3WG7E

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3wg7E00
3ABKE 2EIME 1V54E 3ABME 1OCOE 5B1AE 2EIJE 5IY5E 3ABLE 3AG4E 5B1BE 3AG3E 5B3SE 1OCRE 3WG7E 2DYRE 2EIKE 2DYSE 2OCCE 3ASOE 2EINE 1V55E 1OCZE 3AG1E 3AG2E 1OCCE 3ASNE 3X2QE 2ZXWE 2EILE 2Y69E
chains in the Genus database with same CATH superfamily
3FULA 3QAQA 3Q7AA 4TUUA 2Y3AA 2CHZA 1HZ4A 2WQ6A 5ANRA 3ONKA 3RRUA 2IEJA 3UMVA 2PNNA 1MYOA 4U8YD 4IRUA 4BT9A 3G2VA 3QARA 3F6QA 3Q9NC 3CVVA 3OXLA 3I4RB 2L0TB 5FINA 3SF4A 1N11A 5JA4D 3SZ7A 3B7SA 2XGMA 1S63A 4DI4A 4HRNA 1HXIA 3QWWA 4HBDA 2B0OE 4AM9A 4B89A 1X81A 2PZIA 2AVPA 2FO7A 4JA9A 2MRIA 3SY2A 4B8CB 3CQCB 5A23A 2QFCA 4XX5A 4BERA 4ABNA 1NA0A 3LCAA 4PS3A 1O1SA 1Q2ZA 2Y1LE 3CVYA 4NACA 5T8IA 4B93B 1MZCA 3PZ3A 3JXIA 1TN8A 3PEUB 3L9TA 3I4GA 3LJNA 2LXLA 3FDHA 4N39A 5BW8C 1V54E 2XENA 4O6FA 3TWTA 2P2CP 1N52A 2IO2C 2J49A 4D10C 4IULA 4I6GA 1JWFA 5ENNA 5J08A 4CT4A 1Y8MA 4FC8A 1OCZE 4A1SA 3AU4A 3T8KA 3EHNA 2RG8A 3CHRA 3NOGD 3FTZA 5ARFA 4LERA 3LKUA 3BG1B 3MCXA 1Z3XA 5BNWA 3PNLB 4HI8A 1HO8A 1Z5SC 3ZU7B 4UWHA 3VLEA 5JJ7A 5CECB 3EHRA 1HX8A 4FP7A 4HI9A 3UM1A 5FWQA 4J8SA 4C9BB 4AP2A 3MYVA 4I1AA 5B1BE 2J07A 1TN6A 4BTBA 4V3IA 2KATA 4JHJA 4I2WA 4A63B 2VYIA 3FEYA 1MX6A 1ELWA 1H2UA 3SNXA 3ASDA 2IF4A 1OUVA 1QBQA 2OVFA 3AS4A 5CRVA 1N94A 2P58C 4MLPA 3FFLA 4GZ3A 3VLFA 3N71A 3D9MA 3T5XA 3FH7A 3RSEG 3PNTB 4N3CA 2V4HC 3SO8A 4DX5D 2AXVA 2V0PA 3IXEA 4WNFA 3Q73A 4HS2A 2LSUA 4U07A 5A7DB 1BD8A 3ZUVB 3DSWA 2PQNA 4HOTA 3TWVA 2WMOA 1OCOE 2IOLA 4WAFA 2X38A 4BFRA 3FTWA 4U0SA 1NFIE 1H6PA 5BXOA 5J90A 2XRZA 1UJJA 4YNDA 2E2EA 5EYLA 4DX1A 3E37A 1KZPA 2UY1A 4CDRA 2VGXB 3PE4A 2HM8A 1WM5A 2Y4TA 2RD0A 1W3BA 5T4YA 1UG3A 3DWLG 2WQ7A 1OWMA 1H2TC 4BESA 2KC7A 3G2UA 5JMND 3C3RA 3NBNB 3JQ1A 3APDA 5AAOA 3FTXA 3RO2A 2XZDG 3L16A 3V2OA 5D0OD 4A1GA 4I6JA 4LG6A 3DEOA 3UKRG 2V4LA 4ILHB 4LNUD 2HO1A 2BKGA 3MJWA 2X6FA 5CMWA 2A5EA 3KS2A 3UPVA 4XKCA 1NL4A 4HLEA 3QNKA 2LXMA 3B7BA 1U3DA 4APFA 3ZXPA 4HOQA 5AQBA 3JCKC 2YNQA 1ZB1A 1BU9A 3AS5A 4MKTA 5H7PA 4GZ5A 5KJLA 4AV7A 3DPYA 3MKRA 4ZFHA 2YHCA 1DCQA 1N0QA 3I3NA 2CG2A 3QB2A 4UUCA 1D8EA 4AY5A 1SA4A 3WG7E 1ZU2A 2OOEA 5C2YA 3CHMA 4F3VA 5FQ8A 1FT1A 3ZVVA 5M72A 1YYHA 1OCCE 1VDYA 1ZBPA 4L2LA 4CT0A 2VQ2A 1TNYA 4I2ZA 4JA7A 4UWGA 3T8MA 2J4DA 3P1UA 2WXNA 4G8LA 2LAIA 2F8XK 3UX4A 3RIBA 3E32A 1FCHA 2NXPA 5FZRA 4XKBA 4PS7A 4RG6A 5CEDB 4KMOA 3Q4AB 4ANVA 3RRNB 2DWZA 3LY8A 4G26A 3EHQA 4HQDA 4BEPA 1HF8A 4F53A 4ZHBA 1JWGA 3ASFA 2EQXA 3CV0A 4K5BA 2L9BA 3ULEG 3RO3A 3DPDA 3D9KA 4UWLA 5KNGA 3SD5A 1PY1A 3DSSA 1LTXA 3S7BA 1DVPA 2P9KG 3FUEA 2MHKA 1PC2A 4DX7D 3QJZA 2X3MA 3PDNA 3UM2A 4DLOA 4HOUA 3MX3A 3EHMA 4C48B 3NF1A 3T9KA 3TAXA 4CDNA 4BY6A 1E8ZA 4OVUA 1Z3YA 2WPVA 4KT6B 3Q47B 2DYSE 3FTYA 3HVEA 1OWLA 1A5EA 3ZFWA 2X6KA 4J6IA 2HYZA 2EIME 1E90A 1D8DA 1UJKA 3Q7FA 3U3WA 2VTBA 2GRQB 4H7YA 2X6HA 4HRLA 3TG4A 3FUHA 1ELRA 3KSLA 4O1OA 3DEPA 4CGWA 4GMJA 3SGHA 3NZSA 4MBGA 3UT8A 