3WG7E

A 1.9 angstrom radiation damage free x-ray structure of large (420kda) protein by femtosecond crystallography
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Determination of damage-free crystal structure of an X-ray-sensitive protein using an XFEL.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2013-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3wg7E00
5B3SE 1V54E 2OCCE 3AG4E 3ASOE 2EINE 2EILE 3X2QE 1V55E 1OCZE 1OCOE 2EIME 2EIKE 3ABME 2DYSE 2ZXWE 1OCCE 2Y69E 3ABLE 2DYRE 3ASNE 2EIJE 3AG1E 5IY5E 5B1AE 1OCRE 3ABKE 5B1BE 3WG7E 3AG3E 3AG2E
chains in the Genus database with same CATH superfamily
2Y1LE 3CK8A 3AS8A 4Y6WA 3FUNA 5CMYA 2RD0A 2ZU6B 1GW6A 2V5QC 1Z3YA 1N4PA 4GTPA 3ASHA 3GZ1A 4KT6B 2WQ6A 3AG1E 4J8FA 4WAFA 3PZ3A 3J5QB 3DSTA 3L6AA 2RFMA 1MQSA 4GZ6A 2IO3C 5AJDA 2WB2A 2OOEA 3MEKA 1DCEA 5D66A 2ILRA 4RVBA 4F7AA 3CEQA 2WPVA 4K5BA 2RG8A 2WXMA 3L82A 2MHKA 5BW8C 3UPVA 1YA0A 3S7JA 2R17C 3TGOA 3U64A 3KEAA 4ACLA 2EILE 2VYIA 3ZEFA 1OCOE 2UWJG 4ZFHA 1WY6A 3QK0A 4IULA 3LDZA 3R7RA 3T8KA 3HG0D 3SQVA 2WXHA 3ONKA 5B1BE 2Y4UA 3E37A 3ZHEB 1TNOA 3C72A 2WXJA 1HX8A 3DPDA 3UIOC 1D8EA 1MX4A 4NIKA 5E75A 3ISMC 4A55A 2WXKA 2ZGDA 3JYSA 3UKUG 4EZLA 4L1BA 3CSTA 4ANXA 2Q7FA 1HH8A 5HRYA 3JQ1A 4J8SA 4HLEA 2L9BA 3CSFA 3D9IA 5JHAA 1S70B 3FUMA 4EZKA 2P9IG 2UY1A 4GZDA 2VGEA 4L23A 2IEJA 4GMRA 1HS6A 4FHKA 2P9SG 3I5PA 1S64A 3MZLB 2LAIA 2GRLA 1WAO1 2IQCA 2ZGGA 3QDNA 4WWPA 3R9MA 4OYSA 3UM3A 4GAAA 4EECA 3FUJA 3IHVA 4U04A 4ANVA 2E0IA 4N3BA 3DSVA 2GRRB 2WXGA 1H2UA 1KZOA 4G26A 5ENPD 5A7DB 3ZYMA 5JMND 4K0RA 2PM7A 3S7FA 3ASFA 1DCQA 3UM1A 4MKTA 4GCNA 3HXBA 3FUHA 3DSUA 3PEVB 1NFIE 3Q7FA 1KLXA 2OCCE 5ANLA 3ULQA 3FU6A 4BEPA 5KJKA 2MYOA 3LXUX 3KAEA 3CVQA 1UN9A 5AN8A 2WMOA 4XI0A 3ZUVB 5CMWA 2XEVA 4GZ3A 5EN5D 4UI9C 2WQ7A 4CDRA 2YINA 4U7EB 3APCA 1H2TC 4JC8A 1TNBA 2H6GA 2X6HA 3PZDA 3FTWA 4LSZE 3ABKE 1TNZA 4JB8P 5LOZA 4B94A 2XGSA 3L54A 3CVPA 2C2LA 4XEIG 3E34A 4HI8A 5AENA 1JUQA 1TNUA 2H6FA 5ITZF 4DI4A 2E2EA 1IQUA 3PE3A 1TJCA 2QYUA 3LVRE 1U2VG 3IBEA 4G24A 2FF4A 3HRAA 2XPYA 3CVXA 4OAVB 2V8SE 2P9NG 1FVHA 5BT1A 3E30A 4UQYA 5HS0A 3EU9A 3Q15A 1AWCB 2X6FA 2LO6A 4CRWA 2JLBA 3E33A 2P58C 5G04J 1N0QA 1N4RA 5KCMA 4HRNA 1YCSB 5LCWC 3B7TA 2HR2A 2NYJA 3JUEA 3FTXA 4ABNA 5CEAA 1UOHA 5CBNA 2HM8A 5BNWA 2KCLA 4ILHB 3NBNB 3DSXA 1HZ4A 3P2BA 3TG5A 4DLOA 5JJ7A 1N9AA 3VLEA 2AW6A 3SFXA 3VTYA 4DLQA 3NZSA 3FUEA 1V55E 4EQFA 2R59A 3I4GA 5AAOA 4JEUA 3ABLE 4AP2A 3CK9A 2XGMA 4GMLA 4FA6A 2F0YA 1OWOA 4N2SA 5BXUA 1HE8A 5FZRA 3AS4A 4G25A 5ENQD 3TXMA 2QY7A 5DIZA 4GYWA 1Y6IA 3EJNA 4GZ5A 4PS3A 2DZOA 3WXXA 2CG3A 2I9CA 2PL2A 3C98A 1HXIA 3CQCB 1PC2A 3ESKA 4GTQA 3PVLA 3SFYA 3AG2E 2ETBA 3GZ2A 2J49A 2EINE 4CYMD 2WMNA 1HU3A 3OAWA 1NA0A 1H2VC 4U95D 1N52A 3CQGB 3TG4A 4AXHA 2YNQA 4APFA 5FZQA 1OWNA 2VSNA 1OWPA 1V54E 3G2WA 1KPSB 3I3NA 3B7BA 4I2WA 3AJIA 4EZJA 3FP3A 1OXJA 3FTZA 5T4YA 1E8WA 4IRUA 3RK6A 3D9MA 3LVQE 2GRNB 5B3SE 1UJJA 4PH4B 4FJYA 2CFZA 