4JB8P

Caspase-7 in complex with darpin c7_16
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
DLGKKLLDAASAGQDDEVRILMANGADVNASNQQGWTPLHATAEYGHLEIVDVLLAYGADVNASDSYGSTPLHSAAWAGHLEIVDVLLAHGADVNASDNYGWTPLHLAAHTGHLEIVDVLLANGADVNANNWWGKTPFDLAIDNGNEDIAEVLQKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, construction, and characterization of a second-generation DARPin library with reduced hydrophobicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
molecule keywords Caspase-7 subunit p20
total genus 54
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2013-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4jb8P00
5AN8A 4J8YA 4HQDA 1AWCB 2FO1E 2Y1LE 4G8KA 4U95D 3TWSA 3TWTA 4DX7D 4HBDA 3IXEA 1IKND 3D9HA 5AQ9A 5CECB 4ZHBA 2BKGA 4QFVA 3ZUVB 4ZFHA 4F1PA 2JABA 2F37A 5CERB 2XZTG 4LNUD 4GPMA 4HRMB 3ZKJA 4U8YD 5ENTD 4BESA 4CYMD 2ETAA 3UI2A 5ENSD 2QC9A 2QYJA 2V5QC 3TWQA 5CEDB 4HNAD 1K1BA 1WDYA 4HI8A 1BU9A 3AAAC 5ENOD 3TWXA 1OY3D 2VGEA 4U8VD 5AQAA 3SO8A 2DZNA 3EU9A 2Y0BG 3F6QA 2KBXA 2XZDG 3ZNGA 2RFAA 1MYOA 4DRXE 3UXGA 1MX6A 4Z68A 4K5BA 3TWRA 1TR4A 1G3NB 2L6BA 1N0RA 3JUEA 4YDWA 5AQBA 1BI7B 3B7BA 2ZGDA 4HRNA 2DWZA 4U96D 4ATZD 2V4HC 4O1OA 5ENQD 2F8XK 3HRAA 5FIOA 4BSZB 5KBAA 5CBOA 4N5QA 5HS0A 4DUIA 5JMND 4OAUC 4F6RD 2AJAA 4LG6A 3AJIA 2ETCA 5ENPD 1SW6A 5HRYA 1K3ZD 3LJNA 5KNGA 4BETA 2DZOA 3TWVA 3W9FA 5EYLA 4GMRA 3DEPA 2F8YA 2P2CP 4TUMA 3T9KA 5ITZF 2ZGGA 1BI8B 4A63B 3NBNB 4G8LA 4DX2A 1MJ0A 3UTMA 1MX2A 1YYHA 3V31A 1SVXA 5D66A 4BERA 5FINA 4JB8P 5JA4D 1UOHA 2XENA 5AQ7A 4HLLA 5KWDA 4K5CA 1QYMA 1NFIE 3Q9UC 1S70B 3TWWA 3C5RA 5BXOA 1N11A 2B0OE 4C48B 1BLXB 4YDYA 2NYJA 4O60A 5AAOA 2XEHA 4DX1A 5CBNA 2XEEA 4OAVB 2MYOA 4BEPA 2ETBA 4K5AB 4O1PA 5ENRD 3V2XA 3V79K 1IXVA 5EIDA 1BD8A 4NIKA 5BXUA 3HG0D 1YCSB 4DX6D 5CEAA 1WG0A 3KEAA 4UUCA 1A5EA 5HKPA 3J5QB 3V30A 5EYPF 2A5EA 3T8KA 5EILA 1D9SA 1DC2A 2HE0A 4DX5D 1IHBA 3B95A 1MX4A 2J8SD 3JXJA 5AARA 1YMPA 5EIBE 4HI9A 2BKKB 3EHQA 4QQIA 3W9GA 4J7WA 1N0QA 3J5PA 3JXIA 3ZU7B 4B93B 1K1AA 1OT8A 3NOCD 3EHRA 4HB5A 3TWUA 4RLYA 2RFMA 1DCQA 5EN5D 3Q9NC 4LSZE 2PNNA 1AP7A 3V2OA 3DEOA 2KXPC 3NOGD 2DVWA 4CZ2D 5KNHD 4HRLA
chains in the Genus database with same CATH superfamily
1HU3A 1MQSA 2WXGA 2BF0X 3Q5MA 2V4LA 4HOUA 2OEVA 3EDTB 2Y0BG 2XPZA 1TR4A 4I9CA 1BI7B 3O4ZA 5EX0A 3U9WA 5KJMA 4BWRA 3AG2E 2XCCA 2DZOA 2X6HA 2BUGA 5CCMA 3UTMA 2GROB 1N4SA 1E8YA 3KSQA 4O6FA 3LY7A 5FJYA 1HE8A 4BX9A 2AXUA 2WXJA 3C3RA 4EZLA 1N4QA 1BPOA 3CVPA 3RIBA 4K5AB 4GPKA 4L1BA 1WG0A 4URKA 4DX5D 5EDSA 3CK7A 2A5UA 3QAQA 2WXNA 3UM1A 2GW1A 4B93B 4LNGA 2LSUA 4YNDA 4OVUA 5EN5D 2XS1A 5LP0A 1SZAA 4X8QA 2X3MA 2EIJE 1TEZA 3ABKE 3D9HA 3MV2B 4ZHBA 1E96B 2EIME 3VTYA 3ZGQA 3ZFWA 5ENTD 4GYOA 3CVLA 4E6HA 1NA3A 2KC7A 5HQ8A 1JCQA 3HDXA 1FVFA 4I2ZA 2RG8A 3JQ0A 2BEDA 2HR2A 3KSLA 4A1GA 4I6EA 4LERA 3UIPC 3P1UA 5B1BE 4JPSA 4HRNA 1H6OA 4ILHB 3DRAA 4I6GA 1LD8A 4AP2A 3IBEA 3AJIA 4AEZC 2VTBB 2R02A 3T5XA 3PZDA 2OEWA 1FT1A 2Y69E 3CVWA 4I9EA 3PREA 1QZ2A 4A55A 3PE4A 5KJLA 3CVNA 3QKYA 2RKKA 3ASFA 2YQ8A 3D9OA 2ETBA 4JZYA 3ONKA 3S7FA 4NIKA 3RSEG 5G05C 4CRWA 4UUCA 4KZCA 2WXFA 1IHBA 2WM9A 4D10C 3ESLA 3CHMA 1MHQA 2J4DA 3E32A 4LEUA 3L16A 1NP7A 1EDUA 3URZA 3FWVA 3RK6A 3TG4A 1GW6A 2WQ7A 4ZFHA 4ILIA 4BT9A 5CERB 2EQXA 2XZTG 4RG6A 4G25A 4UQYA 3CHQA 1SQMA 2DYSE 4CDMA 2OCCE 3DSUA 4WNEA 4E85A 4JW1A 4HI8A 1IYGA 5D0OD 4U0ZA 3EU9A 2KATA 4UWKA 4CGVA 3UXGA 2I1KA 4YDWA 4JHJA 4L23A 5FIOA 1FCHA 5CBOA 2CFUA 4HOSA 3SFXA 3UX4A 1O1TA 2XGOA 1QBQA 3UUXA 2XPYA 4L2LA 3T8MA 5FQ7A 4ACKA 1MJ0A 2ONDA 2DIWA 4HLEA 3AS8A 3RAUA 1V54E 4NQ0A 5AJDA 2VGXA 2IEJA 2NYJA 1JUQA 1RZ4A 3MGBA 4UWGA 1LD7A 4Q69A 2NXPA 1TNYA 5H7PA 4PDXA 2ZISA 4FULA 4J0UA 3J5QB 3V30A 4A3VA 4UWLA 4PS8A 4J8FA 2QFCA 5EIBE 4EQFA 4HB5A 3PNLB 3TWUA 4TXPA 1JCRA 2F0YA 1INZA 4K0RA 2KZTB 