4HLLA

Crystal structure of artificial ankyrin repeat protein_ank(gag)1d4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
154
Chain Sequence
DLGKKLLEAARAGQDDEVRLLLEHGADVNARDSIGSTPLHLAAYYGHLEIVRLLLEHGADVNARDSTGTTPLHYAARLGHLEIVRLLLEHGADVNARDAMGWTPLHLAAKKGHLEIVRLLLKHGADVNANDHFGKTAFDISIDNGNEDLAEILQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin(GAG)1D4
publication title Identification of Gag bioactive determinants specific to designed ankyrin and interfering in HIV-1 assembly
rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 55
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hllA00
2JABA 5JA4D 4HI8A 4QQIA 2P2CP 2QYJA 5JMND 1N11A 5HS0A 1BI7B 2XZDG 5EN5D 3ZNGA 3JXIA 2ZGDA 4K5AB 4LG6A 1OY3D 3ZKJA 4J7WA 3ZUVB 3TWSA 4BESA 3TWVA 3TWWA 2L6BA 2XEEA 3DEPA 1N0RA 3TWQA 5CECB 1NFIE 5D66A 5ENTD 3EHRA 3EHQA 1WDYA 4HB5A 4GPMA 4HNAD 4ZHBA 2ETCA 3Q9UC 5ENQD 4A63B 3TWRA 1BD8A 4HLLA 2J8SD 2A5EA 4J8YA 2DZOA 4O60A 5CEDB 3NBNB 4YDYA 4NIKA 1AP7A 2AJAA 2KBXA 5CBOA 4BEPA 3TWUA 4DX5D 3AAAC 3F6QA 5EIBE 5HKPA 1DCQA 3B7BA 2Y1LE 4OAUC 3SO8A 4RLYA 2DVWA 4G8KA 2ETBA 5EILA 4UUCA 2RFAA 4ZFHA 1AWCB 1DC2A 1WG0A 5AQBA 2VGEA 1YMPA 1K1AA 2BKKB 4F1PA 3B95A 5CBNA 4TUMA 3JUEA 1K3ZD 4U95D 5AQAA 4HRNA 5CEAA 2DWZA 3IXEA 1G3NB 4BETA 4DX7D 4DUIA 1IHBA 4K5CA 1YCSB 3W9GA 4N5QA 5ENSD 3ZU7B 2NYJA 1UOHA 3DEOA 3V2XA 1S70B 4G8LA 3AJIA 4YDWA 5AN8A 3J5QB 1BLXB 5AQ9A 3W9FA 4C48B 4O1OA 4HQDA 2XENA 3HG0D 1MX2A 4HRLA 2B0OE 4U96D 5FINA 4GMRA 3TWTA 1MX6A 4ATZD 1TR4A 2HE0A 1MX4A 5ENOD 4HI9A 1K1BA 4LSZE 3J5PA 3JXJA 1BU9A 4Z68A 3TWXA 5AAOA 1QYMA 5HRYA 1YYHA 4CYMD 3Q9NC 2BKGA 1SW6A 2F37A 5BXOA 5EIDA 1SVXA 3LJNA 5CERB 2Y0BG 5KBAA 4OAVB 2ZGGA 2MYOA 4HRMB 5KNGA 4K5BA 5ENPD 5EYLA 1N0QA 3NOGD 4BERA 3EU9A 4U8VD 2V4HC 3V30A 3D9HA 3V79K 1MYOA 1IXVA 4JB8P 3UXGA 4BSZB 5AQ7A 4CZ2D 5KNHD 5FIOA 3KEAA 3V2OA 3UI2A 4DX6D 3V31A 2RFMA 2F8XK 2KXPC 2V5QC 2PNNA 5ENRD 3T8KA 3UTMA 1IKND 2XEHA 4F6RD 4DX1A 2XZTG 1A5EA 3HRAA 2F8YA 4HBDA 1OT8A 2DZNA 2QC9A 1D9SA 3NOCD 1BI8B 4QFVA 4LNUD 4U8YD 5AARA 4B93B 1MJ0A 3C5RA 5EYPF 4DRXE 3T9KA 5KWDA 2FO1E 5ITZF 4O1PA 5BXUA 2ETAA 4DX2A
chains in the Genus database with same CATH superfamily
2RD0A 5HS0A 4TXPA 5LCWJ 1HX8A 3EUVA 3DRAA 3TWWA 1ZU2A 4HB5A 4GPMA 1TNZA 3TWRA 3SFZA 4YDYA 1KLXA 4OYSA 1Z5SC 1IYGA 3OAWA 5CBNA 4PS3A 3X2QE 1E96B 2E2EA 3IXEA 3ASHA 4DX7D 3UUXA 3ZU7B 1OWMA 4B8AA 1PY1A 5JJ6A 3W9FA 2OVFA 2KC7A 4HQDA 5FJYA 1V54E 2OEWA 5G05C 3CVPA 2F37A 4DPRA 2GRQB 3EIJA 1OWPA 3O48A 4OAVB 5KNGA 3D9JA 2IF4A 3QAQA 3SGHA 1EF1C 2IY0C 1FVHA 4HFGA 3R7RA 1SZ9A 2LO6A 2OEVA 4U0SA 1E8YA 3FUIA 4O1PA 3DSUA 4EHMA 4G25A 2ZGDA 3FUMA 4J7WA 3DEPA 2P9LG 3L16A 3EHQA 5C1DA 3RRNB 1HG2A 1LF8A 2EINE 4CDNA 1P5QA 3FTWA 4KVOA 5EIBE 4LEUA 3CR3A 2LNIA 4I1AA 4EZJA 3Q5MA 3R7QA 2OOEA 3PREA 2VQ2A 1YA0A 1YMPA 4ILHB 1TN8A 2WXGA 4UI9K 3Q49B 4L7TA 3CLJA 4BTAA 3VLDA 4K5CA 4AY5A 2DIWA 3IKOB 2OVBA 3QWPA 4AEZC 3TG5A 2XS8A 3FFLA 2XENA 2BTDA 2XRZA 5G05J 3JXJA 3FTYA 3KSQA 4BWRA 2R03A 4DLQA 1SVXA 2E0IA 2CFZA 3S7DA 5KBAA 4N3BA 2MYOA 2QYUA 2XCCA 2JEKA 1H0AA 4U8VD 3MZLB 3U9WA 3QKYA 2YNQA 4JXTA 5AQ7A 3WG7E 1ZBPA 4WUYA 1DCEA 4U07A 3L13A 2WPVA 3SD5A 3FUJA 3CSFA 4A3VA 2IU1A 3C5RA 3T9KA 2FEZA 3N71A 4I1MA 3ESKA 2QYJA 4APOA 3CHOA 4JD2G 3UIPC 3LY9A 3PRZA 2I2OA 3BG1B 5CRVA 4A63B 1E8XA 4WNEA 4IN3B 5AIJA 3ZYKA 4G26A 2ZIRA 4GYWA 1U2VG 4XI0A 4CRWA 3UT4A 3UX4A 3D9IA 1QQEA 4C0EA 3MKQA 3MX3A 1UOHA 4KXKB 3U64A 3D3MA 3UT8A 4KZ0A 3PZ1A 3Q73A 2V0PA 4YDWA 5ANRA 1JWFA 2R05A 4U96D 1OCRE 1TR4A 2A4ZA 4M3OA 4LSZE 3CVWA 1TN6A 1IQRA 2H6HA 4J8FA 2H6FA 1H6PA 3FTSA 4K5BA 5EYLA 4J8EA 3QWVA 4JL0A 2J9QA 1ELKA 3ZW3A 3PNTB 4GZCA 3V31A 2KXPC 2GGFA 2R2LA 3SFYA 4G1TA 1W3BA 5FQ6A 1NL4A 2HR2A 2CHWA 2WXQA 4FA6A 3FH8A 3VLFA 2XHEA 1A17A 4F3VA 4YVOA 4FJZA 2PQNA 2BUGA 3JXIA 4BT8A 