4HLLA

Crystal structure of artificial ankyrin repeat protein_ank(gag)1d4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
154
Chain Sequence
DLGKKLLEAARAGQDDEVRLLLEHGADVNARDSIGSTPLHLAAYYGHLEIVRLLLEHGADVNARDSTGTTPLHYAARLGHLEIVRLLLEHGADVNARDAMGWTPLHLAAKKGHLEIVRLLLKHGADVNANDHFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of Gag bioactive determinants specific to designed ankyrin and interfering in HIV-1 assembly
rcsb
source organism Escherichia coli
molecule tags Protein binding
molecule keywords Ankyrin(GAG)1D4
total genus 55
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hllA00
3ZNGA 1G3NB 5ENPD 4GPMA 1YCSB 3JXIA 4BESA 1D9SA 1OY3D 3JUEA 4LG6A 5AN8A 4O1OA 5EN5D 4BEPA 5HRYA 4HQDA 4DUIA 4HB5A 1N0QA 1BLXB 2RFAA 5EIBE 2Y0BG 3DEPA 1IKND 2KXPC 4HNAD 5ENRD 3NBNB 4YDWA 4K5AB 2BKKB 5AQBA 2FO1E 5ENQD 4LSZE 3V2XA 4DX7D 1N11A 4ZFHA 4OAUC 4RLYA 4HBDA 5CBNA 2XZTG 1K1BA 1OT8A 1YYHA 4Z68A 2DZOA 2KBXA 4U8VD 4DX2A 4U8YD 1AWCB 2F8XK 4K5BA 2BKGA 4OAVB 3NOCD 3KEAA 4DX6D 3C5RA 5FINA 2MYOA 4HI8A 2J8SD 2ETAA 2QYJA 2XEHA 2DVWA 4UUCA 5EYPF 1A5EA 5AQ7A 3V79K 2PNNA 2A5EA 1WDYA 5KNGA 1MJ0A 5AAOA 3J5PA 4CZ2D 1MYOA 5AARA 5AQAA 2XENA 4HRMB 3UI2A 2RFMA 3UXGA 4ATZD 4A63B 5EILA 4QQIA 4U96D 5EIDA 5ENTD 2P2CP 3HRAA 5BXUA 3NOGD 3V30A 1SVXA 1BD8A 3HG0D 5CBOA 5KNHD 1K1AA 4HI9A 2DZNA 1N0RA 2B0OE 2Y1LE 3SO8A 1AP7A 3B95A 5JMND 5FIOA 3JXJA 2VGEA 3DEOA 2V4HC 3EU9A 3B7BA 5EYLA 4DX5D 5KBAA 2HE0A 3AJIA 1BI7B 2NYJA 3AAAC 5HS0A 5KWDA 3Q9UC 1DC2A 4DRXE 4C48B 2ETBA 4BERA 1K3ZD 5CEDB 4O60A 4TUMA 4J7WA 4HRLA 1QYMA 3Q9NC 4J8YA 5D66A 4BETA 1UOHA 4LNUD 5ENSD 1IHBA 2ZGDA 3TWVA 3V31A 2JABA 2AJAA 5ENOD 1MX4A 1DCQA 3IXEA 3UTMA 1SW6A 1NFIE 5BXOA 3ZUVB 2F8YA 4N5QA 4B93B 3ZKJA 4F1PA 4YDYA 4BSZB 1MX2A 1BU9A 1WG0A 3T9KA 1YMPA 2XEEA 2XZDG 4JB8P 4U95D 5AQ9A 1BI8B 3TWSA 2QC9A 3TWRA 3TWQA 4F6RD 1S70B 3TWXA 2F37A 4GMRA 2ETCA 3W9GA 1TR4A 3EHQA 4HLLA 3EHRA 4G8KA 3V2OA 4G8LA 4HRNA 5HKPA 3TWWA 5CEAA 4O1PA 4QFVA 4ZHBA 1MX6A 5CERB 3J5QB 3T8KA 4NIKA 3TWUA 4DX1A 3D9HA 2V5QC 3LJNA 2L6BA 3ZU7B 1IXVA 3F6QA 5JA4D 5CECB 2ZGGA 3W9FA 4CYMD 5ITZF 3TWTA 2DWZA 4K5CA
chains in the Genus database with same CATH superfamily
4K0RA 3VLFA 2PM7A 4FU3A 3ISMC 1N52A 3PZ4A 4LSZE 4ZFHA 4RLYA 5H7PA 2R59A 3LXUX 4DX6D 3EJNA 3ASFA 2J8SD 4UWFA 3Q78A 2XENA 5EDSA 3UT4A 3V30A 5EX3A 1U3CA 3BG0B 2DZNA 4KMOA 2PM6A 5J90A 4Y6CA 3MGBA 3B95A 5JMND 2WB2A 3QAQA 2X6HA 4WUYA 3OAWA 2R05A 2GRRB 3CHOA 3GW4A 3HHMA 4U7EB 1KT1A 3DBSA 5ENOD 1HXIA 1OCZE 5BPPA 4AY6A 4TV3A 3VLDA 1BI8B 4AVXA 1HF8A 2XHEA 3ASHA 2WVIA 5FQ4A 3TG5A 2V5QC 4ACKA 3QOUA 3DWLG 4GPKA 1OWNA 2VSNA 4A3VA 3VTYA 4KVMA 3ASGA 2CHWA 1N94A 4JW1A 5A23A 3S2AA 4EECA 3P2BA 1NA3A 4GTRA 4RQIA 5EIBE 4RVBA 5ENRD 3V2XA 4TRQA 1N11A 3MZLB 3CKBA 4J8DA 2XS1A 4F1SA 3CEQA 2BKGA 4U8HA 1SZ9A 3MYVA 2HYZA 3ZYLA 5EYPF 1N9AA 5AAOA 4CZ2D 3R7RA 4KXKB 1NZNA 2RG8A 3S7DA 5EIDA 4OVUA 4NQ0A 1BD8A 3ZIMA 4PS8A 2XRYA 2VGXB 4U0ZA 2XEVA 4M7CA 1ELWA 3FP3A 2C0MA 2I1JA 3CSFA 4KYOB 2MRIA 4RG6A 5JJ6A 2I2OA 1Z6TA 3OXFA 3PNTB 3ZEFA 4ME2A 5IY5E 5CEDB 4KZCA 4J7WA 1X81A 5D66A 3QDNA 2AJAA 2L9BA 2WXHA 1DCQA 3RRUA 2V4LA 1MQSA 2ZXWE 3UIOC 2I1KA 5AQ9A 3FTUA 2VSOE 4APOA 3FTWA 4UWHA 3KAEA 3T5VA 1TNBA 2PZIA 3CIAA 4CDNA 3IV0A 3L17A 3EIQC 4JEUA 3RIBA 2P9KG 4JXTA 2DIWA 4LNBA 3Q5MA 1KLXA 3R9MA 2Q7FA 3RRNB 4UQYA 5A7DB 3LKUA 2WXMA 2FO1E 4IN3B 2P58C 2F0YA 3HIZA 3LDZA 4X8QA 4ILGA 1IHGA 3ZPJA 4V3IA 3LVQE 4XEIG 2QYJA 5D2MC 3PE3A 1JWFA 1NL4A 1MJ0A 2UY1A 4FJZA 2RFMA 4UQXA 1DVPA 4XIFA 1WAO1 1L5JA 1N54A 4N39A 1TNYA 3JUIA 4HI9A 2B0OE 3SO8A 1TN7A 3FUJA 3CSTA 1E8XA 1TNZA 1OWLA 3SFYA 4GTSA 4FA6A 3SFZA 4UWLA 2J4BA 4J8YA 1LD8A 3CK9A 3L9TA 3LY9A 4LNGA 5LP0A 4GCNA 2WXPA 4G26A 3EHQA 4IRUA 3LEWA 4BWRA 4UI9J 1H6KA 2L6BA 3GZ1A 3PS6A 3CVWA 5CECB 4F3VA 5CCLA 5G05C 2H6FA 4Q69A 