3RJVA 3UT4A 3LDZA 4J8YA 4CEMA 3TWTA 2HM8A 2L0TB 3ZIMA 4PS7A 2V0PA 2BKGA 4I1OB 5KCMA 3KD7A 2LXLA 4N3CA 5LOZA 3CSTA 2QYJA 1H2TC 3FTYA 4U8HA 4RSYA 3G2SA 4M7CA 5BPPA 3MJWA 3R9AB 3TWRA 1RW2A 3B7BA 3Q73A 4U07A 1N4RA 3FUEA 3UIOC 4O1OA 4GTTA 4H7YA 4FC8A 4UI9J 2GRQB 2AJAA 2XCBA 4UI9C 4G11A 2QZAA 4YDOA 4I6JA 2F8YA 1UN8A 3S7BA 3NBNB 4DX2A 4GZ5A 4APOA 2GRMA 3FTWA 4ABNA 4W9RA 2R59A 1JWFA 4B8AA 4AOFA 3Q49B 4EHMA 2B0OE 5B3SE 2XEHA 2XEEA 5AENA 3AG3E 4O1PA 1SZ9A 3V79K 5ARGA 5BV1A 2CG2A 3HG0D 3SFYA 2UY1A 4XKCA 5EILA 4NRHB 5G04J 4F1SA 3ISMC 3UQ3A 5BT1A 4GTVA 2E2EA 3FUDA 5AIJA 5CMYA 1KZOA 3I3NA 3PEUB 4EZJA 3R9MA 3FULA 3CVUA 3FTUA 3FUFA 5KNHD 2Y1LE 3I4RB 3FFLA 4DX7D 3D9NA 2L9BA 3APFA 5FTPA 4DJAA 1WY6A 2KCVA 1S0PA 1PC2A 2XQ0A 3PNTB 3TGOA 1BU9A 3ZXPA 4IRUA 4U8VD 4GZDA 5AQAA 2IOLA 3CSFA 3FU6A 1DVPA 2XZDG 2RFAA 1UJKA 4K5BA 1L5JA 3D9MA 4GYWA 2ZGDA 3PEVB 2VJ8A 2C0MA 4G23A 5BNWA 3CGHA 3ABLE 3HRAA 1OCCE 1K3ZD 3L13A 1Q2ZA 5LCWJ 1QNFA 5FINA 3EHNA 2HYZA 3FUNA 1QYMA 4B94A 1U3CA 4GA0A 1XNFA 2AXZA 5EIDA 3S7DA 3LYAA 3RRUA 5HKPA 3FDHA 3UT7A 1TN6A 1ELWA 3QDNA 1VDYA 4J7WA 3OTNA 4LUNU 4Q94A 2X6FA 5C1DA 2LAHA 4PS3A 2RFMA 4KYOB 3RO3A 3JUIA 1OXJA 1AWCB 4XIFA 3DPDA 1ZBPA 4MS6A 4EZKA 2JABA 4XZ4A 4IULA 1LF8A 4N39A 4FJYA 5ENSD 1Z3YA 2CFZA 3B13A 2ZU6B 5J08A 4NURA 3SD5A 3IKOB 3SGHA 3F6QA 3LS8A 4MRUA 4BTBA 3IEGA 3Q79A 1NL4A 5HS0A 5G2NA 4BFRA 2OOEA 1OCZE 2H6HA 4BETA 5EYLA 2R5SA 3DEPA 3CEQA 2VSYA 1X81A 4OVVA 4G8LA 1MX2A 2PM7A 3WXXA 1U3DA 4GZ6A 4BERA 1UOHA 1H2UA 3ML9A 5JJ7A 2A4ZA 3NZUA 4AVXA 4C48B 1BLXB 1FPPA 3U3WA 3FH8A 4G24A 3V2XA 3DBSA 3CHRA 5CEAA 4GA1A 3NZSA 2WXIA 1DC2A 2HE0A 2P9PG 5AYWD 4RQIA 2VSNA 2WVIA 3BUAA 3MZLB 4IN3B 5LX8A 4I17A 1H6PA 2H6FA 4MBGA 1K8KG 4RLYA 5BW8C 4GMLA 1OCOE 2M63A 2X38A 4CT4A 4HQDA 1W3BA 4ANVA 4U95D 4FHJA 1NI1A 4Q96A 1IQRA 4ME2A 3PS6A 1Z3XA 3PZ3A 4ACLA 2ETAA 5ENNA 2YHEA 5DIZA 5FT9A 4FA6A 3ZYMA 4B0ZA 2WXRA 3FUKA 3I4GA 2GRRB 3FUHA 3SO8A 4DK5A 3QWVA 3L17A 1N95A 5JHAA 2PQNA 3ZEFA 3L08A 2OV8A 2DYRE 4J8EA 4JC8A 4JD2G 4ATZD 4AY5A 5KBAA 1LTXA 4F6RD 5ENPD 2C0LA 2WXQA 5KNGA 3OXGA 4GTSA 5ITZF 3PUJA 4GYYA 1YA0A 3L9TA 5D66A 4B8CB 5AQ7A 4FJZA 3QK0A 3TXNA 3ZYKA 3B7RL 2WMOA 4UI9K 3DWLG 3QARA 2MYOA 1IXVA 3SHFA 4WWPA 1TNUA 4XX5A 3UT8A 1OUVA 3SFZA 2B6CA 2OVBA 2VSOE 4JEUA 2XEVA 4CCAA 3J5PA 3PE3A 1OT8A 4GTPA 3FTZA 3QWWA 3RO2A 1DCEA 3V2OA 1H6KA 4CZ2D 1SA4A 4G26A 3G2TA 3NAWA 4HRLA 4GTRA 3HHMA 2FO1E 4FHKA 3ULEG 4F53A 3FEYA 4LNUD 3SBSA 4P29A 5ARFA 2P9LG 3MA5A 4N5CA 3AAAC 4OYSA 3CKCA 4KZ0A 2C2LA 3PH0C 3CVXA 3BU8A 5AJLA 2P9NG 1IQUA 5ENQD 3L54A 3UKUG 2J08A 5D0QD 4BY6A 4GMRA 2FULA 4TUMA 1OWLA 4A63B 5JJTA 3KEZA 4GTMA 3UINC 3VTXA 5IY5E 3ASNE 3OXFA 2WQ6A 3D9JA 4UQXA 4Y6WA 3HVEB 4CDRA 2GGFA 5CBNA 4FU3A 4F3VA 5FZQA 3Q15A 2IY0C 5ENRD 5E76A 2PZIA 5E75A 4AM9A 4I43A 3FU5A 1SA5A 4KMOA 5BUZA 2AVPA 3EIQC 2IFUA 2ZXWE 4AY6A 5FQ8A 3NF1A 3ULYA 1JWGA 3JXJA 1YMPA 2J4BA 3BQOA 3S7JA 5T4YA 3NOCD 3DSWA 3ASHA 2I2OA 4Y6CA 5DBKA 3DEOA 2FBNA 3UKRG 3U66A 1A17A 2LUHA 3FH5A 5AQ9A 1EPUA 1U2VG 1IHGA 3C3OA 3MYVA 5CHEE 4F1PA 4EPZA 4FADA 4LRZA 2WXOA 2XPIA 2OVFA 1HX8A 3ASGA 3X2QE 2V5QC 3E30A 3S2AA 4FP7A 4U0UA 2LO6A 2WXKA 4WWNA 1HS6A 1P5QA 1E8ZA 3D9IA 2DWZA 3IHVA 4U96D 3CVVA 4PH4B 5LCWC 5BV0A 3LY9A 5JMND 3FTXA 3FY4A 1HG5A 1ZB1A 2HO1A 4XI9A 4XEIG 3N71A 3UPVA 1UN9A 2P9IG 3PRZA 3CHSA 4JA7A 1XGWA 4DLOA 3HXBA 3APCA 4O60A 2WXPA 1OWNA 1TNZA 2IJGX 5LFAA 3PZ2A 2DCPA 1HF8A 3O48A 3ASDA 2Y4TA 3Q7FA 4HXIA 4APFA 3KEAA 1PY1A 3AS4A 3B95A 2GRLA 3ZU7B 4MKTA 3IV0A 2LSVA 3LPZA 3ONLA 1N52A 1N54A 1E8WA 3CLJA 3ZPJA 4L7TA 5AN8A 2I1JA 5EKQD 3CHPA 4LCTA 1TJCA 2VYIA 1O5MA 3QC1A 4JEHA 1WM5A 3UI2A 1X5BA 3Q4AB 1EF1C 2VGEA 3NB2A 3SF4A 3P2BA 3MKQB 2KBXA 3ZNGA 3TG5A 3FHEA 4DI3A 4Z68A 4DPRA 3LXUX 2L6BA 5CRVA 3CK8A 1O1RA 3VLDA 1HZ4A 4KBQA 3DSXA 4G2VA 2ETCA 4PUCA 5HRYA 3U64A 