1IHGA 1E7UA 3PH0C 3IHYA 2Y3AA 1WDYA 2WXJA 5AJLA 2DZOA 4O60A 4NIKA 4CEMA 3FUHA 1UW4B 5AENA 4OVVA 1DC2A 4LRZA 5E76A 4FC8A 4TUMA 3JUEA 3FY4A 4N5CA 3C3RA 2NYJA 2AXUA 5EX0A 3V2XA 1O1RA 3CVUA 3EU5A 5FQ8A 4GYOA 3NF1A 2JLBA 4JPSA 4D10C 3HG0D 4NACA 4WWNA 5KJMA 4HI9A 4GMJA 4GZ3A 1H2UA 5FZRA 2AVPA 3FUEA 5JJ7A 4GTSA 5B3SE 2XPZA 3L9TA 4I1OB 2IO2C 3EU9A 3B7TA 3TG4A 3QOUA 1N4RA 4UWGA 4XIFA 3Q7AA 3FTVA 5G55A 1ELWA 3UI2A 4EZKA 5KJNA 2NC9A 2FBNA 1JPLA 4E6HA 5LFAA 3ZN3A 3HRAA 3U4TA 3ONLA 4CT4A 2F8YA 2Y69E 4HBDA 2DZNA 2WXKA 2NXPA 4QFVA 3OXFA 2P58C 4QQIA 4JHKA 1N11A 2X6KA 3ML9A 3AG1E 3MJWA 4Q69A 2UWJG 3EHRA 1OCCE 4Y6WA 4MBGA 4I6EA 2VGYA 1H2VC 5ARFA 5T4YA 4I6JA 5JHBA 2V8SE 2UY1A 1OWOA 3SBTB 3EJNA 2QY7A 1MZCA 2V4LA 4AOFA 2VGXB 1VDYA 3HYMB 4Q96A 2WXRA 1QBQA 3ZHEA 3SY2A 3HIZA 2WXOA 1BLXB 3R9AB 3ZYMA 3FUKA 1BU9A 3J5PA 4RG9A 4CYMD 4F53A 3TAXA 1HO8A 4M7CA 3UPVA 3UIOC 5ENPD 3CIAA 3QJZA 5C2YA 3R9MA 4Y6CA 2WQHA 4JW1A 4EZLA 5T8IA 4L23A 3T8KA 4I43A 4DX1A 3C3OA 3LXUX 4GA0A 3QDNA 2QC9A 3E4BA 1N4SA 2GRRB 3QNKA 5JJTA 2IONA 4A1SA 1N95A 1NZNA 3D9KA 3FUFA 2CHZA 2I6HA 4N3AA 5ENTD 2X38A 1HH8A 4BSXA 3LVQE 4CT0A 2AJAA 4GB9A 4JC8A 4LUNU 2PZIA 3LDZA 2VTBB 1AWCB 3QWWA 1TNBA 4UI9C 4EBAG 5AQAA 2EIME 1UJJA 4C9BB 5CRUA 1YCSB 1TNYA 3CEQA 3FH5A 2YQ8A 3I3NA 2FULA 3K9IA 4YDOA 4GMRA 2DCPA 4KVMA 5BT1A 3TWXA 5AAOA 2WXIA 5HRYA 2J49A 2PL2A 4HLEA 1H2TC 1U3DA 1OUVA 2MRIA 3ZXPA 1E8WA 3UXGA 2GW1A 3LVRE 4CZ2D 2DBAA 4ACLA 3ASOE 2XGSA 2EIJE 4AP2A 3CGHA 2V5FA 3UM2A 3CQGB 1OT8A 3NOCD 3ESLA 2ZXWE 3CVXA 4HOTA 2P2CP 1TJFA 2NSZA 3ZNGA 3UM1A 3ZKJA 3E33A 1DNPA 3SF4A 1NFIE 3ULYA 3BQOA 4GCOA 3CHRA 3DSVA 1UN8A 4GA2A 4NURA 5B1BE 3AG2E 1N4QA 5BNWA 2KCLA 2VSYA 3JYSA 3CVLA 4FU3A 2WXMA 4HRNA 2HO1A 1HZ4A 4DUIA 2L0TB 5ENSD 2VYIA 4UWKA 5BV1A 3FDHA 1PAQA 5J08A 3CKBA 2XRYA 2X6HA 1GW6A 3FTXA 3GW4A 4KZCA 2ILRA 4K0RA 5FWQA 4GMLA 1SZAA 4IRUA 4W9RA 3UM0A 2KZTB 1IKND 2XEHA 3HXEA 4HXIA 5AYWD 3DPDA 4KMOA 4AXHA 4BTBA 3RJVA 4ABNA 4ACKA 3RIBA 1FT2A 4GYYA 4GZ5A 3JQ1A 3FEYA 4HNAD 4XE0A 3L6AA 3HDXA 3BU8A 5HQ8A 3ZIMA 2R02A 4DX5D 1KPSB 2Y4TA 3B7BA 3TGOA 4RLYA 2ETBA 3E30A 4G11A 3ULQA 2LSVA 4XI9A 5LX8A 2VGEA 1B89A 4URKA 3PEUB 1NA3A 1G3NB 3KD7A 1N9AA 1KT1A 2ZU6B 4JEUA 4DI3A 3MGBA 4L2YA 2J4BA 2B0OE 5LP0A 2X6IA 4L1BA 4J8DA 4Z68A 1QYMA 3Q9NC 2R17C 3AS8A 3HXFA 5BV0A 4C0MA 4RSYA 1INZA 3HHMA 3SBSA 5FIOA 3HVEA 2V5QC 5G04C 5AARA 2FO7A 2FO1E 3MV2B 2R5SA 3JQ0A 3EHNA 4DX2A 2X3MA 4N2SA 3NAWA 2EILE 2CFUA 5BW8C 3ZEFA 3ZUVB 3NZUA 1X81A 3G2SA 2GROB 2RKKA 2P9PG 3CKCA 3ASFA 2A5EA 4J8YA 3KAEA 1AP7A 2VJ8A 3AAAC 3F6QA 2YINA 3RAUA 2WXNA 4ZFHA 1MQSA 4ANVA 5KJKA 3ZVVA 3T5VA 4HS2A 3ZYQA 3ZRHA 3FU3A 3ZGQA 3DBSA 1JCSA 3BEEA 2Y4UA 2P9IG 3DXMG 3Q47B 3DSWA 3URZA 3ZYLA 1Y8MA 4GAAA 1SA4A 1TNOA 3IHVA 2L9BA 2C0LA 3TWTA 1K1BA 3CQCB 1OWNA 3AS4A 3DSXA 3SHFA 4A1GA 5ENNA 1TN7A 1WM5A 2XGOA 3UM3A 3NQPA 5CMYA 4PUCA 1MYOA 4BSZB 3BG0B 1EYHA 1S64A 4R7LA 4U0ZA 4CGWA 2KM4A 3B7RL 3PDNA 3V2OA 4B94A 2PNNA 5G04J 4JA9A 2ONDA 1LD7A 3EDTB 3OTNA 2DYRE 1SQMA 3TL5A 1D9SA 3G2WA 4K03A 4X8QA 3ASNE 3SI5A 5B1AE 4WNDA 4U04A 3RO3A 4JHJA 4FLBA 4BY6A 3S2AA 3PNLB 3RKVA 3CSTA 2BEDA 4UWFA 3RSEG 4GTRA 3D9NA 3FP3A 2WMNA 3BUAA 1DCQA 2LXLA 1E8ZA 2RFAA 1UJKA 3Q78A 4UQYA 2L0IA 4WNGA 3PEVB 3CHPA 4ANXA 4BETA 3QARA 4Q94A 4UWHA 2VSXE 3W9GA 2LXMA 3AJIA 3G2UA 1TNUA 4C48B 2LSUA 4EBAA 1HU3A 4AY6A 4HRLA 4TRQA 1MX6A 5A7DB 1NA0A 3IV0A 3DWLG 1QNFA 1KT0A 2XPYA 3GZ2A 4I9EA 2Y0BG 4GTPA 5D2MC 5DIZA 4GCNA 2MOWA 3D9MA 3S7BA 4CDRA 4OVUA 3O4ZA 3KEZA 2XQ0A 4IULA 3G2VA 3LEWA 4GU5A 2WXHA 4H7XA 2BF0X 4B0ZA 3UINC 3CK7A 4APFA 1ZB1A 4RQIA 4FHJA 3UKRG 2WQ6A 2H6IA 4EECA 5KWDA 2PM7A 3U66A 4FJYA 2ETAA 5EN5D 3LPZA 4XKBA 4BESA 5CECB 3PUJA 4F7AA 1FPPA 3TXNA 2VSNA 5CMWA 4GTVA 4DK5A 3L17A 4MRUA 3P1UA 1WG0A 5FZSA 4FP7A 3CHQA 4U95D 2L6JA 3L82A 3C72A 5EDSA 4P29A 