4HLLA

Crystal structure of artificial ankyrin repeat protein_ank(gag)1d4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
154
Chain Sequence
DLGKKLLEAARAGQDDEVRLLLEHGADVNARDSIGSTPLHLAAYYGHLEIVRLLLEHGADVNARDSTGTTPLHYAARLGHLEIVRLLLEHGADVNARDAMGWTPLHLAAKKGHLEIVRLLLKHGADVNANDHFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ankyrin(GAG)1D4
publication title Identification of Gag bioactive determinants specific to designed ankyrin and interfering in HIV-1 assembly
rcsb
source organism Escherichia coli
total genus 55
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hllA00
2DZOA 4HBDA 5FIOA 2QYJA 4C48B 3UTMA 4G8KA 1OT8A 4NIKA 5CEAA 5EN5D 4BERA 1WDYA 5AQ9A 2B0OE 1YYHA 2DVWA 5ENRD 5EIBE 4N5QA 4OAUC 5AAOA 1TR4A 3TWVA 3B7BA 4YDYA 3NOGD 1MX4A 3ZUVB 4A63B 5ENTD 2XEEA 3T9KA 4BESA 3IXEA 5KWDA 2BKKB 4HI9A 5ITZF 4Z68A 1A5EA 1DCQA 4U96D 3V2OA 4J7WA 5FINA 1SVXA 2L6BA 1OY3D 4DX2A 2Y0BG 1AWCB 2ZGGA 1D9SA 4J8YA 4U8VD 5EIDA 3TWRA 2F8XK 3HG0D 5AARA 2XZDG 4GMRA 1IHBA 1MYOA 3LJNA 1MJ0A 4TUMA 5JMND 1MX2A 5JA4D 5KNGA 2XZTG 4QQIA 3V31A 4ZFHA 4HLLA 1IKND 3NBNB 3JXJA 5CBNA 4HRNA 1YCSB 4G8LA 4QFVA 2HE0A 2F37A 2PNNA 1N11A 1SW6A 4HI8A 1BI7B 5HRYA 4HRLA 2P2CP 4F1PA 5HS0A 4RLYA 3HRAA 4BETA 1YMPA 3Q9NC 2VGEA 4K5CA 3T8KA 1QYMA 3V79K 4HQDA 5ENOD 4CYMD 3W9FA 3EHQA 1S70B 2KBXA 5D66A 2Y1LE 3ZU7B 2KXPC 3EHRA 1NFIE 3NOCD 4O1PA 5ENSD 5KNHD 5CECB 3UI2A 3DEOA 4OAVB 4O60A 1WG0A 2ETAA 4DRXE 5EYLA 4B93B 1AP7A 5HKPA 1BI8B 2ETCA 3Q9UC 4ATZD 3TWQA 5KBAA 5CBOA 1N0RA 5AQ7A 2AJAA 3SO8A 5BXOA 3TWWA 1IXVA 2V4HC 3JXIA 1UOHA 4F6RD 3F6QA 5AQBA 3D9HA 5CEDB 2J8SD 1K3ZD 3TWXA 4HRMB 3B95A 2RFMA 2A5EA 4U95D 1MX6A 3TWTA 3TWUA 5EYPF 5AQAA 2DWZA 2ETBA 1K1AA 4LG6A 5CERB 3W9GA 2XEHA 3TWSA 2MYOA 4GPMA 3J5PA 3ZKJA 3V30A 4DUIA 3KEAA 2DZNA 3AJIA 2FO1E 4DX6D 1DC2A 4ZHBA 1BD8A 1K1BA 2BKGA 3J5QB 4HB5A 5ENQD 3JUEA 2RFAA 4UUCA 4O1OA 4LNUD 4YDWA 5AN8A 5EILA 3UXGA 4CZ2D 4K5BA 4JB8P 1N0QA 2ZGDA 2F8YA 4LSZE 2JABA 2NYJA 1G3NB 3AAAC 4BEPA 4K5AB 2QC9A 4U8YD 3DEPA 3V2XA 3C5RA 3EU9A 4DX5D 2XENA 5BXUA 4HNAD 4DX7D 4DX1A 3ZNGA 4BSZB 1BLXB 2V5QC 5ENPD 1BU9A
chains in the Genus database with same CATH superfamily
4GTRA 2XPZA 4G2VA 1YYHA 1MX4A 4G26A 4KVMA 4XI0A 3SY2A 2L9BA 4RG9A 3KSQA 3CK8A 2ONDA 1P5QA 4TXQA 1TEZA 1D9SA 4TV3A 1WY6A 1D8EA 5D0QD 3LCAA 5ARFA 5KNGA 3RIBA 3MCXA 2WQ6A 3CK7A 2P9IG 3FU0A 3G2WA 3RK6A 3NZUA 4Q94A 4HQDA 3ABME 1S70B 3GZ1A 5CHEE 1LD7A 1N4PA 1AP7A 1BI8B 2YHCA 2WB2A 3ASFA 1Z3XA 3FY4A 4CEMA 4L7TA 4HXIA 3C98A 5AQAA 1KPSB 2J07A 3ZKJA 3ZXSA 3WG7E 3AJIA 1N54A 4DX6D 4TUUA 5B1BE 3DWLG 5FWQA 2WQ7A 1JUQA 1S0PA 5LP0A 3KEZA 4U8YD 4CRWA 3KS2A 3URZA 4Y6CA 3APDA 3BG0B 3ULQA 2IOSA 1O1RA 5ARGA 4GTVA 5CEAA 3L08A 2XPYA 4BSXA 1N9AA 3KAEA 3ONLA 4DJAA 3T9KA 4BESA 4I6GA 4ABNA 3HIZA 1E8YA 3E33A 2R2LA 4GMRA 5JMND 5AARA 3LJNA 2YNQA 4EECA 2V5FA 3RU0A 5CBNA 3ZFWA 1KT1A 3LY8A 4CGVA 5HS0A 3VLDA 4NACA 4AP2A 1XGWA 2J49A 3TXNA 5BW8C 5HKPA 2R03A 3FTZA 3HXEA 3G2UA 3TWQA 3TAXA 4PS8A 3QNKA 2KC7A 4EBAG 1UOHA 1HH8A 1ZU2A 3ZHEB 1NA0A 4JZYA 4LERA 4WNEA 3EJNA 4TRQA 4J8EA 3AS5A 2VTBA 3CGHA 3PDNA 3ZYKA 3KEAA 1WAO1 3NQPA 1K1BA 2P9KG 4UWFA 4XEIG 3TG5A 1OXJA 5FQ7A 3TL5A 2NYJA 2FBNA 1G3NB 1E7UA 4YDOA 2V5QC 3I4GA 4P29A 4C48B 3ZGQA 4HVBA 1FVFA 4AOFA 4JEHA 4YNDA 2XEEA 3IXEA 5KWDA 2KZTA 2DYRE 3ZW3A 2VSNA 2LO6A 2WXGA 2BUGA 3I5PA 3IHVA 3V31A 3DPYA 5BV0A 3FUMA 1UN9A 4QFVA 1EYHA 3MV3B 5T8IA 1N11A 3UMVA 1PC2A 4HRLA 1TJFA 3VTXA 1JWGA 4WNGA 1HXIA 1NFIE 1WG0A 3ASHA 4B93B 3T5XA 2V0PA 4N3AA 4DI3A 3LEWA 1OCCE 1E96B 5AIJA 3PUJA 1NP7A 3U64A 2XRYA 4F3VA 3QJZA 3SBSA 1ZBPA 1TNBA 3FTWA 1FCHA 3ABKE 3RSEG 5JHAA 3SQVA 4HLEA 1E90A 1KLXA 2VQ2A 2CG2A 1Y8MA 2WM9A 5G04C 3EU5A 2P9SG 3HYMB 3FTXA 2HR2A 3ZNGA 1E7VA 3DSSA 1U2VG 2NSZA 2QYJA 2WXJA 2GRLA 3LVRE 4WAFA 5EN5D 2P9NG 3OXLA 3LS8A 