1G3NB

Structure of a p18(ink4c)-cdk6-k-cyclin ternary complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
155
structure length
155
Chain Sequence
GNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYCLIN-DEPENDENT KINASE 6
publication title Structural basis of inhibition of CDK-cyclin complexes by INK4 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle, signaling protein
total genus 52
structure length 155
sequence length 155
chains with identical sequence F
ec nomenclature
pdb deposition date 2000-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13857 Ank_5 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 1g3nB00
2V4HC 3KEAA 5CBOA 5EYLA 4HI9A 3TWWA 5EN5D 3TWVA 4K5BA 1DC2A 4U8YD 1WG0A 3TWXA 2L6BA 4ZFHA 1N11A 5KNGA 5EIDA 3T8KA 3W9FA 4ATZD 4B93B 4HBDA 2DWZA 1BI7B 1WDYA 5AQBA 2XZDG 2F8XK 3DEPA 4QQIA 4OAVB 4DUIA 4O1PA 5CEDB 5KNHD 4RLYA 5AARA 2VGEA 2DZNA 5AQAA 3B7BA 2DZOA 3NOCD 3ZKJA 5ENOD 1MJ0A 4BETA 1IHBA 3V79K 4GPMA 4HRLA 1N0RA 3B95A 4LNUD 5CEAA 1SVXA 3W9GA 1IKND 1S70B 4Z68A 5CECB 3NBNB 3ZNGA 4A63B 3JXIA 2ETAA 5FIOA 1SW6A 3V2XA 2P2CP 4BERA 4DX5D 4HRNA 4K5AB 3TWQA 1BD8A 3LJNA 3EHQA 3TWRA 3SO8A 1A5EA 2XZTG 4G8KA 5AN8A 4DX2A 4ZHBA 4O1OA 4K5CA 1G3NB 5ENSD 5ITZF 1OT8A 2PNNA 2B0OE 2ETCA 4HLLA 2A5EA 5EIBE 4N5QA 5HKPA 5D66A 4HNAD 5AQ9A 4DX6D 3UTMA 1UOHA 3TWTA 1K1BA 5HRYA 3T9KA 3ZU7B 5ENRD 1YCSB 1YMPA 2XEEA 2Y1LE 2ZGDA 4BSZB 1K3ZD 3C5RA 4F6RD 1AWCB 3D9HA 4O60A 3Q9NC 4BEPA 1NFIE 3UXGA 5AAOA 2FO1E 5KWDA 3AJIA 4HQDA 1BI8B 1K1AA 4DX7D 3Q9UC 4U96D 5CBNA 3IXEA 2ETBA 3EU9A 5JMND 5BXOA 3HRAA 4JB8P 4YDYA 1MX4A 3JUEA 3V31A 5CERB 2DVWA 1QYMA 3J5QB 4BESA 4TUMA 4GMRA 5HS0A 1D9SA 1BLXB 4G8LA 2BKGA 3EHRA 4HRMB 5AQ7A 4UUCA 5ENQD 5BXUA 4LSZE 4DX1A 3AAAC 2BKKB 3TWUA 4C48B 2MYOA 2ZGGA 4NIKA 2F37A 3DEOA 3TWSA 5FINA 2J8SD 4LG6A 2JABA 3NOGD 2QYJA 2XEHA 4U8VD 2RFMA 4U95D 4J8YA 1MYOA 1TR4A 2F8YA 4YDWA 3V2OA 3F6QA 4CZ2D 1YYHA 1OY3D 5JA4D 5ENTD 2NYJA 2XENA 1MX2A 1MX6A 3J5PA 4HI8A 2AJAA 2KBXA 3ZUVB 4QFVA 5ENPD 5EILA 2KXPC 2QC9A 2V5QC 5EYPF 3HG0D 4HB5A 2RFAA 3UI2A 1N0QA 2Y0BG 2HE0A 1DCQA 1IXVA 1AP7A 3JXJA 5KBAA 1BU9A 4DRXE 4F1PA 3V30A 4CYMD 4J7WA 4OAUC
chains in the Genus database with same CATH superfamily
3FEYA 4GZCA 3NF1A 2X38A 1N4QA 2JLBA 2F8XK 3D9JA 3LVQE 3QWPA 4GMLA 2GW1A 3CKCA 3RJVA 4XEIG 3EU5A 5KNHD 3QARA 2I1KA 4IYPA 2DZOA 4N5CA 3FU6A 4R7LA 4KBQA 2AXVA 4Z68A 2X6FA 3ASOE 4JC8A 2RD0A 4RVBA 4Y6CA 3C72A 2X6KA 4K5CA 3BEEA 2ETCA 4FA6A 1JWGA 4JA7A 1TNZA 4HNAD 5E76A 1UJJA 3TWTA 1ZBPA 3FUIA 1K3ZD 3R7RA 4ILHB 1H0AA 4BEPA 4CGWA 4B8AA 1OWLA 3T8MA 3CHOA 5CBNA 2FI7A 4HORA 5JMND 1DCEA 4GTPA 5ANLA 3U66A 1S63A 2GRNB 3D9NA 4F3VA 4K0RA 3SY2A 2X6JA 2QYJA 2VYIA 4J8EA 5LOZA 1TNYA 3PZDA 4RG9A 2P9PG 4TRQA 5G2NA 4WWPA 4HI8A 3C3OA 2KXPC 3S7FA 2HO1A 2HE0A 3ZHEB 3B7SA 1UN8A 3L22A 2XGMA 1P5QA 5FZSA 2MRIA 2F0YA 2OEVA 3FEXA 1TN8A 4GPKA 4AP2A 3RRUA 3E4BA 4QQIA 3AG2E 5AARA 4LNGA 3NAWA 3IBEA 1HF8A 3FTZA 2GRMA 2VSNA 3BG0B 5FIOA 3AS8A 4K5AB 2R05A 3LPZA 3UKUG 3TWRA 4XZ4A 1E90A 4ZHBA 2ZISA 4GCNA 2WMOA 2PL2A 5BW8C 1JUQA 2EILE 2J08A 2KC7A 1AWCB 3EIJA 1WY6A 3AG3E 4HQDA 2I9CA 2WXHA 2C0LA 2WXIA 2WXKA 4H7XA 5FT9A 4FU3A 5KJKA 2A4ZA 4UWGA 4NURA 1BLXB 2BKKB 2OVBA 1YA0A 4ATGA 5FINA 3NOGD 5JHBA 4U95D 2J07A 3SQVA 1Z3YA 3JUIA 3Q7AA 3CGHA 4KVMA 4L9PA 4MRUA 3OAWA 3ZIMA 1IXVA 1BU9A 3G2TA 2WXRA 3MA5A 4JL0A 2HM8A 3OXFA 4FC8A 3DSVA 4ATZD 4AJWA 5BNWA 3ESKA 4HOUA 3FUFA 3ASHA 4JVSA 4BETA 4FADA 2HYZA 3NBNB 4A63B 3SHFA 1SW6A 2WQHA 4HRNA 4DLQA 4U04A 2CHWA 4J8DA 4G26A 2Y3AA 1U3DA 1HG2A 1LF8A 3PZ1A 2P58C 1UOHA 1N95A 3D9HA 4YVOA 2FO7A 1N54A 1HZ4A 2OOEA 5FQ4A 4AY6A 3LJ3A 2J9QA 1HE8A 1PC2A 1HU3A 4I6JA 5KJMA 3J5QB 2E0IA 2J09A 3CSFA 4JEHA 2AXZA 2IO3C 4RSYA 1NP7A 1MX6A 2Y69E 3EIQC 4WWNA 4YDEA 2KCLA 1FVFA 2Y0BG 3PE4A 3AG1E 3JXJA 