4JB8P

Caspase-7 in complex with darpin c7_16
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
b'DLGKKLLDAASAGQDDEVRILMANGADVNASNQQGWTPLHATAEYGHLEIVDVLLAYGADVNASDSYGSTPLHSAAWAGHLEIVDVLLAHGADVNASDNYGWTPLHLAAHTGHLEIVDVLLANGADVNANNWWGKTPFDLAIDNGNEDIAEVLQKAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Caspase-7 subunit p20
publication title Design, construction, and characterization of a second-generation DARPin library with reduced hydrophobicity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/de novo protein
total genus 54
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2013-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4jb8P00
4U95D 4O1OA 3TWUA 5EILA 3NBNB 4HI8A 4ATZD 4HBDA 5CEDB 4BERA 1MJ0A 4F6RD 2PNNA 2MYOA 4N5QA 5AARA 3TWQA 5KNGA 3TWRA 5KWDA 4A63B 5ENQD 5ENSD 4BETA 1NFIE 1WG0A 2F37A 3AAAC 2XEEA 1IKND 5CEAA 4BEPA 5CBOA 2QYJA 2DZNA 4DX1A 3TWVA 2XZTG 4QFVA 3Q9NC 1DC2A 4K5CA 3D9HA 3W9GA 1BU9A 3IXEA 3EHQA 4GPMA 2JABA 2HE0A 5CBNA 3TWWA 4B93B 2FO1E 4DRXE 2RFAA 5FINA 3UXGA 1G3NB 2ZGGA 3JUEA 4HB5A 4ZFHA 2BKGA 5ENTD 5KBAA 4HRNA 2KBXA 5AQ9A 4DX7D 2XENA 1AWCB 4HRLA 3AJIA 4TUMA 3V2XA 2AJAA 2ETAA 3HRAA 1N0QA 2NYJA 2Y1LE 1MX4A 3C5RA 4GMRA 4UUCA 4JB8P 4HNAD 4Z68A 1BI8B 1SW6A 5EN5D 2ETBA 3T9KA 3EU9A 3UTMA 4ZHBA 1AP7A 1UOHA 4J7WA 1D9SA 3B95A 4NIKA 3B7BA 2F8XK 4DX5D 3J5QB 2B0OE 4DUIA 3DEOA 3T8KA 5EIDA 3DEPA 5EYLA 4HQDA 5JMND 3ZU7B 4K5AB 4YDWA 5JA4D 1MX2A 5AQ7A 5HRYA 2DZOA 2XEHA 1MX6A 5HKPA 1YMPA 4OAUC 2A5EA 2XZDG 3V30A 1IXVA 1K1BA 3NOGD 5ENOD 2F8YA 3SO8A 1DCQA 3TWTA 5ITZF 4RLYA 3ZNGA 4HI9A 1WDYA 1IHBA 4G8LA 4C48B 5BXOA 3V79K 1TR4A 3ZUVB 2BKKB 3F6QA 1QYMA 4O60A 4BESA 5EYPF 2RFMA 5FIOA 3Q9UC 5AAOA 1OT8A 1S70B 2ZGDA 3HG0D 4G8KA 5ENRD 4LNUD 3TWSA 3V2OA 5BXUA 3JXJA 4DX6D 2P2CP 3V31A 5CERB 4BSZB 4HLLA 1BD8A 4LG6A 3J5PA 5AN8A 1N11A 3JXIA 1BLXB 5KNHD 2QC9A 5D66A 5CECB 3EHRA 4YDYA 4U8YD 2L6BA 1BI7B 4QQIA 3NOCD 1K3ZD 3KEAA 5ENPD 3W9FA 2DVWA 4DX2A 5AQAA 2V4HC 4LSZE 2DWZA 1MYOA 4CZ2D 1YYHA 4J8YA 1N0RA 2J8SD 3TWXA 1A5EA 4K5BA 4O1PA 3UI2A 4OAVB 3ZKJA 4F1PA 5HS0A 4U8VD 1OY3D 2KXPC 3LJNA 1YCSB 2Y0BG 5AQBA 2V5QC 5EIBE 2ETCA 1K1AA 4CYMD 4U96D 1SVXA 4HRMB 2VGEA
chains in the Genus database with same CATH superfamily
5E75A 1KLXA 3S7BA 3LEWA 3SFZA 5G05C 4BETA 2P9NG 3ZHEB 1TNBA 4EBAG 4J8SA 3DSTA 4FU3A 4U8HA 3UM2A 2WVIA 2QFCA 4WWNA 3JUEA 5KCMA 1N54A 5ENTD 4AIFA 3CK8A 4RVBA 3SI5A 3HRAA 1N0QA 3C5RA 3VLFA 2GGFA 4I6JA 2KZTA 3QAQA 2CHZA 1HH8A 3X2QE 4PS8A 2OOEA 1Z5SC 4J7WA 1KT0A 5LFAA 1D9SA 3SZ7A 2H6GA 3B95A 4V3IA 2F8XK 2CHXA 4LEUA 5B1AE 2HM8A 2CFZA 3QJZA 4B94A 2GRMA 1X81A 2YQ8A 2AXVA 4A3VA 3SO8A 2AW6A 4KZCA 4BFRA 3DXMG 3TXMA 3L17A 4NACA 4G8KA 3VLDA 3TWSA 5CCMA 2LUHA 1HF8A 3LYAA 3NOCD 1ZU2A 3SY2A 3ULYA 4AVXA 3MKQA 3IKOB 2J8SD 3CK9A 2EIJE 4PS3A 4FHKA 4OVVA 2P9LG 3PH0C 4N5QA 4A63B 5ENQD 1KZOA 5B3SE 3MKRA 4HOQA 3ESLA 3R9AB 2JABA 1HG5A 4IYPA 3FH7A 1E7VA 3IEGA 3FTYA 3PZ2A 5BNWA 3V2XA 3S7JA 4UUCA 5CECB 1MX4A 1SW6A 3KAEA 3UTMA 2IO2C 3EIJA 1LD8A 1MHQA 1UN8A 4EZLA 3FUFA 3J5QB 4EECA 3AS5A 5EYLA 3AG2E 5HRYA 4U0ZA 3SD5A 3NOGD 3PE3A 4JD2G 5LP0A 4NQ0A 2WQHA 2VQ2A 2R05A 2CHWA 3PNLB 3ESKA 3MYVA 4J8FA 4AEZC 1FT2A 3G2VA 3QWWA 4MLPA 3LY7A 3L16A 3U3WA 1JCQA 1UG3A 3JXIA 1U3DA 1QZ2A 3WXXA 3Q7AA 4DI4A 1KT1A 2KATA 3RJVA 2KCKA 5EKQD 4RSYA 3VLEA 4F1PA 4MRUA 3RRUA 4CYMD 3KEZA 2OEWA 3L08A 4LNGA 5KNGA 2F37A 4HFGA 5CBOA 4F3VA 1DC2A 4P29A 4GPMA 3CHQA 1MQSA 3FWVA 4GYWA 2OVBA 4BY6A 5BV1A 2DCPA 3Q49B 4N2QA 1HE8A 1UOHA 4DX5D 3ZU7B 4ACLA 4FJZA 5CRUA 2R17C 5ENOD 4LRZA 3CHOA 3NF1A 3I5PA 1OWOA 3O4ZA 3R7RA 2R2LA 1D8EA 3R9MA 4ANVA 3PDNA 3CVLA 4GTRA 5G05J 3TXNA 5CRVA 1UJKA 3APFA 1OT8A 1S70B 4DJAA 3JXJA 5CERB 4RQIA 4LG6A 4GMJA 3QWPA 5AN8A 4I2WA 5A6CA 5ARGA 4Q94A 2L6BA 1BI7B 1PC2A 3CEQA 1ELRA 4EBAA 4U8VD 2R02A 4KYOB 