5EX3A 4FA6A 1FT1A 2DCPA 1VDYA 3HXDA 1INZA 1HG5A 2J09A 4J7WA 4KZ0A 2WQHA 5E76A 5C2YA 2ZGGA 4GPKA 1N4QA 4EZJA 3LY7A 2XZTG 4QQIA 5BPPA 4L2LA 3RKVA 4I2WA 4OVVA 3PZ3A 2GRMA 1LTXA 2A4ZA 3K9IA 2R17C 4DRXE 5KJMA 3QWVA 4GTOA 1V54E 1ZB1A 2VGYA 3R9MA 3MYVA 1PY1A 1HX8A 1TNZA 2KCLA 3O4ZA 2FEZA 3P1UA 1U3CA 3W9GA 1SA4A 1MQSA 1Z3YA 5FZRA 1TN7A 3CVYA 3OTNA 5EKQD 4GPMA 2WXIA 1HU3A 3IEGA 3B7SA 2WMOA 2BTDA 5J90A 2WXFA 4IULA 2P58C 5FT9A 3PRZA 2F8YA 1FPPA 4RSYA 3AAAC 3CQCB 4DX1A 4UI9C 1JPLA 3HDXA 3TJPA 5EIBE 4UQXA 3PEUB 2VYIA 3LYAA 4YDYA 3NOGD 3N71A 3DXKG 3L82A 1DCQA 1JWFA 1SVXA 5JJTA 5EX0A 2WXNA 1TYQG 3ESKA 3DPDA 1JCQA 2CHXA 5JA4D 5FQ6A 2X6FA 3CHRA 4HI8A 2OCCE 3ENEA 5FQ4A 4CDRA 3AG4E 2EIME 1A17A 3SZ7A 1E8ZA 4U0ZA 1SZAA 3UX4A 3D3MA 3Q9UC 5T4YA 4ATZD 3NAWA 5ENNA 5BT1A 5KBAA 3FUHA 3R7RA 2HO1A 2VSYA 1JCRA 3JYSA 4Q96A 3OXFA 2R05A 4F6RD 2XS8A 5HI7A 4DLOA 4FLHA 4FHJA 2JEKA 4HS2A 4U63A 4UQYA 3NB2A 3QAQA 3RO3A 4NRHB 3FTVA 1H6OA 4I6EA 3G2VA 2ILRA 3UT7A 3CV0A 4H7YA 1BPOA 2BKGA 2YHEA 1OWLA 2MRIA 2ZU6B 2XCCA 3E4BA 4GTMA 3ONKA 3CVUA 3FUEA 4MBGA 2E2EA 3U4TA 4PUCA 3Q75A 3CQGB 3E32A 3JQ1A 4U8HA 3QDNA 3SBTB 5JJ6A 2CHZA 4ACLA 4JVSA 3FFLA 2WVIA 3ZYMA 4N5QA 5AENA 5AAOA 3PE3A 4B8AA 4A63B 4DK5A 1WM5A 5ENTD 5D0OD 4J6IA 2WXLA 4EQFA 4KZCA 4AV7A 3CHQA 3AU5A 4B0ZA 2J4BA 4G25A 1OWNA 3FH5A 3MKRA 2QZAA 5M72A 2F0YA 3B7TA 4BFRA 4CT4A 4F53A 4GA2A 4I6JA 3BEEA 4ILGA 3ZU7B 3Q49B 1NA3A 2B6CA 3PH0C 5KNHD 3FDHA 4OAVB 4O60A 2YINA 5BUZA 4J8DA 1DNPA 3ASGA 1N0RA 3D9NA 4N2SA 3IV0A 2GROB 2GGFA 4APFA 1E8XA 2XPIA 2FI7A 4TXPA 4GMLA 2X6IA 4OYSA 4PS7A 3KSLA 5T3RA 1UW4B 4U07A 1N95A 4F7AA 3QOUA 4Y6WA 3D9PA 2IJGX 3Q78A 3CK9A 4AIFA 3C5RA 3SNXA 4DX5D 2XENA 4A55A 2PZIA 2VGXA 1BU9A 3UINC 1OT8A 4CDNA 1K8KG 2ZISA 3OAWA 3FU6A 3PUKA 1TNYA 1Z5SC 3V2OA 4GTSA 4XKCA 4XE0A 3MKQA 4U0UA 1H6PA 2IF4A 4TUMA 2AWIA 2LAIA 4APOA 4L2YA 4DI4A 2P9LG 4LUNU 2VTBB 2EINE 4UWKA 5LOZA 3FUJA 4IYPA 3EIJA 4KBQA 4GMJA 4JXTA 3MEKA 3VLFA 4YDEA 3CVXA 3L22A 3L6AA 4C0EA 3NOCD 1Z6TA 2QYUA 2VJ8A 3DEOA 4GB9A 2BEDA 2H6HA 2A5UA 4A1SA 1HZ4A 4FHKA 4GCNA 4WNDA 3ML9A 3VLEA 4LNGA 3APCA 5LX8A 3T8MA 3CVVA 4LEUA 4NURA 2P9UG 2DBAA 3B95A 1QQEA 1SQMA 4U95D 2A5EA 1IHGA 3DXMG 4RVBA 3DSWA 3PVLA 1XNFA 3B13A 2MYOA 2DYSE 4HOQA 3B7RL 4AM9A 3QB2A 4ZHBA 3PZ2A 2C0MA 3JUEA 4I9EA 2WMNA 3ZYQA 2X6KA 2ZGDA 5FZSA 1RW2A 1HFAA 3CVNA 3AU4A 4HNAD 5KCMA 3CVQA 4GYOA 2FO7A 3G2SA 5FIOA 4L9PA 4EZLA 4JD2G 4GZ5A 4BERA 5G05C 2V4LA 1U3DA 4LNBA 2IOLA 1N4RA 3UIOC 4BT8A 3FU3A 3SF4A 2Y0BG 5D2MC 1JCSA 3HVEB 4FP7A 1MYOA 1RZ4A 3S7JA 1FT2A 4I2ZA 3GYZA 1S64A 4BT9A 3MGBA 3MJWA 2HE0A 5HRYA 3PZ4A 3ISMC 4BETA 1YMPA 5ENOD 3ULEG 2Y1LE 4O1PA 4N2QA 3I3NA 5CECB 4AY6A 3C3RA 3TXMA 2WXQA 5G2NA 1Y6IA 3JXIA 2I6HA 3CR3A 3TWTA 2GRPB 3AS4A 1N4SA 5KJNA 4WNFA 2X6HA 3Q73A 3UM0A 3ZHEA 3TGOA 4ACKA 3UIPC 1KZOA 1YA0A 5EILA 3UXGA 3FTSA 3G2TA 3O48A 3RRUA 3ASOE 1ELRA 2C2LA 3JQ0A 3MV2B 3EHMA 2B0OE 3JUIA 4OAUC 3ESLA 4M7CA 5LCWJ 3CHOA 3ZUVB 3Q15A 2R5SA 1NI1A 3E30A 2CHWA 4MRUA 4IN3B 4DX2A 2UY1B 4KYOB 3TWRA 5E75A 2F8XK 4UWGA 4ATGA 4HLLA 4UWHA 3JXJA 3CEQA 3LKUA 4KMOA 4RQIA 5C1DA 2V8SE 3S7DA 3Q79A 2IU1A 4F1PA 4RLYA 3Q9NC 3T8KA 4AEZC 2QY7A 3PS6A 4HOSA 1MZCA 2X6JA 3FUFA 4FC8A 3EIQC 3E37A 1KZPA 3PNLB 4K0RA 3BU8A 2Y4TA 5DIZA 5CEDB 3X2QE 2RFMA 4FJZA 3DSXA 1V55E 4AVXA 3TWUA 3FH7A 1TNUA 2XEVA 2L6JA 2R59A 4Q69A 4U04A 2PM7A 4XIFA 2LXMA 1IYGA 2LSVA 1TN8A 4A3VA 4BEPA 3I4RB 3V2XA 5ANRA 4D10C 4BSZB 3APFA 4JC8A 3HHMA 4G8KA 3LDZA 5CMWA 2DVWA 4I9CA 1TR4A 3PNTB 3SD5A 4PS3A 3L54A 1UN8A 5CCMA 5FINA 2VSOE 5EIDA 2J4DA 1MX2A 1N52A 4XI9A 4HFGA 4UWLA 1GW6A 1H6KA 4MKTA 2P2CP 4CDMA 3D9LA 2E0IA 4XKBA 3CSTA 4CYMD 2KBXA 2PL2A 3CIAA 3L17A 5BNWA 3QARA 5G55A 3Q7FA 4W9RA 5AQ7A 2BF0X 4ILHB 4JHJA 2V4HC 3UM1A 4YVOA 2UWJG 3FP3A 1K3ZD 2RKKA 3LY9A 2AXZA 4GYYA 3CVLA 1HE8A 3BG1B 2DWZA 