4JB8P

Caspase-7 in complex with darpin c7_16
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
DLGKKLLDAASAGQDDEVRILMANGADVNASNQQGWTPLHATAEYGHLEIVDVLLAYGADVNASDSYGSTPLHSAAWAGHLEIVDVLLAHGADVNASDNYGWTPLHLAAHTGHLEIVDVLLANGADVNANNWWGKTPFDLAIDNGNEDIAEVLQKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7 subunit p20
publication title Design, construction, and characterization of a second-generation DARPin library with reduced hydrophobicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 54
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2013-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4jb8P00
2ETCA 5EYPF 3TWRA 3TWXA 2RFMA 4K5BA 4OAUC 3J5PA 1D9SA 5ENRD 2A5EA 4BETA 1TR4A 5CBOA 4A63B 4BESA 2MYOA 1IKND 4U95D 1IHBA 3SO8A 3UXGA 4J7WA 5JMND 4C48B 4CZ2D 1BI8B 2XEEA 4ZFHA 4BEPA 5AAOA 5ENPD 5BXUA 3EU9A 1MJ0A 4K5CA 4J8YA 4F6RD 5FINA 3ZU7B 5CEDB 1DCQA 3B95A 3UI2A 5D66A 3EHQA 5EYLA 1K1AA 4JB8P 5HRYA 1BI7B 4DUIA 1MX6A 5ITZF 4BERA 3V79K 1N0RA 4HRLA 2F8YA 2QYJA 5EILA 5AQAA 2PNNA 4U8YD 1AWCB 4HI8A 1YMPA 2ETAA 2VGEA 3V2OA 4DX2A 1AP7A 3AJIA 1MX2A 1MX4A 5HS0A 5EIBE 1K1BA 1OT8A 1S70B 4HRMB 4LSZE 4RLYA 4LNUD 4LG6A 4Z68A 4HI9A 2NYJA 4ZHBA 3HG0D 5ENTD 4B93B 1N11A 2L6BA 2XZDG 3DEPA 3ZKJA 5ENOD 5HKPA 3V31A 2V4HC 3W9GA 2ZGDA 5AARA 4TUMA 3TWVA 3ZNGA 2V5QC 3Q9NC 1WDYA 5EN5D 4G8LA 5KNGA 5AN8A 4DX5D 2Y0BG 5AQBA 4QFVA 5BXOA 4HNAD 5JA4D 2B0OE 5CERB 1K3ZD 4NIKA 3V30A 3ZUVB 2F37A 4G8KA 4HLLA 4YDYA 3NOCD 1WG0A 2DZNA 5FIOA 4OAVB 1UOHA 1DC2A 2F8XK 4HBDA 4F1PA 4O1PA 5ENQD 3NOGD 2XEHA 2QC9A 4HRNA 3T9KA 4O60A 3NBNB 5ENSD 5CBNA 4N5QA 1BU9A 1BD8A 5CECB 2FO1E 5EIDA 2P2CP 4YDWA 3D9HA 3V2XA 1SW6A 4U8VD 4U96D 4CYMD 5KBAA 2AJAA 2RFAA 1NFIE 4O1OA 2BKGA 2JABA 2XENA 4DX1A 3LJNA 5KWDA 4DX6D 3F6QA 1N0QA 1YCSB 3J5QB 5KNHD 2HE0A 2DVWA 4BSZB 5CEAA 3T8KA 4DX7D 4DRXE 1IXVA 3JXIA 4HB5A 1OY3D 3DEOA 3C5RA 5AQ7A 3TWSA 2XZTG 1QYMA 2ZGGA 3JUEA 3TWTA 4GPMA 4GMRA 3TWUA 2DZOA 3TWQA 3IXEA 2DWZA 4K5AB 3KEAA 3JXJA 3W9FA 2KXPC 3HRAA 2Y1LE 4UUCA 4ATZD 1YYHA 3TWWA 2J8SD 2KBXA 5AQ9A 1SVXA 1G3NB 1A5EA 2ETBA 3UTMA 3EHRA 2BKKB 1MYOA 1BLXB 3AAAC 3B7BA 4QQIA 3Q9UC 4HQDA
chains in the Genus database with same CATH superfamily
3PZ2A 4FLHA 5D0OD 4WAFA 5AYWD 5JMND 2X6JA 2P9LG 4FHJA 3TGOA 1FT2A 4ILGA 4H7XA 1U3CA 4KVOA 3V79K 5FT9A 5E76A 1EDUA 2ONDA 4U8YD 3SBSA 5EIBE 2XCBA 3QK0A 2VGXA 4LG6A 2P9UG 2A4ZA 3DSUA 4YVOA 4RQIA 1WM5A 4MBGA 4PS8A 3AU5A 2AXUA 2V5QC 4YDEA 3CSTA 3L08A 3FTYA 3G2WA 3RJVA 3FFLA 1TNZA 2F8XK 1D8EA 4O1PA 3CVVA 5M72A 4L2LA 4UWHA 4FADA 1H6PA 3FY4A 5KBAA 2XEVA 3HHMA 4ANVA 4O1OA 4DK5A 4DI3A 4FP7A 4AP2A 3LYAA 3Q47B 2DIWA 4XE0A 3S7JA 2WQ7A 1D8DA 3IXEA 3CK8A 3PEUB 3ASNE 2IEJA 3JQ1A 3ZVVA 5D2MC 1A5EA 2ETBA 2FO7A 4G24A 1N4RA 1SZAA 4OAUC 2CHZA 1KT0A 2LXMA 4BTAA 4XI0A 4BETA 3PE3A 4U95D 4J7WA 3AG1E 4WNEA 3KEZA 4BEPA 3FUHA 3ZEFA 3GZSA 4L7TA 1MX6A 2DYSE 3AS5A 5JJ6A 4HOUA 4ANWA 3U66A 2ETAA 5HS0A 1OT8A 4BT8A 5ARGA 3EU5A 4LNUD 2L6JA 4HXIA 5BPPA 4HOSA 4ACLA 3C3RA 2XHEA 3ESLA 4D10C 2XCCA 3QARA 4RG9A 4AIFA 3QWWA 1OUVA 4HBDA 3HXDA 1UG3A 2H6FA 5ENSD 4XKBA 1H2VC 2V4LA 1OCOE 4U04A 3MKRA 2WXGA 2CFZA 4IN3B 4GTOA 4GTMA 1S64A 2XGMA 2RG8A 3JXIA 3QKYA 3C98A 3SGHA 3U4TA 1UN9A 4F7AA 1MHQA 4LUNU 3D9MA 3W9FA 3VLDA 4YNDA 3TWWA 1Z6TA 3LJ3A 2WQ6A 1BLXB 2PL2A 3UQ3A 2AW6A 2YNQA 4DI4A 3APCA 1L5JA 5ANRA 4J6IA 4Y6CA 2YQ8A 4WNFA 3CGHA 3ZW3A 2KM4A 3B95A 4U0SA 3DPDA 4A55A 4JEUA 4F53A 2L0TB 2WVIA 5CRUA 2R2LA 1PY1A 5LCWC 3MJWA 3PNLB 3ZYLA 2XZDG 3CIAA 5AARA 3Q7FA 5G04C 2R02A 3FUNA 2FBNA 2KC7A 4HLLA 3L13A 2XEHA 5FQ7A 2VJ8A 3RK6A 2FO1E 1KZOA 2J49A 1SW6A 1N4PA 1NFIE 4BX8A 2EQXA 1N52A 3SD5A 3J5QB 2OVBA 1YA0A 5T8IA 3MYVA 4WUYA 4XI9A 3MX3A 4ATZD 1JWGA 3L9TA 3UMVA 2LSVA 3DRAA 1HF8A 2IOSA 5B1BE 3MEKA 4CGVA 4J0UA 3ULYA 4WWPA 3L22A 3FUMA 3EIJA 2WXNA 5CBOA 