4U96D 5AIJA 4O1OA 4J0UA 3CHSA 3TWQA 4I9CA 2IOLA 2GRPB 3MA5A 2PL2A 3DSUA 3D9NA 4H7YA 2H6FA 1BU9A 3D9HA 3FY4A 2ZISA 2RFAA 3ASNE 4D10C 1SA4A 3LVRE 3HXFA 3UQ3A 2XS1A 2XPZA 2BEDA 3HXEA 4A1SA 2F0YA 2M63A 3JQ0A 4I6EA 3MEKA 3ASHA 3B7BA 5EIDA 3DEPA 2V5FA 2H6HA 2FO7A 2DZOA 4Q96A 2GW1A 4I1AA 4YDOA 3FU3A 4AJWA 4FLHA 3CKBA 3CV0A 1WDYA 5BPPA 3LY8A 2XPYA 3ONLA 4ATGA 1U3CA 3TJPA 3Q9UC 2WXHA 3QNKA 4GCOA 4G2VA 4HLLA 4KBQA 2WXOA 1N11A 1TYQG 3IV0A 1TN6A 4HOTA 4UQYA 5AQAA 2IEJA 3FHEA 1N94A 2Y0BG 5AQBA 1N4RA 3PZ3A 2WQ7A 3DBSA 2E0IA 3Q47B 3PZDA 5G04J 3SBTB 1FVHA 4GZCA 5CMYA 2EIME 3G2UA 1WG0A 4FA6A 2WXNA 1N95A 4BEPA 3QWVA 4JC8A 4DX1A 4DI3A 2DYSE 4BX8A 3W9GA 3HYMB 3LPZA 2LSVA 1G3NB 5FTPA 4BT8A 2ZXWE 5ARFA 3E33A 5ENNA 4FADA 2Y1LE 1A5EA 5EX3A 5T4YA 4CDNA 3Q73A 1TJFA 2JLBA 4J8DA 2LO6A 1HX8A 4UWKA 4NURA 2BF0X 5JMND 4U63A 4KXKB 3HXCA 2P9SG 1O1RA 4BSXA 3EHMA 4O60A 4B8AA 3ZIMA 2WXLA 2C0LA 3ULEG 3DSXA 4APOA 2WM9A 2A5UA 3S7FA 1TJCA 2X6KA 4GAAA 1K3ZD 3TGOA 4WNGA 2LSUA 4GCNA 3AG1E 1P5QA 1MYOA 1HS6A 4PS7A 3FU0A 3NZSA 1K1AA 2VYIA 1N9AA 4DLOA 3EUVA 4PH4B 3FULA 3PVLA 3FTUA 1O5MA 4UWGA 3U4TA 3PRZA 4UQZA 4CT0A 3TWWA 4I1OB 3CVYA 2J4BA 5C1DA 3BG0B 3QC1A 4ZFHA 5KJMA 3CVPA 4HRNA 4KVMA 5D0OD 3G2TA 3HIZA 1OCOE 4CCAA 5AJLA 2PQRA 3L6AA 3O48A 4CGWA 3FUDA 3TAXA 3EIQC 3T8KA 3GZ1A 4GU5A 3UT8A 3RKVA 3MV2B 1V54E 2VJ8A 5BT1A 3FU5A 1E8XA 3LS8A 2V0PA 3T5VA 3TWTA 4CRWA 3CVNA 4GZ5A 1TR4A 2CG2A 3BG1B 3KS2A 4YNDA 2RFMA 4R7LA 5JJ7A 1QNFA 1IQRA 3V2OA 5BXUA 4DX6D 1Q2ZA 4LNBA 4YDYA 2FULA 3UKRG 3KEAA 3DPDA 1D8DA 2I6HA 3RO3A 3W9FA 3IHYA 2MOWA 2DWZA 3EDTB 4CZ2D 2ONDA 1YYHA 1N0RA 1Z3XA 3BU8A 2I2OA 5CCLA 1Z6TA 5CEDB 4YDEA 3TWRA 4JHKA 3WG7E 2V4LA 3AS4A 4GZDA 3ASDA 2P9UG 4GTMA 2UWJG 5FQ8A 5FZSA 3CR3A 2WMOA 3QKYA 1WM5A 3Q75A 4KT6B 3ZYLA 3APCA 3ZRHA 5CBNA 5JHBA 2FO1E 3UIPC 4RG6A 4JHJA 3ASOE 4ILHB 2LAHA 4JB8P 3RIBA 3UIOC 2ETBA 1MZCA 4GTVA 4N5CA 2IU1A 4YDWA 3URZA 3FUKA 1YMPA 3S7DA 1DCQA 2VTBB 3LKUA 3DXKG 4U0UA 1SZAA 3ZUVB 2IQCA 5HI7A 3FUJA 3PEUB 3UX4A 5G04C 4AP2A 4FULA 5J08A 4JEHA 1Y8MA 3J5PA 5KNHD 2AXUA 2XCBA 3PZ1A 2V4HC 2WQ6A 2WPVA 2X6IA 1E90A 2QY7A 1UJJA 2Y4UA 5ANRA 2GRQB 2CG3A 2UY1B 4H7XA 2DYRE 1OWNA 5AARA 5ENSD 4JEUA 5CEAA 2FEZA 4EPZA 3TWVA 5FZRA 1INZA 3CQGB 2ZU6B 4GTPA 2J09A 3PUKA 4XI0A 3ZFWA 4G11A 4CT4A 3HVEB 2VGXA 3OTNA 4I9EA 1NZNA 2PQNA 2P9PG 1AP7A 4J8EA 3PE4A 3PZ4A 4EHMA 4TV3A 2DBAA 3JUIA 5LOZA 2WXRA 4GZ3A 5KJNA 3ONKA 1ELKA 3FU6A 3G2SA 3OXGA 5HKPA 3NAWA 2LAIA 4CEMA 3R7QA 3Q4AB 3GZSA 3ZHEA 4EZJA 1OWLA 1PY1A 2L9BA 1LTXA 3C3OA 4GYYA 5B1BE 4ILIA 3JYSA 3D9KA 4CDMA 3B7UX 4L2YA 3RU0A 3P1UA 3ML8A 2IF4A 3UM1A 4LSZE 3EU5A 3FUNA 3CQCB 3DRAA 1IHGA 4O1PA 4G23A 2X3MA 2C2LA 3C3QA 3CKCA 3CHPA 2VGEA 5FWQA 2OV8A 2QYJA 4QFVA 4ANXA 4TXPA 2WXIA 5IY5E 2MHKA 4L7TA 4XI9A 5KBAA 1JWGA 4HRLA 3NQPA 2NYJA 4JA7A 1Z3YA 4Z68A 2XCCA 3Q78A 3B7TA 3L54A 5A23A 4GA1A 2B0OE 3HHMA 3CSFA 5FQ7A 3UM3A 2F8YA 4UI9C 3ZNGA 5LCWC 4NRHB 2BKKB 3F6QA 3TL5A 3FEXA 4JHRA 4CDRA 2GRRB 1ZB1A 2IY0C 1FT1A 1H2TC 4XEIG 3APDA 4ABNA 4LNUD 3RRMB 4BTBA 4E6HA 2BUGA 2WXPA 3CHMA 1NL4A 1BLXB 2WXMA 3RO2A 1HZ4A 3HXDA 4U8YD 4BX9A 2RD0A 2MRIA 4DX2A 2KZTB 1OUVA 1XNFA 4PUCA 5H7PA 4OAVB 2WXKA 4UWHA 4C0MA 3B7SA 5EIBE 4A3TA 1H2UA 3UKUG 3TWUA 4N2SA 4WNDA 4J6IA 3SQVA 4ACKA 3GYZA 1X5BA 3T8MA 2FBNA 1L5JA 1U2VG 1H2VC 4GTSA 2PM7A 3UMVA 3IHVA 3CVQA 3UXGA 3U66A 3SFYA 4JXTA 1FPPA 3UT7A 3OXFA 1AWCB 3MX3A 2EQXA 3ZYKA 2ETAA 3CLJA 3MKQB 4N39A 2VSXE 3CGHA 2IOSA 3LY9A 4HORA 4HOSA 3PUJA 3BEEA 3FTXA 1N52A 4DPRA 1HFAA 5JA4D 4WWPA 4UWLA 3SGHA 2XZDG 1K1BA 4FJYA 3C72A 2H6IA 3TG4A 4JA9A 1TNOA 4HI9A 2HYZA 4C48B 3V79K 2VSYA 4XIFA 4A55A 5EYPF 3ABLE 3ZEFA 3ASGA 2ZGDA 1DVPA 5ENRD 3P2BA 2XS8A 3FP3A 2R59A 3D9LA 1OWMA 5T8IA 1JUQA 2QC9A 4EQFA 2LXLA 4M3OA 4B0ZA 3FFLA 3ENEA 3L22A 4Y6WA 2L6JA 3L82A 1EPUA 2CFUA 1QQEA 2VSOE 1SVXA 