4CYMD 3E34A 4OAUC 1VDYA 2V4HC 5EYLA 3UMVA 3ESLA 4UI9C 4TUUA 4B93B 1UG3A 3MX3A 4GTRA 2XRZA 1KZOA 3BQOA 4LNUD 3UUXA 1IKND 1S70B 2XS1A 4URKA 2ETAA 1JPLA 3I4RB 3T5VA 3QWWA 1RZ4A 3AG4E 1L5JA 4IN3B 3EJNA 3TWQA 3LJNA 3NZSA 2ZXWE 1G3NB 3FH7A 3MJWA 4I1AA 4JZYA 1LD8A 4FLBA 3APDA 5D66A 4EHMA 3UTMA 5D2MC 4U7EB 1QBQA 4AOFA 4GTMA 1IHGA 1Q2ZA 5ENNA 4GZ6A 5BXOA 4JB8P 1PAQA 4JHKA 2DCPA 2VGXB 3O4ZA 2WXJA 2VSXE 3SF4A 3BU8A 3L54A 3MCXA 1MYOA 1OY3D 3ULYA 4DI3A 2NYJA 2X6HA 3J5PA 1D8EA 3LKUA 1SZ9A 3OTNA 3FUMA 2ILRA 4JPSA 4L1BA 1N4SA 1TYQG 5JHAA 3HXDA 3TWWA 5AJLA 2CHXA 5AQBA 4O1PA 5G05J 3CVYA 1IHBA 4A55A 4M3OA 1N0RA 1KT0A 3RIBA 3ZFWA 4EZLA 2NC9A 2WXGA 1E7UA 1BD8A 3L13A 2DIWA 2J4DA 3ASNE 3HHMA 1OT8A 3DRAA 3FP3A 2BTDA 1NL4A 1O5MA 4N39A 1Z3XA 4PDXA 4U0UA 2XEEA 1FT1A 4XI0A 2KM4A 4ME2A 4W9RA 4GA0A 1K1AA 4CDNA 5C1DA 5EX0A 5EX3A 3KSQA 1HO8A 1V55E 4DX1A 3GZSA 3BUAA 3QKYA 1E8XA 4NIKA 3UINC 3TXNA 1OWPA 2XQ0A 4L23A 2J8SD 3JCKC 3C3QA 1TR4A 5CCMA 1ZU2A 1ZB1A 3R7QA 1YYHA 2CFUA 1MX2A 1XNFA 4EZKA 2AJAA 2KBXA 1OCZE 4O6FA 3X2QE 3IV0A 4GTOA 5B1AE 1H2TC 2CG3A 3FUEA 5C2YA 3UPVA 1D9SA 4ACKA 2DBAA 4ANVA 3IKOB 4HI9A 1QNFA 2B6CA 3KEZA 3D9PA 5B1BE 3IHVA 5T3RA 2WQ7A 4F53A 3E32A 3KD7A 3DXKG 4BTBA 2VGEA 4MKTA 1PY1A 1OWNA 1KPSB 1OCRE 5CEAA 1SVXA 3LS8A 3CIAA 4FHKA 3JXIA 2LSVA 3AU4A 4HVBA 4EPZA 2IU1A 4HS2A 2IY0C 4BWRA 1OCCE 1SZAA 1Y8MA 4LEUA 4BX8A 3DSSA 3SNXA 2BEDA 3T9KA 2L9BA 3FULA 3Q9NC 3S7BA 3UXGA 4KT6B 5KWDA 3B13A 3B7UX 4I2ZA 2EIKE 3Q9UC 3VLFA 3FTSA 4HOSA 3HRAA 4YDYA 4ACLA 2DVWA 2BKGA 2GROB 5ENQD 2WXFA 5AIJA 3DEOA 3FWVA 3BG1B 4LG6A 2YNQA 4FULA 2IOLA 3TAXA 3QNKA 3SD5A 3ZUVB 3CVXA 4G24A 1IYGA 3O48A 2QFCA 2RFAA 2WXLA 4E6HA 3GZ1A 2XCCA 4CT4A 2PQNA 5HQ8A 1EF1C 3CLJA 5LX8A 4ZFHA 3E37A 4FLHA 2OV8A 3PS6A 4ABNA 4RLYA 5G05C 4N3AA 2P9SG 3B7BA 2Y4UA 1E8ZA 2YQ8A 5CRUA 3QC1A 1FVHA 4YVQC 4U0ZA 2ZIRA 1U2VG 4BERA 2P2CP 3LY8A 4WUYA 3SO8A 2DYRE 4NRHB 1S0PA 5ENSD 2LAHA 5LP0A 3ZPJA 3MKQA 4KVOA 3B7RL 3HXFA 4PS7A 5IY5E 3RRNB 4B94A 3S7DA 3HXEA 3PVLA 5BUZA 2XGOA 3PE3A 4UWKA 3ZYQA 4N3CA 2XHEA 2VGYA 3ABKE 4GZDA 1H6OA 5LFAA 1MZCA 4IRUA 3DPYA 2IEJA 4G8LA 1E8YA 3FTUA 2LUHA 3RSEG 3AAAC 2VTBA 3HVEB 3FTXA 2R5SA 2KZTA 2OEWA 3QOUA 3E33A 3MGBA 3ZXSA 3PUJA 3CQGB 3DSWA 3L6AA 3MYVA 3HXBA 1JCRA 3HDXA 3URZA 4ILIA 3L82A 4GYWA 2AVPA 4GCOA 4LUNU 3Q79A 1U3CA 3D3MA 3T8KA 4GU5A 4JA9A 2XZDG 3DEPA 1DVPA 2R17C 2NXPA 3MZLB 4C0EA 4AY5A 3V79K 3ZKJA 2KCKA 4B0ZA 3ZVVA 2UY1B 3V2XA 3E30A 3ML9A 3CKBA 4RG6A 3LXUX 3IEGA 5ITZF 3DBSA 4TV3A 2AXUA 3LY9A 5HKPA 3G2VA 3QJZA 3HIZA 1HS6A 2Y1LE 4ILGA 1RW2A 2H6FA 3FTVA 3ML8A 1NFIE 5T4YA 3UM2A 3APCA 4P29A 4V3IA 2FEZA 4L2YA 3G2SA 3CVWA 2E2EA 5T8IA 1TEZA 2OVFA 3LEWA 3WXXA 4NACA 1Z6TA 1EYHA 4J8YA 2F8YA 4I43A 5ENTD 4TXQA 1H6KA 3ONKA 2XPYA 3ULQA 1H6PA 4U0SA 1O1TA 3FFLA 2QC9A 1D8DA 2V5QC 1TJCA 3RU0A 1OWMA 2Y4TA 3PRZA 3KEAA 4GYYA 3PZ3A 3S7JA 3FUNA 4G11A 2LO6A 4U8YD 2P9NG 3TWXA 2L0IA 3G2WA 5EIDA 4BTAA 2DWZA 4AM9A 3DPDA 3FH5A 4L7TA 4J6IA 3ZHEA 3L16A 1IQRA 2PZIA 4KYOB 2CG2A 4Y6WA 5FJYA 4BY6A 3QDNA 3RRMB 3ZNGA 4ANWA 1BPOA 4I17A 3JYSA 4DX5D 3EHQA 1IQUA 3CHPA 4O1OA 3PH0C 1B89A 3EHNA 3GZ2A 4CRWA 4DX6D 1TN6A 4F6RD 2JEKA 4O60A 4Q96A 2WXMA 3Q75A 2VSOE 4WNEA 1BI8B 2IJGX 3UIPC 3TG5A 3IXEA 5FQ6A 3DSTA 3V31A 3ENEA 1QYMA 2LSUA 4TUMA 5HS0A 1OWOA 2MYOA 3ZW3A 3P1UA 3U4TA 4X8QA 4U8VD 2RFMA 4ANXA 4YDWA 3U64A 3L17A 5JA4D 4B89A 3AU5A 2QZAA 4UWLA 3FHEA 4N2QA 5M72A 4AVXA 1E96B 1KT1A 4BT8A 1NA0A 4MLPA 5KBAA 4I6EA 4J7WA 4UWHA 3QWVA 1JCSA 4GTSA 4K5BA 1ELKA 3LCAA 4CDRA 1H19A 3UQ3A 1WDYA 5D0QD 4EZJA 1MQSA 3Q47B 4KZ0A 3UT7A 4PUCA 5CECB 1A17A 2P9UG 1A5EA 2NSZA 4DX2A 3HYMB 5AQ9A 3UX4A 2YHEA 1K1BA 5ENRD 4DLOA 3Q78A 4IULA 3FU5A 5KJNA 2FO1E 4AEZC 5ANRA 4XKCA 4JHJA 3UM3A 2YINA 4BESA 1SA5A 4GMRA 4LSZE 4L2LA 3NZUA 2P9IG 4F1SA 3RKVA 3I5PA 3FTWA 5FZRA 2CFZA 5CCLA 3DWLG 