4I1OB 5ENTD 2FBNA 3OXGA 1O1TA 3D9OA 4DI3A 2KZTA 3JUIA 2R5SA 4RQIA 3CVWA 3Q5MA 4I43A 2QZAA 1S0PA 2R2LA 5EIDA 3URZA 5LCWC 2J8SD 2C2LA 5HRYA 3PZDA 3DSXA 1TJFA 4N5QA 3L82A 5AQAA 2BEDA 1QQEA 2GRPB 4J7WA 1SZAA 2EILE 3HHMA 3CR3A 4K03A 4MRUA 4O60A 5DIZA 2WXPA 3D3MA 4N2QA 4GTVA 3DSUA 1E7UA 3UTMA 2HE0A 2V5QC 4JHKA 3V79K 4EZLA 5CMYA 1LD7A 4NIKA 1GW6A 3CVQA 5AENA 1TR4A 4OVVA 4EZKA 3ASNE 3RJVA 2H6HA 3SFZA 4BTAA 4KVMA 2P9IG 3LPZA 3Q9UC 1KT0A 5JJ6A 1H6KA 4EBAG 2RFMA 4Q96A 1QNFA 4EQFA 4LEUA 4PS8A 4LNBA 3RK6A 5BV1A 3KEAA 2CFUA 4UWFA 4YDOA 3FUKA 4F1PA 3FU3A 1ELKA 2KCVA 5D2MC 3E33A 2GW1A 4I17A 5FJYA 4FJYA 5ENPD 5BXUA 3B95A 4FLBA 1AWCB 2BUGA 1HG5A 4Z68A 2WXIA 3D9IA 3QDNA 2KBXA 1IYGA 1IKND 3CQGB 2F8YA 4BWRA 5EN5D 1UW4B 2OEWA 4HLLA 4GTTA 3R7QA 4J8DA 1MX2A 3IV0A 2VSNA 3KD7A 4BX8A 3W9GA 3CSTA 3D9NA 2VSXE 4G2VA 1DNPA 4KXKB 3ONLA 2GRMA 2P9SG 1OY3D 1UOHA 3ESLA 3ZHEA 3CHSA 2WQHA 3CVLA 2MOWA 2LO6A 3HIZA 3TWSA 3AG1E 5EX3A 4TUMA 2A4ZA 3ULQA 4GPKA 4HRMB 3LVQE 2XS8A 3RU0A 1TYQG 2H6GA 4ME2A 5HS0A 2NYJA 2I6HA 4AEZC 1MJ0A 4L7TA 4K5CA 4GA2A 3B7TA 1WY6A 4WNEA 3IHYA 2X6IA 1MQSA 2Y4UA 3IHVA 3KSQA 5G04J 2WXQA 4JVSA 2R02A 3HXFA 1N4PA 3ML9A 5G05J 3C5RA 3NOCD 1BPOA 3Q75A 2OEVA 2BTDA 1QYMA 3VLDA 4NQ0A 2GRLA 3ABKE 4G23A 3ZKJA 2DZOA 1S70B 4W9RA 3DBSA 4C0EA 3C3QA 2LSVA 4U63A 4GZ6A 2UWJG 2HR2A 1RW2A 4YDYA 3ISMC 3G2TA 3K9IA 4LSZE 3FUMA 4GMRA 1U3CA 3HG0D 1WDYA 3DSTA 1E96B 3UUXA 5A6CA 1YA0A 3AU5A 2XCCA 4XEIG 2E0IA 4DX6D 4DUIA 1TNZA 3U66A 1K3ZD 1OWNA 3FUDA 1XNFA 4J8FA 4IYPA 4YVQC 2QC9A 4FHJA 3PEVB 3BG0B 1EF1C 4XE0A 5CBOA 3LDZA 4DRXE 5LCWJ 1TNUA 4B0ZA 2WXKA 3CK8A 2CG3A 1FVFA 4HXIA 3U64A 4JEUA 4L1BA 2QYUA 4YDEA 3LEWA 3KAEA 4YDWA 4U7EB 1O1RA 4U96D 1L5JA 1MHQA 1TJCA 4A3VA 5HQ8A 1KLXA 2CFZA 4JW1A 3PH0C 3FTSA 4DK5A 3OAWA 4DPRA 2XEVA 3QOUA 4GCNA 5KWDA 5D66A 5CRUA 2WM9A 2LAHA 3SHFA 3TG5A 3IEGA 4JPSA 2GRRB 3WXXA 3FHEA 4FULA 4BT8A 2PM6A 5EIBE 5BPPA 1H2VC 2R03A 5AN8A 2C0LA 2WXOA 1MX4A 3ZYLA 4ACKA 3V31A 5JJTA 4OAVB 2P9LG 1PAQA 4AVXA 4LCTA 2M63A 3L22A 2LNIA 5AQ9A 3RAUA 4AXHA 2OCCE 3JYSA 4N5CA 4NRHB 3D9HA 4Y6WA 2F0YA 2BKKB 3CHOA 2I2OA 4L9PA 3Q79A 4XZ4A 3CVPA 4EECA 4GTRA 5LOZA 2FI7A 3ZGQA 2XEHA 2R17C 4GYOA 3LJ3A 3UI2A 4JD2G 3UM0A 1IHGA 3ENEA 5LP0A 4I1MA 3FEXA 4RLYA 3LY7A 3O48A 3IBEA 1EDUA 4UI9C 2FEZA 3S2AA 3AG3E 4U04A 3NQPA 3MZLB 2MYOA 3L13A 4L23A 2I1KA 4GTSA 3VTXA 4FLHA 3E4BA 4L2YA 1AP7A 3GZSA 5FQ7A 3S7FA 4WNGA 1N0RA 1KT1A 3L08A 4M7CA 3GZ2A 1INZA 5EYPF 3UIPC 5FQ6A 3BQOA 3CVNA 3SI5A 3UT4A 2IO3C 3MV3B 2OV8A 2Y0BG 2BF0X 5LFAA 3Q49B 3GZ1A 4KBQA 3X2QE 1G3NB 2A5UA 3D9JA 4RVBA 3R7RA 3VTYA 3MKQB 2QY7A 4XIFA 5EKQD 3HDXA 4GA1A 4TV3A 2J9QA 4F6RD 1SZ9A 3NZUA 3C72A 5HKPA 2Q7FA 1JCQA 2EINE 3HYMB 4BSZB 2AW6A 2GGFA 4HNAD 3APCA 3T5VA 3CKCA 2OVBA 4C0MA 1EPUA 3ZYMA 3AG4E 5ANLA 5KCMA 4GB9A 1K1BA 3ZW3A 5JHBA 4IN3B 5G04C 4CGVA 4N3BA 2LUHA 3HVEB 5G05C 3HXEA 4KZ0A 4GTOA 5ENOD 3QWPA 3RKVA 1HH8A 2CHWA 4JHRA 3D9PA 