1YA0A 4MLPA 3JXIA 1EYHA 2EINE 4O1OA 2QY7A 4HB5A 2P9PG 4OVVA 1H6OA 4FULA 2X3MA 5ANRA 3UT8A 5G04C 4U8YD 3R9AB 5G04J 2J49A 3UM2A 5DBKA 2QFCA 2XEHA 2DVWA 3ZXSA 3FUKA 3X2QE 1FVFA 1DCEA 5EILA 1N4RA 4FADA 3B7UX 4I1MA 2Y1LE 3GZ2A 3SBSA 4L23A 4I2WA 4HS2A 3APDA 3APFA 3CVYA 3OTNA 4GA1A 1OWMA 1HE8A 4HXIA 3IKOB 4ACLA 2RD0A 1K8KG 1NFIE 1XNFA 2YQ8A 5CCMA 1WG0A 4N2QA 2XEEA 2XZDG 3AS8A 5CRUA 1S70B 3NZUA 2ETCA 4YNDA 2KZTA 1NA0A 2I9CA 4HRNA 4HFGA 2E2EA 1IYGA 3T8KA 4CT4A 5T4YA 3UM3A 1TN6A 3EHMA 3UIPC 4J8FA 3ESLA 3ZNGA 4CT0A 2M63A 4JHJA 3CK7A 2OEVA 5CMWA 5EN5D 4DUIA 1E8YA 1N0QA 1IKND 3BEEA 4K5AB 5FZRA 3QNKA 4OAUC 3OXGA 3FY4A 3NQPA 2XZTG 4EZJA 4K5BA 2CHZA 1S64A 4P29A 4YDEA 1A17A 5G55A 2A5UA 3RU0A 1OUVA 1MZCA 2OV8A 3CHMA 4GTTA 3KS2A 4BTBA 4C9BB 4AEZC 2P2CP 3HRAA 3CHSA 1KPSB 1SZAA 3NOGD 4KZ0A 3LJ3A 3JQ0A 1QQEA 1HG2A 3IEGA 4Q96A 3PDNA 3RO2A 3D9PA 4GZ5A 4U04A 3UINC 2DYRE 1DC2A 3T8MA 2IFUA 1K3ZD 5D0OD 2ZIRA 4BETA 1UOHA 3PVLA 1TYQG 5BT1A 3SZ7A 4FC8A 4GB9A 5D0QD 1DNPA 4B93B 4YDYA 1E8WA 1MX2A 5LCWJ 3TWXA 4N3BA 4GYWA 3FUMA 5A6CA 4JVSA 3AU5A 1E7VA 2BUGA 2H6HA 2XGMA 3FU3A 4NACA 1O5MA 5HI7A 4GPMA 2L0IA 2FULA 3WXXA 4MRUA 2Y0BG 3SI5A 3N71A 2BKKB 3DPYA 1TJFA 2EILE 4GYYA 2UWJG 2HM8A 5KJKA 3ASDA 4GTOA 2GW1A 1E90A 3EIJA 2OCCE 4J8EA 1D8DA 5ENTD 3EU5A 2IONA 4ILIA 1SVXA 1UG3A 1D8EA 4I9EA 5BV1A 4XI9A 2Y4TA 1AP7A 3MV3B 5FIOA 3EHNA 3B7BA 4DX5D 3O48A 1Q2ZA 3ASNE 4WNEA 1BI7B 3AAAC 4G24A 1X5BA 3QARA 1N4PA 3HXFA 2EQXA 4I6EA 4HRLA 3ABKE 1IHBA 2JEKA 4DPRA 3PZ3A 2JABA 4F53A 3ML8A 2LUHA 3CGHA 5M72A 1FT1A 2H6GA 2XPIA 3HVEA 2CG3A 5CMYA 3QK0A 4B8CB 5CHEE 2R02A 3IHYA 4G23A 2WXLA 2Y4UA 4W9RA 1LTXA 3QWPA 3KEZA 3OXLA 3W9FA 2OVFA 4I17A 3D3MA 3BUAA 3DSSA 2CFZA 4HQDA 2XS8A 3FULA 4K03A 5AYWD 2KXPC 4HOUA 5ENQD 2WQ6A 4J0UA 2FBNA 2IU1A 4WWOA 5FINA 2MYOA 3O4ZA 3HDXA 2ETAA 4B0ZA 5KJNA 3FH7A 4GCOA 3HVEB 4GA0A 4LERA 4JEHA 4DI4A 2XPYA 4HVBA 1FCHA 3E33A 4URKA 2XCBA 5BV0A 3MEKA 1Z3YA 3D9KA 2HE0A 2KC7A 2P9LG 1PC2A 4TUMA 2DCPA 5ENSD 1MHQA 3CHQA 2WXRA 4TUUA 4N3AA 4L1BA 2XQ0A 1OCRE 3TWQA 3AS4A 1ZB1A 4LEUA 5KJMA 4PH4B 3FU5A 2WXGA 2HR2A 5CERB 4BX9A 2AXUA 2FF4A 2P9NG 4XZ4A 3B7SA 4CRWA 2X38A 4OYSA 2DWZA 4GAAA 1Y8MA 4GMLA 4R7LA 3FU0A 2GRMA 1LF8A 1D9SA 1EPUA 3JUEA 4BT8A 3CVLA 1SA5A 3MJWA 4DI3A 1NI1A 2HO1A 3DPDA 3L16A 4NURA 3S7JA 4HBDA 1TEZA 1YYHA 4AM9A 4BFRA 1EF1C 4B8AA 2PQNA 3PZ2A 5AQ7A 4EZLA 1INZA 2FO7A 2P9IG 1B89A 4XX5A 3TGOA 3QB2A 3UXGA 4QQIA 2IEJA 3JCKC 3RAUA 5CBOA 3G2SA 3TXNA 1Y6IA 5AENA 4YVOA 5JJTA 4JHRA 4WAFA 3CLJA 4WNFA 3E34A 3B13A 4F7AA 4L9PA 3CHPA 1V54E 3B7RL 3UT7A 2C0LA 3ZRHA 4C48B 5C1DA 4BERA 2DYSE 3ZN3A 4AP2A 4GA2A 3I3NA 3Q7AA 4I9CA 3ONLA 4UWKA 2J4DA 2QYUA 3ABME 2X6IA 5AIJA 2F37A 3V2OA 1QZ2A 3TWWA 5LX8A 3SQVA 3FUDA 2WXKA 2VJ8A 2XRZA 4FLBA 4HLEA 2Y3AA 4G2VA 3TJPA 2VSYA 1OY3D 3ZHEB 4EQFA 4JPSA 4DX7D 3D9IA 3C72A 3MCXA 1O1SA 1A5EA 2F8XK 4WWPA 2KCKA 2YHCA 5J08A 3BQOA 4UUCA 2LXMA 5KNGA 2GROB 1KZPA 4A63B 2XPZA 4EHMA 4A1GA 4ATGA 1SA4A 2V0PA 4N5CA 3UQ3A 1FT2A 4J8SA 3ZYMA 5FZQA 4ANWA 3ABLE 1TJCA 1NP7A 2IOLA 2LO6A 4DK5A 4ANXA 5T8IA 2L0TB 1Z5SC 1H2VC 4G11A 3HXBA 2P9UG 3FUEA 4I1AA 4LUNU 4ZHBA 2H6IA 2NSZA 4KBQA 2BTDA 2V5FA 1IXVA 4C0EA 3NB2A 3U9WA 1UJJA 4Y6WA 3BU8A 2EIME 3AG2E 2IQCA 1OCOE 3FDHA 3I4GA 3IBEA 4JC8A 1Z3XA 2VGXA 4GU5A 4I1OB 3D9JA 4WWNA 2LSVA 3G2TA 2AXVA 3P1UA 1WDYA 1JUQA 1UJKA 3SNXA 3U64A 3U4TA 3UM0A 4GTQA 2ZU6B 3IHVA 1K1AA 5CRVA 2L6JA 4FP7A 1HU3A 3LYAA 1H2UA 3TXMA 4AIFA 4FHKA 3D9NA 1H19A 5KWDA 4DRXE 2ETBA 4GTMA 4LNUD 3RK6A 3CQCB 1S63A 1MX4A 5T3RA 5B1AE 3GZSA 4O6FA 4F1PA 3CQGB 3ONKA 1HZ4A 3KD7A 5G05J 4DLQA 3AG3E 4G8KA 3FUFA 2GRPB 3FUHA 4O1PA 3PH0C 3URZA 4I6GA 3APCA 4NIKA 3PZDA 2IO3C 2A4ZA 2VSXE 3CVVA 3I5PA 3G2VA 1OCCE 4U0SA 3UUXA 4IYPA 3QJZA 4L2YA 1FVHA 5ARGA 3Q75A 3ULYA 1O1RA 4HNAD 1ELRA 2R03A 2NC9A 1TN8A 1RZ4A 1PY1A 