3SF4A 1MJ0A 4BTAA 1EYHA 1OXJA 3D9OA 1TN7A 2RKKA 4GA0A 4G1TA 3D9IA 4L2LA 2JEKA 2HE0A 1E96B 1HG2A 4I1MA 4HLEA 3LXUX 4IN3B 1QBQA 3C98A 2XGSA 2E2EA 4GMRA 1BI8B 1S0PA 3AU5A 4ZHBA 3NB2A 4L1BA 4WNEA 1KPSB 2X6HA 4DUIA 4AY6A 3JQ1A 2FI7A 1H0AA 3MV3B 3DSSA 2NXPA 3FUEA 1MX6A 4KZ0A 3LCAA 2Y4TA 4APFA 4WUYA 3AU4A 3CVXA 4ANWA 2P9IG 3RRNB 3OXLA 4BESA 5FIOA 2B6CA 2KM4A 5AAOA 3AG4E 4MS6A 4RG9A 2AWIA 3UINC 1SA5A 2L0TB 3QARA 3RAUA 1WAO1 1O1TA 5D66A 5DBKA 3U9WA 4IRUA 3FUHA 3L9TA 3Q15A 3KD7A 3FTSA 3TWXA 4KVOA 3I3NA 2I1KA 2FF4A 2A4ZA 3S2AA 4AXHA 4HRMB 1W3BA 4YVOA 5EILA 4BWRA 2EIKE 4F6RD 2PM6A 4LUNU 3OAWA 5AYWD 5C2YA 4XKBA 3Q9NC 4K5CA 4UI9J 5LCWJ 3G2WA 2ZGGA 5BUZA 4JZYA 2BKGA 5AQ9A 5BV0A 4DX7D 4HVBA 5FJYA 5J90A 1ELWA 4TUUA 4HNAD 4TRQA 3UM0A 3B7RL 4MBGA 3QB2A 3K9IA 1JCSA 4XKCA 1FCHA 1A17A 4IULA 3EJNA 1LD7A 5G55A 5CMWA 2IONA 2RG8A 2AVPA 2P9KG 2QZAA 5EX0A 5ITZF 4KMOA 3ISMC 5BW8C 4G25A 1SQMA 4N3AA 4XX5A 1DNPA 3ULQA 5E76A 1TNZA 5FQ6A 3CVVA 4AM9A 3V31A 4ILGA 3UT4A 3L13A 4L9PA 3EHRA 3HDXA 4I6GA 1E7UA 1TN8A 3BUAA 4CGVA 4Y6CA 1H6KA 4GMLA 3ZXPA 1OY3D 4AOFA 1H19A 3RK6A 3NBNB 4MKTA 4HBDA 2XGOA 4JL0A 3ZYMA 2MYOA 2OVFA 2V8SE 4YVQC 4GB9A 4FC8A 2XEEA 2J08A 3JCKC 2DZNA 2WXQA 4K03A 4DLQA 3D9PA 4GPKA 4AV7A 2OEVA 3Q7FA 3I4RB 3DWLG 1E8WA 2AJAA 1TNYA 3NZUA 3MGBA 3E37A 3EU9A 3CSTA 4O6FA 2WB2A 4GTTA 4I43A 2YINA 2XHEA 4C0EA 2LXMA 1SZ9A 3RSEG 3ABME 4HQDA 2J07A 2AXZA 4Q69A 3E30A 4JW1A 1MX2A 2XEHA 2A5EA 1K8KG 3ZVVA 2J9QA 2WXJA 4X8QA 2OCCE 4M7CA 3HXBA 4G8LA 2Q7FA 1TNUA 2L0IA 2IFUA 5T3RA 4WAFA 3QOUA 4URKA 3HG0D 3Q79A 4BSZB 4OVUA 3U64A 3PNTB 3UUXA 2WMNA 4UWFA 4LCTA 3AS8A 1NI1A 3BQOA 2WXFA 3LDZA 1RW2A 2PZIA 3UI2A 5HS0A 2XEVA 2XRYA 2EINE 4U95D 3ZN3A 5KJLA 4ATZD 1EF1C 3ZGQA 4BERA 2J49A 1YA0A 1E8YA 4XZ4A 2YHEA 3AAAC 4I2ZA 1EDUA 4N3BA 3IBEA 5JJTA 1VDYA 2KCLA 4G26A 2P58C 4LERA 4B93B 2BTDA 3GZ2A 3FTZA 3AJIA 3FUMA 4UQXA 4WWOA 3ASFA 3FTWA 4HXIA 1E8ZA 4PDXA 3CHRA 4F1SA 3DEOA 3ZXSA 1OCZE 1B89A 3SHFA 4K5AB 2GROB 4GYOA 2R03A 4TXRA 3MJWA 1IXVA 5ANLA 2XGMA 2LNIA 4RLYA 5BXOA 3D9MA 1JWFA 1QYMA 3T5XA 3EHNA 2EILE 4WNFA 2ILRA 4U7EB 4HS2A 5M72A 2I9CA 1HO8A 1S64A 2P2CP 2XQ0A 1BD8A 3PEVB 1LF8A 3I4GA 4QQIA 2GRNB 4OYSA 3CIAA 2YHCA 4HOUA 4B89A 3QK0A 3FH8A 1OCCE 3TG5A 3DPYA 2KXPC 3LJNA 4F53A 2ETCA 3FUIA 3SBSA 4JPSA 5AENA 3D3MA 4HI8A 2VGYA 4BT9A 1UN9A 1H6PA 5KWDA 1JCRA 3KSLA 4XE0A 2VTBA 1IKND 4UI9K 2XZTG 1FVFA 3QDNA 3SNXA 3ABKE 1PAQA 5FINA 1TEZA 2X6FA 1IYGA 3B13A 2XENA 1O1SA 4TUMA 4GA2A 4K0RA 5CHEE 1N4PA 3MCXA 3T9KA 2HR2A 1Y6IA 3GW4A 4FHJA 2HO1A 3PS6A 4NIKA 5DIZA 3FH5A 1WY6A 2UY1A 2IJGX 2QYUA 2YNQA 5AQ7A 3AG3E 4OAUC 3V30A 2C0MA 1V55E 4A1GA 2R5SA 2Y69E 1HXIA 2WXGA 1XGWA 2XRZA 1H6OA 3ZW3A 1N4QA 5FZQA 5FQ4A 5ENPD 3HVEA 1RZ4A 2DVWA 2KCVA 1UW4B 2NSZA 1GW6A 4K5BA 5JJ6A 3ZKJA 4G24A 4AY5A 2X38A 3CVWA 2X6JA 2GRLA 4GTQA 3KSQA 2PNNA 3DSVA 3MZLB 1NFIE 3C3RA 4JVSA 4W9RA 5JHAA 1DCEA 3DSWA 3IXEA 1ZBPA 3EHQA 5EDSA 3CVUA 4DRXE 3D9JA 5KJKA 3LJ3A 4HB5A 5FT9A 1S63A 4TXQA 4B8CB 2KBXA 3LVQE 3FTVA 1NA0A 3ML9A 5EN5D 4EZKA 3UPVA 1IQUA 5LX8A 4ME2A 3N71A 4DK5A 1OCRE 1KZPA 2KC7A 3ZYQA 2ZIRA 4L23A 4F7AA 1BPOA 3E4BA 4GTOA 1HU3A 4E85A 3VTXA 2Y3AA 3FEYA 1NA3A 1IHBA 4GZ6A 2J4DA 5D2MC 3ZPJA 2I1JA 5AJDA 4FP7A 3CK7A 5G2NA 3E32A 3FDHA 2NC9A 4U0SA 1N4SA 3VTYA 4U04A 4ANUA 2VGXB 5HQ8A 4U07A 2VSNA 1JPLA 5A7DB 2IO3C 4I17A 4N3CA 4FLBA 2DIWA 3PREA 3E34A 1NP7A 4J8YA 3SFXA 1OWPA 5D0QD 1YCSB 4C9BB 2V5QC 2XPIA 3Q5MA
chains in the Genus database with same CATH topology
