4JB8P

Caspase-7 in complex with darpin c7_16
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
DLGKKLLDAASAGQDDEVRILMANGADVNASNQQGWTPLHATAEYGHLEIVDVLLAYGADVNASDSYGSTPLHSAAWAGHLEIVDVLLAHGADVNASDNYGWTPLHLAAHTGHLEIVDVLLANGADVNANNWWGKTPFDLAIDNGNEDIAEVLQKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords Caspase-7 subunit p20
publication title Design, construction, and characterization of a second-generation DARPin library with reduced hydrophobicity.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2013-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4jb8P00
3TWQA 1WG0A 3UI2A 1YYHA 4QFVA 1IKND 5D66A 1NFIE 4HB5A 5ENOD 5AN8A 5AQ9A 3AAAC 3Q9UC 2XZDG 1MX2A 3J5QB 5HKPA 1BD8A 3B95A 3TWTA 1QYMA 2ETAA 2XEEA 4GPMA 4BEPA 4HI8A 2L6BA 4JB8P 3NOGD 5HRYA 1N11A 5CBOA 2DWZA 2KXPC 3JXIA 2QC9A 5ITZF 4NIKA 2RFMA 1D9SA 2F37A 4UUCA 3T8KA 2A5EA 5ENQD 1K3ZD 4A63B 4BERA 4J8YA 3UTMA 4C48B 5ENTD 3KEAA 2XZTG 4DUIA 4J7WA 5CEDB 1IHBA 1MYOA 1N0QA 2DVWA 3SO8A 1BI8B 5KBAA 1N0RA 1BLXB 4DRXE 5BXUA 4HI9A 4YDYA 3J5PA 5AQ7A 4ZFHA 1AWCB 4TUMA 4YDWA 5CEAA 4ATZD 4G8KA 1K1BA 4K5BA 1K1AA 2Y0BG 5FIOA 3Q9NC 5KNGA 4QQIA 5HS0A 3V2XA 3W9GA 2BKGA 5AARA 3AJIA 4LNUD 4ZHBA 4BETA 3D9HA 3V79K 5JMND 4DX1A 3NBNB 5KWDA 2B0OE 4DX7D 5BXOA 1UOHA 5ENRD 4U8VD 2AJAA 2P2CP 4LG6A 2RFAA 3TWWA 3V2OA 3V31A 4HLLA 2QYJA 3T9KA 5CECB 4GMRA 3ZUVB 4F1PA 2ZGDA 3ZU7B 3TWRA 5EILA 5ENPD 2DZNA 4F6RD 4BESA 3UXGA 1OT8A 2DZOA 5CBNA 1YCSB 1OY3D 2NYJA 4HBDA 4U95D 1AP7A 3HG0D 2ZGGA 4HRMB 1WDYA 3DEOA 4HRLA 3DEPA 1IXVA 3JUEA 4LSZE 3EHQA 5EYLA 4HRNA 1SVXA 4DX2A 4Z68A 3LJNA 5EYPF 1A5EA 2ETBA 3IXEA 3V30A 4U96D 4O1PA 2V4HC 2Y1LE 1SW6A 1BI7B 2PNNA 3HRAA 3ZNGA 1TR4A 2XEHA 2HE0A 4G8LA 4O1OA 5EIBE 4HQDA 4CYMD 5AQAA 4OAVB 3B7BA 1MX6A 1G3NB 5JA4D 2XENA 4DX5D 3TWUA 1DCQA 3TWVA 4K5CA 3EHRA 1YMPA 4OAUC 3TWSA 3F6QA 4O60A 2V5QC 5EN5D 1S70B 3JXJA 5EIDA 5ENSD 1DC2A 5AQBA 3NOCD 4DX6D 4RLYA 3TWXA 2BKKB 2KBXA 1MJ0A 2JABA 4U8YD 4CZ2D 5CERB 4BSZB 4HNAD 3EU9A 4K5AB 5AAOA 2F8XK 4B93B 2ETCA 2F8YA 2FO1E 1BU9A 3ZKJA 5KNHD 1MX4A 5FINA 4N5QA 3W9FA 2J8SD 2MYOA 2VGEA 3C5RA
chains in the Genus database with same CATH superfamily
2AXZA 4GA0A 4TXRA 4TUUA 4YNDA 5AN8A 4F7AA 3AAAC 5HKPA 2DYSE 3ESKA 5G55A 5JJ6A 4BEPA 1UG3A 2XS1A 3ASNE 2EINE 4GMLA 5CBOA 2DWZA 3JXIA 4JD2G 3QARA 5BW8C 4GB9A 1D9SA 4Y6WA 4GZ5A 3L17A 4GTRA 4LUNU 2XZTG 1HU3A 4O6FA 4AXHA 4GCNA 5T3RA 2DVWA 3DPYA 3TXNA 1XNFA 3ABLE 3ASOE 2H6FA 4B8AA 4ATZD 2YNQA 5KNGA 4YDOA 3R9MA 4X8QA 4PS7A 3LY7A 5E75A 2P9SG 5KWDA 4A3VA 1U3DA 4I2WA 4ANWA 1X5BA 4HLLA 4J0UA 4C0EA 3SF4A 3QAQA 5H7PA 5EX3A 2GGFA 3QDNA 2VGYA 3ZIMA 2X6KA 1H2TC 2LAHA 4XI9A 2WXJA 3CVXA 4PDXA 4UWHA 4EECA 3L9TA 5ENSD 1HE8A 2GRRB 2GRLA 4WNEA 2KBXA 4XE0A 3E37A 2X6IA 3FTYA 2ETCA 1N95A 4ANVA 1BU9A 4OYSA 1HZ4A 4A1GA 2XEVA 3E33A 1TYQG 4HB5A 5AYWD 3Q9UC 2UY1A 3G2TA 3LPZA 3EDTB 3ASDA 4XKBA 3UIPC 3Q7AA 4F53A 3FTWA 4GTPA 3URZA 3UUXA 4ACLA 2WB2A 2L6JA 4I6EA 4OVVA 2DIWA 3ZYQA 4JC8A 2LXLA 3KEAA 3NZUA 4CDMA 4DUIA 2OOEA 2WMNA 3QNKA 3O4ZA 2MHKA 1UJJA 1UJKA 2LAIA 4C0MA 5CEAA 4G8KA 3FH8A 5LP0A 4KZCA 3W9GA 3SBSA 1DVPA 3U4TA 3D9HA 3HVEA 1E7VA 3C98A 3V2OA 1Z6TA 5HQ8A 2XRZA 3RKVA 2L0TB 5CBNA 4HBDA 3SI5A 1Z3YA 3DEOA 4TV3A 4FJZA 2PNNA 4B8CB 1TR4A 3B7TA 1QQEA 1D8EA 2X3MA 3PEVB 4UI9J 3TWUA 2EIJE 1E8YA 1SA5A 4UQYA 3DSSA 5LFAA 4KMOA 2BUGA 2HO1A 1S70B 4CRWA 4APOA 5KJNA 3IV0A 5CERB 4K5AB 4UI9K 3UT8A 2XPIA 3I4GA 3FU5A 2FI7A 3ENEA 4U8HA 5FT9A 1FPPA 1N52A 4W9RA 5G05J 1RZ4A 3TGOA 2C0MA 3J5QB 2C0LA 4G23A 3CLJA 1OCCE 2VQ2A 2XCCA 1HF8A 3FH7A 1MQSA 3FFLA 3MA5A 3JUIA 2VSYA 4U0ZA 4YVQC 4TXPA 1K1AA 2I6HA 4IYPA 2AXUA 3NBNB 2XCBA 1WY6A 3D3MA 3NZSA 1K8KG 3HVEB 1PC2A 1EF1C 3UIOC 3HYMB 1JCQA 1QBQA 3JUEA 4JZYA 4WWOA 3X2QE 5LOZA 3QOUA 3B13A 2QY7A 4U07A 4U0SA 3ZN3A 3D9LA 1N94A 3EHMA 3QK0A 