2X6JA 3QWVA 2DZOA 2XCCA 2KCVA 4OAVB 4U0UA 4A3TA 4HORA 4FLHA 1TNOA 4H7YA 2PNNA 2A5EA 4TXQA 2LAHA 3FU6A 1U2VG 3E32A 3CK8A 2BEDA 3L08A 4WNGA 1WY6A 3C3RA 3MA5A 2WQ7A 3CVPA 1P5QA 3B7TA 1HS6A 3S7BA 5LOZA 3EU9A 3ZYQA 5FQ7A 4G25A 3Q9UC 4M3OA 4ABNA 3HYMB 3C3QA 5EX0A 1TNUA 4AXHA 3CVNA 4CGVA 3TAXA 2VQ2A 3IXEA 1H0AA 3LY8A 1BU9A 2OOEA 4PS7A 4F6RD 2WXOA 2J9QA 2DBAA 3CHRA 3I4RB 4EBAA 3FWVA 3DXMG 1VDYA 4WNDA 3Q73A 5FQ8A 2WQHA 4DX1A 3LJNA 3ZU7B 5DIZA 2BF0X 4CYMD 3CVUA 1JPLA 1YCSB 3DSXA 5E75A 5AN8A 4LG6A 1JCQA 4PDXA 4BEPA 3HXDA 1JCSA 3LVRE 3RSEG 1BLXB 3HXEA 4LCTA 3GYZA 3L82A 2MOWA 4YDWA 3R7QA 4EBAG 2AVPA 5CBNA 1E8ZA 2WXFA 2KM4A 3EDTB 3C5RA 4IULA 2VGYA 2KZTB 3QWWA 1JCRA 3KSLA 1HG5A 2WM9A 5LFAA 2OVBA 5FZSA 3SF4A 2YINA 1RW2A 1MYOA 1S0PA 5EKQD 3MV2B 1ELKA 1OWOA 3G2WA 4A1SA 4GZDA 2FI7A 2B6CA 5FQ6A 4MKTA 3E4BA 2ILRA 5EYLA 3ULEG 2ZISA 3FEXA 4CCAA 2EIJE 1IQRA 4DJAA 3UM1A 4KVOA 3C3OA 2ZGDA 3CV0A 4UI9C 3UKUG 5FT9A 2AWIA 3ZKJA 2CHXA 4BSZB 4EPZA 3U66A 3LS8A 2OEWA 3T9KA 3PNLB 3Q47B 3TWRA 4I43A 3SGHA 3ENEA 4E85A 5CEAA 3FTYA 4AOFA 5JJ7A 2J09A 2V8SE 5FTPA 3AU4A 3BG1B 1G3NB 3FUNA 3UPVA 5ENPD 4BESA 2X6KA 2J08A 4UI9K 3S7FA 4TXRA 4GTPA 5AQBA 3JQ1A 2IF4A 4A55A 3LY7A 3VLEA 1V55E 2KBXA 1AWCB 5C2YA 4PS3A 5B3SE 2LXLA 2WMNA 1QBQA 3J5PA 3MKQB 2IO2C 1HH8A 4ATZD 5ARFA 3EUVA 3HG0D 4FHJA 1HX8A 2IY0C 3MKRA 3ULQA 1H6PA 5BNWA 3JXJA 3ML9A 3PEVB 1PAQA 3L22A 3ZVVA 2NXPA 2IOSA 3NZSA 3FH5A 4KT6B 3T5XA 2KCLA 3Q9NC 4GZCA 3FTVA 3CKCA 5FWQA 2AW6A 3L54A 2F8YA 2AXZA 1KT0A 2J07A 3WG7E 2PQRA 4GMRA 2PL2A 3U3WA 4JA7A 4QFVA 3J5QB 4GTVA 3ESKA 4HOTA 3MKQA 3ZFWA 4RG9A 5JA4D 2ZGGA 2CFUA 5ITZF 3TWTA 1LD7A 3PE4A 3ZW3A 4YDOA 1H2TC 3FHEA 4H7XA 3NBNB 3RRMB 3DSWA 3CR3A 3PZ1A 3LCAA 1K1BA 1N4QA 1OT8A 2ONDA 2YHEA 2RKKA 2VTBA 1E96B 4U63A 4BTAA 4CEMA 4XKCA 4JA9A 1QNFA 4CDRA 4PUCA 5AQAA 3E37A 5ENNA 2LSUA 5BXUA 3ASOE 4BT9A 5G2NA 1HFAA 2WMOA 5KNHD 3DRAA 4J6IA 2VTBB 3QKYA 2XGSA 4MBGA 4JHKA 3DEOA 4CGWA 1ZBPA 3HXCA 4ANVA 4N2SA 1N4SA 4ANUA 3ZXPA 5LCWC 3RO3A 1QYMA 2GRQB 2C2LA 4MS6A 2KATA 1GW6A 3CVXA 2VYIA 2XGOA 3UTMA 1SW6A 4GMJA 3FFLA 2MHKA 4U07A 4U95D 4E6HA 1BPOA 3L13A 1UN9A 4XKBA 4C0MA 4D10C 3PUKA 1MX6A 2E0IA 1UW4B 3TWUA 3TG4A 3D9HA 4XE0A 3F6QA 3PRZA 3NAWA 3UX4A 3UKRG 1EDUA 5E76A 3DXKG 3PEUB 5HRYA 3DEPA 4B89A 2IJGX 3G2UA 4HOQA 4BX8A 5JHAA 2R5SA 3NOCD 3KEAA 3FEYA 3D9MA 4HI8A 1O1TA 4TXPA 3DSVA 1U3DA 5AARA 3UI2A 2R17C 3MX3A 3Q15A 4U96D 3UMVA 1WM5A 4EZKA 4YVQC 3D9OA 1N0RA 5AJDA 3KSQA 3FTXA 4RSYA 5B1BE 5ANLA 4JZYA 3Q49B 2VGEA 2WXNA 2V4HC 4N3CA 5KBAA 2P9SG 3AJIA 5HS0A 1N95A 4GZ6A 3JYSA 3SBTB 4O60A 4UQZA 1OWPA 4CDMA 4APFA 5BW8C 5BXOA 3LPZA 2GGFA 3ZHEA 4B94A 3ZGQA 5KCMA 1YMPA 4UWGA 4JB8P 3SHFA 2QC9A 4GZ3A 2R2LA 1W3BA 3DSUA 5FJYA 4AJWA 5HKPA 2WPVA 4JL0A 3PUJA 3Q7FA 4ILHB 3CVQA 3E30A 1HO8A 4HOSA 3K9IA 5KJLA 4NRHB 3D9LA 3Q4AB 1XGWA 4BY6A 3AS5A 3RJVA 4FJYA 2RFAA 4I6JA 3AG1E 2EIKE 3VTXA 3SD5A 4BSXA 2YNQA 3ZYKA 4Z68A 1JWGA 4U8VD 4DX2A 4AY5A 3FTSA 2GRLA 4LRZA 3RKVA 5HQ8A 3NF1A 5BUZA 3V79K 4JD2G 3AG4E 2LAIA 2WXQA 2WXIA 4HRMB 4AV7A 4Q94A 3L6AA 2UY1B 3FH8A 3SFXA 1KZOA 1ZU2A 4GYOA 1OXJA 2I6HA 4L7TA 1IQUA 3TL5A 2JLBA 4L2LA 2CG2A 5JHBA 3FUIA 2NYJA 3Q79A 2X6FA 5AJLA 2QZAA 2LNIA 1E7UA 1SQMA 3V31A 3TWVA 2WXJA 3QC1A 4G1TA 4XI0A 3ZUVB 3C98A 4N5QA 3DSTA 3TWSA 2GRNB 3SY2A 3W9GA 1TR4A 4HLLA 3EHRA 1FPPA 4G8LA 4I2ZA 1UN8A 4DLOA 2FEZA 3PREA 2Y69E 3FTZA 4K5CA
chains in the Genus database with same CATH topology