2MYOA 3SO8A 3NZUA 5EKQD 3EU9A 3CVNA 5CEDB 2VSYA 3FTSA 3T5VA 3ML8A 3KSQA 4WWOA 2R03A 4UI9C 2F8YA 3AG2E 1PAQA 5AQAA 3TL5A 3NQPA 3DSXA 1HH8A 5FZQA 4Z68A 4DLQA 4MLPA 2V4HC 1TNBA 3APFA 3Q9NC 2Y0BG 4AM9A 4G8KA 5LX8A 3ASDA 4N2QA 3OAWA 4G26A 2QC9A 3PREA 4C9BB 1IHGA 2JEKA 4GU5A 1KPSB 2GRLA 3V2XA 2GRPB 4U96D 4JZYA 2ILRA 2RFAA 3WXXA 5CRVA 1YCSB 5KNHD 2DVWA 3BQOA 3T8KA 2XPYA 3CHOA 4G1TA 4LNGA 3C5RA 2H6HA 3PZ3A 4CEMA 4U0UA 3FULA 4CDNA 5A23A 3ASGA 3FWVA 5KJMA 3KSLA 2Y1LE 4A1SA 4TXRA 3EDTB 3ULEG 1ELWA 4J8SA 4J8FA 1G3NB 2BKKB 5EX0A 5J90A 2P9NG 2GW1A 4O6FA 3EJNA 4A63B 3GZ2A 1GW6A 3ZIMA 4N3CA 1N4QA 4GYWA 1OCRE 4XIFA 1W3BA 1H2TC 2L0IA 5FZRA 4JB8P 4FA6A 4JHRA 4LERA 3RAUA 5EILA 4UQYA 4APFA 4KT6B 3Q73A 4HRMB 4B8CB 3AU4A 4G11A 4GCNA 1FT1A 3FDHA 2NSZA 1TN7A 3ZYMA 4TUMA 1Z3YA 3GW4A 2JLBA 1QZ2A 3NBNB 3SY2A 2NXPA 2P2CP 3HIZA 3I5PA 2IY0C 2GRNB 3ZYKA 2FI7A 3RSEG 3G2TA 1O1SA 4L1BA 1UJKA 4N39A 3OTNA 2J08A 4AY5A 4JL0A 4AV7A 3EHMA 3RU0A 2XRYA 3HXFA 3RKVA 4QQIA 3ENEA 4ANXA 1FVHA 3K9IA 2XGSA 2RFMA 1S63A 3IV0A 4I1AA 2VSNA 3RRUA 4GMJA 3RRMB 4FJYA 4V3IA 2DYRE 4C0MA 4TRQA 4F6RD 2LXLA 3S7DA 3ZU7B 3DWLG 4U07A 3PEVB 3Q7AA 4F1SA 1BI7B 4URKA 2OOEA 5BV1A 4ILIA 2V8SE 1QNFA 3AS4A 3E30A 4ATGA 5BV0A 4GAAA 3RO3A 3V2OA 1MX4A 3EHNA 3CVXA 1H0AA 3L82A 4JEHA 3V31A 3T8MA 4IRUA 3RO2A 3FTVA 3QWVA 4HS2A 3ONKA 2X6FA 2I9CA 4PS7A 2B6CA 3DBSA 4WWNA 1XNFA 5FWQA 1JCQA 2I6HA 4HVBA 4F1PA 4WNDA 4ILHB 5CBNA 4N5QA 1BU9A 5ENNA 2GRRB 4HOTA 4JHJA 2BKGA 3X2QE 4B8AA 4BSXA 4GMRA 1JWFA 1U3DA 5KCMA 3E32A 5KJLA 1Y6IA 4EBAG 3EUVA 4AJWA 3U3WA 3B7BA 2I2OA 3Q9UC 5EYPF 3ZFWA 5CHEE 5FQ8A 4CDMA 1Y8MA 1NI1A 1HFAA 4LEUA 3C72A 3JUIA 4F3VA 3FH5A 3HVEB 5KJKA 5EYLA 2V5FA 4DUIA 3D3MA 1QQEA 2IO3C 5CCLA 4HI8A 5EDSA 1YMPA 1O1TA 1E90A 3AJIA 4I6JA 1O1RA 1E7UA 4W9RA 3ZPJA 3KD7A 3KS2A 3ABKE 4H7YA 2NYJA 2WXOA 4B89A 5B1AE 1N11A 3LS8A 3JCKC 1JUQA 4RG6A 3CSFA 3UT7A 4B0ZA 4HNAD 4GTSA 2EIKE 2EIJE 3P2BA 1A17A 3NZSA 1BD8A 3HYMB 2Y4UA 1Q2ZA 1N9AA 3TG4A 3FUDA 2JABA 4BWRA 4GPKA 3JUEA 3FH7A 3O4ZA 3TWTA 2RKKA 3TWUA 2WPVA 3CK9A 3T5XA 3DXMG 2WXHA 4KXKB 2KXPC 4LRZA 3FHEA 3R9AB 3PH0C 2J8SD 3D9NA 1TNOA 2KBXA 2VSXE 3VTXA 3ZGQA 2HR2A 3D9KA 4FJZA 4PH4B 3CQCB 2BF0X 2HYZA 5D0QD 4TV3A 1E7VA 3B7SA 2XQ0A 1HX8A 1E8ZA 2KCLA 1UJJA 1BPOA 2P9PG 4KVMA 1HU3A 5AENA 3JQ0A 1AWCB 3VLEA 4GTRA 2XPIA 3UINC 3P1UA 2ZGDA 1U2VG 3HVEA 2B0OE 2WXLA 2IF4A 2WQHA 4GA0A 3L16A 4RSYA 3O48A 3BG0B 2ZISA 5EIDA 4GZCA 4XX5A 5KJNA 3G2VA 2XENA 3LJNA 2HO1A 3URZA 4BSZB 3FP3A 3DEOA 4FU3A 2VSOE 2WXFA 4APOA 2KCVA 2UY1B 1TNYA 1OWMA 4P29A 3E33A 3FUFA 3CVLA 3LDZA 5DIZA 1KLXA 2AWIA 3UT8A 3ZHEB 5FQ4A 3ASHA 3SHFA 3L54A 4GA2A 3LY7A 5FINA 1DCQA 3CK7A 3IHVA 3UM1A 3AS8A 3EHQA 4JHKA 4ABNA 1SA5A 4AXHA 4JW1A 3CEQA 4DX2A 1X5BA 2GGFA 3HDXA 3U64A 3C3QA 4BT9A 2P9IG 3N71A 4Q69A 4JA7A 4KZ0A 4EPZA 5G55A 3BU8A 1OCZE 3SNXA 2WMOA 3TWVA 3E37A 4G8LA 3DPYA 1RZ4A 3LVRE 2KZTB 2VQ2A 5AJDA 4HRNA 2J09A 3CVWA 4LNBA 1E8WA 4I6GA 3G2UA 2XPZA 4FHKA 5FJYA 4J8EA 4DX1A 5HQ8A 4G2VA 2IONA 4JPSA 1XGWA 4N3AA 5G05J 2DZOA 4GTTA 2H6GA 4K5AB 3I4GA 3JXJA 1V54E 4I17A 4B94A 4UI9K 2X3MA 3EIQC 4EECA 3WG7E 2WXPA 3C3OA 2R17C 4TUUA 1IQUA 1OWOA 4HQDA 4K0RA 4KBQA 3OXLA 4K5BA 3J5PA 1D9SA 3R9MA 2BUGA 3QC1A 2LSUA 3D9PA 4CZ2D 1IYGA 2ZIRA 3CHSA 3BEEA 4GYYA 1FPPA 3FUIA 2UY1A 4CCAA 1SA4A 5ITZF 1H19A 5BT1A 4DPRA 4Q94A 2PNNA 1HS6A 4L2YA 2VGEA 1MX2A 2Y4TA 3CHMA 4LSZE 4NQ0A 4RLYA 5H7PA 4B93B 2L6BA 3ONLA 3ZHEA 1IQRA 3I3NA 3FU0A 3PNTB 4QFVA 4CT0A 1X81A 2CHWA 4YVQC 5G05C 4CT4A 4XEIG 3UM0A 2MOWA 3D9JA 3SFYA 1JCRA 4JC8A 5LOZA 5FZSA 2WM9A 3MKQB 5AIJA 2AJAA 2KCKA 3TAXA 4HOQA 4NACA 3Q15A 2RD0A 1OCCE 3CKCA 4EZJA 2QFCA 4I1MA 2EILE 5E75A 2YHCA 2P9KG 2MRIA 2KZTA 3UIPC 2EINE 3CVUA 3HXBA 3KEAA 3CHQA 3B7UX 2OV8A 5AQ9A 3QDNA 4AVXA 3SFZA 3UX4A 2ETCA 3TWXA 3FUJA 4EZLA 1QBQA 4UQZA 2E2EA 1N94A 4A3VA 