5FZQA 4XKCA 1S63A 5J90A 3ISMC 1BPOA 2A5UA 1D8EA 3RU0A 4FLHA 4KBQA 5ENOD 4JEHA 3EHMA 4UWLA 4O6FA 3PS6A 5IY5E 3ZFWA 3NOGD 4BERA 4TXRA 4NQ0A 4JVSA 2YHEA 5D0OD 2GRMA 4JA7A 2F8XK 3DSSA 3T5XA 4AJWA 1E90A 4BX9A 1JUQA 1E7VA 1A5EA 3QK0A 4AIFA 3FU5A 1MHQA 3ZPJA 4U0UA 4WAFA 2C0MA 5JMND 3APDA 2DYSE 4I17A 4DLOA 1HE8A 3UMVA 3TWQA 4HORA 3VTYA 2QZAA 2LUHA 4ZHBA 2ETCA 3GZ1A 5CEDB 3NBNB 2KBXA 4CGVA 2UY1B 4UQXA 4KYOB 4EPZA 4OAUC 2DVWA 3ENEA 4PS8A 5JHAA 3WXXA 4PDXA 5H7PA 3APCA 2Q7FA 3LCAA 3RO2A 2AW6A 3E34A 1K1AA 5M72A 2DWZA 1WY6A 2HYZA 3SFXA 3ZHEB 2C2LA 4B89A 1IHBA 3JUIA 2FI7A 2IJGX 3I5PA 1IQUA 4YNDA 2GRNB 2WQ7A 3EIQC 2P9KG 4E85A 3T8MA 2HE0A 3TJPA 3FU6A 3E37A 2IO3C 3QC1A 4UI9J 1XNFA 3SNXA 1LTXA 5CERB 4DI4A 4BFRA 2ZGGA 3FWVA 3TXMA 2WB2A 2I9CA 3V30A 3U3WA 2I1JA 5KJLA 3DSTA 3KEAA 3UTMA 1QZ2A 3ZXSA 1O1TA 4JZYA 2WXFA 1Z6TA 4ILIA 2LAHA 2MHKA 4N2QA 3CVQA 3ONKA 4HOUA 4B93B 1N4PA 3KSLA 3Q79A 5EKQD 1FVFA 3ABLE 2JABA 3PZDA 3FEXA 1Z3YA 3AU5A 2J09A 3CV0A 2XZDG 5DBKA 4K5AB 4CDMA 2CG3A 4G2VA 1OY3D 2AWIA 3DXKG 1PC2A 4G23A 2XEEA 4LNGA 2XEVA 3LY8A 1X5BA 4N39A 3VTXA 5CBOA 4LCTA 3CHSA 1DVPA 5HKPA 1JCRA 3Q15A 3SO8A 3HXBA 4ILGA 1EPUA 2J07A 5AQBA 2BKKB 1OCOE 4DJAA 4U63A 3ABKE 3APFA 5FQ7A 3MCXA 4RVBA 2P9UG 2P9NG 4KT6B 2X6FA 4O1OA 3E32A 2AXVA 1MX4A 2I1KA 5EX3A 1Q2ZA 3OXGA 4LERA 4XEIG 1KZOA 4EQFA 2F0YA 4GTTA 1N0QA 3AG4E 2V4HC 2YHCA 3D9HA 5CCMA 5FTPA 3LYAA 5KNHD 2XGMA 2WM9A 4U8HA 1WAO1 2RFMA 4H7YA 4GTMA 5ANLA 4HOSA 4A55A 4LNBA 2WVIA 3PZ4A 1OCZE 2X6JA 1JCQA 1MJ0A 3D9LA 2WMOA 3MKRA 3P2BA 3OXLA 2IQCA 4TV3A 2R59A 4HI8A 5A6CA 5A23A 4XZ4A 1D8DA 3B7SA 4L9PA 3CK9A 1ELRA 4F1SA 4ME2A 1K8KG 3DPYA 3PVLA 3TWUA 4ANWA 4GZ6A 3MEKA 1O5MA 2GRLA 3Q75A 4UQZA 2PM6A 1KZPA 5HI7A 1FT1A 3LJ3A 2VGXA 2PQRA 4XX5A 3CVNA 3G2TA 3HXDA 2XS1A 1LD8A 2OV8A 1H6OA 4ANUA 4AV7A 3CVYA 3S7JA 2J08A 3VLEA 3LY7A 3B7UX 1Y6IA 2BKGA 5BXOA 5EIDA 2CHXA 5KCMA 1U3CA 3LJNA 4MS6A 1OWLA 4BT9A 1UG3A 2P9SG 2H6GA 3ASGA 1IXVA 5ARGA 1HFAA 4J8SA 3FUDA 1EDUA 3PE3A 4CCAA 2IOLA 3CHMA 3FUNA 3I4RB 2GRPB 1NI1A 4U8YD 4LNUD 4DRXE 3LS8A 4FHKA 5G2NA 3AG3E 4I6GA 3Q7FA 4J6IA 4GTQA 5JA4D 4G24A 1BI7B 2VSOE 4LG6A 4PH4B 4RG6A 5CHEE 2L6BA 5BUZA 3PZ2A 5D66A 3HXCA 3AS5A 3Q9UC 5ENQD 1BD8A 1N52A 3FHEA 2J8SD 1N54A 2QFCA 3LKUA 4TXQA 4BEPA 3NB2A 1HF8A 2KCKA 1O1SA 4G8KA 4UUCA 1FCHA 2KATA 3PUKA 3FTZA 5T3RA 2VTBA 4FULA 1K3ZD 1RZ4A 1H19A 1TYQG 4GPKA 2IEJA 4WNFA 3ULEG 2ZISA 3C98A 5LOZA 4N5QA 4HOQA 2EIKE 3JCKC 3KS2A 4G8LA 4HVBA 5AN8A 5AQ9A 2CG2A 3UKUG 4ATZD 4BX8A 2KCVA 2IOSA 3RRUA 3MYVA 1Z3XA 1YYHA 3CK8A 2EQXA 2RG8A 4I2ZA 1OXJA 1TEZA 5FT9A 3MKQB 4JHRA 4HRMB 3AU4A 3NZSA 4N3CA 1NP7A 3S7FA 4NRHB 1JWGA 4YVQC 3UT7A 4U7EB 1S0PA 3HVEB 4GTOA 3SZ7A 4DX6D 5ENRD 4F6RD 3D9PA 2XZTG 1TJCA 4YDEA 3IEGA 4FADA 5CCLA 5AJDA 5EYPF 4WWPA 4ATGA 2LAIA 2XCBA 4GZDA 4MKTA 2WXLA 1XGWA 5LCWC 3ABME 5E75A 3TWSA 3TWVA 1HS6A 1N0RA 3ASDA 3FH7A 2FF4A 2HM8A 1RW2A 4HLLA 3MV3B 3SQVA 5FQ4A 3MA5A 3I4GA 2Y1LE 1V55E 5EILA 2B6CA 1H6KA 4V3IA 3GZSA 4AM9A 4PS7A 2J4DA 4F1PA 3B95A 4WWOA 5CEAA 5D0QD 1HXIA 4IYPA 3GYZA 4L2LA 3L54A 3QB2A 3B13A 4TUUA 3DEOA 1S70B 1N94A 1SA5A 3IBEA 4A3TA 3PZ3A 3J5QB 4B8CB 5FINA 1MX2A 3CVVA 4I2WA 4J0UA 3L08A 2M63A 2XPIA 3UQ3A 1L5JA 5BPPA 1SW6A 3RK6A 3FTUA 1HG5A 4I9CA 3ML8A 3D9OA 1UN9A 3RRMB 3V79K 2OCCE 4JB8P 3Q4AB 3PE4A 3L22A 2IFUA 4MLPA 2AXZA 2KZTA 2WXPA 3FU0A 3FULA 1BI8B 4AVXA 5ITZF 4GA1A 5BXUA 3C3QA
chains in the Genus database with same CATH topology