1P5QA 1IQUA 3JUEA 4U8HA 4JXTA 5CERB 1SA5A 3TL5A 3OTNA 3PS6A 1UN8A 3CLJA 3ZYKA 2X6JA 1SW6A 3I5PA 5AJLA 1QZ2A 2Y69E 4U0UA 2AXZA 3QK0A 2KZTB 2ZGGA 3UT7A 3UINC 2F37A 5CCMA 3TWXA 1V55E 2J08A 2WB2A 3DSVA 4QQIA 5CBNA 1E7VA 4A55A 3PZ1A 4HB5A 4YVOA 4ATZD 3PZ2A 3ZNGA 3R9MA 4E6HA 4AY6A 3U9WA 4G8KA 5FT9A 4CZ2D 2C0MA 3FU5A 4WNDA 4U8VD 1JPLA 4AOFA 2WXJA 3UIOC 4XI0A 3GW4A 2WXRA 3IKOB 3BEEA 4ACLA 3CIAA 4X8QA 5ENQD 4G24A 2ZU6B 4NURA 4B8AA 4BSXA 4O1PA 3ABME 1A17A 1DCEA 4ILIA 3BU8A 2XCBA 1H6OA 3GYZA 1NA3A 2XPIA 4E85A 4Q69A 4ATGA 4TXPA 3DXKG 3PZ4A 1K8KG 1Y6IA 2DBAA 4UQYA 4URKA 1WG0A 2JABA 1OXJA 4WWNA 3CHQA 1FT2A 1OWPA 3Q15A 4K5AB 3FUFA 3FH5A 1E8YA 2IFUA 2ETAA 2KCKA 4UI9J 2NSZA 4GYYA 4U0ZA 3LY9A 3UQ3A 1BI7B 1IHBA 2ZISA 2ILRA 3TWQA 3JQ0A 5FQ4A 3S7DA 1BLXB 3NAWA 2WXGA 3FWVA 3CK9A 2EIJE 1NP7A 3ZHEB 4I9CA 3EU5A 4ILGA 4GMLA 1JCRA 3EDTB 2H6FA 2KM4A 3APFA 4F7AA 1E8WA 3SBTB 4ANWA 5ENRD 2AWIA 5B1AE 3FUIA 1OT8A 4FADA 3ULYA 3O4ZA 3JXJA 2DYRE 3UXGA 2XPZA 2IU1A 2XZTG 4GZCA 5KBAA 4GCOA 3V30A 3RRMB 4RG9A 2JLBA 5IY5E 2WXHA 2XPYA 2JEKA 4TXQA 4AIFA 3QKYA 1X5BA 2VJ8A 2DCPA 4WWPA 3R9AB 3SFYA 4EBAA 4FA6A 3G2SA 4JC8A 4GA0A 3CSFA 4CEMA 3PUKA 2WXLA 2J4BA 4JZYA 2XHEA 1OCRE 3TXMA 3LXUX 2PL2A 4OAUC 3ASOE 3EU9A 4U95D 5BV0A 4DX2A 4OYSA 3BUAA 4TXRA 1WAO1 3FP3A 2ZIRA 4DLQA 3CVXA 3C98A 1LD8A 3CKBA 1NZNA 4G11A 1N95A 2DIWA 3AS8A 2QYJA 4G25A 3D9LA 2R59A 1SQMA 4KVOA 2IQCA 3LYAA 5AQ7A 1NI1A 5KNHD 4HVBA 1N4QA 4UQXA 1RZ4A 4I9EA 3SQVA 1HU3A 4XI9A 5G2NA 3SFXA 3EIJA 2L6BA 5LX8A 4EZJA 2I1JA 5HI7A 3CK7A 1H0AA 3ASHA 1XGWA 2P9PG 4J8YA 1DC2A 2GRNB 3U4TA 1U2VG 1KPSB 1H19A 2UY1B 5E75A 3FUJA 1EYHA 4B94A 3CEQA 2YHEA 1E8XA 3FUNA 3TWUA 3FU6A 5FZQA 3B7RL 3EJNA 3LS8A 5EX0A 2ONDA 3UKUG 2L0IA 3S7JA 3ZXSA 4PH4B 2WXMA 4FJZA 4PUCA 1YCSB 2PQRA 1HS6A 3DRAA 3CVUA 2VGXA 5B3SE 3HXDA 4FU3A 5BT1A 2FULA 4N2SA 3FY4A 3ZN3A 2EIKE 4Q94A 2VGYA 3EIQC 2ZGDA 3L17A 4GPMA 3UM3A 5KJKA 4GTMA 2DVWA 4WUYA 3ML8A 3MA5A 5G55A 5CHEE 4ANXA 3C3OA 5AIJA 4APOA 5C1DA 4UQZA 2WXFA 2WMNA 4CYMD 3PVLA 5D0QD 4GAAA 2XEEA 3AAAC 2B6CA 4EHMA 2XQ0A 3E30A 1JUQA 3CGHA 3ASGA 4FHKA 1TEZA 3L54A 3J5QB 2VGEA 1O5MA 4PDXA 1FVHA 5ARGA 1N4SA 3PRZA 2XGSA 4J0UA 4MS6A 5E76A 3G2WA 3FH8A 3ZEFA 3P2BA 4KYOB 3FTUA 1N4RA 1N54A 5BUZA 1LF8A 2P9UG 2L6JA 4BX9A 1UN9A 5KJMA 3L6AA 4HFGA 4CDMA 2RKKA 3AG2E 2VSYA 2FF4A 2XGOA 1Z6TA 3TXNA 3W9FA 3QC1A 4LRZA 3B7UX 5CCLA 3B13A 3E34A 2I9CA 1BI8B 3HXCA 2IOSA 5CEAA 2P9NG 4GTQA 4HOSA 2NC9A 1B89A 4DJAA 5AJDA 3TJPA 3TWWA 3DXMG 4Y6CA 2WVIA 5ITZF 3PUJA 3QWVA 2IONA 4AJWA 4GTPA 2CHXA 2VSOE 5FTPA 1N9AA 1JCSA 3LVRE 3ESKA 4LNGA 5AARA 3MKQA 4GU5A 1IXVA 2AJAA 2GROB 2PM7A 1OWOA 3MV2B 2ETBA 3HRAA 3AJIA 2V8SE 1KZOA 1IQRA 4KZCA 2ETCA 3J5PA 4K0RA 3ABLE 2VTBB 2RFAA 1HG2A 4EPZA 2DZNA 4N3AA 4BETA 4JL0A 5JHAA 1D9SA 4M3OA 5KJNA 2ZXWE 4F1SA 5ENSD 4J8EA 5EILA 3FTVA 4RSYA 4H7XA 4G1TA 4CCAA 1SVXA 1FPPA 4P29A 3OXFA 4QFVA 4R7LA 4WWOA 3Q78A 3V2XA 4ANUA 4JEHA 3PE3A 3ZIMA 2R05A 4TRQA 2YQ8A 1TN7A 2IY0C 5DBKA 4I6EA 5EDSA 1HE8A 3PREA 2KCLA 3HXBA 4A3TA 3ZPJA 2H6IA 2XS1A 5FZSA 2AXUA 2YINA 5T3RA 4GZDA 3NB2A 2J09A 3MEKA 3ZYQA 4JB8P 1HFAA 1TNOA 2KXPC 3TGOA 4HORA 3CHPA 4CRWA 1S64A 1TNBA 1YMPA 4LUNU 4UI9K 1K1AA 4UWKA 2IJGX 3EUVA 5FIOA 3MGBA 2V5FA 3ZRHA 3TWRA 5AYWD 3FU0A 4GYWA 3SBSA 2XRYA 3KEZA 2FO1E