4EHMA 4I43A 4AOFA 5BUZA 2EIME 3BUAA 4BFRA 3PS6A 1K1AA 4JXTA 2PM7A 3DSWA 3FH8A 4GCOA 1KT1A 2PM6A 3LVQE 5A7DB 3L6AA 5G2NA 5BW8C 2L9BA 3FTUA 5HKPA 5JHAA 5JJ7A 3FTXA 1WDYA 5EN5D 3U9WA 3OXGA 2WXIA 3S7FA 4HFGA 3MA5A 3NOGD 2X38A 1ZBPA 2IQCA 2XS1A 4KMOA 1ELRA 4MS6A 4BY6A 1OWLA 4L23A 3PE4A 3Q78A 1N0QA 3R7RA 2OCCE 4HB5A 3DXKG 3PRZA 4XKCA 3ASFA 2IU1A 3TWQA 5T4YA 4DJAA 2J07A 4E6HA 3MKQA 4IULA 3B7RL 2CG3A 4MRUA 3TWRA 5ENRD 3AG4E 3B13A 3ISMC 3MZLB 3B7TA 1IKND 4I2ZA 4M7CA 3LEWA 1MJ0A 4K5CA 3UT4A 4EBAA 3Q4AB 1TJFA 2Y69E 1RW2A 3S2AA 1INZA 2P9SG 2QY7A 2XGOA 1N0RA 3GZ1A 1K8KG 5HI7A 1E8XA 1LD7A 3BG1B 4BX9A 2OEWA 2LNIA 4I6EA 1S70B 1OWPA 1DNPA 4NURA 5AJLA 4A1GA 3DEPA 2I1KA 3IEGA 2A5UA 3W9GA 5AQBA 1O5MA 3L17A 4NIKA 3I4RB 3CKBA 5LP0A 1WG0A 5C2YA 3FTZA 3PUKA 4I1OB 3FU5A 3LY8A 1H6OA 1EYHA 2PQRA 3ML9A 4I9EA 3IKOB 4YDWA 1HG5A 3Q5MA 4UWLA 5KWDA 3ESKA 3F6QA 3ZXSA 5CEAA 1MZCA 3IHYA 4GYOA 2ZGGA 5CMYA 1TNUA 2OVFA 2DWZA 1N4SA 2C0MA 2H6IA 3ZN3A 2IO2C 3SFXA 1MYOA 1ZB1A 4E85A 4M3OA 4PDXA 4OVUA 2A5EA 1TR4A 1VDYA 2R5SA 3PZDA 3UXGA 2YHEA 1BI8B 4GA1A 5AAOA 5ENPD 3SQVA 2GRQB 4J8YA 3TG5A 3UI2A 5D66A 2KATA 3KAEA 3PUJA 3CV0A 2LAIA 2NC9A 2QYJA 2P58C 2VGYA 4FULA 1NL4A 4Q96A 2M63A 3JYSA 3NB2A 2DBAA 2F0YA 4HI9A 5LCWJ 4A3TA 3TXNA 5ANLA 1H2UA 2FF4A 3UIOC 3Q49B 3RIBA 5KNGA 4UWFA 3LPZA 5JA4D 5G04J 4CRWA 3QJZA 2F37A 1NP7A 4I2WA 1HE8A 2VYIA 3NOCD 1DC2A 5FIOA 2CG2A 4GTPA 5CECB 4PUCA 2YINA 3D9HA 1MQSA 1TJCA 1TN8A 3HXCA 2UWJG 5ARFA 1EF1C 4YDOA 4I9CA 1JPLA 2E0IA 3FTWA 5AQ7A 3TWSA 4FC8A 2AXZA 2Q7FA 3RRNB 4CGWA 1HG2A 2ZU6B 4N5CA 4JVSA 3GYZA 3CLJA 3Q75A 2HM8A 1LD8A 3EHRA 3TJPA 3UUXA 3Q79A 4Y6WA 3ZRHA 2FULA 4GZ6A 4MKTA 4C0EA 1TYQG 2XEEA 1FCHA 2DCPA 4GZDA 4BTBA 3PZ4A 4L9PA 2CHXA 3D9LA 2WXMA 3AG3E 2BTDA 5CMWA 3LKUA 2QZAA 2FEZA 1DVPA 3PZ1A 1NZNA 1SQMA 4UWKA 4UI9J 3D9OA 3MV3B 1AP7A 4U63A 4X8QA 1K1BA 1TEZA 4GZ3A 1UN8A 3HG0D 4K03A 4XZ4A 5ENOD 4JA9A 3DSVA 1OWNA 5AN8A 5BXOA 5CERB 2DZNA 1UOHA 1KZPA 2MHKA 3ZYQA 2C0LA 2ZXWE 4O60A 4TXPA 4G23A 3QNKA 3DSSA 4G25A 2GRMA 4GTVA 4U8VD 2AXVA 1P5QA 2WXJA 4OVVA 3OXFA 3QWPA 5IY5E 2BEDA 4TXQA 2IFUA 3UM2A 3S7BA 2C2LA 3MGBA 4GPMA 4ANUA 2X6KA 5FQ6A 4RVBA 1DCEA 3UM3A 4PS3A 2CFUA 4KZCA 3PVLA 1YYHA 2R05A 3AAAC 5C1DA 3FEXA 3CVYA 2X6IA 1E8YA 3E34A 1H6KA 3CVQA 3CQGB 3FEYA 3MCXA 4ME2A 4EZKA 4HLEA 4ZFHA 5BXUA 1Z5SC 4N3BA 4U0ZA 5HRYA 2WB2A 4BERA 4ACKA 4HRLA 2I1JA 5EX3A 2IJGX 3CHRA 3FUKA 4GB9A 1E96B 1HXIA 5ENTD 4N2SA 3VLFA 3UKUG 3QOUA 1WY6A 1N95A 1K3ZD 3LY9A 3ZUVB 4CDRA 2VTBB 4GTQA 4J8DA 5B3SE 4FLBA 5JJTA 3TXMA 1LF8A 5CCMA 5ENQD 4UWGA 3T9KA 2XS8A 2X6HA 1S0PA 1EPUA 2PZIA 3SZ7A 3ASOE 1PC2A 4CYMD 3DSTA 4DX6D 1OXJA 4U8HA 4DX7D 1OY3D 2GROB 1FVFA 1NA3A 4GZ5A 4HORA 3VTYA 2XZTG 1QYMA 3QAQA 4AEZC 3IBEA 2J4BA 4IYPA 4GMLA 1LTXA 2WMNA 3HRAA 3LXUX 2WXKA 1SVXA 2PQNA 4ZHBA 1WAO1 4AY6A 2LUHA 3ABLE 3NAWA 3ULQA 1V55E 2VGXB 2QYUA 4BESA 1IHBA 5JHBA 4C48B 5LFAA 3FU3A 5A6CA 1Z3XA 3CR3A 4DLOA 3FUEA 3G2SA 3FU6A 2Y3AA 1TN6A 2LAHA 4KYOB 1NA0A 1ZU2A 1HZ4A 2WXRA 3MV2B 4WNGA 1UW4B 2J9QA 4OYSA 5FTPA 4U7EB 3ZKJA 3PDNA 3LCAA 2LO6A 3ZNGA 2AVPA 4DX5D 4EQFA 1N54A 1HO8A 3V30A 4YDYA 2V0PA 2IOLA 3R7QA 4OAVB 3UPVA 3UKRG 3NF1A 3HXEA 2R59A 5DBKA 2HE0A 3CVPA 4DRXE 4R7LA 1IXVA 2WXQA 2XRZA 1JCSA 3CHPA 1ELKA 5BNWA 4JD2G 5T3RA 4NRHB 4LCTA 1SZ9A 3SI5A 2VTBA 3APDA 4UQXA 3SBTB 4UUCA 3ZXPA 3E4BA 1B89A 3D9IA 3UTMA 5J08A 2J4DA 3QB2A 3ABME 3SF4A 2OEVA
chains in the Genus database with same CATH topology
