4TXQA

Crystal structure of lip5 n-terminal domain complexed with chmp1b mim
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
162
structure length
162
Chain Sequence
MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVKHRKYARWKATYIHNCLKNGETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associated protein VTA1 homolog
publication title A Novel Mechanism of Regulating the ATPase VPS4 by Its Cofactor LIP5 and the Endosomal Sorting Complex Required for Transport (ESCRT)-III Protein CHMP5.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 4txqA00
5H7PA 2LUHA 2LXMA 2LXLA 2RKKA 4TXQA 4TXPA 4U7EB 4TXRA
chains in the Genus database with same CATH superfamily
4UUCA 4U0UA 4UWKA 4HOSA 4NRHB 5LFAA 2B6CA 1DCQA 4HFGA 4B0ZA 3UINC 1N0QA 2ZIRA 3I3NA 3ZIMA 2XEVA 4KYOB 4HVBA 5AARA 2R03A 2WXPA 3IEGA 3SHFA 3QWVA 4U7EB 2MHKA 3NF1A 2UWJG 2IO2C 1OWLA 1TEZA 3UT8A 4LNGA 1N4SA 4JPSA 2AWIA 4GTSA 3CSTA 3HHMA 4I1AA 4ILGA 3SBTB 3RRUA 2R59A 3DPDA 3ISMC 1IQRA 4LRZA 3UUXA 4DLOA 5HRYA 5G55A 4JVSA 1BLXB 4FLBA 4UQZA 1HO8A 4O1PA 3IV0A 5ENOD 4LCTA 4DJAA 2V8SE 3LCAA 3FTSA 3AS4A 1BPOA 5KCMA 2H6FA 3DSXA 3NOCD 4GMRA 4B94A 1N54A 5EN5D 2YINA 4AJWA 4BY6A 3S2AA 5LCWC 3Q9UC 3EUVA 2XS1A 3LVRE 4U07A 2FEZA 3KS2A 3L13A 5G2NA 2HO1A 3FTXA 5AYWD 5FT9A 4HXIA 2R02A 1LTXA 5CCLA 5ENPD 1JWGA 1UG3A 3MKRA 2I1JA 3JUEA 5KBAA 1H6KA 3RJVA 4Z68A 4TV3A 3L17A 2KATA 1OWNA 1JCSA 2XEHA 4GPKA 4I6EA 3ZHEA 1S70B 4G8KA 2CFUA 3MA5A 3D9LA 5JHAA 4L1BA 3LJ3A 4GAAA 3TL5A 1V55E 3RU0A 3BU8A 4CDRA 5LCWJ 3FUFA 3HIZA 3VLDA 3C3OA 2IOLA 3RIBA 2L0IA 3LXUX 4N3BA 1XNFA 2P9LG 1LF8A 3LVQE 5E76A 4XI9A 3Q4AB 2DVWA 3HXFA 3DSWA 4QFVA 3ZYMA 4PS3A 4ZHBA 3QWPA 3APFA 4I1MA 1QQEA 2LSVA 3E37A 3QWWA 4U96D 3ONLA 2ZGDA 4I2ZA 3RO3A 4JB8P 3FUEA 2VSXE 4YDEA 5EX3A 4G23A 4TUMA 4KVOA 2L6BA 2KCKA 3Q78A 2VSNA 4CGVA 3C3QA 4DPRA 1JCRA 2KCVA 2CHXA 3CR3A 2RFMA 2DZOA 2VGXB 4A55A 3NBNB 2VSOE 3L6AA 3PE3A 3ZUVB 1ELKA 3QARA 2XENA 4F53A 3CVYA 3R9AB 2J49A 5ANLA 4AOFA 1HG2A 5AJLA 4NIKA 4J8YA 3UPVA 2R2LA 4EZLA 4CDNA 4XI0A 3AG4E 2Y69E 3FUMA 4I43A 3WXXA 2PNNA 1SZ9A 5JHBA 1SA4A 4GTMA 4HBDA 3S7JA 4IYPA 5M72A 3PEVB 4N3AA 2FF4A 2PQRA 3VTXA 1TJFA 3L9TA 4Y6CA 4UI9K 1TN7A 4G8LA 4B89A 2WXHA 4OVUA 4DX1A 2ETAA 3L22A 4AP2A 3L16A 4I6JA 3FUIA 1UN9A 5KJKA 4GTOA 3FP3A 4JEUA 5AQBA 3TWTA 3FU0A 3TXMA 4JHJA 3V2OA 2R17C 5CBNA 1TYQG 4JC8A 3C3RA 3CVXA 4G26A 2RG8A 2VJ8A 4XE0A 2F37A 3G2TA 3UTMA 4GCNA 2X6HA 3FTWA 3Q73A 1HU3A 3Q5MA 3C98A 4LG6A 4BEPA 3PREA 2Y4TA 3MV2B 3PZ4A 5KJNA 5B1AE 3ZNGA 2PL2A 3CK7A 2X3MA 3IBEA 2ILRA 4AIFA 2XGOA 4HRNA 3CHPA 4CYMD 4BTAA 3DSVA 5FWQA 3UXGA 1S64A 3HXCA 5G05C 2QZAA 4BETA 1FT2A 4J7WA 3APDA 5A6CA 4L2LA 3CVLA 3NZUA 1WM5A 3FWVA 3T8KA 4Q69A 5BV0A 4HNAD 2OOEA 3FEXA 1WY6A 2QY7A 3PVLA 1BI8B 5BUZA 4ZFHA 3CVWA 3U64A 1HZ4A 4WAFA 3RO2A 3OXFA 1BD8A 4F1SA 4MRUA 4U8VD 3JYSA 4KMOA 3J5PA 2P2CP 4JD2G 2WB2A 2V5QC 2CFZA 3ONKA 