3LJNA 2AWIA 3RRMB 1BI8B 2ZGGA 3TJPA 4JB8P 1NA0A 5JA4D 2XENA 5KWDA 2CHXA 3SBTB 2FF4A 3LEWA 2I9CA 3IHYA 3LVRE 4CDNA 2ILRA 3HIZA 3T5VA 1TN7A 3AG1E 1Y6IA 5FQ4A 3ZXSA 3CK9A 1A5EA 3OAWA 3T8KA 5ANRA 5ANLA 1D9SA 3PUKA 3ZHEB 3G2WA 4CT0A 5AARA 1ZU2A 3EHQA 3TAXA 3QWPA 5G55A 3QNKA 3LY8A 3Q9NC 4L9PA 1TYQG 5D2MC 1KT1A 2QYUA 1IKND 5CECB 4BTAA 2V5FA 3G2UA 4A3TA 4GCNA 4GCOA 3RKVA 4BSXA 2P9KG 4HNAD 1OY3D 1OWOA 4WNFA 3UM0A 2YNQA 1MYOA 4DI4A 1N0RA 1ELRA 4JVSA 5FWQA 4TUUA 3QJZA 4JL0A 1KT0A 4GU5A 2F8XK 3TL5A 4TXRA 4UWHA 4LG6A 2L6JA 2IQCA 2L0IA 3DPYA 2IO3C 3CQCB 1OWMA 3LKUA 1NFIE 2R03A 3KAEA 2R17C 2J49A 4ANWA 5AAOA 4DX1A 4OAVB 5JJ6A 2J07A 4KXKB 5A6CA 3Q75A 2KM4A 1N9AA 1TNOA 3D9LA 2XS8A 2J8SD 3D3MA 2BKKB 3W9GA 3SI5A 3D9KA 3HYMB 2FO7A 3HXFA 3SQVA 2XRYA 3MX3A 5JHBA 1QQEA 4L2YA 3MV3B 1E90A 2LXMA 3K9IA 4R7LA 3HXEA 1Z5SC 3UM3A 1K1BA 1KZPA 1TNBA 2DZNA 3Q47B 2IF4A 4J6IA 1MX6A 2X6KA 4U63A 4HOTA 5FQ6A 2IONA 2WPVA 1HFAA 1MZCA 5HI7A 4UWFA 2PM6A 2P2CP 2EIKE 4YVQC 3V31A 4ANXA 4WNDA 4J8DA 3QB2A 1N11A 1E7UA 3PZ4A 4I2WA 3CVQA 4WWOA 3CHOA 3C72A 3BG1B 3DSVA 2GRPB 5J90A 3BEEA 4GZ3A 3FH7A 4HI9A 3FUMA 4HVBA 2XGSA 2LAIA 3JXIA 3R7RA 2IU1A 4AJWA 1DCQA 2KXPC 2MHKA 3EIJA 3D9PA 3FU0A 2AXVA 4QFVA 2FEZA 2F37A 4YVOA 1OWPA 1JCSA 5A7DB 3HVEA 3FTVA 4ATGA 3RRNB 3TWXA 4U0SA 2NSZA 3U4TA 1DNPA 2PL2A 1TJFA 2I6HA 4C9BB 2KCLA 2V4HC 2MOWA 4B89A 4BSZB 4N5QA 4OAUC 3L82A 2J09A 3LJ3A 1V55E 3EJNA 1E7VA 4EBAG 4BT8A 4U7EB 3DSTA 3GYZA 3ZHEA 3SY2A 3FP3A 2WXLA 2FI7A 2NC9A 2Y4UA 4K03A 5T3RA 4I1MA 3FTSA 1E8XA 3FEXA 4XI0A 2R05A 1BD8A 5BXUA 2ZIRA 3HXDA 3NQPA 3CKBA 4F7AA 5EYPF 3B7SA 1D8EA 2CHWA 4HFGA 4MLPA 2A5EA 2JLBA 5G04C 3LCAA 4QQIA 4G1TA 3C3QA 1K1AA 3EHRA 4N2SA 3ESKA 5C2YA 5T8IA 2IOSA 3TWSA 3ZN3A 2X6JA 3ZUVB 2E0IA 4AV7A 3AU4A 3ZYQA 4HRMB 3GZSA 4J8SA 4U8YD 3TXMA 3BG0B 4C0MA 5M72A 1WDYA 4C0EA 2R2LA 5KJNA 2P9UG 3CIAA 2CG3A 4DRXE 3MKRA 1G3NB 5AQBA 2VGXB 3AS5A 4AXHA 4WAFA 3PDNA 3ULQA 4ANUA 4KVOA 2AW6A 3AG4E 3L22A 2WMNA 1B89A 1HO8A 3PZ1A 2IO2C 1NZNA 4HLLA 3SZ7A 2GRNB 2WXMA 3WG7E 3JQ1A 4UQZA 5BXOA 4FLHA 4YDEA 4A1SA 2YINA 5A23A 3Q7AA 1FVHA 3FU3A 3KS2A 4U04A 2KZTA 3GZ1A 3CV0A 4I1AA 1HH8A 1Z6TA 3MKQA 1JPLA 4N3AA 1S64A 4RVBA 1ELKA 3DXMG 4JHKA 3R7QA 1N0QA 4ILGA 2PNNA 2DVWA 3OXLA 3E4BA 3C98A 4G8KA 4IYPA 2XRZA 4V3IA 2EINE 5EX3A 4BESA 3CR3A 5CCLA 3UM2A 2QC9A 4JHRA 4BX8A 3MCXA 5CEDB 4NACA 2X6IA 2VQ2A 4GMJA 5FZRA 4N3BA 3B7UX 4TRQA 4N2QA 4JA9A 3JUEA 5FZSA 1H2VC 3CQGB 2VSXE 5CMWA 4XE0A 2VGYA 3CVYA 3APDA 3GW4A 4M3OA 4TXQA 1SW6A 2H6GA 1KPSB 4GZCA 3ML8A 1H19A 3T9KA 2EILE 3FUIA 1SVXA 3I5PA 3Q9UC 3TWWA 1WAO1 1PAQA 3C5RA 4DLQA 4FLBA 2WXHA 4YDYA 1KLXA 3L6AA 1UW4B 4GA2A 2LNIA 3ZW3A 2VTBA 4RG9A 3HXCA 4KVMA 1YCSB 3G2VA 3Q78A 1D8DA 3EHMA 1N4PA 4GTQA 1MX4A 3B7TA 1S63A 3RU0A 5G05J 3JCKC 2QY7A 1OCRE 2CHZA 3ZVVA 4LSZE 3E37A 1UG3A 3JYSA 3SNXA 4GAAA 3ZRHA 1HG2A 4HBDA 3EUVA 3IXEA 2V8SE 4WNGA 4GPMA 3ZKJA 4HS2A 4CYMD 1O1SA 3TWQA 4AIFA 3VLEA 5ENOD 1HXIA 4KT6B 1H0AA 2P58C 2UY1B 3LVQE 3E34A 2KCKA 4HOQA 3EU5A 2YHCA 5CRUA 1UJJA 3ENEA 1TN8A 4GTOA 4DUIA 3ZYLA 4LNBA 3TWVA 3W9FA 2XHEA 2H6IA 2P9SG 1Y8MA 2WQHA 1YYHA 1N94A 4GB9A 2BTDA 1FT2A 4TV3A 4K5CA 4EECA 3FUJA 1S70B 4JXTA 3ABME 3E33A 3PVLA 3QOUA 4BEPA 2JEKA 4CGWA 4WUYA 2Y3AA 4DX6D 2RD0A 2XGMA 3AU5A 4H7XA 3UMVA 3GZ2A 2Q7FA 4HORA 3DSSA 2UWJG 4EBAA 2DBAA 5KJKA 1EYHA 3ASOE 4XKBA 3DXKG 2PQRA 2J9QA 2MRIA 3MEKA 3VLFA 1AP7A 3NOGD 2WB2A 5B1AE
chains in the Genus database with same CATH topology