3ZNGA 1G3NB 5ENPD 4GPMA 1YCSB 3JXIA 4BESA 1D9SA 1OY3D 3JUEA 4LG6A 5AN8A 4O1OA 5EN5D 4BEPA 5HRYA 4HQDA 4DUIA 4HB5A 1N0QA 1BLXB 2RFAA 5EIBE 2Y0BG 3DEPA 1IKND 2KXPC 4HNAD 5ENRD 3NBNB 4YDWA 4K5AB 2BKKB 5AQBA 2FO1E 5ENQD 4LSZE 3V2XA 4DX7D 1N11A 4ZFHA 4OAUC 4RLYA 4HBDA 5CBNA 2XZTG 1K1BA 1OT8A 1YYHA 4Z68A 2DZOA 2KBXA 4U8VD 4DX2A 4U8YD 1AWCB 2F8XK 4K5BA 2BKGA 4OAVB 3NOCD 3KEAA 4DX6D 3C5RA 5FINA 2MYOA 4HI8A 2J8SD 2ETAA 2QYJA 2XEHA 2DVWA 4UUCA 5EYPF 1A5EA 5AQ7A 3V79K 2PNNA 2A5EA 1WDYA 5KNGA 1MJ0A 5AAOA 3J5PA 4CZ2D 1MYOA 5AARA 5AQAA 2XENA 4HRMB 3UI2A 2RFMA 3UXGA 4ATZD 4A63B 5EILA 4QQIA 4U96D 5EIDA 5ENTD 2P2CP 3HRAA 5BXUA 3NOGD 3V30A 1SVXA 1BD8A 3HG0D 5CBOA 5KNHD 1K1AA 4HI9A 2DZNA 1N0RA 2B0OE 2Y1LE 3SO8A 1AP7A 3B95A 5JMND 5FIOA 3JXJA 2VGEA 3DEOA 2V4HC 3EU9A 3B7BA 5EYLA 4DX5D 5KBAA 2HE0A 3AJIA 1BI7B 2NYJA 3AAAC 5HS0A 5KWDA 3Q9UC 1DC2A 4DRXE 4C48B 2ETBA 4BERA 1K3ZD 5CEDB 4O60A 4TUMA 4J7WA 4HRLA 1QYMA 3Q9NC 4J8YA 5D66A 4BETA 1UOHA 4LNUD 5ENSD 1IHBA 2ZGDA 3TWVA 3V31A 2JABA 2AJAA 5ENOD 1MX4A 1DCQA 3IXEA 3UTMA 1SW6A 1NFIE 5BXOA 3ZUVB 2F8YA 4N5QA 4B93B 3ZKJA 4F1PA 4YDYA 4BSZB 1MX2A 1BU9A 1WG0A 3T9KA 1YMPA 2XEEA 2XZDG 4JB8P 4U95D 5AQ9A 1BI8B 3TWSA 2QC9A 3TWRA 3TWQA 4F6RD 1S70B 3TWXA 2F37A 4GMRA 2ETCA 3W9GA 1TR4A 3EHQA 4HLLA 3EHRA 4G8KA 3V2OA 4G8LA 4HRNA 5HKPA 3TWWA 5CEAA 4O1PA 4QFVA 4ZHBA 1MX6A 5CERB 3J5QB 3T8KA 4NIKA 3TWUA 4DX1A 3D9HA 2V5QC 3LJNA 2L6BA 3ZU7B 1IXVA 3F6QA 5JA4D 5CECB 2ZGGA 3W9FA 4CYMD 5ITZF 3TWTA 2DWZA 4K5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNG A;  1G3N B;  5ENP D;  4GPM A;  1YCS B;  3JXI A;  4BES A;  1D9S A;  1OY3 D;  3JUE A;  4LG6 A;  5AN8 A;  4O1O A;  5EN5 D;  4BEP A;  5HRY A;  4HQD A;  4DUI A;  4HB5 A;  1N0Q A;  1BLX B;  2RFA A;  5EIB E;  2Y0B G;  3DEP A;  1IKN D;  2KXP C;  4HNA D;  5ENR D;  3NBN B;  4YDW A;  4K5A B;  2BKK B;  5AQB A;  2FO1 E;  5ENQ D;  4LSZ E;  3V2X A;  4DX7 D;  1N11 A;  4ZFH A;  4OAU C;  4RLY A;  4HBD A;  5CBN A;  2XZT G;  1K1B A;  1OT8 A;  1YYH A;  4Z68 A;  2DZO A;  2KBX A;  4U8V D;  4DX2 A;  4U8Y D;  1AWC B;  2F8X K;  4K5B A;  2BKG A;  4OAV B;  3NOC D;  3KEA A;  4DX6 D;  3C5R A;  5FIN A;  2MYO A;  4HI8 A;  2J8S D;  2ETA A;  2QYJ A;  2XEH A;  2DVW A;  4UUC A;  5EYP F;  1A5E A;  5AQ7 A;  3V79 K;  2PNN A;  2A5E A;  1WDY A;  5KNG A;  1MJ0 A;  5AAO A;  3J5P A;  4CZ2 D;  1MYO A;  5AAR A;  5AQA A;  2XEN A;  4HRM B;  3UI2 A;  2RFM A;  3UXG A;  4ATZ D;  4A63 B;  5EIL A;  4QQI A;  4U96 D;  5EID A;  5ENT D;  2P2C P;  3HRA A;  5BXU A;  3NOG D;  3V30 A;  1SVX A;  1BD8 A;  3HG0 D;  5CBO A;  5KNH D;  1K1A A;  4HI9 A;  2DZN A;  1N0R A;  2B0O E;  2Y1L E;  3SO8 A;  1AP7 A;  3B95 A;  5JMN D;  5FIO A;  3JXJ A;  2VGE A;  3DEO A;  2V4H C;  3EU9 A;  3B7B A;  5EYL A;  4DX5 D;  5KBA A;  2HE0 A;  3AJI A;  1BI7 B;  2NYJ A;  3AAA C;  5HS0 A;  5KWD A;  3Q9U C;  1DC2 A;  4DRX E;  4C48 B;  2ETB A;  4BER A;  1K3Z D;  5CED B;  4O60 A;  4TUM A;  4J7W A;  4HRL A;  1QYM A;  3Q9N C;  4J8Y A;  5D66 A;  4BET A;  1UOH A;  4LNU D;  5ENS D;  1IHB A;  2ZGD A;  3TWV A;  3V31 A;  2JAB A;  2AJA A;  5ENO D;  1MX4 A;  1DCQ A;  3IXE A;  3UTM A;  1SW6 A;  1NFI E;  5BXO A;  3ZUV B;  2F8Y A;  4N5Q A;  4B93 B;  3ZKJ A;  4F1P A;  4YDY A;  4BSZ B;  1MX2 A;  1BU9 A;  1WG0 A;  3T9K A;  1YMP A;  2XEE A;  2XZD G;  4JB8 P;  4U95 D;  5AQ9 A;  1BI8 B;  3TWS A;  2QC9 A;  3TWR A;  3TWQ A;  4F6R D;  1S70 B;  3TWX A;  2F37 A;  4GMR A;  2ETC A;  3W9G A;  1TR4 A;  3EHQ A;  4HLL A;  3EHR A;  4G8K A;  3V2O A;  4G8L A;  4HRN A;  5HKP A;  3TWW A;  5CEA A;  4O1P A;  4QFV A;  4ZHB A;  1MX6 A;  5CER B;  3J5Q B;  3T8K A;  4NIK A;  3TWU A;  4DX1 A;  3D9H A;  2V5Q C;  3LJN A;  2L6B A;  3ZU7 B;  1IXV A;  3F6Q A;  5JA4 D;  5CEC B;  2ZGG A;  3W9F A;  4CYM D;  5ITZ F;  3TWT A;  2DWZ A;  4K5C A; 
#chains in the Genus database with same CATH topology
