3KAEA

Cdc27 n-terminus
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
240
structure length
225
Chain Sequence
SKLIGKICKSIRYRDYETAIFLAACLLEYRMLMSIVLYLNGEYTRALFHLHKLNTCTSKYYESLCYKKKKDYKKAIKSLESILEGKVERDPDVDARIQEMFVDPGDEEFFESLLGDLCTLSGYREEGIGHYVRSFGKSFLFSPVENLLLENKVPQKRGIEEEYVSDSIEFHESLSPSLVKKYMEHVPGIGSYFISNAARRYFNLGMNDKSKACFELVRRKDPMFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible protein of nuclear scaffold
publication title Molecular structure of the N-terminal domain of the APC/C subunit Cdc27 reveals a homo-dimeric tetratricopeptide repeat architecture
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Protein binding
total genus 86
structure length 225
sequence length 240
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-10-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3kaeA00
3PDNA 1TJCA 3QWWA 4J8FA 3CKCA 5FT9A 2VYIA 1HZ4A 3CV0A 3Q5MA 5BNWA 1B89A 4N39A 2UY1A 2ONDA 3URZA 4ME2A 3RJVA 3VTXA 4HOTA 5ARGA 3AS8A 4CGWA 1IHGA 3CK8A 4JA9A 2JLBA 5CCMA 3Q49B 1ELRA 3EDTB 4WNFA 1KLXA 4UI9C 2HR2A 5FZSA 3ASDA 2UY1B 5C1DA 4A1SA 3ULQA 1A17A 4YVOA 4U0UA 2WQHA 4N3CA 3Q47B 5HI7A 3TGOA 4N3AA 4I2ZA 3TAXA 4N2QA 3S7FA 4GCNA 2LNIA 3ZHEA 1IYGA 4CDRA 4G26A 5BW8C 4HOQA 4IN3B 3E4BA 3FFLA 3GW4A 4GA0A 4JL0A 3UPVA 2XGOA 4U04A 4HOUA 2VSNA 4I1AA 2FF4A 3AS5A 3ZHEB 4GYOA 4HOSA 3MA5A 4EQFA 4BT8A 3CEQA 3R9AB 3GYZA 3LY7A 5LCWC 3Q4AB 4O6FA 3UQ3A 4JHRA 3LYAA 4Y6CA 2LSVA 3PE4A 2OOEA 3IEGA 2XEVA 4ABNA 3S7JA 2P58C 4U0ZA 4GA2A 3OXLA 3KAEA 3AS4A 4H7XA 3Q15A 3RIBA 2E2EA 4WUYA 2Q7FA 4HORA 3WXXA 3LKUA 4J8DA 4H7YA 3ZGQA 4GPKA 3S7BA 4WNGA 4GZ3A 3U4TA 1ZBPA 5M72A 5FTPA 4GA1A 3K9IA 2J9QA 5DIZA 5G05J 1HXIA 3ZN3A 3GZ1A 4B94A 4CGVA 3SF4A 4I17A 2YHCA 1NA0A 3QKYA 4F3VA 2AVPA 4GCOA 4G24A 1HH8A 4Y6WA 4KYOB 2V5FA 4J0UA 5FZRA 2FI7A 2XCCA 3QWPA 5D0OD 3LY8A 2XGMA 3N71A 4KBQA 1Y8MA 1FCHA 2PZIA 3MKRA 4U0SA 2Y4TA 5CCLA 2KCLA 3MV3B 3CK9A 4I9CA 4N2SA 4NQ0A 1W3BA 2HO1A 4XI0A 5KJNA 4AIFA 2VQ2A 5EKQD 1PC2A 4J8EA 2XCBA 4UQZA 2NC9A 4BTBA 3KD7A 5HQ8A 1XNFA 1KT1A 3QDNA 2VGXA 4XIFA 5G05C 5ARFA 3RO3A 2PQNA 5EX3A 3FP3A 2IF4A 4NRHB 3OXFA 4UI9K 4WNDA 4YVQC 1P5QA 5FZQA 4WNEA 2VGXB 5D0QD 5G04J 4AY5A 3QOUA 3MV2B 4AY6A 3GZ2A 4RG9A 3S7DA 5JJTA 5CHEE 3ASFA 3UUXA 4GYWA 4I9EA 3ASHA 2PQRA 2FEZA 2I6HA 2WPVA 2XGSA 3U3WA 3LY9A 2LSUA 3CVPA 4G2VA 3FWVA 1E96B 3RU0A 2MHKA 1ZU2A 4BTAA 4U07A 1YA0A 1OUVA 4UQYA 3CK7A 2DBAA 1NZNA 5A6CA 4GZ5A 4RG6A 4GYYA 2XPIA 5LCWJ 3RKVA 4UQXA 3TG5A 3ZPJA 2KCKA 5DBKA 5KJLA 1NA3A 3TG4A 3ZFWA 3MEKA 3ASGA 2L6JA 4XI9A 4N3BA 2UWJG 5BT1A 5JJ7A 5G04C 3O48A 2HYZA 3PE3A 4GZ6A 4YNDA 2KCVA 3CVNA 3CKBA 4W9RA 1QQEA 2IFUA 2KC7A 3CVLA 4AM9A 2C0LA 3VTYA 5EX0A 2BUGA 2FO7A 3OXGA 3SZ7A 4N5CA 2FBNA 4BWRA 3LPZA 4JA7A 2QFCA 2R5SA 3ESKA 2VSYA 2YQ8A 5A7DB 2Y4UA 2C2LA 5FJYA 3HYMB 2C0MA 4UI9J 3RO2A 3BEEA 1KT0A 5KJKA 5JJ6A 4G25A 4KXKB 3JYSA 1ELWA 3QWVA 1WM5A 3CVQA 4G23A 3NF1A 4LEUA 5AYWD 1WAO1 4APOA 2GW1A 4I2WA 5KJMA 4BT9A 2VGYA 1QZ2A 2KATA 3LCAA 4G1TA 3KS2A 2PL2A
chains in the Genus database with same CATH superfamily
2CHZA 4LG6A 4J8FA 3KEZA 3IXEA 3Q5MA 2VYIA 3TWWA 2UY1A 2ONDA 5E76A 5BXUA 4ME2A 1OCRE 4J8YA 4CGWA 4JA9A 1OWPA 3DSVA 2JLBA 4GMRA 2P9LG 4LNUD 1ELRA 5BUZA 4I6EA 4G8LA 4FLBA 4GMLA 3APDA 5FZSA 3PRZA 2R2LA 3SD5A 3UIOC 3LVRE 3B7UX 4ATGA 2Y1LE 3CQCB 3TAXA 2J4DA 1H2VC 4HNAD 4GCNA 1OY3D 2A4ZA 2DZNA 2LNIA 1IYGA 3Q9NC 4CDRA 4A1GA 2EIME 3SFZA 4IN3B 1VDYA 3FFLA 3CHMA 3HXFA 4JL0A 1TNUA 2XGOA 5A23A 4U04A 2IY0C 1HG2A 3W9GA 3ZHEB 5KWDA 1SZ9A 4F7AA 2QZAA 3MKQB 3FUFA 3LY7A 3UX4A 5LCWC 3V30A 4BERA 3L13A 2NSZA 4O6FA 5HRYA 3UQ3A 4IYPA 1O5MA 4O1PA 4GTQA 5AJLA 4MS6A 1D8DA 3PE4A 3G2SA 3FTSA 1K1AA 4PDXA 2P58C 1UJJA 3FTVA 4K03A 4GA2A 3MYVA 2E2EA 2AJAA 2Q7FA 3IBEA 2EQXA 3MX3A 2YNQA 3S7BA 4BESA 5JHAA 3U4TA 2RFMA 3T9KA 5FTPA 4E6HA 4RSYA 2WXLA 4TUUA 2J9QA 5DIZA 3C5RA 3NBNB 2R17C 3T8KA 3F6QA 3KSQA 1HS6A 1K3ZD 3ZIMA 4B94A 5AENA 4F3VA 3HIZA 4GCOA 4Y6WA 5KCMA 3AG1E 5FZRA 4ILHB 4DK5A 3Q79A 2FI7A 2IJGX 1H6OA 3BU8A 3O4ZA 3QWPA 3T8MA 3LY8A 4L9PA 1FCHA 3Q78A 4GTRA 4I9CA 2I1KA 4GTSA 4XI0A 3J5PA 5LX8A 3ABKE 4FA6A 3ZYLA 3E37A 3EU9A 4JC8A 4AIFA 3Q73A 1PC2A 1K1BA 3I4GA 5AQBA 3CLJA 4DI3A 3LJ3A 4FJYA 4JPSA 3D9MA 4EZLA 2ETAA 1TN8A 2CHWA 3HVEB 3SBSA 2ETBA 2ZU6B 5G05C 3TWVA 2Y3AA 5ARFA 1TNOA 2WQ7A 3FP3A 4B8AA 5CRVA 3CHRA 3LXUX 4YVQC 2VGXB 4AY5A 3EIJA 1AP7A 1TJFA 3VLDA 3MV2B 1BU9A 1E90A 4AOFA 4P29A 3S7DA 3FTXA 4GZDA 3UUXA 3FTUA 4DX6D 3B7TA 3DSWA 4JEHA 4DX7D 2PM6A 3ASHA 1YMPA 3TWRA 3EUVA 2P9PG 2AWIA 1HO8A 2LSUA 3CVPA 3FU6A 1H2UA 2R05A 4A55A 1E96B 1TEZA 3CVWA 2GRQB 2MHKA 1ZU2A 4U07A 1OUVA 3CK7A 5HS0A 1S0PA 1NZNA 2P9NG 3DWLG 5LCWJ 3RKVA 3TG5A 3MJWA 2KBXA 2WXOA 4XI9A 1GW6A 5EDSA 3FTWA 3CHQA 5BT1A 5G04C 2CHXA 4FHKA 4ILGA 4GZ6A 3CVNA 3DEOA 2IOSA 4FHJA 4W9RA 1QYMA 3CHPA 1JWFA 3GZSA 3ABLE 1KZOA 4AM9A 5EX0A 1MX2A 2BUGA 2FO7A 3SZ7A 2FBNA 3JUEA 3L08A 5LOZA 3CGHA 4ANUA 4JA7A 3PZ1A 3FH8A 2WXPA 3HXCA 2VSYA 1BPOA 2Y4UA 3DPYA 2ZISA 3HYMB 2IO3C 3PH0C 2C0MA 1JCQA 3C72A 4UI9J 3RO2A 3BEEA 4U8VD 1KT0A 2IU1A 4BSXA 2MYOA 5EIBE 2DYSE 3TL5A 3ML9A 2QYUA 4F6RD 3EIQC 2PM7A 3TWQA 3JYSA 4AXHA 1ELWA 2VTBB 3QWVA 5FQ6A 4DLOA 2GRNB 3CVQA 4DX1A 1OT8A 3UM2A 2L0TB 4APOA 4I2WA 4XEIG 1EF1C 3CSFA 1ZB1A 3NZSA 3V2XA 2YINA 2XENA 2WXJA 3G2UA 3SGHA 3AAAC 2XZDG 3QWWA 3ZU7B 3CVYA 3CV0A 5FT9A 1HZ4A 1YCSB 5BNWA 4U96D 3ZXSA 1U3DA 1N94A 4V3IA 2BTDA 4UWLA 5BPPA 1IHGA 3CK8A 5ANRA 2LAIA 4RLYA 