2ETCA 5EYPF 3TWRA 3TWXA 2RFMA 4K5BA 4OAUC 3J5PA 1D9SA 5ENRD 2A5EA 4BETA 1TR4A 5CBOA 4A63B 4BESA 2MYOA 1IKND 4U95D 1IHBA 3SO8A 3UXGA 4J7WA 5JMND 4C48B 4CZ2D 1BI8B 2XEEA 4ZFHA 4BEPA 5AAOA 5ENPD 5BXUA 3EU9A 1MJ0A 4K5CA 4J8YA 4F6RD 5FINA 3ZU7B 5CEDB 1DCQA 3B95A 3UI2A 5D66A 3EHQA 5EYLA 1K1AA 4JB8P 5HRYA 1BI7B 4DUIA 1MX6A 5ITZF 4BERA 3V79K 1N0RA 4HRLA 2F8YA 2QYJA 5EILA 5AQAA 2PNNA 4U8YD 1AWCB 4HI8A 1YMPA 2ETAA 2VGEA 3V2OA 4DX2A 1AP7A 3AJIA 1MX2A 1MX4A 5HS0A 5EIBE 1K1BA 1OT8A 1S70B 4HRMB 4LSZE 4RLYA 4LNUD 4LG6A 4Z68A 4HI9A 2NYJA 4ZHBA 3HG0D 5ENTD 4B93B 1N11A 2L6BA 2XZDG 3DEPA 3ZKJA 5ENOD 5HKPA 3V31A 2V4HC 3W9GA 2ZGDA 5AARA 4TUMA 3TWVA 3ZNGA 2V5QC 3Q9NC 1WDYA 5EN5D 4G8LA 5KNGA 5AN8A 4DX5D 2Y0BG 5AQBA 4QFVA 5BXOA 4HNAD 5JA4D 2B0OE 5CERB 1K3ZD 4NIKA 3V30A 3ZUVB 2F37A 4G8KA 4HLLA 4YDYA 3NOCD 1WG0A 2DZNA 5FIOA 4OAVB 1UOHA 1DC2A 2F8XK 4HBDA 4F1PA 4O1PA 5ENQD 3NOGD 2XEHA 2QC9A 4HRNA 3T9KA 4O60A 3NBNB 5ENSD 5CBNA 4N5QA 1BU9A 1BD8A 5CECB 2FO1E 5EIDA 2P2CP 4YDWA 3D9HA 3V2XA 1SW6A 4U8VD 4U96D 4CYMD 5KBAA 2AJAA 2RFAA 1NFIE 4O1OA 2BKGA 2JABA 2XENA 4DX1A 3LJNA 5KWDA 4DX6D 3F6QA 1N0QA 1YCSB 3J5QB 5KNHD 2HE0A 2DVWA 4BSZB 5CEAA 3T8KA 4DX7D 4DRXE 1IXVA 3JXIA 4HB5A 1OY3D 3DEOA 3C5RA 5AQ7A 3TWSA 2XZTG 1QYMA 2ZGGA 3JUEA 3TWTA 4GPMA 4GMRA 3TWUA 2DZOA 3TWQA 3IXEA 2DWZA 4K5AB 3KEAA 3JXJA 3W9FA 2KXPC 3HRAA 2Y1LE 4UUCA 4ATZD 1YYHA 3TWWA 2J8SD 2KBXA 5AQ9A 1SVXA 1G3NB 1A5EA 2ETBA 3UTMA 3EHRA 2BKKB 1MYOA 1BLXB 3AAAC 3B7BA 4QQIA 3Q9UC 4HQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETC A;  5EYP F;  3TWR A;  3TWX A;  2RFM A;  4K5B A;  4OAU C;  3J5P A;  1D9S A;  5ENR D;  2A5E A;  4BET A;  1TR4 A;  5CBO A;  4A63 B;  4BES A;  2MYO A;  1IKN D;  4U95 D;  1IHB A;  3SO8 A;  3UXG A;  4J7W A;  5JMN D;  4C48 B;  4CZ2 D;  1BI8 B;  2XEE A;  4ZFH A;  4BEP A;  5AAO A;  5ENP D;  5BXU A;  3EU9 A;  1MJ0 A;  4K5C A;  4J8Y A;  4F6R D;  5FIN A;  3ZU7 B;  5CED B;  1DCQ A;  3B95 A;  3UI2 A;  5D66 A;  3EHQ A;  5EYL A;  1K1A A;  4JB8 P;  5HRY A;  1BI7 B;  4DUI A;  1MX6 A;  5ITZ F;  4BER A;  3V79 K;  1N0R A;  4HRL A;  2F8Y A;  2QYJ A;  5EIL A;  5AQA A;  2PNN A;  4U8Y D;  1AWC B;  4HI8 A;  1YMP A;  2ETA A;  2VGE A;  3V2O A;  4DX2 A;  1AP7 A;  3AJI A;  1MX2 A;  1MX4 A;  5HS0 A;  5EIB E;  1K1B A;  1OT8 A;  1S70 B;  4HRM B;  4LSZ E;  4RLY A;  4LNU D;  4LG6 A;  4Z68 A;  4HI9 A;  2NYJ A;  4ZHB A;  3HG0 D;  5ENT D;  4B93 B;  1N11 A;  2L6B A;  2XZD G;  3DEP A;  3ZKJ A;  5ENO D;  5HKP A;  3V31 A;  2V4H C;  3W9G A;  2ZGD A;  5AAR A;  4TUM A;  3TWV A;  3ZNG A;  2V5Q C;  3Q9N C;  1WDY A;  5EN5 D;  4G8L A;  5KNG A;  5AN8 A;  4DX5 D;  2Y0B G;  5AQB A;  4QFV A;  5BXO A;  4HNA D;  5JA4 D;  2B0O E;  5CER B;  1K3Z D;  4NIK A;  3V30 A;  3ZUV B;  2F37 A;  4G8K A;  4HLL A;  4YDY A;  3NOC D;  1WG0 A;  2DZN A;  5FIO A;  4OAV B;  1UOH A;  1DC2 A;  2F8X K;  4HBD A;  4F1P A;  4O1P A;  5ENQ D;  3NOG D;  2XEH A;  2QC9 A;  4HRN A;  3T9K A;  4O60 A;  3NBN B;  5ENS D;  5CBN A;  4N5Q A;  1BU9 A;  1BD8 A;  5CEC B;  2FO1 E;  5EID A;  2P2C P;  4YDW A;  3D9H A;  3V2X A;  1SW6 A;  4U8V D;  4U96 D;  4CYM D;  5KBA A;  2AJA A;  2RFA A;  1NFI E;  4O1O A;  2BKG A;  2JAB A;  2XEN A;  4DX1 A;  3LJN A;  5KWD A;  4DX6 D;  3F6Q A;  1N0Q A;  1YCS B;  3J5Q B;  5KNH D;  2HE0 A;  2DVW A;  4BSZ B;  5CEA A;  3T8K A;  4DX7 D;  4DRX E;  1IXV A;  3JXI A;  4HB5 A;  1OY3 D;  3DEO A;  3C5R A;  5AQ7 A;  3TWS A;  2XZT G;  1QYM A;  2ZGG A;  3JUE A;  3TWT A;  4GPM A;  4GMR A;  3TWU A;  2DZO A;  3TWQ A;  3IXE A;  2DWZ A;  4K5A B;  3KEA A;  3JXJ A;  3W9F A;  2KXP C;  3HRA A;  2Y1L E;  4UUC A;  4ATZ D;  1YYH A;  3TWW A;  2J8S D;  2KBX A;  5AQ9 A;  1SVX A;  1G3N B;  1A5E A;  2ETB A;  3UTM A;  3EHR A;  2BKK B;  1MYO A;  1BLX B;  3AAA C;  3B7B A;  4QQI A;  3Q9U C;  4HQD A; 
#chains in the Genus database with same CATH topology