4LG6A 4BWRA 3TWSA 2OV8A 3CSFA 2FO1E 3C72A 3DRAA 5BV1A 1FVHA 3J5QB 2OEWA 3UPVA 1NZNA 5AN8A 4FJYA 1H2UA 3QWPA 4KVOA 4ANWA 3CKCA 2QC9A 3EU9A 3U9WA 3ZPJA 4BX8A 4A3TA 3ZYLA 3HXBA 4I43A 4JA7A 2WXRA 4B8CB 2LSUA 5AYWD 2BKKB 4WWNA 5DBKA 4Z68A 2LNIA 3BQOA 2L6BA 3MZLB 3U3WA 4GZCA 3HG0D 4FU3A 1E8WA 3FTYA 3GW4A 2CG3A 4BTAA 3ABLE 1ELWA 2F37A 1X81A 2VSXE 2IQCA 5A23A 1EPUA 4JHKA 1OCOE 2Y69E 1L5JA 4B94A 1PAQA 5CCLA 2XHEA 3PREA 3TWWA 5B1AE 3F6QA 4FLBA 2KATA 4WUYA 1UJJA 2WXOA 2OVBA 1MX6A 2LUHA 2FF4A 4PDXA 1SZ9A 1O1TA 1K1AA 1X5BA 4FULA 1OCRE 3MKQB 4O6FA 3V30A 4U7EB 4DUIA 5AJDA 1BD8A 4E6HA 2CFUA 4G11A 3S7BA 2J08A 2RFAA 4O1OA 4LNUD 3CHSA 2LXLA 4C9BB 2XCBA 3LJ3A 4JB8P 3HXCA 4GYWA 3Q47B 3FU5A 1D8DA 1Q2ZA 1DVPA 2WXPA 3UTMA 3D9IA 1N94A 3ULYA 2H6GA 4GAAA 3S2AA 2IFUA 2I2OA 3GZ2A 5G05J 3R7QA 3GZSA 3UKRG 3T5VA 1AWCB 3FWVA 5JJ7A 3DBSA 1IQRA 1OWOA 5AJLA 1YCSB 1SW6A 4AJWA 4K5CA 5H7PA 5HQ8A 3CHPA 1B89A 2ETCA 3ASNE 3ZRHA 3SO8A 3L9TA 1IXVA 5ANLA 4DLQA 3VTYA 4X8QA 3CVPA 1OWPA 4JEUA 3FUNA 1UG3A 2DIWA 5CERB 2NC9A 2GRNB 3DSUA 3D9JA 2PM6A 2M63A 4GZ6A 4YDWA 5JHBA 4CZ2D 3CVWA 4UI9K 3DEPA 2KZTB 3ZIMA 4R7LA 2EQXA 3E34A 3FHEA 2NXPA 4NIKA 2KCKA 3PZ1A 3PZDA 5ENRD 4G24A 4NQ0A 4URKA 3BUAA 3D9OA 3LPZA 5CRVA 5KJLA 4I1AA 4GTPA 3LXUX 4HOUA 4U8VD 5G04J 2H6FA 4GA1A 2C0LA 1IQUA 4G23A 4ZFHA 1IKND 3IBEA 3NBNB 3CKBA 2R02A 4GTTA 4ANUA 3EUVA 4K03A 1HG2A 2IY0C 2VGEA 1QYMA 2IO2C 3EHQA 2EIJE 2X3MA 3WXXA 2KXPC 5CMYA 3AS8A 2GW1A 4LRZA 5CBOA 3UT8A 3QK0A 4XX5A 3Q7AA 5AQBA 3D9HA 1DCEA 3PEVB 3AG3E 2QFCA 2LAHA 3UUXA 4GTQA 3FTUA 2MOWA 2H6IA 3LVQE 1H19A 4OVUA 2DZNA 4EZKA 4JHRA 1EDUA 1OCZE 4HB5A 4J8FA 4L1BA 2WXMA 1TJCA 4YVQC 2IO3C 2KCVA 2RD0A 4K5AB 2AXUA 5BXUA 3NZSA 3QWWA 4HBDA 2PQRA 3D9KA 5AQ9A 3IHYA 4N3CA 3TWVA 3B7BA 3HXFA 5FZQA 2RG8A 3ASDA 4HI9A 4GU5A 5ITZF 4C0MA 1H2TC 2GRQB 5CRUA 3U66A 2P9PG 4GZDA 1S63A 4GZ3A 1MJ0A 4AXHA 4MS6A 3P2BA 2HYZA 4ILIA 4JPSA 4KXKB 4UI9J 4G1TA 3FEXA 1BI7B 1HF8A 3Q5MA 2OEVA 3HRAA 4J8SA 2ZIRA 3V79K 1QBQA 4V3IA 4A1GA 3HVEA 4U0SA 5KJKA 4EHMA 4WWPA 5BXOA 3MA5A 3SI5A 3RAUA 4EBAA 5J08A 3B7UX 3TWXA 2Q7FA 3UKUG 4N5CA 2AXVA 1TNOA 4CT0A 5EYPF 4MLPA 1KT0A 4XZ4A 4UQZA 1SA5A 1OWMA 2I1KA 3FUKA 1DC2A 1W3BA 2CFZA 4GCOA 4WWOA 2EILE 3EHNA 2OVFA 3FUIA 3NF1A 1HO8A 3Q4AB 2JABA 1NL4A 4I1OB 3FULA 2AW6A 2XGOA 4AY5A 2XGSA 1BLXB 5ENPD 1LF8A 3QKYA 4DPRA 1WDYA 3AG2E 3SFZA 3TG4A 3ZXPA 3UM2A 4FADA 2WXKA 1OUVA 1QNFA 3RRNB 4J8YA 5A6CA 1IHBA 3S7FA 4JW1A 3CLJA 4JL0A 4HORA 1MHQA 2KM4A 2OOEA 2PNNA 5EDSA 2L0TB 4TXRA 4E85A 5LFAA 2UY1A 3W9FA 5IY5E 5D66A 3EHRA 1H2VC 2Y3AA 3UI2A 2EIKE 3RJVA 3L13A 1ELKA 2AJAA 3RO2A 5B3SE 2FULA 4F1SA 2J8SD 2I9CA 2XRZA 3KD7A 4HRMB 1QZ2A 3FEYA 3R9AB 1H0AA 1O5MA 5FJYA 2JLBA 4JA9A 2ETBA 4IRUA 3UQ3A 4BX9A 5A7DB 3J5PA 5LCWC 2J9QA 2WPVA 3SHFA 2YQ8A 1LD8A 5ENQD 3ZN3A 3OXGA 4LCTA 4UUCA 1UJKA 3DSVA 3EDTB 2L0IA 1N0QA 4LSZE 3ZVVA 4EPZA 4DX7D 3QC1A 2DZOA 3D9MA 4CCAA 3UT4A 4H7XA 3IKOB 3ML8A 2I1JA 5FTPA 1A5EA 4U96D 3L16A 1OY3D 4J0UA 4I17A 2AVPA 2XZDG 4BY6A 3AG1E 3UM3A 4CGWA 4HRNA 4G8LA 4GA0A 2WXHA 3PE4A 4KT6B 3DSTA 3CHMA 3C3QA 3ZEFA 4M3OA 3FH8A 4ANVA 2XQ0A 3MX3A 3SFXA 3JCKC 3RRMB 5ENSD 3SGHA 2ETAA 2IEJA 5EYLA 1HS6A 3C3OA 2GRRB 1O1SA 4PH4B 4I1MA 2IONA 1EF1C 1TN6A 4N39A 2ZXWE 2XEHA 5FQ8A 2HM8A 3SFYA 4BTBA 2VGXB 2XGMA 4N3BA 4ANXA 4HOTA 2PQNA 4ME2A 4B89A 4K5BA 2XS1A 2X38A 2Y4UA 4RG6A 4L23A 2MHKA 3FUDA
chains in the Genus database with same CATH topology
