4HLLA

Crystal structure of artificial ankyrin repeat protein_ank(gag)1d4
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
154
structure length
154
Chain Sequence
b'DLGKKLLEAARAGQDDEVRLLLEHGADVNARDSIGSTPLHLAAYYGHLEIVRLLLEHGADVNARDSTGTTPLHYAARLGHLEIVRLLLEHGADVNARDAMGWTPLHLAAKKGHLEIVRLLLKHGADVNANDHFGKTAFDISIDNGNEDLAEILQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ankyrin(GAG)1D4
publication title Identification of Gag bioactive determinants specific to designed ankyrin and interfering in HIV-1 assembly
rcsb
source organism Escherichia coli
molecule tags Protein binding
total genus 55
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2012-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hllA00
5FIOA 1QYMA 3EHQA 1BLXB 3V79K 1BD8A 4DUIA 4HI9A 4CYMD 4DX1A 3V30A 3JXJA 5KBAA 4O1PA 2J8SD 4NIKA 1OY3D 2RFAA 5ENRD 1MX2A 1A5EA 5ENPD 4LSZE 5KWDA 1N11A 2XEHA 2F8YA 3UI2A 2HE0A 2A5EA 5EN5D 1OT8A 4UUCA 4DRXE 5CEAA 3ZUVB 5CECB 1AP7A 4HB5A 1IKND 3TWXA 3NOGD 5EIBE 5KNGA 3HG0D 4HLLA 5BXUA 3AAAC 4U95D 1MX6A 3DEOA 3V2XA 2NYJA 5ENQD 4C48B 1NFIE 2KXPC 3TWQA 4F6RD 4HI8A 3AJIA 5EILA 3UXGA 5AQ7A 3Q9UC 5EIDA 2VGEA 1YMPA 3LJNA 3W9FA 1MX4A 4RLYA 2DWZA 2Y0BG 4U8VD 4A63B 4DX2A 5AAOA 3ZU7B 4ZHBA 3HRAA 5JMND 5ITZF 3D9HA 3TWVA 1UOHA 2ETAA 5ENSD 4HQDA 1TR4A 4HRMB 4K5AB 3TWUA 2F8XK 5AQBA 2DVWA 1AWCB 2XZTG 4B93B 4BESA 1WG0A 5CBNA 1SW6A 2B0OE 4OAVB 2BKGA 5ENOD 2AJAA 4HBDA 2PNNA 5HKPA 2QYJA 5BXOA 4OAUC 4LNUD 2JABA 2FO1E 4Z68A 1BU9A 1K1AA 5AN8A 2V5QC 2F37A 4U8YD 4BEPA 1WDYA 2XZDG 1IXVA 2P2CP 4LG6A 5D66A 5AARA 2MYOA 3UTMA 1MJ0A 3V31A 3NBNB 3ZNGA 3T8KA 3V2OA 5CBOA 3F6QA 4G8LA 4ATZD 2RFMA 5CEDB 4U96D 1D9SA 3SO8A 1MYOA 4ZFHA 3DEPA 3J5PA 4BERA 1N0QA 3TWRA 3B7BA 4GMRA 4HRLA 4N5QA 2ETBA 4QQIA 4J8YA 5ENTD 4TUMA 3TWWA 5CERB 3EU9A 5HRYA 3ZKJA 