4LCTA 2OCCE 3PE3A 2EIKE 3QB2A 3HIZA 4GTQA 3F6QA 4GA2A 5EIDA 4RG6A 1MJ0A 2IY0C 3BQOA 4GA1A 1D8DA 4JXTA 2J8SD 1TN7A 4G11A 5B3SE 1NFIE 3TWTA 4Q96A 4I2ZA 1QNFA 2BF0X 3PREA 2X6JA 1IYGA 3UT4A 4F3VA 2H6GA 4JEUA 3CHPA 2J4BA 3S7FA 3ZEFA 1SA4A 3MKQB 1H19A 3S2AA 2Y0BG 3O48A 4G1TA 3CVYA 3Q75A 4GTMA 1TNZA 2RFAA 3E4BA 4LG6A 4RSYA 4GTSA 3UT7A 2V8SE 5ARGA 2VJ8A 2GW1A 2P9IG 1O1TA 3UPVA 3SFXA 4UWKA 3FEXA 1SW6A 4GTOA 3LVQE 4JHKA 3B7BA 2XENA 1E8ZA 4B89A 4ANXA 3CVNA 4XI0A 3TWSA 1TJCA 3UKRG 3D9JA 4Q94A 1N4PA 5LCWJ 4BY6A 2F8XK 3AG4E 3T5XA 2NC9A 2DYRE 3S7DA 1W3BA 4H7XA 3SZ7A 2Q7FA 1Q2ZA 2XZDG 3B95A 3RU0A 3KAEA 4YVOA 3I4RB 5ITZF 4UI9C 4I6GA 2H6HA 4A63B 4PS3A 3LYAA 2IONA 5CEDB 1MYOA 3ZRHA 3RO3A 3HHMA 3Q78A 1HXIA 4LRZA 3RRMB 4YDYA 1HFAA 4DPRA 5AQ7A 1FT1A 2KZTA 1MZCA 3FUIA 5G05C 3R9AB 3V2XA 2HYZA 3CVPA 1RW2A 4U8VD 2AJAA 2WXLA 3TWWA 4WNFA 2J49A 4F1PA 3EIJA 5ENPD 4BESA 1WM5A 2DZOA 4LSZE 5FZQA 4ZFHA 2VTBA 4HOQA 1NZNA 2DCPA 1ELWA 3FWVA 4HQDA 1DCQA 5FJYA 2Y3AA 5AQBA 4L2LA 4J8EA 3L16A 2P9PG 2RKKA 3IHVA 2I1KA 4MKTA 3ZVVA 3KS2A 4URKA 2IO2C 3DSTA 5BPPA 5IY5E 1BD8A 4HOTA 4JB8P 5ANRA 2YHEA 5AJDA 1E8WA 1OXJA 4UUCA 3VLEA 3CV0A 1JWFA 3DRAA 1H2UA 5CMYA 5FZSA 2BEDA 4AEZC 2IFUA 3B7RL 5CRVA 2YINA 1ZBPA 2P58C 4AY5A 3PZ3A 1S0PA 3AG1E 5C2YA 4APFA 1Z5SC 3IEGA 2X6FA 1NL4A 3AS8A 3QC1A 3SQVA 1OWLA 1N4SA 4HVBA 3PZ1A 3ZYMA 4GZ6A 3ZYKA 3UXGA 3DSWA 4WWNA 4FHKA 4HRNA 3JQ0A 4AM9A 3ULYA 2WXHA 4HS2A 5FWQA 1NA3A 1TNBA 1MX6A 1FVFA 2R05A 3VTYA 2EQXA 5ENNA 3TWVA 2WXNA 2WXRA 3HXCA 2R03A 4V3IA 1YA0A 4RLYA 3TWXA 3CKCA 5KJLA 3FH5A 2F8YA 3CIAA 3ZKJA 3UM0A 3UM3A 2NSZA 4IRUA 3OXGA 3AS4A 2LO6A 5KJKA 3FUEA 1H6PA 2J09A 3Q49B 3ZYLA 5A6CA 2I2OA 4NACA 1TEZA 2JEKA 5EX0A 5LCWC 2DBAA 3UINC 3ABME 1XGWA 3DSXA 4HI9A 5FIOA 4TXQA 4HFGA 3MJWA 3DBSA 2R02A 4U04A 3ZXPA 2B0OE 4KVMA 2CFUA 3ONLA 5CCMA 5M72A 3SBTB 4F6RD 3MGBA 3FU3A 4K0RA 5FQ6A 1KT1A 2CHZA 4IN3B 2ZGGA 3DEPA 4FULA 4Z68A 4BT9A 3LY8A 2Y1LE 1BI7B 4FADA 1E8XA 2OEVA 5AQAA 1G3NB 3KSQA 4FLBA 2IF4A 2XQ0A 2ZXWE 3FTXA 5BT1A 2V4LA 2BKKB 5FINA 4N5QA 3C5RA 1IKND 3OXFA 3D9NA 5BNWA 4PH4B 3CSTA 1PY1A 3WG7E 1SZAA 5C1DA 5JJTA 1TN6A 3ZGQA 2IJGX 4ILHB 2X6HA 4ABNA 4KZ0A 3EJNA 3KD7A 2IOSA 3ZHEA 4J8YA 4EPZA 2A5UA 3PNTB 4A3TA 2RD0A 3AS5A 2R5SA 5KBAA 4Q69A 3FUNA 1JWGA 3ZPJA 5CRUA 1P5QA 1K1BA 2UY1B 3CKBA 4QQIA 3FUHA 3CVWA 4CT4A 2LNIA 1O1SA 3FHEA 2XGOA 4IULA 2GRMA 3I5PA 5J08A 4EBAG 3SFZA 3V30A 1L5JA 4U96D 5A23A 4BFRA 4O1PA 3ZW3A 1KZPA 2LSVA 2HE0A 2VYIA 2LSUA 2KATA 2P9UG 4KVOA 3HDXA 1H6KA 5HI7A 2L0IA 3LKUA 2ZIRA 3ASFA 1H0AA 2FULA 3TJPA 3ASHA 2GRNB 3EU5A 4FJYA 3IBEA 1X81A 4NRHB 3Q47B 3GZ1A 3L82A 3LEWA 5D66A 3FUFA 2R2LA 3L22A 3PUKA 2ETAA 4AP2A 3BG1B 4L23A 2KXPC 3GYZA 1OCOE 3CHRA 3SGHA 2A5EA 3R7RA 1K3ZD 4J6IA 4MS6A 1Y6IA 4WNDA 3SO8A 1DNPA 1INZA 2WXKA 3MEKA 1BLXB 2PL2A 3J5PA 2R59A 5JHBA 2WXGA 3LXUX 2WXOA 5AARA 3JQ1A 3Q5MA 4XZ4A 2FEZA 3FU0A 2WQ6A 2WM9A 4GMRA 3ZUVB 3D9OA 1FT2A 3PZDA 5EILA 2PZIA 4N3CA 5FQ8A 1S63A 1TN8A 1IQRA 3EHQA 3AU5A 5EYLA 2LXMA 4GCOA 2XEHA 4O1OA 4LEUA 3BU8A 3SY2A 2CFZA 3MV3B 5CCLA 4HORA 4DX5D 2NXPA 3OXLA 2L9BA 3C3QA 4WAFA 2PQNA 2XRYA 1OUVA 4DK5A 3AU4A 1DC2A 2OV8A 3I3NA 1WAO1 3FULA 4BTBA 3UM1A 2R17C 3PNLB 2FO1E 3RJVA 2IOLA 2MYOA 4CT0A 2QFCA 4RVBA 4QFVA 3QJZA 2CG2A 4UWFA 2J4DA 1JCSA 3FDHA 4DJAA 4BSXA 3NB2A 2XEEA 2XGSA 3NAWA 4FP7A 3GZSA 3IKOB 4GYWA 1KPSB 3SFYA 4NIKA 1NA0A 1OWMA 4PS8A 3T8KA 3B7SA 3FUDA 4AJWA 4J7WA 2EILE 4CDRA 5FQ4A 2QYUA 2ZU6B 4DRXE 5BXUA 1NP7A 3U64A 2LUHA 1EYHA 4FA6A 2F0YA 4CGWA 4AVXA 4GTVA 5CMWA 5BUZA 4BX9A 3Q73A 1N4QA 3LCAA 5ENRD 1UW4B 2P2CP 1B89A 4WWPA 4ME2A 4MLPA 3Q7FA 2QYJA 1O1RA 3Q4AB 4ACKA 3EHNA 3FTUA 4ANUA 5KJMA 2DZNA 4L2YA 4I1AA 1LD8A 3APFA 4HRLA 2CG3A 5EYPF 3OAWA 2ETBA 3D9MA 3IXEA 3L08A 1HG2A 4E85A 1HO8A 3G2SA 5JJ7A 3RSEG 1OWOA 4OAVB 3ASGA 1E7UA 1UN8A 3VTXA 3FUMA 