5AN8A 4J8YA 4HQDA 1AWCB 2FO1E 2Y1LE 4G8KA 4U95D 3TWSA 3TWTA 4DX7D 4HBDA 3IXEA 1IKND 3D9HA 5AQ9A 5CECB 4ZHBA 2BKGA 4QFVA 3ZUVB 4ZFHA 4F1PA 2JABA 2F37A 5CERB 2XZTG 4LNUD 4GPMA 4HRMB 3ZKJA 4U8YD 5ENTD 4BESA 4CYMD 2ETAA 3UI2A 5ENSD 2QC9A 2QYJA 2V5QC 3TWQA 5CEDB 4HNAD 1K1BA 1WDYA 4HI8A 1BU9A 3AAAC 5ENOD 3TWXA 1OY3D 2VGEA 4U8VD 5AQAA 3SO8A 2DZNA 3EU9A 2Y0BG 3F6QA 2KBXA 2XZDG 3ZNGA 2RFAA 1MYOA 4DRXE 3UXGA 1MX6A 4Z68A 4K5BA 3TWRA 1TR4A 1G3NB 2L6BA 1N0RA 3JUEA 4YDWA 5AQBA 1BI7B 3B7BA 2ZGDA 4HRNA 2DWZA 4U96D 4ATZD 2V4HC 4O1OA 5ENQD 2F8XK 3HRAA 5FIOA 4BSZB 5KBAA 5CBOA 4N5QA 5HS0A 4DUIA 5JMND 4OAUC 4F6RD 2AJAA 4LG6A 3AJIA 2ETCA 5ENPD 1SW6A 5HRYA 1K3ZD 3LJNA 5KNGA 4BETA 2DZOA 3TWVA 3W9FA 5EYLA 4GMRA 3DEPA 2F8YA 2P2CP 4TUMA 3T9KA 5ITZF 2ZGGA 1BI8B 4A63B 3NBNB 4G8LA 4DX2A 1MJ0A 3UTMA 1MX2A 1YYHA 3V31A 1SVXA 5D66A 4BERA 5FINA 4JB8P 5JA4D 1UOHA 2XENA 5AQ7A 4HLLA 5KWDA 4K5CA 1QYMA 1NFIE 3Q9UC 1S70B 3TWWA 3C5RA 5BXOA 1N11A 2B0OE 4C48B 1BLXB 4YDYA 2NYJA 4O60A 5AAOA 2XEHA 4DX1A 5CBNA 2XEEA 4OAVB 2MYOA 4BEPA 2ETBA 4K5AB 4O1PA 5ENRD 3V2XA 3V79K 1IXVA 5EIDA 1BD8A 4NIKA 5BXUA 3HG0D 1YCSB 4DX6D 5CEAA 1WG0A 3KEAA 4UUCA 1A5EA 5HKPA 3J5QB 3V30A 5EYPF 2A5EA 3T8KA 5EILA 1D9SA 1DC2A 2HE0A 4DX5D 1IHBA 3B95A 1MX4A 2J8SD 3JXJA 5AARA 1YMPA 5EIBE 4HI9A 2BKKB 3EHQA 4QQIA 3W9GA 4J7WA 1N0QA 3J5PA 3JXIA 3ZU7B 4B93B 1K1AA 1OT8A 3NOCD 3EHRA 4HB5A 3TWUA 4RLYA 2RFMA 1DCQA 5EN5D 3Q9NC 4LSZE 2PNNA 1AP7A 3V2OA 3DEOA 2KXPC 3NOGD 2DVWA 4CZ2D 5KNHD 4HRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AN8 A;  4J8Y A;  4HQD A;  1AWC B;  2FO1 E;  2Y1L E;  4G8K A;  4U95 D;  3TWS A;  3TWT A;  4DX7 D;  4HBD A;  3IXE A;  1IKN D;  3D9H A;  5AQ9 A;  5CEC B;  4ZHB A;  2BKG A;  4QFV A;  3ZUV B;  4ZFH A;  4F1P A;  2JAB A;  2F37 A;  5CER B;  2XZT G;  4LNU D;  4GPM A;  4HRM B;  3ZKJ A;  4U8Y D;  5ENT D;  4BES A;  4CYM D;  2ETA A;  3UI2 A;  5ENS D;  2QC9 A;  2QYJ A;  2V5Q C;  3TWQ A;  5CED B;  4HNA D;  1K1B A;  1WDY A;  4HI8 A;  1BU9 A;  3AAA C;  5ENO D;  3TWX A;  1OY3 D;  2VGE A;  4U8V D;  5AQA A;  3SO8 A;  2DZN A;  3EU9 A;  2Y0B G;  3F6Q A;  2KBX A;  2XZD G;  3ZNG A;  2RFA A;  1MYO A;  4DRX E;  3UXG A;  1MX6 A;  4Z68 A;  4K5B A;  3TWR A;  1TR4 A;  1G3N B;  2L6B A;  1N0R A;  3JUE A;  4YDW A;  5AQB A;  1BI7 B;  3B7B A;  2ZGD A;  4HRN A;  2DWZ A;  4U96 D;  4ATZ D;  2V4H C;  4O1O A;  5ENQ D;  2F8X K;  3HRA A;  5FIO A;  4BSZ B;  5KBA A;  5CBO A;  4N5Q A;  5HS0 A;  4DUI A;  5JMN D;  4OAU C;  4F6R D;  2AJA A;  4LG6 A;  3AJI A;  2ETC A;  5ENP D;  1SW6 A;  5HRY A;  1K3Z D;  3LJN A;  5KNG A;  4BET A;  2DZO A;  3TWV A;  3W9F A;  5EYL A;  4GMR A;  3DEP A;  2F8Y A;  2P2C P;  4TUM A;  3T9K A;  5ITZ F;  2ZGG A;  1BI8 B;  4A63 B;  3NBN B;  4G8L A;  4DX2 A;  1MJ0 A;  3UTM A;  1MX2 A;  1YYH A;  3V31 A;  1SVX A;  5D66 A;  4BER A;  5FIN A;  4JB8 P;  5JA4 D;  1UOH A;  2XEN A;  5AQ7 A;  4HLL A;  5KWD A;  4K5C A;  1QYM A;  1NFI E;  3Q9U C;  1S70 B;  3TWW A;  3C5R A;  5BXO A;  1N11 A;  2B0O E;  4C48 B;  1BLX B;  4YDY A;  2NYJ A;  4O60 A;  5AAO A;  2XEH A;  4DX1 A;  5CBN A;  2XEE A;  4OAV B;  2MYO A;  4BEP A;  2ETB A;  4K5A B;  4O1P A;  5ENR D;  3V2X A;  3V79 K;  1IXV A;  5EID A;  1BD8 A;  4NIK A;  5BXU A;  3HG0 D;  1YCS B;  4DX6 D;  5CEA A;  1WG0 A;  3KEA A;  4UUC A;  1A5E A;  5HKP A;  3J5Q B;  3V30 A;  5EYP F;  2A5E A;  3T8K A;  5EIL A;  1D9S A;  1DC2 A;  2HE0 A;  4DX5 D;  1IHB A;  3B95 A;  1MX4 A;  2J8S D;  3JXJ A;  5AAR A;  1YMP A;  5EIB E;  4HI9 A;  2BKK B;  3EHQ A;  4QQI A;  3W9G A;  4J7W A;  1N0Q A;  3J5P A;  3JXI A;  3ZU7 B;  4B93 B;  1K1A A;  1OT8 A;  3NOC D;  3EHR A;  4HB5 A;  3TWU A;  4RLY A;  2RFM A;  1DCQ A;  5EN5 D;  3Q9N C;  4LSZ E;  2PNN A;  1AP7 A;  3V2O A;  3DEO A;  2KXP C;  3NOG D;  2DVW A;  4CZ2 D;  5KNH D;  4HRL A; 
#chains in the Genus database with same CATH topology