2DZOA 4HBDA 5FIOA 2QYJA 4C48B 3UTMA 4G8KA 1OT8A 4NIKA 5CEAA 5EN5D 4BERA 1WDYA 5AQ9A 2B0OE 1YYHA 2DVWA 5ENRD 5EIBE 4N5QA 4OAUC 5AAOA 1TR4A 3TWVA 3B7BA 4YDYA 3NOGD 1MX4A 3ZUVB 4A63B 5ENTD 2XEEA 3T9KA 4BESA 3IXEA 5KWDA 2BKKB 4HI9A 5ITZF 4Z68A 1A5EA 1DCQA 4U96D 3V2OA 4J7WA 5FINA 1SVXA 2L6BA 1OY3D 4DX2A 2Y0BG 1AWCB 2ZGGA 1D9SA 4J8YA 4U8VD 5EIDA 3TWRA 2F8XK 3HG0D 5AARA 2XZDG 4GMRA 1IHBA 1MYOA 3LJNA 1MJ0A 4TUMA 5JMND 1MX2A 5JA4D 5KNGA 2XZTG 4QQIA 3V31A 4ZFHA 4HLLA 1IKND 3NBNB 3JXJA 5CBNA 4HRNA 1YCSB 4G8LA 4QFVA 2HE0A 2F37A 2PNNA 1N11A 1SW6A 4HI8A 1BI7B 5HRYA 4HRLA 2P2CP 4F1PA 5HS0A 4RLYA 3HRAA 4BETA 1YMPA 3Q9NC 2VGEA 4K5CA 3T8KA 1QYMA 3V79K 4HQDA 5ENOD 4CYMD 3W9FA 3EHQA 1S70B 2KBXA 5D66A 2Y1LE 3ZU7B 2KXPC 3EHRA 1NFIE 3NOCD 4O1PA 5ENSD 5KNHD 5CECB 3UI2A 3DEOA 4OAVB 4O60A 1WG0A 2ETAA 4DRXE 5EYLA 4B93B 1AP7A 5HKPA 1BI8B 2ETCA 3Q9UC 4ATZD 3TWQA 5KBAA 5CBOA 1N0RA 5AQ7A 2AJAA 3SO8A 5BXOA 3TWWA 1IXVA 2V4HC 3JXIA 1UOHA 4F6RD 3F6QA 5AQBA 3D9HA 5CEDB 2J8SD 1K3ZD 3TWXA 4HRMB 3B95A 2RFMA 2A5EA 4U95D 1MX6A 3TWTA 3TWUA 5EYPF 5AQAA 2DWZA 2ETBA 1K1AA 4LG6A 5CERB 3W9GA 2XEHA 3TWSA 2MYOA 4GPMA 3J5PA 3ZKJA 3V30A 4DUIA 3KEAA 2DZNA 3AJIA 2FO1E 4DX6D 1DC2A 4ZHBA 1BD8A 1K1BA 2BKGA 3J5QB 4HB5A 5ENQD 3JUEA 2RFAA 4UUCA 4O1OA 4LNUD 4YDWA 5AN8A 5EILA 3UXGA 4CZ2D 4K5BA 4JB8P 1N0QA 2ZGDA 2F8YA 4LSZE 2JABA 2NYJA 1G3NB 3AAAC 4BEPA 4K5AB 2QC9A 4U8YD 3DEPA 3V2XA 3C5RA 3EU9A 4DX5D 2XENA 5BXUA 4HNAD 4DX7D 4DX1A 3ZNGA 4BSZB 1BLXB 2V5QC 5ENPD 1BU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZO A;  4HBD A;  5FIO A;  2QYJ A;  4C48 B;  3UTM A;  4G8K A;  1OT8 A;  4NIK A;  5CEA A;  5EN5 D;  4BER A;  1WDY A;  5AQ9 A;  2B0O E;  1YYH A;  2DVW A;  5ENR D;  5EIB E;  4N5Q A;  4OAU C;  5AAO A;  1TR4 A;  3TWV A;  3B7B A;  4YDY A;  3NOG D;  1MX4 A;  3ZUV B;  4A63 B;  5ENT D;  2XEE A;  3T9K A;  4BES A;  3IXE A;  5KWD A;  2BKK B;  4HI9 A;  5ITZ F;  4Z68 A;  1A5E A;  1DCQ A;  4U96 D;  3V2O A;  4J7W A;  5FIN A;  1SVX A;  2L6B A;  1OY3 D;  4DX2 A;  2Y0B G;  1AWC B;  2ZGG A;  1D9S A;  4J8Y A;  4U8V D;  5EID A;  3TWR A;  2F8X K;  3HG0 D;  5AAR A;  2XZD G;  4GMR A;  1IHB A;  1MYO A;  3LJN A;  1MJ0 A;  4TUM A;  5JMN D;  1MX2 A;  5JA4 D;  5KNG A;  2XZT G;  4QQI A;  3V31 A;  4ZFH A;  4HLL A;  1IKN D;  3NBN B;  3JXJ A;  5CBN A;  4HRN A;  1YCS B;  4G8L A;  4QFV A;  2HE0 A;  2F37 A;  2PNN A;  1N11 A;  1SW6 A;  4HI8 A;  1BI7 B;  5HRY A;  4HRL A;  2P2C P;  4F1P A;  5HS0 A;  4RLY A;  3HRA A;  4BET A;  1YMP A;  3Q9N C;  2VGE A;  4K5C A;  3T8K A;  1QYM A;  3V79 K;  4HQD A;  5ENO D;  4CYM D;  3W9F A;  3EHQ A;  1S70 B;  2KBX A;  5D66 A;  2Y1L E;  3ZU7 B;  2KXP C;  3EHR A;  1NFI E;  3NOC D;  4O1P A;  5ENS D;  5KNH D;  5CEC B;  3UI2 A;  3DEO A;  4OAV B;  4O60 A;  1WG0 A;  2ETA A;  4DRX E;  5EYL A;  4B93 B;  1AP7 A;  5HKP A;  1BI8 B;  2ETC A;  3Q9U C;  4ATZ D;  3TWQ A;  5KBA A;  5CBO A;  1N0R A;  5AQ7 A;  2AJA A;  3SO8 A;  5BXO A;  3TWW A;  1IXV A;  2V4H C;  3JXI A;  1UOH A;  4F6R D;  3F6Q A;  5AQB A;  3D9H A;  5CED B;  2J8S D;  1K3Z D;  3TWX A;  4HRM B;  3B95 A;  2RFM A;  2A5E A;  4U95 D;  1MX6 A;  3TWT A;  3TWU A;  5EYP F;  5AQA A;  2DWZ A;  2ETB A;  1K1A A;  4LG6 A;  5CER B;  3W9G A;  2XEH A;  3TWS A;  2MYO A;  4GPM A;  3J5P A;  3ZKJ A;  3V30 A;  4DUI A;  3KEA A;  2DZN A;  3AJI A;  2FO1 E;  4DX6 D;  1DC2 A;  4ZHB A;  1BD8 A;  1K1B A;  2BKG A;  3J5Q B;  4HB5 A;  5ENQ D;  3JUE A;  2RFA A;  4UUC A;  4O1O A;  4LNU D;  4YDW A;  5AN8 A;  5EIL A;  3UXG A;  4CZ2 D;  4K5B A;  4JB8 P;  1N0Q A;  2ZGD A;  2F8Y A;  4LSZ E;  2JAB A;  2NYJ A;  1G3N B;  3AAA C;  4BEP A;  4K5A B;  2QC9 A;  4U8Y D;  3DEP A;  3V2X A;  3C5R A;  3EU9 A;  4DX5 D;  2XEN A;  5BXU A;  4HNA D;  4DX7 D;  4DX1 A;  3ZNG A;  4BSZ B;  1BLX B;  2V5Q C;  5ENP D;  1BU9 A; 
#chains in the Genus database with same CATH topology