2H6GA 1KZPA 2PM6A 4XI9A 2GRRB 3MEKA 1W3BA 4JW1A 4U07A 5ARFA 2FBNA 4PS3A 5EN5D 4XE0A 4LRZA 2L6BA 2C0MA 4WWOA 4A1SA 4DUIA 3QB2A 2RG8A 2DZNA 2RKKA 1OXJA 3CHSA 4HRLA 2IOSA 3CV0A 5ARGA 1Z5SC 3PREA 3S2AA 5A7DB 2HR2A 2DYSE 3D9LA 3UIOC 1NA3A 4UI9K 4HLLA 4HOTA 4HOQA 1WM5A 2KCVA 5JJTA 2V0PA 4BT9A 4J0UA 4DX7D 1TN7A 5A23A 5BPPA 1K8KG 1HH8A 2LNIA 5FWQA 3KAEA 3FDHA 4E85A 3FUJA 3DXMG 2EQXA 2LXMA 5CMWA 3U9WA 3VTXA 4BFRA 2R2LA 3QAQA 4CGVA 2VGXA 4Q94A 2CHZA 4CCAA 3PZ2A 3PDNA 5ENPD 5EILA 5A6CA 3VTYA 1EPUA 3HG0D 1N0QA 4NQ0A 2V5FA 3SI5A 3LDZA 3TG4A 5EKQD 4WAFA 3CVLA 3TWVA 1E7VA 2EIME 3Q5MA 5CRVA 1EDUA 5FQ7A 3JQ0A 3Q73A 3R9MA 2GRPB 5AQAA 4XKBA 4GTTA 4GPMA 2WVIA 3W9GA 4CDMA 1N4PA 1H2UA 3C3RA 4A3TA 4D10C 5EIBE 2R02A 4N5QA 3KSLA 3LYAA 4XIFA 4JXTA 1X5BA 2IFUA 1TJFA 2R59A 2GGFA 3AJIA 2EIJE 2AWIA 2WMNA 4FJYA 2FULA 3KS2A 4U96D 4OVUA 4OYSA 3UM1A 3ABME 1ELWA 5CERB 2WXQA 5FQ8A 5AQ7A 4LERA 4JD2G 2ZU6B 3CEQA 5DIZA 3UT8A 4CT0A 1Y6IA 3FUKA 3VLDA 3PZ4A 4I9CA 4G2VA 2WXOA 4LCTA 4I1MA 3RO2A 4BSXA 5BV1A 4UI9J 5BV0A 5AYWD 3D9MA 4QFVA 1HX8A 1ELRA 3CSTA 1GW6A 4HB5A 2M63A 4GTVA 4GZ3A 3DSUA 1JCQA 4A1GA 5CBOA 4EQFA 3MKRA 1INZA 1FT2A 1DC2A 3QK0A 1WG0A 4A3VA 5KNGA 3W9FA 1BI7B 1SQMA 1UJKA 4OAVB 4KMOA 4FJZA 3NOCD 1MJ0A 2XPZA 5LCWJ 2IQCA 5J90A 3D9OA 2R03A 3R9AB 1HXIA 2MOWA 2VJ8A 1N9AA 4G8KA 3ZRHA 1TNBA 2PNNA 3AS5A 4FP7A 2AW6A 2QY7A 1QZ2A 3ASGA 4GZ5A 3LY7A 2GRQB 3Q7FA 3ZU7B 3PNTB 5CHEE 1FPPA 5J08A 3CK8A 4GYOA 3ISMC 2BF0X 3FU3A 5KCMA 4YNDA 2ETBA 3CK7A 4YDOA 3JUEA 3CHQA 2UWJG 3EHRA 4WNFA 1OUVA 4GA1A 4BX9A 4B8CB 3TWUA 3D9IA 3TL5A 3FH8A 3UM0A 2I6HA 3TWSA 2JABA 3FUDA 1DNPA 4G1TA 2IF4A 3RO3A 3F6QA 4CZ2D 1H2VC 4LNBA 4HFGA 4UWFA 2J4BA 2FF4A 3EUVA 3G2UA 4PH4B 3UI2A 3HXCA 5EDSA 1DCQA 1UW4B 2XPIA 1NZNA 2WQ6A 3ASDA 3V30A 1TNUA 3ZYKA 2P9LG 3Q4AB 4N3BA 1N11A 4KXKB 4HBDA 4Q69A 4EECA 5BT1A 3VLEA 3T5XA 5ENOD 3B95A 3SFXA 3ZN3A 4H7YA 1FCHA 2LXLA 3FTYA 3C98A 4UQXA 2V8SE 2XZTG 5G04J 4UQYA 5AN8A 4HLEA 2EINE 5AENA 2BUGA 2A5EA 4PS8A 2XCBA 1X81A 2ZGDA 3GYZA 4BSZB 5AAOA 4APFA 4MS6A 3PEUB 4KZCA 4AIFA 5B3SE 4ANUA 4N2SA 3FUHA 3JQ1A 4G25A 4GAAA 4HRMB 5BXUA 2ZGGA 3ABLE 4K03A 3CVQA 2XRYA 2XEHA 3TJPA 4GA2A 3ONLA 3OXLA 3IHYA 4G23A 1HG5A 3SFZA 4RQIA 2PM7A 3FY4A 4GB9A 4OVVA 1N52A 3HVEA 4U63A 4MBGA 1AP7A 2WPVA 4I9EA 2MHKA 4F1PA 1LD7A 1WAO1 3ZYLA 1SA4A 3ASFA 1N94A 2C2LA 4M7CA 3EDTB 5E75A 2I1JA 2YHCA 2WB2A 5LCWC 3N71A 4GTQA 3SBTB 2L6JA 5KJLA 5DBKA 4XX5A 3CQCB 3TXMA 5G55A 4C0MA 3L08A 3D9KA 5JJ7A 3DSXA 3SZ7A 2B0OE 3CVPA 3NB2A 3CR3A 5HRYA 4CEMA 1YMPA 2UY1A 2ONDA 2XGSA 1HFAA 1LTXA 4I6GA 1OCOE 3P2BA 2WXNA 2WM9A 3CHRA 3OXGA 3NQPA 4DPRA 3PEVB 3I3NA 1MX4A 1V54E 3FU0A 5FTPA 4C48B 5H7PA 2F37A 3K9IA 4J8FA 1QQEA 3GW4A 3EHMA 3L9TA 4GMJA 2H6IA 3CVVA 3B7TA 5CMYA 3TGOA 2P9KG 1TNOA 4TXPA 3PUKA 5JJ6A 4U8HA 2OCCE 2I2OA 3I4GA 3Q49B 3CVNA 2XS8A 1KLXA 3SGHA 4EBAA 3ZGQA 2VQ2A 4AV7A 2Q7FA 3SFYA 2H6HA 5CEDB 3CHMA 3MKQB 1O1SA 3AS4A 4TXRA 3UKRG 4JEUA 4F7AA 4I1OB 4DJAA 3Q15A 5D0OD 1XGWA 4J8SA 5G04C 3ZEFA 3RAUA 4APOA 2IONA 1JWFA 3PNLB 4DK5A 4I2WA 1YCSB 3MV2B 3C5RA 2V4LA 2VTBB 1E8WA 2IO2C 2J49A 2X6IA 2A5UA 3UT4A 2KZTB 3CK9A 3MV3B 2PQRA 3EU9A 2KATA 2VSYA 2QYUA 4DI4A 1NI1A 3CVUA 4AXHA 2X3MA 3RK6A 4UUCA 1S64A 5FZQA 3ULEG 3ZYMA 1MHQA 2GRLA 4UQZA 1N4RA 3U3WA 4C9BB 4FHJA 4WNDA 3WG7E 3V2OA 4JHRA 5AJDA 2XENA 1UN9A 4WNGA 2WXPA 3APFA 5EYPF 4HXIA 4EBAG 1O1RA 2L0TB 5HI7A 4DRXE 2LAIA 3SBSA 2XEVA 3LVRE 3ZXPA
chains in the Genus database with same CATH topology