 1HU3 A;  1MQS A;  2WXG A;  2BF0 X;  3Q5M A;  2V4L A;  4HOU A;  2OEV A;  3EDT B;  2Y0B G;  2XPZ A;  1TR4 A;  4I9C A;  1BI7 B;  3O4Z A;  5EX0 A;  3U9W A;  5KJM A;  4BWR A;  3AG2 E;  2XCC A;  2DZO A;  2X6H A;  2BUG A;  5CCM A;  3UTM A;  2GRO B;  1N4S A;  1E8Y A;  3KSQ A;  4O6F A;  3LY7 A;  5FJY A;  1HE8 A;  4BX9 A;  2AXU A;  2WXJ A;  3C3R A;  4EZL A;  1N4Q A;  1BPO A;  3CVP A;  3RIB A;  4K5A B;  4GPK A;  4L1B A;  1WG0 A;  4URK A;  4DX5 D;  5EDS A;  3CK7 A;  2A5U A;  3QAQ A;  2WXN A;  3UM1 A;  2GW1 A;  4B93 B;  4LNG A;  2LSU A;  4YND A;  4OVU A;  5EN5 D;  2XS1 A;  5LP0 A;  1SZA A;  4X8Q A;  2X3M A;  2EIJ E;  1TEZ A;  3ABK E;  3D9H A;  3MV2 B;  4ZHB A;  1E96 B;  2EIM E;  3VTY A;  3ZGQ A;  3ZFW A;  5ENT D;  4GYO A;  3CVL A;  4E6H A;  1NA3 A;  2KC7 A;  5HQ8 A;  1JCQ A;  3HDX A;  1FVF A;  4I2Z A;  2RG8 A;  3JQ0 A;  2BED A;  2HR2 A;  3KSL A;  4A1G A;  4I6E A;  4LER A;  3UIP C;  3P1U A;  5B1B E;  4JPS A;  4HRN A;  1H6O A;  4ILH B;  3DRA A;  4I6G A;  1LD8 A;  4AP2 A;  3IBE A;  3AJI A;  4AEZ C;  2VTB B;  2R02 A;  3T5X A;  3PZD A;  2OEW A;  1FT1 A;  2Y69 E;  3CVW A;  4I9E A;  3PRE A;  1QZ2 A;  4A55 A;  3PE4 A;  5KJL A;  3CVN A;  3QKY A;  2RKK A;  3ASF A;  2YQ8 A;  3D9O A;  2ETB A;  4JZY A;  3ONK A;  3S7F A;  4NIK A;  3RSE G;  5G05 C;  4CRW A;  4UUC A;  4KZC A;  2WXF A;  1IHB A;  2WM9 A;  4D10 C;  3ESL A;  3CHM A;  1MHQ A;  2J4D A;  3E32 A;  4LEU A;  3L16 A;  1NP7 A;  1EDU A;  3URZ A;  3FWV A;  3RK6 A;  3TG4 A;  1GW6 A;  2WQ7 A;  4ZFH A;  4ILI A;  4BT9 A;  5CER B;  2EQX A;  2XZT G;  4RG6 A;  4G25 A;  4UQY A;  3CHQ A;  1SQM A;  2DYS E;  4CDM A;  2OCC E;  3DSU A;  4WNE A;  4E85 A;  4JW1 A;  4HI8 A;  1IYG A;  5D0O D;  4U0Z A;  3EU9 A;  2KAT A;  4UWK A;  4CGV A;  3UXG A;  2I1K A;  4YDW A;  4JHJ A;  4L23 A;  5FIO A;  1FCH A;  5CBO A;  2CFU A;  4HOS A;  3SFX A;  3UX4 A;  1O1T A;  2XGO A;  1QBQ A;  3UUX A;  2XPY A;  4L2L A;  3T8M A;  5FQ7 A;  4ACK A;  1MJ0 A;  2OND A;  2DIW A;  4HLE A;  3AS8 A;  3RAU A;  1V54 E;  4NQ0 A;  5AJD A;  2VGX A;  2IEJ A;  2NYJ A;  1JUQ A;  1RZ4 A;  3MGB A;  4UWG A;  1LD7 A;  4Q69 A;  2NXP A;  1TNY A;  5H7P A;  4PDX A;  2ZIS A;  4FUL A;  4J0U A;  3J5Q B;  3V30 A;  4A3V A;  4UWL A;  4PS8 A;  4J8F A;  2QFC A;  5EIB E;  4EQF A;  4HB5 A;  3PNL B;  3TWU A;  4TXP A;  1JCR A;  2F0Y A;  1INZ A;  4K0R A;  2KZT B;  3RJV A;  3UT4 A;  3LDZ A;  4J8Y A;  4CEM A;  3TWT A;  2HM8 A;  2L0T B;  3ZIM A;  4PS7 A;  2V0P A;  2BKG A;  4I1O B;  5KCM A;  3KD7 A;  2LXL A;  4N3C A;  5LOZ A;  3CST A;  2QYJ A;  1H2T C;  3FTY A;  4U8H A;  4RSY A;  3G2S A;  4M7C A;  5BPP A;  3MJW A;  3R9A B;  3TWR A;  1RW2 A;  3B7B A;  3Q73 A;  4U07 A;  1N4R A;  3FUE A;  3UIO C;  4O1O A;  4GTT A;  4H7Y A;  4FC8 A;  4UI9 J;  2GRQ B;  2AJA A;  2XCB A;  4UI9 C;  4G11 A;  2QZA A;  4YDO A;  4I6J A;  2F8Y A;  1UN8 A;  3S7B A;  3NBN B;  4DX2 A;  4GZ5 A;  4APO A;  2GRM A;  3FTW A;  4ABN A;  4W9R A;  2R59 A;  1JWF A;  4B8A A;  4AOF A;  3Q49 B;  4EHM A;  2B0O E;  5B3S E;  2XEH A;  2XEE A;  5AEN A;  3AG3 E;  4O1P A;  1SZ9 A;  3V79 K;  5ARG A;  5BV1 A;  2CG2 A;  3HG0 D;  3SFY A;  2UY1 A;  4XKC A;  5EIL A;  4NRH B;  5G04 J;  4F1S A;  3ISM C;  3UQ3 A;  5BT1 A;  4GTV A;  2E2E A;  3FUD A;  5AIJ A;  5CMY A;  1KZO A;  3I3N A;  3PEU B;  4EZJ A;  3R9M A;  3FUL A;  3CVU A;  3FTU A;  3FUF A;  5KNH D;  2Y1L E;  3I4R B;  3FFL A;  4DX7 D;  3D9N A;  2L9B A;  3APF A;  5FTP A;  4DJA A;  1WY6 A;  2KCV A;  1S0P A;  1PC2 A;  2XQ0 A;  3PNT B;  3TGO A;  1BU9 A;  3ZXP A;  4IRU A;  4U8V D;  4GZD A;  5AQA A;  2IOL A;  3CSF A;  3FU6 A;  1DVP A;  2XZD G;  2RFA A;  1UJK A;  4K5B A;  1L5J A;  3D9M A;  4GYW A;  2ZGD A;  3PEV B;  2VJ8 A;  2C0M A;  4G23 A;  5BNW A;  3CGH A;  3ABL E;  3HRA A;  1OCC E;  1K3Z D;  3L13 A;  1Q2Z A;  5LCW J;  1QNF A;  5FIN A;  3EHN A;  2HYZ A;  3FUN A;  1QYM A;  4B94 A;  1U3C A;  4GA0 A;  1XNF A;  2AXZ A;  5EID A;  3S7D A;  3LYA A;  3RRU A;  5HKP A;  3FDH A;  3UT7 A;  1TN6 A;  1ELW A;  3QDN A;  1VDY A;  4J7W A;  3OTN A;  4LUN U;  4Q94 A;  2X6F A;  5C1D A;  2LAH A;  4PS3 A;  2RFM A;  4KYO