 4GTR A;  2XPZ A;  4G2V A;  1YYH A;  1MX4 A;  4G26 A;  4KVM A;  4XI0 A;  3SY2 A;  2L9B A;  4RG9 A;  3KSQ A;  3CK8 A;  2OND A;  1P5Q A;  4TXQ A;  1TEZ A;  1D9S A;  4TV3 A;  1WY6 A;  1D8E A;  5D0Q D;  3LCA A;  5ARF A;  5KNG A;  3RIB A;  3MCX A;  2WQ6 A;  3CK7 A;  2P9I G;  3FU0 A;  3G2W A;  3RK6 A;  3NZU A;  4Q94 A;  4HQD A;  3ABM E;  1S70 B;  3GZ1 A;  5CHE E;  1LD7 A;  1N4P A;  1AP7 A;  1BI8 B;  2YHC A;  2WB2 A;  3ASF A;  1Z3X A;  3FY4 A;  4CEM A;  4L7T A;  4HXI A;  3C98 A;  5AQA A;  1KPS B;  2J07 A;  3ZKJ A;  3ZXS A;  3WG7 E;  3AJI A;  1N54 A;  4DX6 D;  4TUU A;  5B1B E;  3DWL G;  5FWQ A;  2WQ7 A;  1JUQ A;  1S0P A;  5LP0 A;  3KEZ A;  4U8Y D;  4CRW A;  3KS2 A;  3URZ A;  4Y6C A;  3APD A;  3BG0 B;  3ULQ A;  2IOS A;  1O1R A;  5ARG A;  4GTV A;  5CEA A;  3L08 A;  2XPY A;  4BSX A;  1N9A A;  3KAE A;  3ONL A;  4DJA A;  3T9K A;  4BES A;  4I6G A;  4ABN A;  3HIZ A;  1E8Y A;  3E33 A;  2R2L A;  4GMR A;  5JMN D;  5AAR A;  3LJN A;  2YNQ A;  4EEC A;  2V5F A;  3RU0 A;  5CBN A;  3ZFW A;  1KT1 A;  3LY8 A;  4CGV A;  5HS0 A;  3VLD A;  4NAC A;  4AP2 A;  1XGW A;  2J49 A;  3TXN A;  5BW8 C;  5HKP A;  2R03 A;  3FTZ A;  3HXE A;  3G2U A;  3TWQ A;  3TAX A;  4PS8 A;  3QNK A;  2KC7 A;  4EBA G;  1UOH A;  1HH8 A;  1ZU2 A;  3ZHE B;  1NA0 A;  4JZY A;  4LER A;  4WNE A;  3EJN A;  4TRQ A;  4J8E A;  3AS5 A;  2VTB A;  3CGH A;  3PDN A;  3ZYK A;  3KEA A;  1WAO 1;  3NQP A;  1K1B A;  2P9K G;  4UWF A;  4XEI G;  3TG5 A;  1OXJ A;  5FQ7 A;  3TL5 A;  2NYJ A;  2FBN A;  1G3N B;  1E7U A;  4YDO A;  2V5Q C;  3I4G A;  4P29 A;  4C48 B;  3ZGQ A;  4HVB A;  1FVF A;  4AOF A;  4JEH A;  4YND A;  2XEE A;  3IXE A;  5KWD A;  2KZT A;  2DYR E;  3ZW3 A;  2VSN A;  2LO6 A;  2WXG A;  2BUG A;  3I5P A;  3IHV A;  3V31 A;  3DPY A;  5BV0 A;  3FUM A;  1UN9 A;  4QFV A;  1EYH A;  3MV3 B;  5T8I A;  1N11 A;  3UMV A;  1PC2 A;  4HRL A;  1TJF A;  3VTX A;  1JWG A;  4WNG A;  1HXI A;  1NFI E;  1WG0 A;  3ASH A;  4B93 B;  3T5X A;  2V0P A;  4N3A A;  4DI3 A;  3LEW A;  1OCC E;  1E96 B;  5AIJ A;  3PUJ A;  1NP7 A;  3U64 A;  2XRY A;  4F3V A;  3QJZ A;  3SBS A;  1ZBP A;  1TNB A;  3FTW A;  1FCH A;  3ABK E;  3RSE G;  5JHA A;  3SQV A;  4HLE A;  1E90 A;  1KLX A;  2VQ2 A;  2CG2 A;  1Y8M A;  2WM9 A;  5G04 C;  3EU5 A;  2P9S G;  3HYM B;  3FTX A;  2HR2 A;  3ZNG A;  1E7V A;  3DSS A;  1U2V G;  2NSZ A;  2QYJ A;  2WXJ A;  2GRL A;  3LVR E;  4WAF A;  5EN5 D;  2P9N G;  3OXL A;  3LS8 A;  5EX3 A;  4FA6 A;  1FT1 A;  2DCP A;  1VDY A;  3HXD A;  1INZ A;  1HG5 A;  2J09 A;  4J7W A;  4KZ0 A;  2WQH A;  5E76 A;  5C2Y A;  2ZGG A;  4GPK A;  1N4Q A;  4EZJ A;  3LY7 A;  2XZT G;  4QQI A;  5BPP A;  4L2L A;  3RKV A;  4I2W A;  4OVV A;  3PZ3 A;  2GRM A;  1LTX A;  2A4Z A;  3K9I A;  2R17 C;  4DRX E;  5KJM A;  3QWV A;  4GTO A;  1V54 E;  1ZB1 A;  2VGY A;  3R9M A;  3MYV A;  1PY1 A;  1HX8 A;  1TNZ A;  2KCL A;  3O4Z A;  2FEZ A;  3P1U A;  1U3C A;  3W9G A;  1SA4 A;  1MQS A;  1Z3Y A;  5FZR A;  1TN7 A;  3CVY A;  3OTN A;  5EKQ D;  4GPM A;  2WXI A;  1HU3 A;  3IEG A;  3B7S A;  2WMO A;  2BTD A;  5J90 A;  2WXF A;  4IUL A;  2P58 C;  5FT9 A;  3PRZ A;  2F8Y A;  1FPP A;  4RSY A;  3AAA C;  3CQC B;  4DX1 A;  4UI9 C;  1JPL A;  3HDX A;  3TJP A;  5EIB E;  4UQX A;  3PEU B;  2VYI A;  3LYA A;  4YDY A;  3NOG D;  3N71 A;  3DXK G;  3L82 A;  1DCQ A;  1JWF A;  1SVX A;  5JJT A;  5EX0 A;  2WXN A;  1TYQ G;  3ESK A;  3DPD A;  1JCQ A;  2CHX A;  5JA4 D;  5FQ6 A;  2X6F A;  3CHR A;  4HI8 A;  2OCC E;  3ENE A;  5FQ4 A;  4CDR A;  3AG4 E;  2EIM E;  1A17 A;  3SZ7 A;  1E8Z A;  4U0Z A;  1SZA A;  3UX4 A;  3D3M A;  3Q9U C;  5T4Y A;  4ATZ D;  3NAW A;  5ENN A;  5BT1 A;  5KBA A;  3FUH A;  3R7R A;  2HO1 A;  2VSY A;  1JCR A;  3JYS A;  4Q96 A;  3OXF A;  2R05 A;  4F6R D;  2XS8 A;  5HI7 A;  4DLO A;  4FLH A;  4FHJ A;  2JEK A;  4HS2 A;  4U63 A;  4UQY A;  3NB2 A;  3QAQ A;  3RO3 A;  4NRH B;  3FTV A;  1H6O A;  4I6E A;  3G2V A;  2ILR A;  3UT7 A;  3CV0 A;  4H7Y A;  1BPO A;  2BKG A;  2YHE A;  1OWL A;  2MRI A;  2ZU6 B;  2XCC A;  3E4B A;  4GTM A;  3ONK A;  3CVU A;  3FUE A;  4MBG A;  2E2E A;  3U4T A;  4PUC A;  3Q75 A;  3CQG B;  3E32 A;  3JQ1 A;  4U8H