5D0OD 4K5CA 4BX8A 1KZOA 2PQRA 4O60A 2V5QC 3AG2E 4JPSA 5T8IA 2VSOE 4CCAA 4HNAD 3SD5A 2XPZA 5AAOA 4G25A 2J07A 5E76A 1WG0A 3CK7A 4WNGA 1H6OA 2WXQA 3FUJA 4I1MA 2FO7A 1FCHA 1QYMA 3OTNA 1UN9A 5FQ7A 2A4ZA 4XIFA 1V54E 3E32A 3CHSA 2I1JA 2WVIA 4KYOB 2BTDA 2HR2A 4BERA 2MOWA 3FTZA 5CHEE 2YQ8A 1BI8B 5AIJA 3B7UX 3QKYA 1OCRE 2IQCA 4ZHBA 2Y4TA 3HXDA 3P2BA 4BETA 5JMND 2AWIA 4NURA 3TXMA 2KCLA 4J8FA 1HS6A 3V31A 3ZXSA 2IEJA 1TNYA 3CQCB 3L6AA 4UQZA 4BWRA 4N3AA 4MRUA 2HM8A 1IXVA 3LJNA 3MZLB 4N5CA 3G2WA 2KZTB 4I43A 4L9PA 1Z3XA 4DLQA 4KXKB 2KM4A 3CVQA 3EHRA 1YMPA 4OAUC 1BPOA 4CGVA 5EN5D 4GMJA 1JUQA 1H2VC 4U8YD 4CZ2D 2WQ7A 3JCKC 5KNHD 1MX4A 3VLDA 2VTBB 4GYOA 3DSVA 4RG9A 3TG5A 4MBGA 4JW1A 5AQ9A 4RQIA 2L6BA 1N11A 2QC9A 3ZFWA 1O5MA 3FU6A 2RFMA 4A55A 4DLOA 2CHWA 4JHRA 2Y69E 5AJLA 4XX5A 4C9BB 2I9CA 3RAUA 1AWCB 1JCRA 4I17A 2WXIA 3CHMA 1KT0A 3Q9NC 1TNOA 3MKRA 4LNUD 4DX1A 1LD7A 1TJFA 3HXEA 3FEYA 5BXOA 1UOHA 3DSUA 3FP3A 3GZ2A 5CECB 3T8MA 3ZU7B 3SNXA 3G2VA 4J8DA 5EKQD 3RIBA 3BUAA 2V5FA 4AY6A 5J90A 2V0PA 3UKUG 2XS8A 5B1AE 3UM2A 2XPYA 3HRAA 5A7DB 1FVHA 3ISMC 4CDNA 4B0ZA 1EDUA 4JVSA 4DI3A 4EHMA 1ZB1A 2FF4A 3LDZA 3JXJA 2B6CA 2WXMA 4GU5A 4BSZB 3ESLA 3PDNA 5KCMA 4LNGA 3PH0C 1HX8A 3TWQA 4ATGA 3UI2A 1YYHA 4FHJA 4JEHA 2GROB 4FC8A 5ENOD 5LX8A 3TL5A 2OVFA 1MX2A 4GZ3A 5HRYA 4I6JA 1MHQA 4XKCA 2XGMA 1E96B 2KC7A 2F37A 2WPVA 5ENQD 3E30A 3APCA 4K03A 4L1BA 1N0RA 3MV2B 2P9NG 4R7LA 3ML8A 4FU3A 1KLXA 3CK8A 2AXVA 3U66A 1DCEA 3T9KA 2ZGDA 4JA9A 1U3CA 1OY3D 3R7QA 2WXPA 4HRMB 1SQMA 1WDYA 3K9IA 3ULQA 5ANLA 3MX3A 1N54A 4G8LA 2FBNA 3UQ3A 4CYMD 3ONKA 5JA4D 4HXIA 2OEWA 2OVBA 2YHCA 1IQUA 3KSLA 3MYVA 5FZRA 3RO2A 5ARFA 3EUVA 4U0UA 5D0QD 2J08A 3CHOA 4UWGA 3MKQA 4AIFA 3CEQA 4LNBA 2WMOA 4I9CA 2P9LG 3FTSA 3CVLA 3NOGD 3QWPA 5D2MC 5FTPA 4G24A 3D9KA 2WXFA 3PE4A 1NI1A 2UWJG 2WQHA 2QZAA 3CSFA 4C48B 2KCKA 1N4RA 3ML9A 2Y4UA 3C72A 1IHBA 1N0QA 3QWVA 3Q15A 4EBAA 3FUKA 4P29A 5G04J 2JLBA 4TUMA 2VGXA 4U7EB 3CQGB 4K5BA 4GYYA 3QWWA 5HS0A 2BKGA 3FY4A 3U3WA 3VLFA 4EZKA 1U2VG 1ELKA 3PVLA 4B94A 2CHXA 2J9QA 1OWPA 2E2EA 3ZHEB 3LVRE 4N3BA 1HG5A 1OT8A 1YCSB 2NYJA 4U95D 3HG0D 4DX2A 1GW6A 2AVPA 3TG4A 4EQFA 3JYSA 1QZ2A 4I9EA 3DPDA 4UWLA 4NQ0A 2E0IA 4FLHA 3CR3A 4ILIA 2XHEA 3UMVA 4M7CA 4TRQA 3T5VA 3NOCD 2AW6A 5G2NA 2JABA 4OVUA 3EU9A 4N39A 3W9FA 3MCXA 4HLEA 3LJ3A 5B1BE 2C2LA 3BG0B 3CVVA 1EPUA 3PZ2A 1V55E 4LERA 5DIZA 4GPMA 4HI8A 1OWNA 4F1SA 3EIQC 5BV0A 3CGHA 5T4YA 3CHQA 3PUJA 4YDEA 3Q79A 3UTMA 2ONDA 4JA7A 5JHAA 3C3OA 4G2VA 4N2QA 1S64A 3AG3E 4BTAA 3L54A 1N9AA 3PS6A 5AENA 1LTXA 2VSXE 2VGXB 3AJIA 4HOUA 3V79K 3DXMG 3PEUB 4DX7D 2VSNA 1PAQA 2RG8A 4JHJA 4XEIG 4EZJA 3NF1A 1OCZE 3DXKG 5DBKA 2MRIA 1TNUA 1ZU2A 3RK6A 4AOFA 3HXBA 4G26A 2V4HC 3L13A 4GZCA 1IHGA 3C3RA 4N2SA 3NQPA 4EZLA 3ULEG 3HXFA 2ILRA 4U63A 3S7JA 4I1OB 2H6IA 3U9WA 2EIME 3WXXA 3G2UA 4DX6D 2P9KG 3TAXA 2KCVA 2GRQB 4Y6CA 4B93B 2GRPB 4JL0A 3IHYA 3LS8A 4ILGA 3FTVA 3CVUA 1HH8A 3S7BA 1JPLA 4UQXA 4J8SA 4GPKA 3D9PA 3BEEA 3DWLG 1SZ9A 4AV7A 2X38A 4WUYA 3RRNB 3ABKE 1A17A 5ENTD 4PUCA 2PM6A 4CEMA 4GAAA 4KT6B 1E90A 2IO3C 1LF8A 4YDWA 2M63A 5BV1A 4KBQA 3D9IA 4GTTA 3UX4A 3LY9A 3SHFA 3PRZA 4HOSA 3TWRA 1ELRA 3P1UA 3E34A 4L7TA 1AP7A 4A1SA 2ZISA 4H7YA 1SVXA 2PM7A 4E6HA 1Y8MA 3APDA 1A5EA 5EDSA 3KEZA 5G04C 3ZNGA 5EIBE 3CK9A 3RRUA 4BT8A 4GZDA 3PZ4A 3GW4A 1VDYA 4M3OA 2IU1A 4D10C 4DI4A 3N71A 2VGEA
chains in the Genus database with same CATH topology