5AENA 4TUUA 1KLXA 5A7DB 5G05J 4DI4A 2H6GA 3APCA 4LSZE 2X6FA 2I2OA 3KSQA 3ZHEB 2Y4UA 2WXRA 3LPZA 5FQ8A 4O6FA 3NQPA 3ZVVA 4UWLA 1TNOA 4RG6A 3EU5A 4AY5A 2P9KG 1U2VG 4GYWA 1MX2A 3HXDA 3J5QB 4AXHA 2I1KA 2P9UG 4JZYA 5EKQD 2XQ0A 5T3RA 5FZQA 4LNUD 1E7VA 3TGOA 2V4LA 1HF8A 2VQ2A 4RSYA 1H6OA 2ETCA 3CV0A 3CKCA 2F8XK 3HYMB 4MLPA 4WNFA 1YA0A 4A63B 4DUIA 3FUNA 3U4TA 3CVQA 4GTQA 1E7UA 1TNUA 4GZ3A 2WXLA 4YDWA 4BX9A 2LSUA 5T4YA 3OXGA 3ENEA 2H6IA 3AG2E 3DRAA 3W9FA 1XGWA 3CHSA 3FY4A 2A5EA 2HE0A 2LUHA 1MJ0A 3CKBA 5CERB 3MEKA 3UMVA 1MX6A 2ZU6B 4F6RD 1O1RA 1NI1A 4UQXA 5B3SE 4DX5D 5ENQD 2LNIA 4E85A 4KVMA 3IHYA 1ZB1A 5FZRA 4HI8A 3PZ3A 4GZCA 3KSLA 3UT7A 2IJGX 1OT8A 4ABNA 2ZGGA 3CK9A 1SQMA 1K8KG 2ZISA 2ZXWE 1D8DA 3FH5A 4PS7A 4MS6A 4DX6D 1IHBA 3Q49B 2JLBA 4GYOA 2RKKA 4FJZA 4N2QA 1KPSB 2GRRB 1KZPA 3CHOA 4RG9A 5JJ6A 3QDNA 5KNGA 1EDUA 4HS2A 4KZCA 2XRZA 2WXQA 3GW4A 2PZIA 3QKYA 2OEWA 3PE4A 1AWCB 4ANUA 2VTBA 3DXMG 4UQYA 3B7TA 5D66A 4G24A 4GZ6A 2XHEA 2EIME 3PZ1A 3T9KA 1LD7A 1D8EA 5CRVA 4NURA 3TWVA 2HR2A 3TWUA 2WQ7A 3GZ1A 2L6JA 3NB2A 4AY6A 3FULA 3MJWA 2LAHA 2KZTA 2BTDA 3ASFA 3D9IA 5H7PA 3ABLE 3RRNB 4C9BB 3ESKA 2WVIA 2CG3A 2DYSE 1NZNA 4EZJA 4W9RA 4A1SA 4U0SA 3QOUA 3AAAC 4IN3B 3SZ7A 1E8WA 2AVPA 4BERA 1OWOA 5A23A 5AIJA 4GA2A 3SD5A 3MV3B 5JMND 3PNTB 2IOSA 2HYZA 4J0UA 4JA7A 1PC2A 3CGHA 4J8FA 2UY1A 4ATZD 2J08A 4PDXA 3QAQA 2FULA 2XZDG 3TWSA 4GA0A 4DLQA 2OV8A 3G2VA 4AEZC 1HX8A 3DSSA 1TNZA 4EZKA 1B89A 3L54A 4CT4A 1TNBA 4DRXE 4ME2A 5HI7A 5CMYA 4U63A 4TRQA 3LS8A 3HXEA 2FO7A 5KJMA 4G25A 1N0RA 1WG0A 2XGSA 3PZ2A 1LD8A 3D9MA 3UM3A 4V3IA 4WNDA 2MRIA 5ANRA 4YNDA 5LP0A 4FHKA 3DSUA 3SY2A 4A1GA 4RVBA 3Q15A 1H19A 3HXBA 2JEKA 4G1TA 3ZW3A 3D9NA 2FO1E 3JQ0A 3MKQA 5AN8A 3MGBA 3ULYA 3LKUA 4B93B 4UWGA 3T5XA 4CGWA 5JJTA 3D9KA 3UKRG 4LUNU 3FU6A 4RQIA 3DXKG 5LOZA 1E8XA 1MX4A 3S7DA 3R7QA 5FQ6A 1KT1A 1K3ZD 3U3WA 1IQUA 5FINA 2LXMA 3RAUA 3PUKA 2DWZA 3F6QA 3ZPJA 1TN8A 1UW4B 3ML9A 3TAXA 4J8EA 4XKCA 4UWHA 5DBKA 2F0YA 4ILHB 4RLYA 4DX7D 4EQFA 2CHWA 4OAVB 3SI5A 5ENSD 4IRUA 3SBSA 3JXJA 2FI7A 2ONDA 2C2LA 3U9WA 1RZ4A 3ASNE 5DIZA 3FUDA 4BFRA 3BG0B 3B7RL 3O48A 5EDSA 1EYHA 4ACLA 3K9IA 4ILIA 4ANVA 4XIFA 4FHJA 1G3NB 3SF4A 1DVPA 2C0LA 4KZ0A 3EHNA 4PS8A 4CDMA 1BU9A 3ABME 2EIJE 3R9MA 3QB2A 5E75A 1N95A 3C72A 2IU1A 1Q2ZA 2VYIA 4DX2A 2YHEA 3T8MA 2E2EA 4QQIA 3FUKA 1OWPA 2M63A 3O4ZA 2WMNA 1JWFA 1DC2A 3UX4A 1TNYA 4GZDA 3OTNA 4JL0A 3CSFA 1X5BA 4EECA 2R5SA 2IEJA 2A4ZA 2X6JA 5ENTD 4BESA 4F7AA 1EPUA 3Q79A 3G2WA 4PUCA 2IF4A 4JHKA 4YVQC 1YYHA 3B95A 5CMWA 5BW8C 3EJNA 1AP7A 3FEYA 4TXRA 5BXOA 1Z6TA 2VTBB 3B13A 3EHMA 4GMLA 1SZAA 3I4RB 2GRLA 2I9CA 4B8CB 2IQCA 3AS5A 4IULA 1N4QA 3ML8A 2OEVA 3UM0A 4HOTA 1MZCA 4YDOA 4FLHA 1MYOA 4U95D 2IY0C 1N4PA 3TJPA 1QNFA 3UKUG 2WXIA 4EHMA 4EPZA 2KZTB 5EYLA 1O1TA 5AQ9A 3GZSA 3BQOA 3B7SA 1HXIA 4K5BA 4BT8A 1RW2A 2J8SD 3DEPA 3GZ2A 3UI2A 5BT1A 1N94A 3PS6A 3CVPA 4H7YA 2V5FA 