5CCMA 1FVFA 4TXQA 1FT2A 4B89A 3X2QE 2H6HA 3ZVVA 4FU3A 2HR2A 2UY1B 2OEWA 4A1SA 4KVMA 4U0UA 3FEYA 3UKRG 2I9CA 5B3SE 4LRZA 3EU5A 4I2ZA 3S7FA 3SHFA 4JB8P 4J8SA 1XGWA 3V31A 3Q7FA 2WQ6A 1NL4A 3HXDA 4LNBA 4BX9A 5BV1A 3PZ2A 5B1BE 3LJNA 5LFAA 4FULA 2M63A 1H6KA 3GW4A 5CRUA 2PNNA 4E85A 1UN9A 1TYQG 5KBAA 2XEHA 4EPZA 1TR4A 2FF4A 2WXRA 4GPMA 1SW6A 3FHEA 4HOSA 4EZJA 2XQ0A 4BT8A 3UM3A 3ZNGA 5AQ7A 2AXZA 4Q94A 4HQDA 3Q4AB 3FU3A 3TWUA 3JCKC 1MX4A 3PUKA 4HRMB 4TXRA 2R02A 3IEGA 4ZFHA 4FLHA 4K5CA 1BI8B 3KAEA 3AS4A 4A3TA 3Q15A 4F1SA 2XHEA 3CSTA 4I6JA 3FY4A 4WUYA 4HORA 2X6FA 2OCCE 3VLEA 3LKUA 4J8DA 5EYLA 1KPSB 2V8SE 2XZTG 2GRRB 2GRMA 4WWPA 5J08A 5M72A 3LVQE 4YDEA 4Q96A 2F8YA 3ZN3A 3J5QB 2RG8A 4CGVA 3ZRHA 4I17A 2GRLA 1NA0A 2X38A 4AEZC 2ZGGA 1EYHA 4D10C 4XE0A 3L82A 4G24A 4U7EB 1NFIE 1DCQA 4I1MA 3BG1B 2EIKE 2V5FA 4NACA 4LERA 4R7LA 2V4HC 5FQ8A 3APFA 4U8YD 4LNGA 3N71A 4KBQA 3MKRA 4CZ2D 3UT8A 4K5BA 5CBOA 4N2SA 2HO1A 1Z6TA 3FTYA 3AJIA 3L54A 2X6KA 2FO1E 2VQ2A 1E7VA 3L22A 2XCBA 1EDUA 4DX5D 1HFAA 4K0RA 2NC9A 2BEDA 3FULA 3U9WA 2DZOA 1V54E 5KNGA 3JXIA 1XNFA 1KT1A 3QDNA 1V55E 4XKBA 4OYSA 4AVXA 5EX3A 4NRHB 5IY5E 4AP2A 5JHBA 3NOGD 3D9HA 3DBSA 5D0QD 3ZYKA 1HG5A 3CHOA 1N0RA 3P1UA 3CHSA 3ESLA 1U3CA 3QK0A 3GZ2A 4RG9A 4GTVA 3DSTA 4QFVA 3ASFA 4KZ0A 4M3OA 1NI1A 3E30A 1O1RA 5HKPA 4HRLA 3DSSA 4K5AB 4YDOA 2FEZA 2I6HA 1RW2A 4CYMD 3PREA 4ANWA 4G2VA 1PY1A 4CCAA 3FWVA 3MZLB 1DC2A 3HXEA 2H6GA 4HI9A 4BTAA 1YA0A 4I6GA 1D9SA 3AU4A 4ACKA 4GZ5A 4GB9A 4RG6A 2XPIA 2QYJA 5DBKA 4FP7A 5KJLA 1NA3A 3TG4A 1SA5A 3ZFWA 1INZA 3MEKA 4GZCA 2L6JA 3ENEA 4F1PA 1H19A 4BX8A 3JQ1A 4L2YA 3R7RA 5BXOA 3O48A 3RRMB 1OCCE 3IKOB 4AV7A 3IV0A 2KCVA 5T8IA 4EZKA 4CEMA 3CKBA 1ELKA 3D9IA 5EILA 1QQEA 2KC7A 2BKGA 3ZKJA 4ANXA 5FQ4A 2IQCA 3VLFA 2J09A 4UWFA 1LD7A 3LPZA 4DRXE 2QFCA 3D9OA 2RD0A 2YQ8A 5AARA 5EYPF 1JUQA 1WY6A 4JW1A 2C2LA 2VJ8A 5FJYA 2J07A 2IONA 1TNBA 4G25A 4MRUA 2ILRA 5D66A 3L16A 3MCXA 5KNHD 1WM5A 1UG3A 3D9JA 2B6CA 2FULA 1DVPA 4G23A 4J6IA 4BSZB 2NYJA 1OWMA 4KMOA 4LEUA 3NQPA 2ZIRA 5B1AE 3DPDA 3FH5A 2VGYA 3PS6A 1QZ2A 5D2MC 1FVHA 2F0YA 3KS2A 4WWOA 4TV3A 3PDNA 2JABA 3PEVB 1L5JA 2A5EA 3FUEA 2Y69E 2X3MA 4N39A 1FPPA 2OVBA 3BUAA 3RJVA 3VTXA 4HOTA 3AS8A 2HM8A 3PUJA 2WXQA 3EHQA 4DLQA 3SQVA 2P2CP 3HXBA 1KLXA 4PS3A 3NOCD 1N4RA 2ETCA 3R7QA 5C1DA 4JVSA 5EN5D 4YVOA 1NP7A 3IHVA 4CDMA 1O1TA 2XS8A 4U8HA 3WG7E 3DXKG 1HF8A 3TGOA 5ENRD 2VSOE 4N3AA 3FUNA 1JWGA 4N2QA 4XKCA 2J08A 3I5PA 3FUJA 1N52A 3B7SA 2WMOA 3L9TA 3NAWA 2LXMA 1S70B 4G26A 3KEAA 1N4PA 3AU5A 3E4BA 4GA0A 3APCA 1LTXA 4HOUA 1N4SA 3B7RL 2VSNA 3RK6A 4JXTA 3Q75A 3TWTA 3MA5A 1PAQA 5AAOA 4G11A 4EQFA 4L7TA 3UM0A 4NURA 1IQRA 1UJKA 3UXGA 2IOLA 4PH4B 2MOWA 3GYZA 1K8KG 3R9MA 3V79K 3JQ0A 3SFYA 4ANVA 3UT4A 3LYAA 3D9NA 4I1OB 3ULEG 4Y6CA 2LSVA 4GTPA 3C98A 4GTOA 2QC9A 3UTMA 4OVUA 3L6AA 5ENPD 3PVLA 3FUKA 3BG0B 3RIBA 4F53A 2I1JA 3WXXA 4UWKA 2WMNA 1MJ0A 5H7PA 4AJWA 4MBGA 5FIOA 3JUIA 4HB5A 4WNGA 4GTTA 4L23A 2ZXWE 3QJZA 1UN8A 4I43A 2KZTA 2P9SG 1ZBPA 3S2AA 4GAAA 2MRIA 3K9IA 5G05J 3G2TA 3QAQA 5ENTD 3AG3E 2NXPA 4OVVA 2DVWA 3FUHA 5CMYA 1OWLA 3QNKA 2R59A 2YHCA 4MLPA 3HRAA 4U95D 1LD8A 3Q7AA 1E8ZA 1H2TC 2EIJE 1FT1A 4KYOB 3G2WA 1N9AA 4A63B 3G2VA 4O60A 2BF0X 5D0OD 2XGMA 2RFAA 4ILIA 2BKKB 2I2OA 2PZIA 3T5XA 4U0SA 4Q69A 1A5EA 2KCLA 5ANLA 2OV8A 4NQ0A 5JMND 1Z5SC 1BI7B 5KJNA 1EPUA 4M7CA 1SQMA 3SI5A 3OTNA 4N5QA 3D3MA 3L17A 4UQZA 4BTBA 2WXFA 3SNXA 2CFZA 4JZYA 4ATZD 3RAUA 3FH7A 2KM4A 1IQUA 2WXKA 2V4LA 4YDWA 5T4YA 3PZ4A 3C3OA 3SBTB 2PQNA 3E33A 4HI8A 3DXMG 4J7WA 4UI9K 3FDHA 2OVFA 5FZQA 4WNEA 3DRAA 2DCPA 5E75A 5G04J 4LSZE 3QOUA 4C48B 1SA4A 4AY6A 4HRNA 4KT6B 1IHBA 2Y0BG 2DIWA 3P2BA 5JJTA 5G2NA 3ULYA 3TWSA 3ONKA 4GU5A 4IRUA 3B7BA 2X6HA 3TXNA 2L9BA 4A3VA 3E34A 1E7UA 2PQRA 2X6IA 5JA4D 2XGSA 4O1OA 3U3WA 5CBNA 5FWQA 1OWOA 2YHEA 3UM1A 5ENOD 5AIJA 4MKTA 4DUIA 4BEPA 1JPLA 2KXPC 3PZ3A 5G55A 1HE8A 1MYOA 1OCOE 1LF8A 2QY7A 4UQXA 4DI4A 1N95A 3ASGA 3I3NA 3HDXA 3AG2E 3V2OA 5JJ7A 1Q2ZA 1Z3YA 2GROB 3PE3A 1IKND 4YNDA 3UT7A 4LCTA 1E8YA 1QBQA 1E8WA 3CQGB 4X8QA 1RZ4A 3FUIA 1OXJA 2IFUA 3CVLA 1MQSA 3NB2A 2CFUA 3OXGA 1TN7A 3EJNA 4RVBA 2GRPB 3RRNB 3T5VA 1D8EA 4BWRA 3PNLB 3UINC 3LDZA 2H6IA 2R5SA 3ESKA 1U2VG 1H0AA 5A7DB 3ASOE 3LS8A 2DYRE 2EILE 3FEXA 2IEJA 2XPYA 3AG4E 3Q9UC 2WB2A 5JJ6A 3SO8A 5EIDA 3C3QA 1N0QA 1TN6A 4KXKB 5C2YA 3ZW3A 4JHKA 1MHQA 3MGBA 4DX2A 3LEWA 2OEVA 3FUMA 2GW1A 1MZCA 2F8XK 4JEUA 4G1TA 2B0OE 2L0IA 1BD8A 1TJCA 2WM9A 2V0PA 2LUHA 3CKCA 1G3NB 1B89A 3OAWA 3URZA 3U66A 1TNYA 5ARGA 3Q49B 2J49A 3EDTB 3FU5A 4WNFA 1AWCB 1QNFA 4UI9C 3ASDA 3IHYA 3ULQA 1TNZA 1S63A 1A17A 2WQHA 4QQIA 4N3CA 3Q47B 5HI7A 1WG0A 4HLLA 3TJPA 4RQIA 3JXJA 2ZGDA 2WVIA 4XZ4A 5ENNA 1OWNA 4XX5A 3ZHEA 5BW8C 4HOQA 3B13A 3MKQA 4C9BB 4NIKA 1OCZE 1WDYA 3UPVA 4PUCA 3FU0A 4B93B 5J90A 2XRYA 4I1AA 5CEAA 1HU3A 3AS5A 4GYOA 3HHMA 1O1SA 5FQ7A 5AN8A 3CEQA 1HX8A 3R9AB 3PNTB 4EECA 3C3RA 2XS1A 1Z3XA 3EHNA 4JHRA 3EHRA 3D9LA 3ZXPA 3QC1A 2IO2C 5FINA 3RSEG 2OOEA 3ASNE 2XEVA 3KSLA 4ABNA 3S7JA 4BY6A 4U0ZA 3PZDA 3OXLA 4H7XA 2LO6A 4TRQA 4B8CB 2E0IA 3ML8A 1KZPA 3DEPA 2LAHA 4H7YA 3ZGQA 4PS7A 4GPKA 3ISMC 2AXUA 3D9KA 4CT4A 4URKA 4GZ3A 1MX6A 3RRUA 3ZEFA 1YYHA 1N54A 4GA1A 4EHMA 4EBAA 3W9FA 4GMJA 1HXIA 3GZ1A 3UIPC 3SF4A 4L1BA 2KZTB 3QKYA 2AVPA 2DWZA 2F37A 1HH8A 1UW4B 3DSUA 4C0MA 4J0UA 4UWHA 3QARA 2P9UG 2AW6A 3U64A 4UUCA 2CG3A 3HG0D 2XCCA 2X6JA 1DCEA 1BLXB 4HLEA 2XRZA 1JCRA 1Y8MA 4IULA 2Y4TA 4PS8A 3CR3A 5CCLA 