2JABA 5JA4D 4HI8A 4QQIA 2P2CP 2QYJA 5JMND 1N11A 5HS0A 1BI7B 2XZDG 5EN5D 3ZNGA 3JXIA 2ZGDA 4K5AB 4LG6A 1OY3D 3ZKJA 4J7WA 3ZUVB 3TWSA 4BESA 3TWVA 3TWWA 2L6BA 2XEEA 3DEPA 1N0RA 3TWQA 5CECB 1NFIE 5D66A 5ENTD 3EHRA 3EHQA 1WDYA 4HB5A 4GPMA 4HNAD 4ZHBA 2ETCA 3Q9UC 5ENQD 4A63B 3TWRA 1BD8A 4HLLA 2J8SD 2A5EA 4J8YA 2DZOA 4O60A 5CEDB 3NBNB 4YDYA 4NIKA 1AP7A 2AJAA 2KBXA 5CBOA 4BEPA 3TWUA 4DX5D 3AAAC 3F6QA 5EIBE 5HKPA 1DCQA 3B7BA 2Y1LE 4OAUC 3SO8A 4RLYA 2DVWA 4G8KA 2ETBA 5EILA 4UUCA 2RFAA 4ZFHA 1AWCB 1DC2A 1WG0A 5AQBA 2VGEA 1YMPA 1K1AA 2BKKB 4F1PA 3B95A 5CBNA 4TUMA 3JUEA 1K3ZD 4U95D 5AQAA 4HRNA 5CEAA 2DWZA 3IXEA 1G3NB 4BETA 4DX7D 4DUIA 1IHBA 4K5CA 1YCSB 3W9GA 4N5QA 5ENSD 3ZU7B 2NYJA 1UOHA 3DEOA 3V2XA 1S70B 4G8LA 3AJIA 4YDWA 5AN8A 3J5QB 1BLXB 5AQ9A 3W9FA 4C48B 4O1OA 4HQDA 2XENA 3HG0D 1MX2A 4HRLA 2B0OE 4U96D 5FINA 4GMRA 3TWTA 1MX6A 4ATZD 1TR4A 2HE0A 1MX4A 5ENOD 4HI9A 1K1BA 4LSZE 3J5PA 3JXJA 1BU9A 4Z68A 3TWXA 5AAOA 1QYMA 5HRYA 1YYHA 4CYMD 3Q9NC 2BKGA 1SW6A 2F37A 5BXOA 5EIDA 1SVXA 3LJNA 5CERB 2Y0BG 5KBAA 4OAVB 2ZGGA 2MYOA 4HRMB 5KNGA 4K5BA 5ENPD 5EYLA 1N0QA 3NOGD 4BERA 3EU9A 4U8VD 2V4HC 3V30A 3D9HA 3V79K 1MYOA 1IXVA 4JB8P 3UXGA 4BSZB 5AQ7A 4CZ2D 5KNHD 5FIOA 3KEAA 3V2OA 3UI2A 4DX6D 3V31A 2RFMA 2F8XK 2KXPC 2V5QC 2PNNA 5ENRD 3T8KA 3UTMA 1IKND 2XEHA 4F6RD 4DX1A 2XZTG 1A5EA 3HRAA 2F8YA 4HBDA 1OT8A 2DZNA 2QC9A 1D9SA 3NOCD 1BI8B 4QFVA 4LNUD 4U8YD 5AARA 4B93B 1MJ0A 3C5RA 5EYPF 4DRXE 3T9KA 5KWDA 2FO1E 5ITZF 4O1PA 5BXUA 2ETAA 4DX2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JAB A;  5JA4 D;  4HI8 A;  4QQI A;  2P2C P;  2QYJ A;  5JMN D;  1N11 A;  5HS0 A;  1BI7 B;  2XZD G;  5EN5 D;  3ZNG A;  3JXI A;  2ZGD A;  4K5A B;  4LG6 A;  1OY3 D;  3ZKJ A;  4J7W A;  3ZUV B;  3TWS A;  4BES A;  3TWV A;  3TWW A;  2L6B A;  2XEE A;  3DEP A;  1N0R A;  3TWQ A;  5CEC B;  1NFI E;  5D66 A;  5ENT D;  3EHR A;  3EHQ A;  1WDY A;  4HB5 A;  4GPM A;  4HNA D;  4ZHB A;  2ETC A;  3Q9U C;  5ENQ D;  4A63 B;  3TWR A;  1BD8 A;  4HLL A;  2J8S D;  2A5E A;  4J8Y A;  2DZO A;  4O60 A;  5CED B;  3NBN B;  4YDY A;  4NIK A;  1AP7 A;  2AJA A;  2KBX A;  5CBO A;  4BEP A;  3TWU A;  4DX5 D;  3AAA C;  3F6Q A;  5EIB E;  5HKP A;  1DCQ A;  3B7B A;  2Y1L E;  4OAU C;  3SO8 A;  4RLY A;  2DVW A;  4G8K A;  2ETB A;  5EIL A;  4UUC A;  2RFA A;  4ZFH A;  1AWC B;  1DC2 A;  1WG0 A;  5AQB A;  2VGE A;  1YMP A;  1K1A A;  2BKK B;  4F1P A;  3B95 A;  5CBN A;  4TUM A;  3JUE A;  1K3Z D;  4U95 D;  5AQA A;  4HRN A;  5CEA A;  2DWZ A;  3IXE A;  1G3N B;  4BET A;  4DX7 D;  4DUI A;  1IHB A;  4K5C A;  1YCS B;  3W9G A;  4N5Q A;  5ENS D;  3ZU7 B;  2NYJ A;  1UOH A;  3DEO A;  3V2X A;  1S70 B;  4G8L A;  3AJI A;  4YDW A;  5AN8 A;  3J5Q B;  1BLX B;  5AQ9 A;  3W9F A;  4C48 B;  4O1O A;  4HQD A;  2XEN A;  3HG0 D;  1MX2 A;  4HRL A;  2B0O E;  4U96 D;  5FIN A;  4GMR A;  3TWT A;  1MX6 A;  4ATZ D;  1TR4 A;  2HE0 A;  1MX4 A;  5ENO D;  4HI9 A;  1K1B A;  4LSZ E;  3J5P A;  3JXJ A;  1BU9 A;  4Z68 A;  3TWX A;  5AAO A;  1QYM A;  5HRY A;  1YYH A;  4CYM D;  3Q9N C;  2BKG A;  1SW6 A;  2F37 A;  5BXO A;  5EID A;  1SVX A;  3LJN A;  5CER B;  2Y0B G;  5KBA A;  4OAV B;  2ZGG A;  2MYO A;  4HRM B;  5KNG A;  4K5B A;  5ENP D;  5EYL A;  1N0Q A;  3NOG D;  4BER A;  3EU9 A;  4U8V D;  2V4H C;  3V30 A;  3D9H A;  3V79 K;  1MYO A;  1IXV A;  4JB8 P;  3UXG A;  4BSZ B;  5AQ7 A;  4CZ2 D;  5KNH D;  5FIO A;  3KEA A;  3V2O A;  3UI2 A;  4DX6 D;  3V31 A;  2RFM A;  2F8X K;  2KXP C;  2V5Q C;  2PNN A;  5ENR D;  3T8K A;  3UTM A;  1IKN D;  2XEH A;  4F6R D;  4DX1 A;  2XZT G;  1A5E A;  3HRA A;  2F8Y A;  4HBD A;  1OT8 A;  2DZN A;  2QC9 A;  1D9S A;  3NOC D;  1BI8 B;  4QFV A;  4LNU D;  4U8Y D;  5AAR A;  4B93 B;  1MJ0 A;  3C5R A;  5EYP F;  4DRX E;  3T9K A;  5KWD A;  2FO1 E;  5ITZ F;  4O1P A;  5BXU A;  2ETA A;  4DX2 A; 
#chains in the Genus database with same CATH topology