3VLFA 4F1PA 2DYRE 2A5UA 3CVUA 2V4HC 2EQXA 5G04C 1VDYA 3FUJA 1FVFA 5KNHD 1TR4A 2CHZA 3SNXA 4N5CA 4J8SA 3ZXPA 2UY1B 1OY3D 5CECB 2OVBA 1TN6A 3TWQA 4EBAA 1L5JA 3AU5A 1WDYA 3ULEG 3U66A 5AQAA 3SFXA 2L9BA 1ELWA 1PAQA 4AVXA 2YQ8A 3D9HA 2P58C 5FQ4A 1IXVA 1PY1A 1GW6A 4JEHA 2WXKA 2BKKB 4ANXA 2WXMA 3I4GA 3AG3E 4WWNA 3CHRA 1U3DA 1Z5SC 5G04J 3EHRA 1WAO1 3IXEA 1JCQA 4BSXA 1ZU2A 4I17A 1ELRA 2KXPC 5JJ7A 4I6GA 1UOHA 2DCPA 3VLEA 3G2UA 3LY8A 3ZYQA 4OYSA 2RD0A 2P9SG 1JPLA 3WG7E 2GRQB 3FTYA 3ZEFA 4GTRA 3AJIA 3EU9A 4HRMB 2I6HA 3JQ1A 1KT0A 2FBNA 3MKQB 2YNQA 3BEEA 2DZNA 3LEWA 1N9AA 3D9OA 3MZLB 2KM4A 4JHRA 4N39A 3CHMA 4WNGA 3ZN3A 5BXUA 4FP7A 2P9PG 4XZ4A 5D0QD 3W9GA 2P9NG 1QZ2A 3R7RA 3HDXA 3MYVA 1OUVA 3RRMB 5FQ7A 3L82A 4NACA 3G2SA 1E8YA 4HI9A 3D9PA 2VGEA 3DWLG 3AU4A 3LY9A 3PDNA 2XEEA 5KJLA 4CCAA 3JCKC 3BUAA 1E96B 5CCMA 1OCCE 3CIAA 4FA6A 4BTBA 4UI9C 4U8HA 4HOQA 2V0PA 4KBQA 2NXPA 3SGHA 4J8DA 5ARFA 3RKVA 2J09A 4I2WA 4EBAG 1OWMA 2QC9A 3FH7A 3Q9NC 4LEUA 4CZ2D 5J08A 3ASHA 1OCOE 2J07A 1ZBPA 5EILA 1NA3A 4BSZB 4L9PA 5HQ8A 4O1OA 1N4RA 3PEUB 3ZFWA 3FTUA 2Y0BG 4HRLA 2GROB 3TWWA 5EIDA 5CBOA 4X8QA 4N3CA 1UN8A 5FJYA 5BPPA 5BNWA 3DBSA 3PH0C 2F8YA 3RK6A 5AAOA 5D2MC 2XS8A 3PZDA 4UI9J 2J4DA 2LO6A 2PM6A 4LERA 4AV7A 3ESLA 3E34A 2VGYA 3TWXA 2KC7A 5FZSA 3LJNA 4L7TA 1FT1A 1H2TC 1V54E 3OAWA 5CRUA 4APFA 4BWRA 3KD7A 4KXKB 3KEZA 4HORA 3OXLA 2NYJA 1UJKA 2L0TB 4R7LA 4A3VA 1IKND 2AW6A 2JABA 4WWOA 4BX8A 4K5AB 1K1AA 3MX3A 3CHQA 1W3BA 5FIOA 4I1OB 4A3TA 5BV1A 1OXJA 4M7CA 2IFUA 4XKBA 1FPPA 2X6IA 3Q7AA 3FU3A 4C48B 2MOWA 4F3VA 2GGFA 2GRPB 2BUGA 4HQDA 1NP7A 3V79K 2WXGA 3ZU7B 2LXLA 4FC8A 4GB9A 1O5MA 1IYGA 3FFLA 2WPVA 3FU5A 4GZ5A 3TG5A 2EILE 3VTYA 2GRMA 4FJYA 2R05A 2QYUA 4O60A 1YCSB 2AXUA 3KEAA 2XCBA 4YDYA 2BKGA 4ANWA 5CHEE 1HS6A 3EDTB 4JXTA 2C0MA 3SQVA 2OVFA 4GTTA 1K1BA 3E30A 2ETBA 3HVEA 2WM9A 4C0EA 3X2QE 3CEQA 2WMOA 1INZA 3KAEA 3Q7FA 4OAUC 1SA5A 1TJCA 3ULQA 4APOA 3D3MA 4XEIG 4GMJA 5EX0A 2HM8A 3ZYKA 4GTVA 3V31A 3NOGD 5AQ7A 2QYJA 4KT6B 4I9EA 1Y8MA 5HS0A 5D0OD 3PUJA 3DSTA 3FDHA 1A17A 1BI7B 3UIPC 3GYZA 1S0PA 2KCLA 2XGMA 4K03A 1MQSA 2GW1A 3EIQC 1NFIE 4UWFA 1NL4A 1A5EA 3IKOB 2J9QA 3UIOC 2Q7FA 4MKTA 3ASDA 4K0RA 2LAIA 1OCRE 3BG1B 3URZA 4MBGA 3UQ3A 3V2XA 3QNKA 2B0OE 4FU3A 3PRZA 3TXNA 1SVXA 3NZSA 1HFAA 4FADA 4L23A 3ABKE 1QYMA 3SO8A 3ZGQA 3RSEG 3DEOA 2X38A 4DI3A 3QC1A 1DNPA 3IHVA 2XPZA 2XZTG 2XCCA 4N2SA 1JUQA 2XRYA 5CEAA 1FVHA 4J6IA 4JW1A 2E0IA 3S7BA 4GYYA 4DK5A 4FULA 4NQ0A 3Q47B 5T8IA 4H7XA 2BEDA 3QJZA 2WQ6A 5ARGA 4G11A 4WWPA 3CVNA 2Y3AA 4HLEA 1HG5A 1H2UA 3CQGB 1UJJA 2AXVA 2KBXA 4CT0A 1E8ZA 1O1SA 5JA4D 3CVVA 3HG0D 5FTPA 5KWDA 3E4BA 1Y6IA 3ASGA 3AS8A 3Q75A 3B7UX 1FCHA 3SFYA 1P5QA 3D9JA 4U0ZA 2WXNA 3EIJA 3UM1A 5EIBE 1SW6A 4LNBA 4L2YA 4P29A 5C1DA 2BF0X 1IHGA 4Q96A 2AJAA 2OCCE 2WXOA 3E32A 2QFCA 2IONA 4I9CA 3S7FA 3T5VA 3UT4A 2PM7A 3FHEA 5AJDA 3CQCB 3CLJA 4HOUA 1H2VC 5HKPA 1HH8A 3NAWA 