A;  3QDN A;  3SBT B;  5JJ6 A;  2CHZ A;  4ACL A;  4JVS A;  3FFL A;  2WVI A;  3ZYM A;  4N5Q A;  5AEN A;  5AAO A;  3PE3 A;  4B8A A;  4A63 B;  4DK5 A;  1WM5 A;  5ENT D;  5D0O D;  4J6I A;  2WXL A;  4EQF A;  4KZC A;  4AV7 A;  3CHQ A;  3AU5 A;  4B0Z A;  2J4B A;  4G25 A;  1OWN A;  3FH5 A;  3MKR A;  2QZA A;  5M72 A;  2F0Y A;  3B7T A;  4BFR A;  4CT4 A;  4F53 A;  4GA2 A;  4I6J A;  3BEE A;  4ILG A;  3ZU7 B;  3Q49 B;  1NA3 A;  2B6C A;  3PH0 C;  5KNH D;  3FDH A;  4OAV B;  4O60 A;  2YIN A;  5BUZ A;  4J8D A;  1DNP A;  3ASG A;  1N0R A;  3D9N A;  4N2S A;  3IV0 A;  2GRO B;  2GGF A;  4APF A;  1E8X A;  2XPI A;  2FI7 A;  4TXP A;  4GML A;  2X6I A;  4OYS A;  4PS7 A;  3KSL A;  5T3R A;  1UW4 B;  4U07 A;  1N95 A;  4F7A A;  3QOU A;  4Y6W A;  3D9P A;  2IJG X;  3Q78 A;  3CK9 A;  4AIF A;  3C5R A;  3SNX A;  4DX5 D;  2XEN A;  4A55 A;  2PZI A;  2VGX A;  1BU9 A;  3UIN C;  1OT8 A;  4CDN A;  1K8K G;  2ZIS A;  3OAW A;  3FU6 A;  3PUK A;  1TNY A;  1Z5S C;  3V2O A;  4GTS A;  4XKC A;  4XE0 A;  3MKQ A;  4U0U A;  1H6P A;  2IF4 A;  4TUM A;  2AWI A;  2LAI A;  4APO A;  4L2Y A;  4DI4 A;  2P9L G;  4LUN U;  2VTB B;  2EIN E;  4UWK A;  5LOZ A;  3FUJ A;  4IYP A;  3EIJ A;  4KBQ A;  4GMJ A;  4JXT A;  3MEK A;  3VLF A;  4YDE A;  3CVX A;  3L22 A;  3L6A A;  4C0E A;  3NOC D;  1Z6T A;  2QYU A;  2VJ8 A;  3DEO A;  4GB9 A;  2BED A;  2H6H A;  2A5U A;  4A1S A;  1HZ4 A;  4FHK A;  4GCN A;  4WND A;  3ML9 A;  3VLE A;  4LNG A;  3APC A;  5LX8 A;  3T8M A;  3CVV A;  4LEU A;  4NUR A;  2P9U G;  2DBA A;  3B95 A;  1QQE A;  1SQM A;  4U95 D;  2A5E A;  1IHG A;  3DXM G;  4RVB A;  3DSW A;  3PVL A;  1XNF A;  3B13 A;  2MYO A;  2DYS E;  4HOQ A;  3B7R L;  4AM9 A;  3QB2 A;  4ZHB A;  3PZ2 A;  2C0M A;  3JUE A;  4I9E A;  2WMN A;  3ZYQ A;  2X6K A;  2ZGD A;  5FZS A;  1RW2 A;  1HFA A;  3CVN A;  3AU4 A;  4HNA D;  5KCM A;  3CVQ A;  4GYO A;  2FO7 A;  3G2S A;  5FIO A;  4L9P A;  4EZL A;  4JD2 G;  4GZ5 A;  4BER A;  5G05 C;  2V4L A;  1U3D A;  4LNB A;  2IOL A;  1N4R A;  3UIO C;  4BT8 A;  3FU3 A;  3SF4 A;  2Y0B G;  5D2M C;  1JCS A;  3HVE B;  4FP7 A;  1MYO A;  1RZ4 A;  3S7J A;  1FT2 A;  4I2Z A;  3GYZ A;  1S64 A;  4BT9 A;  3MGB A;  3MJW A;  2HE0 A;  5HRY A;  3PZ4 A;  3ISM C;  4BET A;  1YMP A;  5ENO D;  3ULE G;  2Y1L E;  4O1P A;  4N2Q A;  3I3N A;  5CEC B;  4AY6 A;  3C3R A;  3TXM A;  2WXQ A;  5G2N A;  1Y6I A;  3JXI A;  2I6H A;  3CR3 A;  3TWT A;  2GRP B;  3AS4 A;  1N4S A;  5KJN A;  4WNF A;  2X6H A;  3Q73 A;  3UM0 A;  3ZHE A;  3TGO A;  4ACK A;  3UIP C;  1KZO A;  1YA0 A;  5EIL A;  3UXG A;  3FTS A;  3G2T A;  3O48 A;  3RRU A;  3ASO E;  1ELR A;  2C2L A;  3JQ0 A;  3MV2 B;  3EHM A;  2B0O E;  3JUI A;  4OAU C;  3ESL A;  4M7C A;  5LCW J;  3CHO A;  3ZUV B;  3Q15 A;  2R5S A;  1NI1 A;  3E30 A;  2CHW A;  4MRU A;  4IN3 B;  4DX2 A;  2UY1 B;  4KYO B;  3TWR A;  5E75 A;  2F8X K;  4UWG A;  4ATG A;  4HLL A;  4UWH A;  3JXJ A;  3CEQ A;  3LKU A;  4KMO A;  4RQI A;  5C1D A;  2V8S E;  3S7D A;  3Q79 A;  2IU1 A;  4F1P A;  4RLY A;  3Q9N C;  3T8K A;  4AEZ C;  2QY7 A;  3PS6 A;  4HOS A;  1MZC A;  2X6J A;  3FUF A;  4FC8 A;  3EIQ C;  3E37 A;  1KZP A;  3PNL B;  4K0R A;  3BU8 A;  2Y4T A;  5DIZ A;  5CED B;  3X2Q E;  2RFM A;  4FJZ A;  3DSX A;  1V55 E;  4AVX A;  3TWU A;  3FH7 A;  1TNU A;  2XEV A;  2L6J A;  2R59 A;  4Q69 A;  4U04 A;  2PM7 A;  4XIF A;  2LXM A;  1IYG A;  2LSV A;  1TN8 A;  4A3V A;  4BEP A;  3I4R B;  3V2X A;  5ANR A;  4D10 C;  4BSZ B;  3APF A;  4JC8 A;  3HHM A;  4G8K A;  3LDZ A;  5CMW A;  2DVW A;  4I9C A;  1TR4 A;  3PNT B;  3SD5 A;  4PS3 A;  3L54 A;  1UN8 A;  5CCM A;  5FIN A;  2VSO E;  5EID A;  2J4D A;  1MX2 A;  1N52 A;  4XI9 A;  4HFG A;  4UWL A;  1GW6 A;  1H6K A;  4MKT A;  2P2C P;  4CDM A;  3D9L A;  2E0I A;  4XKB A;  3CST A;  4CYM D;  2KBX A;  2PL2 A;  3CIA A;  3L17 A;  5BNW A;  