2GGFA 3UKUG 3MV3B 3CK9A 5T3RA 1W3BA 1S64A 5CECB 3B95A 3HVEA 1E8XA 2P9IG 5EKQD 4J8EA 2V5QC 1X5BA 5AQAA 3ZYMA 2EINE 3KD7A 5HQ8A 3ABME 2VGEA 1JCSA 3CIAA 3FUDA 2VGXA 4XIFA 4JHJA 3RO3A 4HVBA 1N4QA 4WAFA 3E32A 5CMWA 3CVVA 2IF4A 3BQOA 3OXFA 4FJZA 4GTMA 4HFGA 4WNDA 2VSXE 1P5QA 4EBAG 4B0ZA 2A5UA 4KZCA 4BFRA 4APFA 3FTZA 5ENSD 4C0EA 3ZUVB 3CVUA 5AJDA 5CHEE 3TXMA 4HS2A 2RKKA 4GYWA 4BETA 4I9EA 3CVXA 3SY2A 2WPVA 3ONLA 3LY9A 4ZHBA 3RU0A 4TUMA 3UMVA 4HBDA 2CG2A 5ITZF 4UQYA 2DBAA 3I4RB 2L6BA 5A6CA 5AQ9A 4GYYA 1DNPA 2XEEA 2J8SD 4KVOA 5ENQD 4YDYA 3ZPJA 4UWGA 2KCKA 3TWXA 4ACLA 4TXPA 5LP0A 4CT0A 4N3BA 4L2LA 4LUNU 2UWJG 2H6FA 2HYZA 2WXMA 4HXIA 3D9PA 2WXGA 2XPZA 3EHMA 5CEDB 1H6PA 4JD2G 2WXNA 4G8KA 2C0LA 3VTYA 3UI2A 4N5CA 3ZYQA 4DJAA 4DPRA 2J4BA 2R03A 2P9KG 2AXVA 1UOHA 1SZAA 2HE0A 2WXIA 2VTBA 2LXLA 5BV0A 5KJKA 3PEUB 4WWNA 4OAUC 4CDNA 4Z68A 1Y6IA 4U63A 3NZUA 4OAVB 2WXHA 3NF1A 3DSXA 1SVXA 1N11A 5AYWD 4FADA 4FC8A 1WAO1 1X81A 5KJMA 4BT9A 4CRWA 2KATA 3LCAA 3SFXA 2JEKA 5CERB 3QB2A 2PL2A 1IXVA
chains in the Genus database with same CATH topology
2WXJA 3PDNA 3G2UA 3PEVB 3SGHA 2CHZA 1TJCA 2WM9A 3QWWA 4J8FA 1L5JA 2V0PA 3FUEA 3KEZA 3CVYA 3CKCA 2VYIA 3CV0A 1HZ4A 3Q5MA 5FT9A 5BNWA 2X3MA 1B89A 3ZXSA 4N39A 2UY1A 1U3DA 2OVBA 2ONDA 3OAWA 3URZA 4V3IA 5E76A 4ME2A 3RJVA 3U66A 3VTXA 4HOTA 5ARGA 3AS8A 2HM8A 2BTDA 3PUJA 4UWLA 2WXQA 5BPPA 4CGWA 1IHGA 3CK8A 5ANRA 2LAIA 4JA9A 1OWPA 2JLBA 5CCMA 1FVFA 4DLQA 4B89A 3Q49B 1ELRA 2J49A 3EDTB 3FU5A 4I6EA 4WNFA 3ZVVA 5BUZA 1KLXA 4FU3A 1QNFA 4UI9C 2HR2A 4FLBA 4PS3A 4GMLA 3APDA 5FZSA 3ASDA 3IHYA 3PRZA 3R7QA 2UY1B 5C1DA 4A1SA 3SD5A 3ULQA 4JVSA 1A17A 3LVRE 4YVOA 1NP7A 3IHVA 4KVMA 4CDMA 4U8HA 4U0UA 2WQHA 1HF8A 4N3CA 3Q47B 5HI7A 3FEYA 3TJPA 3TGOA 3B7UX 4ATGA 2VSOE 2I9CA 4N3AA 3CQCB 3FUNA 4LRZA 1JWGA 4I2ZA 3TAXA 4N2QA 3S7FA 3SHFA 2J4DA 1H2VC 4J8SA 1XGWA 4GCNA 4XKCA 2J08A 2WVIA 3I5PA 2WQ6A 2A4ZA 4BX9A 3FUJA 5BV1A 4XZ4A 2LNIA 1N52A 3B7SA 5ENNA 1OWNA 2WMOA 4XX5A 3ZHEA 1IYGA 5LFAA 4FULA 4CDRA 4A1GA 4G26A 5BW8C 2M63A 3SFZA 1H6KA 3AU5A 1VDYA 3B13A 3E4BA 3FFLA 3GW4A 3MKQA 4HOQA 3CHMA 4IN3B 4C9BB 4GA0A 4JL0A 4E85A 1UN9A 3APCA 3UPVA 2XGOA 5A23A 4PUCA 4U04A 4HOUA 3FU0A 5J90A 4EPZA 2XRYA 3B7RL 2VSNA 3RK6A 4I1AA 2FF4A 2WXRA 4JXTA 1HU3A 3AS5A 1HG2A 3ZHEB 4GYOA 3FHEA 4HOSA 3MA5A 1SZ9A 1PAQA 3HHMA 4F7AA 4G11A 5FQ7A 4L7TA 4EQFA 4EZJA 2XQ0A 3MKQB 4BT8A 3CEQA 4NURA 1IQRA 1HX8A 1UJKA 2IOLA 3PNTB 3R9AB 4PH4B 4EECA 2MOWA 3FUFA 3GYZA 3LY7A 3UX4A 5LCWC 3JQ0A 2AXZA 3L13A 4Q94A 4ANVA 3Q4AB 2NSZA 4O6FA 3UQ3A 3FU3A 3UT4A 4IYPA 3JCKC 1Z3XA 3EHNA 4JHRA 3D9LA 3LYAA 3D9NA 3QC1A 4I1OB 5AJLA 4MS6A 3PUKA 4Y6CA 2LSVA 3C98A 3PE4A 2OOEA 3G2SA 3FTSA 3IEGA 2XEVA 4OVUA 4PDXA 4ABNA 3S7JA 2P58C 3L6AA 4U0ZA 1UJJA 3PZDA 4FLHA 4BY6A 3FTVA 4K03A 4GA2A 3MYVA 3OXLA 3RRMB 3PVLA 3FUKA 3BG0B 3KAEA 3AS4A 4H7XA 4A3TA 3Q15A 3RIBA 2XHEA 4F1SA 2E2EA 3CSTA 4I6JA 3FY4A 4WUYA 2Q7FA 4HORA 2LO6A 2I1JA 2X6FA 4TRQA 3WXXA 4F53A 3VLEA 4B8CB 2E0IA 4UWKA 3LKUA 3ML8A 2WMNA 2EQXA 3IBEA 3MX3A 4J8DA 2LAHA 2YNQA 4H7YA 3ZGQA 4PS7A 4AJWA 4GPKA 2V8SE 3JUIA 3S7BA 2AXUA 3D9KA 4CT4A 5JHAA 4WNGA 2GRMA 4URKA 4L23A 4GZ3A 3QJZA 4WWPA 5J08A 1UN8A 4I43A 2KZTA 3RRUA 3U4TA 1ZBPA 3S2AA 3ZEFA 4GAAA 5M72A 1N54A 3LVQE 5FTPA 4E6HA 4RSYA 4GA1A 2MRIA 2WXLA 3K9IA 4Q96A 4TUUA 2J9QA 5DIZA 3G2TA 3QAQA 5G05J 2R17C 4EBAA 2NXPA 1HS6A 4GMJA 1HXIA 4OVVA 3ZN3A 3GZ1A 3FUHA 5CMYA 3ZIMA 2RG8A 1OWLA 3QNKA 3SF4A 4B94A 3ZRHA 2R59A 4CGVA 4I17A 2GRLA 2YHCA 1NA0A 4MLPA 2X38A 4L1BA 2KZTB 5AENA 3QKYA 4AEZC 1EYHA 4D10C 3HIZA 4XE0A 4F3VA 2AVPA 4GCOA 4G24A 1HH8A 1E8ZA 4Y6WA 1H2TC 1UW4B 4I1MA 3BG1B 4KYOB 5KCMA 4C0MA 2V5FA 4J0UA 3G2WA 4NACA 4LERA 4UWHA 3QARA 4R7LA 5FZRA 3G2VA 4ILHB 2AW6A 2FI7A 5FQ8A 3U64A 4DK5A 2IJGX 3APFA 2CG3A 2XCCA 2X6JA 2BF0X 3O4ZA 3QWPA 5D0OD 3T8MA 3LY8A 2XGMA 3N71A 4KBQA 4ILIA 4HLEA 2XRZA 1Y8MA 1FCHA 2I2OA 2PZIA 3T5XA 3MKRA 4IULA 4U0SA 2Y4TA 4PS8A 3CR3A 4Q69A 5CCLA 2KCLA 2GGFA 3MV3B 5ANLA 3UT8A 2OV8A 3CK9A 4I9CA 4N2SA 5T3RA 2I1KA 4NQ0A 1W3BA 2HO1A 1Z6TA 3FTYA 4XI0A 3HVEA 5KJNA 5LX8A 1EPUA 3L54A 2X6KA 4FA6A 3ZYLA 1E8XA 1SQMA 4JC8A 4AIFA 2VQ2A 5EKQD 1E7VA 1PC2A 3SI5A 3OTNA 3L22A 4J8EA 2XCBA 3I4GA 3D3MA 1EDUA 1HFAA 1X5BA 3L17A 3CLJA 4UQZA 3ZYMA 4K0RA 2NC9A 4DI3A 3LJ3A 3FULA 4FJYA 4JPSA 4BTBA 3D9MA 2WXFA 3U9WA 3KD7A 3SNXA 4EZLA 5HQ8A 2CFZA 4JZYA 2CHWA 3HVEB 3CIAA 1XNFA 1KT1A 3FH7A 3QDNA 2KM4A 3FUDA 2VGXA 1IQUA 3SBSA 2ZU6B 2WXKA 2V4LA 4XIFA 4JHJA 4XKBA 4OYSA 2Y3AA 5ARFA 5G05C 5T4YA 3RO3A 4AVXA 4HVBA 3SBTB 2PQNA 4WAFA 5EX3A 2WQ7A 3FP3A 4B8AA 5CMWA 3CVVA 3CHRA 2IF4A 4NRHB 3OXFA 4FJZA 3LXUX 4HFGA 4UI9K 3FDHA 4AP2A 4WNDA 2VSXE 5JHBA 4YVQC 1P5QA 2OVFA 5FZQA 4WNEA 2VGXB 3DBSA 2DCPA 5D0QD 5E75A 3EIJA 5G04J 1HG5A 3CHOA 3ZYKA 4AY5A 1TJFA 4B0ZA 2A5UA 3QOUA 3P1UA 4KZCA 3VLDA 3CHSA 3ESLA 3MV2B 4BFRA 4APFA 1E90A 1U3CA 4AOFA 4AY6A 3FTZA 3QK0A 3GZ2A 4RG9A 4P29A 4KT6B 3S7DA 3P2BA 2DIWA 4C0EA 5JJTA 3CVUA 3FTXA 5AJDA 4GZDA 4QFVA 5CHEE 3ASFA 4KZ0A 4M3OA 5G2NA 3TXMA 3UUXA 3FTUA 3ONKA 4HS2A 4GU5A 4IRUA 2X6HA 4GYWA 3TXNA 4I9EA 2L9BA 3B7TA 4A3VA 4JEHA 1E7UA 2PM6A 3CVXA 3ASHA 2PQRA 2X6IA 2FEZA 2I6HA 2WPVA 3ONLA 2XGSA 3U3WA 5FWQA 1OWOA 2YHEA 2AWIA 3PREA 3LY9A 4ANWA 1HO8A 2LSUA 3CVPA 3FU6A 4G2VA 1H2UA 4A55A 1PY1A 4CCAA 5AIJA 3FWVA 1E96B 1TEZA 3MZLB 3RU0A 3CVWA 4MKTA 3UMVA 2MHKA 2CG2A 1ZU2A 4BTAA 4U07A 1YA0A 1OUVA 4UQYA 3CK7A 1JPLA 2DBAA 4I6GA 3I4RB 3AU4A 1S0PA 5G55A 1NZNA 1HE8A 4ACKA 