2ETCA 4O60A 5EYLA 2DZOA 1K1BA 1K3ZD 4YDYA 5KNHD 2BKKB 2KBXA 4DX7D 4BETA 2ZGGA 3T9KA 1S70B 3C5RA 1BI8B 3W9GA 5JA4D 5EYPF 5AQ9A 2DZNA 4K5BA 2QC9A 1N0RA 2XENA 4F1PA 3EHRA 3J5QB 4BSZB 4K5CA 4O1OA 5AQAA 2Y1LE 1SVXA 3NOCD 3TWSA 1IHBA 4DX5D 3IXEA 4CZ2D 3B95A 4G8KA 4J7WA 4DX6D 2XEEA 1DCQA 3Q9NC 4YDWA 1G3NB 4HNAD 5HS0A 1BI7B 2ZGDA 4GPMA 3JXIA 3KEAA 1YCSB 3JUEA 2L6BA 4JB8P 1DC2A 4QFVA 3TWTA 4HRNA 1YYHA 2V4HC 5FINA
chains in the Genus database with same CATH superfamily
1TN7A 3FHEA 3CVLA 3JYSA 3LCAA 3PE3A 5CEAA 2WVIA 4EBAA 3RKVA 4C48B 1SA4A 5M72A 3TWQA 3CHOA 3E30A 4A3TA 1TNOA 1X5BA 1FT2A 3D9HA 2F0YA 1UOHA 3CEQA 2CHXA 3UM3A 3ASOE 2XQ0A 3WXXA 2L0IA 3UT4A 2OVBA 4F53A 2OEWA 3GZ1A 2VSNA 2WXGA 4ACKA 4GTTA 3ZXPA 2IOSA 1K3ZD 4ANXA 5KNHD 4L7TA 3EIQC 4JHRA 2ZGGA 4FHJA 4GCNA 5T8IA 4L1BA 4G25A 2CFZA 5CHEE 3LDZA 4M3OA 4Y6CA 4BSZB 4O1OA 3UIPC 4BWRA 5KJMA 1OUVA 4JA9A 1H6OA 1N52A 3PNLB 3G2WA 4UQZA 2XS1A 4G2VA 3JXIA 3FUJA 3SY2A 3JUEA 1DC2A 4HRNA 2XRZA 1BU9A 3PREA 3LJ3A 4BX8A 4GTMA 2V0PA 4B0ZA 3Q4AB 3B7TA 3R7QA 3ZPJA 1LTXA 1N4RA 3L17A 3ISMC 2H6HA 3LY8A 4KZCA 5C2YA 4HLLA 4ACLA 3QARA 2I1JA 1YMPA 3W9FA 4MRUA 5T3RA 3G2SA 5FTPA 1V55E 1X81A 4RSYA 5JJTA 3TGOA 4IRUA 2XZTG 1WG0A 3ASNE 3EHMA 4G11A 2P9UG 3RO2A 1OXJA 1TJFA 2JABA 1K1AA 2R02A 4TUUA 2MYOA 4WWPA 3CVNA 3NAWA 3ZHEB 3AS8A 3DEPA 4BERA 3QWPA 3MGBA 3SFYA 4A3VA 3HDXA 1FCHA 1OWMA 4AIFA 3UPVA 2XGOA 4UWFA 4YDYA 2WXLA 1UN9A 4AVXA 3IBEA 3FUDA 1JWFA 3ZEFA 4G24A 4GTVA 5EYPF 4J8FA 5JHAA 1HXIA 2C2LA 4L9PA 2ILRA 2ONDA 2V5FA 3CR3A 4Q96A 4DX6D 3HXDA 2J09A 1KT1A 4GTOA 3PZ3A 1YCSB 1HF8A 3S7DA 4GZ5A 5C1DA 5FIOA 3V79K 4DX1A 1OY3D 3VTYA 2V4LA 2EINE 3PUJA 3NZUA 3D9PA 2I9CA 5T4YA 1A17A 2MRIA 3AAAC 2MOWA 4B8AA 3HVEA 5A23A 3T5VA 4FADA 4DX2A 1O1RA 3UKUG 4C9BB 4UWHA 1E90A 4FHKA 3FUIA 3JQ1A 4BX9A 3QWWA 4B93B 2I6HA 5FWQA 