B;  3RO3 A;  3JUI A;  1OXJ A;  1AWC B;  4XIF A;  3DPD A;  1ZBP A;  4MS6 A;  4EZK A;  2JAB A;  4XZ4 A;  4IUL A;  1LF8 A;  4N39 A;  4FJY A;  5ENS D;  1Z3Y A;  2CFZ A;  3B13 A;  2ZU6 B;  5J08 A;  4NUR A;  3SD5 A;  3IKO B;  3SGH A;  3F6Q A;  3LS8 A;  4MRU A;  4BTB A;  3IEG A;  3Q79 A;  1NL4 A;  5HS0 A;  5G2N A;  4BFR A;  2OOE A;  1OCZ E;  2H6H A;  4BET A;  5EYL A;  2R5S A;  3DEP A;  3CEQ A;  2VSY A;  1X81 A;  4OVV A;  4G8L A;  1MX2 A;  2PM7 A;  3WXX A;  1U3D A;  4GZ6 A;  4BER A;  1UOH A;  1H2U A;  3ML9 A;  5JJ7 A;  2A4Z A;  3NZU A;  4AVX A;  4C48 B;  1BLX B;  1FPP A;  3U3W A;  3FH8 A;  4G24 A;  3V2X A;  3DBS A;  3CHR A;  5CEA A;  4GA1 A;  3NZS A;  2WXI A;  1DC2 A;  2HE0 A;  2P9P G;  5AYW D;  4RQI A;  2VSN A;  2WVI A;  3BUA A;  3MZL B;  4IN3 B;  5LX8 A;  4I17 A;  1H6P A;  2H6F A;  4MBG A;  1K8K G;  4RLY A;  5BW8 C;  4GML A;  1OCO E;  2M63 A;  2X38 A;  4CT4 A;  4HQD A;  1W3B A;  4ANV A;  4U95 D;  4FHJ A;  1NI1 A;  4Q96 A;  1IQR A;  4ME2 A;  3PS6 A;  1Z3X A;  3PZ3 A;  4ACL A;  2ETA A;  5ENN A;  2YHE A;  5DIZ A;  5FT9 A;  4FA6 A;  3ZYM A;  4B0Z A;  2WXR A;  3FUK A;  3I4G A;  2GRR B;  3FUH A;  3SO8 A;  4DK5 A;  3QWV A;  3L17 A;  1N95 A;  5JHA A;  2PQN A;  3ZEF A;  3L08 A;  2OV8 A;  2DYR E;  4J8E A;  4JC8 A;  4JD2 G;  4ATZ D;  4AY5 A;  5KBA A;  1LTX A;  4F6R D;  5ENP D;  2C0L A;  2WXQ A;  5KNG A;  3OXG A;  4GTS A;  5ITZ F;  3PUJ A;  4GYY A;  1YA0 A;  3L9T A;  5D66 A;  4B8C B;  5AQ7 A;  4FJZ A;  3QK0 A;  3TXN A;  3ZYK A;  3B7R L;  2WMO A;  4UI9 K;  3DWL G;  3QAR A;  2MYO A;  1IXV A;  3SHF A;  4WWP A;  1TNU A;  4XX5 A;  3UT8 A;  1OUV A;  3SFZ A;  2B6C A;  2OVB A;  2VSO E;  4JEU A;  2XEV A;  4CCA A;  3J5P A;  3PE3 A;  1OT8 A;  4GTP A;  3FTZ A;  3QWW A;  3RO2 A;  1DCE A;  3V2O A;  1H6K A;  4CZ2 D;  1SA4 A;  4G26 A;  3G2T A;  3NAW A;  4HRL A;  4GTR A;  3HHM A;  2FO1 E;  4FHK A;  3ULE G;  4F53 A;  3FEY A;  4LNU D;  3SBS A;  4P29 A;  5ARF A;  2P9L G;  3MA5 A;  4N5C A;  3AAA C;  4OYS A;  3CKC A;  4KZ0 A;  2C2L A;  3PH0 C;  3CVX A;  3BU8 A;  5AJL A;  2P9N G;  1IQU A;  5ENQ D;  3L54 A;  3UKU G;  2J08 A;  5D0Q D;  4BY6 A;  4GMR A;  2FUL A;  4TUM A;  1OWL A;  4A63 B;  5JJT A;  3KEZ A;  4GTM A;  3UIN C;  3VTX A;  5IY5 E;  3ASN E;  3OXF A;  2WQ6 A;  3D9J A;  4UQX A;  4Y6W A;  3HVE B;  4CDR A;  2GGF A;  5CBN A;  4FU3 A;  4F3V A;  5FZQ A;  3Q15 A;  2IY0 C;  5ENR D;  5E76 A;  2PZI A;  5E75 A;  4AM9 A;  4I43 A;  3FU5 A;  1SA5 A;  4KMO A;  5BUZ A;  2AVP A;  3EIQ C;  2IFU A;  2ZXW E;  4AY6 A;  5FQ8 A;  3NF1 A;  3ULY A;  1JWG A;  3JXJ A;  1YMP A;  2J4B A;  3BQO A;  3S7J A;  5T4Y A;  3NOC D;  3DSW A;  3ASH A;  2I2O A;  4Y6C A;  5DBK A;  3DEO A;  2FBN A;  3UKR G;  3U66 A;  1A17 A;  2LUH A;  3FH5 A;  5AQ9 A;  1EPU A;  1U2V G;  1IHG A;  3C3O A;  3MYV A;  5CHE E;  4F1P A;  4EPZ A;  4FAD A;  4LRZ A;  2WXO A;  2XPI A;  2OVF A;  1HX8 A;  3ASG A;  3X2Q E;  2V5Q C;  3E30 A;  3S2A A;  4FP7 A;  4U0U A;  2LO6 A;  2WXK A;  4WWN A;  1HS6 A;  1P5Q A;  1E8Z A;  3D9I A;  2DWZ A;  3IHV A;  4U96 D;  3CVV A;  4PH4 B;  5LCW C;  5BV0 A;  3LY9 A;  5JMN D;  3FTX A;  3FY4 A;  1HG5 A;  1ZB1 A;  2HO1 A;  4XI9 A;  4XEI G;  3N71 A;  3UPV A;  1UN9 A;  2P9I G;  3PRZ A;  3CHS A;  4JA7 A;  1XGW A;  4DLO A;  3HXB A;  3APC A;  4O60 A;  2WXP A;  1OWN A;  1TNZ A;  2IJG X;  5LFA A;  3PZ2 A;  2DCP A;  1HF8 A;  3O48 A;  3ASD A;  2Y4T A;  3Q7F A;  4HXI A;  4APF A;  3KEA A;  1PY1 A;  3AS4 A;  3B95 A;  2GRL A;  3ZU7 B;  4MKT A;  3IV0 A;  2LSV A;  3LPZ A;  3ONL A;  1N52 A;  1N54 A;  1E8W A;  3CLJ A;  3ZPJ A;  4L7T A;  5AN8 A;  2I1J A;  5EKQ D;  3CHP A;  4LCT A;  1TJC A;  2VYI A;  1O5M A;  3QC1 A;  4JEH A;  1WM5 A;  3UI2 A;  1X5B A;  3Q4A B;  1EF1 C;  2VGE A;  3NB2 A;  3SF4 A;  3P2B A;  3MKQ B;  2KBX A;  3ZNG A;  3TG5 A;  3FHE