2V4HC 3KEAA 5CBOA 5EYLA 4HI9A 3TWWA 5EN5D 3TWVA 4K5BA 1DC2A 4U8YD 1WG0A 3TWXA 2L6BA 4ZFHA 1N11A 5KNGA 5EIDA 3T8KA 3W9FA 4ATZD 4B93B 4HBDA 2DWZA 1BI7B 1WDYA 5AQBA 2XZDG 2F8XK 3DEPA 4QQIA 4OAVB 4DUIA 4O1PA 5CEDB 5KNHD 4RLYA 5AARA 2VGEA 2DZNA 5AQAA 3B7BA 2DZOA 3NOCD 3ZKJA 5ENOD 1MJ0A 4BETA 1IHBA 3V79K 4GPMA 4HRLA 1N0RA 3B95A 4LNUD 5CEAA 1SVXA 3W9GA 1IKND 1S70B 4Z68A 5CECB 3NBNB 3ZNGA 4A63B 3JXIA 2ETAA 5FIOA 1SW6A 3V2XA 2P2CP 4BERA 4DX5D 4HRNA 4K5AB 3TWQA 1BD8A 3LJNA 3EHQA 3TWRA 3SO8A 1A5EA 2XZTG 4G8KA 5AN8A 4DX2A 4ZHBA 4O1OA 4K5CA 1G3NB 5ENSD 5ITZF 1OT8A 2PNNA 2B0OE 2ETCA 4HLLA 2A5EA 5EIBE 4N5QA 5HKPA 5D66A 4HNAD 5AQ9A 4DX6D 3UTMA 1UOHA 3TWTA 1K1BA 5HRYA 3T9KA 3ZU7B 5ENRD 1YCSB 1YMPA 2XEEA 2Y1LE 2ZGDA 4BSZB 1K3ZD 3C5RA 4F6RD 1AWCB 3D9HA 4O60A 3Q9NC 4BEPA 1NFIE 3UXGA 5AAOA 2FO1E 5KWDA 3AJIA 4HQDA 1BI8B 1K1AA 4DX7D 3Q9UC 4U96D 5CBNA 3IXEA 2ETBA 3EU9A 5JMND 5BXOA 3HRAA 4JB8P 4YDYA 1MX4A 3JUEA 3V31A 5CERB 2DVWA 1QYMA 3J5QB 4BESA 4TUMA 4GMRA 5HS0A 1D9SA 1BLXB 4G8LA 2BKGA 3EHRA 4HRMB 5AQ7A 4UUCA 5ENQD 5BXUA 4LSZE 4DX1A 3AAAC 2BKKB 3TWUA 4C48B 2MYOA 2ZGGA 4NIKA 2F37A 3DEOA 3TWSA 5FINA 2J8SD 4LG6A 2JABA 3NOGD 2QYJA 2XEHA 4U8VD 2RFMA 4U95D 4J8YA 1MYOA 1TR4A 2F8YA 4YDWA 3V2OA 3F6QA 4CZ2D 1YYHA 1OY3D 5JA4D 5ENTD 2NYJA 2XENA 1MX2A 1MX6A 3J5PA 4HI8A 2AJAA 2KBXA 3ZUVB 4QFVA 5ENPD 5EILA 2KXPC 2QC9A 2V5QC 5EYPF 3HG0D 4HB5A 2RFAA 3UI2A 1N0QA 2Y0BG 2HE0A 1DCQA 1IXVA 1AP7A 3JXJA 5KBAA 1BU9A 4DRXE 4F1PA 3V30A 4CYMD 4J7WA 4OAUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4H C;  3KEA A;  5CBO A;  5EYL A;  4HI9 A;  3TWW A;  5EN5 D;  3TWV A;  4K5B A;  1DC2 A;  4U8Y D;  1WG0 A;  3TWX A;  2L6B A;  4ZFH A;  1N11 A;  5KNG A;  5EID A;  3T8K A;  3W9F A;  4ATZ D;  4B93 B;  4HBD A;  2DWZ A;  1BI7 B;  1WDY A;  5AQB A;  2XZD G;  2F8X K;  3DEP A;  4QQI A;  4OAV B;  4DUI A;  4O1P A;  5CED B;  5KNH D;  4RLY A;  5AAR A;  2VGE A;  2DZN A;  5AQA A;  3B7B A;  2DZO A;  3NOC D;  3ZKJ A;  5ENO D;  1MJ0 A;  4BET A;  1IHB A;  3V79 K;  4GPM A;  4HRL A;  1N0R A;  3B95 A;  4LNU D;  5CEA A;  1SVX A;  3W9G A;  1IKN D;  1S70 B;  4Z68 A;  5CEC B;  3NBN B;  3ZNG A;  4A63 B;  3JXI A;  2ETA A;  5FIO A;  1SW6 A;  3V2X A;  2P2C P;  4BER A;  4DX5 D;  4HRN A;  4K5A B;  3TWQ A;  1BD8 A;  3LJN A;  3EHQ A;  3TWR A;  3SO8 A;  1A5E A;  2XZT G;  4G8K A;  5AN8 A;  4DX2 A;  4ZHB A;  4O1O A;  4K5C A;  1G3N B;  5ENS D;  5ITZ F;  1OT8 A;  2PNN A;  2B0O E;  2ETC A;  4HLL A;  2A5E A;  5EIB E;  4N5Q A;  5HKP A;  5D66 A;  4HNA D;  5AQ9 A;  4DX6 D;  3UTM A;  1UOH A;  3TWT A;  1K1B A;  5HRY A;  3T9K A;  3ZU7 B;  5ENR D;  1YCS B;  1YMP A;  2XEE A;  2Y1L E;  2ZGD A;  4BSZ B;  1K3Z D;  3C5R A;  4F6R D;  1AWC B;  3D9H A;  4O60 A;  3Q9N C;  4BEP A;  1NFI E;  3UXG A;  5AAO A;  2FO1 E;  5KWD A;  3AJI A;  4HQD A;  1BI8 B;  1K1A A;  4DX7 D;  3Q9U C;  4U96 D;  5CBN A;  3IXE A;  2ETB A;  3EU9 A;  5JMN D;  5BXO A;  3HRA A;  4JB8 P;  4YDY A;  1MX4 A;  3JUE A;  3V31 A;  5CER B;  2DVW A;  1QYM A;  3J5Q B;  4BES A;  4TUM A;  4GMR A;  5HS0 A;  1D9S A;  1BLX B;  4G8L A;  2BKG A;  3EHR A;  4HRM B;  5AQ7 A;  4UUC A;  5ENQ D;  5BXU A;  4LSZ E;  4DX1 A;  3AAA C;  2BKK B;  3TWU A;  4C48 B;  2MYO A;  2ZGG A;  4NIK A;  2F37 A;  3DEO A;  3TWS A;  5FIN A;  2J8S D;  4LG6 A;  2JAB A;  3NOG D;  2QYJ A;  2XEH A;  4U8V D;  2RFM A;  4U95 D;  4J8Y A;  1MYO A;  1TR4 A;  2F8Y A;  4YDW A;  3V2O A;  3F6Q A;  4CZ2 D;  1YYH A;  1OY3 D;  5JA4 D;  5ENT D;  2NYJ A;  2XEN A;  1MX2 A;  1MX6 A;  3J5P A;  4HI8 A;  2AJA A;  2KBX A;  3ZUV B;  4QFV A;  5ENP D;  5EIL A;  2KXP C;  2QC9 A;  2V5Q C;  5EYP F;  3HG0 D;  4HB5 A;  2RFA A;  3UI2 A;  1N0Q A;  2Y0B G;  2HE0 A;  1DCQ A;  1IXV A;  1AP7 A;  3JXJ A;  5KBA A;  1BU9 A;  4DRX E;  4F1P A;  3V30 A;  4CYM D;  4J7W A;  4OAU C; 
#chains in the Genus database with same CATH topology