4OVVA 1EF1C 4GPMA 3FH8A 1S63A 4U04A 3ZYLA 4ACKA 3LYAA 5EYPF 4JA9A 3LY7A 2DIWA 4TXQA 5ENRD 4K5CA 5J90A 3B7BA 4XX5A 1Z3XA 4BT9A 3P1UA 4HLLA 3TG4A 3HRAA 2VSYA 3ZXSA 5CEDB 2XPYA 2DBAA 4E6HA 4D10C 2X6KA 2NSZA 3PNLB 3CK8A 4U8YD 3JXIA 4Q94A 4HB5A 3LDZA 4WNEA 3QK0A 1DCEA 5ITZF 2Y1LE 4Y6WA 4TXPA 2VGXA 4CRWA 1E90A 1OCZE 3ASOE 1Z3YA 4G2VA 3AG1E 3L08A 5B1BE 2EINE 3MCXA 4B8AA 3ZKJA 2EIKE 4PH4B 2YHCA 3DPYA 5IY5E 2XPIA 1H6PA 4ATGA 3UM2A 2GRNB 4WUYA 1NA0A 1D9SA 5ENNA 4GTPA 3FUHA 3FTZA 4C0MA 2WXFA 1U3CA 2H6HA 3HVEB 2RFAA 2WXJA 1HE8A 5LX8A 1N52A 3FTVA 3I5PA 1QBQA 2P9IG 4M3OA 2WQHA 3V30A 1N11A 3P2BA 4CEMA 2NC9A 2CG2A 4AM9A 4N5QA 3SFZA 4GA1A 5C2YA 4YVOA 4GCOA 4GU5A 4URKA 2MYOA 1KZOA 2AXZA 3JUIA 2IO3C 3TWRA 3N71A 1X81A 3E33A 1MHQA 3ZRHA 2J4BA 2PQNA 1H0AA 1YMPA 3C5RA 3EHQA
chains in the Genus database with same CATH topology
5H7PA 2LUHA 2LXMA 2LXLA 2RKKA 4TXQA 4TXPA 4U7EB 4TXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H7P A;  2LUH A;  2LXM A;  2LXL A;  2RKK A;  4TXQ A;  4TXP A;  4U7E B;  4TXR A; 
#chains in the Genus database with same CATH topology
 4UUC A;  4U0U A;  4UWK A;  4HOS A;  4NRH B;  5LFA A;  2B6C A;  1DCQ A;  4HFG A;  4B0Z A;  3UIN C;  1N0Q A;  2ZIR A;  3I3N A;  3ZIM A;  2XEV A;  4KYO B;  4HVB A;  5AAR A;  2R03 A;  2WXP A;  3IEG A;  3SHF A;  3QWV A;  4U7E B;  2MHK A;  3NF1 A;  2UWJ G;  2IO2 C;  1OWL A;  1TEZ A;  3UT8 A;  4LNG A;  1N4S A;  4JPS A;  2AWI A;  4GTS A;  3CST A;  3HHM A;  4I1A A;  4ILG A;  3SBT B;  3RRU A;  2R59 A;  3DPD A;  3ISM C;  1IQR A;  4LRZ A;  3UUX A;  4DLO A;  5HRY A;  5G55 A;  4JVS A;  1BLX B;  4FLB A;  4UQZ A;  1HO8 A;  4O1P A;  3IV0 A;  5ENO D;  4LCT A;  4DJA A;  2V8S E;  3LCA A;  3FTS A;  3AS4 A;  1BPO A;  5KCM A;  2H6F A;  3DSX A;  3NOC D;  4GMR A;  4B94 A;  1N54 A;  5EN5 D;  2YIN A;  4AJW A;  4BY6 A;  3S2A A;  5LCW C;  3Q9U C;  3EUV A;  2XS1 A;  3LVR E;  4U07 A;  2FEZ A;  3KS2 A;  3L13 A;  5G2N A;  2HO1 A;  3FTX A;  5AYW D;  5FT9 A;  4HXI A;  2R02 A;  1LTX A;  5CCL A;  5ENP D;  1JWG A;  1UG3 A;  3MKR A;  2I1J A;  3JUE A;  5KBA A;  1H6K A;  3RJV A;  4Z68 A;  4TV3 A;  3L17 A;  2KAT A;  1OWN A;  1JCS A;  2XEH A;  4GPK A;  4I6E A;  3ZHE A;  1S70 B;  4G8K A;  2CFU A;  3MA5 A;  3D9L A;  5JHA A;  4L1B A;  3LJ3 A;  4GAA A;  3TL5 A;  1V55 E;  3RU0 A;  3BU8 A;  4CDR A;  5LCW J;  3FUF A;  3HIZ A;  3VLD A;  3C3O A;  2IOL A;  3RIB A;  2L0I A;  3LXU X;  4N3B A;  1XNF A;  2P9L G;  1LF8 A;  3LVQ E;  5E76 A;  4XI9 A;  3Q4A B;  2DVW A;  3HXF A;  3DSW A;  4QFV A;  3ZYM A;  4PS3 A;  4ZHB A;  3QWP A;  3APF A;  4I1M A;  1QQE A;  2LSV A;  3E37 A;  3QWW A;  4U96 D;  3ONL A;  2ZGD A;  4I2Z A;  3RO3 A;  4JB8 P;  3FUE A;  2VSX E;  4YDE A;  5EX3 A;  4G23 A;  4TUM A;  4KVO A;  2L6B A;  2KCK A;  3Q78 A;  2VSN A;  4CGV A;  3C3Q A;  4DPR A;  1JCR A;  2KCV A;  2CHX A;  3CR3 A;  2RFM A;  2DZO A;  2VGX B;  