5FZSA 1DC2A 2M63A 3ABME 4YVQC 2LSVA 2I1KA 3PRZA 2VSXE 3L22A 3I4RB 3K9IA 5B1AE 4EHMA 2KZTA 1EYHA 1ELWA 2J4DA 1Z5SC 2HYZA 4YDOA 4I6JA 5BPPA 3FHEA 4DRXE 3TWVA 2I6HA 5EIBE 3MKQB 3S2AA 1Z6TA 4UWLA 3T5VA 4JA9A 2OEWA 2XZDG 4AOFA 2GRPB 3DWLG 4HOQA 3CVVA 3Q75A 3RKVA 2XEEA 2NSZA 4KVOA 3PEUB 2WVIA 4LRZA 4TUMA 4J7WA 3NB2A 3ONLA 1RW2A 5E76A 5AIJA 4JHJA 2CHWA 3SO8A 4A3TA 3QWPA 2Y3AA 3B7SA 3D9OA 2IOSA 5ENOD 3UIPC 5FQ6A 3DSWA 2AVPA 4BT9A 4BWRA 3APFA 4HOUA 3ASDA 5H7PA 3KSLA 2EQXA 4KZ0A 3W9FA 3FY4A 4FADA 4PS8A 3TXNA 3CV0A 3CKBA 4HOSA 2XCBA 1XNFA 1E7VA 2J07A 1TNYA 2DCPA 3ZXPA 1DNPA 3PREA 2V0PA 2L6BA 4B0ZA 3FUDA 5AQ9A 3URZA 4Q96A 3R9AB 4BT8A 1LTXA 1BI7B 1VDYA 3CR3A 3OXGA 4ILGA 3NF1A 4BX9A 1OCZE 4I43A 4GA1A 3L16A 4BY6A 2FI7A 1SVXA 3UX4A 2GRQB 4DPRA 3SBSA 3BUAA 4FU3A 5D0OD 1FT2A 1INZA 4HB5A 3DEPA 2OV8A 1UJKA 2A4ZA 4U8HA 4BFRA 3SD5A 4L7TA 4AVXA 1MHQA 2AXUA 4Q69A 3ZYQA 4AIFA 2OVFA 1EDUA 2C0LA 3RJVA 2XS1A 3Q5MA 4ME2A 1OCRE 2YHEA 4F1SA 2L6JA 4OVUA 4J8YA 4C0MA 3CVUA 4HVBA 1OY3D 3T5XA 1EF1C 1N94A 3G2TA 3JXJA 4M3OA 4GTTA 5LFAA 4AEZC 2IO2C 2VGXB 4M7CA 1PAQA 1D8DA 3FUKA 2ETAA 3RRMB 3VLFA 5G05C 5ENRD 2UY1B 4LG6A 4UI9K 5T8IA 3ZHEA 4J8EA 3EHNA 2JABA 1ELKA 1HG2A 1K8KG 2P9KG 2YHCA 2HO1A 4WNEA 5IY5E 2PZIA 4O1PA 3IEGA 2PQNA 2ZIRA 4NACA 1FPPA 5KNGA 3D9JA 2ZXWE 2DYRE 4LNGA 3E32A 3FU0A 4K5CA 4GTMA 5EDSA 3LY7A 4U63A 4Q94A 3HHMA 3KS2A 1N4QA 1L5JA 3HXFA 2OEVA 4KZCA 3SHFA 4X8QA 4FLBA 4N5CA 4I9CA 1H6OA 1IHBA 1TEZA 3AU4A 4KYOB 1IXVA 3T9KA 1HFAA 1SA5A 4I17A 3RRUA 2GW1A 4FJZA 3ULEG 5A6CA 4E6HA 1UG3A 3MYVA 2NC9A 1JPLA 2IFUA 3LY9A 2KCKA 1W3BA 4CCAA 4G2VA 4I1AA 4DUIA 1H19A 3JQ0A 4G11A 3TJPA 4G8KA 4JHKA 4GU5A 4HRMB 4G8LA 3TWSA 4BTBA 4JA7A 3SGHA 1N95A 4H7YA 3GZSA 1LF8A 3PS6A 3V2XA 1LD7A 1SZ9A 4JVSA 2F37A 4GTVA 2X6JA 4YDYA 1N4SA 5EYLA 3D3MA 4I6EA 3WG7E 3TAXA 2J4BA 5EYPF 2XRYA 3CHOA 4I1MA 2PM6A 4LNUD 1SA4A 3AG4E 3CHRA 3HDXA 4JPSA 1IYGA 4WWOA 3CVYA 2FULA 4JL0A 2V4LA 2KCVA 3TWXA 4GB9A 1H6PA 2LNIA 4DX7D 3IKOB 2AWIA 4GPKA 2J9QA 3Q4AB 5BUZA 2ETCA 3PH0C 4LCTA 4XIFA 1HF8A 4K03A 4AY6A 3CK7A 4RG6A 2F8XK 4HLLA 2ZISA 3LKUA 2P2CP 4EPZA 5ENTD 4KMOA 4O1OA 5AQBA 4G23A 3O4ZA 5CCLA 5ENSD 4YDEA 1A5EA 2DVWA 2PQRA 3LCAA 4CZ2D 3DRAA 3OXFA 3IHYA 3UTMA 2PNNA 5AQ7A 3ML8A 2P9PG 2IOLA 2XENA 3AAAC 4XI9A 1NI1A 2X6KA 1BI8B 3RO2A 3L17A 3FEYA 2BKGA 2DYSE 3ZPJA 3SY2A 3FFLA 3LYAA 2RKKA 5M72A 4GA0A 3V2OA 3SZ7A 3ZRHA 3FH7A 5T3RA 4U0SA 5ARGA 2WXOA 5ANRA 2WXRA 4L2LA 4A1SA 2Y0BG 3RSEG 1ZU2A 2CG2A 3L9TA 4DX2A 2FBNA 2XS8A 3LEWA 1X5BA 5CBOA 1SZAA 1QQEA 3ASOE 3QC1A 4RLYA 2H6IA 3ZN3A 3MV3B 5FTPA 4LUNU 4FULA 3B13A 3BEEA 2FEZA 1Z3XA 4XKCA 5BV0A 2LSUA 4UWFA 1QNFA 3PDNA 2KXPC 3HVEA 3Q47B 3U4TA 2VGYA 5CRVA 3BQOA 4B8CB 1TYQG 3RO3A 3O48A 4U0UA 4RG9A 5KNHD 4C0EA 5ARFA 4HXIA 1S0PA 3Q79A 4JXTA 2R05A 4JHRA 4WNFA 4G1TA 3NZUA 2XZTG 2WM9A 5G2NA 1KT0A 1X81A 3CKCA 1HG5A 3FH5A 3ZGQA 4ZHBA 1SQMA 3PNTB 4N39A 4GCOA 3DEOA 3ZYKA 2H6HA 4GTRA 3UMVA 3B7RL 4PS7A 4U96D 1K1BA 4FLHA 