3TWQA 1WG0A 3UI2A 1YYHA 4QFVA 1IKND 5D66A 1NFIE 4HB5A 5ENOD 5AN8A 5AQ9A 3AAAC 3Q9UC 2XZDG 1MX2A 3J5QB 5HKPA 1BD8A 3B95A 3TWTA 1QYMA 2ETAA 2XEEA 4GPMA 4BEPA 4HI8A 2L6BA 4JB8P 3NOGD 5HRYA 1N11A 5CBOA 2DWZA 2KXPC 3JXIA 2QC9A 5ITZF 4NIKA 2RFMA 1D9SA 2F37A 4UUCA 3T8KA 2A5EA 5ENQD 1K3ZD 4A63B 4BERA 4J8YA 3UTMA 4C48B 5ENTD 3KEAA 2XZTG 4DUIA 4J7WA 5CEDB 1IHBA 1MYOA 1N0QA 2DVWA 3SO8A 1BI8B 5KBAA 1N0RA 1BLXB 4DRXE 5BXUA 4HI9A 4YDYA 3J5PA 5AQ7A 4ZFHA 1AWCB 4TUMA 4YDWA 5CEAA 4ATZD 4G8KA 1K1BA 4K5BA 1K1AA 2Y0BG 5FIOA 3Q9NC 5KNGA 4QQIA 5HS0A 3V2XA 3W9GA 2BKGA 5AARA 3AJIA 4LNUD 4ZHBA 4BETA 3D9HA 3V79K 5JMND 4DX1A 3NBNB 5KWDA 2B0OE 4DX7D 5BXOA 1UOHA 5ENRD 4U8VD 2AJAA 2P2CP 4LG6A 2RFAA 3TWWA 3V2OA 3V31A 4HLLA 2QYJA 3T9KA 5CECB 4GMRA 3ZUVB 4F1PA 2ZGDA 3ZU7B 3TWRA 5EILA 5ENPD 2DZNA 4F6RD 4BESA 3UXGA 1OT8A 2DZOA 5CBNA 1YCSB 1OY3D 2NYJA 4HBDA 4U95D 1AP7A 3HG0D 2ZGGA 4HRMB 1WDYA 3DEOA 4HRLA 3DEPA 1IXVA 3JUEA 4LSZE 3EHQA 5EYLA 4HRNA 1SVXA 4DX2A 4Z68A 3LJNA 5EYPF 1A5EA 2ETBA 3IXEA 3V30A 4U96D 4O1PA 2V4HC 2Y1LE 1SW6A 1BI7B 2PNNA 3HRAA 3ZNGA 1TR4A 2XEHA 2HE0A 4G8LA 4O1OA 5EIBE 4HQDA 4CYMD 5AQAA 4OAVB 3B7BA 1MX6A 1G3NB 5JA4D 2XENA 4DX5D 3TWUA 1DCQA 3TWVA 4K5CA 3EHRA 1YMPA 4OAUC 3TWSA 3F6QA 4O60A 2V5QC 5EN5D 1S70B 3JXJA 5EIDA 5ENSD 1DC2A 5AQBA 3NOCD 4DX6D 4RLYA 3TWXA 2BKKB 2KBXA 1MJ0A 2JABA 4U8YD 4CZ2D 5CERB 4BSZB 4HNAD 3EU9A 4K5AB 5AAOA 2F8XK 4B93B 2ETCA 2F8YA 2FO1E 1BU9A 3ZKJA 5KNHD 1MX4A 5FINA 4N5QA 3W9FA 2J8SD 2MYOA 2VGEA 3C5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TWQ A;  1WG0 A;  3UI2 A;  1YYH A;  4QFV A;  1IKN D;  5D66 A;  1NFI E;  4HB5 A;  5ENO D;  5AN8 A;  5AQ9 A;  3AAA C;  3Q9U C;  2XZD G;  1MX2 A;  3J5Q B;  5HKP A;  1BD8 A;  3B95 A;  3TWT A;  1QYM A;  2ETA A;  2XEE A;  4GPM A;  4BEP A;  4HI8 A;  2L6B A;  4JB8 P;  3NOG D;  5HRY A;  1N11 A;  5CBO A;  2DWZ A;  2KXP C;  3JXI A;  2QC9 A;  5ITZ F;  4NIK A;  2RFM A;  1D9S A;  2F37 A;  4UUC A;  3T8K A;  2A5E A;  5ENQ D;  1K3Z D;  4A63 B;  4BER A;  4J8Y A;  3UTM A;  4C48 B;  5ENT D;  3KEA A;  2XZT G;  4DUI A;  4J7W A;  5CED B;  1IHB A;  1MYO A;  1N0Q A;  2DVW A;  3SO8 A;  1BI8 B;  5KBA A;  1N0R A;  1BLX B;  4DRX E;  5BXU A;  4HI9 A;  4YDY A;  3J5P A;  5AQ7 A;  4ZFH A;  1AWC B;  4TUM A;  4YDW A;  5CEA A;  4ATZ D;  4G8K A;  1K1B A;  4K5B A;  1K1A A;  2Y0B G;  5FIO A;  3Q9N C;  5KNG A;  4QQI A;  5HS0 A;  3V2X A;  3W9G A;  2BKG A;  5AAR A;  3AJI A;  4LNU D;  4ZHB A;  4BET A;  3D9H A;  3V79 K;  5JMN D;  4DX1 A;  3NBN B;  5KWD A;  2B0O E;  4DX7 D;  5BXO A;  1UOH A;  5ENR D;  4U8V D;  2AJA A;  2P2C P;  4LG6 A;  2RFA A;  3TWW A;  3V2O A;  3V31 A;  4HLL A;  2QYJ A;  3T9K A;  5CEC B;  4GMR A;  3ZUV B;  4F1P A;  2ZGD A;  3ZU7 B;  3TWR A;  5EIL A;  5ENP D;  2DZN A;  4F6R D;  4BES A;  3UXG A;  1OT8 A;  2DZO A;  5CBN A;  1YCS B;  1OY3 D;  2NYJ A;  4HBD A;  4U95 D;  1AP7 A;  3HG0 D;  2ZGG A;  4HRM B;  1WDY A;  3DEO A;  4HRL A;  3DEP A;  1IXV A;  3JUE A;  4LSZ E;  3EHQ A;  5EYL A;  4HRN A;  1SVX A;  4DX2 A;  4Z68 A;  3LJN A;  5EYP F;  1A5E A;  2ETB A;  3IXE A;  3V30 A;  4U96 D;  4O1P A;  2V4H C;  2Y1L E;  1SW6 A;  1BI7 B;  2PNN A;  3HRA A;  3ZNG A;  1TR4 A;  2XEH A;  2HE0 A;  4G8L A;  4O1O A;  5EIB E;  4HQD A;  4CYM D;  5AQA A;  4OAV B;  3B7B A;  1MX6 A;  1G3N B;  5JA4 D;  2XEN A;  4DX5 D;  3TWU A;  1DCQ A;  3TWV A;  4K5C A;  3EHR A;  1YMP A;  4OAU C;  3TWS A;  3F6Q A;  4O60 A;  2V5Q C;  5EN5 D;  1S70 B;  3JXJ A;  5EID A;  5ENS D;  1DC2 A;  5AQB A;  3NOC D;  4DX6 D;  4RLY A;  3TWX A;  2BKK B;  2KBX A;  1MJ0 A;  2JAB A;  4U8Y D;  4CZ2 D;  5CER B;  4BSZ B;  4HNA D;  3EU9 A;  4K5A B;  5AAO A;  2F8X K;  4B93 B;  2ETC A;  2F8Y A;  2FO1 E;  1BU9 A;  3ZKJ A;  5KNH D;  1MX4 A;  5FIN A;  4N5Q A;  3W9F A;  2J8S D;  2MYO A;  2VGE A;  3C5R A; 
#chains in the Genus database with same CATH topology