 3PZ2 A;  4FLH A;  5D0O D;  4WAF A;  5AYW D;  5JMN D;  2X6J A;  2P9L G;  4FHJ A;  3TGO A;  1FT2 A;  4ILG A;  4H7X A;  1U3C A;  4KVO A;  3V79 K;  5FT9 A;  5E76 A;  1EDU A;  2OND A;  4U8Y D;  3SBS A;  5EIB E;  2XCB A;  3QK0 A;  2VGX A;  4LG6 A;  2P9U G;  2A4Z A;  3DSU A;  4YVO A;  4RQI A;  1WM5 A;  4MBG A;  4PS8 A;  3AU5 A;  2AXU A;  2V5Q C;  4YDE A;  3CST A;  3L08 A;  3FTY A;  3G2W A;  3RJV A;  3FFL A;  1TNZ A;  2F8X K;  1D8E A;  4O1P A;  3CVV A;  5M72 A;  4L2L A;  4UWH A;  4FAD A;  1H6P A;  3FY4 A;  5KBA A;  2XEV A;  3HHM A;  4ANV A;  4O1O A;  4DK5 A;  4DI3 A;  4FP7 A;  4AP2 A;  3LYA A;  3Q47 B;  2DIW A;  4XE0 A;  3S7J A;  2WQ7 A;  1D8D A;  3IXE A;  3CK8 A;  3PEU B;  3ASN E;  2IEJ A;  3JQ1 A;  3ZVV A;  5D2M C;  1A5E A;  2ETB A;  2FO7 A;  4G24 A;  1N4R A;  1SZA A;  4OAU C;  2CHZ A;  1KT0 A;  2LXM A;  4BTA A;  4XI0 A;  4BET A;  3PE3 A;  4U95 D;  4J7W A;  3AG1 E;  4WNE A;  3KEZ A;  4BEP A;  3FUH A;  3ZEF A;  3GZS A;  4L7T A;  1MX6 A;  2DYS E;  3AS5 A;  5JJ6 A;  4HOU A;  4ANW A;  3U66 A;  2ETA A;  5HS0 A;  1OT8 A;  4BT8 A;  5ARG A;  3EU5 A;  4LNU D;  2L6J A;  4HXI A;  5BPP A;  4HOS A;  4ACL A;  3C3R A;  2XHE A;  3ESL A;  4D10 C;  2XCC A;  3QAR A;  4RG9 A;  4AIF A;  3QWW A;  1OUV A;  4HBD A;  3HXD A;  1UG3 A;  2H6F A;  5ENS D;  4XKB A;  1H2V C;  2V4L A;  1OCO E;  4U04 A;  3MKR A;  2WXG A;  2CFZ A;  4IN3 B;  4GTO A;  4GTM A;  1S64 A;  2XGM A;  2RG8 A;  3JXI A;  3QKY A;  3C98 A;  3SGH A;  3U4T A;  1UN9 A;  4F7A A;  1MHQ A;  4LUN U;  3D9M A;  3W9F A;  3VLD A;  4YND A;  3TWW A;  1Z6T A;  3LJ3 A;  2WQ6 A;  1BLX B;  2PL2 A;  3UQ3 A;  2AW6 A;  2YNQ A;  4DI4 A;  3APC A;  1L5J A;  5ANR A;  4J6I A;  4Y6C A;  2YQ8 A;  4WNF A;  3CGH A;  3ZW3 A;  2KM4 A;  3B95 A;  4U0S A;  3DPD A;  4A55 A;  4JEU A;  4F53 A;  2L0T B;  2WVI A;  5CRU A;  2R2L A;  1PY1 A;  5LCW C;  3MJW A;  3PNL B;  3ZYL A;  2XZD G;  3CIA A;  5AAR A;  3Q7F A;  5G04 C;  2R02 A;  3FUN A;  2FBN A;  2KC7 A;  4HLL A;  3L13 A;  2XEH A;  5FQ7 A;  2VJ8 A;  3RK6 A;  2FO1 E;  1KZO A;  2J49 A;  1SW6 A;  1N4P A;  1NFI E;  4BX8 A;  2EQX A;  1N52 A;  3SD5 A;  3J5Q B;  2OVB A;  1YA0 A;  5T8I A;  3MYV A;  4WUY A;  4XI9 A;  3MX3 A;  4ATZ D;  1JWG A;  3L9T A;  3UMV A;  2LSV A;  3DRA A;  1HF8 A;  2IOS A;  5B1B E;  3MEK A;  4CGV A;  4J0U A;  3ULY A;  4WWP A;  3L22 A;  3FUM A;  3EIJ A;  2WXN A;  5CBO A;  2MYO A;  3SO8 A;  3NZU A;  5EKQ D;  3EU9 A;  3CVN A;  5CED B;  2VSY A;  3FTS A;  3T5V A;  3ML8 A;  3KSQ A;  4WWO A;  2R03 A;  4UI9 C;  2F8Y A;  3AG2 E;  1PAQ A;  5AQA A;  3TL5 A;  3NQP A;  3DSX A;  1HH8 A;  5FZQ A;  4Z68 A;  4DLQ A;  4MLP A;  2V4H C;  1TNB A;  3APF A;  3Q9N C;  2Y0B G;  4AM9 A;  4G8K A;  5LX8 A;  3ASD A;  4N2Q A;  3OAW A;  4G26 A;  2QC9 A;  3PRE A;  4C9B B;  1IHG A;  2JEK A;  4GU5 A;  1KPS B;  2GRL A;  3V2X A;  2GRP B;  4U96 D;  4JZY A;  2ILR A;  2RFA A;  3WXX A;  5CRV A;  1YCS B;  5KNH D;  2DVW A;  3BQO A;  3T8K A;  2XPY A;  3CHO A;  4G1T A;  4LNG A;  3C5R A;  2H6H A;  3PZ3 A;  4CEM A;  4U0U A;  3FUL A;  4CDN A;  5A23 A;  3ASG A;  3FWV A;  5KJM A;  3KSL A;  2Y1L E;  4A1S A;  4TXR A;  3EDT B;  3ULE G;  1ELW A;  4J8S A;  4J8F A;  1G3N B;  2BKK B;  5EX0 A;  5J90 A;  2P9N G;  2GW1 A;  4O6F A;  3EJN A;  4A63 B;  3GZ2 A;  1GW6 A;  3ZIM A;  4N3C A;  1N4Q A;  4GYW A;  1OCR E;  4XIF A;  1W3B A;  1H2T C;  2L0I A;  5FZR A;  4JB8 P;  4FA6 A;  4JHR A;  4LER A;  3RAU A;  5EIL A;  4UQY A;  4APF A;  4KT6 B;  3Q73 A;  4HRM B;  4B8C B;  3AU4 A;  4G11 A;  4GCN A;  1FT1 A;  3FDH A;  2NSZ A;  1TN7 A;  3ZYM A;  4TUM A;  1Z3Y A;  3GW4 A;  2JLB A;  1QZ2 A;  3NBN B;  3SY2 A;  2NXP A;  2P2C P;  3HIZ A;  3I5P A;  2IY0 C;  2GRN B;  3ZYK A;  2FI7 A;  3RSE G;  3G2T A;  1O1S A;  4L1B A;  1UJK A;  4N39 A;  3OTN A;  2J08 A;  4AY5 A;  4JL0 A;  4AV7 A;  3EHM A;  3RU0 A;  2XRY A;  3HXF A;  3RKV A;  4QQI A;  3ENE A;  4ANX A;  1FVH A;  3K9I A;  2XGS A;  2RFM A;  1S63 A;  3IV0 A;  4I1A A;  2VSN A;  3RRU A;  4GMJ A;  3RRM B;  4FJY A;  4V3I A;  2DYR E;  4C0M A;  4TRQ A;  4F6R D;  2LXL A;  3S7D A;  3ZU7 B;  3DWL G;  4U07 A;  3PEV B;  3Q7A