 4K0R A;  3VLF A;  2PM7 A;  4FU3 A;  3ISM C;  1N52 A;  3PZ4 A;  4LSZ E;  4ZFH A;  4RLY A;  5H7P A;  2R59 A;  3LXU X;  4DX6 D;  3EJN A;  3ASF A;  2J8S D;  4UWF A;  3Q78 A;  2XEN A;  5EDS A;  3UT4 A;  3V30 A;  5EX3 A;  1U3C A;  3BG0 B;  2DZN A;  4KMO A;  2PM6 A;  5J90 A;  4Y6C A;  3MGB A;  3B95 A;  5JMN D;  2WB2 A;  3QAQ A;  2X6H A;  4WUY A;  3OAW A;  2R05 A;  2GRR B;  3CHO A;  3GW4 A;  3HHM A;  4U7E B;  1KT1 A;  3DBS A;  5ENO D;  1HXI A;  1OCZ E;  5BPP A;  4AY6 A;  4TV3 A;  3VLD A;  1BI8 B;  4AVX A;  1HF8 A;  2XHE A;  3ASH A;  2WVI A;  5FQ4 A;  3TG5 A;  2V5Q C;  4ACK A;  3QOU A;  3DWL G;  4GPK A;  1OWN A;  2VSN A;  4A3V A;  3VTY A;  4KVM A;  3ASG A;  2CHW A;  1N94 A;  4JW1 A;  5A23 A;  3S2A A;  4EEC A;  3P2B A;  1NA3 A;  4GTR A;  4RQI A;  5EIB E;  4RVB A;  5ENR D;  3V2X A;  4TRQ A;  1N11 A;  3MZL B;  3CKB A;  4J8D A;  2XS1 A;  4F1S A;  3CEQ A;  2BKG A;  4U8H A;  1SZ9 A;  3MYV A;  2HYZ A;  3ZYL A;  5EYP F;  1N9A A;  5AAO A;  4CZ2 D;  3R7R A;  4KXK B;  1NZN A;  2RG8 A;  3S7D A;  5EID A;  4OVU A;  4NQ0 A;  1BD8 A;  3ZIM A;  4PS8 A;  2XRY A;  2VGX B;  4U0Z A;  2XEV A;  4M7C A;  1ELW A;  3FP3 A;  2C0M A;  2I1J A;  3CSF A;  4KYO B;  2MRI A;  4RG6 A;  5JJ6 A;  2I2O A;  1Z6T A;  3OXF A;  3PNT B;  3ZEF A;  4ME2 A;  5IY5 E;  5CED B;  4KZC A;  4J7W A;  1X81 A;  5D66 A;  3QDN A;  2AJA A;  2L9B A;  2WXH A;  1DCQ A;  3RRU A;  2V4L A;  1MQS A;  2ZXW E;  3UIO C;  2I1K A;  5AQ9 A;  3FTU A;  2VSO E;  4APO A;  3FTW A;  4UWH A;  3KAE A;  3T5V A;  1TNB A;  2PZI A;  3CIA A;  4CDN A;  3IV0 A;  3L17 A;  3EIQ C;  4JEU A;  3RIB A;  2P9K G;  4JXT A;  2DIW A;  4LNB A;  3Q5M A;  1KLX A;  3R9M A;  2Q7F A;  3RRN B;  4UQY A;  5A7D B;  3LKU A;  2WXM A;  2FO1 E;  4IN3 B;  2P58 C;  2F0Y A;  3HIZ A;  3LDZ A;  4X8Q A;  4ILG A;  1IHG A;  3ZPJ A;  4V3I A;  3LVQ E;  4XEI G;  2QYJ A;  5D2M C;  3PE3 A;  1JWF A;  1NL4 A;  1MJ0 A;  2UY1 A;  4FJZ A;  2RFM A;  4UQX A;  1DVP A;  4XIF A;  1WAO 1;  1L5J A;  1N54 A;  4N39 A;  1TNY A;  3JUI A;  4HI9 A;  2B0O E;  3SO8 A;  1TN7 A;  3FUJ A;  3CST A;  1E8X A;  1TNZ A;  1OWL A;  3SFY A;  4GTS A;  4FA6 A;  3SFZ A;  4UWL A;  2J4B A;  4J8Y A;  1LD8 A;  3CK9 A;  3L9T A;  3LY9 A;  4LNG A;  5LP0 A;  4GCN A;  2WXP A;  4G26 A;  3EHQ A;  4IRU A;  3LEW A;  4BWR A;  4UI9 J;  1H6K A;  2L6B A;  3GZ1 A;  3PS6 A;  3CVW A;  5CEC B;  4F3V A;  5CCL A;  5G05 C;  2H6F A;  4Q69 A;  1YA0 A;  4MLP A;  3JXI A;  1EYH A;  2EIN E;  4O1O A;  2QY7 A;  4HB5 A;  2P9P G;  4OVV A;  1H6O A;  4FUL A;  2X3M A;  5ANR A;  3UT8 A;  5G04 C;  4U8Y D;  3R9A B;  5G04 J;  2J49 A;  3UM2 A;  5DBK A;  2QFC A;  2XEH A;  2DVW A;  3ZXS A;  3FUK A;  3X2Q E;  1FVF A;  1DCE A;  5EIL A;  1N4R A;  4FAD A;  3B7U X;  4I1M A;  2Y1L E;  3GZ2 A;  3SBS A;  4L23 A;  4I2W A;  4HS2 A;  3APD A;  3APF A;  3CVY A;  3OTN A;  4GA1 A;  1OWM A;  1HE8 A;  4HXI A;  3IKO B;  4ACL A;  2RD0 A;  1K8K G;  1NFI E;  1XNF A;  2YQ8 A;  5CCM A;  1WG0 A;  4N2Q A;  2XEE A;  2XZD G;  3AS8 A;  5CRU A;  1S70 B;  3NZU A;  2ETC A;  4YND A;  2KZT A;  1NA0 A;  2I9C A;  4HRN A;  4HFG A;  2E2E A;  1IYG A;  3T8K A;  4CT4 A;  5T4Y A;  3UM3 A;  1TN6 A;  3EHM A;  3UIP C;  4J8F A;  3ESL A;  3ZNG A;  4CT0 A;  2M63 A;  4JHJ A;  3CK7 A;  2OEV A;  5CMW A;  5EN5 D;  4DUI A;  1E8Y A;  1N0Q A;  1IKN D;  3BEE A;  4K5A B;  5FZR A;  3QNK A;  4OAU C;  3OXG A;  3FY4 A;  3NQP A;  2XZT G;  4EZJ A;  4K5B A;  2CHZ A;  1S64 A;  4P29 A;  4YDE A;  1A17 A;  5G55 A;  2A5U A;  3RU0 A;  1OUV A;  1MZC A;  2OV8 A;  3CHM A;  4GTT A;  3KS2 A;  4BTB A;  4C9B B;  4AEZ C;  2P2C P;  3HRA A;  3CHS A;  1KPS B;  1SZA A;  3NOG D;  4KZ0 A;  3LJ3 A;  3JQ0 A;  1QQE A;  1HG2 A;  3IEG A;  4Q96 A;  3PDN A;  3RO2 A;  3D9P A;  4GZ5 A;  4U04 A;  3UIN C;  2DYR E;  1DC2 A;  3T8M A;  2IFU A;  1K3Z D;  5D0O D;  2ZIR A;  4BET A;  1UOH A;  3PVL A;  1TYQ G;  5BT1 A;  3SZ7 A;  4FC8 A;  4GB9 A;  5D0Q D;  1DNP A;  4B93 B;  4YDY A;  1E8W A;  1MX2 A;  5LCW J;  3TWX A;  4N3B A;  4GYW A;  3FUM A;  5A6C A;  4JVS A;  3AU5 A;  1E7V A;  2BUG A;  2H6H A;  2XGM A;  3FU3 A;  4NAC A;  1O5M A;  5HI7 A;  4GPM A;  