5A6CA 4GZ5A 4GB9A 4RG6A 1LF8A 1DNPA 2XPIA 4GYYA 5LCWJ 2QY7A 4KVOA 4UQXA 3RKVA 3TG5A 3ZPJA 4UWGA 2KCKA 4FP7A 5DBKA 4ACLA 1NA3A 4DI4A 3TG4A 3MJWA 3ZFWA 5KJLA 1INZA 5LP0A 3MEKA 4GZCA 3ASGA 2L6JA 2WXOA 3ENEA 3I3NA 3HDXA 4XI9A 4CT0A 4N3BA 1GW6A 1H19A 4BX8A 5EDSA 3FTWA 4L2LA 3JQ1A 2UWJG 3CHQA 4LUNU 4L2YA 3R7RA 5G04C 2CHXA 5BT1A 5JJ7A 2WXMA 1Z3YA 2HYZA 3O48A 3D9PA 3PE3A 4FHKA 4HXIA 4ILGA 2WXGA 4GZ6A 3IKOB 4AV7A 3IV0A 4YNDA 2KCVA 3CVNA 2XPZA 3UT7A 4LCTA 1E8YA 5T8IA 2IOSA 4FHJA 4EZKA 4CEMA 1E8WA 3CKBA 3CQGB 3EHMA 4W9RA 4EBAG 1ELKA 3CHPA 1JWFA 3D9IA 3FUIA 3GZSA 1QQEA 2IFUA 2KC7A 2WXNA 3CVLA 4AM9A 2C0LA 3VTYA 1MQSA 5EX0A 2CFUA 2BUGA 2FO7A 3OXGA 3SZ7A 4ANXA 5FQ4A 3EJNA 4N5CA 2FBNA 3ZYQA 4DJAA 4RVBA 4DPRA 2IQCA 3RRNB 3T5VA 3VLFA 2J09A 3L08A 5LOZA 4BWRA 2J4BA 4UWFA 3CGHA 4ANUA 3PNLB 3LDZA 3LPZA 4JA7A 3FH8A 2AXVA 2WXPA 2QFCA 2R5SA 3ESKA 3D9OA 2VSYA 2RD0A 1H0AA 1BPOA 2YQ8A 5A7DB 2Y4UA 1JUQA 1WY6A 4JW1A 2C2LA 2VJ8A 1SZAA 3LS8A 2VTBA 2WXIA 5FJYA 3HYMB 3PH0C 2C0MA 4UI9J 3RO2A 3BEEA 1KT0A 2IU1A 2J07A 3FEXA 2IONA 5BV0A 4BSXA 5KJKA 3TL5A 2XPYA 3ML9A 2WB2A 5JJ6A 3PEUB 4WWNA 4G25A 4MRUA 3EIQC 2PM7A 2ILRA 4KXKB 3JYSA 3L16A 4AXHA 1ELWA 3MCXA 5C2YA 4CDNA 2VTBB 3QWVA 3ZW3A 4JHKA 1Y6IA 1WM5A 4U63A 1UG3A 3D9JA 3NZUA 5FQ6A 1MHQA 4DLOA 2FULA 3CVQA 1DVPA 2WXHA 4G23A 4J6IA 3NF1A 1OWMA 4KMOA 4LEUA 3MGBA 3NQPA 3LEWA 5AYWD 2L0TB 3DPDA 4FADA 3FUMA 1WAO1 4FC8A 4APOA 2GW1A 3FH5A 4I2WA 5KJMA 1EF1C 4BT9A 3CSFA 2VGYA 4CRWA 3PS6A 1QZ2A 4JEUA 2KATA 3LCAA 1FVHA 2JEKA 4G1TA 3NZSA 3KS2A 4WWOA 2L0IA 2YINA 3QB2A 2PL2A 4TV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PDN A;  1TJC A;  3QWW A;  4J8F A;  3CKC A;  5FT9 A;  2VYI A;  1HZ4 A;  3CV0 A;  3Q5M A;  5BNW A;  1B89 A;  4N39 A;  2UY1 A;  2OND A;  3URZ A;  4ME2 A;  3RJV A;  3VTX A;  4HOT A;  5ARG A;  3AS8 A;  4CGW A;  1IHG A;  3CK8 A;  4JA9 A;  2JLB A;  5CCM A;  3Q49 B;  1ELR A;  3EDT B;  4WNF A;  1KLX A;  4UI9 C;  2HR2 A;  5FZS A;  3ASD A;  2UY1 B;  5C1D A;  4A1S A;  3ULQ A;  1A17 A;  4YVO A;  4U0U A;  2WQH A;  4N3C A;  3Q47 B;  5HI7 A;  3TGO A;  4N3A A;  4I2Z A;  3TAX A;  4N2Q A;  3S7F A;  4GCN A;  2LNI A;  3ZHE A;  1IYG A;  4CDR A;  4G26 A;  5BW8 C;  4HOQ A;  4IN3 B;  3E4B A;  3FFL A;  3GW4 A;  4GA0 A;  4JL0 A;  3UPV A;  2XGO A;  4U04 A;  4HOU A;  2VSN A;  4I1A A;  2FF4 A;  3AS5 A;  3ZHE B;  4GYO A;  4HOS A;  3MA5 A;  4EQF A;  4BT8 A;  3CEQ A;  3R9A B;  3GYZ A;  3LY7 A;  5LCW C;  3Q4A B;  4O6F A;  3UQ3 A;  4JHR A;  3LYA A;  4Y6C A;  2LSV A;  3PE4 A;  2OOE A;  3IEG A;  2XEV A;  4ABN A;  3S7J A;  2P58 C;  4U0Z A;  4GA2 A;  3OXL A;  3KAE A;  3AS4 A;  4H7X A;  3Q15 A;  3RIB A;  2E2E A;  4WUY A;  2Q7F A;  4HOR A;  3WXX A;  3LKU A;  4J8D A;  4H7Y A;  3ZGQ A;  4GPK A;  3S7B A;  4WNG A;  4GZ3 A;  3U4T A;  1ZBP A;  5M72 A;  5FTP A;  4GA1 A;  3K9I A;  2J9Q A;  5DIZ A;  5G05 J;  1HXI A;  3ZN3 A;  3GZ1 A;  4B94 A;  4CGV A;  3SF4 A;  4I17 A;  2YHC A;  1NA0 A;  3QKY A;  4F3V A;  2AVP A;  4GCO A;  4G24 A;  1HH8 A;  4Y6W A;  4KYO B;  2V5F A;  4J0U A;  5FZR A;  2FI7 A;  2XCC A;  3QWP A;  5D0O D;  3LY8 A;  2XGM A;  3N71 A;  4KBQ A;  1Y8M A;  1FCH A;  2PZI A;  3MKR A;  4U0S A;  2Y4T A;  5CCL A;  2KCL A;  3MV3 B;  3CK9 A;  4I9C A;  4N2S A;  4NQ0 A;  1W3B A;  2HO1 A;  4XI0 A;  5KJN A;  4AIF A;  2VQ2 A;  5EKQ D;  1PC2 A;  4J8E A;  2XCB A;  4UQZ A;  2NC9 A;  4BTB A;  3KD7 A;  5HQ8 A;  1XNF A;  1KT1 A;  3QDN A;  2VGX A;  4XIF A;  5G05 C;  5ARF A;  3RO3 A;  2PQN A;  5EX3 A;  3FP3 A;  2IF4 A;  4NRH B;  3OXF A;  4UI9 K;  4WND A;  4YVQ C;  1P5Q A;  5FZQ A;  4WNE A;  2VGX B;  5D0Q D;  5G04 J;  4AY5 A;  3QOU A;  3MV2 B;  4AY6 A;  3GZ2 A;  4RG9 A;  3S7D A;  5JJT A;  5CHE E;  3ASF A;  3UUX A;  4GYW A;  4I9E A;  3ASH A;  2PQR A;  2FEZ A;  2I6H A;  2WPV A;  2XGS A;  3U3W A;  3LY9 A;  2LSU A;  3CVP A;  4G2V A;  3FWV A;  1E96 B;  3RU0 A;  2MHK A;  1ZU2 A;  4BTA A;  4U07 A;  1YA0 A;  1OUV A;  4UQY A;  3CK7 A;  2DBA A;  1NZN A;  5A6C A;  4GZ5 A;  4RG6 A;  4GYY A;  2XPI A;  5LCW J;  3RKV A;  4UQX A;  3TG5 A;  3ZPJ A;  2KCK A;  5DBK A;  5KJL A;  1NA3 A;  3TG4 A;  3ZFW A;  3MEK A;  3ASG A;  2L6J A;  4XI9 A;  4N3B A;  2UWJ G;  5BT1 A;  5JJ7 A;  5G04 C;  3O48 A;  2HYZ A;  3PE3 A;  4GZ6 A;  4YND A;  2KCV A;  3CVN A;  3CKB A;  4W9R A;  1QQE A;  2IFU A;  2KC7 A;  3CVL A;  4AM9 A;  2C0L A;  3VTY A;  5EX0 A;  2BUG A;  2FO7 A;  3OXG A;  3SZ7 A;  4N5C A;  2FBN A;  4BWR A;  3LPZ A;  4JA7 A;  2QFC A;  2R5S A;  3ESK A;  2VSY A;  2YQ8 A;  5A7D B;  2Y4U A;  2C2L A;  5FJY A;  3HYM B;  2C0M A;  4UI9 J;  3RO2 A;  3BEE A;  1KT0 A;  5KJK A;  5JJ6 A;  4G25 A;  4KXK B;  3JYS A;  1ELW A;  3QWV A;  1WM5 A;  3CVQ A;  4G23 A;  3NF1 A;  4LEU A;  5AYW D;  1WAO 1;  4APO A;  2GW1 A;  4I2W A;  5KJM A;  4BT9 A;  2VGY A;  1QZ2 A;  2KAT A;  3LCA A;  4G1T A;  3KS2 A;  2PL2 A; 
#chains in the Genus database with same CATH topology