 2RD0 A;  5HS0 A;  4TXP A;  5LCW J;  1HX8 A;  3EUV A;  3DRA A;  3TWW A;  1ZU2 A;  4HB5 A;  4GPM A;  1TNZ A;  3TWR A;  3SFZ A;  4YDY A;  1KLX A;  4OYS A;  1Z5S C;  1IYG A;  3OAW A;  5CBN A;  4PS3 A;  3X2Q E;  1E96 B;  2E2E A;  3IXE A;  3ASH A;  4DX7 D;  3UUX A;  3ZU7 B;  1OWM A;  4B8A A;  1PY1 A;  5JJ6 A;  3W9F A;  2OVF A;  2KC7 A;  4HQD A;  5FJY A;  1V54 E;  2OEW A;  5G05 C;  3CVP A;  2F37 A;  4DPR A;  2GRQ B;  3EIJ A;  1OWP A;  3O48 A;  4OAV B;  5KNG A;  3D9J A;  2IF4 A;  3QAQ A;  3SGH A;  1EF1 C;  2IY0 C;  1FVH A;  4HFG A;  3R7R A;  1SZ9 A;  2LO6 A;  2OEV A;  4U0S A;  1E8Y A;  3FUI A;  4O1P A;  3DSU A;  4EHM A;  4G25 A;  2ZGD A;  3FUM A;  4J7W A;  3DEP A;  2P9L G;  3L16 A;  3EHQ A;  5C1D A;  3RRN B;  1HG2 A;  1LF8 A;  2EIN E;  4CDN A;  1P5Q A;  3FTW A;  4KVO A;  5EIB E;  4LEU A;  3CR3 A;  2LNI A;  4I1A A;  4EZJ A;  3Q5M A;  3R7Q A;  2OOE A;  3PRE A;  2VQ2 A;  1YA0 A;  1YMP A;  4ILH B;  1TN8 A;  2WXG A;  4UI9 K;  3Q49 B;  4L7T A;  3CLJ A;  4BTA A;  3VLD A;  4K5C A;  4AY5 A;  2DIW A;  3IKO B;  2OVB A;  3QWP A;  4AEZ C;  3TG5 A;  2XS8 A;  3FFL A;  2XEN A;  2BTD A;  2XRZ A;  5G05 J;  3JXJ A;  3FTY A;  3KSQ A;  4BWR A;  2R03 A;  4DLQ A;  1SVX A;  2E0I A;  2CFZ A;  3S7D A;  5KBA A;  4N3B A;  2MYO A;  2QYU A;  2XCC A;  2JEK A;  1H0A A;  4U8V D;  3MZL B;  3U9W A;  3QKY A;  2YNQ A;  4JXT A;  5AQ7 A;  3WG7 E;  1ZBP A;  4WUY A;  1DCE A;  4U07 A;  3L13 A;  2WPV A;  3SD5 A;  3FUJ A;  3CSF A;  4A3V A;  2IU1 A;  3C5R A;  3T9K A;  2FEZ A;  3N71 A;  4I1M A;  3ESK A;  2QYJ A;  4APO A;  3CHO A;  4JD2 G;  3UIP C;  3LY9 A;  3PRZ A;  2I2O A;  3BG1 B;  5CRV A;  4A63 B;  1E8X A;  4WNE A;  4IN3 B;  5AIJ A;  3ZYK A;  4G26 A;  2ZIR A;  4GYW A;  1U2V G;  4XI0 A;  4CRW A;  3UT4 A;  3UX4 A;  3D9I A;  1QQE A;  4C0E A;  3MKQ A;  3MX3 A;  1UOH A;  4KXK B;  3U64 A;  3D3M A;  3UT8 A;  4KZ0 A;  3PZ1 A;  3Q73 A;  2V0P A;  4YDW A;  5ANR A;  1JWF A;  2R05 A;  4U96 D;  1OCR E;  1TR4 A;  2A4Z A;  4M3O A;  4LSZ E;  3CVW A;  1TN6 A;  1IQR A;  2H6H A;  4J8F A;  2H6F A;  1H6P A;  3FTS A;  4K5B A;  5EYL A;  4J8E A;  3QWV A;  4JL0 A;  2J9Q A;  1ELK A;  3ZW3 A;  3PNT B;  4GZC A;  3V31 A;  2KXP C;  2GGF A;  2R2L A;  3SFY A;  4G1T A;  1W3B A;  5FQ6 A;  1NL4 A;  2HR2 A;  2CHW A;  2WXQ A;  4FA6 A;  3FH8 A;  3VLF A;  2XHE A;  1A17 A;  4F3V A;  4YVO A;  4FJZ A;  2PQN A;  2BUG A;  3JXI A;  4BT8 A;  1IHG A;  1E7U A;  3PH0 C;  3IHY A;  2Y3A A;  1WDY A;  2WXJ A;  5AJL A;  2DZO A;  4O60 A;  4NIK A;  4CEM A;  3FUH A;  1UW4 B;  5AEN A;  4OVV A;  1DC2 A;  4LRZ A;  5E76 A;  4FC8 A;  4TUM A;  3JUE A;  3FY4 A;  4N5C A;  3C3R A;  2NYJ A;  2AXU A;  5EX0 A;  3V2X A;  1O1R A;  3CVU A;  3EU5 A;  5FQ8 A;  4GYO A;  3NF1 A;  2JLB A;  4JPS A;  4D10 C;  3HG0 D;  4NAC A;  4WWN A;  5KJM A;  4HI9 A;  4GMJ A;  4GZ3 A;  1H2U A;  5FZR A;  2AVP A;  3FUE A;  5JJ7 A;  4GTS A;  5B3S E;  2XPZ A;  3L9T A;  4I1O B;  2IO2 C;  3EU9 A;  3B7T A;  3TG4 A;  3QOU A;  1N4R A;  4UWG A;  4XIF A;  3Q7A A;  3FTV A;  5G55 A;  1ELW A;  3UI2 A;  4EZK A;  5KJN A;  2NC9 A;  2FBN A;  1JPL A;  4E6H A;  5LFA A;  3ZN3 A;  3HRA A;  3U4T A;  3ONL A;  4CT4 A;  2F8Y A;  2Y69 E;  4HBD A;  2DZN A;  2WXK A;  2NXP A;  4QFV A;  3OXF A;  2P58 C;  4QQI A;  4JHK A;  1N11 A;  2X6K A;  3ML9 A;  3AG1 E;  3MJW A;  4Q69 A;  2UWJ G;  3EHR A;  1OCC E;  4Y6W A;  4MBG A;  4I6E A;  2VGY A;  1H2V C;  5ARF A;  5T4Y A;  4I6J A;  5JHB A;  2V8S E;  2UY1 A;  1OWO A;  3SBT B;  3EJN A;  2QY7 A;  1MZC A;  2V4L A;  4AOF A;  2VGX B;  1VDY A;  3HYM B;  4Q96 A;  2WXR A;  1QBQ A;  3ZHE A;  3SY2 A;  3HIZ A;  2WXO A;  1BLX B;  3R9A B;  3ZYM A;  3FUK A;  1BU9 A;  3J5P A;  4RG9 A;  4CYM D;  4F53 A;  3TAX A;  1HO8 A;  4M7C A;  3UPV A;  3UIO C;  5ENP D;  3CIA A;  3QJZ A;  5C2Y A;  3R9M A;  4Y6C A;  2WQH A;  4JW1 A;  4EZL A;  5T8I A;  4L23 A;  3T8K A;  4I43 A;  4DX1 A;  3C3O A;  3LXU X;  4GA0 A;  3QDN A;  2QC9 A;  3E4B A;  1N4S A;  2GRR B;  3QNK A;  5JJT A;  2ION A;  4A1S A;  1N95 A;  1NZN A;  3D9K A;  3FUF A;  2CHZ A;  2I6H A;  4N3A A;  5ENT D;  2X38 A;  1HH8 A;  4BSX A;  3LVQ E;  4CT0 A;  