2L0I A;  2FUL A;  3WXX A;  4MRU A;  2Y0B G;  3SI5 A;  3N71 A;  2BKK B;  3DPY A;  1TJF A;  2EIL E;  4GYY A;  2UWJ G;  2HM8 A;  5KJK A;  3ASD A;  4GTO A;  2GW1 A;  1E90 A;  3EIJ A;  2OCC E;  4J8E A;  1D8D A;  5ENT D;  3EU5 A;  2ION A;  4ILI A;  1SVX A;  1UG3 A;  1D8E A;  4I9E A;  5BV1 A;  4XI9 A;  2Y4T A;  1AP7 A;  3MV3 B;  5FIO A;  3EHN A;  3B7B A;  4DX5 D;  3O48 A;  1Q2Z A;  3ASN E;  4WNE A;  1BI7 B;  3AAA C;  4G24 A;  1X5B A;  3QAR A;  1N4P A;  3HXF A;  2EQX A;  4I6E A;  4HRL A;  3ABK E;  1IHB A;  2JEK A;  4DPR A;  3PZ3 A;  2JAB A;  4F53 A;  3ML8 A;  2LUH A;  3CGH A;  5M72 A;  1FT1 A;  2H6G A;  2XPI A;  3HVE A;  2CG3 A;  5CMY A;  3QK0 A;  4B8C B;  5CHE E;  2R02 A;  3IHY A;  4G23 A;  2WXL A;  2Y4U A;  4W9R A;  1LTX A;  3QWP A;  3KEZ A;  3OXL A;  3W9F A;  2OVF A;  4I17 A;  3D3M A;  3BUA A;  3DSS A;  2CFZ A;  4HQD A;  2XS8 A;  3FUL A;  4K03 A;  5AYW D;  2KXP C;  4HOU A;  5ENQ D;  2WQ6 A;  4J0U A;  2FBN A;  2IU1 A;  4WWO A;  5FIN A;  2MYO A;  3O4Z A;  3HDX A;  2ETA A;  4B0Z A;  5KJN A;  3FH7 A;  4GCO A;  3HVE B;  4GA0 A;  4LER A;  4JEH A;  4DI4 A;  2XPY A;  4HVB A;  1FCH A;  3E33 A;  4URK A;  2XCB A;  5BV0 A;  3MEK A;  1Z3Y A;  3D9K A;  2HE0 A;  2KC7 A;  2P9L G;  1PC2 A;  4TUM A;  2DCP A;  5ENS D;  1MHQ A;  3CHQ A;  2WXR A;  4TUU A;  4N3A A;  4L1B A;  2XQ0 A;  1OCR E;  3TWQ A;  3AS4 A;  1ZB1 A;  4LEU A;  5KJM A;  4PH4 B;  3FU5 A;  2WXG A;  2HR2 A;  5CER B;  4BX9 A;  2AXU A;  2FF4 A;  2P9N G;  4XZ4 A;  3B7S A;  4CRW A;  2X38 A;  4OYS A;  2DWZ A;  4GAA A;  1Y8M A;  4GML A;  4R7L A;  3FU0 A;  2GRM A;  1LF8 A;  1D9S A;  1EPU A;  3JUE A;  4BT8 A;  3CVL A;  1SA5 A;  3MJW A;  4DI3 A;  1NI1 A;  2HO1 A;  3DPD A;  3L16 A;  4NUR A;  3S7J A;  4HBD A;  1TEZ A;  1YYH A;  4AM9 A;  4BFR A;  1EF1 C;  4B8A A;  2PQN A;  3PZ2 A;  5AQ7 A;  4EZL A;  1INZ A;  2FO7 A;  2P9I G;  1B89 A;  4XX5 A;  3TGO A;  3QB2 A;  3UXG A;  4QQI A;  2IEJ A;  3JCK C;  3RAU A;  5CBO A;  3G2S A;  3TXN A;  1Y6I A;  5AEN A;  4YVO A;  5JJT A;  4JHR A;  4WAF A;  3CLJ A;  4WNF A;  3E34 A;  3B13 A;  4F7A A;  4L9P A;  3CHP A;  1V54 E;  3B7R L;  3UT7 A;  2C0L A;  3ZRH A;  4C48 B;  5C1D A;  4BER A;  2DYS E;  3ZN3 A;  4AP2 A;  4GA2 A;  3I3N A;  3Q7A A;  4I9C A;  3ONL A;  4UWK A;  2J4D A;  2QYU A;  3ABM E;  2X6I A;  5AIJ A;  2F37 A;  3V2O A;  1QZ2 A;  3TWW A;  5LX8 A;  3SQV A;  3FUD A;  2WXK A;  2VJ8 A;  2XRZ A;  4FLB A;  4HLE A;  2Y3A A;  4G2V A;  3TJP A;  2VSY A;  1OY3 D;  3ZHE B;  4EQF A;  4JPS A;  4DX7 D;  3D9I A;  3C72 A;  3MCX A;  1O1S A;  1A5E A;  2F8X K;  4WWP A;  2KCK A;  2YHC A;  5J08 A;  3BQO A;  4UUC A;  2LXM A;  5KNG A;  2GRO B;  1KZP A;  4A63 B;  2XPZ A;  4EHM A;  4A1G A;  4ATG A;  1SA4 A;  2V0P A;  4N5C A;  3UQ3 A;  1FT2 A;  4J8S A;  3ZYM A;  5FZQ A;  4ANW A;  3ABL E;  1TJC A;  1NP7 A;  2IOL A;  2LO6 A;  4DK5 A;  4ANX A;  5T8I A;  2L0T B;  1Z5S C;  1H2V C;  4G11 A;  3HXB A;  2P9U G;  3FUE A;  4I1A A;  4LUN U;  4ZHB A;  2H6I A;  2NSZ A;  4KBQ A;  2BTD A;  2V5F A;  1IXV A;  4C0E A;  3NB2 A;  3U9W A;  1UJJ A;  4Y6W A;  3BU8 A;  2EIM E;  3AG2 E;  2IQC A;  1OCO E;  3FDH A;  3I4G A;  3IBE A;  4JC8 A;  1Z3X A;  2VGX A;  4GU5 A;  4I1O B;  3D9J A;  4WWN A;  2LSV A;  3G2T A;  2AXV A;  3P1U A;  1WDY A;  1JUQ A;  1UJK A;  3SNX A;  3U64 A;  3U4T A;  3UM0 A;  4GTQ A;  2ZU6 B;  3IHV A;  1K1A A;  5CRV A;  2L6J A;  4FP7 A;  1HU3 A;  3LYA A;  1H2U A;  3TXM A;  4AIF A;  4FHK A;  3D9N A;  1H19 A;  5KWD A;  4DRX E;  2ETB A;  4GTM A;  4LNU D;  3RK6 A;  3CQC B;  1S63 A;  1MX4 A;  5T3R A;  5B1A E;  3GZS A;  4O6F A;  4F1P A;  3CQG B;  3ONK A;  1HZ4 A;  3KD7 A;  5G05 J;  4DLQ A;  3AG3 E;  4G8K A;  3FUF A;  2GRP B;  3FUH A;  4O1P A;  3PH0 C;  3URZ A;  4I6G A;  3APC A;  4NIK A;  3PZD A;  2IO3 C;  2A4Z A;  2VSX E;  3CVV