4U95D 4O1OA 3TWUA 5EILA 3NBNB 4HI8A 4ATZD 4HBDA 5CEDB 4BERA 1MJ0A 4F6RD 2PNNA 2MYOA 4N5QA 5AARA 3TWQA 5KNGA 3TWRA 5KWDA 4A63B 5ENQD 5ENSD 4BETA 1NFIE 1WG0A 2F37A 3AAAC 2XEEA 1IKND 5CEAA 4BEPA 5CBOA 2QYJA 2DZNA 4DX1A 3TWVA 2XZTG 4QFVA 3Q9NC 1DC2A 4K5CA 3D9HA 3W9GA 1BU9A 3IXEA 3EHQA 4GPMA 2JABA 2HE0A 5CBNA 3TWWA 4B93B 2FO1E 4DRXE 2RFAA 5FINA 3UXGA 1G3NB 2ZGGA 3JUEA 4HB5A 4ZFHA 2BKGA 5ENTD 5KBAA 4HRNA 2KBXA 5AQ9A 4DX7D 2XENA 1AWCB 4HRLA 3AJIA 4TUMA 3V2XA 2AJAA 2ETAA 3HRAA 1N0QA 2NYJA 2Y1LE 1MX4A 3C5RA 4GMRA 4UUCA 4JB8P 4HNAD 4Z68A 1BI8B 1SW6A 5EN5D 2ETBA 3T9KA 3EU9A 3UTMA 4ZHBA 1AP7A 1UOHA 4J7WA 1D9SA 3B95A 4NIKA 3B7BA 2F8XK 4DX5D 3J5QB 2B0OE 4DUIA 3DEOA 3T8KA 5EIDA 3DEPA 5EYLA 4HQDA 5JMND 3ZU7B 4K5AB 4YDWA 5JA4D 1MX2A 5AQ7A 5HRYA 2DZOA 2XEHA 1MX6A 5HKPA 1YMPA 4OAUC 2A5EA 2XZDG 3V30A 1IXVA 1K1BA 3NOGD 5ENOD 2F8YA 3SO8A 1DCQA 3TWTA 5ITZF 4RLYA 3ZNGA 4HI9A 1WDYA 1IHBA 4G8LA 4C48B 5BXOA 3V79K 1TR4A 3ZUVB 2BKKB 3F6QA 1QYMA 4O60A 4BESA 5EYPF 2RFMA 5FIOA 3Q9UC 5AAOA 1OT8A 1S70B 2ZGDA 3HG0D 4G8KA 5ENRD 4LNUD 3TWSA 3V2OA 5BXUA 3JXJA 4DX6D 2P2CP 3V31A 5CERB 4BSZB 4HLLA 1BD8A 4LG6A 3J5PA 5AN8A 1N11A 3JXIA 1BLXB 5KNHD 2QC9A 5D66A 5CECB 3EHRA 4YDYA 4U8YD 2L6BA 1BI7B 4QQIA 3NOCD 1K3ZD 3KEAA 5ENPD 3W9FA 2DVWA 4DX2A 5AQAA 2V4HC 4LSZE 2DWZA 1MYOA 4CZ2D 1YYHA 4J8YA 1N0RA 2J8SD 3TWXA 1A5EA 4K5BA 4O1PA 3UI2A 4OAVB 3ZKJA 4F1PA 5HS0A 4U8VD 1OY3D 2KXPC 3LJNA 1YCSB 2Y0BG 5AQBA 2V5QC 5EIBE 2ETCA 1K1AA 4CYMD 4U96D 1SVXA 4HRMB 2VGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U95 D;  4O1O A;  3TWU A;  5EIL A;  3NBN B;  4HI8 A;  4ATZ D;  4HBD A;  5CED B;  4BER A;  1MJ0 A;  4F6R D;  2PNN A;  2MYO A;  4N5Q A;  5AAR A;  3TWQ A;  5KNG A;  3TWR A;  5KWD A;  4A63 B;  5ENQ D;  5ENS D;  4BET A;  1NFI E;  1WG0 A;  2F37 A;  3AAA C;  2XEE A;  1IKN D;  5CEA A;  4BEP A;  5CBO A;  2QYJ A;  2DZN A;  4DX1 A;  3TWV A;  2XZT G;  4QFV A;  3Q9N C;  1DC2 A;  4K5C A;  3D9H A;  3W9G A;  1BU9 A;  3IXE A;  3EHQ A;  4GPM A;  2JAB A;  2HE0 A;  5CBN A;  3TWW A;  4B93 B;  2FO1 E;  4DRX E;  2RFA A;  5FIN A;  3UXG A;  1G3N B;  2ZGG A;  3JUE A;  4HB5 A;  4ZFH A;  2BKG A;  5ENT D;  5KBA A;  4HRN A;  2KBX A;  5AQ9 A;  4DX7 D;  2XEN A;  1AWC B;  4HRL A;  3AJI A;  4TUM A;  3V2X A;  2AJA A;  2ETA A;  3HRA A;  1N0Q A;  2NYJ A;  2Y1L E;  1MX4 A;  3C5R A;  4GMR A;  4UUC A;  4JB8 P;  4HNA D;  4Z68 A;  1BI8 B;  1SW6 A;  5EN5 D;  2ETB A;  3T9K A;  3EU9 A;  3UTM A;  4ZHB A;  1AP7 A;  1UOH A;  4J7W A;  1D9S A;  3B95 A;  4NIK A;  3B7B A;  2F8X K;  4DX5 D;  3J5Q B;  2B0O E;  4DUI A;  3DEO A;  3T8K A;  5EID A;  3DEP A;  5EYL A;  4HQD A;  5JMN D;  3ZU7 B;  4K5A B;  4YDW A;  5JA4 D;  1MX2 A;  5AQ7 A;  5HRY A;  2DZO A;  2XEH A;  1MX6 A;  5HKP A;  1YMP A;  4OAU C;  2A5E A;  2XZD G;  3V30 A;  1IXV A;  1K1B A;  3NOG D;  5ENO D;  2F8Y A;  3SO8 A;  1DCQ A;  3TWT A;  5ITZ F;  4RLY A;  3ZNG A;  4HI9 A;  1WDY A;  1IHB A;  4G8L A;  4C48 B;  5BXO A;  3V79 K;  1TR4 A;  3ZUV B;  2BKK B;  3F6Q A;  1QYM A;  4O60 A;  4BES A;  5EYP F;  2RFM A;  5FIO A;  3Q9U C;  5AAO A;  1OT8 A;  1S70 B;  2ZGD A;  3HG0 D;  4G8K A;  5ENR D;  4LNU D;  3TWS A;  3V2O A;  5BXU A;  3JXJ A;  4DX6 D;  2P2C P;  3V31 A;  5CER B;  4BSZ B;  4HLL A;  1BD8 A;  4LG6 A;  3J5P A;  5AN8 A;  1N11 A;  3JXI A;  1BLX B;  5KNH D;  2QC9 A;  5D66 A;  5CEC B;  3EHR A;  4YDY A;  4U8Y D;  2L6B A;  1BI7 B;  4QQI A;  3NOC D;  1K3Z D;  3KEA A;  5ENP D;  3W9F A;  2DVW A;  4DX2 A;  5AQA A;  2V4H C;  4LSZ E;  2DWZ A;  1MYO A;  4CZ2 D;  1YYH A;  4J8Y A;  1N0R A;  2J8S D;  3TWX A;  1A5E A;  4K5B A;  4O1P A;  3UI2 A;  4OAV B;  3ZKJ A;  4F1P A;  5HS0 A;  4U8V D;  1OY3 D;  2KXP C;  3LJN A;  1YCS B;  2Y0B G;  5AQB A;  2V5Q C;  5EIB E;  2ETC A;  1K1A A;  4CYM D;  4U96 D;  1SVX A;  4HRM B;  2VGE A; 
#chains in the Genus database with same CATH topology