 2CHZ A;  4LG6 A;  4J8F A;  3KEZ A;  3IXE A;  3Q5M A;  2VYI A;  3TWW A;  2UY1 A;  2OND A;  5E76 A;  5BXU A;  4ME2 A;  1OCR E;  4J8Y A;  4CGW A;  4JA9 A;  1OWP A;  3DSV A;  2JLB A;  4GMR A;  2P9L G;  4LNU D;  1ELR A;  5BUZ A;  4I6E A;  4G8L A;  4FLB A;  4GML A;  3APD A;  5FZS A;  3PRZ A;  2R2L A;  3SD5 A;  3UIO C;  3LVR E;  3B7U X;  4ATG A;  2Y1L E;  3CQC B;  3TAX A;  2J4D A;  1H2V C;  4HNA D;  4GCN A;  1OY3 D;  2A4Z A;  2DZN A;  2LNI A;  1IYG A;  3Q9N C;  4CDR A;  4A1G A;  2EIM E;  3SFZ A;  4IN3 B;  1VDY A;  3FFL A;  3CHM A;  3HXF A;  4JL0 A;  1TNU A;  2XGO A;  5A23 A;  4U04 A;  2IY0 C;  1HG2 A;  3W9G A;  3ZHE B;  5KWD A;  1SZ9 A;  4F7A A;  2QZA A;  3MKQ B;  3FUF A;  3LY7 A;  3UX4 A;  5LCW C;  3V30 A;  4BER A;  3L13 A;  2NSZ A;  4O6F A;  5HRY A;  3UQ3 A;  4IYP A;  1O5M A;  4O1P A;  4GTQ A;  5AJL A;  4MS6 A;  1D8D A;  3PE4 A;  3G2S A;  3FTS A;  1K1A A;  4PDX A;  2P58 C;  1UJJ A;  3FTV A;  4K03 A;  4GA2 A;  3MYV A;  2E2E A;  2AJA A;  2Q7F A;  3IBE A;  2EQX A;  3MX3 A;  2YNQ A;  3S7B A;  4BES A;  5JHA A;  3U4T A;  2RFM A;  3T9K A;  5FTP A;  4E6H A;  4RSY A;  2WXL A;  4TUU A;  2J9Q A;  5DIZ A;  3C5R A;  3NBN B;  2R17 C;  3T8K A;  3F6Q A;  3KSQ A;  1HS6 A;  1K3Z D;  3ZIM A;  4B94 A;  5AEN A;  4F3V A;  3HIZ A;  4GCO A;  4Y6W A;  5KCM A;  3AG1 E;  5FZR A;  4ILH B;  4DK5 A;  3Q79 A;  2FI7 A;  2IJG X;  1H6O A;  3BU8 A;  3O4Z A;  3QWP A;  3T8M A;  3LY8 A;  4L9P A;  1FCH A;  3Q78 A;  4GTR A;  4I9C A;  2I1K A;  4GTS A;  4XI0 A;  3J5P A;  5LX8 A;  3ABK E;  4FA6 A;  3ZYL A;  3E37 A;  3EU9 A;  4JC8 A;  4AIF A;  3Q73 A;  1PC2 A;  1K1B A;  3I4G A;  5AQB A;  3CLJ A;  4DI3 A;  3LJ3 A;  4FJY A;  4JPS A;  3D9M A;  4EZL A;  2ETA A;  1TN8 A;  2CHW A;  3HVE B;  3SBS A;  2ETB A;  2ZU6 B;  5G05 C;  3TWV A;  2Y3A A;  5ARF A;  1TNO A;  2WQ7 A;  3FP3 A;  4B8A A;  5CRV A;  3CHR A;  3LXU X;  4YVQ C;  2VGX B;  4AY5 A;  3EIJ A;  1AP7 A;  1TJF A;  3VLD A;  3MV2 B;  1BU9 A;  1E90 A;  4AOF A;  4P29 A;  3S7D A;  3FTX A;  4GZD A;  3UUX A;  3FTU A;  4DX6 D;  3B7T A;  3DSW A;  4JEH A;  4DX7 D;  2PM6 A;  3ASH A;  1YMP A;  3TWR A;  3EUV A;  2P9P G;  2AWI A;  1HO8 A;  2LSU A;  3CVP A;  3FU6 A;  1H2U A;  2R05 A;  4A55 A;  1E96 B;  1TEZ A;  3CVW A;  2GRQ B;  2MHK A;  1ZU2 A;  4U07 A;  1OUV A;  3CK7 A;  5HS0 A;  1S0P A;  1NZN A;  2P9N G;  3DWL G;  5LCW J;  3RKV A;  3TG5 A;  3MJW A;  2KBX A;  2WXO A;  4XI9 A;  1GW6 A;  5EDS A;  3FTW A;  3CHQ A;  5BT1 A;  5G04 C;  2CHX A;  4FHK A;  4ILG A;  4GZ6 A;  3CVN A;  3DEO A;  2IOS A;  4FHJ A;  4W9R A;  1QYM A;  3CHP A;  1JWF A;  3GZS A;  3ABL E;  1KZO A;  4AM9 A;  5EX0 A;  1MX2 A;  2BUG A;  2FO7 A;  3SZ7 A;  2FBN A;  3JUE A;  3L08 A;  5LOZ A;  3CGH A;  4ANU A;  4JA7 A;  3PZ1 A;  3FH8 A;  2WXP A;  3HXC A;  2VSY A;  1BPO A;  2Y4U A;  3DPY A;  2ZIS A;  3HYM B;  2IO3 C;  3PH0 C;  2C0M A;  1JCQ A;  3C72 A;  4UI9 J;  3RO2 A;  3BEE A;  4U8V D;  1KT0 A;  2IU1 A;  4BSX A;  2MYO A;  5EIB E;  2DYS E;  3TL5 A;  3ML9 A;  2QYU A;  4F6R D;  3EIQ C;  2PM7 A;  3TWQ A;  3JYS A;  4AXH A;  1ELW A;  2VTB B;  3QWV A;  5FQ6 A;  4DLO A;  2GRN B;  3CVQ A;  4DX1 A;  1OT8 A;  3UM2 A;  2L0T B;  4APO A;  4I2W A;  4XEI G;  1EF1 C;  3CSF A;  1ZB1 A;  3NZS A;  3V2X A;  2YIN A;  2XEN A;  2WXJ A;  3G2U A;  3SGH A;  3AAA C;  2XZD G;  3QWW A;  3ZU7 B;  3CVY A;  3CV0 A;  5FT9 A;  1HZ4 A;  1YCS B;  5BNW A;  4U96 D;  3ZXS A;  1U3D A;  1N94 A;  4V3I A;  2BTD A;  4UWL A;  5BPP A;  1IHG A;  3CK8 A;  5ANR A;  2LAI A;  4RLY A;  5CCM A;  1FVF A;  4TXQ A;  1FT2 A;  4B89 A;  3X2Q E;  2H6H A;  3ZVV A;  4FU3 A;  2HR2 A;  2UY1 B;  2OEW A;  4A1S A;  4KVM A;  4U0U A;  3FEY A;  3UKR G;  2I9C A;  5B3S E;  4LRZ A;  3EU5 A;  4I2Z A;  3S7F A;  3SHF A;  4JB8 P;  4J8S A;  1XGW A;  3V31 A;  3Q7F A;  2WQ6 A;  1NL4 A;  3HXD A;  4LNB A;  4BX9 A;  5BV1 A;  3PZ2 A;  5B1B E;  3LJN A;  5LFA A;  4FUL A;  2M63 A;  1H6K A;  3GW4 A;  5CRU A;  2PNN A;  4E85 A;  1UN9 A;  1TYQ G;  5KBA A;  2XEH A;  4EPZ A;  1TR4 A;  2FF4 A;  2WXR A;  4GPM A;  1SW6 A;  3FHE A;  4HOS A;  4EZJ A;  2XQ0 A;  4BT8 A;  3UM3 A;  3ZNG A;  5AQ7 A;  2AXZ A;  4Q94 A;  4HQD A;  3Q4A B;  3FU3 A;  3TWU A;  3JCK C;  1MX4 A;  3PUK A;  4HRM B;  4TXR A;  2R02 A;  3IEG A;  4ZFH A;  4FLH A;  4K5C A;  1BI8 B;  3KAE A;  3AS4 A;  4A3T A;  3Q15 A;  4F1S A;  2XHE A;  3CST A;  4I6J A;  3FY4 A;  4WUY A;  4HOR A;  2X6F A;  2OCC E;  3VLE A;  3LKU A;  4J8D A;  5EYL A;  1KPS B;  2V8S E;  2XZT G;  2GRR B;  2GRM A;  4WWP A;  5J08 A;  5M72 A;  3LVQ E;  4YDE A;  4Q96 A;  2F8Y A;  3ZN3 A;  3J5Q B;  2RG8 A;  4CGV A;  3ZRH A;  4I17 A;  2GRL A;  1NA0 A;  2X38 A;  4AEZ C;  2ZGG A;  1EYH A;  4D10 C;  4XE0 A;  3L82 A;  4G24 A;  4U7E B;  1NFI E;  1DCQ A;  4I1M A;  3BG1 B;  2EIK E;  2V5F A;  4NAC A;  4LER A;  4R7L A;  2V4H C;  5FQ8 A;  3APF A;  4U8Y D;  4LNG A;  3N71 A;  4KBQ A;  3MKR A;  4CZ2 D;  3UT8 A;  4K5B A;  5CBO A;  4N2S A;  2HO1 A;  1Z6T A;  3FTY A;  3AJI A;  3L54 A;  2X6K A;  2FO1 E;  2VQ2 A;  1E7V A;  3L22 A;  2XCB A;  1EDU A;  4DX5 D;  1HFA A;  4K0R A;  2NC9 A;  2BED A;  3FUL A;  3U9W A;  2DZO A;  1V54 E;  5KNG A;  3JXI A;  1XNF A;  1KT1 A;  3QDN A;  1V55 E;  4XKB A;  4OYS A;  4AVX A;  5EX3 A;  4NRH B;  5IY5 E;  4AP2 A;  5JHB A;  3NOG D;  3D9H A;  3DBS A;  5D0Q D;  3ZYK A;  1HG5 A;  3CHO A;  1N0R A;  3P1U A;  3CHS A;  3ESL A;  1U3C A;  3QK0 A;  3GZ2 A;  4RG9 A;  4GTV A;  3DST A;  4QFV A;  3ASF A;  4KZ0 A;  4M3O A;  1NI1 A;  3E30 A;  1O1R A;  5HKP A;  4HRL A;  3DSS A;  4K5A B;  4YDO A;  2FEZ A;  2I6H A;  1RW2 A;  4CYM D;  3PRE A;  4ANW A;  4G2V A;  1PY1 A;  4CCA A;  3FWV A;  3MZL B;  1DC2 A;  3HXE A;  2H6G A;  4HI9 A;  4BTA A;  1YA0 A;  4I6G A;  1D9S A;  3AU4 A;  4ACK A;  4GZ5 A;  4GB9 A;  4RG6 A;  2XPI A;  2QYJ A;  5DBK A;  4FP7 A;  5KJL A;  1NA3 A;  3TG4 A;  1SA5 A;  3ZFW A;  1INZ A;  3MEK A;  4GZC A;  2L6J A;  3ENE A;  4F1P A;  1H19 A;  