1QBQA 2XQ0A 5BXOA 4HQDA 3DXMG 4WNDA 1FCHA 3Q9UC 3MKRA 4HI9A 4H7XA 4NURA 4L9PA 1MX2A 1JCRA 1E90A 3FTYA 2VSOE 3ULYA 3RAUA 4WNGA 3VTXA 1TN8A 1E96B 2XPIA 1JWGA 2C0MA 3V79K 2DIWA 1KT1A 1WDYA 1IHGA 3PZ2A 4F3VA 5FQ7A 1Y8MA 4TRQA 4UI9J 2BUGA 3GYZA 4I2ZA 3UQ3A 3TWUA 2OVBA 3TL5A 3DBSA 4AM9A 3FU3A 2NXPA 3R7QA 3FU5A 4DX1A 3NOCD 4CGWA 5DBKA 1UN8A 4HS2A 3ZIMA 4B89A 5EKQD 2WXPA 3ENEA 1UW4B 3Q73A 5LP0A 3UM0A 3APDA 2LAHA 2J09A 4F6RD 3G2SA 4DI3A 5BV1A 4LNBA 3FWVA 3FEXA 3ZFWA 4BSXA 4BERA 4BX8A 1NP7A 4ILIA 2RFAA 4XZ4A 4OVVA 3TWTA 3T8MA 2BF0X 3QAQA 1MX6A 2XRZA 4NRHB 3KD7A 4I9EA 2MOWA 2VTBA 5FWQA 1WM5A 5AYWD 5CECB 1E8YA 4CEMA 4HBDA 4O60A 2ONDA 3QARA 3ASGA 3EUVA 3V31A 1IKND 3PUKA 4TXQA 3MCXA 3UKRG 3SFZA 3UT4A 4JD2G 2X38A 3ZKJA 4I6GA 4AJWA 2DWZA 2KBXA 3ZYLA 5HKPA 3PZ1A 3KEZA 4WUYA 1O1TA 3B95A 1TN6A 1ZBPA 5LCWJ 3B7UX 1HO8A 4N5QA 4R7LA 4DX5D 4MBGA 5FT9A 3D9PA 5EILA 3QWWA 4J6IA 5G04C 4J0UA 1KZPA 3QNKA 5ENNA 2B0OE 2WXFA 4NQ0A 3FUIA 4XKBA 1NL4A 1IQRA 3HXEA 2EIME 3JCKC 4YVOA 1FVFA 3D9HA 3Q78A 1BPOA 4PUCA 3TWRA 3PNLB 3AS5A 2CFUA 4DK5A 4HFGA 3CHQA 3FTSA 3ZU7B 4MRUA 3HIZA 4N3CA 2A5UA 4Z68A 1S63A 1ZB1A 1MZCA 4JW1A 3LPZA 2HE0A 5CERB 3D9NA 4YDWA 5CEDB 5FQ4A 5AARA 3BG0B 3C3OA 2R2LA 2QZAA 4A1GA 2AXVA 4N2QA 2XGOA 2B6CA 2VQ2A 1U3DA 3TWWA 1Q2ZA 3FTUA 1B89A 1G3NB 2X3MA 4BESA 4GYOA 2QFCA 3RU0A 1JCSA 3S7DA 2KATA 4O6FA 4UUCA 1WG0A 3FUFA 3NQPA 4HOTA 1TJFA 2VGXA 2BEDA 2LUHA 3CHMA 4LERA 3LY8A 3U66A 4CDMA 4MS6A 4KXKB 4LEUA 3RIBA 2IY0C 2I2OA 1PY1A 3C3RA 2QYJA 3FDHA 4APOA 2R02A 4URKA 5C2YA 2A5EA 1BLXB 3SBTB 4A3VA 4ACKA 2XEHA 4HNAD 5FJYA 4F53A 5JJTA 4UWHA 5KJNA 1TN7A 4TV3A 3SF4A 4AY5A 3UUXA 5FQ8A 3SI5A 1K1AA 1N0RA 2Y69E 3TWQA 4BTAA 2KM4A 3SNXA 4AV7A 3LJNA 5FINA 3Q7AA 2GROB 4L2YA 1DVPA 3BU8A 3UM2A 2EIKE 4UWGA 3MV2B 4C48B 1RZ4A 4KVMA 1NZNA 4CT4A 1MYOA 5G55A 2LXMA 1SW6A 1FT1A 4E85A 2FO1E 3V30A 3E4BA 4RQIA 2EIJE 3QOUA 5KJLA 5LX8A 5CRUA 4P29A 2IF4A 3KSQA 1YYHA 3CIAA 2GRMA 4TXRA 3N71A 3ML9A 3MGBA 1OT8A 3ASNE 1O1RA 4JEHA 4W9RA 3PE4A 4Y6CA 3PZ4A 4C9BB 2YQ8A 2CHXA 5D2MC 5J08A 3HXCA 3QKYA 1N11A 4EBAG 2WXQA 4ANWA 4GTOA 2DBAA 1BD8A 3D9LA 4BETA 4JZYA 2XHEA 2BTDA 1QZ2A 4MLPA 4OAUC 2L0TB 5C1DA 3FULA 1N54A 4GA2A 3RRNB 4FHJA 3UXGA 1LD8A 3ZVVA 3DSSA 4K5AB 1AP7A 1BU9A 4GMJA 3G2UA 5J90A 2V4HC 3PUJA 3NOGD 3HXDA 3OXLA 3CVNA 3G2VA 4QQIA 2AXZA 5EIDA 4IYPA 1P5QA 1JCQA 1QYMA 2Y4TA 3EHMA 4TUUA 4UQZA 3ZW3A 1A17A 3EIJA 3QWVA 2QC9A 4EBAA 1NA3A 2WXIA 4HRLA 4TXPA 2R5SA 4ATZD 4CDNA 4A63B 2R03A 3CHPA 4F1PA 3DXKG 4U8VD 4D10C 4CGVA 1EPUA 1OCCE 3FTVA 5JJ6A 3D9KA 1E7UA 5G05J 1YMPA 3HVEB 4KBQA 3CLJA 3EU5A 3CVLA 4UWKA 3EIQC 4FP7A 3X2QE 3C3QA 3J5PA 4CT0A 4DX6D 5A23A 1OWMA 3OTNA 2KC7A 2P9LG 3AU5A 2MRIA 3MA5A 3MJWA 5EX3A 1ELRA 3ZNGA 3F6QA 3UI2A 1OUVA 4UQXA 2WQHA 1TR4A 1OWLA 3MX3A 2IU1A 3Q9NC 2L0IA 2CHZA 4GPMA 1E8XA 5D0QD 4GZCA 3IXEA 4BSZB 5KWDA 5CHEE 1K3ZD 1MJ0A 2V5FA 3ZXSA 2IONA 2WXNA 2JEKA 2J08A 2KZTB 4ANUA 1O1SA 4HORA 5HI7A 4GTSA 5HQ8A 5AJLA 3QB2A 