 5E75 A;  1KLX A;  3S7B A;  3LEW A;  3SFZ A;  5G05 C;  4BET A;  2P9N G;  3ZHE B;  1TNB A;  4EBA G;  4J8S A;  3DST A;  4FU3 A;  4U8H A;  3UM2 A;  2WVI A;  2QFC A;  4WWN A;  3JUE A;  5KCM A;  1N54 A;  5ENT D;  4AIF A;  3CK8 A;  4RVB A;  3SI5 A;  3HRA A;  1N0Q A;  3C5R A;  3VLF A;  2GGF A;  4I6J A;  2KZT A;  3QAQ A;  2CHZ A;  1HH8 A;  3X2Q E;  4PS8 A;  2OOE A;  1Z5S C;  4J7W A;  1KT0 A;  5LFA A;  1D9S A;  3SZ7 A;  2H6G A;  3B95 A;  4V3I A;  2F8X K;  2CHX A;  4LEU A;  5B1A E;  2HM8 A;  2CFZ A;  3QJZ A;  4B94 A;  2GRM A;  1X81 A;  2YQ8 A;  2AXV A;  4A3V A;  3SO8 A;  2AW6 A;  4KZC A;  4BFR A;  3DXM G;  3TXM A;  3L17 A;  4NAC A;  4G8K A;  3VLD A;  3TWS A;  5CCM A;  2LUH A;  1HF8 A;  3LYA A;  3NOC D;  1ZU2 A;  3SY2 A;  3ULY A;  4AVX A;  3MKQ A;  3IKO B;  2J8S D;  3CK9 A;  2EIJ E;  4PS3 A;  4FHK A;  4OVV A;  2P9L G;  3PH0 C;  4N5Q A;  4A63 B;  5ENQ D;  1KZO A;  5B3S E;  3MKR A;  4HOQ A;  3ESL A;  3R9A B;  2JAB A;  1HG5 A;  4IYP A;  3FH7 A;  1E7V A;  3IEG A;  3FTY A;  3PZ2 A;  5BNW A;  3V2X A;  3S7J A;  4UUC A;  5CEC B;  1MX4 A;  1SW6 A;  3KAE A;  3UTM A;  2IO2 C;  3EIJ A;  1LD8 A;  1MHQ A;  1UN8 A;  4EZL A;  3FUF A;  3J5Q B;  4EEC A;  3AS5 A;  5EYL A;  3AG2 E;  5HRY A;  4U0Z A;  3SD5 A;  3NOG D;  3PE3 A;  4JD2 G;  5LP0 A;  4NQ0 A;  2WQH A;  2VQ2 A;  2R05 A;  2CHW A;  3PNL B;  3ESK A;  3MYV A;  4J8F A;  4AEZ C;  1FT2 A;  3G2V A;  3QWW A;  4MLP A;  3LY7 A;  3L16 A;  3U3W A;  1JCQ A;  1UG3 A;  3JXI A;  1U3D A;  1QZ2 A;  3WXX A;  3Q7A A;  4DI4 A;  1KT1 A;  2KAT A;  3RJV A;  2KCK A;  5EKQ D;  4RSY A;  3VLE A;  4F1P A;  4MRU A;  3RRU A;  4CYM D;  3KEZ A;  2OEW A;  3L08 A;  4LNG A;  5KNG A;  2F37 A;  4HFG A;  5CBO A;  4F3V A;  1DC2 A;  4P29 A;  4GPM A;  3CHQ A;  1MQS A;  3FWV A;  4GYW A;  2OVB A;  4BY6 A;  5BV1 A;  2DCP A;  3Q49 B;  4N2Q A;  1HE8 A;  1UOH A;  4DX5 D;  3ZU7 B;  4ACL A;  4FJZ A;  5CRU A;  2R17 C;  5ENO D;  4LRZ A;  3CHO A;  3NF1 A;  3I5P A;  1OWO A;  3O4Z A;  3R7R A;  2R2L A;  1D8E A;  3R9M A;  4ANV A;  3PDN A;  3CVL A;  4GTR A;  5G05 J;  3TXN A;  5CRV A;  1UJK A;  3APF A;  1OT8 A;  1S70 B;  4DJA A;  3JXJ A;  5CER B;  4RQI A;  4LG6 A;  4GMJ A;  3QWP A;  5AN8 A;  4I2W A;  5A6C A;  5ARG A;  4Q94 A;  2L6B A;  1BI7 B;  1PC2 A;  3CEQ A;  1ELR A;  4EBA A;  4U8V D;  2R02 A;  4KYO B;  4U96 D;  5AIJ A;  4O1O A;  4J0U A;  3CHS A;  3TWQ A;  4I9C A;  2IOL A;  2GRP B;  3MA5 A;  2PL2 A;  3DSU A;  3D9N A;  4H7Y A;  2H6F A;  1BU9 A;  3D9H A;  3FY4 A;  2ZIS A;  2RFA A;  3ASN E;  4D10 C;  1SA4 A;  3LVR E;  3HXF A;  3UQ3 A;  2XS1 A;  2XPZ A;  2BED A;  3HXE A;  4A1S A;  2F0Y A;  2M63 A;  3JQ0 A;  4I6E A;  3MEK A;  3ASH A;  3B7B A;  5EID A;  3DEP A;  2V5F A;  2H6H A;  2FO7 A;  2DZO A;  4Q96 A;  2GW1 A;  4I1A A;  4YDO A;  3FU3 A;  4AJW A;  4FLH A;  3CKB A;  3CV0 A;  1WDY A;  5BPP A;  3LY8 A;  2XPY A;  3ONL A;  4ATG A;  1U3C A;  3TJP A;  3Q9U C;  2WXH A;  3QNK A;  4GCO A;  4G2V A;  4HLL A;  4KBQ A;  2WXO A;  1N11 A;  1TYQ G;  3IV0 A;  1TN6 A;  4HOT A;  4UQY A;  5AQA A;  2IEJ A;  3FHE A;  1N94 A;  2Y0B G;  5AQB A;  1N4R A;  3PZ3 A;  2WQ7 A;  3DBS A;  2E0I A;  3Q47 B;  3PZD A;  5G04 J;  3SBT B;  1FVH A;  4GZC A;  5CMY A;  2EIM E;  3G2U A;  1WG0 A;  4FA6 A;  2WXN A;  1N95 A;  4BEP A;  3QWV A;  4JC8 A;  4DX1 A;  4DI3 A;  2DYS E;  4BX8 A;  3W9G A;  3HYM B;  3LPZ A;  2LSV A;  1G3N B;  5FTP A;  4BT8 A;  2ZXW E;  5ARF A;  3E33 A;  5ENN A;  4FAD A;  2Y1L E;  1A5E A;  5EX3 A;  5T4Y A;  4CDN A;  3Q73 A;  1TJF A;  2JLB A;  4J8D A;  2LO6 A;  1HX8 A;  4UWK A;  4NUR A;  2BF0 X;  5JMN D;  4U63 A;  4KXK B;  3HXC A;  2P9S G;  1O1R A;  4BSX A;  3EHM A;  4O60 A;  4B8A A;  3ZIM A;  2WXL A;  2C0L A;  3ULE G;  3DSX A;  4APO A;  2WM9 A;  2A5U A;  3S7F A;  1TJC A;  2X6K A;  4GAA A;  1K3Z D;  3TGO A;  4WNG A;  2LSU A;  4GCN A;  3AG1 E;  1P5Q A;  1MYO A;  1HS6 A;  4PS7 A;  3FU0 A;  3NZS A;  1K1A A;  2VYI A;  1N9A A;  4DLO A;  3EUV A;  4PH4 B;  3FUL A;  3PVL A;  3FTU A;  1O5M A;  4UWG A;  3U4T A;  3PRZ A;  4UQZ A;  4CT0 A;  3TWW A;  4I1O B;  3CVY A;  2J4B A;  5C1D A;  3BG0 