3QAR A;  5G55 A;  3Q7F A;  4W9R A;  5AQ7 A;  2BF0 X;  4ILH B;  4JHJ A;  2V4H C;  3UM1 A;  4YVO A;  2UWJ G;  3FP3 A;  1K3Z D;  2RKK A;  3LY9 A;  2AXZ A;  4GYY A;  3CVL A;  1HE8 A;  3BG1 B;  2DWZ A;  4LG6 A;  4BWR A;  3TWS A;  2OV8 A;  3CSF A;  2FO1 E;  3C72 A;  3DRA A;  5BV1 A;  1FVH A;  3J5Q B;  2OEW A;  3UPV A;  1NZN A;  5AN8 A;  4FJY A;  1H2U A;  3QWP A;  4KVO A;  4ANW A;  3CKC A;  2QC9 A;  3EU9 A;  3U9W A;  3ZPJ A;  4BX8 A;  4A3T A;  3ZYL A;  3HXB A;  4I43 A;  4JA7 A;  2WXR A;  4B8C B;  2LSU A;  5AYW D;  2BKK B;  4WWN A;  5DBK A;  4Z68 A;  2LNI A;  3BQO A;  2L6B A;  3MZL B;  3U3W A;  4GZC A;  3HG0 D;  4FU3 A;  1E8W A;  3FTY A;  3GW4 A;  2CG3 A;  4BTA A;  3ABL E;  1ELW A;  2F37 A;  1X81 A;  2VSX E;  2IQC A;  5A23 A;  1EPU A;  4JHK A;  1OCO E;  2Y69 E;  1L5J A;  4B94 A;  1PAQ A;  5CCL A;  2XHE A;  3PRE A;  3TWW A;  5B1A E;  3F6Q A;  4FLB A;  2KAT A;  4WUY A;  1UJJ A;  2WXO A;  2OVB A;  1MX6 A;  2LUH A;  2FF4 A;  4PDX A;  1SZ9 A;  1O1T A;  1K1A A;  1X5B A;  4FUL A;  1OCR E;  3MKQ B;  4O6F A;  3V30 A;  4U7E B;  4DUI A;  5AJD A;  1BD8 A;  4E6H A;  2CFU A;  4G11 A;  3S7B A;  2J08 A;  2RFA A;  4O1O A;  4LNU D;  3CHS A;  2LXL A;  4C9B B;  2XCB A;  3LJ3 A;  4JB8 P;  3HXC A;  4GYW A;  3Q47 B;  3FU5 A;  1D8D A;  1Q2Z A;  1DVP A;  2WXP A;  3UTM A;  3D9I A;  1N94 A;  3ULY A;  2H6G A;  4GAA A;  3S2A A;  2IFU A;  2I2O A;  3GZ2 A;  5G05 J;  3R7Q A;  3GZS A;  3UKR G;  3T5V A;  1AWC B;  3FWV A;  5JJ7 A;  3DBS A;  1IQR A;  1OWO A;  5AJL A;  1YCS B;  1SW6 A;  4AJW A;  4K5C A;  5H7P A;  5HQ8 A;  3CHP A;  1B89 A;  2ETC A;  3ASN E;  3ZRH A;  3SO8 A;  3L9T A;  1IXV A;  5ANL A;  4DLQ A;  3VTY A;  4X8Q A;  3CVP A;  1OWP A;  4JEU A;  3FUN A;  1UG3 A;  2DIW A;  5CER B;  2NC9 A;  2GRN B;  3DSU A;  3D9J A;  2PM6 A;  2M63 A;  4GZ6 A;  4YDW A;  5JHB A;  4CZ2 D;  3CVW A;  4UI9 K;  3DEP A;  2KZT B;  3ZIM A;  4R7L A;  2EQX A;  3E34 A;  3FHE A;  2NXP A;  4NIK A;  2KCK A;  3PZ1 A;  3PZD A;  5ENR D;  4G24 A;  4NQ0 A;  4URK A;  3BUA A;  3D9O A;  3LPZ A;  5CRV A;  5KJL A;  4I1A A;  4GTP A;  3LXU X;  4HOU A;  4U8V D;  5G04 J;  2H6F A;  4GA1 A;  2C0L A;  1IQU A;  4G23 A;  4ZFH A;  1IKN D;  3IBE A;  3NBN B;  3CKB A;  2R02 A;  4GTT A;  4ANU A;  3EUV A;  4K03 A;  1HG2 A;  2IY0 C;  2VGE A;  1QYM A;  2IO2 C;  3EHQ A;  2EIJ E;  2X3M A;  3WXX A;  2KXP C;  5CMY A;  3AS8 A;  2GW1 A;  4LRZ A;  5CBO A;  3UT8 A;  3QK0 A;  4XX5 A;  3Q7A A;  5AQB A;  3D9H A;  1DCE A;  3PEV B;  3AG3 E;  2QFC A;  2LAH A;  3UUX A;  4GTQ A;  3FTU A;  2MOW A;  2H6I A;  3LVQ E;  1H19 A;  4OVU A;  2DZN A;  4EZK A;  4JHR A;  1EDU A;  1OCZ E;  4HB5 A;  4J8F A;  4L1B A;  2WXM A;  1TJC A;  4YVQ C;  2IO3 C;  2KCV A;  2RD0 A;  4K5A B;  2AXU A;  5BXU A;  3NZS A;  3QWW A;  4HBD A;  2PQR A;  3D9K A;  5AQ9 A;  3IHY A;  4N3C A;  3TWV A;  3B7B A;  3HXF A;  5FZQ A;  2RG8 A;  3ASD A;  4HI9 A;  4GU5 A;  5ITZ F;  4C0M A;  1H2T C;  2GRQ B;  5CRU A;  3U66 A;  2P9P G;  4GZD A;  1S63 A;  4GZ3 A;  1MJ0 A;  4AXH A;  4MS6 A;  3P2B A;  2HYZ A;  4ILI A;  4JPS A;  4KXK B;  4UI9 J;  4G1T A;  3FEX A;  1BI7 B;  1HF8 A;  3Q5M A;  2OEV A;  3HRA A;  4J8S A;  2ZIR A;  3V79 K;  1QBQ A;  4V3I A;  4A1G A;  3HVE A;  4U0S A;  5KJK A;  4EHM A;  4WWP A;  5BXO A;  3MA5 A;  3SI5 A;  3RAU A;  4EBA A;  5J08 A;  3B7U X;  3TWX A;  2Q7F A;  3UKU G;  4N5C A;  2AXV A;  1TNO A;  4CT0 A;  5EYP F;  4MLP A;  1KT0 A;  4XZ4 A;  4UQZ A;  1SA5 A;  1OWM A;  2I1K A;  3FUK A;  1DC2 A;  1W3B A;  2CFZ A;  4GCO A;  4WWO A;  2EIL E;  3EHN A;  2OVF A;  3FUI A;  3NF1 A;  1HO8 A;  3Q4A B;  2JAB A;  1NL4 A;  4I1O B;  3FUL A;  2AW6 A;  2XGO A;  4AY5 A;  2XGS A;  1BLX B;  5ENP D;  1LF8 A;  3QKY A;  4DPR A;  1WDY A;  3AG2 E;  3SFZ A;  3TG4 A;  3ZXP A;  3UM2 A;  4FAD A;  2WXK A;  1OUV A;  1QNF