT A;  3VTY A;  4CT4 A;  2KZT B;  3GZ1 A;  3CKB A;  4KZC A;  3ENE A;  2LSU A;  4GU5 A;  5AYW D;  3R7Q A;  4F3V A;  3NZU A;  4JVS A;  4GYW A;  3PVL A;  1P5Q A;  5AEN A;  3ZN3 A;  4HOT A;  2J08 A;  3LXU X;  4NAC A;  1SZA A;  3O48 A;  3CVL A;  2Y3A A;  4YND A;  3S7B A;  3CIA A;  3K9I A;  1EDU A;  2Y4U A;  3FFL A;  2BUG A;  3PEU B;  4I43 A;  1ELR A;  2V5F A;  3LY8 A;  4EPZ A;  2PM6 A;  3RJV A;  3PRE A;  4G1T A;  4BTA A;  1U3D A;  2Q7F A;  4JEU A;  3APF A;  1E8Z A;  3FUH A;  2OVB A;  4G24 A;  3UX4 A;  3UPV A;  4BX9 A;  2AXZ A;  1Z3Y A;  2UY1 B;  4PH4 B;  2WQH A;  4XKB A;  3CR3 A;  4LRZ A;  4XIF A;  3MZL B;  2L6J A;  3SZ7 A;  4GZ6 A;  1OWL A;  5JJ7 A;  4EQF A;  2XRZ A;  2L0T B;  5A6C A;  2IOL A;  3CSF A;  4GYO A;  3JCK C;  4U63 A;  3MX3 A;  4EEC A;  2M63 A;  5BPP A;  4Q94 A;  1TEZ A;  1EF1 C;  1U3C A;  3VLE A;  5A23 A;  5EDS A;  2HO1 A;  1H19 A;  3CHQ A;  1QQE A;  4FHK A;  4AP2 A;  4IUL A;  4C0M A;  2XGO A;  4E6H A;  1KLX A;  3QWV A;  4N5C A;  4WWO A;  3T8M A;  3Q49 B;  4LER A;  2C0L A;  5FQ4 A;  5BW8 C;  2VGX B;  3CVW A;  1NA0 A;  3QOU A;  3FEX A;  4GZD A;  4AY6 A;  5FZR A;  2V8S E;  4ANV A;  4J8S A;  4ACL A;  4CRW A;  3NQP A;  5FJY A;  3SBT B;  3LY9 A;  4IYP A;  4PS8 A;  3LKU A;  3JUI A;  4L23 A;  3JQ0 A;  1OUV A;  3BG1 B;  5G04 J;  1EPU A;  4FA6 A;  4PS7 A;  4BWR A;  4PUC A;  3MV2 B;  4DJA A;  2KZT A;  4KBQ A;  3EIQ C;  2XCC A;  4MS6 A;  5D0Q D;  3D9J A;  3B7S A;  2IU1 A;  3I5P A;  2C2L A;  4B0Z A;  4EBA G;  4AJW A;  4HOS A;  2YIN A;  2HM8 A;  1ZBP A;  4GB9 A;  4U07 A;  4WWP A;  4CCA A;  3QWP A;  1H2U A;  4HXI A;  2DIW A;  4CEM A;  3HHM A;  3TG4 A;  1QNF A;  5E76 A;  4Q69 A;  2XPY A;  4B8A A;  4FLH A;  2IOS A;  3QAQ A;  4J8F A;  5LCW C;  3L08 A;  3B7U X;  4XZ4 A;  3IEG A;  4Y6W A;  3TL5 A;  4CDR A;  3CVY A;  1IQU A;  2KM4 A;  5JHA A;  3CVU A;  3JQ1 A;  3CQC B;  4I1A A;  3EDT B;  1UN9 A;  1A17 A;  2I1J A;  2L0I A;  5CCM A;  4EZJ A;  3CV0 A;  1GW6 A;  3IBE A;  2WM9 A;  4QFV A;  4BT8 A;  3FH8 A;  3PEV B;  1ZU2 A;  3PNT B;  5EKQ D;  4MLP A;  3ZW3 A;  2E2E A;  2X6I A;  2VTB A;  2XHE A;  4ILG A;  2R17 C;  3FUF A;  3GZS A;  2XPZ A;  3PS6 A;  4B8C B;  2WMO A;  3LY7 A;  3QNK A;  4B94 A;  5FQ8 A;  3TG5 A;  5T8I A;  5ARG A;  1PC2 A;  2PQR A;  3B7R L;  2PZI A;  4GYY A;  1HU3 A;  2BTD A;  2X3M A;  3CVN A;  4PS3 A;  2GRM A;  3PE4 A;  5BUZ A;  1X5B A;  4GML A;  3LVR E;  4J6I A;  4P29 A;  2J4B A;  3TAX A;  4UWG A;  1SZ9 A;  2LO6 A;  3B7T A;  3D9L A;  1OWP A;  2C0M A;  2PQN A;  1HXI A;  4JXT A;  4V3I A;  4C9B B;  3FUN A;  1OWM A;  1INZ A;  1SQM A;  3KD7 A;  4U04 A;  5G04 C;  2XCB A;  4NQ0 A;  3FTY A;  4U0U A;  1BPO A;  4APO A;  5HQ8 A;  2XGM A;  2LSV A;  3LEW A;  2A5U A;  2XPI A;  2L9B A;  3TJP A;  1HS6 A;  4G25 A;  4G26 A;  3OAW A;  2FO7 A;  2VSO E;  2WXR A;  3GW4 A;  4TV3 A;  5FT9 A;  2WB2 A;  2AWI A;  3CST A;  2J07 A;  4UQX A;  3R9A B;  2JEK A;  3U9W A;  1XNF A;  4A55 A;  2ION A;  3L22 A;  2GGF A;  4YVO A;  3LJ3 A;  2WXH A;  1HO8 A;  2WXF A;  1FVF A;  1E7V A;  2XEV A;  1UJK A;  2GRL A;  3CEQ A;  2AVP A;  1FCH A;  5BNW A;  3QB2 A;  4XE0 A;  5ANR A;  4DK5 A;  2QFC A;  4E85 A;  5CMW A;  4I2W A;  4ATG A;  4UQZ A;  4CT0 A;  4GZC A;  4XX5 A;  3VTX A;  3URZ A;  4CDN A;  3UUX A;  4A1G A;  4O6F A;  3AS5 A;  1E8X A;  1E8Y A;  2WXQ A;  3ASG A;  5FWQ A;  2IJG X;  4JL0 A;  3U3W A;  2LAH A;  2EQX A;  3HIZ A;  2ILR A;  3NF1 A;  3P1U A;  4JZY A;  5FQ6 A;  2E0I A;  3MKQ B;  1N52 A;  4BT9 A;  3HYM B;  4RVB A;  4FC8 A;  3MGB A;  2JLB A;  1WY6 A;  3RRU A;  3CHP A;  2OND A;  5LCW J;  3PH0 C;  3VLD A;  5BV1 A;  4M3O A;  4I2Z A;  4BSX A;  4ME2 A;  4GZ3 A;  5CMY A;  3UT8 A;  3IV0 A;  1HFA A;  3CHM A;  4FLB A;  5JJT A;  4JHR A;  4TUU A;  2CHZ A;  4MKT A;  3APC A;  3PUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...