2AJA A;  4GB9 A;  4JC8 A;  4LUN U;  2PZI A;  3LDZ A;  2VTB B;  1AWC B;  3QWW A;  1TNB A;  4UI9 C;  4EBA G;  5AQA A;  2EIM E;  1UJJ A;  4C9B B;  5CRU A;  1YCS B;  1TNY A;  3CEQ A;  3FH5 A;  2YQ8 A;  3I3N A;  2FUL A;  3K9I A;  4YDO A;  4GMR A;  2DCP A;  4KVM A;  5BT1 A;  3TWX A;  5AAO A;  2WXI A;  5HRY A;  2J49 A;  2PL2 A;  4HLE A;  1H2T C;  1U3D A;  1OUV A;  2MRI A;  3ZXP A;  1E8W A;  3UXG A;  2GW1 A;  3LVR E;  4CZ2 D;  2DBA A;  4ACL A;  3ASO E;  2XGS A;  2EIJ E;  4AP2 A;  3CGH A;  2V5F A;  3UM2 A;  3CQG B;  1OT8 A;  3NOC D;  3ESL A;  2ZXW E;  3CVX A;  4HOT A;  2P2C P;  1TJF A;  2NSZ A;  3ZNG A;  3UM1 A;  3ZKJ A;  3E33 A;  1DNP A;  3SF4 A;  1NFI E;  3ULY A;  3BQO A;  4GCO A;  3CHR A;  3DSV A;  1UN8 A;  4GA2 A;  4NUR A;  5B1B E;  3AG2 E;  1N4Q A;  5BNW A;  2KCL A;  2VSY A;  3JYS A;  3CVL A;  4FU3 A;  2WXM A;  4HRN A;  2HO1 A;  1HZ4 A;  4DUI A;  2L0T B;  5ENS D;  2VYI A;  4UWK A;  5BV1 A;  3FDH A;  1PAQ A;  5J08 A;  3CKB A;  2XRY A;  2X6H A;  1GW6 A;  3FTX A;  3GW4 A;  4KZC A;  2ILR A;  4K0R A;  5FWQ A;  4GML A;  1SZA A;  4IRU A;  4W9R A;  3UM0 A;  2KZT B;  1IKN D;  2XEH A;  3HXE A;  4HXI A;  5AYW D;  3DPD A;  4KMO A;  4AXH A;  4BTB A;  3RJV A;  4ABN A;  4ACK A;  3RIB A;  1FT2 A;  4GYY A;  4GZ5 A;  3JQ1 A;  3FEY A;  4HNA D;  4XE0 A;  3L6A A;  3HDX A;  3BU8 A;  5HQ8 A;  3ZIM A;  2R02 A;  4DX5 D;  1KPS B;  2Y4T A;  3B7B A;  3TGO A;  4RLY A;  2ETB A;  3E30 A;  4G11 A;  3ULQ A;  2LSV A;  4XI9 A;  5LX8 A;  2VGE A;  1B89 A;  4URK A;  3PEU B;  1NA3 A;  1G3N B;  3KD7 A;  1N9A A;  1KT1 A;  2ZU6 B;  4JEU A;  4DI3 A;  3MGB A;  4L2Y A;  2J4B A;  2B0O E;  5LP0 A;  2X6I A;  4L1B A;  4J8D A;  4Z68 A;  1QYM A;  3Q9N C;  2R17 C;  3AS8 A;  3HXF A;  5BV0 A;  4C0M A;  4RSY A;  1INZ A;  3HHM A;  3SBS A;  5FIO A;  3HVE A;  2V5Q C;  5G04 C;  5AAR A;  2FO7 A;  2FO1 E;  3MV2 B;  2R5S A;  3JQ0 A;  3EHN A;  4DX2 A;  2X3M A;  4N2S A;  3NAW A;  2EIL E;  2CFU A;  5BW8 C;  3ZEF A;  3ZUV B;  3NZU A;  1X81 A;  3G2S A;  2GRO B;  2RKK A;  2P9P G;  3CKC A;  3ASF A;  2A5E A;  4J8Y A;  3KAE A;  1AP7 A;  2VJ8 A;  3AAA C;  3F6Q A;  2YIN A;  3RAU A;  2WXN A;  4ZFH A;  1MQS A;  4ANV A;  5KJK A;  3ZVV A;  3T5V A;  4HS2 A;  3ZYQ A;  3ZRH A;  3FU3 A;  3ZGQ A;  3DBS A;  1JCS A;  3BEE A;  2Y4U A;  2P9I G;  3DXM G;  3Q47 B;  3DSW A;  3URZ A;  3ZYL A;  1Y8M A;  4GAA A;  1SA4 A;  1TNO A;  3IHV A;  2L9B A;  2C0L A;  3TWT A;  1K1B A;  3CQC B;  1OWN A;  3AS4 A;  3DSX A;  3SHF A;  4A1G A;  5ENN A;  1TN7 A;  1WM5 A;  2XGO A;  3UM3 A;  3NQP A;  5CMY A;  4PUC A;  1MYO A;  4BSZ B;  3BG0 B;  1EYH A;  1S64 A;  4R7L A;  4U0Z A;  4CGW A;  2KM4 A;  3B7R L;  3PDN A;  3V2O A;  4B94 A;  2PNN A;  5G04 J;  4JA9 A;  2OND A;  1LD7 A;  3EDT B;  3OTN A;  2DYR E;  1SQM A;  3TL5 A;  1D9S A;  3G2W A;  4K03 A;  4X8Q A;  3ASN E;  3SI5 A;  5B1A E;  4WND A;  4U04 A;  3RO3 A;  4JHJ A;  4FLB A;  4BY6 A;  3S2A A;  3PNL B;  3RKV A;  3CST A;  2BED A;  4UWF A;  3RSE G;  4GTR A;  3D9N A;  3FP3 A;  2WMN A;  3BUA A;  1DCQ A;  2LXL A;  1E8Z A;  2RFA A;  1UJK A;  3Q78 A;  4UQY A;  2L0I A;  4WNG A;  3PEV B;  3CHP A;  4ANX A;  4BET A;  3QAR A;  4Q94 A;  4UWH A;  2VSX E;  3W9G A;  2LXM A;  3AJI A;  3G2U A;  1TNU A;  4C48 B;  2LSU A;  4EBA A;  1HU3 A;  4AY6 A;  4HRL A;  4TRQ A;  1MX6 A;  5A7D B;  1NA0 A;  3IV0 A;  3DWL G;  1QNF A;  1KT0 A;  2XPY A;  3GZ2 A;  4I9E A;  2Y0B G;  4GTP A;  5D2M C;  5DIZ A;  4GCN A;  2MOW A;  3D9M A;  3S7B A;  4CDR A;  4OVU A;  3O4Z A;  3KEZ A;  2XQ0 A;  4IUL A;  3G2V A;  3LEW A;  4GU5 A;  2WXH A;  4H7X A;  2BF0 X;  4B0Z A;  3UIN C;  3CK7 A;  4APF A;  1ZB1 A;  4RQI A;  4FHJ A;  3UKR G;  2WQ6 A;  2H6I A;  4EEC A;  5KWD A;  2PM7 A;  3U66 A;  4FJY A;  2ETA A;  5EN5 D;  3LPZ A;  4XKB A;  4BES A;  5CEC B;  3PUJ A;  4F7A