chains in the Genus database with same CATH topology
3ABKE 2EIME 1V54E 3ABME 1OCOE 5B1AE 2EIJE 5IY5E 3ABLE 3AG4E 5B1BE 3AG3E 5B3SE 1OCRE 3WG7E 2DYRE 2EIKE 2DYSE 2OCCE 3ASOE 2EINE 1V55E 1OCZE 3AG1E 3AG2E 1OCCE 3ASNE 3X2QE 2ZXWE 2EILE 2Y69E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABK E;  2EIM E;  1V54 E;  3ABM E;  1OCO E;  5B1A E;  2EIJ E;  5IY5 E;  3ABL E;  3AG4 E;  5B1B E;  3AG3 E;  5B3S E;  1OCR E;  3WG7 E;  2DYR E;  2EIK E;  2DYS E;  2OCC E;  3ASO E;  2EIN E;  1V55 E;  1OCZ E;  3AG1 E;  3AG2 E;  1OCC E;  3ASN E;  3X2Q E;  2ZXW E;  2EIL E;  2Y69 E; 
#chains in the Genus database with same CATH topology
 3FUL A;  3QAQ A;  3Q7A A;  4TUU A;  2Y3A A;  2CHZ A;  1HZ4 A;  2WQ6 A;  5ANR A;  3ONK A;  3RRU A;  2IEJ A;  3UMV A;  2PNN A;  1MYO A;  4U8Y D;  4IRU A;  4BT9 A;  3G2V A;  3QAR A;  3F6Q A;  3Q9N C;  3CVV A;  3OXL A;  3I4R B;  2L0T B;  5FIN A;  3SF4 A;  1N11 A;  5JA4 D;  3SZ7 A;  3B7S A;  2XGM A;  1S63 A;  4DI4 A;  4HRN A;  1HXI A;  3QWW A;  4HBD A;  2B0O E;  4AM9 A;  4B89 A;  1X81 A;  2PZI A;  2AVP A;  2FO7 A;  4JA9 A;  2MRI A;  3SY2 A;  4B8C B;  3CQC B;  5A23 A;  2QFC A;  4XX5 A;  4BER A;  4ABN A;  1NA0 A;  3LCA A;  4PS3 A;  1O1S A;  1Q2Z A;  2Y1L E;  3CVY A;  4NAC A;  5T8I A;  4B93 B;  1MZC A;  3PZ3 A;  3JXI A;  1TN8 A;  3PEU B;  3L9T A;  3I4G A;  3LJN A;  2LXL A;  3FDH A;  4N39 A;  5BW8 C;  1V54 E;  2XEN A;  4O6F A;  3TWT A;  2P2C P;  1N52 A;  2IO2 C;  2J49 A;  4D10 C;  4IUL A;  4I6G A;  1JWF A;  5ENN A;  5J08 A;  4CT4 A;  1Y8M A;  4FC8 A;  1OCZ E;  4A1S A;  3AU4 A;  3T8K A;  3EHN A;  2RG8 A;  3CHR A;  3NOG D;  3FTZ A;  5ARF A;  4LER A;  3LKU A;  3BG1 B;  3MCX A;  1Z3X A;  5BNW A;  3PNL B;  4HI8 A;  1HO8 A;  1Z5S C;  3ZU7 B;  4UWH A;  3VLE A;  5JJ7 A;  5CEC B;  3EHR A;  1HX8 A;  4FP7 A;  4HI9 A;  3UM1 A;  5FWQ A;  4J8S A;  4C9B B;  4AP2 A;  3MYV A;  4I1A A;  5B1B E;  2J07 A;  1TN6 A;  4BTB A;  4V3I A;  2KAT A;  4JHJ A;  4I2W A;  4A63 B;  2VYI A;  3FEY A;  1MX6 A;  1ELW A;  1H2U A;  3SNX A;  3ASD A;  2IF4 A;  1OUV A;  1QBQ A;  2OVF A;  3AS4 A;  5CRV A;  1N94 A;  2P58 C;  4MLP A;  3FFL A;  4GZ3 A;  3VLF A;  3N71 A;  3D9M A;  3T5X A;  3FH7 A;  3RSE G;  3PNT B;  4N3C A;  2V4H C;  3SO8 A;  4DX5 D;  2AXV A;  2V0P A;  3IXE A;  4WNF A;  3Q73 A;  4HS2 A;  2LSU A;  4U07 A;  5A7D B;  1BD8 A;  3ZUV B;  3DSW A;  2PQN A;  4HOT A;  3TWV A;  2WMO A;  1OCO E;  2IOL A;  4WAF A;  2X38 A;  4BFR A;  3FTW A;  4U0S A;  1NFI E;  1H6P A;  5BXO A;  5J90 A;  2XRZ A;  1UJJ A;  4YND A;  2E2E A;  5EYL A;  