5HKPA 4NQ0A 3ABME 4DPRA 3SNXA 1N94A 3SFZA 2F37A 3LVQE 4AEZC 3TG5A 2IY0C 4GZ3A 3Q5MA 1UJJA 2CG2A 2JLBA 2GRPB 1SZAA 4JEHA 2GW1A 1N0QA 2KCLA 2DIWA 2P9PG 4N5QA 3P2BA 3S7BA 4B94A 2GRLA 3ZKJA 5HRYA 4LNBA 2ETCA 3QNKA 1OCOE 5CCMA 2P9NG 2VYIA 3C3QA 2J4DA 3UKRG 1SQMA 3BU8A 3VTXA 1UJKA 3SZ7A 4BSXA 3TAXA 4FLBA 4U07A 1OWOA 3C3OA 3J5QB 5BUZA 4U8HA 3ABLE 4K5CA 3U4TA 1HE8A 2YHCA 3B95A 4U0ZA 2L6JA 5ARFA 3PZ2A 2YQ8A 4J0UA 5HS0A 3QK0A 1KZOA 2B6CA 2ZISA 3DXMG 1BD8A 2XHEA 3BG0B 4NIKA 2UWJG 2WPVA 3S2AA 2WXMA 3ONKA 4E85A 5ENNA 1HU3A 4C0MA 5EIBE 2I2OA 4I6EA 5AJLA 3PZDA 1JPLA 3APDA 5LP0A 1E8ZA 3SFXA 4KVOA 3UXGA 2WQHA 3PEUB 4A63B 2GRMA 4F7AA 3QWVA 2KM4A 4LCTA 1P5QA 1TNYA 3UM0A 2R59A 4JEUA 3JCKC 4OAVB 2AJAA 1HX8A 3FU3A 3FTXA 4I9CA 2FO1E 2VGXA 4L2YA 2WM9A 4N2SA 2WXHA 1ELWA 4GAAA 1FT1A 1H0AA 2IFUA 2Y69E 4GZ6A 3ASDA 4DLQA 4EECA 4E6HA 3ML8A 4I17A 3T9KA 4CT4A 1K8KG 4WWOA 2WXNA 3UM2A 2FEZA 1N0RA 3OTNA 2QZAA 3T8MA 4M7CA 4UQXA 5KJKA 2WXKA 1S63A 1WY6A 2OVFA 1DCQA 4EZLA 3RIBA 2IEJA 1DCEA 4GPMA 2C0MA 2WB2A 3U3WA 1LF8A 1HH8A 1TN8A 4HORA 4X8QA 3JXJA 5KBAA 2GRRB 3FUEA 4TXPA 3AG2E 2L0TB 4I1AA 4GZCA 3G2VA 1AP7A 1H19A 1IKND 4WNEA 3ML9A 5G04C 4KBQA 1N4QA 1YA0A 2YHEA 4HS2A 4P29A 4N3AA 2X6IA 3QKYA 3CV0A 4CRWA 3KD7A 5ITZF 3EIJA 5AQBA 1L5JA 2DVWA 4B89A 2MHKA 4XX5A 4OAUC 3FTUA 3S7JA 4U8YD 1EYHA 2A5UA 4AM9A 3Q78A 5CBOA 3F6QA 3ULEG 1ELRA 4NURA 3KEZA 5CERB 5G05J 4OVUA 1ELKA 3LY9A 4BFRA 4DX7D 3HVEB 2Q7FA 3SHFA 2WXPA 2GROB 5HI7A 3ZW3A 3U66A 4EZJA 1QZ2A 3TJPA 4APOA 1NA3A 1G3NB 2QYUA 4HNAD 2EIME 4YDOA 2H6GA 2LNIA 2X6FA 1RW2A 3OXGA 1TNZA 3EHQA 3ONLA 4HI9A 2WXOA 3PS6A 4U63A 1TEZA 5ANLA 3C72A 4FA6A 4YVQC 2CG3A 4GYWA 3ABKE 3FH7A 1N4SA 4F3VA 2XRYA 2XGSA 1IHGA 3GZSA 3DEOA 1OWNA 3CIAA 3AJIA 4RQIA 3Q9UC 1MZCA 4GTPA 4TRQA 3GYZA 4HQDA 3DSUA 1TR4A 4K5AB 3QOUA 3PRZA 3MCXA 3FH8A 