4BX8 A;  3JQ1 A;  4L2Y A;  3R7R A;  5BXO A;  3O48 A;  3RRM B;  1OCC E;  3IKO B;  4AV7 A;  3IV0 A;  2KCV A;  5T8I A;  4EZK A;  4CEM A;  3CKB A;  1ELK A;  3D9I A;  5EIL A;  1QQE A;  2KC7 A;  2BKG A;  3ZKJ A;  4ANX A;  5FQ4 A;  2IQC A;  3VLF A;  2J09 A;  4UWF A;  1LD7 A;  3LPZ A;  4DRX E;  2QFC A;  3D9O A;  2RD0 A;  2YQ8 A;  5AAR A;  5EYP F;  1JUQ A;  1WY6 A;  4JW1 A;  2C2L A;  2VJ8 A;  5FJY A;  2J07 A;  2ION A;  1TNB A;  4G25 A;  4MRU A;  2ILR A;  5D66 A;  3L16 A;  3MCX A;  5KNH D;  1WM5 A;  1UG3 A;  3D9J A;  2B6C A;  2FUL A;  1DVP A;  4G23 A;  4J6I A;  4BSZ B;  2NYJ A;  1OWM A;  4KMO A;  4LEU A;  3NQP A;  2ZIR A;  5B1A E;  3DPD A;  3FH5 A;  2VGY A;  3PS6 A;  1QZ2 A;  5D2M C;  1FVH A;  2F0Y A;  3KS2 A;  4WWO A;  4TV3 A;  3PDN A;  2JAB A;  3PEV B;  1L5J A;  2A5E A;  3FUE A;  2Y69 E;  2X3M A;  4N39 A;  1FPP A;  2OVB A;  3BUA A;  3RJV A;  3VTX A;  4HOT A;  3AS8 A;  2HM8 A;  3PUJ A;  2WXQ A;  3EHQ A;  4DLQ A;  3SQV A;  2P2C P;  3HXB A;  1KLX A;  4PS3 A;  3NOC D;  1N4R A;  2ETC A;  3R7Q A;  5C1D A;  4JVS A;  5EN5 D;  4YVO A;  1NP7 A;  3IHV A;  4CDM A;  1O1T A;  2XS8 A;  4U8H A;  3WG7 E;  3DXK G;  1HF8 A;  3TGO A;  5ENR D;  2VSO E;  4N3A A;  3FUN A;  1JWG A;  4N2Q A;  4XKC A;  2J08 A;  3I5P A;  3FUJ A;  1N52 A;  3B7S A;  2WMO A;  3L9T A;  3NAW A;  2LXM A;  1S70 B;  4G26 A;  3KEA A;  1N4P A;  3AU5 A;  3E4B A;  4GA0 A;  3APC A;  1LTX A;  4HOU A;  1N4S A;  3B7R L;  2VSN A;  3RK6 A;  4JXT A;  3Q75 A;  3TWT A;  3MA5 A;  1PAQ A;  5AAO A;  4G11 A;  4EQF A;  4L7T A;  3UM0 A;  4NUR A;  1IQR A;  1UJK A;  3UXG A;  2IOL A;  4PH4 B;  2MOW A;  3GYZ A;  1K8K G;  3R9M A;  3V79 K;  3JQ0 A;  3SFY A;  4ANV A;  3UT4 A;  3LYA A;  3D9N A;  4I1O B;  3ULE G;  4Y6C A;  2LSV A;  4GTP A;  3C98 A;  4GTO A;  2QC9 A;  3UTM A;  4OVU A;  3L6A A;  5ENP D;  3PVL A;  3FUK A;  3BG0 B;  3RIB A;  4F53 A;  2I1J A;  3WXX A;  4UWK A;  2WMN A;  1MJ0 A;  5H7P A;  4AJW A;  4MBG A;  5FIO A;  3JUI A;  4HB5 A;  4WNG A;  4GTT A;  4L23 A;  2ZXW E;  3QJZ A;  1UN8 A;  4I43 A;  2KZT A;  2P9S G;  1ZBP A;  3S2A A;  4GAA A;  2MRI A;  3K9I A;  5G05 J;  3G2T A;  3QAQ A;  5ENT D;  3AG3 E;  2NXP A;  4OVV A;  2DVW A;  3FUH A;  5CMY A;  1OWL A;  3QNK A;  2R59 A;  2YHC A;  4MLP A;  3HRA A;  4U95 D;  1LD8 A;  3Q7A A;  1E8Z A;  1H2T C;  2EIJ E;  1FT1 A;  4KYO B;  3G2W A;  1N9A A;  4A63 B;  3G2V A;  4O60 A;  2BF0 X;  5D0O D;  2XGM A;  2RFA A;  4ILI A;  2BKK B;  2I2O A;  2PZI A;  3T5X A;  4U0S A;  4Q69 A;  1A5E A;  2KCL A;  5ANL A;  2OV8 A;  4NQ0 A;  5JMN D;  1Z5S C;  1BI7 B;  5KJN A;  1EPU A;  4M7C A;  1SQM A;  3SI5 A;  3OTN A;  4N5Q A;  3D3M A;  3L17 A;  4UQZ A;  4BTB A;  2WXF A;  3SNX A;  2CFZ A;  4JZY A;  4ATZ D;  3RAU A;  3FH7 A;  2KM4 A;  1IQU A;  2WXK A;  2V4L A;  4YDW A;  5T4Y A;  3PZ4 A;  3C3O A;  3SBT B;  2PQN A;  3E33 A;  4HI8 A;  3DXM G;  4J7W A;  4UI9 K;  3FDH A;  2OVF A;  5FZQ A;  4WNE A;  3DRA A;  2DCP A;  5E75 A;  5G04 J;  4LSZ E;  3QOU A;  4C48 B;  1SA4 A;  4AY6 A;  4HRN A;  4KT6 B;  1IHB A;  2Y0B G;  2DIW A;  3P2B A;  5JJT A;  5G2N A;  3ULY A;  3TWS A;  3ONK A;  4GU5 A;  4IRU A;  3B7B A;  2X6H A;  3TXN A;  2L9B A;  4A3V A;  3E34 A;  1E7U A;  2PQR A;  2X6I A;  5JA4 D;  2XGS A;  4O1O A;  3U3W A;  5CBN A;  5FWQ A;  1OWO A;  2YHE A;  3UM1 A;  5ENO D;  5AIJ A;  4MKT A;  4DUI A;  4BEP A;  1JPL A;  2KXP C;  3PZ3 A;  5G55 A;  1HE8 A;  1MYO A;  1OCO E;  1LF8 A;  2QY7 A;  4UQX A;  4DI4 A;  1N95 A;  3ASG A;  3I3N A;  3HDX A;  3AG2 E;  3V2O A;  5JJ7 A;  1Q2Z A;  1Z3Y A;  2GRO B;  3PE3 A;  1IKN D;  4YND A;  3UT7 A;  4LCT A;  1E8Y A;  1QBQ A;  1E8W A;  3CQG B;  4X8Q A;  1RZ4 A;  3FUI A;  1OXJ A;  2IFU A;  3CVL A;  1MQS A;  3NB2 A;  2CFU A;  3OXG A;  1TN7 A;  3EJN A;  4RVB A;  2GRP B;  3RRN B;  3T5V A;  1D8E A;  4BWR A;  3PNL B;  3UIN C;  3LDZ A;  2H6I A;  2R5S A;  3ESK A;  1U2V G;  1H0A A;  5A7D B;  3ASO E;  3LS8 A;  2DYR E;  2EIL E;  3FEX A;  2IEJ A;  2XPY A;  3AG4 E;  3Q9U C;  2WB2 A;  5JJ6 A;  3SO8 A;  5EID A;  3C3Q A;  1N0Q A;  1TN6 A;  4KXK B;  5C2Y A;  3ZW3 A;  4JHK A;  1MHQ A;  3MGB A;  4DX2 A;  3LEW A;  2OEV A;  3FUM A;  2GW1 A;  1MZC A;  2F8X K;  4JEU A;  4G1T A;  2B0O E;  2L0I A;  1BD8 A;  1TJC A;  2WM9 A;  2V0P A;  2LUH A;  3CKC A;  1G3N B;  1B89 A;  3OAW A;  3URZ A;  3U66 A;  1TNY A;  5ARG A;  3Q49 B;  2J49 A;  3EDT B;  3FU5 A;  4WNF A;  1AWC B;  1QNF A;  4UI9 C;  3ASD A;  3IHY A;  3ULQ A;  1TNZ A;  1S63 A;  1A17 A;  2WQH A;  4QQI A;  4N3C A;  3Q47 B;  5HI7 A;  1WG0 A;  4HLL A;  3TJP A;  4RQI A;  3JXJ A;  2ZGD A;  2WVI A;  4XZ4 A;  5ENN A;  1OWN A;  4XX5 A;  3ZHE A;  5BW8 C;  4HOQ A;  3B13 A;  3MKQ A;  4C9B B;  4NIK A;  1OCZ E;  1WDY A;  3UPV A;  4PUC A;  3FU0 A;  4B93 B;  5J90 A;  2XRY A;  4I1A A;  5CEA A;  1HU3 A;  3AS5 A;  4GYO A;  3HHM A;  1O1S A;  5FQ7 A;  5AN8 A;  3CEQ A;  1HX8 A;  3R9A B;  3PNT B;  4EEC A;  3C3R A;  2XS1 A;  1Z3X A;  3EHN A;  4JHR A;  3EHR A;  3D9L A;  3ZXP A;  3QC1 A;  2IO2 C;  5FIN A;  3RSE G;  2OOE A;  3ASN E;  2XEV A;  3KSL A;  4ABN A;  3S7J A;  4BY6 A;  4U0Z A;  3PZD A;  3OXL A;  4H7X A;  2LO6 A;  4TRQ A;  4B8C B;  2E0I A;  3ML8 A;  1KZP A;  3DEP A;  2LAH A;  4H7Y A;  3ZGQ A;  4PS7 A;  4GPK A;  3ISM C;  2AXU A;  3D9K A;  4CT4 A;  4URK A;  4GZ3 A;  1MX6 A;  3RRU A;  3ZEF A;  1YYH A;  1N54 A;  4GA1 A;  4EHM A;  4EBA A;  3W9F A;  4GMJ A;  1HXI A;  3GZ1 A;  3UIP C;  3SF4 A;  