4DX1 A;  3E37 A;  1KZP A;  2UY1 A;  4CDR A;  2VGX B;  3PE4 A;  2HM8 A;  1WM5 A;  2Y4T A;  2RD0 A;  1W3B A;  5T4Y A;  1UG3 A;  3DWL G;  2WQ7 A;  1OWM A;  1H2T C;  4BES A;  2KC7 A;  3G2U A;  5JMN D;  3C3R A;  3NBN B;  3JQ1 A;  3APD A;  5AAO A;  3FTX A;  3RO2 A;  2XZD G;  3L16 A;  3V2O A;  5D0O D;  4A1G A;  4I6J A;  4LG6 A;  3DEO A;  3UKR G;  2V4L A;  4ILH B;  4LNU D;  2HO1 A;  2BKG A;  3MJW A;  2X6F A;  5CMW A;  2A5E A;  3KS2 A;  3UPV A;  4XKC A;  1NL4 A;  4HLE A;  3QNK A;  2LXM A;  3B7B A;  1U3D A;  4APF A;  3ZXP A;  4HOQ A;  5AQB A;  3JCK C;  2YNQ A;  1ZB1 A;  1BU9 A;  3AS5 A;  4MKT A;  5H7P A;  4GZ5 A;  5KJL A;  4AV7 A;  3DPY A;  3MKR A;  4ZFH A;  2YHC A;  1DCQ A;  1N0Q A;  3I3N A;  2CG2 A;  3QB2 A;  4UUC A;  1D8E A;  4AY5 A;  1SA4 A;  3WG7 E;  1ZU2 A;  2OOE A;  5C2Y A;  3CHM A;  4F3V A;  5FQ8 A;  1FT1 A;  3ZVV A;  5M72 A;  1YYH A;  1OCC E;  1VDY A;  1ZBP A;  4L2L A;  4CT0 A;  2VQ2 A;  1TNY A;  4I2Z A;  4JA7 A;  4UWG A;  3T8M A;  2J4D A;  3P1U A;  2WXN A;  4G8L A;  2LAI A;  2F8X K;  3UX4 A;  3RIB A;  3E32 A;  1FCH A;  2NXP A;  5FZR A;  4XKB A;  4PS7 A;  4RG6 A;  5CED B;  4KMO A;  3Q4A B;  4ANV A;  3RRN B;  2DWZ A;  3LY8 A;  4G26 A;  3EHQ A;  4HQD A;  4BEP A;  1HF8 A;  4F53 A;  4ZHB A;  1JWG A;  3ASF A;  2EQX A;  3CV0 A;  4K5B A;  2L9B A;  3ULE G;  3RO3 A;  3DPD A;  3D9K A;  4UWL A;  5KNG A;  3SD5 A;  1PY1 A;  3DSS A;  1LTX A;  3S7B A;  1DVP A;  2P9K G;  3FUE A;  2MHK A;  1PC2 A;  4DX7 D;  3QJZ A;  2X3M A;  3PDN A;  3UM2 A;  4DLO A;  4HOU A;  3MX3 A;  3EHM A;  4C48 B;  3NF1 A;  3T9K A;  3TAX A;  4CDN A;  4BY6 A;  1E8Z A;  4OVU A;  1Z3Y A;  2WPV A;  4KT6 B;  3Q47 B;  2DYS E;  3FTY A;  3HVE A;  1OWL A;  1A5E A;  3ZFW A;  2X6K A;  4J6I A;  2HYZ A;  2EIM E;  1E90 A;  1D8D A;  1UJK A;  3Q7F A;  3U3W A;  2VTB A;  2GRQ B;  4H7Y A;  2X6H A;  4HRL A;  3TG4 A;  3FUH A;  1ELR A;  3KSL A;  4O1O A;  3DEP A;  4CGW A;  4GMJ A;  3SGH A;  3NZS A;  4MBG A;  3UT8 A;  4I1O B;  5ENT D;  2FBN A;  3OXG A;  1O1T A;  3D9O A;  4DI3 A;  2KZT A;  3JUI A;  2R5S A;  4RQI A;  3CVW A;  3Q5M A;  4I43 A;  2QZA A;  1S0P A;  2R2L A;  5EID A;  3URZ A;  5LCW C;  2J8S D;  2C2L A;  5HRY A;  3PZD A;  3DSX A;  1TJF A;  4N5Q A;  3L82 A;  5AQA A;  2BED A;  1QQE A;  2GRP B;  4J7W A;  1SZA A;  2EIL E;  3HHM A;  3CR3 A;  4K03 A;  4MRU A;  4O60 A;  5DIZ A;  2WXP A;  3D3M A;  4N2Q A;  4GTV A;  3DSU A;  1E7U A;  3UTM A;  2HE0 A;  2V5Q C;  4JHK A;  3V79 K;  4EZL A;  5CMY A;  1LD7 A;  4NIK A;  1GW6 A;  3CVQ A;  5AEN A;  1TR4 A;  4OVV A;  4EZK A;  3ASN E;  3RJV A;  2H6H A;  3SFZ A;  4BTA A;  4KVM A;  2P9I G;  3LPZ A;  3Q9U C;  1KT0 A;  5JJ6 A;  1H6K A;  4EBA G;  2RFM A;  4Q96 A;  1QNF A;  4EQF A;  4LEU A;  4PS8 A;  4LNB A;  3RK6 A;  5BV1 A;  3KEA A;  2CFU A;  4UWF A;  4YDO A;  3FUK A;  4F1P A;  3FU3 A;  1ELK A;  2KCV A;  5D2M C;  3E33 A;  2GW1 A;  4I17 A;  5FJY A;  4FJY A;  