3CVWA 2J8SD 3L13A 3ESLA 3L08A 3EDTB 4B93B 4XE0A 3U9WA 3JUIA 2IJGX 2VSYA 3UT8A 2DZNA 2GGFA 2XPZA 3Q49B 4DJAA 5AQAA 3CHSA 5EX0A 2WXLA 3UINC 3LJ3A 4RSYA 4J8DA 1D9SA 5CCMA 3JXIA 1XGWA 3S7BA 2AJAA 3LS8A 4XX5A 1O5MA 2VJ8A 1H0AA 4I1OB 3EHRA 3U3WA 4IN3B 3MKQA 5JA4D 5KBAA 5JHBA 4YNDA 2X6IA 2F8YA 3VLDA 3GW4A 2LXLA 3P1UA 2P9UG 3W9GA 3CGHA 1H6KA 4B8AA 4FC8A 1U3CA 2VTBB 1E8ZA 3QJZA 3BG1B 4QFVA 2BKKB 5FIOA 4PDXA 2XCCA 4GYYA 3AG3E 3C5RA 3HYMB 3FH8A 3DPYA 4N3AA 4U8YD 4ATGA 2I1JA 3EHQA 4V3IA 3NAWA 1JWFA 2FO7A 4U07A 3IV0A 4WWNA 5KJMA 4U0ZA 3UT7A
chains in the Genus database with same CATH topology
5B3SE 1V54E 2OCCE 3AG4E 3ASOE 2EINE 2EILE 3X2QE 1V55E 1OCZE 1OCOE 2EIME 2EIKE 3ABME 2DYSE 2ZXWE 1OCCE 2Y69E 3ABLE 2DYRE 3ASNE 2EIJE 3AG1E 5IY5E 5B1AE 1OCRE 3ABKE 5B1BE 3WG7E 3AG3E 3AG2E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B3S E;  1V54 E;  2OCC E;  3AG4 E;  3ASO E;  2EIN E;  2EIL E;  3X2Q E;  1V55 E;  1OCZ E;  1OCO E;  2EIM E;  2EIK E;  3ABM E;  2DYS E;  2ZXW E;  1OCC E;  2Y69 E;  3ABL E;  2DYR E;  3ASN E;  2EIJ E;  3AG1 E;  5IY5 E;  5B1A E;  1OCR E;  3ABK E;  5B1B E;  3WG7 E;  3AG3 E;  3AG2 E; 
#chains in the Genus database with same CATH topology
 2Y1L E;  3CK8 A;  3AS8 A;  4Y6W A;  3FUN A;  5CMY A;  2RD0 A;  2ZU6 B;  1GW6 A;  2V5Q C;  1Z3Y A;  1N4P A;  4GTP A;  3ASH A;  3GZ1 A;  4KT6 B;  2WQ6 A;  3AG1 E;  4J8F A;  4WAF A;  3PZ3 A;  3J5Q B;  3DST A;  3L6A A;  2RFM A;  1MQS A;  4GZ6 A;  2IO3 C;  5AJD A;  2WB2 A;  2OOE A;  3MEK A;  1DCE A;  5D66 A;  2ILR A;  4RVB A;  4F7A A;  3CEQ A;  2WPV A;  4K5B A;  2RG8 A;  2WXM A;  3L82 A;  2MHK A;  5BW8 C;  3UPV A;  1YA0 A;  3S7J A;  2R17 C;  3TGO A;  3U64 A;  3KEA A;  4ACL A;  2EIL E;  2VYI A;  3ZEF A;  1OCO E;  2UWJ G;  4ZFH A;  1WY6 A;  3QK0 A;  4IUL A;  3LDZ A;  3R7R A;  3T8K A;  3HG0 D;  3SQV A;  2WXH A;  3ONK A;  5B1B E;  2Y4U A;  3E37 A;  3ZHE B;  1TNO A;  3C72 A;  2WXJ A;  1HX8 A;  3DPD A;  3UIO C;  1D8E A;  1MX4 A;  4NIK A;  5E75 A;  3ISM C;  4A55 A;  2WXK A;  2ZGD A;  3JYS A;  3UKU G;  4EZL A;  4L1B A;  3CST A;  4ANX A;  2Q7F A;  1HH8 A;  5HRY A;  3JQ1 A;  4J8S A;  4HLE A;  2L9B A;  3CSF A;  3D9I A;  5JHA A;  1S70 B;  3FUM A;  4EZK A;  2P9I G;  2UY1 A;  4GZD A;  2VGE A;  4L23 A;  2IEJ A;  4GMR A;  1HS6 A;  4FHK A;  2P9S G;  3I5P A;  1S64 A;  3MZL B;  2LAI A;  2GRL A;  1WAO 1;  2IQC A;  2ZGG A;  3QDN A;  4WWP A;  3R9M A;  4OYS A;  3UM3 A;  4GAA A;  4EEC A;  3FUJ A;  3IHV A;  4U04 A;  4ANV A;  2E0I A;  4N3B A;  3DSV A;  2GRR B;  2WXG A;  1H2U A;  1KZO A;  4G26 A;  5ENP D;  5A7D B;  3ZYM A;  5JMN D;  4K0R A;  2PM7 A;  3S7F A;  3ASF A;  1DCQ A;  3UM1 A;  4MKT A;  4GCN A;  3HXB A;  3FUH A;  3DSU A;  3PEV B;  1NFI E;  3Q7F A;  1KLX A;  2OCC E;  5ANL A;  3ULQ A;  3FU6 A;  4BEP A;  5KJK A;  2MYO A;  3LXU X;  3KAE A;  3CVQ A;  1UN9 A;  5AN8 A;  2WMO A;  4XI0 A;  3ZUV B;  5CMW A;  2XEV A;  4GZ3 A;  5EN5 D;  4UI9 C;  2WQ7 A;  4CDR A;  