4A55 A;  3NBN B;  2VSO E;  3L6A A;  3PE3 A;  3ZUV B;  1ELK A;  3QAR A;  2XEN A;  4F53 A;  3CVY A;  3R9A B;  2J49 A;  5ANL A;  4AOF A;  1HG2 A;  5AJL A;  4NIK A;  4J8Y A;  3UPV A;  2R2L A;  4EZL A;  4CDN A;  4XI0 A;  3AG4 E;  2Y69 E;  3FUM A;  4I43 A;  3WXX A;  2PNN A;  1SZ9 A;  5JHB A;  1SA4 A;  4GTM A;  4HBD A;  3S7J A;  4IYP A;  5M72 A;  3PEV B;  4N3A A;  2FF4 A;  2PQR A;  3VTX A;  1TJF A;  3L9T A;  4Y6C A;  4UI9 K;  1TN7 A;  4G8L A;  4B89 A;  2WXH A;  4OVU A;  4DX1 A;  2ETA A;  3L22 A;  4AP2 A;  3L16 A;  4I6J A;  3FUI A;  1UN9 A;  5KJK A;  4GTO A;  3FP3 A;  4JEU A;  5AQB A;  3TWT A;  3FU0 A;  3TXM A;  4JHJ A;  3V2O A;  2R17 C;  5CBN A;  1TYQ G;  4JC8 A;  3C3R A;  3CVX A;  4G26 A;  2RG8 A;  2VJ8 A;  4XE0 A;  2F37 A;  3G2T A;  3UTM A;  4GCN A;  2X6H A;  3FTW A;  3Q73 A;  1HU3 A;  3Q5M A;  3C98 A;  4LG6 A;  4BEP A;  3PRE A;  2Y4T A;  3MV2 B;  3PZ4 A;  5KJN A;  5B1A E;  3ZNG A;  2PL2 A;  3CK7 A;  2X3M A;  3IBE A;  2ILR A;  4AIF A;  2XGO A;  4HRN A;  3CHP A;  4CYM D;  4BTA A;  3DSV A;  5FWQ A;  3UXG A;  1S64 A;  3HXC A;  5G05 C;  2QZA A;  4BET A;  1FT2 A;  4J7W A;  3APD A;  5A6C A;  4L2L A;  3CVL A;  3NZU A;  1WM5 A;  3FWV A;  3T8K A;  4Q69 A;  5BV0 A;  4HNA D;  2OOE A;  3FEX A;  1WY6 A;  2QY7 A;  3PVL A;  1BI8 B;  5BUZ A;  4ZFH A;  3CVW A;  3U64 A;  1HZ4 A;  4WAF A;  3RO2 A;  3OXF A;  1BD8 A;  4F1S A;  4MRU A;  4U8V D;  3JYS A;  4KMO A;  3J5P A;  2P2C P;  4JD2 G;  2WB2 A;  2V5Q C;  2CFZ A;  3ONK A;  5AEN A;  4TUU A;  1KLX A;  5A7D B;  5G05 J;  4DI4 A;  2H6G A;  3APC A;  4LSZ E;  2X6F A;  2I2O A;  3KSQ A;  3ZHE B;  2Y4U A;  2WXR A;  3LPZ A;  5FQ8 A;  4O6F A;  3NQP A;  3ZVV A;  4UWL A;  1TNO A;  4RG6 A;  3EU5 A;  4AY5 A;  2P9K G;  1U2V G;  4GYW A;  1MX2 A;  3HXD A;  3J5Q B;  4AXH A;  2I1K A;  2P9U G;  4JZY A;  5EKQ D;  2XQ0 A;  5T3R A;  5FZQ A;  4LNU D;  1E7V A;  3TGO A;  2V4L A;  1HF8 A;  2VQ2 A;  4RSY A;  1H6O A;  2ETC A;  3CV0 A;  3CKC A;  2F8X K;  3HYM B;  4MLP A;  4WNF A;  1YA0 A;  4A63 B;  4DUI A;  3FUN A;  3U4T A;  3CVQ A;  4GTQ A;  1E7U A;  1TNU A;  4GZ3 A;  2WXL A;  4YDW A;  4BX9 A;  2LSU A;  5T4Y A;  3OXG A;  3ENE A;  2H6I A;  3AG2 E;  3DRA A;  3W9F A;  1XGW A;  3CHS A;  3FY4 A;  2A5E A;  2HE0 A;  2LUH A;  1MJ0 A;  3CKB A;  5CER B;  3MEK A;  3UMV A;  1MX6 A;  2ZU6 B;  4F6R D;  1O1R A;  1NI1 A;  4UQX A;  5B3S E;  4DX5 D;  5ENQ D;  2LNI A;  4E85 A;  4KVM A;  3IHY A;  1ZB1 A;  5FZR A;  4HI8 A;  3PZ3 A;  4GZC A;  3KSL A;  3UT7 A;  2IJG X;  1OT8 A;  4ABN A;  2ZGG A;  3CK9 A;  1SQM A;  1K8K G;  2ZIS A;  2ZXW E;  1D8D A;  3FH5 A;  4PS7 A;  4MS6 A;  4DX6 D;  1IHB A;  3Q49 B;  2JLB A;  4GYO A;  2RKK A;  4FJZ A;  4N2Q A;  1KPS B;  2GRR B;  1KZP A;  3CHO A;  4RG9 A;  5JJ6 A;  3QDN A;  5KNG A;  1EDU A;  4HS2 A;  4KZC A;  2XRZ A;  2WXQ A;  3GW4 A;  2PZI A;  3QKY A;  2OEW A;  3PE4 A;  1AWC B;  4ANU A;  2VTB A;  