5ENP D;  5BXU A;  3B95 A;  4FLB A;  1AWC B;  2BUG A;  1HG5 A;  4Z68 A;  2WXI A;  3D9I A;  3QDN A;  2KBX A;  1IYG A;  1IKN D;  3CQG B;  2F8Y A;  4BWR A;  5EN5 D;  1UW4 B;  2OEW A;  4HLL A;  4GTT A;  3R7Q A;  4J8D A;  1MX2 A;  3IV0 A;  2VSN A;  3KD7 A;  4BX8 A;  3W9G A;  3CST A;  3D9N A;  2VSX E;  4G2V A;  1DNP A;  4KXK B;  3ONL A;  2GRM A;  2P9S G;  1OY3 D;  1UOH A;  3ESL A;  3ZHE A;  3CHS A;  2WQH A;  3CVL A;  2MOW A;  2LO6 A;  3HIZ A;  3TWS A;  3AG1 E;  5EX3 A;  4TUM A;  2A4Z A;  3ULQ A;  4GPK A;  4HRM B;  3LVQ E;  2XS8 A;  3RU0 A;  1TYQ G;  2H6G A;  4ME2 A;  5HS0 A;  2NYJ A;  2I6H A;  4AEZ C;  1MJ0 A;  4L7T A;  4K5C A;  4GA2 A;  3B7T A;  1WY6 A;  4WNE A;  3IHY A;  2X6I A;  1MQS A;  2Y4U A;  3IHV A;  3KSQ A;  5G04 J;  2WXQ A;  4JVS A;  2R02 A;  3HXF A;  1N4P A;  3ML9 A;  5G05 J;  3C5R A;  3NOC D;  1BPO A;  3Q75 A;  2OEV A;  2BTD A;  1QYM A;  3VLD A;  4NQ0 A;  2GRL A;  3ABK E;  4G23 A;  3ZKJ A;  2DZO A;  1S70 B;  4W9R A;  3DBS A;  4C0E A;  3C3Q A;  2LSV A;  4U63 A;  4GZ6 A;  2UWJ G;  2HR2 A;  1RW2 A;  4YDY A;  3ISM C;  3G2T A;  3K9I A;  4LSZ E;  3FUM A;  4GMR A;  1U3C A;  3HG0 D;  1WDY A;  3DST A;  1E96 B;  3UUX A;  5A6C A;  1YA0 A;  3AU5 A;  2XCC A;  4XEI G;  2E0I A;  4DX6 D;  4DUI A;  1TNZ A;  3U66 A;  1K3Z D;  1OWN A;  3FUD A;  1XNF A;  4J8F A;  4IYP A;  4YVQ C;  2QC9 A;  4FHJ A;  3PEV B;  3BG0 B;  1EF1 C;  4XE0 A;  5CBO A;  3LDZ A;  4DRX E;  5LCW J;  1TNU A;  4B0Z A;  2WXK A;  3CK8 A;  2CG3 A;  1FVF A;  4HXI A;  3U64 A;  4JEU A;  4L1B A;  2QYU A;  4YDE A;  3LEW A;  3KAE A;  4YDW A;  4U7E B;  1O1R A;  4U96 D;  1L5J A;  1MHQ A;  1TJC A;  4A3V A;  5HQ8 A;  1KLX A;  2CFZ A;  4JW1 A;  3PH0 C;  3FTS A;  4DK5 A;  3OAW A;  4DPR A;  2XEV A;  3QOU A;  4GCN A;  5KWD A;  5D66 A;  5CRU A;  2WM9 A;  2LAH A;  3SHF A;  3TG5 A;  3IEG A;  4JPS A;  2GRR B;  3WXX A;  3FHE A;  4FUL A;  4BT8 A;  2PM6 A;  5EIB E;  5BPP A;  1H2V C;  2R03 A;  5AN8 A;  2C0L A;  2WXO A;  1MX4 A;  3ZYL A;  4ACK A;  3V31 A;  5JJT A;  4OAV B;  2P9L G;  1PAQ A;  4AVX A;  4LCT A;  2M63 A;  3L22 A;  2LNI A;  5AQ9 A;  3RAU A;  4AXH A;  2OCC E;  3JYS A;  4N5C A;  4NRH B;  3D9H A;  4Y6W A;  2F0Y A;  2BKK B;  3CHO A;  2I2O A;  4L9P A;  3Q79 A;  4XZ4 A;  3CVP A;  4EEC A;  4GTR A;  5LOZ A;  2FI7 A;  3ZGQ A;  2XEH A;  2R17 C;  4GYO A;  3LJ3 A;  3UI2 A;  4JD2 G;  3UM0 A;  1IHG A;  3ENE A;  5LP0 A;  4I1M A;  3FEX A;  4RLY A;  3LY7 A;  3O48 A;  3IBE A;  1EDU A;  4UI9 C;  2FEZ A;  3S2A A;  3AG3 E;  4U04 A;  3NQP A;  3MZL B;  2MYO A;  3L13 A;  4L23 A;  2I1K A;  4GTS A;  3VTX A;  4FLH A;  3E4B A;  4L2Y A;  1AP7 A;  3GZS A;  5FQ7 A;  3S7F A;  4WNG A;  1N0R A;  1KT1 A;  3L08 A;  4M7C A;  3GZ2 A;  1INZ A;  5EYP F;  3UIP C;  5FQ6 A;  3BQO A;  3CVN A;  3SI5 A;  3UT4 A;  2IO3 C;  3MV3 B;  2OV8 A;  2Y0B G;  2BF0 X;  5LFA A;  3Q49 B;  3GZ1 A;  4KBQ A;  3X2Q E;  1G3N B;  2A5U A;  3D9J A;  