2YIN A;  4U7E B;  3APC A;  1H2T C;  4JC8 A;  1TNB A;  2H6G A;  2X6H A;  3PZD A;  3FTW A;  4LSZ E;  3ABK E;  1TNZ A;  4JB8 P;  5LOZ A;  4B94 A;  2XGS A;  3L54 A;  3CVP A;  2C2L A;  4XEI G;  3E34 A;  4HI8 A;  5AEN A;  1JUQ A;  1TNU A;  2H6F A;  5ITZ F;  4DI4 A;  2E2E A;  1IQU A;  3PE3 A;  1TJC A;  2QYU A;  3LVR E;  1U2V G;  3IBE A;  4G24 A;  2FF4 A;  3HRA A;  2XPY A;  3CVX A;  4OAV B;  2V8S E;  2P9N G;  1FVH A;  5BT1 A;  3E30 A;  4UQY A;  5HS0 A;  3EU9 A;  3Q15 A;  1AWC B;  2X6F A;  2LO6 A;  4CRW A;  2JLB A;  3E33 A;  2P58 C;  5G04 J;  1N0Q A;  1N4R A;  5KCM A;  4HRN A;  1YCS B;  5LCW C;  3B7T A;  2HR2 A;  2NYJ A;  3JUE A;  3FTX A;  4ABN A;  5CEA A;  1UOH A;  5CBN A;  2HM8 A;  5BNW A;  2KCL A;  4ILH B;  3NBN B;  3DSX A;  1HZ4 A;  3P2B A;  3TG5 A;  4DLO A;  5JJ7 A;  1N9A A;  3VLE A;  2AW6 A;  3SFX A;  3VTY A;  4DLQ A;  3NZS A;  3FUE A;  1V55 E;  4EQF A;  2R59 A;  3I4G A;  5AAO A;  4JEU A;  3ABL E;  4AP2 A;  3CK9 A;  2XGM A;  4GML A;  4FA6 A;  2F0Y A;  1OWO A;  4N2S A;  5BXU A;  1HE8 A;  5FZR A;  3AS4 A;  4G25 A;  5ENQ D;  3TXM A;  2QY7 A;  5DIZ A;  4GYW A;  1Y6I A;  3EJN A;  4GZ5 A;  4PS3 A;  2DZO A;  3WXX A;  2CG3 A;  2I9C A;  2PL2 A;  3C98 A;  1HXI A;  3CQC B;  1PC2 A;  3ESK A;  4GTQ A;  3PVL A;  3SFY A;  3AG2 E;  2ETB A;  3GZ2 A;  2J49 A;  2EIN E;  4CYM D;  2WMN A;  1HU3 A;  3OAW A;  1NA0 A;  1H2V C;  4U95 D;  1N52 A;  3CQG B;  3TG4 A;  4AXH A;  2YNQ A;  4APF A;  5FZQ A;  1OWN A;  2VSN A;  1OWP A;  1V54 E;  3G2W A;  1KPS B;  3I3N A;  3B7B A;  4I2W A;  3AJI A;  4EZJ A;  3FP3 A;  1OXJ A;  3FTZ A;  5T4Y A;  1E8W A;  4IRU A;  3RK6 A;  3D9M A;  3LVQ E;  2GRN B;  5B3S E;  1UJJ A;  4PH4 B;  4FJY A;  2CFZ A;  5FZS A;  1DC2 A;  2M63 A;  3ABM E;  4YVQ C;  2LSV A;  2I1K A;  3PRZ A;  2VSX E;  3L22 A;  3I4R B;  3K9I A;  5B1A E;  4EHM A;  2KZT A;  1EYH A;  1ELW A;  2J4D A;  1Z5S C;  2HYZ A;  4YDO A;  4I6J A;  5BPP A;  3FHE A;  4DRX E;  3TWV A;  2I6H A;  5EIB E;  3MKQ B;  3S2A A;  1Z6T A;  4UWL A;  3T5V A;  4JA9 A;  2OEW A;  2XZD G;  4AOF A;  2GRP B;  3DWL G;  4HOQ A;  3CVV A;  3Q75 A;  3RKV A;  2XEE A;  2NSZ A;  4KVO A;  3PEU B;  2WVI A;  4LRZ A;  4TUM A;  4J7W A;  3NB2 A;  3ONL A;  1RW2 A;  5E76 A;  5AIJ A;  4JHJ A;  2CHW A;  3SO8 A;  4A3T A;  3QWP A;  2Y3A A;  3B7S A;  3D9O A;  2IOS A;  5ENO D;  3UIP C;  5FQ6 A;  3DSW A;  2AVP A;  4BT9 A;  4BWR A;  3APF A;  4HOU A;  3ASD A;  5H7P A;  3KSL A;  2EQX A;  4KZ0 A;  3W9F A;  3FY4 A;  4FAD A;  4PS8 A;  3TXN A;  3CV0 A;  3CKB A;  4HOS A;  2XCB A;  1XNF A;  1E7V A;  2J07 A;  1TNY A;  2DCP A;  3ZXP A;  1DNP A;  3PRE A;  2V0P A;  2L6B A;  4B0Z A;  3FUD A;  5AQ9 A;  3URZ A;  4Q96 A;  3R9A B;  4BT8 A;  1LTX A;  1BI7 B;  1VDY A;  3CR3 A;  3OXG A;  4ILG A;  3NF1 A;  4BX9 A;  1OCZ E;  4I43 A;  4GA1 A;  3L16 A;  4BY6 A;  2FI7 A;  1SVX A;  3UX4 A;  2GRQ B;  4DPR A;  3SBS A;  3BUA A;  4FU3 A;  5D0O D;  1FT2 A;  1INZ A;  4HB5 A;  3DEP A;  