A;  4DI3 A;  4Z68 A;  4DPR A;  3LXU X;  2L6B A;  5CRV A;  3CK8 A;  1O1R A;  3VLD A;  1HZ4 A;  4KBQ A;  3DSX A;  4G2V A;  2ETC A;  4PUC A;  5HRY A;  3U64 A;  3LJN A;  2AWI A;  3RRM B;  1BI8 B;  2ZGG A;  3TJP A;  4JB8 P;  1NA0 A;  5JA4 D;  2XEN A;  5KWD A;  2CHX A;  3SBT B;  2FF4 A;  3LEW A;  2I9C A;  3IHY A;  3LVR E;  4CDN A;  2ILR A;  3HIZ A;  3T5V A;  1TN7 A;  3AG1 E;  1Y6I A;  5FQ4 A;  3ZXS A;  3CK9 A;  1A5E A;  3OAW A;  3T8K A;  5ANR A;  5ANL A;  1D9S A;  3PUK A;  3ZHE B;  3G2W A;  4CT0 A;  5AAR A;  1ZU2 A;  3EHQ A;  3TAX A;  3QWP A;  5G55 A;  3QNK A;  3LY8 A;  3Q9N C;  4L9P A;  1TYQ G;  5D2M C;  1KT1 A;  2QYU A;  1IKN D;  5CEC B;  4BTA A;  2V5F A;  3G2U A;  4A3T A;  4GCN A;  4GCO A;  3RKV A;  4BSX A;  2P9K G;  4HNA D;  1OY3 D;  1OWO A;  4WNF A;  3UM0 A;  2YNQ A;  1MYO A;  4DI4 A;  1N0R A;  1ELR A;  4JVS A;  5FWQ A;  4TUU A;  3QJZ A;  4JL0 A;  1KT0 A;  4GU5 A;  2F8X K;  3TL5 A;  4TXR A;  4UWH A;  4LG6 A;  2L6J A;  2IQC A;  2L0I A;  3DPY A;  2IO3 C;  3CQC B;  1OWM A;  3LKU A;  1NFI E;  2R03 A;  3KAE A;  2R17 C;  2J49 A;  4ANW A;  5AAO A;  4DX1 A;  4OAV B;  5JJ6 A;  2J07 A;  4KXK B;  5A6C A;  3Q75 A;  2KM4 A;  1N9A A;  1TNO A;  3D9L A;  2XS8 A;  2J8S D;  3D3M A;  2BKK B;  3W9G A;  3SI5 A;  3D9K A;  3HYM B;  2FO7 A;  3HXF A;  3SQV A;  2XRY A;  3MX3 A;  5JHB A;  1QQE A;  4L2Y A;  3MV3 B;  1E90 A;  2LXM A;  3K9I A;  4R7L A;  3HXE A;  1Z5S C;  3UM3 A;  1K1B A;  1KZP A;  1TNB A;  2DZN A;  3Q47 B;  2IF4 A;  4J6I A;  1MX6 A;  2X6K A;  4U63 A;  4HOT A;  5FQ6 A;  2ION A;  2WPV A;  1HFA A;  1MZC A;  5HI7 A;  4UWF A;  2PM6 A;  2P2C P;  2EIK E;  4YVQ C;  3V31 A;  4ANX A;  4WND A;  4J8D A;  3QB2 A;  1N11 A;  1E7U A;  3PZ4 A;  4I2W A;  3CVQ A;  4WWO A;  3CHO A;  3C72 A;  3BG1 B;  3DSV A;  2GRP B;  5J90 A;  3BEE A;  4GZ3 A;  3FH7 A;  4HI9 A;  3FUM A;  4HVB A;  2XGS A;  2LAI A;  3JXI A;  3R7R A;  2IU1 A;  4AJW A;  1DCQ A;  2KXP C;  2MHK A;  3EIJ A;  3D9P A;  3FU0 A;  2AXV A;  4QFV A;  2FEZ A;  2F37 A;  4YVO A;  1OWP A;  1JCS A;  5A7D B;  3HVE A;  3FTV A;  4ATG A;  3RRN B;  3TWX A;  4U0S A;  2NSZ A;  3U4T A;  1DNP A;  2PL2 A;  1TJF A;  2I6H A;  4C9B B;  2KCL A;  2V4H C;  2MOW A;  4B89 A;  4BSZ B;  4N5Q A;  4OAU C;  3L82 A;  2J09 A;  3LJ3 A;  1V55 E;  3EJN A;  1E7V A;  4EBA G;  4BT8 A;  4U7E B;  3DST A;  3GYZ A;  3ZHE A;  3SY2 A;  3FP3 A;  2WXL A;  2FI7 A;  2NC9 A;  2Y4U A;  4K03 A;  5T3R A;  4I1M A;  3FTS A;  1E8X A;  3FEX A;  4XI0 A;  2R05 A;  1BD8 A;  5BXU A;  2ZIR A;  3HXD A;  3NQP A;  3CKB A;  4F7A A;  5EYP F;  3B7S A;  1D8E A;  2CHW A;  4HFG A;  4MLP A;  2A5E A;  2JLB A;  5G04 C;  3LCA A;  4QQI A;  4G1T A;  3C3Q A;  1K1A A;  3EHR A;  4N2S A;  3ESK A;  5C2Y A;  5T8I A;  2IOS A;  3TWS A;  3ZN3 A;  2X6J A;  3ZUV B;  2E0I A;  4AV7 A;  3AU4 A;  3ZYQ A;  4HRM B;  3GZS A;  4J8S A;  4U8Y D;  3TXM A;  3BG0 B;  4C0M A;  5M72 A;  1WDY A;  4C0E A;  2R2L A;  5KJN A;  2P9U G;  3CIA A;  2CG3 A;  4DRX E;  3MKR A;  1G3N B;  5AQB A;  2VGX B;  3AS5 A;  4AXH A;  4WAF A;  3PDN A;  3ULQ A;  4ANU A;  4KVO A;  2AW6 A;  3AG4 E;  3L22 A;  2WMN A;  1B89 A;  1HO8 A;  3PZ1 A;  2IO2 C;  1NZN A;  4HLL A;  3SZ7 A;  2GRN B;  2WXM A;  3WG7 E;  3JQ1 A;  4UQZ A;  5BXO A;  4FLH A;  4YDE A;  4A1S A;  2YIN A;  5A23 A;  3Q7A A;  1FVH A;  3FU3 A;  3KS2 A;  4U04 A;  2KZT A;  3GZ1 A;  3CV0 A;  4I1A A;  1HH8 A;  1Z6T A;  3MKQ A;  1JPL A;  4N3A A;  1S64 A;  4RVB A;  1ELK A;  3DXM G;  4JHK A;  3R7Q A;  1N0Q A;  4ILG A;  2PNN A;  2DVW A;  3OXL A;  3E4B A;  3C98 A;  4G8K A;  4IYP A;  2XRZ A;  4V3I A;  2EIN E;  5EX3 A;  4BES A;  3CR3 A;  5CCL A;  3UM2 A;  2QC9 A;  4JHR A;  4BX8 A;  3MCX A;  5CED B;  4NAC A;  2X6I A;  2VQ2 A;  4GMJ A;  5FZR A;  4N3B A;  3B7U X;  4TRQ A;  4N2Q A;  4JA9 A;  3JUE A;  5FZS A;  1H2V