 3FEY A;  4GZC A;  3NF1 A;  2X38 A;  1N4Q A;  2JLB A;  2F8X K;  3D9J A;  3LVQ E;  3QWP A;  4GML A;  2GW1 A;  3CKC A;  3RJV A;  4XEI G;  3EU5 A;  5KNH D;  3QAR A;  2I1K A;  4IYP A;  2DZO A;  4N5C A;  3FU6 A;  4R7L A;  4KBQ A;  2AXV A;  4Z68 A;  2X6F A;  3ASO E;  4JC8 A;  2RD0 A;  4RVB A;  4Y6C A;  3C72 A;  2X6K A;  4K5C A;  3BEE A;  2ETC A;  4FA6 A;  1JWG A;  4JA7 A;  1TNZ A;  4HNA D;  5E76 A;  1UJJ A;  3TWT A;  1ZBP A;  3FUI A;  1K3Z D;  3R7R A;  4ILH B;  1H0A A;  4BEP A;  4CGW A;  4B8A A;  1OWL A;  3T8M A;  3CHO A;  5CBN A;  2FI7 A;  4HOR A;  5JMN D;  1DCE A;  4GTP A;  5ANL A;  3U66 A;  1S63 A;  2GRN B;  3D9N A;  4F3V A;  4K0R A;  3SY2 A;  2X6J A;  2QYJ A;  2VYI A;  4J8E A;  5LOZ A;  1TNY A;  3PZD A;  4RG9 A;  2P9P G;  4TRQ A;  5G2N A;  4WWP A;  4HI8 A;  3C3O A;  2KXP C;  3S7F A;  2HO1 A;  2HE0 A;  3ZHE B;  3B7S A;  1UN8 A;  3L22 A;  2XGM A;  1P5Q A;  5FZS A;  2MRI A;  2F0Y A;  2OEV A;  3FEX A;  1TN8 A;  4GPK A;  4AP2 A;  3RRU A;  3E4B A;  4QQI A;  3AG2 E;  5AAR A;  4LNG A;  3NAW A;  3IBE A;  1HF8 A;  3FTZ A;  2GRM A;  2VSN A;  3BG0 B;  5FIO A;  3AS8 A;  4K5A B;  2R05 A;  3LPZ A;  3UKU G;  3TWR A;  4XZ4 A;  1E90 A;  4ZHB A;  2ZIS A;  4GCN A;  2WMO A;  2PL2 A;  5BW8 C;  1JUQ A;  2EIL E;  2J08 A;  2KC7 A;  1AWC B;  3EIJ A;  1WY6 A;  3AG3 E;  4HQD A;  2I9C A;  2WXH A;  2C0L A;  2WXI A;  2WXK A;  4H7X A;  5FT9 A;  4FU3 A;  5KJK A;  2A4Z A;  4UWG A;  4NUR A;  1BLX B;  2BKK B;  2OVB A;  1YA0 A;  4ATG A;  5FIN A;  3NOG D;  5JHB A;  4U95 D;  2J07 A;  3SQV A;  1Z3Y A;  3JUI A;  3Q7A A;  3CGH A;  4KVM A;  4L9P A;  4MRU A;  3OAW A;  3ZIM A;  1IXV A;  1BU9 A;  3G2T A;  2WXR A;  3MA5 A;  4JL0 A;  2HM8 A;  3OXF A;  4FC8 A;  3DSV A;  4ATZ D;  4AJW A;  5BNW A;  3ESK A;  4HOU A;  3FUF A;  3ASH A;  4JVS A;  4BET A;  4FAD A;  2HYZ A;  3NBN B;  4A63 B;  3SHF A;  1SW6 A;  2WQH A;  4HRN A;  4DLQ A;  4U04 A;  2CHW A;  4J8D A;  4G26 A;  2Y3A A;  1U3D A;  1HG2 A;  1LF8 A;  3PZ1 A;  2P58 C;  1UOH A;  1N95 A;  3D9H A;  4YVO A;  2FO7 A;  1N54 A;  1HZ4 A;  2OOE A;  5FQ4 A;  4AY6 A;  3LJ3 A;  2J9Q A;  1HE8 A;  1PC2 A;  1HU3 A;  4I6J A;  5KJM A;  3J5Q B;  2E0I A;  2J09 A;  3CSF A;  4JEH A;  2AXZ A;  2IO3 C;  4RSY A;  1NP7 A;  1MX6 A;  2Y69 E;  3EIQ C;  4WWN A;  4YDE A;  2KCL A;  1FVF A;  2Y0B G;  3PE4 A;  3AG1 E;  3JXJ A;  4CYM D;  3E34 A;  4OAU C;  1VDY A;  2V4H C;  5EYL A;  3UMV A;  3ESL A;  4UI9 C;  4TUU A;  4B93 B;  1UG3 A;  3MX3 A;  4GTR A;  2XRZ A;  1KZO A;  3BQO A;  4LNU D;  3UUX A;  1IKN D;  1S70 B;  2XS1 A;  4URK A;  2ETA A;  1JPL A;  3I4R B;  3T5V A;  3QWW A;  1RZ4 A;  3AG4 E;  1L5J A;  4IN3 B;  3EJN A;  3TWQ A;  3LJN A;  3NZS A;  2ZXW E;  1G3N B;  3FH7 A;  3MJW A;  4I1A A;  4JZY A;  1LD8 A;  4FLB A;  3APD A;  5D66 A;  4EHM A;  3UTM A;  5D2M C;  4U7E B;  1QBQ A;  4AOF A;  4GTM A;  1IHG A;  1Q2Z A;  5ENN A;  4GZ6 A;  5BXO A;  4JB8 P;  1PAQ A;  4JHK A;  2DCP A;  2VGX B;  3O4Z A;  2WXJ A;  2VSX E;  3SF4 A;  3BU8 A;  3L54 A;  3MCX A;  1MYO A;  1OY3 D;  3ULY A;  4DI3 A;  2NYJ A;  2X6H A;  3J5P A;  1D8E A;  3LKU A;  1SZ9 A;  3OTN A;  3FUM A;  2ILR A;  4JPS A;  4L1B A;  1N4S A;  1TYQ G;  5JHA A;  3HXD A;  3TWW A;  5AJL A;  2CHX A;  5AQB A;  4O1P A;  5G05 J;  3CVY A;  1IHB A;  4A55 A;  4M3O A;  1N0R A;  1KT0 A;  3RIB A;  3ZFW A;  4EZL A;  2NC9 A;  2WXG A;  1E7U A;  1BD8 A;  3L13 A;  2DIW A;  2J4D A;  3ASN E;  3HHM A;  1OT8 A;  3DRA A;  3FP3 A;  2BTD A;  1NL4 A;  1O5M A;  4N39 A;  1Z3X A;  4PDX A;  4U0U A;  2XEE A;  1FT1 A;  4XI0 A;  2KM4 A;  4ME2 A;  4W9R A;  4GA0 A;  1K1A A;  4CDN A;  5C1D A;  5EX0 A;  5EX3 A;  3KSQ A;  1HO8 A;  1V55 E;  4DX1 A;  3GZS A;  3BUA A;  3QKY A;  1E8X A;  4NIK A;  3UIN C;  3TXN A;  1OWP A;  2XQ0 A;  4L23 A;  2J8S D;  3JCK C;  3C3Q A;  1TR4 A;  5CCM A;  1ZU2 A;  1ZB1 A;  3R7Q A;  1YYH A;  2CFU A;  1MX2 A;  1XNF A;  4EZK A;  2AJA A;  2KBX A;  1OCZ E;  4O6F A;  3X2Q E;  3IV0 A;  4GTO A;  5B1A E;  1H2T C;  2CG3 A;  3FUE A;  5C2Y A;  3UPV A;  1D9S A;  4ACK A;  2DBA A;  4ANV A;  3IKO B;  4HI9 A;  1QNF A;  2B6C A;  3KEZ A;  3D9P A;  