B;  3QC1 A;  4ZFH A;  5KJM A;  3CVP A;  4HRN A;  4KVM A;  5D0O D;  3G2T A;  3HIZ A;  1OCO E;  4CCA A;  5AJL A;  2PQR A;  3L6A A;  3O48 A;  4CGW A;  3FUD A;  3TAX A;  3EIQ C;  3T8K A;  3GZ1 A;  4GU5 A;  3UT8 A;  3RKV A;  3MV2 B;  1V54 E;  2VJ8 A;  5BT1 A;  3FU5 A;  1E8X A;  3LS8 A;  2V0P A;  3T5V A;  3TWT A;  4CRW A;  3CVN A;  4GZ5 A;  1TR4 A;  2CG2 A;  3BG1 B;  3KS2 A;  4YND A;  2RFM A;  4R7L A;  5JJ7 A;  1QNF A;  1IQR A;  3V2O A;  5BXU A;  4DX6 D;  1Q2Z A;  4LNB A;  4YDY A;  2FUL A;  3UKR G;  3KEA A;  3DPD A;  1D8D A;  2I6H A;  3RO3 A;  3W9F A;  3IHY A;  2MOW A;  2DWZ A;  3EDT B;  4CZ2 D;  2OND A;  1YYH A;  1N0R A;  1Z3X A;  3BU8 A;  2I2O A;  5CCL A;  1Z6T A;  5CED B;  4YDE A;  3TWR A;  4JHK A;  3WG7 E;  2V4L A;  3AS4 A;  4GZD A;  3ASD A;  2P9U G;  4GTM A;  2UWJ G;  5FQ8 A;  5FZS A;  3CR3 A;  2WMO A;  3QKY A;  1WM5 A;  3Q75 A;  4KT6 B;  3ZYL A;  3APC A;  3ZRH A;  5CBN A;  5JHB A;  2FO1 E;  3UIP C;  4RG6 A;  4JHJ A;  3ASO E;  4ILH B;  2LAH A;  4JB8 P;  3RIB A;  3UIO C;  2ETB A;  1MZC A;  4GTV A;  4N5C A;  2IU1 A;  4YDW A;  3URZ A;  3FUK A;  1YMP A;  3S7D A;  1DCQ A;  2VTB B;  3LKU A;  3DXK G;  4U0U A;  1SZA A;  3ZUV B;  2IQC A;  5HI7 A;  3FUJ A;  3PEU B;  3UX4 A;  5G04 C;  4AP2 A;  4FUL A;  5J08 A;  4JEH A;  1Y8M A;  3J5P A;  5KNH D;  2AXU A;  2XCB A;  3PZ1 A;  2V4H C;  2WQ6 A;  2WPV A;  2X6I A;  1E90 A;  2QY7 A;  1UJJ A;  2Y4U A;  5ANR A;  2GRQ B;  2CG3 A;  2UY1 B;  4H7X A;  2DYR E;  1OWN A;  5AAR A;  5ENS D;  4JEU A;  5CEA A;  2FEZ A;  4EPZ A;  3TWV A;  5FZR A;  1INZ A;  3CQG B;  2ZU6 B;  4GTP A;  2J09 A;  3PUK A;  4XI0 A;  3ZFW A;  4G11 A;  4CT4 A;  3HVE B;  2VGX A;  3OTN A;  4I9E A;  1NZN A;  2PQN A;  2P9P G;  1AP7 A;  4J8E A;  3PE4 A;  3PZ4 A;  4EHM A;  4TV3 A;  2DBA A;  3JUI A;  5LOZ A;  2WXR A;  4GZ3 A;  5KJN A;  3ONK A;  1ELK A;  3FU6 A;  3G2S A;  3OXG A;  5HKP A;  3NAW A;  2LAI A;  4CEM A;  3R7Q A;  3Q4A B;  3GZS A;  3ZHE A;  4EZJ A;  1OWL A;  1PY1 A;  2L9B A;  1LTX A;  3C3O A;  4GYY A;  5B1B E;  4ILI A;  3JYS A;  3D9K A;  4CDM A;  3B7U X;  4L2Y A;  3RU0 A;  3P1U A;  3ML8 A;  2IF4 A;  3UM1 A;  4LSZ E;  3EU5 A;  3FUN A;  3CQC B;  3DRA A;  1IHG A;  4O1P A;  4G23 A;  2X3M A;  2C2L A;  3C3Q A;  3CKC A;  3CHP A;  2VGE A;  5FWQ A;  2OV8 A;  2QYJ A;  4QFV A;  4ANX A;  4TXP A;  2WXI A;  5IY5 E;  2MHK A;  4L7T A;  4XI9 A;  5KBA A;  1JWG A;  4HRL A;  3NQP A;  2NYJ A;  4JA7 A;  1Z3Y A;  4Z68 A;  2XCC A;  3Q78 A;  3B7T A;  3L54 A;  5A23 A;  4GA1 A;  2B0O E;  3HHM A;  3CSF A;  5FQ7 A;  3UM3 A;  2F8Y A;  4UI9 C;  3ZNG A;  5LCW C;  4NRH B;  2BKK B;  3F6Q A;  3TL5 A;  3FEX A;  4JHR A;  4CDR A;  2GRR B;  1ZB1 A;  2IY0 C;  1FT1 A;  1H2T C;  4XEI G;  3APD A;  4ABN A;  4LNU D;  3RRM B;  4BTB A;  4E6H A;  2BUG A;  2WXP A;  3CHM A;  1NL4 A;  1BLX B;  2WXM A;  3RO2 A;  1HZ4 A;  3HXD A;  4U8Y D;  4BX9 A;  2RD0 A;  2MRI A;  4DX2 A;  2KZT B;  1OUV A;  1XNF A;  4PUC A;  5H7P A;  4OAV B;  2WXK A;  4UWH A;  4C0M A;  3B7S A;  5EIB E;  4A3T A;  1H2U A;  3UKU G;  3TWU A;  4N2S A;  4WND A;  4J6I A;  3SQV A;  4ACK A;  3GYZ A;  1X5B A;  3T8M A;  2FBN A;  1L5J A;  1U2V G;  1H2V C;  4GTS A;  2PM7 A;  3UMV A;  3IHV A;  3CVQ A;  3UXG A;  3U66 A;  3SFY A;  4JXT A;  1FPP A;  3UT7 A;  3OXF A;  1AWC B;  3MX3 A;  2EQX A;  3ZYK A;  2ETA A;  3CLJ A;  3MKQ B;  4N39 A;  2VSX E;  3CGH A;  2IOS A;  3LY9 A;  4HOR A;  4HOS A;  3PUJ A;  3BEE A;  3FTX A;  1N52 A;  4DPR A;  1HFA A;  5JA4 D;  4WWP A;  4UWL A;  3SGH A;  2XZD G;  1K1B A;  4FJY A;  3C72 A;  2H6I A;  3TG4 A;  4JA9 A;  1TNO A;  4HI9 A;  2HYZ A;  4C48 B;  3V79 K;  2VSY A;  4XIF A;  4A55 A;  5EYP F;  3ABL E;  3ZEF A;  3ASG A;  2ZGD A;  1DVP A;  5ENR D;  3P2B A;  2XS8 A;  3FP3 A;  2R59 A;  3D9L A;  1OWM A;  5T8I A;  1JUQ A;  2QC9 A;  4EQF A;  