A;  3I5P A;  3G2V A;  1OCC E;  4U0S A;  3UUX A;  4IYP A;  3QJZ A;  4L2Y A;  1FVH A;  5ARG A;  3Q75 A;  3ULY A;  1O1R A;  4HNA D;  1ELR A;  2R03 A;  2NC9 A;  1TN8 A;  1RZ4 A;  1PY1 A;  2X6J A;  3QWV A;  2DZO A;  2XCC A;  2KCV A;  4OAV B;  4U0U A;  4A3T A;  4HOR A;  4FLH A;  1TNO A;  4H7Y A;  2PNN A;  2A5E A;  4TXQ A;  2LAH A;  3FU6 A;  1U2V G;  3E32 A;  3CK8 A;  2BED A;  3L08 A;  4WNG A;  1WY6 A;  3C3R A;  3MA5 A;  2WQ7 A;  3CVP A;  1P5Q A;  3B7T A;  1HS6 A;  3S7B A;  5LOZ A;  3EU9 A;  3ZYQ A;  5FQ7 A;  4G25 A;  3Q9U C;  4M3O A;  4ABN A;  3HYM B;  3C3Q A;  5EX0 A;  1TNU A;  4AXH A;  3CVN A;  4CGV A;  3TAX A;  2VQ2 A;  3IXE A;  1H0A A;  3LY8 A;  1BU9 A;  2OOE A;  4PS7 A;  4F6R D;  2WXO A;  2J9Q A;  2DBA A;  3CHR A;  3I4R B;  4EBA A;  3FWV A;  3DXM G;  1VDY A;  4WND A;  3Q73 A;  5FQ8 A;  2WQH A;  4DX1 A;  3LJN A;  3ZU7 B;  5DIZ A;  2BF0 X;  4CYM D;  3CVU A;  1JPL A;  1YCS B;  3DSX A;  5E75 A;  5AN8 A;  4LG6 A;  1JCQ A;  4PDX A;  4BEP A;  3HXD A;  1JCS A;  3LVR E;  3RSE G;  1BLX B;  3HXE A;  4LCT A;  3GYZ A;  3L82 A;  2MOW A;  4YDW A;  3R7Q A;  4EBA G;  2AVP A;  5CBN A;  1E8Z A;  2WXF A;  2KM4 A;  3EDT B;  3C5R A;  4IUL A;  2VGY A;  2KZT B;  3QWW A;  1JCR A;  3KSL A;  1HG5 A;  2WM9 A;  5LFA A;  2OVB A;  5FZS A;  3SF4 A;  2YIN A;  1RW2 A;  1MYO A;  1S0P A;  5EKQ D;  3MV2 B;  1ELK A;  1OWO A;  3G2W A;  4A1S A;  4GZD A;  2FI7 A;  2B6C A;  5FQ6 A;  4MKT A;  3E4B A;  2ILR A;  5EYL A;  3ULE G;  2ZIS A;  3FEX A;  4CCA A;  2EIJ E;  1IQR A;  4DJA A;  3UM1 A;  4KVO A;  3C3O A;  2ZGD A;  3CV0 A;  4UI9 C;  3UKU G;  5FT9 A;  2AWI A;  3ZKJ A;  2CHX A;  4BSZ B;  4EPZ A;  3U66 A;  3LS8 A;  2OEW A;  3T9K A;  3PNL B;  3Q47 B;  3TWR A;  4I43 A;  3SGH A;  3ENE A;  4E85 A;  5CEA A;  3FTY A;  4AOF A;  5JJ7 A;  2J09 A;  2V8S E;  5FTP A;  3AU4 A;  3BG1 B;  1G3N B;  3FUN A;  3UPV A;  5ENP D;  4BES A;  2X6K A;  2J08 A;  4UI9 K;  3S7F A;  4TXR A;  4GTP A;  5AQB A;  3JQ1 A;  2IF4 A;  4A55 A;  3LY7 A;  3VLE A;  1V55 E;  2KBX A;  1AWC B;  5C2Y A;  4PS3 A;  5B3S E;  2LXL A;  2WMN A;  1QBQ A;  3J5P A;  3MKQ B;  2IO2 C;  1HH8 A;  4ATZ D;  5ARF A;  3EUV A;  3HG0 D;  4FHJ A;  1HX8 A;  2IY0 C;  3MKR A;  3ULQ A;  1H6P A;  5BNW A;  3JXJ A;  3ML9 A;  3PEV B;  1PAQ A;  3L22 A;  3ZVV A;  2NXP A;  2IOS A;  3NZS A;  3FH5 A;  4KT6 B;  3T5X A;  2KCL A;  3Q9N C;  4GZC A;  3FTV A;  3CKC A;  5FWQ A;  2AW6 A;  3L54 A;  2F8Y A;  2AXZ A;  1KT0 A;  2J07 A;  3WG7 E;  2PQR A;  4GMR A;  2PL2 A;  3U3W A;  4JA7 A;  4QFV A;  3J5Q B;  4GTV A;  3ESK A;  4HOT A;  3MKQ A;  3ZFW A;  4RG9 A;  5JA4 D;  2ZGG A;  2CFU A;  5ITZ F;  3TWT A;  1LD7 A;  3PE4 A;  3ZW3 A;  4YDO A;  1H2T C;  3FHE A;  4H7X A;  3NBN B;  3RRM B;  3DSW A;  3CR3 A;  3PZ1 A;  3LCA A;  1K1B A;  1N4Q A;  1OT8 A;  2OND A;  2YHE A;  2RKK A;  2VTB A;  1E96 B;  4U63 A;  4BTA A;  4CEM A;  4XKC A;  4JA9 A;  1QNF A;  4CDR A;  4PUC A;  5AQA A;  3E37 A;  5ENN A;  2LSU A;  5BXU A;  3ASO E;  4BT9 A;  5G2N A;  1HFA A;  2WMO A;  5KNH D;  3DRA A;  4J6I A;  2VTB B;  3QKY A;  2XGS A;  4MBG A;  4JHK A;  3DEO A;  4CGW A;  1ZBP A;  3HXC A;  4ANV A;  4N2S A;  1N4S A;  4ANU A;  3ZXP A;  5LCW C;  3RO3 A;  1QYM A;  2GRQ B;  2C2L A;  4MS6 A;  2KAT A;  1GW6 A;  3CVX A;  2VYI A;  2XGO A;  3UTM A;  1SW6 A;  4GMJ A;  3FFL A;  2MHK A;  4U07 A;  4U95 D;  4E6H A;  1BPO A;  3L13 A;  1UN9 A;  4XKB A;  4C0M A;  4D10 C;  3PUK A;  1MX6 A;  2E0I A;  1UW4 B;  3TWU A;  3TG4 A;  3D9H A;  4XE0 A;  3F6Q A;  3PRZ A;  3NAW A;  3UX4 A;  3UKR G;  1EDU A;  5E76 A;  3DXK G;  3PEU B;  5HRY A;  3DEP A;  4B89 A;  2IJG X;  3G2U A;  4HOQ A;  4BX8 A;  5JHA A;  2R5S A;  3NOC D;  3KEA A;  3FEY A;  3D9M A;  4HI8 A;  1O1T A;  4TXP A;  3DSV A;  1U3D A;  5AAR A;  3UI2 A;  2R17 C;  3MX3 A;  3Q15 A;  4U96 D;  