5B1B E;  3IHV A;  5T3R A;  2WQ7 A;  4F53 A;  3E32 A;  3KD7 A;  3DXK G;  4BTB A;  2VGE A;  4MKT A;  1PY1 A;  1OWN A;  1KPS B;  1OCR E;  5CEA A;  1SVX A;  3LS8 A;  3CIA A;  4FHK A;  3JXI A;  2LSV A;  3AU4 A;  4HVB A;  4EPZ A;  2IU1 A;  4HS2 A;  2IY0 C;  4BWR A;  1OCC E;  1SZA A;  1Y8M A;  4LEU A;  4BX8 A;  3DSS A;  3SNX A;  2BED A;  3T9K A;  2L9B A;  3FUL A;  3Q9N C;  3S7B A;  3UXG A;  4KT6 B;  5KWD A;  3B13 A;  3B7U X;  4I2Z A;  2EIK E;  3Q9U C;  3VLF A;  3FTS A;  4HOS A;  3HRA A;  4YDY A;  4ACL A;  2DVW A;  2BKG A;  2GRO B;  5ENQ D;  2WXF A;  5AIJ A;  3DEO A;  3FWV A;  3BG1 B;  4LG6 A;  2YNQ A;  4FUL A;  2IOL A;  3TAX A;  3QNK A;  3SD5 A;  3ZUV B;  3CVX A;  4G24 A;  1IYG A;  3O48 A;  2QFC A;  2RFA A;  2WXL A;  4E6H A;  3GZ1 A;  2XCC A;  4CT4 A;  2PQN A;  5HQ8 A;  1EF1 C;  3CLJ A;  5LX8 A;  4ZFH A;  3E37 A;  4FLH A;  2OV8 A;  3PS6 A;  4ABN A;  4RLY A;  5G05 C;  4N3A A;  2P9S G;  3B7B A;  2Y4U A;  1E8Z A;  2YQ8 A;  5CRU A;  3QC1 A;  1FVH A;  4YVQ C;  4U0Z A;  2ZIR A;  1U2V G;  4BER A;  2P2C P;  3LY8 A;  4WUY A;  3SO8 A;  2DYR E;  4NRH B;  1S0P A;  5ENS D;  2LAH A;  5LP0 A;  3ZPJ A;  3MKQ A;  4KVO A;  3B7R L;  3HXF A;  4PS7 A;  5IY5 E;  3RRN B;  4B94 A;  3S7D A;  3HXE A;  3PVL A;  5BUZ A;  2XGO A;  3PE3 A;  4UWK A;  3ZYQ A;  4N3C A;  2XHE A;  2VGY A;  3ABK E;  4GZD A;  1H6O A;  5LFA A;  1MZC A;  4IRU A;  3DPY A;  2IEJ A;  4G8L A;  1E8Y A;  3FTU A;  2LUH A;  3RSE G;  3AAA C;  2VTB A;  3HVE B;  3FTX A;  2R5S A;  2KZT A;  2OEW A;  3QOU A;  3E33 A;  3MGB A;  3ZXS A;  3PUJ A;  3CQG B;  3DSW A;  3L6A A;  3MYV A;  3HXB A;  1JCR A;  3HDX A;  3URZ A;  4ILI A;  3L82 A;  4GYW A;  2AVP A;  4GCO A;  4LUN U;  3Q79 A;  1U3C A;  3D3M A;  3T8K A;  4GU5 A;  4JA9 A;  2XZD G;  3DEP A;  1DVP A;  2R17 C;  2NXP A;  3MZL B;  4C0E A;  4AY5 A;  3V79 K;  3ZKJ A;  2KCK A;  4B0Z A;  3ZVV A;  2UY1 B;  3V2X A;  3E30 A;  3ML9 A;  3CKB A;  4RG6 A;  3LXU X;  3IEG A;  5ITZ F;  3DBS A;  4TV3 A;  2AXU A;  3LY9 A;  5HKP A;  3G2V A;  3QJZ A;  3HIZ A;  1HS6 A;  2Y1L E;  4ILG A;  1RW2 A;  2H6F A;  3FTV A;  3ML8 A;  1NFI E;  5T4Y A;  3UM2 A;  3APC A;  4P29 A;  4V3I A;  2FEZ A;  4L2Y A;  3G2S A;  3CVW A;  2E2E A;  5T8I A;  1TEZ A;  2OVF A;  3LEW A;  3WXX A;  4NAC A;  1Z6T A;  1EYH A;  4J8Y A;  2F8Y A;  4I43 A;  5ENT D;  4TXQ A;  1H6K A;  3ONK A;  2XPY A;  3ULQ A;  1H6P A;  4U0S A;  1O1T A;  3FFL A;  2QC9 A;  1D8D A;  2V5Q C;  1TJC A;  3RU0 A;  1OWM A;  2Y4T A;  3PRZ A;  3KEA A;  4GYY A;  3PZ3 A;  3S7J A;  3FUN A;  4G11 A;  2LO6 A;  4U8Y D;  2P9N G;  3TWX A;  2L0I A;  3G2W A;  5EID A;  4BTA A;  2DWZ A;  4AM9 A;  3DPD A;  3FH5 A;  4L7T A;  4J6I A;  3ZHE A;  3L16 A;  1IQR A;  2PZI A;  4KYO B;  2CG2 A;  4Y6W A;  5FJY A;  4BY6 A;  3QDN A;  3RRM B;  3ZNG A;  4ANW A;  1BPO A;  4I17 A;  3JYS A;  4DX5 D;  3EHQ A;  1IQU A;  3CHP A;  4O1O A;  3PH0 C;  1B89 A;  3EHN A;  3GZ2 A;  4CRW A;  4DX6 D;  1TN6 A;  4F6R D;  2JEK A;  4O60 A;  4Q96 A;  2WXM A;  3Q75 A;  2VSO E;  4WNE A;  1BI8 B;  2IJG X;  3UIP C;  3TG5 A;  3IXE A;  5FQ6 A;  3DST A;  3V31 A;  3ENE A;  1QYM A;  2LSU A;  4TUM A;  5HS0 A;  1OWO A;  2MYO A;  3ZW3 A;  3P1U A;  3U4T A;  4X8Q A;  4U8V D;  2RFM A;  4ANX A;  4YDW A;  3U64 A;  3L17 A;  5JA4 D;  4B89 A;  3AU5 A;  2QZA A;  4UWL A;  3FHE A;  4N2Q A;  5M72 A;  4AVX A;  1E96 B;  1KT1 A;  4BT8 A;  1NA0 A;  4MLP A;  5KBA A;  4I6E A;  4J7W A;  4UWH A;  3QWV A;  1JCS A;  4GTS A;  4K5B A;  1ELK A;  3LCA A;  4CDR A;  1H19 A;  3UQ3 A;  1WDY A;  5D0Q D;  4EZJ A;  1MQS A;  3Q47 B;  4KZ0 A;  3UT7 A;  4PUC A;  5CEC B;  1A17 A;  2P9U G;  1A5E A;  2NSZ A;  4DX2 A;  3HYM B;  5AQ9 A;  3UX4 A;  2YHE A;  1K1B A;  5ENR D;  4DLO A;  3Q78 A;  4IUL A;  3FU5 A;  5KJN A;  2FO1 E;  4AEZ C;  5ANR A;  4XKC A;  4JHJ A;  3UM3 A;  2YIN