C;  3CQG B;  2VSX E;  5CMW A;  4XE0 A;  2VGY A;  3CVY A;  3APD A;  3GW4 A;  4M3O A;  4TXQ A;  1SW6 A;  2H6G A;  1KPS B;  4GZC A;  3ML8 A;  1H19 A;  3T9K A;  2EIL E;  3FUI A;  1SVX A;  3I5P A;  3Q9U C;  3TWW A;  1WAO 1;  1PAQ A;  3C5R A;  4DLQ A;  4FLB A;  2WXH A;  4YDY A;  1KLX A;  3L6A A;  1UW4 B;  4GA2 A;  2LNI A;  3ZW3 A;  2VTB A;  4RG9 A;  3HXC A;  4KVM A;  1YCS B;  3G2V A;  3Q78 A;  1D8D A;  3EHM A;  1N4P A;  4GTQ A;  1MX4 A;  3B7T A;  1S63 A;  3RU0 A;  5G05 J;  3JCK C;  2QY7 A;  1OCR E;  2CHZ A;  3ZVV A;  4LSZ E;  3E37 A;  1UG3 A;  3JYS A;  3SNX A;  4GAA A;  3ZRH A;  1HG2 A;  4HBD A;  3EUV A;  3IXE A;  2V8S E;  4WNG A;  4GPM A;  3ZKJ A;  4HS2 A;  4CYM D;  1O1S A;  3TWQ A;  4AIF A;  3VLE A;  5ENO D;  1HXI A;  4KT6 B;  1H0A A;  2P58 C;  2UY1 B;  3LVQ E;  3E34 A;  2KCK A;  4HOQ A;  3EU5 A;  2YHC A;  5CRU A;  1UJJ A;  3ENE A;  1TN8 A;  4GTO A;  4DUI A;  3ZYL A;  4LNB A;  3TWV A;  3W9F A;  2XHE A;  2H6I A;  2P9S G;  1Y8M A;  2WQH A;  1YYH A;  1N94 A;  4GB9 A;  2BTD A;  1FT2 A;  4TV3 A;  4K5C A;  4EEC A;  3FUJ A;  1S70 B;  4JXT A;  3ABM E;  3E33 A;  3PVL A;  3QOU A;  4BEP A;  2JEK A;  4CGW A;  4WUY A;  2Y3A A;  4DX6 D;  2RD0 A;  2XGM A;  3AU5 A;  4H7X A;  3UMV A;  3GZ2 A;  2Q7F A;  4HOR A;  3DSS A;  2UWJ G;  4EBA A;  2DBA A;  5KJK A;  1EYH A;  3ASO E;  4XKB A;  3DXK G;  2PQR A;  2J9Q A;  2MRI A;  3MEK A;  3VLF A;  1AP7 A;  3NOG D;  2WB2 A;  5B1A E; 
#chains in the Genus database with same CATH homology
 5AN8 A;  4J8Y A;  4HQD A;  1AWC B;  2FO1 E;  2Y1L E;  4G8K A;  4U95 D;  3TWS A;  3TWT A;  4DX7 D;  4HBD A;  3IXE A;  1IKN D;  3D9H A;  5AQ9 A;  5CEC B;  4ZHB A;  2BKG A;  4QFV A;  3ZUV B;  4ZFH A;  4F1P A;  2JAB A;  2F37 A;  5CER B;  2XZT G;  4LNU D;  4GPM A;  4HRM B;  3ZKJ A;  4U8Y D;  5ENT D;  4BES A;  4CYM D;  2ETA A;  3UI2 A;  5ENS D;  2QC9 A;  2QYJ A;  2V5Q C;  3TWQ A;  5CED B;  4HNA D;  1K1B A;  1WDY A;  4HI8 A;  1BU9 A;  3AAA C;  5ENO D;  3TWX A;  1OY3 D;  2VGE A;  4U8V D;  5AQA A;  3SO8 A;  2DZN A;  3EU9 A;  2Y0B G;  3F6Q A;  2KBX A;  2XZD G;  3ZNG A;  2RFA A;  1MYO A;  4DRX E;  3UXG A;  1MX6 A;  4Z68 A;  4K5B A;  3TWR A;  1TR4 A;  1G3N B;  2L6B A;  1N0R A;  3JUE A;  4YDW A;  5AQB A;  1BI7 B;  3B7B A;  2ZGD A;  4HRN A;  2DWZ A;  4U96 D;  4ATZ D;  2V4H C;  4O1O A;  5ENQ D;  2F8X K;  3HRA A;  5FIO A;  4BSZ B;  5KBA A;  5CBO A;  4N5Q A;  5HS0 A;  4DUI A;  5JMN D;  4OAU C;  4F6R D;  2AJA A;  4LG6 A;  3AJI A;  2ETC A;  5ENP D;  1SW6 A;  5HRY A;  1K3Z D;  3LJN A;  5KNG A;  4BET A;  2DZO A;  3TWV A;  3W9F A;  5EYL A;  4GMR A;  3DEP A;  2F8Y A;  2P2C P;  4TUM A;  3T9K A;  5ITZ F;  2ZGG A;  1BI8 B;  4A63 B;  3NBN B;  4G8L A;  4DX2 A;  1MJ0 A;  3UTM A;  1MX2 A;  1YYH A;  3V31 A;  1SVX A;  5D66 A;  4BER A;  5FIN A;  4JB8 P;  5JA4 D;  1UOH A;  2XEN A;  5AQ7 A;  4HLL A;  5KWD A;  4K5C A;  1QYM A;  1NFI E;  3Q9U C;  1S70 B;  3TWW A;  3C5R A;  5BXO A;  1N11 A;  2B0O E;  4C48 B;  1BLX B;  4YDY A;  2NYJ A;  4O60 A;  5AAO A;  2XEH A;  4DX1 A;  5CBN A;  2XEE A;  4OAV B;  2MYO A;  4BEP A;  2ETB A;  4K5A B;  4O1P A;  5ENR D;  3V2X A;  3V79 K;  1IXV A;  5EID A;  1BD8 A;  4NIK A;  5BXU A;  3HG0 D;  1YCS B;  4DX6 D;  5CEA A;  1WG0 A;  3KEA A;  4UUC A;  1A5E A;  5HKP A;  3J5Q B;  3V30 A;  5EYP F;  2A5E A;  3T8K A;  5EIL A;  1D9S A;  1DC2 A;  2HE0 A;  4DX5 D;  1IHB A;  3B95 A;  1MX4 A;  2J8S D;  3JXJ A;  5AAR A;  1YMP A;  5EIB E;  4HI9 A;  2BKK B;  3EHQ A;  4QQI A;  3W9G A;  4J7W A;  1N0Q A;  3J5P A;  3JXI A;  3ZU7 B;  4B93 B;  1K1A A;  1OT8 A;  3NOC D;  3EHR A;  4HB5 A;  3TWU A;  4RLY A;  2RFM A;  1DCQ A;  5EN5 D;  3Q9N C;  4LSZ E;  2PNN A;  1AP7 A;  3V2O A;  3DEO A;  2KXP C;  3NOG D;  2DVW A;  4CZ2 D;  5KNH D;  4HRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...