4L1B A;  2KZT B;  3QKY A;  2AVP A;  2DWZ A;  2F37 A;  1HH8 A;  1UW4 B;  3DSU A;  4C0M A;  4J0U A;  4UWH A;  3QAR A;  2P9U G;  2AW6 A;  3U64 A;  4UUC A;  2CG3 A;  3HG0 D;  2XCC A;  2X6J A;  1DCE A;  1BLX B;  4HLE A;  2XRZ A;  1JCR A;  1Y8M A;  4IUL A;  2Y4T A;  4PS8 A;  3CR3 A;  5CCL A;  2GGF A;  3UKU G;  3MV3 B;  3CK9 A;  5T3R A;  1W3B A;  1S64 A;  5CEC B;  3B95 A;  3HVE A;  1E8X A;  2P9I G;  5EKQ D;  4J8E A;  2V5Q C;  1X5B A;  5AQA A;  3ZYM A;  2EIN E;  3KD7 A;  5HQ8 A;  3ABM E;  2VGE A;  1JCS A;  3CIA A;  3FUD A;  2VGX A;  4XIF A;  4JHJ A;  3RO3 A;  4HVB A;  1N4Q A;  4WAF A;  3E32 A;  5CMW A;  3CVV A;  2IF4 A;  3BQO A;  3OXF A;  4FJZ A;  4GTM A;  4HFG A;  4WND A;  2VSX E;  1P5Q A;  4EBA G;  4B0Z A;  2A5U A;  4KZC A;  4BFR A;  4APF A;  3FTZ A;  5ENS D;  4C0E A;  3ZUV B;  3CVU A;  5AJD A;  5CHE E;  3TXM A;  4HS2 A;  2RKK A;  4GYW A;  4BET A;  4I9E A;  3CVX A;  3SY2 A;  2WPV A;  3ONL A;  3LY9 A;  4ZHB A;  3RU0 A;  4TUM A;  3UMV A;  4HBD A;  2CG2 A;  5ITZ F;  4UQY A;  2DBA A;  3I4R B;  2L6B A;  5A6C A;  5AQ9 A;  4GYY A;  1DNP A;  2XEE A;  2J8S D;  4KVO A;  5ENQ D;  4YDY A;  3ZPJ A;  4UWG A;  2KCK A;  3TWX A;  4ACL A;  4TXP A;  5LP0 A;  4CT0 A;  4N3B A;  4L2L A;  4LUN U;  2UWJ G;  2H6F A;  2HYZ A;  2WXM A;  4HXI A;  3D9P A;  2WXG A;  2XPZ A;  3EHM A;  5CED B;  1H6P A;  4JD2 G;  2WXN A;  4G8K A;  2C0L A;  3VTY A;  3UI2 A;  4N5C A;  3ZYQ A;  4DJA A;  4DPR A;  2J4B A;  2R03 A;  2P9K G;  2AXV A;  1UOH A;  1SZA A;  2HE0 A;  2WXI A;  2VTB A;  2LXL A;  5BV0 A;  5KJK A;  3PEU B;  4WWN A;  4OAU C;  4CDN A;  4Z68 A;  1Y6I A;  4U63 A;  3NZU A;  4OAV B;  2WXH A;  3NF1 A;  3DSX A;  1SVX A;  1N11 A;  5AYW D;  4FAD A;  4FC8 A;  1WAO 1;  1X81 A;  5KJM A;  4BT9 A;  4CRW A;  2KAT A;  3LCA A;  3SFX A;  2JEK A;  5CER B;  3QB2 A;  2PL2 A;  1IXV A; 
#chains in the Genus database with same CATH homology
 2WXJ A;  3PDN A;  3G2U A;  3PEV B;  3SGH A;  2CHZ A;  1TJC A;  2WM9 A;  3QWW A;  4J8F A;  1L5J A;  2V0P A;  3FUE A;  3KEZ A;  3CVY A;  3CKC A;  2VYI A;  3CV0 A;  1HZ4 A;  3Q5M A;  5FT9 A;  5BNW A;  2X3M A;  1B89 A;  3ZXS A;  4N39 A;  2UY1 A;  1U3D A;  2OVB A;  2OND A;  3OAW A;  3URZ A;  4V3I A;  5E76 A;  4ME2 A;  3RJV A;  3U66 A;  3VTX A;  4HOT A;  5ARG A;  3AS8 A;  2HM8 A;  2BTD A;  3PUJ A;  4UWL A;  2WXQ A;  5BPP A;  4CGW A;  1IHG A;  3CK8 A;  5ANR A;  2LAI A;  4JA9 A;  1OWP A;  2JLB A;  5CCM A;  1FVF A;  4DLQ A;  4B89 A;  3Q49 B;  1ELR A;  2J49 A;  3EDT B;  3FU5 A;  4I6E A;  4WNF A;  3ZVV A;  5BUZ A;  1KLX A;  4FU3 A;  1QNF A;  4UI9 C;  2HR2 A;  4FLB A;  4PS3 A;  4GML A;  3APD A;  5FZS A;  3ASD A;  3IHY A;  3PRZ A;  3R7Q A;  2UY1 B;  5C1D A;  4A1S A;  3SD5 A;  3ULQ A;  4JVS A;  1A17 A;  3LVR E;  4YVO A;  1NP7 A;  3IHV A;  4KVM A;  4CDM A;  4U8H A;  4U0U A;  2WQH A;  1HF8 A;  4N3C A;  3Q47 B;  5HI7 A;  3FEY A;  3TJP A;  3TGO A;  3B7U X;  4ATG A;  2VSO E;  2I9C A;  4N3A A;  3CQC B;  3FUN A;  4LRZ A;  1JWG A;  4I2Z A;  3TAX A;  4N2Q A;  3S7F A;  3SHF A;  2J4D A;  1H2V C;  4J8S A;  1XGW A;  4GCN A;  4XKC A;  2J08 A;  2WVI A;  3I5P A;  2WQ6 A;  2A4Z A;  4BX9 A;  3FUJ A;  5BV1 A;  4XZ4 A;  2LNI A;  1N52 A;  3B7S A;  5ENN A;  1OWN A;  2WMO A;  4XX5 A;  3ZHE A;  1IYG A;  5LFA A;  4FUL A;  4CDR A;  4A1G A;  4G26 A;  5BW8 C;  2M63 A;  3SFZ A;  1H6K A;  3AU5 A;  1VDY A;  3B13 A;  3E4B A;  3FFL A;  3GW4 A;  3MKQ A;  4HOQ A;  3CHM A;  4IN3 B;  4C9B B;  4GA0 A;  4JL0 A;  4E85 A;  1UN9 A;  3APC A;  3UPV A;  2XGO A;  5A23 A;  4PUC A;  4U04 A;  4HOU A;  3FU0 A;  5J90 A;  4EPZ A;  2XRY A;  3B7R L;  2VSN A;  3RK6 A;  4I1A A;  2FF4 A;  2WXR A;  4JXT A;  1HU3 A;  3AS5 A;  1HG2 A;  3ZHE B;  4GYO A;  3FHE A;  4HOS A;  3MA5 A;  1SZ9 A;  1PAQ A;  3HHM A;  4F7A A;  4G11 A;  5FQ7 A;  4L7T A;  4EQF A;  4EZJ A;  2XQ0 A;  3MKQ B;  4BT8 A;  3CEQ A;  4NUR A;  1IQR A;  1HX8 A;  1UJK A;  2IOL A;  3PNT B;  3R9A B;  4PH4 B;  4EEC A;  2MOW A;  3FUF A;  3GYZ A;  3LY7 A;  3UX4 A;  5LCW C;  3JQ0 A;  2AXZ A;  3L13 A;  4Q94 A;  4ANV A;  3Q4A B;  2NSZ A;  4O6F A;  3UQ3 A;  3FU3 A;  3UT4 A;  4IYP A;  3JCK C;  1Z3X A;  3EHN A;  4JHR A;  3D9L A;  3LYA A;  3D9N A;  3QC1 A;  4I1O B;  5AJL A;  4MS6 A;  3PUK A;  4Y6C A;  2LSV A;  3C98 A;  3PE4 A;  2OOE A;  3G2S A;  3FTS A;  3IEG A;  2XEV A;  4OVU A;  4PDX A;  4ABN A;  3S7J A;  2P58 C;  3L6A A;  4U0Z A;  1UJJ A;  3PZD A;  4FLH A;  4BY6 A;  3FTV A;  4K03 A;  4GA2 A;  3MYV A;  3OXL A;  3RRM B;  3PVL A;  3FUK A;  3BG0 B;  3KAE A;  3AS4 A;  4H7X A;  4A3T A;  3Q15 A;  3RIB A;  2XHE A;  4F1S A;  2E2E A;  3CST A;  4I6J A;  3FY4 A;  4WUY A;  2Q7F A;  4HOR A;  2LO6 A;  2I1J A;  2X6F A;  4TRQ A;  3WXX A;  4F53 A;  3VLE A;  4B8C B;  2E0I A;  4UWK A;  3LKU A;  3ML8 A;  2WMN A;  2EQX A;  3IBE A;  3MX3 A;  4J8D A;  2LAH A;  2YNQ A;  4H7Y A;  3ZGQ A;  4PS7 A;  4AJW A;  4GPK A;  2V8S E;  3JUI A;  3S7B A;  2AXU A;  3D9K A;  4CT4 A;  5JHA A;  4WNG A;  2GRM A;  4URK A;  4L23 A;  4GZ3 A;  3QJZ A;  4WWP A;  5J08 A;  1UN8 A;  4I43 A;  2KZT A;  3RRU A;  3U4T A;  1ZBP A;  3S2A A;  3ZEF A;  4GAA A;  5M72 A;  1N54 A;  3LVQ E;  5FTP A;  4E6H A;  4RSY A;  4GA1 A;  2MRI A;  2WXL A;  3K9I A;  4Q96 A;  4TUU A;  2J9Q A;  5DIZ A;  3G2T A;  3QAQ A;  5G05 J;  2R17 C;  4EBA A;  2NXP A;  1HS6 A;  4GMJ A;  1HXI A;  4OVV A;  3ZN3 A;  3GZ1 A;  3FUH A;  5CMY A;  3ZIM A;  2RG8 A;  1OWL A;  3QNK A;  3SF4 