A;  4F1S A;  1BI7 B;  4URK A;  2OOE A;  5BV1 A;  4ILI A;  2V8S E;  1QNF A;  3AS4 A;  3E30 A;  4ATG A;  5BV0 A;  4GAA A;  3RO3 A;  3V2O A;  1MX4 A;  3EHN A;  3CVX A;  1H0A A;  3L82 A;  4JEH A;  3V31 A;  3T8M A;  4IRU A;  3RO2 A;  3FTV A;  3QWV A;  4HS2 A;  3ONK A;  2X6F A;  2I9C A;  4PS7 A;  2B6C A;  3DBS A;  4WWN A;  1XNF A;  5FWQ A;  1JCQ A;  2I6H A;  4HVB A;  4F1P A;  4WND A;  4ILH B;  5CBN A;  4N5Q A;  1BU9 A;  5ENN A;  2GRR B;  4HOT A;  4JHJ A;  2BKG A;  3X2Q E;  4B8A A;  4BSX A;  4GMR A;  1JWF A;  1U3D A;  5KCM A;  3E32 A;  5KJL A;  1Y6I A;  4EBA G;  3EUV A;  4AJW A;  3U3W A;  3B7B A;  2I2O A;  3Q9U C;  5EYP F;  3ZFW A;  5CHE E;  5FQ8 A;  4CDM A;  1Y8M A;  1NI1 A;  1HFA A;  4LEU A;  3C72 A;  3JUI A;  4F3V A;  3FH5 A;  3HVE B;  5KJK A;  5EYL A;  2V5F A;  4DUI A;  3D3M A;  1QQE A;  2IO3 C;  5CCL A;  4HI8 A;  5EDS A;  1YMP A;  1O1T A;  1E90 A;  3AJI A;  4I6J A;  1O1R A;  1E7U A;  4W9R A;  3ZPJ A;  3KD7 A;  3KS2 A;  3ABK E;  4H7Y A;  2NYJ A;  2WXO A;  4B89 A;  5B1A E;  1N11 A;  3LS8 A;  3JCK C;  1JUQ A;  4RG6 A;  3CSF A;  3UT7 A;  4B0Z A;  4HNA D;  4GTS A;  2EIK E;  2EIJ E;  3P2B A;  1A17 A;  3NZS A;  1BD8 A;  3HYM B;  2Y4U A;  1Q2Z A;  1N9A A;  3TG4 A;  3FUD A;  2JAB A;  4BWR A;  4GPK A;  3JUE A;  3FH7 A;  3O4Z A;  3TWT A;  2RKK A;  3TWU A;  2WPV A;  3CK9 A;  3T5X A;  3DXM G;  2WXH A;  4KXK B;  2KXP C;  4LRZ A;  3FHE A;  3R9A B;  3PH0 C;  2J8S D;  3D9N A;  1TNO A;  2KBX A;  2VSX E;  3VTX A;  3ZGQ A;  2HR2 A;  3D9K A;  4FJZ A;  4PH4 B;  3CQC B;  2BF0 X;  2HYZ A;  5D0Q D;  4TV3 A;  1E7V A;  3B7S A;  2XQ0 A;  1HX8 A;  1E8Z A;  2KCL A;  1UJJ A;  1BPO A;  2P9P G;  4KVM A;  1HU3 A;  5AEN A;  3JQ0 A;  1AWC B;  3VLE A;  4GTR A;  2XPI A;  3UIN C;  3P1U A;  2ZGD A;  1U2V G;  3HVE A;  2B0O E;  2WXL A;  2IF4 A;  2WQH A;  4GA0 A;  3L16 A;  4RSY A;  3O48 A;  3BG0 B;  2ZIS A;  5EID A;  4GZC A;  4XX5 A;  5KJN A;  3G2V A;  2XEN A;  3LJN A;  2HO1 A;  3URZ A;  4BSZ B;  3FP3 A;  3DEO A;  4FU3 A;  2VSO E;  2WXF A;  4APO A;  2KCV A;  2UY1 B;  1TNY A;  1OWM A;  4P29 A;  3E33 A;  3FUF A;  3CVL A;  3LDZ A;  5DIZ A;  1KLX A;  2AWI A;  3UT8 A;  3ZHE B;  5FQ4 A;  3ASH A;  3SHF A;  3L54 A;  4GA2 A;  3LY7 A;  5FIN A;  1DCQ A;  3CK7 A;  3IHV A;  3UM1 A;  3AS8 A;  3EHQ A;  4JHK A;  4ABN A;  1SA5 A;  4AXH A;  4JW1 A;  3CEQ A;  4DX2 A;  1X5B A;  2GGF A;  3HDX A;  3U64 A;  3C3Q A;  4BT9 A;  2P9I G;  3N71 A;  4Q69 A;  4JA7 A;  4KZ0 A;  4EPZ A;  5G55 A;  3BU8 A;  1OCZ E;  3SNX A;  2WMO A;  3TWV A;  3E37 A;  4G8L A;  3DPY A;  1RZ4 A;  3LVR E;  2KZT B;  2VQ2 A;  5AJD A;  4HRN A;  2J09 A;  3CVW A;  4LNB A;  1E8W A;  4I6G A;  3G2U A;  2XPZ A;  4FHK A;  5FJY A;  4J8E A;  4DX1 A;  5HQ8 A;  4G2V A;  2ION A;  4JPS A;  1XGW A;  4N3A A;  5G05 J;  2DZO A;  4GTT A;  2H6G A;  4K5A B;  3I4G A;  3JXJ A;  1V54 E;  4I17 A;  4B94 A;  4UI9 K;  2X3M A;  3EIQ C;  4EEC A;  3WG7 E;  2WXP A;  3C3O A;  2R17 C;  4TUU A;  1IQU A;  1OWO A;  4HQD A;  4K0R A;  4KBQ A;  3OXL A;  4K5B A;  3J5P A;  1D9S A;  3R9M A;  2BUG A;  3QC1 A;  2LSU A;  3D9P A;  4CZ2 D;  1IYG A;  2ZIR A;  3CHS A;  3BEE A;  4GYY A;  1FPP A;  3FUI A;  2UY1 A;  4CCA A;  1SA4 A;  5ITZ F;  1H19 A;  5BT1 A;  4DPR A;  4Q94 A;  2PNN A;  1HS6 A;  4L2Y A;  2VGE A;  1MX2 A;  2Y4T A;  3CHM A;  4LSZ E;  4NQ0 A;  4RLY A;  5H7P A;  4B93 B;  2L6B A;  3ONL A;  3ZHE A;  1IQR A;  3I3N A;  3FU0 A;  3PNT B;  4QFV A;  4CT0 A;  1X81 A;  2CHW A;  4YVQ C;  5G05 C;  4CT4 A;  4XEI G;  3UM0 A;  2MOW A;  3D9J A;  3SFY A;  1JCR A;  4JC8 A;  5LOZ A;  5FZS A;  2WM9 A;  3MKQ B;  5AIJ A;  2AJA A;  2KCK A;  3TAX A;  4HOQ A;  4NAC A;  3Q15 A;  2RD0 A;  1OCC E;  3CKC A;  4EZJ A;  2QFC A;  4I1M A;  2EIL E;  5E75 A;  2YHC A;  2P9K G;  2MRI A;  2KZT A;  3UIP C;  2EIN E;  3CVU A;  