2LXL A;  4M3O A;  4B0Z A;  3FFL A;  3ENE A;  3L22 A;  4Y6W A;  2L6J A;  3L82 A;  1EPU A;  2CFU A;  1QQE A;  2VSO E;  1SVX A;  3SF4 A;  1MJ0 A;  4BTA A;  1EYH A;  1OXJ A;  3D9O A;  1TN7 A;  2RKK A;  4GA0 A;  4G1T A;  3D9I A;  4L2L A;  2JEK A;  2HE0 A;  1E96 B;  1HG2 A;  4I1M A;  4HLE A;  3LXU X;  4IN3 B;  1QBQ A;  3C98 A;  2XGS A;  2E2E A;  4GMR A;  1BI8 B;  1S0P A;  3AU5 A;  4ZHB A;  3NB2 A;  4L1B A;  4WNE A;  1KPS B;  2X6H A;  4DUI A;  4AY6 A;  3JQ1 A;  2FI7 A;  1H0A A;  3MV3 B;  3DSS A;  2NXP A;  3FUE A;  1MX6 A;  4KZ0 A;  3LCA A;  2Y4T A;  4APF A;  4WUY A;  3AU4 A;  3CVX A;  4ANW A;  2P9I G;  3RRN B;  3OXL A;  4BES A;  5FIO A;  2B6C A;  2KM4 A;  5AAO A;  3AG4 E;  4MS6 A;  4RG9 A;  2AWI A;  3UIN C;  1SA5 A;  2L0T B;  3QAR A;  3RAU A;  1WAO 1;  1O1T A;  5D66 A;  5DBK A;  3U9W A;  4IRU A;  3FUH A;  3L9T A;  3Q15 A;  3KD7 A;  3FTS A;  3TWX A;  4KVO A;  3I3N A;  2I1K A;  2FF4 A;  2A4Z A;  3S2A A;  4AXH A;  4HRM B;  1W3B A;  4YVO A;  5EIL A;  4BWR A;  2EIK E;  4F6R D;  2PM6 A;  4LUN U;  3OAW A;  5AYW D;  5C2Y A;  4XKB A;  3Q9N C;  4K5C A;  4UI9 J;  5LCW J;  3G2W A;  2ZGG A;  5BUZ A;  4JZY A;  2BKG A;  5AQ9 A;  5BV0 A;  4DX7 D;  4HVB A;  5FJY A;  5J90 A;  1ELW A;  4TUU A;  4HNA D;  4TRQ A;  3UM0 A;  3B7R L;  4MBG A;  3QB2 A;  3K9I A;  1JCS A;  4XKC A;  1FCH A;  1A17 A;  4IUL A;  3EJN A;  1LD7 A;  5G55 A;  5CMW A;  2ION A;  2RG8 A;  2AVP A;  2P9K G;  2QZA A;  5EX0 A;  5ITZ F;  4KMO A;  3ISM C;  5BW8 C;  4G25 A;  1SQM A;  4N3A A;  4XX5 A;  1DNP A;  3ULQ A;  5E76 A;  1TNZ A;  5FQ6 A;  3CVV A;  4AM9 A;  3V31 A;  4ILG A;  3UT4 A;  3L13 A;  4L9P A;  3EHR A;  3HDX A;  4I6G A;  1E7U A;  1TN8 A;  3BUA A;  4CGV A;  4Y6C A;  1H6K A;  4GML A;  3ZXP A;  1OY3 D;  4AOF A;  1H19 A;  3RK6 A;  3NBN B;  4MKT A;  4HBD A;  2XGO A;  4JL0 A;  3ZYM A;  2MYO A;  2OVF A;  2V8S E;  4YVQ C;  4GB9 A;  4FC8 A;  2XEE A;  2J08 A;  3JCK C;  2DZN A;  2WXQ A;  4K03 A;  4DLQ A;  3D9P A;  4GPK A;  4AV7 A;  2OEV A;  3Q7F A;  3I4R B;  3DWL G;  1E8W A;  2AJA A;  1TNY A;  3NZU A;  3MGB A;  3E37 A;  3EU9 A;  3CST A;  4O6F A;  2WB2 A;  4GTT A;  4I43 A;  2YIN A;  2XHE A;  4C0E A;  2LXM A;  1SZ9 A;  3RSE G;  3ABM E;  4HQD A;  2J07 A;  2AXZ A;  4Q69 A;  3E30 A;  4JW1 A;  1MX2 A;  2XEH A;  2A5E A;  1K8K G;  3ZVV A;  2J9Q A;  2WXJ A;  4X8Q A;  2OCC E;  4M7C A;  3HXB A;  4G8L A;  2Q7F A;  1TNU A;  2L0I A;  2IFU A;  5T3R A;  4WAF A;  3QOU A;  4URK A;  3HG0 D;  3Q79 A;  4BSZ B;  4OVU A;  3U64 A;  3PNT B;  3UUX A;  2WMN A;  4UWF A;  4LCT A;  3AS8 A;  1NI1 A;  3BQO A;  2WXF A;  3LDZ A;  1RW2 A;  2PZI A;  3UI2 A;  5HS0 A;  2XEV A;  2XRY A;  2EIN E;  4U95 D;  3ZN3 A;  5KJL A;  4ATZ D;  1EF1 C;  3ZGQ A;  4BER A;  2J49 A;  1YA0 A;  1E8Y A;  4XZ4 A;  2YHE A;  3AAA C;  4I2Z A;  1EDU A;  4N3B A;  3IBE A;  5JJT A;  1VDY A;  2KCL A;  4G26 A;  2P58 C;  4LER A;  4B93 B;  2BTD A;  3GZ2 A;  3FTZ A;  3AJI A;  3FUM A;  4UQX A;  4WWO A;  3ASF A;  3FTW A;  4HXI A;  1E8Z A;  4PDX A;  3CHR A;  4F1S A;  3DEO A;  3ZXS A;  1OCZ E;  1B89 A;  3SHF A;  4K5A B;  2GRO B;  4GYO A;  2R03 A;  4TXR A;  3MJW A;  1IXV A;  5ANL A;  2XGM A;  2LNI A;  4RLY A;  5BXO A;  3D9M A;  1JWF A;  1QYM A;  3T5X A;  3EHN A;  2EIL E;  4WNF A;  2ILR A;  4U7E B;  4HS2 A;  5M72 A;  2I9C A;  1HO8 A;  1S64 A;  2P2C P;  2XQ0 A;  1BD8 A;  3PEV B;  1LF8 A;  3I4G A;  4QQI A;  2GRN B;  4OYS A;  3CIA A;  2YHC A;  4HOU A;  4B89 A;  3QK0 A;  3FH8 A;  1OCC E;  3TG5 A;  3DPY A;  2KXP C;  3LJN A;  4F53 A;  2ETC A;  3FUI A;  3SBS A;  4JPS A;  5AEN A;  3D3M A;  4HI8 A;  2VGY A;  4BT9 A;  1UN9 A;  1H6P A;  5KWD A;  1JCR A;  3KSL A;  4XE0 A;  2VTB A;  1IKN D;  4UI9 K;  2XZT G;  1FVF A;  3QDN A;  3SNX A;  3ABK E;  1PAQ A;  5FIN A;  1TEZ A;  2X6F A;  1IYG A;  3B13 A;  2XEN A;  1O1S