3DXM G;  4UQY A;  3B7T A;  5D66 A;  4G24 A;  4GZ6 A;  2XHE A;  2EIM E;  3PZ1 A;  3T9K A;  1LD7 A;  1D8E A;  5CRV A;  4NUR A;  3TWV A;  2HR2 A;  3TWU A;  2WQ7 A;  3GZ1 A;  2L6J A;  3NB2 A;  4AY6 A;  3FUL A;  3MJW A;  2LAH A;  2KZT A;  2BTD A;  3ASF A;  3D9I A;  5H7P A;  3ABL E;  3RRN B;  4C9B B;  3ESK A;  2WVI A;  2CG3 A;  2DYS E;  1NZN A;  4EZJ A;  4W9R A;  4A1S A;  4U0S A;  3QOU A;  3AAA C;  4IN3 B;  3SZ7 A;  1E8W A;  2AVP A;  4BER A;  1OWO A;  5A23 A;  5AIJ A;  4GA2 A;  3SD5 A;  3MV3 B;  5JMN D;  3PNT B;  2IOS A;  2HYZ A;  4J0U A;  4JA7 A;  1PC2 A;  3CGH A;  4J8F A;  2UY1 A;  4ATZ D;  2J08 A;  4PDX A;  3QAQ A;  2FUL A;  2XZD G;  3TWS A;  4GA0 A;  4DLQ A;  2OV8 A;  3G2V A;  4AEZ C;  1HX8 A;  3DSS A;  1TNZ A;  4EZK A;  1B89 A;  3L54 A;  4CT4 A;  1TNB A;  4DRX E;  4ME2 A;  5HI7 A;  5CMY A;  4U63 A;  4TRQ A;  3LS8 A;  3HXE A;  2FO7 A;  5KJM A;  4G25 A;  1N0R A;  1WG0 A;  2XGS A;  3PZ2 A;  1LD8 A;  3D9M A;  3UM3 A;  4V3I A;  4WND A;  2MRI A;  5ANR A;  4YND A;  5LP0 A;  4FHK A;  3DSU A;  3SY2 A;  4A1G A;  4RVB A;  3Q15 A;  1H19 A;  3HXB A;  2JEK A;  4G1T A;  3ZW3 A;  3D9N A;  2FO1 E;  3JQ0 A;  3MKQ A;  5AN8 A;  3MGB A;  3ULY A;  3LKU A;  4B93 B;  4UWG A;  3T5X A;  4CGW A;  5JJT A;  3D9K A;  3UKR G;  4LUN U;  3FU6 A;  4RQI A;  3DXK G;  5LOZ A;  1E8X A;  1MX4 A;  3S7D A;  3R7Q A;  5FQ6 A;  1KT1 A;  1K3Z D;  3U3W A;  1IQU A;  5FIN A;  2LXM A;  3RAU A;  3PUK A;  2DWZ A;  3F6Q A;  3ZPJ A;  1TN8 A;  1UW4 B;  3ML9 A;  3TAX A;  4J8E A;  4XKC A;  4UWH A;  5DBK A;  2F0Y A;  4ILH B;  4RLY A;  4DX7 D;  4EQF A;  2CHW A;  4OAV B;  3SI5 A;  5ENS D;  4IRU A;  3SBS A;  3JXJ A;  2FI7 A;  2OND A;  2C2L A;  3U9W A;  1RZ4 A;  3ASN E;  5DIZ A;  3FUD A;  4BFR A;  3BG0 B;  3B7R L;  3O48 A;  5EDS A;  1EYH A;  4ACL A;  3K9I A;  4ILI A;  4ANV A;  4XIF A;  4FHJ A;  1G3N B;  3SF4 A;  1DVP A;  2C0L A;  4KZ0 A;  3EHN A;  4PS8 A;  4CDM A;  1BU9 A;  3ABM E;  2EIJ E;  3R9M A;  3QB2 A;  5E75 A;  1N95 A;  3C72 A;  2IU1 A;  1Q2Z A;  2VYI A;  4DX2 A;  2YHE A;  3T8M A;  2E2E A;  4QQI A;  3FUK A;  1OWP A;  2M63 A;  3O4Z A;  2WMN A;  1JWF A;  1DC2 A;  3UX4 A;  1TNY A;  4GZD A;  3OTN A;  4JL0 A;  3CSF A;  1X5B A;  4EEC A;  2R5S A;  2IEJ A;  2A4Z A;  2X6J A;  5ENT D;  4BES A;  4F7A A;  1EPU A;  3Q79 A;  3G2W A;  4PUC A;  2IF4 A;  4JHK A;  4YVQ C;  1YYH A;  3B95 A;  5CMW A;  5BW8 C;  3EJN A;  1AP7 A;  3FEY A;  4TXR A;  5BXO A;  1Z6T A;  2VTB B;  3B13 A;  3EHM A;  4GML A;  1SZA A;  3I4R B;  2GRL A;  2I9C A;  4B8C B;  2IQC A;  3AS5 A;  4IUL A;  1N4Q A;  3ML8 A;  2OEV A;  3UM0 A;  4HOT A;  1MZC A;  4YDO A;  4FLH A;  1MYO A;  4U95 D;  2IY0 C;  1N4P A;  3TJP A;  1QNF A;  3UKU G;  2WXI A;  4EHM A;  4EPZ A;  2KZT B;  5EYL A;  1O1T A;  5AQ9 A;  3GZS A;  3BQO A;  3B7S A;  1HXI A;  4K5B A;  4BT8 A;  1RW2 A;  2J8S D;  3DEP A;  3GZ2 A;  3UI2 A;  5BT1 A;  1N94 