3UQ3A 2OV8A 4BEPA 2UY1B 2P2CP 4LG6A 1U3CA 3R9MA 3NBNB 3ASGA 5FZQA 4GU5A 2KATA 2R5SA 2VTBA 4U96D 2LXMA 4RG9A 4GA2A 3CHSA 3DBSA 4O60A 4KXKB 4EBAG 4GTRA 4I2ZA 3FEYA 3D9MA 2XS8A 5EX3A 4I1MA 4U04A 5AQ9A 2DZNA 4Q94A 3ULQA 2QC9A 3L08A 3CKCA 3EHNA 4I1OB 1JWGA 3RJVA 4J7WA 5FQ6A 5LCWJ 3Q75A 4KZ0A 2FF4A 3O48A 1QBQA 3FTSA 2P9SG 4IULA 3D9NA 4D10C 2J8SD 3B7UX 3RK6A 5EN5D 3APFA 3EUVA 5CCLA 4AY6A 4IN3B 5EILA 5IY5E 2IONA 3CVXA 4BTBA 4A1GA 1KZPA 2XGMA 4XEIG 1AWCB 4ILGA 4XI9A 1XNFA 1WM5A 4AOFA 1O1TA 1E7VA 1IXVA 4UWKA 4N5CA 4G8LA 4ATZD 1MHQA 2CFUA 4GTQA 3PEVB 3PDNA 3D9OA 2P9LG 3E34A 1RZ4A 3BG1B 4GTSA 2AXUA 4HFGA 3HYMB 3KS2A 3B13A 3ZYKA 3ZIMA 2LUHA 5G05C 3MJWA 5JHBA 4CDNA 4J6IA 5CMYA 3BUAA 3Q9NC 2A4ZA 2FULA 2R05A 3I4RB 5KCMA 3MKQA 3LPZA 2BTDA 4O1PA 4JHJA 2XCCA 3EJNA 1E8YA 5FQ8A 2C0LA 2J4BA 2XPYA 2KZTA 4LUNU 3ZYQA 3Q47B 1JCRA 4GMJA 2IJGX 4TV3A 3HRAA 5FZSA 3K9IA 3U9WA 4IYPA 3B7SA 2LAIA 3FFLA 5EX0A 4C0EA 3CVQA 4HBDA 3IKOB 2DYRE 1S0PA 4U7EB 3U64A 1IQRA 1SA5A 3OXLA 3V2OA 4ZFHA 1KPSB 2LO6A 4L23A 2IF4A 2QY7A 2EQXA 2BF0X 3Q7FA 3Q79A 1TJCA 3T5XA 5DBKA 4OVVA 5CMWA 3TG4A 1VDYA 1GW6A 4XIFA 4DX5D 2HO1A 4FC8A 5AENA 4HOTA 4YDWA 3BEEA 4UWLA 3VLEA 3KEAA 4QFVA 3AG4E 3V2XA 5BV1A 2VTBB 4R7LA 5ENPD 5LCWC 4UUCA 1W3BA 3TWXA 3CVWA 2XPIA 4HVBA 3L9TA 3UIOC 5AIJA 1NZNA 3ZFWA 3PH0C 3MV2B 2YINA 4U8VD 1ZBPA 1Y8MA 3SQVA 2F8XK 3Q73A 3EU5A 2FBNA 5A7DB 3IEGA 2B0OE 1LD7A 2QYJA 1PAQA 2H6IA 1H2VC 2PM6A 5AARA 3AS5A 3V31A 1MJ0A 4HLEA 1UW4B 3SGHA 5EKQD 2PZIA 2VGYA 3JQ0A 4Y6WA 1JCSA 1OCRE 1UN8A 5ENTD 2M63A 3TWWA 4L2LA 3EU9A 2WXIA 3E32A 5EDSA 3IHVA 3SD5A 4WWNA 4EHMA 3CQCB 1DVPA 2QFCA 5JA4D 2WXJA 1N95A 3QC1A 1D8EA 2OEVA 4CGVA 1E7UA 4A1SA 3R9AB 2IO3C 3HXEA 4FULA 4KT6B 3FTWA 4KMOA 3FULA 3NZSA 4ILHB 3APCA 2E0IA 5H7PA 2DBAA 5CRUA 1U3DA 3V30A 1INZA 3FUHA 1Q2ZA 5KJLA 1N11A 4Q69A 