A;  4B94 A;  3ZRH A;  2R59 A;  4CGV A;  4I17 A;  2GRL A;  2YHC A;  1NA0 A;  4MLP A;  2X38 A;  4L1B A;  2KZT B;  5AEN A;  3QKY A;  4AEZ C;  1EYH A;  4D10 C;  3HIZ A;  4XE0 A;  4F3V A;  2AVP A;  4GCO A;  4G24 A;  1HH8 A;  1E8Z A;  4Y6W A;  1H2T C;  1UW4 B;  4I1M A;  3BG1 B;  4KYO B;  5KCM A;  4C0M A;  2V5F A;  4J0U A;  3G2W A;  4NAC A;  4LER A;  4UWH A;  3QAR A;  4R7L A;  5FZR A;  3G2V A;  4ILH B;  2AW6 A;  2FI7 A;  5FQ8 A;  3U64 A;  4DK5 A;  2IJG X;  3APF A;  2CG3 A;  2XCC A;  2X6J A;  2BF0 X;  3O4Z A;  3QWP A;  5D0O D;  3T8M A;  3LY8 A;  2XGM A;  3N71 A;  4KBQ A;  4ILI A;  4HLE A;  2XRZ A;  1Y8M A;  1FCH A;  2I2O A;  2PZI A;  3T5X A;  3MKR A;  4IUL A;  4U0S A;  2Y4T A;  4PS8 A;  3CR3 A;  4Q69 A;  5CCL A;  2KCL A;  2GGF A;  3MV3 B;  5ANL A;  3UT8 A;  2OV8 A;  3CK9 A;  4I9C A;  4N2S A;  5T3R A;  2I1K A;  4NQ0 A;  1W3B A;  2HO1 A;  1Z6T A;  3FTY A;  4XI0 A;  3HVE A;  5KJN A;  5LX8 A;  1EPU A;  3L54 A;  2X6K A;  4FA6 A;  3ZYL A;  1E8X A;  1SQM A;  4JC8 A;  4AIF A;  2VQ2 A;  5EKQ D;  1E7V A;  1PC2 A;  3SI5 A;  3OTN A;  3L22 A;  4J8E A;  2XCB A;  3I4G A;  3D3M A;  1EDU A;  1HFA A;  1X5B A;  3L17 A;  3CLJ A;  4UQZ A;  3ZYM A;  4K0R A;  2NC9 A;  4DI3 A;  3LJ3 A;  3FUL A;  4FJY A;  4JPS A;  4BTB A;  3D9M A;  2WXF A;  3U9W A;  3KD7 A;  3SNX A;  4EZL A;  5HQ8 A;  2CFZ A;  4JZY A;  2CHW A;  3HVE B;  3CIA A;  1XNF A;  1KT1 A;  3FH7 A;  3QDN A;  2KM4 A;  3FUD A;  2VGX A;  1IQU A;  3SBS A;  2ZU6 B;  2WXK A;  2V4L A;  4XIF A;  4JHJ A;  4XKB A;  4OYS A;  2Y3A A;  5ARF A;  5G05 C;  5T4Y A;  3RO3 A;  4AVX A;  4HVB A;  3SBT B;  2PQN A;  4WAF A;  5EX3 A;  2WQ7 A;  3FP3 A;  4B8A A;  5CMW A;  3CVV A;  3CHR A;  2IF4 A;  4NRH B;  3OXF A;  4FJZ A;  3LXU X;  4HFG A;  4UI9 K;  3FDH A;  4AP2 A;  4WND A;  2VSX E;  5JHB A;  4YVQ C;  1P5Q A;  2OVF A;  5FZQ A;  4WNE A;  2VGX B;  3DBS A;  2DCP A;  5D0Q D;  5E75 A;  3EIJ A;  5G04 J;  1HG5 A;  3CHO A;  3ZYK A;  4AY5 A;  1TJF A;  4B0Z A;  2A5U A;  3QOU A;  3P1U A;  4KZC A;  3VLD A;  3CHS A;  3ESL A;  3MV2 B;  4BFR A;  4APF A;  1E90 A;  1U3C A;  4AOF A;  4AY6 A;  3FTZ A;  3QK0 A;  3GZ2 A;  4RG9 A;  4P29 A;  4KT6 B;  3S7D A;  3P2B A;  2DIW A;  4C0E A;  5JJT A;  3CVU A;  3FTX A;  5AJD A;  4GZD A;  4QFV A;  5CHE E;  3ASF A;  4KZ0 A;  4M3O A;  5G2N A;  3TXM A;  3UUX A;  3FTU A;  3ONK A;  4HS2 A;  4GU5 A;  4IRU A;  2X6H A;  4GYW A;  3TXN A;  4I9E A;  2L9B A;  3B7T A;  4A3V A;  4JEH A;  1E7U A;  2PM6 A;  3CVX A;  3ASH A;  2PQR A;  2X6I A;  2FEZ A;  2I6H A;  2WPV A;  3ONL A;  2XGS A;  3U3W A;  5FWQ A;  1OWO A;  2YHE A;  2AWI A;  3PRE A;  3LY9 A;  4ANW A;  1HO8 A;  2LSU A;  3CVP A;  3FU6 A;  4G2V A;  1H2U A;  4A55 A;  1PY1 A;  4CCA A;  5AIJ A;  3FWV A;  1E96 B;  1TEZ A;  3MZL B;  3RU0 A;  3CVW A;  4MKT A;  3UMV A;  2MHK A;  2CG2 A;  1ZU2 A;  4BTA A;  4U07 A;  1YA0 A;  1OUV A;  4UQY A;  3CK7 A;  1JPL A;  2DBA A;  4I6G A;  3I4R B;  3AU4 A;  1S0P A;  5G55 A;  1NZN A;  1HE8 A;  4ACK A;  5A6C A;  4GZ5 A;  4GB9 A;  4RG6 A;  1LF8 A;  1DNP A;  2XPI A;  4GYY A;  5LCW J;  2QY7 A;  4KVO A;  4UQX A;  3RKV A;  3TG5 A;  3ZPJ A;  4UWG A;  2KCK A;  4FP7 A;  5DBK A;  4ACL A;  1NA3 A;  4DI4 A;  3TG4 A;  3MJW A;  3ZFW A;  5KJL A;  1INZ A;  5LP0 A;  3MEK A;  4GZC A;  3ASG A;  2L6J A;  2WXO A;  3ENE A;  3I3N A;  3HDX A;  4XI9 A;  4CT0 A;  4N3B A;  1GW6 A;  1H19 A;  4BX8 A;  5EDS A;  3FTW A;  4L2L A;  3JQ1 A;  2UWJ G;  3CHQ A;  4LUN U;  4L2Y A;  3R7R A;  5G04 C;  2CHX A;  5BT1 A;  5JJ7 A;  2WXM A;  1Z3Y A;  2HYZ A;  3O48 A;  3D9P A;  3PE3 A;  4FHK A;  4HXI A;  4ILG A;  2WXG A;  4GZ6 A;  3IKO B;  4AV7 A;  3IV0 A;  4YND A;  2KCV A;  3CVN A;  2XPZ A;  3UT7 A;  4LCT A;  1E8Y A;  5T8I A;  2IOS A;  4FHJ A;  4EZK A;  4CEM A;  1E8W A;  3CKB A;  3CQG B;  3EHM A;  4W9R A;  4EBA G;  1ELK A;  3CHP A;  1JWF A;  3D9I A;  3FUI A;  3GZS A;  1QQE A;  2IFU A;  2KC7 A;  2WXN A;  3CVL A;  4AM9 A;  2C0L A;  3VTY A;  1MQS A;  5EX0 A;  2CFU A;  2BUG A;  2FO7 A;  3OXG A;  3SZ7 A;  4ANX A;  5FQ4 A;  3EJN A;  4N5C A;  2FBN A;  3ZYQ A;  4DJA A;  4RVB A;  4DPR A;  2IQC A;  3RRN B;  3T5V A;  3VLF A;  2J09 A;  3L08 A;  5LOZ A;  4BWR A;  2J4B A;  4UWF A;  3CGH A;  4ANU A;  3PNL B;  3LDZ A;  3LPZ A;  4JA7 A;  3FH8 A;  2AXV A;  2WXP A;  2QFC A;  2R5S A;  3ESK A;  3D9O A;  2VSY A;  2RD0 A;  1H0A A;  1BPO A;  2YQ8 A;  5A7D B;  2Y4U A;  1JUQ A;  1WY6 A;  4JW1 A;  2C2L A;  2VJ8 A;  1SZA A;  3LS8 A;  2VTB A;  2WXI A;  5FJY A;  3HYM B;  3PH0 C;  2C0M A;  4UI9 J;  3RO2 A;  3BEE A;  1KT0 A;  2IU1 A;  2J07 A;  3FEX A;  2ION A;  5BV0 A;  4BSX A;  5KJK A;  3TL5 A;  2XPY A;  3ML9 A;  2WB2 A;  5JJ6 A;  3PEU B;  4WWN A;  4G25 A;  4MRU A;  3EIQ C;  2PM7 A;  2ILR A;  4KXK B;  3JYS A;  3L16 A;  4AXH A;  1ELW A;  3MCX A;  5C2Y A;  4CDN A;  2VTB B;  3QWV A;  3ZW3 A;  4JHK A;  1Y6I A;  1WM5 A;  4U63 A;  1UG3 A;  3D9J A;  3NZU A;  5FQ6 A;  1MHQ A;  4DLO A;  2FUL A;  3CVQ A;  1DVP A;  2WXH A;  4G23 A;  4J6I A;  3NF1 A;  1OWM A;  4KMO A;  4LEU A;  3MGB A;  3NQP A;  3LEW A;  5AYW D;  2L0T B;  3DPD A;  4FAD A;  3FUM A;  1WAO 1;  4FC8 A;  4APO A;  2GW1 A;  3FH5 A;  4I2W A;  5KJM A;  1EF1 C;  4BT9 A;  3CSF A;  2VGY A;  4CRW A;  3PS6 A;  1QZ2 A;  4JEU A;  2KAT A;  3LCA A;  1FVH A;  2JEK A;  4G1T A;  3NZS A;  3KS2 A;  4WWO A;  2L0I A;  2YIN A;  3QB2 A;  2PL2 A;  4TV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...