A;  1FPP A;  3TXN A;  2VSN A;  5CMW A;  4GTV A;  4DK5 A;  3L17 A;  4MRU A;  3P1U A;  1WG0 A;  5FZS A;  4FP7 A;  3CHQ A;  4U95 D;  2L6J A;  3L82 A;  3C72 A;  5EDS A;  4P29 A;  5FZQ A;  4XKC A;  1S63 A;  5J90 A;  3ISM C;  1BPO A;  2A5U A;  1D8E A;  3RU0 A;  4FLH A;  4KBQ A;  5ENO D;  4JEH A;  3EHM A;  4UWL A;  4O6F A;  3PS6 A;  5IY5 E;  3ZFW A;  3NOG D;  4BER A;  4TXR A;  4NQ0 A;  4JVS A;  2YHE A;  5D0O D;  2GRM A;  4JA7 A;  2F8X K;  3DSS A;  3T5X A;  4AJW A;  1E90 A;  4BX9 A;  1JUQ A;  1E7V A;  1A5E A;  3QK0 A;  4AIF A;  3FU5 A;  1MHQ A;  3ZPJ A;  4U0U A;  4WAF A;  2C0M A;  5JMN D;  3APD A;  2DYS E;  4I17 A;  4DLO A;  1HE8 A;  3UMV A;  3TWQ A;  4HOR A;  3VTY A;  2QZA A;  2LUH A;  4ZHB A;  2ETC A;  3GZ1 A;  5CED B;  3NBN B;  2KBX A;  4CGV A;  2UY1 B;  4UQX A;  4KYO B;  4EPZ A;  4OAU C;  2DVW A;  3ENE A;  4PS8 A;  5JHA A;  3WXX A;  4PDX A;  5H7P A;  3APC A;  2Q7F A;  3LCA A;  3RO2 A;  2AW6 A;  3E34 A;  1K1A A;  5M72 A;  2DWZ A;  1WY6 A;  2HYZ A;  3SFX A;  3ZHE B;  2C2L A;  4B89 A;  1IHB A;  3JUI A;  2FI7 A;  2IJG X;  3I5P A;  1IQU A;  4YND A;  2GRN B;  2WQ7 A;  3EIQ C;  2P9K G;  4E85 A;  3T8M A;  2HE0 A;  3TJP A;  3FU6 A;  3E37 A;  2IO3 C;  3QC1 A;  4UI9 J;  1XNF A;  3SNX A;  1LTX A;  5CER B;  4DI4 A;  4BFR A;  2ZGG A;  3FWV A;  3TXM A;  2WB2 A;  2I9C A;  3V30 A;  3U3W A;  2I1J A;  5KJL A;  3DST A;  3KEA A;  3UTM A;  1QZ2 A;  3ZXS A;  1O1T A;  4JZY A;  2WXF A;  1Z6T A;  4ILI A;  2LAH A;  2MHK A;  4N2Q A;  3CVQ A;  3ONK A;  4HOU A;  4B93 B;  1N4P A;  3KSL A;  3Q79 A;  5EKQ D;  1FVF A;  3ABL E;  2JAB A;  3PZD A;  3FEX A;  1Z3Y A;  3AU5 A;  2J09 A;  3CV0 A;  2XZD G;  5DBK A;  4K5A B;  4CDM A;  2CG3 A;  4G2V A;  1OY3 D;  2AWI A;  3DXK G;  1PC2 A;  4G23 A;  2XEE A;  4LNG A;  2XEV A;  3LY8 A;  1X5B A;  4N39 A;  3VTX A;  5CBO A;  4LCT A;  3CHS A;  1DVP A;  5HKP A;  1JCR A;  3Q15 A;  3SO8 A;  3HXB A;  4ILG A;  1EPU A;  2J07 A;  5AQB A;  2BKK B;  1OCO E;  4DJA A;  4U63 A;  3ABK E;  3APF A;  5FQ7 A;  3MCX A;  4RVB A;  2P9U G;  2P9N G;  4KT6 B;  2X6F A;  4O1O A;  3E32 A;  2AXV A;  1MX4 A;  2I1K A;  5EX3 A;  1Q2Z A;  3OXG A;  4LER A;  4XEI G;  1KZO A;  4EQF A;  2F0Y A;  4GTT A;  1N0Q A;  3AG4 E;  2V4H C;  2YHC A;  3D9H A;  5CCM A;  5FTP A;  3LYA A;  5KNH D;  2XGM A;  2WM9 A;  4U8H A;  1WAO 1;  2RFM A;  4H7Y A;  4GTM A;  5ANL A;  4HOS A;  4A55 A;  4LNB A;  2WVI A;  3PZ4 A;  1OCZ E;  2X6J A;  1JCQ A;  1MJ0 A;  3D9L A;  2WMO A;  3MKR A;  3P2B A;  3OXL A;  2IQC A;  4TV3 A;  2R59 A;  4HI8 A;  5A6C A;  5A23 A;  4XZ4 A;  1D8D A;  3B7S A;  4L9P A;  3CK9 A;  1ELR A;  4F1S A;  4ME2 A;  1K8K G;  3DPY A;  3PVL A;  3TWU A;  4ANW A;  4GZ6 A;  3MEK A;  1O5M A;  2GRL A;  3Q75 A;  4UQZ A;  2PM6 A;  1KZP A;  5HI7 A;  1FT1 A;  3LJ3 A;  2VGX A;  2PQR A;  4XX5 A;  3CVN A;  3G2T A;  3HXD A;  2XS1 A;  1LD8 A;  2OV8 A;  1H6O A;  4ANU A;  4AV7 A;  3CVY A;  3S7J A;  2J08 A;  3VLE A;  3LY7 A;  3B7U X;  1Y6I A;  2BKG A;  5BXO A;  5EID A;  2CHX A;  5KCM A;  1U3C A;  3LJN A;  4MS6 A;  1OWL A;  4BT9 A;  1UG3 A;  2P9S G;  2H6G A;  3ASG A;  1IXV A;  5ARG A;  1HFA A;  4J8S A;  3FUD A;  1EDU A;  3PE3 A;  4CCA A;  2IOL A;  3CHM A;  3FUN A;  3I4R B;  2GRP B;  1NI1 A;  4U8Y D;  4LNU D;  4DRX E;  3LS8 A;  4FHK A;  5G2N A;  3AG3 E;  4I6G A;  3Q7F A;  4J6I A;  4GTQ A;  5JA4 D;  4G24 A;  1BI7 B;  2VSO E;  4LG6 A;  4PH4 B;  4RG6 A;  5CHE E;  2L6B A;  5BUZ A;  3PZ2 A;  5D66 A;  3HXC A;  3AS5 A;  3Q9U C;  5ENQ D;  1BD8 A;  1N52 A;  3FHE A;  2J8S D;  1N54 A;  2QFC A;  3LKU A;  4TXQ A;  4BEP A;  3NB2 A;  1HF8 A;  2KCK A;  1O1S A;  4G8K A;  4UUC A;  1FCH A;  2KAT A;  3PUK A;  3FTZ A;  5T3R A;  2VTB A;  4FUL A;  1K3Z D;  1RZ4 A;  1H19 A;  1TYQ G;  4GPK A;  2IEJ A;  4WNF A;  3ULE G;  2ZIS A;  3C98 A;  5LOZ A;  