 2AXZ A;  4GA0 A;  4TXR A;  4TUU A;  4YND A;  5AN8 A;  4F7A A;  3AAA C;  5HKP A;  2DYS E;  3ESK A;  5G55 A;  5JJ6 A;  4BEP A;  1UG3 A;  2XS1 A;  3ASN E;  2EIN E;  4GML A;  5CBO A;  2DWZ A;  3JXI A;  4JD2 G;  3QAR A;  5BW8 C;  4GB9 A;  1D9S A;  4Y6W A;  4GZ5 A;  3L17 A;  4GTR A;  4LUN U;  2XZT G;  1HU3 A;  4O6F A;  4AXH A;  4GCN A;  5T3R A;  2DVW A;  3DPY A;  3TXN A;  1XNF A;  3ABL E;  3ASO E;  2H6F A;  4B8A A;  4ATZ D;  2YNQ A;  5KNG A;  4YDO A;  3R9M A;  4X8Q A;  4PS7 A;  3LY7 A;  5E75 A;  2P9S G;  5KWD A;  4A3V A;  1U3D A;  4I2W A;  4ANW A;  1X5B A;  4HLL A;  4J0U A;  4C0E A;  3SF4 A;  3QAQ A;  5H7P A;  5EX3 A;  2GGF A;  3QDN A;  2VGY A;  3ZIM A;  2X6K A;  1H2T C;  2LAH A;  4XI9 A;  2WXJ A;  3CVX A;  4PDX A;  4UWH A;  4EEC A;  3L9T A;  5ENS D;  1HE8 A;  2GRR B;  2GRL A;  4WNE A;  2KBX A;  4XE0 A;  3E37 A;  2X6I A;  3FTY A;  2ETC A;  1N95 A;  4ANV A;  1BU9 A;  4OYS A;  1HZ4 A;  4A1G A;  2XEV A;  3E33 A;  1TYQ G;  4HB5 A;  5AYW D;  3Q9U C;  2UY1 A;  3G2T A;  3LPZ A;  3EDT B;  3ASD A;  4XKB A;  3UIP C;  3Q7A A;  4F53 A;  3FTW A;  4GTP A;  3URZ A;  3UUX A;  4ACL A;  2WB2 A;  2L6J A;  4I6E A;  4OVV A;  2DIW A;  3ZYQ A;  4JC8 A;  2LXL A;  3KEA A;  3NZU A;  4CDM A;  4DUI A;  2OOE A;  2WMN A;  3QNK A;  3O4Z A;  2MHK A;  1UJJ A;  1UJK A;  2LAI A;  4C0M A;  5CEA A;  4G8K A;  3FH8 A;  5LP0 A;  4KZC A;  3W9G A;  3SBS A;  1DVP A;  3U4T A;  3D9H A;  3HVE A;  1E7V A;  3C98 A;  3V2O A;  1Z6T A;  5HQ8 A;  2XRZ A;  3RKV A;  2L0T B;  5CBN A;  4HBD A;  3SI5 A;  1Z3Y A;  3DEO A;  4TV3 A;  4FJZ A;  2PNN A;  4B8C B;  1TR4 A;  3B7T A;  1QQE A;  1D8E A;  2X3M A;  3PEV B;  4UI9 J;  3TWU A;  2EIJ E;  1E8Y A;  1SA5 A;  4UQY A;  3DSS A;  5LFA A;  4KMO A;  2BUG A;  2HO1 A;  1S70 B;  4CRW A;  4APO A;  5KJN A;  3IV0 A;  5CER B;  4K5A B;  4UI9 K;  3UT8 A;  2XPI A;  3I4G A;  3FU5 A;  2FI7 A;  3ENE A;  4U8H A;  5FT9 A;  1FPP A;  1N52 A;  4W9R A;  5G05 J;  1RZ4 A;  3TGO A;  2C0M A;  3J5Q B;  2C0L A;  4G23 A;  3CLJ A;  1OCC E;  2VQ2 A;  2XCC A;  1HF8 A;  3FH7 A;  1MQS A;  3FFL A;  3MA5 A;  3JUI A;  2VSY A;  4U0Z A;  4YVQ C;  4TXP A;  1K1A A;  2I6H A;  4IYP A;  2AXU A;  3NBN B;  2XCB A;  1WY6 A;  3D3M A;  3NZS A;  1K8K G;  3HVE B;  1PC2 A;  1EF1 C;  3UIO C;  3HYM B;  1JCQ A;  1QBQ A;  3JUE A;  4JZY A;  4WWO A;  3X2Q E;  5LOZ A;  3QOU A;  3B13 A;  2QY7 A;  4U07 A;  4U0S A;  3ZN3 A;  3D9L A;  1N94 A;  3EHM A;  3QK0 A;  4LCT A;  2OCC E;  3PE3 A;  2EIK E;  3QB2 A;  3HIZ A;  4GTQ A;  3F6Q A;  4GA2 A;  5EID A;  4RG6 A;  1MJ0 A;  2IY0 C;  3BQO A;  4GA1 A;  1D8D A;  4JXT A;  2J8S D;  1TN7 A;  4G11 A;  5B3S E;  1NFI E;  3TWT A;  4Q96 A;  4I2Z A;  1QNF A;  2BF0 X;  3PRE A;  2X6J A;  1IYG A;  3UT4 A;  4F3V A;  2H6G A;  4JEU A;  3CHP A;  2J4B A;  3S7F A;  3ZEF A;  1SA4 A;  3MKQ B;  1H19 A;  3S2A A;  2Y0B G;  3O48 A;  4G1T A;  3CVY A;  3Q75 A;  4GTM A;  1TNZ A;  2RFA A;  3E4B A;  4LG6 A;  4RSY A;  4GTS A;  3UT7 A;  2V8S E;  5ARG A;  2VJ8 A;  2GW1 A;  2P9I G;  1O1T A;  3UPV A;  3SFX A;  4UWK A;  3FEX A;  1SW6 A;  4GTO A;  3LVQ E;  4JHK A;  3B7B A;  2XEN A;  1E8Z A;  4B89 A;  4ANX A;  3CVN A;  4XI0 A;  3TWS A;  1TJC A;  3UKR G;  3D9J A;  4Q94 A;  1N4P A;  5LCW J;  4BY6 A;  2F8X K;  3AG4 E;  3T5X A;  2NC9 A;  2DYR E;  3S7D A;  1W3B A;  4H7X A;  3SZ7 A;  2Q7F A;  1Q2Z A;  2XZD G;  3B95 A;  3RU0 A;  3KAE A;  4YVO A;  3I4R B;  5ITZ F;  4UI9 C;  4I6G A;  2H6H A;  4A63 B;  4PS3 A;  3LYA A;  2ION A;  5CED B;  1MYO A;  3ZRH A;  3RO3 A;  3HHM A;  3Q78 A;  1HXI A;  4LRZ A;  3RRM B;  4YDY A;  1HFA A;  4DPR A;  5AQ7 A;  1FT1 A;  2KZT A;  1MZC A;  3FUI A;  5G05 C;  3R9A B;  3V2X A;  2HYZ A;  3CVP A;  1RW2 A;  4U8V D;  2AJA A;  2WXL A;  3TWW A;  4WNF A;  2J49 A;  4F1P A;  3EIJ A;  5ENP D;  4BES A;  1WM5 A;  2DZO A;  4LSZ E;  5FZQ A;  4ZFH A;  2VTB A;  4HOQ A;  1NZN A;  2DCP A;  1ELW A;  3FWV A;  4HQD A;  1DCQ A;  5FJY A;  2Y3A A;  5AQB A;  4L2L A;  4J8E A;  3L16 A;  2P9P G;  2RKK A;  3IHV A;  2I1K A;  4MKT A;  3ZVV A;  3KS2 A;  4URK A;  2IO2 C;  3DST A;  5BPP A;  5IY5 E;  1BD8 A;  4HOT A;  4JB8 P;  5ANR A;  2YHE A;  