3UMV A;  1WM5 A;  4EZK A;  4YVQ C;  3D9O A;  1N0R A;  5AJD A;  3KSQ A;  3FTX A;  4RSY A;  5B1B E;  5ANL A;  4JZY A;  3Q49 B;  2VGE A;  2WXN A;  2V4H C;  4N3C A;  5KBA A;  2P9S G;  3AJI A;  5HS0 A;  1N95 A;  4GZ6 A;  3JYS A;  3SBT B;  4O60 A;  4UQZ A;  1OWP A;  4CDM A;  4APF A;  5BW8 C;  5BXO A;  3LPZ A;  2GGF A;  3ZHE A;  4B94 A;  3ZGQ A;  5KCM A;  1YMP A;  4UWG A;  4JB8 P;  3SHF A;  2QC9 A;  4GZ3 A;  2R2L A;  1W3B A;  3DSU A;  5FJY A;  4AJW A;  5HKP A;  2WPV A;  4JL0 A;  3PUJ A;  3Q7F A;  4ILH B;  3CVQ A;  3E30 A;  1HO8 A;  4HOS A;  3K9I A;  5KJL A;  4NRH B;  3D9L A;  3Q4A B;  1XGW A;  4BY6 A;  3AS5 A;  3RJV A;  4FJY A;  2RFA A;  4I6J A;  3AG1 E;  2EIK E;  3VTX A;  3SD5 A;  4BSX A;  2YNQ A;  3ZYK A;  4Z68 A;  1JWG A;  4U8V D;  4DX2 A;  4AY5 A;  3FTS A;  2GRL A;  4LRZ A;  3RKV A;  5HQ8 A;  3NF1 A;  5BUZ A;  3V79 K;  4JD2 G;  3AG4 E;  2LAI A;  2WXQ A;  2WXI A;  4HRM B;  4AV7 A;  4Q94 A;  3L6A A;  2UY1 B;  3FH8 A;  3SFX A;  1KZO A;  1ZU2 A;  4GYO A;  1OXJ A;  2I6H A;  4L7T A;  1IQU A;  3TL5 A;  2JLB A;  4L2L A;  2CG2 A;  5JHB A;  3FUI A;  2NYJ A;  3Q79 A;  2X6F A;  5AJL A;  2QZA A;  2LNI A;  1E7U A;  1SQM A;  3V31 A;  3TWV A;  2WXJ A;  3QC1 A;  4G1T A;  4XI0 A;  3ZUV B;  3C98 A;  4N5Q A;  3DST A;  3TWS A;  2GRN B;  3SY2 A;  3W9G A;  1TR4 A;  4HLL A;  3EHR A;  1FPP A;  4G8L A;  4I2Z A;  1UN8 A;  4DLO A;  2FEZ A;  3PRE A;  2Y69 E;  3FTZ A;  4K5C A; 
#chains in the Genus database with same CATH homology
 3ZNG A;  1G3N B;  5ENP D;  4GPM A;  1YCS B;  3JXI A;  4BES A;  1D9S A;  1OY3 D;  3JUE A;  4LG6 A;  5AN8 A;  4O1O A;  5EN5 D;  4BEP A;  5HRY A;  4HQD A;  4DUI A;  4HB5 A;  1N0Q A;  1BLX B;  2RFA A;  5EIB E;  2Y0B G;  3DEP A;  1IKN D;  2KXP C;  4HNA D;  5ENR D;  3NBN B;  4YDW A;  4K5A B;  2BKK B;  5AQB A;  2FO1 E;  5ENQ D;  4LSZ E;  3V2X A;  4DX7 D;  1N11 A;  4ZFH A;  4OAU C;  4RLY A;  4HBD A;  5CBN A;  2XZT G;  1K1B A;  1OT8 A;  1YYH A;  4Z68 A;  2DZO A;  2KBX A;  4U8V D;  4DX2 A;  4U8Y D;  1AWC B;  2F8X K;  4K5B A;  2BKG A;  4OAV B;  3NOC D;  3KEA A;  4DX6 D;  3C5R A;  5FIN A;  2MYO A;  4HI8 A;  2J8S D;  2ETA A;  2QYJ A;  2XEH A;  2DVW A;  4UUC A;  5EYP F;  1A5E A;  5AQ7 A;  3V79 K;  2PNN A;  2A5E A;  1WDY A;  5KNG A;  1MJ0 A;  5AAO A;  3J5P A;  4CZ2 D;  1MYO A;  5AAR A;  5AQA A;  2XEN A;  4HRM B;  3UI2 A;  2RFM A;  3UXG A;  4ATZ D;  4A63 B;  5EIL A;  4QQI A;  4U96 D;  5EID A;  5ENT D;  2P2C P;  3HRA A;  5BXU A;  3NOG D;  3V30 A;  1SVX A;  1BD8 A;  3HG0 D;  5CBO A;  5KNH D;  1K1A A;  4HI9 A;  2DZN A;  1N0R A;  2B0O E;  2Y1L E;  3SO8 A;  1AP7 A;  3B95 A;  5JMN D;  5FIO A;  3JXJ A;  2VGE A;  3DEO A;  2V4H C;  3EU9 A;  3B7B A;  5EYL A;  4DX5 D;  5KBA A;  2HE0 A;  3AJI A;  1BI7 B;  2NYJ A;  3AAA C;  5HS0 A;  5KWD A;  3Q9U C;  1DC2 A;  4DRX E;  4C48 B;  2ETB A;  4BER A;  1K3Z D;  5CED B;  4O60 A;  4TUM A;  4J7W A;  4HRL A;  1QYM A;  3Q9N C;  4J8Y A;  5D66 A;  4BET A;  1UOH A;  4LNU D;  5ENS D;  1IHB A;  2ZGD A;  3TWV A;  3V31 A;  2JAB A;  2AJA A;  5ENO D;  1MX4 A;  1DCQ A;  3IXE A;  3UTM A;  1SW6 A;  1NFI E;  5BXO A;  3ZUV B;  2F8Y A;  4N5Q A;  4B93 B;  3ZKJ A;  4F1P A;  4YDY A;  4BSZ B;  1MX2 A;  1BU9 A;  1WG0 A;  3T9K A;  1YMP A;  2XEE A;  2XZD G;  4JB8 P;  4U95 D;  5AQ9 A;  1BI8 B;  3TWS A;  2QC9 A;  3TWR A;  3TWQ A;  4F6R D;  1S70 B;  3TWX A;  2F37 A;  4GMR A;  2ETC A;  3W9G A;  1TR4 A;  3EHQ A;  4HLL A;  3EHR A;  4G8K A;  3V2O A;  4G8L A;  4HRN A;  5HKP A;  3TWW A;  5CEA A;  4O1P A;  4QFV A;  4ZHB A;  1MX6 A;  5CER B;  3J5Q B;  3T8K A;  4NIK A;  3TWU A;  4DX1 A;  3D9H A;  2V5Q C;  3LJN A;  2L6B A;  3ZU7 B;  1IXV A;  3F6Q A;  5JA4 D;  5CEC B;  2ZGG A;  3W9F A;  4CYM D;  5ITZ F;  3TWT A;  2DWZ A;  4K5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...