4CT0A 5B1AE 5B3SE 4ATGA 1MX6A 2PQRA 3G2UA 1S64A 4AP2A 2JEKA 3LXUX 3ZVVA 5BW8C 4GCOA 3VLDA 2WQ7A 3GW4A 3DPDA 4DI3A 2Y4UA 4JXTA 3TWVA 4U0SA 5ENSD 2HYZA 1EDUA 1IQUA 4BESA 5LFAA 3CSTA 2PNNA 5BXOA 3CK9A 3MKQB 2X38A 1NP7A 3RSEG 5FINA 1WDYA 5D2MC 3HHMA 3UTMA 2AXVA 3CHQA 1OWLA 4YDEA 2WXFA 3ENEA 1MYOA 3LYAA 2KZTB 4GMRA 4NRHB 1HG2A 4XZ4A 4TUMA 5ARGA 1JCQA 5EYLA 5JJ7A 1S70B 1KT0A 3W9GA 4UQYA 4HOSA 4AY5A 4F1PA 3ZRHA 3LKUA 3ZHEA 1SVXA 3IV0A 4CDMA 4CZ2D 5G2NA 2PL2A 2ZIRA 3LVRE 4I9EA 2R17C 3UMVA 3DSTA 1YYHA 1QYMA 4N39A 3L82A 2FI7A 3ZXSA 4CYMD 5FJYA 4PS8A 4CCAA 5CRVA 5KWDA 1NI1A 3D9IA 2J49A 2Y3AA 2A5EA 1V54E 3ZUVB 4HB5A 2WMNA 3E4BA 1FVHA 1OCCE 3ZU7B 4ZHBA 1H6KA 3E37A 1WAO1 5BT1A 5CBNA 3UX4A 2WXRA 3HXFA 4LEUA 2EIJE 3C98A 4I6GA 2XZDG 5D66A 4J8SA 3T8KA 2KCVA 4V3IA 5BV0A 4B8CB 4QQIA 1EPUA 3P1UA 4WNGA 3PE4A 1LD8A 2OOEA 3DRAA 3CSFA 1SZ9A 2L9BA 5ANRA 3KSLA 3ZYLA 4ABNA 3QB2A 2J07A 2Y1LE 4JHKA 4G8KA 2WMOA 1N9AA 4ANWA 3CLJA 1HZ4A 2RD0A 5LX8A 3HXCA 1Z3XA 1ZU2A 3UUXA 1PC2A 1Y6IA 4KYOB 4OYSA 2IOLA 3BQOA 4HOQA 4URKA 4I6JA 3MKRA 2GRNB 4MKTA 3L16A 3NB2A 2ZXWE 3NOGD 3L6AA 5E76A 1UG3A 2NYJA 2VGXB 3MX3A 4GA0A 2EILE 5EIDA 4PDXA 3LEWA 4LRZA 4ME2A 4UI9J 3G2TA 2IU1A 3KAEA 3RRUA 1Z6TA 5D0OD 1HS6A 4GA1A 4APFA 2R03A 4BT8A 3D9LA 1E96B 1D8DA 3AS4A 3PZ1A 3URZA 3QDNA 4LNUD 3ULYA 3ZNGA 4NACA 4PH4B 2X6JA 5CEDB 4N3CA 3SO8A 2VSOE 4RG6A 4PUCA 1BPOA 4JC8A 4MLPA 2BKKB 1TYQG 1HFAA 1ZB1A 4FJZA 4ANUA 1BI8B 3TL5A 1O1SA 4WAFA 3VLFA 3MYVA 3RRNB 3AG1E 2X6KA 1E8WA 4A55A 2J08A 1XGWA 2NC9A 4DLOA 3UT8A 2BUGA 3TXNA 4G1TA 3RU0A 2RFAA 4JZYA 4XKBA 2F8YA 3DWLG 2HE0A 5FQ7A 4FU3A 2CHZA 5CECB 4DJAA 3CQGB 3GZ2A 3HG0D 2Y4TA 1N54A 4HI8A 3MA5A 2VGEA 3LJNA 4I43A 4RLYA 3CVPA 2FO7A 3MEKA 3AG3E 2XPZA 2IQCA 1FPPA 2CHWA 3FY4A 2P9KG 3FH5A 3X2QE 3DPYA 4Z68A 2R2LA 3KSQA 5E75A 4CDRA 3NF1A 3WG7E 