2OV8 A;  1UJK A;  2A4Z A;  4U8H A;  4BFR A;  3SD5 A;  4L7T A;  4AVX A;  1MHQ A;  2AXU A;  4Q69 A;  3ZYQ A;  4AIF A;  2OVF A;  1EDU A;  2C0L A;  3RJV A;  2XS1 A;  3Q5M A;  4ME2 A;  1OCR E;  2YHE A;  4F1S A;  2L6J A;  4OVU A;  4J8Y A;  4C0M A;  3CVU A;  4HVB A;  1OY3 D;  3T5X A;  1EF1 C;  1N94 A;  3G2T A;  3JXJ A;  4M3O A;  4GTT A;  5LFA A;  4AEZ C;  2IO2 C;  2VGX B;  4M7C A;  1PAQ A;  1D8D A;  3FUK A;  2ETA A;  3RRM B;  3VLF A;  5G05 C;  5ENR D;  2UY1 B;  4LG6 A;  4UI9 K;  5T8I A;  3ZHE A;  4J8E A;  3EHN A;  2JAB A;  1ELK A;  1HG2 A;  1K8K G;  2P9K G;  2YHC A;  2HO1 A;  4WNE A;  5IY5 E;  2PZI A;  4O1P A;  3IEG A;  2PQN A;  2ZIR A;  4NAC A;  1FPP A;  5KNG A;  3D9J A;  2ZXW E;  2DYR E;  4LNG A;  3E32 A;  3FU0 A;  4K5C A;  4GTM A;  5EDS A;  3LY7 A;  4U63 A;  4Q94 A;  3HHM A;  3KS2 A;  1N4Q A;  1L5J A;  3HXF A;  2OEV A;  4KZC A;  3SHF A;  4X8Q A;  4FLB A;  4N5C A;  4I9C A;  1H6O A;  1IHB A;  1TEZ A;  3AU4 A;  4KYO B;  1IXV A;  3T9K A;  1HFA A;  1SA5 A;  4I17 A;  3RRU A;  2GW1 A;  4FJZ A;  3ULE G;  5A6C A;  4E6H A;  1UG3 A;  3MYV A;  2NC9 A;  1JPL A;  2IFU A;  3LY9 A;  2KCK A;  1W3B A;  4CCA A;  4G2V A;  4I1A A;  4DUI A;  1H19 A;  3JQ0 A;  4G11 A;  3TJP A;  4G8K A;  4JHK A;  4GU5 A;  4HRM B;  4G8L A;  3TWS A;  4BTB A;  4JA7 A;  3SGH A;  1N95 A;  4H7Y A;  3GZS A;  1LF8 A;  3PS6 A;  3V2X A;  1LD7 A;  1SZ9 A;  4JVS A;  2F37 A;  4GTV A;  2X6J A;  4YDY A;  1N4S A;  5EYL A;  3D3M A;  4I6E A;  3WG7 E;  3TAX A;  2J4B A;  5EYP F;  2XRY A;  3CHO A;  4I1M A;  2PM6 A;  4LNU D;  1SA4 A;  3AG4 E;  3CHR A;  3HDX A;  4JPS A;  1IYG A;  4WWO A;  3CVY A;  2FUL A;  4JL0 A;  2V4L A;  2KCV A;  3TWX A;  4GB9 A;  1H6P A;  2LNI A;  4DX7 D;  3IKO B;  2AWI A;  4GPK A;  2J9Q A;  3Q4A B;  5BUZ A;  2ETC A;  3PH0 C;  4LCT A;  4XIF A;  1HF8 A;  4K03 A;  4AY6 A;  3CK7 A;  4RG6 A;  2F8X K;  4HLL A;  2ZIS A;  3LKU A;  2P2C P;  4EPZ A;  5ENT D;  4KMO A;  4O1O A;  5AQB A;  4G23 A;  3O4Z A;  5CCL A;  5ENS D;  4YDE A;  1A5E A;  2DVW A;  2PQR A;  3LCA A;  4CZ2 D;  3DRA A;  3OXF A;  3IHY A;  3UTM A;  2PNN A;  5AQ7 A;  3ML8 A;  2P9P G;  2IOL A;  2XEN A;  3AAA C;  4XI9 A;  1NI1 A;  2X6K A;  1BI8 B;  3RO2 A;  3L17 A;  3FEY A;  2BKG A;  2DYS E;  3ZPJ A;  3SY2 A;  3FFL A;  3LYA A;  2RKK A;  5M72 A;  4GA0 A;  3V2O A;  3SZ7 A;  3ZRH A;  3FH7 A;  5T3R A;  4U0S A;  5ARG A;  2WXO A;  5ANR A;  2WXR A;  4L2L A;  4A1S A;  2Y0B G;  3RSE G;  1ZU2 A;  2CG2 A;  3L9T A;  4DX2 A;  2FBN A;  2XS8 A;  3LEW A;  1X5B A;  5CBO A;  1SZA A;  1QQE A;  3ASO E;  3QC1 A;  4RLY A;  2H6I A;  3ZN3 A;  3MV3 B;  5FTP A;  4LUN U;  4FUL A;  3B13 A;  3BEE A;  2FEZ A;  1Z3X A;  4XKC A;  5BV0 A;  2LSU A;  4UWF A;  1QNF A;  3PDN A;  2KXP C;  3HVE A;  3Q47 B;  3U4T A;  2VGY A;  5CRV A;  3BQO A;  4B8C B;  1TYQ G;  3RO3 A;  3O48 A;  4U0U A;  4RG9 A;  5KNH D;  4C0E A;  5ARF A;  4HXI A;  1S0P A;  3Q79 A;  4JXT A;  2R05 A;  4JHR A;  4WNF A;  4G1T A;  3NZU