5AJD A;  1E8W A;  1OXJ A;  4UUC A;  3VLE A;  3CV0 A;  1JWF A;  3DRA A;  1H2U A;  5CMY A;  5FZS A;  2BED A;  4AEZ C;  2IFU A;  3B7R L;  5CRV A;  2YIN A;  1ZBP A;  2P58 C;  4AY5 A;  3PZ3 A;  1S0P A;  3AG1 E;  5C2Y A;  4APF A;  1Z5S C;  3IEG A;  2X6F A;  1NL4 A;  3AS8 A;  3QC1 A;  3SQV A;  1OWL A;  1N4S A;  4HVB A;  3PZ1 A;  3ZYM A;  4GZ6 A;  3ZYK A;  3UXG A;  3DSW A;  4WWN A;  4FHK A;  4HRN A;  3JQ0 A;  4AM9 A;  3ULY A;  2WXH A;  4HS2 A;  5FWQ A;  1NA3 A;  1TNB A;  1MX6 A;  1FVF A;  2R05 A;  3VTY A;  2EQX A;  5ENN A;  3TWV A;  2WXN A;  2WXR A;  3HXC A;  2R03 A;  4V3I A;  1YA0 A;  4RLY A;  3TWX A;  3CKC A;  5KJL A;  3FH5 A;  2F8Y A;  3CIA A;  3ZKJ A;  3UM0 A;  3UM3 A;  2NSZ A;  4IRU A;  3OXG A;  3AS4 A;  2LO6 A;  5KJK A;  3FUE A;  1H6P A;  2J09 A;  3Q49 B;  3ZYL A;  5A6C A;  2I2O A;  4NAC A;  1TEZ A;  2JEK A;  5EX0 A;  5LCW C;  2DBA A;  3UIN C;  3ABM E;  1XGW A;  3DSX A;  4HI9 A;  5FIO A;  4TXQ A;  4HFG A;  3MJW A;  3DBS A;  2R02 A;  4U04 A;  3ZXP A;  2B0O E;  4KVM A;  2CFU A;  3ONL A;  5CCM A;  5M72 A;  3SBT B;  4F6R D;  3MGB A;  3FU3 A;  4K0R A;  5FQ6 A;  1KT1 A;  2CHZ A;  4IN3 B;  2ZGG A;  3DEP A;  4FUL A;  4Z68 A;  4BT9 A;  3LY8 A;  2Y1L E;  1BI7 B;  4FAD A;  1E8X A;  2OEV A;  5AQA A;  1G3N B;  3KSQ A;  4FLB A;  2IF4 A;  2XQ0 A;  2ZXW E;  3FTX A;  5BT1 A;  2V4L A;  2BKK B;  5FIN A;  4N5Q A;  3C5R A;  1IKN D;  3OXF A;  3D9N A;  5BNW A;  4PH4 B;  3CST A;  1PY1 A;  3WG7 E;  1SZA A;  5C1D A;  5JJT A;  1TN6 A;  3ZGQ A;  2IJG X;  4ILH B;  2X6H A;  4ABN A;  4KZ0 A;  3EJN A;  3KD7 A;  2IOS A;  3ZHE A;  4J8Y A;  4EPZ A;  2A5U A;  3PNT B;  4A3T A;  2RD0 A;  3AS5 A;  2R5S A;  5KBA A;  4Q69 A;  3FUN A;  1JWG A;  3ZPJ A;  5CRU A;  1P5Q A;  1K1B A;  2UY1 B;  3CKB A;  4QQI A;  3FUH A;  3CVW A;  4CT4 A;  2LNI A;  1O1S A;  3FHE A;  2XGO A;  4IUL A;  2GRM A;  3I5P A;  5J08 A;  4EBA G;  3SFZ A;  3V30 A;  1L5J A;  4U96 D;  5A23 A;  4BFR A;  4O1P A;  3ZW3 A;  1KZP A;  2LSV A;  2HE0 A;  2VYI A;  2LSU A;  2KAT A;  2P9U G;  4KVO A;  3HDX A;  1H6K A;  5HI7 A;  2L0I A;  3LKU A;  2ZIR A;  3ASF A;  1H0A A;  2FUL A;  3TJP A;  3ASH A;  2GRN B;  3EU5 A;  4FJY A;  3IBE A;  1X81 A;  4NRH B;  3Q47 B;  3GZ1 A;  3L82 A;  3LEW A;  5D66 A;  3FUF A;  2R2L A;  3L22 A;  3PUK A;  2ETA A;  4AP2 A;  3BG1 B;  4L23 A;  2KXP C;  3GYZ A;  1OCO E;  3CHR A;  3SGH A;  2A5E A;  3R7R A;  1K3Z D;  4J6I A;  4MS6 A;  1Y6I A;  4WND A;  3SO8 A;  1DNP A;  1INZ A;  2WXK A;  3MEK A;  1BLX B;  2PL2 A;  3J5P A;  2R59 A;  5JHB A;  2WXG A;  3LXU X;  2WXO A;  5AAR A;  3JQ1 A;  3Q5M A;  4XZ4 A;  2FEZ A;  3FU0 A;  2WQ6 A;  2WM9 A;  4GMR A;  3ZUV B;  3D9O A;  1FT2 A;  3PZD A;  5EIL A;  2PZI A;  4N3C A;  5FQ8 A;  1S63 A;  1TN8 A;  1IQR A;  3EHQ A;  3AU5 A;  5EYL A;  2LXM A;  4GCO A;  2XEH A;  4O1O A;  4LEU A;  3BU8 A;  3SY2 A;  2CFZ A;  3MV3 B;  5CCL A;  4HOR A;  4DX5 D;  2NXP A;  3OXL A;  2L9B A;  3C3Q A;  4WAF A;  2PQN A;  2XRY A;  1OUV A;  4DK5 A;  3AU4 A;  1DC2 A;  2OV8 A;  3I3N A;  1WAO 1;  3FUL A;  4BTB A;  3UM1 A;  2R17 C;  3PNL B;  2FO1 E;  3RJV A;  2IOL A;  2MYO A;  4CT0 A;  2QFC A;  4RVB A;  4QFV A;  3QJZ A;  2CG2 A;  4UWF A;  2J4D A;  1JCS A;  3FDH A;  4DJA A;  4BSX A;  3NB2 A;  2XEE A;  2XGS A;  3NAW A;  4FP7 A;  3GZS A;  3IKO B;  4GYW A;  1KPS B;  3SFY A;  4NIK A;  1NA0 A;  1OWM A;  4PS8 A;  3T8K A;  3B7S A;  3FUD A;  4AJW A;  4J7W A;  2EIL E;  4CDR A;  5FQ4 A;  2QYU A;  2ZU6 B;  4DRX E;  5BXU A;  1NP7 A;  3U64 A;  2LUH A;  1EYH A;  4FA6 A;  2F0Y A;  4CGW A;  4AVX A;  4GTV A;  5CMW A;  5BUZ A;  4BX9 A;  3Q73 A;  1N4Q A;  3LCA A;  5ENR D;  1UW4 B;  2P2C P;  1B89 A;  4WWP A;  4ME2 A;  4MLP A;  3Q7F A;  2QYJ A;  1O1R A;  3Q4A B;  4ACK A;  3EHN A;  3FTU A;  4ANU A;  5KJM A;  2DZN A;  4L2Y A;  4I1A A;  