3HXB A;  3KEA A;  3CHQ A;  3B7U X;  2OV8 A;  5AQ9 A;  3QDN A;  4AVX A;  3SFZ A;  3UX4 A;  2ETC A;  3TWX A;  3FUJ A;  4EZL A;  1QBQ A;  4UQZ A;  2E2E A;  1N94 A;  4A3V A;  4EHM A;  4I43 A;  4AOF A;  5BUZ A;  2EIM E;  3BUA A;  4BFR A;  3PS6 A;  1K1A A;  4JXT A;  2PM7 A;  3DSW A;  3FH8 A;  4GCO A;  1KT1 A;  2PM6 A;  3LVQ E;  5A7D B;  3L6A A;  5G2N A;  5BW8 C;  2L9B A;  3FTU A;  5HKP A;  5JHA A;  5JJ7 A;  3FTX A;  1WDY A;  5EN5 D;  3U9W A;  3OXG A;  2WXI A;  3S7F A;  4HFG A;  3MA5 A;  3NOG D;  2X38 A;  1ZBP A;  2IQC A;  2XS1 A;  4KMO A;  1ELR A;  4MS6 A;  4BY6 A;  1OWL A;  4L23 A;  3PE4 A;  3Q78 A;  1N0Q A;  3R7R A;  2OCC E;  4HB5 A;  3DXK G;  3PRZ A;  4XKC A;  3ASF A;  2IU1 A;  3TWQ A;  5T4Y A;  4DJA A;  2J07 A;  4E6H A;  3MKQ A;  4IUL A;  3B7R L;  2CG3 A;  4MRU A;  3TWR A;  5ENR D;  3AG4 E;  3B13 A;  3ISM C;  3MZL B;  3B7T A;  1IKN D;  4I2Z A;  4M7C A;  3LEW A;  1MJ0 A;  4K5C A;  3UT4 A;  4EBA A;  3Q4A B;  1TJF A;  2Y69 E;  1RW2 A;  3S2A A;  1INZ A;  2P9S G;  2QY7 A;  2XGO A;  1N0R A;  3GZ1 A;  1K8K G;  5HI7 A;  1E8X A;  1LD7 A;  3BG1 B;  4BX9 A;  2OEW A;  2LNI A;  4I6E A;  1S70 B;  1OWP A;  1DNP A;  4NUR A;  5AJL A;  4A1G A;  3DEP A;  2I1K A;  3IEG A;  2A5U A;  3W9G A;  5AQB A;  1O5M A;  3L17 A;  4NIK A;  3I4R B;  3CKB A;  5LP0 A;  1WG0 A;  5C2Y A;  3FTZ A;  3PUK A;  4I1O B;  3FU5 A;  3LY8 A;  1H6O A;  1EYH A;  2PQR A;  3ML9 A;  4I9E A;  3IKO B;  4YDW A;  1HG5 A;  3Q5M A;  4UWL A;  5KWD A;  3ESK A;  3F6Q A;  3ZXS A;  5CEA A;  1MZC A;  3IHY A;  4GYO A;  2ZGG A;  5CMY A;  1TNU A;  2OVF A;  2DWZ A;  1N4S A;  2C0M A;  2H6I A;  3ZN3 A;  2IO2 C;  3SFX A;  1MYO A;  1ZB1 A;  4E85 A;  4M3O A;  4PDX A;  4OVU A;  2A5E A;  1TR4 A;  1VDY A;  2R5S A;  3PZD A;  3UXG A;  2YHE A;  1BI8 B;  4GA1 A;  5AAO A;  5ENP D;  3SQV A;  2GRQ B;  4J8Y A;  3TG5 A;  3UI2 A;  5D66 A;  2KAT A;  3KAE A;  3PUJ A;  3CV0 A;  2LAI A;  2NC9 A;  2QYJ A;  2P58 C;  2VGY A;  4FUL A;  1NL4 A;  4Q96 A;  2M63 A;  3JYS A;  3NB2 A;  2DBA A;  2F0Y A;  4HI9 A;  5LCW J;  4A3T A;  3TXN A;  5ANL A;  1H2U A;  2FF4 A;  3UIO C;  3Q49 B;  3RIB A;  5KNG A;  4UWF A;  3LPZ A;  5JA4 D;  5G04 J;  4CRW A;  3QJZ A;  2F37 A;  1NP7 A;  4I2W A;  1HE8 A;  2VYI A;  3NOC D;  1DC2 A;  5FIO A;  2CG2 A;  4GTP A;  5CEC B;  4PUC A;  2YIN A;  3D9H A;  1MQS A;  1TJC A;  1TN8 A;  3HXC A;  2UWJ G;  5ARF A;  1EF1 C;  4YDO A;  4I9C A;  1JPL A;  2E0I A;  3FTW A;  5AQ7 A;  3TWS A;  4FC8 A;  2AXZ A;  2Q7F A;  3RRN B;  4CGW A;  1HG2 A;  2ZU6 B;  4N5C A;  4JVS A;  3GYZ A;  3CLJ A;  3Q75 A;  2HM8 A;  1LD8 A;  3EHR A;  3TJP A;  3UUX A;  3Q79 A;  4Y6W A;  3ZRH A;  2FUL A;  4GZ6 A;  4MKT A;  4C0E A;  1TYQ G;  2XEE A;  1FCH A;  2DCP A;  4GZD A;  4BTB A;  3PZ4 A;  4L9P A;  2CHX A;  3D9L A;  2WXM A;  3AG3 E;  2BTD A;  5CMW A;  3LKU A;  2QZA A;  2FEZ A;  1DVP A;  3PZ1 A;  1NZN A;  1SQM A;  4UWK A;  4UI9 J;  3D9O A;  3MV3 B;  1AP7 A;  4U63 A;  4X8Q A;  1K1B A;  1TEZ A;  4GZ3 A;  1UN8 A;  3HG0 D;  4K03 A;  4XZ4 A;  5ENO D;  4JA9 A;  3DSV A;  1OWN A;  5AN8 A;  5BXO A;  5CER B;  2DZN A;  1UOH A;  1KZP A;  2MHK A;  3ZYQ A;  2C0L A;  2ZXW E;  4O60 A;  4TXP A;  4G23 A;  3QNK A;  3DSS A;  4G25 A;  2GRM A;  4GTV A;  4U8V D;  2AXV A;  1P5Q A;  2WXJ A;  4OVV A;  3OXF A;  3QWP A;  5IY5 E;  2BED A;  4TXQ A;  2IFU A;  3UM2 A;  3S7B A;  2C2L A;  3MGB A;  4GPM A;  4ANU A;  2X6K A;  5FQ6 A;  4RVB A;  1DCE A;  3UM3 A;  4PS3 A;  2CFU A;  4KZC A;  3PVL A;  1YYH A;  2R05 A;  3AAA C;  5C1D A;  3FEX A;  3CVY A;  2X6I A;  1E8Y A;  3E34 A;  1H6K A;  3CVQ A;  3CQG B;  3FEY A;  3MCX A;  4ME2 A;  4EZK A;  4HLE A;  4ZFH A;  5BXU A;  1Z5S C;  4N3B A;  4U0Z A;  5HRY A;  2WB2 A;  4BER A;  4ACK A;  4HRL A;  2I1J A;  5EX3 A;  2IJG X;  3CHR A;  3FUK A;  4GB9 A;  1E96 B;  1HXI A;  