A;  4TUM A;  4GA2 A;  4K0R A;  5CHE E;  1N4P A;  3MCX A;  3T9K A;  2HR2 A;  1Y6I A;  3GW4 A;  4FHJ A;  2HO1 A;  3PS6 A;  4NIK A;  5DIZ A;  3FH5 A;  1WY6 A;  2UY1 A;  2IJG X;  2QYU A;  2YNQ A;  5AQ7 A;  3AG3 E;  4OAU C;  3V30 A;  2C0M A;  1V55 E;  4A1G A;  2R5S A;  2Y69 E;  1HXI A;  2WXG A;  1XGW A;  2XRZ A;  1H6O A;  3ZW3 A;  1N4Q A;  5FZQ A;  5FQ4 A;  5ENP D;  3HVE A;  1RZ4 A;  2DVW A;  2KCV A;  1UW4 B;  2NSZ A;  1GW6 A;  4K5B A;  5JJ6 A;  3ZKJ A;  4G24 A;  4AY5 A;  2X38 A;  3CVW A;  2X6J A;  2GRL A;  4GTQ A;  3KSQ A;  2PNN A;  3DSV A;  3MZL B;  1NFI E;  3C3R A;  4JVS A;  4W9R A;  5JHA A;  1DCE A;  3DSW A;  3IXE A;  1ZBP A;  3EHQ A;  5EDS A;  3CVU A;  4DRX E;  3D9J A;  5KJK A;  3LJ3 A;  4HB5 A;  5FT9 A;  1S63 A;  4TXQ A;  4B8C B;  2KBX A;  3LVQ E;  3FTV A;  1NA0 A;  3ML9 A;  5EN5 D;  4EZK A;  3UPV A;  1IQU A;  5LX8 A;  4ME2 A;  3N71 A;  4DK5 A;  1OCR E;  1KZP A;  2KC7 A;  3ZYQ A;  2ZIR A;  4L23 A;  4F7A A;  1BPO A;  3E4B A;  4GTO A;  1HU3 A;  4E85 A;  3VTX A;  2Y3A A;  3FEY A;  1NA3 A;  1IHB A;  4GZ6 A;  2J4D A;  5D2M C;  3ZPJ A;  2I1J A;  5AJD A;  4FP7 A;  3CK7 A;  5G2N A;  3E32 A;  3FDH A;  2NC9 A;  4U0S A;  1N4S A;  3VTY A;  4U04 A;  4ANU A;  2VGX B;  5HQ8 A;  4U07 A;  2VSN A;  1JPL A;  5A7D B;  2IO3 C;  4I17 A;  4N3C A;  4FLB A;  2DIW A;  3PRE A;  3E34 A;  1NP7 A;  4J8Y A;  3SFX A;  1OWP A;  5D0Q D;  1YCS B;  4C9B B;  2V5Q C;  2XPI A;  3Q5M A; 
#chains in the Genus database with same CATH homology
 4U95 D;  4O1O A;  3TWU A;  5EIL A;  3NBN B;  4HI8 A;  4ATZ D;  4HBD A;  5CED B;  4BER A;  1MJ0 A;  4F6R D;  2PNN A;  2MYO A;  4N5Q A;  5AAR A;  3TWQ A;  5KNG A;  3TWR A;  5KWD A;  4A63 B;  5ENQ D;  5ENS D;  4BET A;  1NFI E;  1WG0 A;  2F37 A;  3AAA C;  2XEE A;  1IKN D;  5CEA A;  4BEP A;  5CBO A;  2QYJ A;  2DZN A;  4DX1 A;  3TWV A;  2XZT G;  4QFV A;  3Q9N C;  1DC2 A;  4K5C A;  3D9H A;  3W9G A;  1BU9 A;  3IXE A;  3EHQ A;  4GPM A;  2JAB A;  2HE0 A;  5CBN A;  3TWW A;  4B93 B;  2FO1 E;  4DRX E;  2RFA A;  5FIN A;  3UXG A;  1G3N B;  2ZGG A;  3JUE A;  4HB5 A;  4ZFH A;  2BKG A;  5ENT D;  5KBA A;  4HRN A;  2KBX A;  5AQ9 A;  4DX7 D;  2XEN A;  1AWC B;  4HRL A;  3AJI A;  4TUM A;  3V2X A;  2AJA A;  2ETA A;  3HRA A;  1N0Q A;  2NYJ A;  2Y1L E;  1MX4 A;  3C5R A;  4GMR A;  4UUC A;  4JB8 P;  4HNA D;  4Z68 A;  1BI8 B;  1SW6 A;  5EN5 D;  2ETB A;  3T9K A;  3EU9 A;  3UTM A;  4ZHB A;  1AP7 A;  1UOH A;  4J7W A;  1D9S A;  3B95 A;  4NIK A;  3B7B A;  2F8X K;  4DX5 D;  3J5Q B;  2B0O E;  4DUI A;  3DEO A;  3T8K A;  5EID A;  3DEP A;  5EYL A;  4HQD A;  5JMN D;  3ZU7 B;  4K5A B;  4YDW A;  5JA4 D;  1MX2 A;  5AQ7 A;  5HRY A;  2DZO A;  2XEH A;  1MX6 A;  5HKP A;  1YMP A;  4OAU C;  2A5E A;  2XZD G;  3V30 A;  1IXV A;  1K1B A;  3NOG D;  5ENO D;  2F8Y A;  3SO8 A;  1DCQ A;  3TWT A;  5ITZ F;  4RLY A;  3ZNG A;  4HI9 A;  1WDY A;  1IHB A;  4G8L A;  4C48 B;  5BXO A;  3V79 K;  1TR4 A;  3ZUV B;  2BKK B;  3F6Q A;  1QYM A;  4O60 A;  4BES A;  5EYP F;  2RFM A;  5FIO A;  3Q9U C;  5AAO A;  1OT8 A;  1S70 B;  2ZGD A;  3HG0 D;  4G8K A;  5ENR D;  4LNU D;  3TWS A;  3V2O A;  5BXU A;  3JXJ A;  4DX6 D;  2P2C P;  3V31 A;  5CER B;  4BSZ B;  4HLL A;  1BD8 A;  4LG6 A;  3J5P A;  5AN8 A;  1N11 A;  3JXI A;  1BLX B;  5KNH D;  2QC9 A;  5D66 A;  5CEC B;  3EHR A;  4YDY A;  4U8Y D;  2L6B A;  1BI7 B;  4QQI A;  3NOC D;  1K3Z D;  3KEA A;  5ENP D;  3W9F A;  2DVW A;  4DX2 A;  5AQA A;  2V4H C;  4LSZ E;  2DWZ A;  1MYO A;  4CZ2 D;  1YYH A;  4J8Y A;  1N0R A;  2J8S D;  3TWX A;  1A5E A;  4K5B A;  4O1P A;  3UI2 A;  4OAV B;  3ZKJ A;  4F1P A;  5HS0 A;  4U8V D;  1OY3 D;  2KXP C;  3LJN A;  1YCS B;  2Y0B G;  5AQB A;  2V5Q C;  5EIB E;  2ETC A;  1K1A A;  4CYM D;  4U96 D;  1SVX A;  4HRM B;  2VGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...