4RVB A;  3R7R A;  3VTY A;  3MKQ B;  2QY7 A;  4XIF A;  5EKQ D;  3HDX A;  4GA1 A;  4TV3 A;  2J9Q A;  4F6R D;  1SZ9 A;  3NZU A;  3C72 A;  5HKP A;  2Q7F A;  1JCQ A;  2EIN E;  3HYM B;  4BSZ B;  2AW6 A;  2GGF A;  4HNA D;  3APC A;  3T5V A;  3CKC A;  2OVB A;  4C0M A;  1EPU A;  3ZYM A;  3AG4 E;  5ANL A;  5KCM A;  4GB9 A;  1K1B A;  3ZW3 A;  5JHB A;  4IN3 B;  5G04 C;  4CGV A;  4N3B A;  2LUH A;  3HVE B;  5G05 C;  3HXE A;  4KZ0 A;  4GTO A;  5ENO D;  3QWP A;  3RKV A;  1HH8 A;  2CHW A;  4JHR A;  3D9P A;  1P5Q A;  1IQU A;  3JUE A;  4U8H A;  4JXT A;  5CER B;  1SA5 A;  3TL5 A;  3OTN A;  3PS6 A;  1UN8 A;  3CLJ A;  3ZYK A;  2X6J A;  1SW6 A;  3I5P A;  5AJL A;  1QZ2 A;  2Y69 E;  4U0U A;  2AXZ A;  3QK0 A;  2KZT B;  2ZGG A;  3UT7 A;  3UIN C;  2F37 A;  5CCM A;  3TWX A;  1V55 E;  2J08 A;  2WB2 A;  3DSV A;  4QQI A;  5CBN A;  1E7V A;  4A55 A;  3PZ1 A;  4HB5 A;  4YVO A;  4ATZ D;  3PZ2 A;  3ZNG A;  3R9M A;  4E6H A;  4AY6 A;  3U9W A;  4G8K A;  5FT9 A;  4CZ2 D;  2C0M A;  3FU5 A;  4WND A;  4U8V D;  1JPL A;  4AOF A;  2WXJ A;  3UIO C;  4XI0 A;  3GW4 A;  2WXR A;  3IKO B;  3BEE A;  4ACL A;  3CIA A;  4X8Q A;  5ENQ D;  4G24 A;  2ZU6 B;  4NUR A;  4B8A A;  4BSX A;  4O1P A;  3ABM E;  1A17 A;  1DCE A;  4ILI A;  3BU8 A;  2XCB A;  1H6O A;  3GYZ A;  1NA3 A;  2XPI A;  4E85 A;  4Q69 A;  4ATG A;  4TXP A;  3DXK G;  3PZ4 A;  1K8K G;  1Y6I A;  2DBA A;  4UQY A;  4URK A;  1WG0 A;  2JAB A;  1OXJ A;  4WWN A;  3CHQ A;  1FT2 A;  1OWP A;  3Q15 A;  4K5A B;  3FUF A;  3FH5 A;  1E8Y A;  2IFU A;  2ETA A;  2KCK A;  4UI9 J;  2NSZ A;  4GYY A;  4U0Z A;  3LY9 A;  3UQ3 A;  1BI7 B;  1IHB A;  2ZIS A;  2ILR A;  3TWQ A;  3JQ0 A;  5FQ4 A;  3S7D A;  1BLX B;  3NAW A;  2WXG A;  3FWV A;  3CK9 A;  2EIJ E;  1NP7 A;  3ZHE B;  4I9C A;  3EU5 A;  4ILG A;  4GML A;  1JCR A;  3EDT B;  2H6F A;  2KM4 A;  3APF A;  4F7A A;  1E8W A;  3SBT B;  4ANW A;  5ENR D;  2AWI A;  5B1A E;  3FUI A;  1OT8 A;  4FAD A;  3ULY A;  3O4Z A;  3JXJ A;  2DYR E;  3UXG A;  2XPZ A;  2IU1 A;  2XZT G;  4GZC A;  5KBA A;  4GCO A;  3V30 A;  3RRM B;  4RG9 A;  2JLB A;  5IY5 E;  2WXH A;  2XPY A;  2JEK A;  4TXQ A;  4AIF A;  3QKY A;  1X5B A;  2VJ8 A;  2DCP A;  4WWP A;  3R9A B;  3SFY A;  4EBA A;  4FA6 A;  3G2S A;  4JC8 A;  4GA0 A;  3CSF A;  4CEM A;  3PUK A;  2WXL A;  2J4B A;  4JZY A;  2XHE A;  1OCR E;  3TXM A;  3LXU X;  2PL2 A;  4OAU C;  3ASO E;  3EU9 A;  4U95 D;  5BV0 A;  4DX2 A;  4OYS A;  3BUA A;  4TXR A;  1WAO 1;  3FP3 A;  2ZIR A;  4DLQ A;  3CVX A;  3C98 A;  1LD8 A;  3CKB A;  1NZN A;  4G11 A;  1N95 A;  2DIW A;  3AS8 A;  2QYJ A;  4G25 A;  3D9L A;  2R59 A;  1SQM A;  4KVO A;  2IQC A;  3LYA A;  5AQ7 A;  1NI1 A;  5KNH D;  4HVB A;  1N4Q A;  4UQX A;  1RZ4 A;  4I9E A;  3SQV A;  1HU3 A;  4XI9 A;  5G2N A;  3SFX A;  3EIJ A;  2L6B A;  5LX8 A;  4EZJ A;  2I1J A;  5HI7 A;  3CK7 A;  1H0A A;  3ASH A;  1XGW A;  2P9P G;  4J8Y A;  1DC2 A;  2GRN B;  3U4T A;  1U2V G;  