A;  4BES A;  1SA5 A;  4GMR A;  4LSZ E;  4L2L A;  3NZU A;  2P9I G;  4F1S A;  3RKV A;  3I5P A;  3FTW A;  5FZR A;  2CFZ A;  5CCL A;  3DWL G;  2H6G A;  1KZP A;  2PM6 A;  4XI9 A;  2GRR B;  3MEK A;  1W3B A;  4JW1 A;  4U07 A;  5ARF A;  2FBN A;  4PS3 A;  5EN5 D;  4XE0 A;  4LRZ A;  2L6B A;  2C0M A;  4WWO A;  4A1S A;  4DUI A;  3QB2 A;  2RG8 A;  2DZN A;  2RKK A;  1OXJ A;  3CHS A;  4HRL A;  2IOS A;  3CV0 A;  5ARG A;  1Z5S C;  3PRE A;  3S2A A;  5A7D B;  2HR2 A;  2DYS E;  3D9L A;  3UIO C;  1NA3 A;  4UI9 K;  4HLL A;  4HOT A;  4HOQ A;  1WM5 A;  2KCV A;  5JJT A;  2V0P A;  4BT9 A;  4J0U A;  4DX7 D;  1TN7 A;  5A23 A;  5BPP A;  1K8K G;  1HH8 A;  2LNI A;  5FWQ A;  3KAE A;  3FDH A;  4E85 A;  3FUJ A;  3DXM G;  2EQX A;  2LXM A;  5CMW A;  3U9W A;  3VTX A;  4BFR A;  2R2L A;  3QAQ A;  4CGV A;  2VGX A;  4Q94 A;  2CHZ A;  4CCA A;  3PZ2 A;  3PDN A;  5ENP D;  5EIL A;  5A6C A;  3VTY A;  1EPU A;  3HG0 D;  1N0Q A;  4NQ0 A;  2V5F A;  3SI5 A;  3LDZ A;  3TG4 A;  5EKQ D;  4WAF A;  3CVL A;  3TWV A;  1E7V A;  2EIM E;  3Q5M A;  5CRV A;  1EDU A;  5FQ7 A;  3JQ0 A;  3Q73 A;  3R9M A;  2GRP B;  5AQA A;  4XKB A;  4GTT A;  4GPM A;  2WVI A;  3W9G A;  4CDM A;  1N4P A;  1H2U A;  3C3R A;  4A3T A;  4D10 C;  5EIB E;  2R02 A;  4N5Q A;  3KSL A;  3LYA A;  4XIF A;  4JXT A;  1X5B A;  2IFU A;  1TJF A;  2R59 A;  2GGF A;  3AJI A;  2EIJ E;  2AWI A;  2WMN A;  4FJY A;  2FUL A;  3KS2 A;  4U96 D;  4OVU A;  4OYS A;  3UM1 A;  3ABM E;  1ELW A;  5CER B;  2WXQ A;  5FQ8 A;  5AQ7 A;  4LER A;  4JD2 G;  2ZU6 B;  3CEQ A;  5DIZ A;  3UT8 A;  4CT0 A;  1Y6I A;  3FUK A;  3VLD A;  3PZ4 A;  4I9C A;  4G2V A;  2WXO A;  4LCT A;  4I1M A;  3RO2 A;  4BSX A;  5BV1 A;  4UI9 J;  5BV0 A;  5AYW D;  3D9M A;  4QFV A;  1HX8 A;  1ELR A;  3CST A;  1GW6 A;  4HB5 A;  2M63 A;  4GTV A;  4GZ3 A;  3DSU A;  1JCQ A;  4A1G A;  5CBO A;  4EQF A;  3MKR A;  1INZ A;  1FT2 A;  1DC2 A;  3QK0 A;  1WG0 A;  4A3V A;  5KNG A;  3W9F A;  1BI7 B;  1SQM A;  1UJK A;  4OAV B;  4KMO A;  4FJZ A;  3NOC D;  1MJ0 A;  2XPZ A;  5LCW J;  2IQC A;  5J90 A;  3D9O A;  2R03 A;  3R9A B;  1HXI A;  2MOW A;  2VJ8 A;  1N9A A;  4G8K A;  3ZRH A;  1TNB A;  2PNN A;  3AS5 A;  4FP7 A;  2AW6 A;  2QY7 A;  1QZ2 A;  3ASG A;  4GZ5 A;  3LY7 A;  2GRQ B;  3Q7F A;  3ZU7 B;  3PNT B;  5CHE E;  1FPP A;  5J08 A;  3CK8 A;  4GYO A;  3ISM C;  2BF0 X;  3FU3 A;  5KCM A;  4YND A;  2ETB A;  3CK7 A;  4YDO A;  3JUE A;  3CHQ A;  2UWJ G;  3EHR A;  4WNF A;  1OUV A;  4GA1 A;  4BX9 A;  4B8C B;  3TWU A;  3D9I A;  3TL5 A;  3FH8 A;  3UM0 A;  2I6H A;  3TWS A;  2JAB A;  3FUD A;  1DNP A;  4G1T A;  2IF4 A;  3RO3 A;  3F6Q A;  4CZ2 D;  1H2V C;  4LNB A;  4HFG A;  4UWF A;  2J4B A;  2FF4 A;  3EUV A;  3G2U A;  4PH4 B;  3UI2 A;  3HXC A;  5EDS A;  1DCQ A;  1UW4 B;  2XPI A;  1NZN A;  2WQ6 A;  3ASD A;  3V30 A;  1TNU A;  3ZYK A;  2P9L G;  3Q4A B;  4N3B A;  1N11 A;  4KXK B;  4HBD A;  4Q69 A;  4EEC A;  5BT1 A;  3VLE A;  3T5X A;  5ENO D;  3B95 A;  3SFX A;  3ZN3 A;  4H7Y A;  1FCH A;  2LXL A;  3FTY A;  3C98 A;  4UQX A;  2V8S E;  2XZT G;  5G04 J;  4UQY A;  5AN8 A;  4HLE A;  2EIN E;  5AEN A;  2BUG A;  2A5E A;  4PS8 A;  2XCB A;  1X81 A;  2ZGD A;  3GYZ A;  4BSZ B;  5AAO A;  4APF A;  4MS6 A;  3PEU B;  4KZC A;  4AIF A;  5B3S E;  4ANU A;  4N2S A;  3FUH A;  3JQ1 A;  4G25 A;  4GAA A;  4HRM B;  5BXU A;  2ZGG A;  3ABL E;  4K03 A;  3CVQ A;  2XRY A;  2XEH A;  3TJP A;  4GA2 A;  3ONL A;  3OXL A;  3IHY A;  4G23 A;  1HG5 A;  3SFZ A;  4RQI A;  2PM7 A;  3FY4 A;  4GB9 A;  4OVV A;  1N52 A;  3HVE A;  4U63 A;  4MBG A;  1AP7 A;  2WPV A;  4I9E A;  2MHK A;  4F1P A;  1LD7 A;  1WAO 1;  3ZYL A;  1SA4 A;  3ASF A;  1N94 A;  2C2L A;  4M7C A;  3EDT B;  5E75 A;  2I1J A;  2YHC A;  2WB2 A;  5LCW C;  3N71 A;  4GTQ A;  3SBT B;  2L6J A;  5KJL A;  5DBK A;  4XX5 A;  3CQC B;  3TXM A;  5G55 