1LD8 A;  3APF A;  4HRL A;  2CG3 A;  5EYP F;  3OAW A;  2ETB A;  3D9M A;  3IXE A;  3L08 A;  1HG2 A;  4E85 A;  1HO8 A;  3G2S A;  5JJ7 A;  3RSE G;  1OWO A;  4OAV B;  3ASG A;  1E7U A;  1UN8 A;  3VTX A;  3FUM A;  5D0O D;  4K5C A;  4BX8 A;  1KZO A;  2PQR A;  4O60 A;  2V5Q C;  3AG2 E;  4JPS A;  5T8I A;  2VSO E;  4CCA A;  4HNA D;  3SD5 A;  2XPZ A;  5AAO A;  4G25 A;  2J07 A;  5E76 A;  1WG0 A;  3CK7 A;  4WNG A;  1H6O A;  2WXQ A;  3FUJ A;  4I1M A;  2FO7 A;  1FCH A;  1QYM A;  3OTN A;  1UN9 A;  5FQ7 A;  2A4Z A;  4XIF A;  1V54 E;  3E32 A;  3CHS A;  2I1J A;  2WVI A;  4KYO B;  2BTD A;  2HR2 A;  4BER A;  2MOW A;  3FTZ A;  5CHE E;  2YQ8 A;  1BI8 B;  5AIJ A;  3B7U X;  3QKY A;  1OCR E;  2IQC A;  4ZHB A;  2Y4T A;  3HXD A;  3P2B A;  4BET A;  5JMN D;  2AWI A;  4NUR A;  3TXM A;  2KCL A;  4J8F A;  1HS6 A;  3V31 A;  3ZXS A;  2IEJ A;  1TNY A;  3CQC B;  3L6A A;  4UQZ A;  4BWR A;  4N3A A;  4MRU A;  2HM8 A;  1IXV A;  3LJN A;  3MZL B;  4N5C A;  3G2W A;  2KZT B;  4I43 A;  4L9P A;  1Z3X A;  4DLQ A;  4KXK B;  2KM4 A;  3CVQ A;  3EHR A;  1YMP A;  4OAU C;  1BPO A;  4CGV A;  5EN5 D;  4GMJ A;  1JUQ A;  1H2V C;  4U8Y D;  4CZ2 D;  2WQ7 A;  3JCK C;  5KNH D;  1MX4 A;  3VLD A;  2VTB B;  4GYO A;  3DSV A;  4RG9 A;  3TG5 A;  4MBG A;  4JW1 A;  5AQ9 A;  4RQI A;  2L6B A;  1N11 A;  2QC9 A;  3ZFW A;  1O5M A;  3FU6 A;  2RFM A;  4A55 A;  4DLO A;  2CHW A;  4JHR A;  2Y69 E;  5AJL A;  4XX5 A;  4C9B B;  2I9C A;  3RAU A;  1AWC B;  1JCR A;  4I17 A;  2WXI A;  3CHM A;  1KT0 A;  3Q9N C;  1TNO A;  3MKR A;  4LNU D;  4DX1 A;  1LD7 A;  1TJF A;  3HXE A;  3FEY A;  5BXO A;  1UOH A;  3DSU A;  3FP3 A;  3GZ2 A;  5CEC B;  3T8M A;  3ZU7 B;  3SNX A;  3G2V A;  4J8D A;  5EKQ D;  3RIB A;  3BUA A;  2V5F A;  4AY6 A;  5J90 A;  2V0P A;  3UKU G;  2XS8 A;  5B1A E;  3UM2 A;  2XPY A;  3HRA A;  5A7D B;  1FVH A;  3ISM C;  4CDN A;  4B0Z A;  1EDU A;  4JVS A;  4DI3 A;  4EHM A;  1ZB1 A;  2FF4 A;  3LDZ A;  3JXJ A;  2B6C A;  2WXM A;  4GU5 A;  4BSZ B;  3ESL A;  3PDN A;  5KCM A;  4LNG A;  3PH0 C;  1HX8 A;  3TWQ A;  4ATG A;  3UI2 A;  1YYH A;  4FHJ A;  4JEH A;  2GRO B;  4FC8 A;  5ENO D;  5LX8 A;  3TL5 A;  2OVF A;  1MX2 A;  4GZ3 A;  5HRY A;  4I6J A;  1MHQ A;  4XKC A;  2XGM A;  1E96 B;  2KC7 A;  2F37 A;  2WPV A;  5ENQ D;  3E30 A;  3APC A;  4K03 A;  4L1B A;  1N0R A;  3MV2 B;  2P9N G;  4R7L A;  3ML8 A;  4FU3 A;  1KLX A;  3CK8 A;  2AXV A;  3U66 A;  1DCE A;  3T9K A;  2ZGD A;  4JA9 A;  1U3C A;  1OY3 D;  3R7Q A;  2WXP A;  4HRM B;  1SQM A;  1WDY A;  3K9I A;  3ULQ A;  5ANL A;  3MX3 A;  1N54 A;  4G8L A;  2FBN A;  3UQ3 A;  4CYM D;  3ONK A;  5JA4 D;  4HXI A;  2OEW A;  2OVB A;  2YHC A;  1IQU A;  3KSL A;  3MYV A;  5FZR A;  3RO2 A;  5ARF A;  3EUV A;  4U0U A;  5D0Q D;  2J08 A;  3CHO A;  4UWG A;  3MKQ A;  4AIF A;  3CEQ A;  4LNB A;  2WMO A;  4I9C A;  2P9L G;  3FTS A;  3CVL A;  3NOG D;  3QWP A;  5D2M C;  5FTP A;  4G24 A;  3D9K A;  2WXF A;  3PE4 A;  1NI1 A;  2UWJ G;  2WQH A;  2QZA A;  3CSF A;  4C48 B;  2KCK A;  1N4R A;  3ML9 A;  2Y4U A;  3C72 A;  1IHB A;  1N0Q A;  3QWV A;  3Q15 A;  4EBA A;  3FUK A;  4P29 A;  5G04 J;  2JLB A;  4TUM A;  2VGX A;  4U7E B;  3CQG B;  4K5B A;  4GYY A;  3QWW A;  5HS0 A;  2BKG A;  3FY4 A;  3U3W A;  3VLF A;  4EZK A;  1U2V G;  1ELK A;  3PVL A;  4B94 A;  2CHX A;  2J9Q A;  1OWP A;  2E2E A;  3ZHE B;  3LVR E;  4N3B A;  1HG5 A;  1OT8 A;  1YCS B;  2NYJ A;  4U95 D;  3HG0 D;  4DX2 A;  1GW6 A;  2AVP A;  3TG4 A;  4EQF A;  3JYS A;  1QZ2 A;  4I9E A;  3DPD A;  4UWL A;  4NQ0 A;  2E0I A;  4FLH A;  3CR3 A;  4ILI A;  2XHE A;  3UMV A;  4M7C A;  4TRQ A;  3T5V A;  3NOC D;  2AW6 A;  5G2N A;  2JAB A;  4OVU A;  3EU9 A;  4N39 A;  3W9F A;  3MCX A;  4HLE A;  3LJ3 A;  5B1B E;  2C2L A;  3BG0 B;  3CVV A;  1EPU A;  3PZ2 A;  1V55 E;  4LER A;  5DIZ A;  4GPM A;  4HI8 A;  1OWN