A;  2XZT G;  2WM9 A;  5G2N A;  1KT0 A;  1X81 A;  3CKC A;  1HG5 A;  3FH5 A;  3ZGQ A;  4ZHB A;  1SQM A;  3PNT B;  4N39 A;  4GCO A;  3DEO A;  3ZYK A;  2H6H A;  4GTR A;  3UMV A;  3B7R L;  4PS7 A;  4U96 D;  1K1B A;  4FLH A;  1QBQ A;  2XQ0 A;  5BXO A;  4HQD A;  3DXM G;  4WND A;  1FCH A;  3Q9U C;  3MKR A;  4HI9 A;  4H7X A;  4NUR A;  4L9P A;  1MX2 A;  1JCR A;  1E90 A;  3FTY A;  2VSO E;  3ULY A;  3RAU A;  4WNG A;  3VTX A;  1TN8 A;  1E96 B;  2XPI A;  1JWG A;  2C0M A;  3V79 K;  2DIW A;  1KT1 A;  1WDY A;  1IHG A;  3PZ2 A;  4F3V A;  5FQ7 A;  1Y8M A;  4TRQ A;  4UI9 J;  2BUG A;  3GYZ A;  4I2Z A;  3UQ3 A;  3TWU A;  2OVB A;  3TL5 A;  3DBS A;  4AM9 A;  3FU3 A;  2NXP A;  3R7Q A;  3FU5 A;  4DX1 A;  3NOC D;  4CGW A;  5DBK A;  1UN8 A;  4HS2 A;  3ZIM A;  4B89 A;  5EKQ D;  2WXP A;  3ENE A;  1UW4 B;  3Q73 A;  5LP0 A;  3UM0 A;  3APD A;  2LAH A;  2J09 A;  4F6R D;  3G2S A;  4DI3 A;  5BV1 A;  4LNB A;  3FWV A;  3FEX A;  3ZFW A;  4BSX A;  4BER A;  4BX8 A;  1NP7 A;  4ILI A;  2RFA A;  4XZ4 A;  4OVV A;  3TWT A;  3T8M A;  2BF0 X;  3QAQ A;  1MX6 A;  2XRZ A;  4NRH B;  3KD7 A;  4I9E A;  2MOW A;  2VTB A;  5FWQ A;  1WM5 A;  5AYW D;  5CEC B;  1E8Y A;  4CEM A;  4HBD A;  4O60 A;  2OND A;  3QAR A;  3ASG A;  3EUV A;  3V31 A;  1IKN D;  3PUK A;  4TXQ A;  3MCX A;  3UKR G;  3SFZ A;  3UT4 A;  4JD2 G;  2X38 A;  3ZKJ A;  4I6G A;  4AJW A;  2DWZ A;  2KBX A;  3ZYL A;  5HKP A;  3PZ1 A;  3KEZ A;  4WUY A;  1O1T A;  3B95 A;  1TN6 A;  1ZBP A;  5LCW J;  3B7U X;  1HO8 A;  4N5Q A;  4R7L A;  4DX5 D;  4MBG A;  5FT9 A;  3D9P A;  5EIL A;  3QWW A;  4J6I A;  5G04 C;  4J0U A;  1KZP A;  3QNK A;  5ENN A;  2B0O E;  2WXF A;  4NQ0 A;  3FUI A;  4XKB A;  1NL4 A;  1IQR A;  3HXE A;  2EIM E;  3JCK C;  4YVO A;  1FVF A;  3D9H A;  3Q78 A;  1BPO A;  4PUC A;  3TWR A;  3PNL B;  3AS5 A;  2CFU A;  4DK5 A;  4HFG A;  3CHQ A;  3FTS A;  3ZU7 B;  4MRU A;  3HIZ A;  4N3C A;  2A5U A;  4Z68 A;  1S63 A;  1ZB1 A;  1MZC A;  4JW1 A;  3LPZ A;  2HE0 A;  5CER B;  3D9N A;  4YDW A;  5CED B;  5FQ4 A;  5AAR A;  3BG0 B;  3C3O A;  2R2L A;  2QZA A;  4A1G A;  2AXV A;  4N2Q A;  2XGO A;  2B6C A;  2VQ2 A;  1U3D A;  3TWW A;  1Q2Z A;  3FTU A;  1B89 A;  1G3N B;  2X3M A;  4BES A;  4GYO A;  2QFC A;  3RU0 A;  1JCS A;  3S7D A;  2KAT A;  4O6F A;  4UUC A;  1WG0 A;  3FUF A;  3NQP A;  4HOT A;  1TJF A;  2VGX A;  2BED A;  2LUH A;  3CHM A;  4LER A;  3LY8 A;  3U66 A;  4CDM A;  4MS6 A;  4KXK B;  4LEU A;  3RIB A;  2IY0 C;  2I2O A;  1PY1 A;  3C3R A;  2QYJ A;  3FDH A;  4APO A;  2R02 A;  4URK A;  5C2Y A;  2A5E A;  1BLX B;  3SBT B;  4A3V A;  4ACK A;  2XEH A;  4HNA D;  5FJY A;  4F53 A;  5JJT A;  4UWH A;  5KJN A;  1TN7 A;  4TV3 A;  3SF4 A;  4AY5 A;  3UUX A;  5FQ8 A;  3SI5 A;  1K1A A;  1N0R A;  2Y69 E;  3TWQ A;  4BTA A;  2KM4 A;  3SNX A;  4AV7 A;  3LJN A;  5FIN A;  3Q7A A;  2GRO B;  4L2Y A;  1DVP A;  3BU8 A;  3UM2 A;  2EIK E;  4UWG A;  3MV2 B;  4C48 B;  1RZ4 A;  4KVM A;  1NZN A;  4CT4 A;  1MYO