A;  3PS6 A;  3CVP A;  4H7Y A;  2V5F A;  3VLF A;  4F1P A;  2DYR E;  2A5U A;  3CVU A;  2V4H C;  2EQX A;  5G04 C;  1VDY A;  3FUJ A;  1FVF A;  5KNH D;  1TR4 A;  2CHZ A;  3SNX A;  4N5C A;  4J8S A;  3ZXP A;  2UY1 B;  1OY3 D;  5CEC B;  2OVB A;  1TN6 A;  3TWQ A;  4EBA A;  1L5J A;  3AU5 A;  1WDY A;  3ULE G;  3U66 A;  5AQA A;  3SFX A;  2L9B A;  1ELW A;  1PAQ A;  4AVX A;  2YQ8 A;  3D9H A;  2P58 C;  5FQ4 A;  1IXV A;  1PY1 A;  1GW6 A;  4JEH A;  2WXK A;  2BKK B;  4ANX A;  2WXM A;  3I4G A;  3AG3 E;  4WWN A;  3CHR A;  1U3D A;  1Z5S C;  5G04 J;  3EHR A;  1WAO 1;  3IXE A;  1JCQ A;  4BSX A;  1ZU2 A;  4I17 A;  1ELR A;  2KXP C;  5JJ7 A;  4I6G A;  1UOH A;  2DCP A;  3VLE A;  3G2U A;  3LY8 A;  3ZYQ A;  4OYS A;  2RD0 A;  2P9S G;  1JPL A;  3WG7 E;  2GRQ B;  3FTY A;  3ZEF A;  4GTR A;  3AJI A;  3EU9 A;  4HRM B;  2I6H A;  3JQ1 A;  1KT0 A;  2FBN A;  3MKQ B;  2YNQ A;  3BEE A;  2DZN A;  3LEW A;  1N9A A;  3D9O A;  3MZL B;  2KM4 A;  4JHR A;  4N39 A;  3CHM A;  4WNG A;  3ZN3 A;  5BXU A;  4FP7 A;  2P9P G;  4XZ4 A;  5D0Q D;  3W9G A;  2P9N G;  1QZ2 A;  3R7R A;  3HDX A;  3MYV A;  1OUV A;  3RRM B;  5FQ7 A;  3L82 A;  4NAC A;  3G2S A;  1E8Y A;  4HI9 A;  3D9P A;  2VGE A;  3DWL G;  3AU4 A;  3LY9 A;  3PDN A;  2XEE A;  5KJL A;  4CCA A;  3JCK C;  3BUA A;  1E96 B;  5CCM A;  1OCC E;  3CIA A;  4FA6 A;  4BTB A;  4UI9 C;  4U8H A;  4HOQ A;  2V0P A;  4KBQ A;  2NXP A;  3SGH A;  4J8D A;  5ARF A;  3RKV A;  2J09 A;  4I2W A;  4EBA G;  1OWM A;  2QC9 A;  3FH7 A;  3Q9N C;  4LEU A;  4CZ2 D;  5J08 A;  3ASH A;  1OCO E;  2J07 A;  1ZBP A;  5EIL A;  1NA3 A;  4BSZ B;  4L9P A;  5HQ8 A;  4O1O A;  1N4R A;  3PEU B;  3ZFW A;  3FTU A;  2Y0B G;  4HRL A;  2GRO B;  3TWW A;  5EID A;  5CBO A;  4X8Q A;  4N3C A;  1UN8 A;  5FJY A;  5BPP A;  5BNW A;  3DBS A;  3PH0 C;  2F8Y A;  3RK6 A;  5AAO A;  5D2M C;  2XS8 A;  3PZD A;  4UI9 J;  2J4D A;  2LO6 A;  2PM6 A;  4LER A;  4AV7 A;  3ESL A;  3E34 A;  2VGY A;  3TWX A;  2KC7 A;  5FZS A;  3LJN A;  4L7T A;  1FT1 A;  1H2T C;  1V54 E;  3OAW A;  5CRU A;  4APF A;  4BWR A;  3KD7 A;  4KXK B;  3KEZ A;  4HOR A;  3OXL A;  2NYJ A;  1UJK A;  2L0T B;  4R7L A;  4A3V A;  1IKN D;  2AW6 A;  2JAB A;  4WWO A;  4BX8 A;  4K5A B;  1K1A A;  3MX3 A;  3CHQ A;  1W3B A;  5FIO A;  4I1O B;  4A3T A;  5BV1 A;  1OXJ A;  4M7C A;  2IFU A;  4XKB A;  1FPP A;  2X6I A;  3Q7A A;  3FU3 A;  4C48 B;  2MOW A;  4F3V A;  2GGF A;  2GRP B;  2BUG A;  4HQD A;  1NP7 A;  3V79 K;  2WXG A;  3ZU7 B;  2LXL A;  4FC8 A;  4GB9 A;  1O5M A;  1IYG A;  3FFL A;  2WPV A;  3FU5 A;  4GZ5 A;  3TG5 A;  2EIL E;  3VTY A;  2GRM A;  4FJY A;  2R05 A;  2QYU A;  4O60 A;  1YCS B;  2AXU A;  3KEA A;  2XCB A;  4YDY A;  2BKG A;  4ANW A;  5CHE E;  1HS6 A;  3EDT B;  4JXT A;  2C0M A;  3SQV A;  2OVF A;  4GTT A;  1K1B A;  3E30 A;  2ETB A;  3HVE A;  2WM9 A;  4C0E A;  3X2Q E;  3CEQ A;  2WMO A;  1INZ A;  3KAE A;  3Q7F A;  4OAU C;  