A;  4F1S A;  3EIQ C;  5BV0 A;  3CGH A;  5T4Y A;  3CHQ A;  3PUJ A;  4YDE A;  3Q79 A;  3UTM A;  2OND A;  4JA7 A;  5JHA A;  3C3O A;  4G2V A;  4N2Q A;  1S64 A;  3AG3 E;  4BTA A;  3L54 A;  1N9A A;  3PS6 A;  5AEN A;  1LTX A;  2VSX E;  2VGX B;  3AJI A;  4HOU A;  3V79 K;  3DXM G;  3PEU B;  4DX7 D;  2VSN A;  1PAQ A;  2RG8 A;  4JHJ A;  4XEI G;  4EZJ A;  3NF1 A;  1OCZ E;  3DXK G;  5DBK A;  2MRI A;  1TNU A;  1ZU2 A;  3RK6 A;  4AOF A;  3HXB A;  4G26 A;  2V4H C;  3L13 A;  4GZC A;  1IHG A;  3C3R A;  4N2S A;  3NQP A;  4EZL A;  3ULE G;  3HXF A;  2ILR A;  4U63 A;  3S7J A;  4I1O B;  2H6I A;  3U9W A;  2EIM E;  3WXX A;  3G2U A;  4DX6 D;  2P9K G;  3TAX A;  2KCV A;  2GRQ B;  4Y6C A;  4B93 B;  2GRP B;  4JL0 A;  3IHY A;  3LS8 A;  4ILG A;  3FTV A;  3CVU A;  1HH8 A;  3S7B A;  1JPL A;  4UQX A;  4J8S A;  4GPK A;  3D9P A;  3BEE A;  3DWL G;  1SZ9 A;  4AV7 A;  2X38 A;  4WUY A;  3RRN B;  3ABK E;  1A17 A;  5ENT D;  4PUC A;  2PM6 A;  4CEM A;  4GAA A;  4KT6 B;  1E90 A;  2IO3 C;  1LF8 A;  4YDW A;  2M63 A;  5BV1 A;  4KBQ A;  3D9I A;  4GTT A;  3UX4 A;  3LY9 A;  3SHF A;  3PRZ A;  4HOS A;  3TWR A;  1ELR A;  3P1U A;  3E34 A;  4L7T A;  1AP7 A;  4A1S A;  2ZIS A;  4H7Y A;  1SVX A;  2PM7 A;  4E6H A;  1Y8M A;  3APD A;  1A5E A;  5EDS A;  3KEZ A;  5G04 C;  3ZNG A;  5EIB E;  3CK9 A;  3RRU A;  4BT8 A;  4GZD A;  3PZ4 A;  3GW4 A;  1VDY A;  4M3O A;  2IU1 A;  4D10 C;  4DI4 A;  3N71 A;  2VGE A; 
#chains in the Genus database with same CATH homology
 3TWQ A;  1WG0 A;  3UI2 A;  1YYH A;  4QFV A;  1IKN D;  5D66 A;  1NFI E;  4HB5 A;  5ENO D;  5AN8 A;  5AQ9 A;  3AAA C;  3Q9U C;  2XZD G;  1MX2 A;  3J5Q B;  5HKP A;  1BD8 A;  3B95 A;  3TWT A;  1QYM A;  2ETA A;  2XEE A;  4GPM A;  4BEP A;  4HI8 A;  2L6B A;  4JB8 P;  3NOG D;  5HRY A;  1N11 A;  5CBO A;  2DWZ A;  2KXP C;  3JXI A;  2QC9 A;  5ITZ F;  4NIK A;  2RFM A;  1D9S A;  2F37 A;  4UUC A;  3T8K A;  2A5E A;  5ENQ D;  1K3Z D;  4A63 B;  4BER A;  4J8Y A;  3UTM A;  4C48 B;  5ENT D;  3KEA A;  2XZT G;  4DUI A;  4J7W A;  5CED B;  1IHB A;  1MYO A;  1N0Q A;  2DVW A;  3SO8 A;  1BI8 B;  5KBA A;  1N0R A;  1BLX B;  4DRX E;  5BXU A;  4HI9 A;  4YDY A;  3J5P A;  5AQ7 A;  4ZFH A;  1AWC B;  4TUM A;  4YDW A;  5CEA A;  4ATZ D;  4G8K A;  1K1B A;  4K5B A;  1K1A A;  2Y0B G;  5FIO A;  3Q9N C;  5KNG A;  4QQI A;  5HS0 A;  3V2X A;  3W9G A;  2BKG A;  5AAR A;  3AJI A;  4LNU D;  4ZHB A;  4BET A;  3D9H A;  3V79 K;  5JMN D;  4DX1 A;  3NBN B;  5KWD A;  2B0O E;  4DX7 D;  5BXO A;  1UOH A;  5ENR D;  4U8V D;  2AJA A;  2P2C P;  4LG6 A;  2RFA A;  3TWW A;  3V2O A;  3V31 A;  4HLL A;  2QYJ A;  3T9K A;  5CEC B;  4GMR A;  3ZUV B;  4F1P A;  2ZGD A;  3ZU7 B;  3TWR A;  5EIL A;  5ENP D;  2DZN A;  4F6R D;  4BES A;  3UXG A;  1OT8 A;  2DZO A;  5CBN A;  1YCS B;  1OY3 D;  2NYJ A;  4HBD A;  4U95 D;  1AP7 A;  3HG0 D;  2ZGG A;  4HRM B;  1WDY A;  3DEO A;  4HRL A;  3DEP A;  1IXV A;  3JUE A;  4LSZ E;  3EHQ A;  5EYL A;  4HRN A;  1SVX A;  4DX2 A;  4Z68 A;  3LJN A;  5EYP F;  1A5E A;  2ETB A;  3IXE A;  3V30 A;  4U96 D;  4O1P A;  2V4H C;  2Y1L E;  1SW6 A;  1BI7 B;  2PNN A;  3HRA A;  3ZNG A;  1TR4 A;  2XEH A;  2HE0 A;  4G8L A;  4O1O A;  5EIB E;  4HQD A;  4CYM D;  5AQA A;  4OAV B;  3B7B A;  1MX6 A;  1G3N B;  5JA4 D;  2XEN A;  4DX5 D;  3TWU A;  1DCQ A;  3TWV A;  4K5C A;  3EHR A;  1YMP A;  4OAU C;  3TWS A;  3F6Q A;  4O60 A;  2V5Q C;  5EN5 D;  1S70 B;  3JXJ A;  5EID A;  5ENS D;  1DC2 A;  5AQB A;  3NOC D;  4DX6 D;  4RLY A;  3TWX A;  2BKK B;  2KBX A;  1MJ0 A;  2JAB A;  4U8Y D;  4CZ2 D;  5CER B;  4BSZ B;  4HNA D;  3EU9 A;  4K5A B;  5AAO A;  2F8X K;  4B93 B;  2ETC A;  2F8Y A;  2FO1 E;  1BU9 A;  3ZKJ A;  5KNH D;  1MX4 A;  5FIN A;  4N5Q A;  3W9F A;  2J8S D;  2MYO A;  2VGE A;  3C5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...