A;  4C0M A;  3L08 A;  3D9K A;  5JJ7 A;  3DSX A;  3SZ7 A;  2B0O E;  3CVP A;  3NB2 A;  3CR3 A;  5HRY A;  4CEM A;  1YMP A;  2UY1 A;  2OND A;  2XGS A;  1HFA A;  1LTX A;  4I6G A;  1OCO E;  3P2B A;  2WXN A;  2WM9 A;  3CHR A;  3OXG A;  3NQP A;  4DPR A;  3PEV B;  3I3N A;  1MX4 A;  1V54 E;  3FU0 A;  5FTP A;  4C48 B;  5H7P A;  2F37 A;  3K9I A;  4J8F A;  1QQE A;  3GW4 A;  3EHM A;  3L9T A;  4GMJ A;  2H6I A;  3CVV A;  3B7T A;  5CMY A;  3TGO A;  2P9K G;  1TNO A;  4TXP A;  3PUK A;  5JJ6 A;  4U8H A;  2OCC E;  2I2O A;  3I4G A;  3Q49 B;  3CVN A;  2XS8 A;  1KLX A;  3SGH A;  4EBA A;  3ZGQ A;  2VQ2 A;  4AV7 A;  2Q7F A;  3SFY A;  2H6H A;  5CED B;  3CHM A;  3MKQ B;  1O1S A;  3AS4 A;  4TXR A;  3UKR G;  4JEU A;  4F7A A;  4I1O B;  4DJA A;  3Q15 A;  5D0O D;  1XGW A;  4J8S A;  5G04 C;  3ZEF A;  3RAU A;  4APO A;  2ION A;  1JWF A;  3PNL B;  4DK5 A;  4I2W A;  1YCS B;  3MV2 B;  3C5R A;  2V4L A;  2VTB B;  1E8W A;  2IO2 C;  2J49 A;  2X6I A;  2A5U A;  3UT4 A;  2KZT B;  3CK9 A;  3MV3 B;  2PQR A;  3EU9 A;  2KAT A;  2VSY A;  2QYU A;  4DI4 A;  1NI1 A;  3CVU A;  4AXH A;  2X3M A;  3RK6 A;  4UUC A;  1S64 A;  5FZQ A;  3ULE G;  3ZYM A;  1MHQ A;  2GRL A;  4UQZ A;  1N4R A;  3U3W A;  4C9B B;  4FHJ A;  4WND A;  3WG7 E;  3V2O A;  4JHR A;  5AJD A;  2XEN A;  1UN9 A;  4WNG A;  2WXP A;  3APF A;  5EYP F;  4HXI A;  4EBA G;  1O1R A;  2L0T B;  5HI7 A;  4DRX E;  2LAI A;  3SBS A;  2XEV A;  3LVR E;  3ZXP A; 
#chains in the Genus database with same CATH homology
 2V4H C;  3KEA A;  5CBO A;  5EYL A;  4HI9 A;  3TWW A;  5EN5 D;  3TWV A;  4K5B A;  1DC2 A;  4U8Y D;  1WG0 A;  3TWX A;  2L6B A;  4ZFH A;  1N11 A;  5KNG A;  5EID A;  3T8K A;  3W9F A;  4ATZ D;  4B93 B;  4HBD A;  2DWZ A;  1BI7 B;  1WDY A;  5AQB A;  2XZD G;  2F8X K;  3DEP A;  4QQI A;  4OAV B;  4DUI A;  4O1P A;  5CED B;  5KNH D;  4RLY A;  5AAR A;  2VGE A;  2DZN A;  5AQA A;  3B7B A;  2DZO A;  3NOC D;  3ZKJ A;  5ENO D;  1MJ0 A;  4BET A;  1IHB A;  3V79 K;  4GPM A;  4HRL A;  1N0R A;  3B95 A;  4LNU D;  5CEA A;  1SVX A;  3W9G A;  1IKN D;  1S70 B;  4Z68 A;  5CEC B;  3NBN B;  3ZNG A;  4A63 B;  3JXI A;  2ETA A;  5FIO A;  1SW6 A;  3V2X A;  2P2C P;  4BER A;  4DX5 D;  4HRN A;  4K5A B;  3TWQ A;  1BD8 A;  3LJN A;  3EHQ A;  3TWR A;  3SO8 A;  1A5E A;  2XZT G;  4G8K A;  5AN8 A;  4DX2 A;  4ZHB A;  4O1O A;  4K5C A;  1G3N B;  5ENS D;  5ITZ F;  1OT8 A;  2PNN A;  2B0O E;  2ETC A;  4HLL A;  2A5E A;  5EIB E;  4N5Q A;  5HKP A;  5D66 A;  4HNA D;  5AQ9 A;  4DX6 D;  3UTM A;  1UOH A;  3TWT A;  1K1B A;  5HRY A;  3T9K A;  3ZU7 B;  5ENR D;  1YCS B;  1YMP A;  2XEE A;  2Y1L E;  2ZGD A;  4BSZ B;  1K3Z D;  3C5R A;  4F6R D;  1AWC B;  3D9H A;  4O60 A;  3Q9N C;  4BEP A;  1NFI E;  3UXG A;  5AAO A;  2FO1 E;  5KWD A;  3AJI A;  4HQD A;  1BI8 B;  1K1A A;  4DX7 D;  3Q9U C;  4U96 D;  5CBN A;  3IXE A;  2ETB A;  3EU9 A;  5JMN D;  5BXO A;  3HRA A;  4JB8 P;  4YDY A;  1MX4 A;  3JUE A;  3V31 A;  5CER B;  2DVW A;  1QYM A;  3J5Q B;  4BES A;  4TUM A;  4GMR A;  5HS0 A;  1D9S A;  1BLX B;  4G8L A;  2BKG A;  3EHR A;  4HRM B;  5AQ7 A;  4UUC A;  5ENQ D;  5BXU A;  4LSZ E;  4DX1 A;  3AAA C;  2BKK B;  3TWU A;  4C48 B;  2MYO A;  2ZGG A;  4NIK A;  2F37 A;  3DEO A;  3TWS A;  5FIN A;  2J8S D;  4LG6 A;  2JAB A;  3NOG D;  2QYJ A;  2XEH A;  4U8V D;  2RFM A;  4U95 D;  4J8Y A;  1MYO A;  1TR4 A;  2F8Y A;  4YDW A;  3V2O A;  3F6Q A;  4CZ2 D;  1YYH A;  1OY3 D;  5JA4 D;  5ENT D;  2NYJ A;  2XEN A;  1MX2 A;  1MX6 A;  3J5P A;  4HI8 A;  2AJA A;  2KBX A;  3ZUV B;  4QFV A;  5ENP D;  5EIL A;  2KXP C;  2QC9 A;  2V5Q C;  5EYP F;  3HG0 D;  4HB5 A;  2RFA A;  3UI2 A;  1N0Q A;  2Y0B G;  2HE0 A;  1DCQ A;  1IXV A;  1AP7 A;  3JXJ A;  5KBA A;  1BU9 A;  4DRX E;  4F1P A;  3V30 A;  4CYM D;  4J7W A;  4OAU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...