5ENT D;  4N2S A;  3VLF A;  3UKU G;  3QOU A;  1WY6 A;  1N95 A;  1K3Z D;  3LY9 A;  3ZUV B;  4CDR A;  2VTB B;  4GTQ A;  4J8D A;  5B3S E;  4FLB A;  5JJT A;  3TXM A;  1LF8 A;  5CCM A;  5ENQ D;  4UWG A;  3T9K A;  2XS8 A;  2X6H A;  1S0P A;  1EPU A;  2PZI A;  3SZ7 A;  3ASO E;  1PC2 A;  4CYM D;  3DST A;  4DX6 D;  1OXJ A;  4U8H A;  4DX7 D;  1OY3 D;  2GRO B;  1FVF A;  1NA3 A;  4GZ5 A;  4HOR A;  3VTY A;  2XZT G;  1QYM A;  3QAQ A;  4AEZ C;  3IBE A;  2J4B A;  4IYP A;  4GML A;  1LTX A;  2WMN A;  3HRA A;  3LXU X;  2WXK A;  1SVX A;  2PQN A;  4ZHB A;  1WAO 1;  4AY6 A;  2LUH A;  3ABL E;  3NAW A;  3ULQ A;  1V55 E;  2VGX B;  2QYU A;  4BES A;  1IHB A;  5JHB A;  4C48 B;  5LFA A;  3FU3 A;  5A6C A;  1Z3X A;  3CR3 A;  4DLO A;  3FUE A;  3G2S A;  3FU6 A;  2Y3A A;  1TN6 A;  2LAH A;  4KYO B;  1NA0 A;  1ZU2 A;  1HZ4 A;  2WXR A;  3MV2 B;  4WNG A;  1UW4 B;  2J9Q A;  4OYS A;  5FTP A;  4U7E B;  3ZKJ A;  3PDN A;  3LCA A;  2LO6 A;  3ZNG A;  2AVP A;  4DX5 D;  4EQF A;  1N54 A;  1HO8 A;  3V30 A;  4YDY A;  2V0P A;  2IOL A;  3R7Q A;  4OAV B;  3UPV A;  3UKR G;  3NF1 A;  3HXE A;  2R59 A;  5DBK A;  2HE0 A;  3CVP A;  4DRX E;  4R7L A;  1IXV A;  2WXQ A;  2XRZ A;  1JCS A;  3CHP A;  1ELK A;  5BNW A;  4JD2 G;  5T3R A;  4NRH B;  4LCT A;  1SZ9 A;  3SI5 A;  2VTB A;  3APD A;  4UQX A;  3SBT B;  4UUC A;  3ZXP A;  3E4B A;  1B89 A;  3D9I A;  3UTM A;  5J08 A;  2J4D A;  3QB2 A;  3ABM E;  3SF4 A;  2OEV A; 
#chains in the Genus database with same CATH homology
 2ETC A;  5EYP F;  3TWR A;  3TWX A;  2RFM A;  4K5B A;  4OAU C;  3J5P A;  1D9S A;  5ENR D;  2A5E A;  4BET A;  1TR4 A;  5CBO A;  4A63 B;  4BES A;  2MYO A;  1IKN D;  4U95 D;  1IHB A;  3SO8 A;  3UXG A;  4J7W A;  5JMN D;  4C48 B;  4CZ2 D;  1BI8 B;  2XEE A;  4ZFH A;  4BEP A;  5AAO A;  5ENP D;  5BXU A;  3EU9 A;  1MJ0 A;  4K5C A;  4J8Y A;  4F6R D;  5FIN A;  3ZU7 B;  5CED B;  1DCQ A;  3B95 A;  3UI2 A;  5D66 A;  3EHQ A;  5EYL A;  1K1A A;  4JB8 P;  5HRY A;  1BI7 B;  4DUI A;  1MX6 A;  5ITZ F;  4BER A;  3V79 K;  1N0R A;  4HRL A;  2F8Y A;  2QYJ A;  5EIL A;  5AQA A;  2PNN A;  4U8Y D;  1AWC B;  4HI8 A;  1YMP A;  2ETA A;  2VGE A;  3V2O A;  4DX2 A;  1AP7 A;  3AJI A;  1MX2 A;  1MX4 A;  5HS0 A;  5EIB E;  1K1B A;  1OT8 A;  1S70 B;  4HRM B;  4LSZ E;  4RLY A;  4LNU D;  4LG6 A;  4Z68 A;  4HI9 A;  2NYJ A;  4ZHB A;  3HG0 D;  5ENT D;  4B93 B;  1N11 A;  2L6B A;  2XZD G;  3DEP A;  3ZKJ A;  5ENO D;  5HKP A;  3V31 A;  2V4H C;  3W9G A;  2ZGD A;  5AAR A;  4TUM A;  3TWV A;  3ZNG A;  2V5Q C;  3Q9N C;  1WDY A;  5EN5 D;  4G8L A;  5KNG A;  5AN8 A;  4DX5 D;  2Y0B G;  5AQB A;  4QFV A;  5BXO A;  4HNA D;  5JA4 D;  2B0O E;  5CER B;  1K3Z D;  4NIK A;  3V30 A;  3ZUV B;  2F37 A;  4G8K A;  4HLL A;  4YDY A;  3NOC D;  1WG0 A;  2DZN A;  5FIO A;  4OAV B;  1UOH A;  1DC2 A;  2F8X K;  4HBD A;  4F1P A;  4O1P A;  5ENQ D;  3NOG D;  2XEH A;  2QC9 A;  4HRN A;  3T9K A;  4O60 A;  3NBN B;  5ENS D;  5CBN A;  4N5Q A;  1BU9 A;  1BD8 A;  5CEC B;  2FO1 E;  5EID A;  2P2C P;  4YDW A;  3D9H A;  3V2X A;  1SW6 A;  4U8V D;  4U96 D;  4CYM D;  5KBA A;  2AJA A;  2RFA A;  1NFI E;  4O1O A;  2BKG A;  2JAB A;  2XEN A;  4DX1 A;  3LJN A;  5KWD A;  4DX6 D;  3F6Q A;  1N0Q A;  1YCS B;  3J5Q B;  5KNH D;  2HE0 A;  2DVW A;  4BSZ B;  5CEA A;  3T8K A;  4DX7 D;  4DRX E;  1IXV A;  3JXI A;  4HB5 A;  1OY3 D;  3DEO A;  3C5R A;  5AQ7 A;  3TWS A;  2XZT G;  1QYM A;  2ZGG A;  3JUE A;  3TWT A;  4GPM A;  4GMR A;  3TWU A;  2DZO A;  3TWQ A;  3IXE A;  2DWZ A;  4K5A B;  3KEA A;  3JXJ A;  3W9F A;  2KXP C;  3HRA A;  2Y1L E;  4UUC A;  4ATZ D;  1YYH A;  3TWW A;  2J8S D;  2KBX A;  5AQ9 A;  1SVX A;  1G3N B;  1A5E A;  2ETB A;  3UTM A;  3EHR A;  2BKK B;  1MYO A;  1BLX B;  3AAA C;  3B7B A;  4QQI A;  3Q9U C;  4HQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...