1SA5 A;  1TJC A;  3ULQ A;  4APO A;  3D3M A;  4XEI G;  4GMJ A;  5EX0 A;  2HM8 A;  3ZYK A;  4GTV A;  3V31 A;  3NOG D;  5AQ7 A;  2QYJ A;  4KT6 B;  4I9E A;  1Y8M A;  5HS0 A;  5D0O D;  3PUJ A;  3DST A;  3FDH A;  1A17 A;  1BI7 B;  3UIP C;  3GYZ A;  1S0P A;  2KCL A;  2XGM A;  4K03 A;  1MQS A;  2GW1 A;  3EIQ C;  1NFI E;  4UWF A;  1NL4 A;  1A5E A;  3IKO B;  2J9Q A;  3UIO C;  2Q7F A;  4MKT A;  3ASD A;  4K0R A;  2LAI A;  1OCR E;  3BG1 B;  3URZ A;  4MBG A;  3UQ3 A;  3V2X A;  3QNK A;  2B0O E;  4FU3 A;  3PRZ A;  3TXN A;  1SVX A;  3NZS A;  1HFA A;  4FAD A;  4L23 A;  3ABK E;  1QYM A;  3SO8 A;  3ZGQ A;  3RSE G;  3DEO A;  2X38 A;  4DI3 A;  3QC1 A;  1DNP A;  3IHV A;  2XPZ A;  2XZT G;  2XCC A;  4N2S A;  1JUQ A;  2XRY A;  5CEA A;  1FVH A;  4J6I A;  4JW1 A;  2E0I A;  3S7B A;  4GYY A;  4DK5 A;  4FUL A;  4NQ0 A;  3Q47 B;  5T8I A;  4H7X A;  2BED A;  3QJZ A;  2WQ6 A;  5ARG A;  4G11 A;  4WWP A;  3CVN A;  2Y3A A;  4HLE A;  1HG5 A;  1H2U A;  3CQG B;  1UJJ A;  2AXV A;  2KBX A;  4CT0 A;  1E8Z A;  1O1S A;  5JA4 D;  3CVV A;  3HG0 D;  5FTP A;  5KWD A;  3E4B A;  1Y6I A;  3ASG A;  3AS8 A;  3Q75 A;  3B7U X;  1FCH A;  3SFY A;  1P5Q A;  3D9J A;  4U0Z A;  2WXN A;  3EIJ A;  3UM1 A;  5EIB E;  1SW6 A;  4LNB A;  4L2Y A;  4P29 A;  5C1D A;  2BF0 X;  1IHG A;  4Q96 A;  2AJA A;  2OCC E;  2WXO A;  3E32 A;  2QFC A;  2ION A;  4I9C A;  3S7F A;  3T5V A;  3UT4 A;  2PM7 A;  3FHE A;  5AJD A;  3CQC B;  3CLJ A;  4HOU A;  1H2V C;  5HKP A;  1HH8 A;  3NAW A;  4OVV A;  1EF1 C;  4GPM A;  3FH8 A;  1S63 A;  4U04 A;  3ZYL A;  4ACK A;  3LYA A;  5EYP F;  4JA9 A;  3LY7 A;  2DIW A;  4TXQ A;  5ENR D;  4K5C A;  5J90 A;  3B7B A;  4XX5 A;  1Z3X A;  4BT9 A;  3P1U A;  4HLL A;  3TG4 A;  3HRA A;  2VSY A;  3ZXS A;  5CED B;  2XPY A;  2DBA A;  4E6H A;  4D10 C;  2X6K A;  2NSZ A;  3PNL B;  3CK8 A;  4U8Y D;  3JXI A;  4Q94 A;  4HB5 A;  3LDZ A;  4WNE A;  3QK0 A;  1DCE A;  5ITZ F;  2Y1L E;  4Y6W A;  4TXP A;  2VGX A;  4CRW A;  1E90 A;  1OCZ E;  3ASO E;  1Z3Y A;  4G2V A;  3AG1 E;  3L08 A;  5B1B E;  2EIN E;  3MCX A;  4B8A A;  3ZKJ A;  2EIK E;  4PH4 B;  2YHC A;  3DPY A;  5IY5 E;  2XPI A;  1H6P A;  4ATG A;  3UM2 A;  2GRN B;  4WUY A;  1NA0 A;  1D9S A;  5ENN A;  4GTP A;  3FUH A;  3FTZ A;  4C0M A;  2WXF A;  1U3C A;  2H6H A;  3HVE B;  2RFA A;  2WXJ A;  1HE8 A;  5LX8 A;  1N52 A;  3FTV A;  3I5P A;  1QBQ A;  2P9I G;  4M3O A;  2WQH A;  3V30 A;  1N11 A;  3P2B A;  4CEM A;  2NC9 A;  2CG2 A;  4AM9 A;  4N5Q A;  3SFZ A;  4GA1 A;  5C2Y A;  4YVO A;  4GCO A;  4GU5 A;  4URK A;  2MYO A;  1KZO A;  2AXZ A;  3JUI A;  2IO3 C;  3TWR A;  3N71 A;  1X81 A;  3E33 A;  1MHQ A;  3ZRH A;  2J4B A;  2PQN A;  1H0A A;  1YMP A;  3C5R A;  3EHQ A; 
#chains in the Genus database with same CATH homology
 5H7P A;  2LUH A;  2LXM A;  2LXL A;  2RKK A;  4TXQ A;  4TXP A;  4U7E B;  4TXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...