A;  5G55 A;  2LXM A;  1SW6 A;  1FT1 A;  4E85 A;  2FO1 E;  3V30 A;  3E4B A;  4RQI A;  2EIJ E;  3QOU A;  5KJL A;  5LX8 A;  5CRU A;  4P29 A;  2IF4 A;  3KSQ A;  1YYH A;  3CIA A;  2GRM A;  4TXR A;  3N71 A;  3ML9 A;  3MGB A;  1OT8 A;  3ASN E;  1O1R A;  4JEH A;  4W9R A;  3PE4 A;  4Y6C A;  3PZ4 A;  4C9B B;  2YQ8 A;  2CHX A;  5D2M C;  5J08 A;  3HXC A;  3QKY A;  1N11 A;  4EBA G;  2WXQ A;  4ANW A;  4GTO A;  2DBA A;  1BD8 A;  3D9L A;  4BET A;  4JZY A;  2XHE A;  2BTD A;  1QZ2 A;  4MLP A;  4OAU C;  2L0T B;  5C1D A;  3FUL A;  1N54 A;  4GA2 A;  3RRN B;  4FHJ A;  3UXG A;  1LD8 A;  3ZVV A;  3DSS A;  4K5A B;  1AP7 A;  1BU9 A;  4GMJ A;  3G2U A;  5J90 A;  2V4H C;  3PUJ A;  3NOG D;  3HXD A;  3OXL A;  3CVN A;  3G2V A;  4QQI A;  2AXZ A;  5EID A;  4IYP A;  1P5Q A;  1JCQ A;  1QYM A;  2Y4T A;  3EHM A;  4TUU A;  4UQZ A;  3ZW3 A;  1A17 A;  3EIJ A;  3QWV A;  2QC9 A;  4EBA A;  1NA3 A;  2WXI A;  4HRL A;  4TXP A;  2R5S A;  4ATZ D;  4CDN A;  4A63 B;  2R03 A;  3CHP A;  4F1P A;  3DXK G;  4U8V D;  4D10 C;  4CGV A;  1EPU A;  1OCC E;  3FTV A;  5JJ6 A;  3D9K A;  1E7U A;  5G05 J;  1YMP A;  3HVE B;  4KBQ A;  3CLJ A;  3EU5 A;  3CVL A;  4UWK A;  3EIQ C;  4FP7 A;  3X2Q E;  3C3Q A;  3J5P A;  4CT0 A;  4DX6 D;  5A23 A;  1OWM A;  3OTN A;  2KC7 A;  2P9L G;  3AU5 A;  2MRI A;  3MA5 A;  3MJW A;  5EX3 A;  1ELR A;  3ZNG A;  3F6Q A;  3UI2 A;  1OUV A;  4UQX A;  2WQH A;  1TR4 A;  1OWL A;  3MX3 A;  2IU1 A;  3Q9N C;  2L0I A;  2CHZ A;  4GPM A;  1E8X A;  5D0Q D;  4GZC A;  3IXE A;  4BSZ B;  5KWD A;  5CHE E;  1K3Z D;  1MJ0 A;  2V5F A;  3ZXS A;  2ION A;  2WXN A;  2JEK A;  2J08 A;  2KZT B;  4ANU A;  1O1S A;  4HOR A;  5HI7 A;  4GTS A;  5HQ8 A;  5AJL A;  3QB2 A;  3CVW A;  2J8S D;  3L13 A;  3ESL A;  3L08 A;  3EDT B;  4B93 B;  4XE0 A;  3U9W A;  3JUI A;  2IJG X;  2VSY A;  3UT8 A;  2DZN A;  2GGF A;  2XPZ A;  3Q49 B;  4DJA A;  5AQA A;  3CHS A;  5EX0 A;  2WXL A;  3UIN C;  3LJ3 A;  4RSY A;  4J8D A;  1D9S A;  5CCM A;  3JXI A;  1XGW A;  3S7B A;  2AJA A;  3LS8 A;  4XX5 A;  1O5M A;  2VJ8 A;  1H0A A;  4I1O B;  3EHR A;  3U3W A;  4IN3 B;  3MKQ A;  5JA4 D;  5KBA A;  5JHB A;  4YND A;  2X6I A;  2F8Y A;  3VLD A;  3GW4 A;  2LXL A;  3P1U A;  2P9U G;  3W9G A;  3CGH A;  1H6K A;  4B8A A;  4FC8 A;  1U3C A;  2VTB B;  1E8Z A;  3QJZ A;  3BG1 B;  4QFV A;  2BKK B;  5FIO A;  4PDX A;  2XCC A;  4GYY A;  3AG3 E;  3C5R A;  3HYM B;  3FH8 A;  3DPY A;  4N3A A;  4U8Y D;  4ATG A;  2I1J A;  3EHQ A;  4V3I A;  3NAW A;  1JWF A;  2FO7 A;  4U07 A;  3IV0 A;  4WWN A;  5KJM A;  4U0Z A;  3UT7 A; 
#chains in the Genus database with same CATH homology
 5B3S E;  1V54 E;  2OCC E;  3AG4 E;  3ASO E;  2EIN E;  2EIL E;  3X2Q E;  1V55 E;  1OCZ E;  1OCO E;  2EIM E;  2EIK E;  3ABM E;  2DYS E;  2ZXW E;  1OCC E;  2Y69 E;  3ABL E;  2DYR E;  3ASN E;  2EIJ E;  3AG1 E;  5IY5 E;  5B1A E;  1OCR E;  3ABK E;  5B1B E;  3WG7 E;  3AG3 E;  3AG2 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...