1KPS B;  1H19 A;  2UY1 B;  5E75 A;  3FUJ A;  1EYH A;  4B94 A;  3CEQ A;  2YHE A;  1E8X A;  3FUN A;  3TWU A;  3FU6 A;  5FZQ A;  3B7R L;  3EJN A;  3LS8 A;  5EX0 A;  2OND A;  3UKU G;  2L0I A;  3S7J A;  3ZXS A;  4PH4 B;  2WXM A;  4FJZ A;  4PUC A;  1YCS B;  2PQR A;  1HS6 A;  3DRA A;  3CVU A;  2VGX A;  5B3S E;  3HXD A;  4FU3 A;  5BT1 A;  2FUL A;  4N2S A;  3FY4 A;  3ZN3 A;  2EIK E;  4Q94 A;  2VGY A;  3EIQ C;  2ZGD A;  3L17 A;  4GPM A;  3UM3 A;  5KJK A;  4GTM A;  2DVW A;  4WUY A;  3ML8 A;  3MA5 A;  5G55 A;  5CHE E;  4ANX A;  3C3O A;  5AIJ A;  4APO A;  5C1D A;  4UQZ A;  2WXF A;  2WMN A;  4CYM D;  3PVL A;  5D0Q D;  4GAA A;  2XEE A;  3AAA C;  2B6C A;  4EHM A;  2XQ0 A;  3E30 A;  1JUQ A;  3CGH A;  3ASG A;  4FHK A;  1TEZ A;  3L54 A;  3J5Q B;  2VGE A;  1O5M A;  4PDX A;  1FVH A;  5ARG A;  1N4S A;  3PRZ A;  2XGS A;  4J0U A;  4MS6 A;  5E76 A;  3G2W A;  3FH8 A;  3ZEF A;  3P2B A;  4KYO B;  3FTU A;  1N4R A;  1N54 A;  5BUZ A;  1LF8 A;  2P9U G;  2L6J A;  4BX9 A;  1UN9 A;  5KJM A;  3L6A A;  4HFG A;  4CDM A;  2RKK A;  3AG2 E;  2VSY A;  2FF4 A;  2XGO A;  1Z6T A;  3TXN A;  3W9F A;  3QC1 A;  4LRZ A;  3B7U X;  5CCL A;  3B13 A;  3E34 A;  2I9C A;  1BI8 B;  3HXC A;  2IOS A;  5CEA A;  2P9N G;  4GTQ A;  4HOS A;  2NC9 A;  1B89 A;  4DJA A;  5AJD A;  3TJP A;  3TWW A;  3DXM G;  4Y6C A;  2WVI A;  5ITZ F;  3PUJ A;  3QWV A;  2ION A;  4AJW A;  4GTP A;  2CHX A;  2VSO E;  5FTP A;  1N9A A;  1JCS A;  3LVR E;  3ESK A;  4LNG A;  5AAR A;  3MKQ A;  4GU5 A;  1IXV A;  2AJA A;  2GRO B;  2PM7 A;  1OWO A;  3MV2 B;  2ETB A;  3HRA A;  3AJI A;  2V8S E;  1KZO A;  1IQR A;  4KZC A;  2ETC A;  3J5P A;  4K0R A;  3ABL E;  2VTB B;  2RFA A;  1HG2 A;  4EPZ A;  2DZN A;  4N3A A;  4BET A;  4JL0 A;  5JHA A;  1D9S A;  4M3O A;  5KJN A;  2ZXW E;  4F1S A;  5ENS D;  4J8E A;  5EIL A;  3FTV A;  4RSY A;  4H7X A;  4G1T A;  4CCA A;  1SVX A;  1FPP A;  4P29 A;  3OXF A;  4QFV A;  4R7L A;  4WWO A;  3Q78 A;  3V2X A;  4ANU A;  4JEH A;  3PE3 A;  3ZIM A;  2R05 A;  4TRQ A;  2YQ8 A;  1TN7 A;  2IY0 C;  5DBK A;  4I6E A;  5EDS A;  1HE8 A;  3PRE A;  2KCL A;  3HXB A;  4A3T A;  3ZPJ A;  2H6I A;  2XS1 A;  5FZS A;  2AXU A;  2YIN A;  5T3R A;  4GZD A;  3NB2 A;  2J09 A;  3MEK A;  3ZYQ A;  4JB8 P;  1HFA A;  1TNO A;  2KXP C;  3TGO A;  4HOR A;  3CHP A;  4CRW A;  1S64 A;  1TNB A;  1YMP A;  4LUN U;  4UI9 K;  1K1A A;  4UWK A;  2IJG X;  3EUV A;  5FIO A;  3MGB A;  2V5F A;  3ZRH A;  3TWR A;  5AYW D;  3FU0 A;  4GYW A;  3SBS A;  2XRY A;  3KEZ A;  2FO1 E; 
#chains in the Genus database with same CATH homology
 3ABK E;  2EIM E;  1V54 E;  3ABM E;  1OCO E;  5B1A E;  2EIJ E;  5IY5 E;  3ABL E;  3AG4 E;  5B1B E;  3AG3 E;  5B3S E;  1OCR E;  3WG7 E;  2DYR E;  2EIK E;  2DYS E;  2OCC E;  3ASO E;  2EIN E;  1V55 E;  1OCZ E;  3AG1 E;  3AG2 E;  1OCC E;  3ASN E;  3X2Q E;  2ZXW E;  2EIL E;  2Y69 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...