A;  3RRN B;  4J8Y A;  5A6C A;  1IHB A;  3S7F A;  4JW1 A;  3CLJ A;  4JL0 A;  4HOR A;  1MHQ A;  2KM4 A;  2OOE A;  2PNN A;  5EDS A;  2L0T B;  4TXR A;  4E85 A;  5LFA A;  2UY1 A;  3W9F A;  5IY5 E;  5D66 A;  3EHR A;  1H2V C;  2Y3A A;  3UI2 A;  2EIK E;  3RJV A;  3L13 A;  1ELK A;  2AJA A;  3RO2 A;  5B3S E;  2FUL A;  4F1S A;  2J8S D;  2I9C A;  2XRZ A;  3KD7 A;  4HRM B;  1QZ2 A;  3FEY A;  3R9A B;  1H0A A;  1O5M A;  5FJY A;  2JLB A;  4JA9 A;  2ETB A;  4IRU A;  3UQ3 A;  4BX9 A;  5A7D B;  3J5P A;  5LCW C;  2J9Q A;  2WPV A;  3SHF A;  2YQ8 A;  1LD8 A;  5ENQ D;  3ZN3 A;  3OXG A;  4LCT A;  4UUC A;  1UJK A;  3DSV A;  3EDT B;  2L0I A;  1N0Q A;  4LSZ E;  3ZVV A;  4EPZ A;  4DX7 D;  3QC1 A;  2DZO A;  3D9M A;  4CCA A;  3UT4 A;  4H7X A;  3IKO B;  3ML8 A;  2I1J A;  5FTP A;  1A5E A;  4U96 D;  3L16 A;  1OY3 D;  4J0U A;  4I17 A;  2AVP A;  2XZD G;  4BY6 A;  3AG1 E;  3UM3 A;  4CGW A;  4HRN A;  4G8L A;  4GA0 A;  2WXH A;  3PE4 A;  4KT6 B;  3DST A;  3CHM A;  3C3Q A;  3ZEF A;  4M3O A;  3FH8 A;  4ANV A;  2XQ0 A;  3MX3 A;  3SFX A;  3JCK C;  3RRM B;  5ENS D;  3SGH A;  2ETA A;  2IEJ A;  5EYL A;  1HS6 A;  3C3O A;  2GRR B;  1O1S A;  4PH4 B;  4I1M A;  2ION A;  1EF1 C;  1TN6 A;  4N39 A;  2ZXW E;  2XEH A;  5FQ8 A;  2HM8 A;  3SFY A;  4BTB A;  2VGX B;  2XGM A;  4N3B A;  4ANX A;  4HOT A;  2PQN A;  4ME2 A;  4B89 A;  4K5B A;  2XS1 A;  2X38 A;  2Y4U A;  4RG6 A;  4L23 A;  2MHK A;  3FUD A; 
#chains in the Genus database with same CATH homology
 2DZO A;  4HBD A;  5FIO A;  2QYJ A;  4C48 B;  3UTM A;  4G8K A;  1OT8 A;  4NIK A;  5CEA A;  5EN5 D;  4BER A;  1WDY A;  5AQ9 A;  2B0O E;  1YYH A;  2DVW A;  5ENR D;  5EIB E;  4N5Q A;  4OAU C;  5AAO A;  1TR4 A;  3TWV A;  3B7B A;  4YDY A;  3NOG D;  1MX4 A;  3ZUV B;  4A63 B;  5ENT D;  2XEE A;  3T9K A;  4BES A;  3IXE A;  5KWD A;  2BKK B;  4HI9 A;  5ITZ F;  4Z68 A;  1A5E A;  1DCQ A;  4U96 D;  3V2O A;  4J7W A;  5FIN A;  1SVX A;  2L6B A;  1OY3 D;  4DX2 A;  2Y0B G;  1AWC B;  2ZGG A;  1D9S A;  4J8Y A;  4U8V D;  5EID A;  3TWR A;  2F8X K;  3HG0 D;  5AAR A;  2XZD G;  4GMR A;  1IHB A;  1MYO A;  3LJN A;  1MJ0 A;  4TUM A;  5JMN D;  1MX2 A;  5JA4 D;  5KNG A;  2XZT G;  4QQI A;  3V31 A;  4ZFH A;  4HLL A;  1IKN D;  3NBN B;  3JXJ A;  5CBN A;  4HRN A;  1YCS B;  4G8L A;  4QFV A;  2HE0 A;  2F37 A;  2PNN A;  1N11 A;  1SW6 A;  4HI8 A;  1BI7 B;  5HRY A;  4HRL A;  2P2C P;  4F1P A;  5HS0 A;  4RLY A;  3HRA A;  4BET A;  1YMP A;  3Q9N C;  2VGE A;  4K5C A;  3T8K A;  1QYM A;  3V79 K;  4HQD A;  5ENO D;  4CYM D;  3W9F A;  3EHQ A;  1S70 B;  2KBX A;  5D66 A;  2Y1L E;  3ZU7 B;  2KXP C;  3EHR A;  1NFI E;  3NOC D;  4O1P A;  5ENS D;  5KNH D;  5CEC B;  3UI2 A;  3DEO A;  4OAV B;  4O60 A;  1WG0 A;  2ETA A;  4DRX E;  5EYL A;  4B93 B;  1AP7 A;  5HKP A;  1BI8 B;  2ETC A;  3Q9U C;  4ATZ D;  3TWQ A;  5KBA A;  5CBO A;  1N0R A;  5AQ7 A;  2AJA A;  3SO8 A;  5BXO A;  3TWW A;  1IXV A;  2V4H C;  3JXI A;  1UOH A;  4F6R D;  3F6Q A;  5AQB A;  3D9H A;  5CED B;  2J8S D;  1K3Z D;  3TWX A;  4HRM B;  3B95 A;  2RFM A;  2A5E A;  4U95 D;  1MX6 A;  3TWT A;  3TWU A;  5EYP F;  5AQA A;  2DWZ A;  2ETB A;  1K1A A;  4LG6 A;  5CER B;  3W9G A;  2XEH A;  3TWS A;  2MYO A;  4GPM A;  3J5P A;  3ZKJ A;  3V30 A;  4DUI A;  3KEA A;  2DZN A;  3AJI A;  2FO1 E;  4DX6 D;  1DC2 A;  4ZHB A;  1BD8 A;  1K1B A;  2BKG A;  3J5Q B;  4HB5 A;  5ENQ D;  3JUE A;  2RFA A;  4UUC A;  4O1O A;  4LNU D;  4YDW A;  5AN8 A;  5EIL A;  3UXG A;  4CZ2 D;  4K5B A;  4JB8 P;  1N0Q A;  2ZGD A;  2F8Y A;  4LSZ E;  2JAB A;  2NYJ A;  1G3N B;  3AAA C;  4BEP A;  4K5A B;  2QC9 A;  4U8Y D;  3DEP A;  3V2X A;  3C5R A;  3EU9 A;  4DX5 D;  2XEN A;  5BXU A;  4HNA D;  4DX7 D;  4DX1 A;  3ZNG A;  4BSZ B;  1BLX B;  2V5Q C;  5ENP D;  1BU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...