4N5Q A;  4HOQ A;  2EIK E;  3JCK C;  3KS2 A;  4G8L A;  4HVB A;  5AN8 A;  5AQ9 A;  2CG2 A;  3UKU G;  4ATZ D;  4BX8 A;  2KCV A;  2IOS A;  3RRU A;  3MYV A;  1Z3X A;  1YYH A;  3CK8 A;  2EQX A;  2RG8 A;  4I2Z A;  1OXJ A;  1TEZ A;  5FT9 A;  3MKQ B;  4JHR A;  4HRM B;  3AU4 A;  3NZS A;  4N3C A;  1NP7 A;  3S7F A;  4NRH B;  1JWG A;  4YVQ C;  3UT7 A;  4U7E B;  1S0P A;  3HVE B;  4GTO A;  3SZ7 A;  4DX6 D;  5ENR D;  4F6R D;  3D9P A;  2XZT G;  1TJC A;  4YDE A;  3IEG A;  4FAD A;  5CCL A;  5AJD A;  5EYP F;  4WWP A;  4ATG A;  2LAI A;  2XCB A;  4GZD A;  4MKT A;  2WXL A;  1XGW A;  5LCW C;  3ABM E;  5E75 A;  3TWS A;  3TWV A;  1HS6 A;  1N0R A;  3ASD A;  3FH7 A;  2FF4 A;  2HM8 A;  1RW2 A;  4HLL A;  3MV3 B;  3SQV A;  5FQ4 A;  3MA5 A;  3I4G A;  2Y1L E;  1V55 E;  5EIL A;  2B6C A;  1H6K A;  4V3I A;  3GZS A;  4AM9 A;  4PS7 A;  2J4D A;  4F1P A;  3B95 A;  4WWO A;  5CEA A;  5D0Q D;  1HXI A;  4IYP A;  3GYZ A;  4L2L A;  3L54 A;  3QB2 A;  3B13 A;  4TUU A;  3DEO A;  1S70 B;  1N94 A;  1SA5 A;  3IBE A;  4A3T A;  3PZ3 A;  3J5Q B;  4B8C B;  5FIN A;  1MX2 A;  3CVV A;  4I2W A;  4J0U A;  3L08 A;  2M63 A;  2XPI A;  3UQ3 A;  1L5J A;  5BPP A;  1SW6 A;  3RK6 A;  3FTU A;  1HG5 A;  4I9C A;  3ML8 A;  3D9O A;  1UN9 A;  3RRM B;  3V79 K;  2OCC E;  4JB8 P;  3Q4A B;  3PE4 A;  3L22 A;  2IFU A;  4MLP A;  2AXZ A;  2KZT A;  2WXP A;  3FU0 A;  3FUL A;  1BI8 B;  4AVX A;  5ITZ F;  4GA1 A;  5BXU A;  3C3Q A; 
#chains in the Genus database with same CATH homology
 2JAB A;  5JA4 D;  4HI8 A;  4QQI A;  2P2C P;  2QYJ A;  5JMN D;  1N11 A;  5HS0 A;  1BI7 B;  2XZD G;  5EN5 D;  3ZNG A;  3JXI A;  2ZGD A;  4K5A B;  4LG6 A;  1OY3 D;  3ZKJ A;  4J7W A;  3ZUV B;  3TWS A;  4BES A;  3TWV A;  3TWW A;  2L6B A;  2XEE A;  3DEP A;  1N0R A;  3TWQ A;  5CEC B;  1NFI E;  5D66 A;  5ENT D;  3EHR A;  3EHQ A;  1WDY A;  4HB5 A;  4GPM A;  4HNA D;  4ZHB A;  2ETC A;  3Q9U C;  5ENQ D;  4A63 B;  3TWR A;  1BD8 A;  4HLL A;  2J8S D;  2A5E A;  4J8Y A;  2DZO A;  4O60 A;  5CED B;  3NBN B;  4YDY A;  4NIK A;  1AP7 A;  2AJA A;  2KBX A;  5CBO A;  4BEP A;  3TWU A;  4DX5 D;  3AAA C;  3F6Q A;  5EIB E;  5HKP A;  1DCQ A;  3B7B A;  2Y1L E;  4OAU C;  3SO8 A;  4RLY A;  2DVW A;  4G8K A;  2ETB A;  5EIL A;  4UUC A;  2RFA A;  4ZFH A;  1AWC B;  1DC2 A;  1WG0 A;  5AQB A;  2VGE A;  1YMP A;  1K1A A;  2BKK B;  4F1P A;  3B95 A;  5CBN A;  4TUM A;  3JUE A;  1K3Z D;  4U95 D;  5AQA A;  4HRN A;  5CEA A;  2DWZ A;  3IXE A;  1G3N B;  4BET A;  4DX7 D;  4DUI A;  1IHB A;  4K5C A;  1YCS B;  3W9G A;  4N5Q A;  5ENS D;  3ZU7 B;  2NYJ A;  1UOH A;  3DEO A;  3V2X A;  1S70 B;  4G8L A;  3AJI A;  4YDW A;  5AN8 A;  3J5Q B;  1BLX B;  5AQ9 A;  3W9F A;  4C48 B;  4O1O A;  4HQD A;  2XEN A;  3HG0 D;  1MX2 A;  4HRL A;  2B0O E;  4U96 D;  5FIN A;  4GMR A;  3TWT A;  1MX6 A;  4ATZ D;  1TR4 A;  2HE0 A;  1MX4 A;  5ENO D;  4HI9 A;  1K1B A;  4LSZ E;  3J5P A;  3JXJ A;  1BU9 A;  4Z68 A;  3TWX A;  5AAO A;  1QYM A;  5HRY A;  1YYH A;  4CYM D;  3Q9N C;  2BKG A;  1SW6 A;  2F37 A;  5BXO A;  5EID A;  1SVX A;  3LJN A;  5CER B;  2Y0B G;  5KBA A;  4OAV B;  2ZGG A;  2MYO A;  4HRM B;  5KNG A;  4K5B A;  5ENP D;  5EYL A;  1N0Q A;  3NOG D;  4BER A;  3EU9 A;  4U8V D;  2V4H C;  3V30 A;  3D9H A;  3V79 K;  1MYO A;  1IXV A;  4JB8 P;  3UXG A;  4BSZ B;  5AQ7 A;  4CZ2 D;  5KNH D;  5FIO A;  3KEA A;  3V2O A;  3UI2 A;  4DX6 D;  3V31 A;  2RFM A;  2F8X K;  2KXP C;  2V5Q C;  2PNN A;  5ENR D;  3T8K A;  3UTM A;  1IKN D;  2XEH A;  4F6R D;  4DX1 A;  2XZT G;  1A5E A;  3HRA A;  2F8Y A;  4HBD A;  1OT8 A;  2DZN A;  2QC9 A;  1D9S A;  3NOC D;  1BI8 B;  4QFV A;  4LNU D;  4U8Y D;  5AAR A;  4B93 B;  1MJ0 A;  3C5R A;  5EYP F;  4DRX E;  3T9K A;  5KWD A;  2FO1 E;  5ITZ F;  4O1P A;  5BXU A;  2ETA A;  4DX2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...