3ESLA 1B89A 4G26A 4JW1A 3B7RL 3TWRA 4TXQA 3OXFA 4N2QA 4K03A 4K0RA 2LAHA 2H6FA 3UINC 2X6HA 5G04J 3PNTB 3PUKA 2LSUA 1O5MA 1IYGA 5B1BE 3FUNA 1PY1A 4WNFA 3TWSA 5FZRA 4UWGA 2XEEA 2AVPA 3ASFA 3S7FA 4EQFA 3TWTA 2IO2C 2V4HC 4FP7A 4H7XA 2RKKA 5BPPA 1BLXB 5BNWA 4DUIA 3MV3B 3ASHA 3CK8A 3LS8A 3CHPA 4LSZE 4BT9A 3UI2A 4XE0A 1QNFA 4N3BA 4KVMA 3N71A 2GGFA 5JJ6A 3RAUA 1EF1C 2WQ6A 5FQ4A 2KXPC 4F6RD 3R7RA 5AQ7A 1QQEA 4RVBA 2VSXE 1MQSA 2DWZA 1H2UA 5JMND 4FLHA 3TWUA 4ILIA 5D0QD 2BKGA 2V8SE 3C3RA 4UI9C 3QJZA 2V5QC 4YNDA 3Q15A 3QAQA 3HIZA 4GZDA 4LNGA 3CKBA 4MS6A 1D9SA 4HRLA 2OCCE 3HXBA 4GYYA 5AJDA 2AW6A 1H6PA 1HO8A 5A6CA 1U2VG 3CVYA 2UY1A 2XENA 4I2WA 4JPSA 3ESKA 5AQAA 3FU6A 5KJNA 1NA0A 3IXEA 3FU5A 2X3MA 2PM7A 1BI7B 2ZGDA 3DSSA 4JL0A 4WUYA 3RO3A 4UI9K 2PQNA 2L6BA 4J8EA 4AXHA 3I4GA 2VSYA 5ENRD 4PS3A 3PZ4A 3TXMA 4EZKA 4CGWA 3EDTB 1OT8A 3DXKG 3FUKA 2P9IG 3SF4A 1N4PA 3DSXA 5KNGA 3DSVA 4GMLA 5BXUA 4U95D 3FEXA 1JUQA 2NSZA 1NL4A 3CVVA 3O4ZA 2DYSE 2AXZA 3LY7A 3FP3A 2DCPA 3MZLB 2LXLA 2GRQB 4HRMB 3I5PA 4J8DA 1DNPA 3AU5A 5AN8A 3L22A 3FDHA 2HR2A 4W9RA 4LERA 3D9JA 4GPKA 2KC7A 3FUFA 3SBSA 1H2TC 2J9QA 2BEDA 2RFMA 2VJ8A 3CK7A 3J5PA 3B7BA 2EIKE 4JD2G 4J8YA 4EPZA 2DZOA 3FTVA 4AJWA 3L54A 3UT7A 2LSVA 3C5RA 3E33A 1TNBA 4CEMA 3DSWA 4GB9A 3FU0A 3D9KA 4XKCA 3NOCD 1IHBA 4H7YA 2ZU6B 3FWVA 3I3NA 4DK5A 4ANVA 4TXRA 4JB8P 3CHRA 5HQ8A 2XEVA 1E8XA 4YVOA 3CHMA 2KCKA 3FTZA 1MX2A 1A5EA 5J08A 2XEHA 3Q7AA 3CVUA 4DRXE 3ZYMA 3UM1A 2VQ2A 5ENQD 2YNQA 2I1KA 1NFIE 4GYOA 2XCBA 3ZN3A 1MX4A 2NXPA 2Y0BG 3FUMA 5AAOA 1OCZE 4U0UA 5LOZA 2ETAA 3SBTB 4BTAA 2HM8A 1SW6A 5ENOD 1OWPA 2AWIA 5FT9A 4WNDA 3JUIA 4MBGA 3L13A 1TNUA 3IHYA 4HXIA 3ZGQA 3FTYA 2E2EA 3D3MA 5AYWD 4JA7A 1Z3YA 3RRMB 2ETBA 2P58C 4PS7A 3PVLA 1FVFA 4F1SA 1TN6A 2RG8A 1K1BA 3AU4A 2KBXA 4HOUA 1HG5A 4BETA 3OAWA 1KLXA 5DIZA 4O6FA 4G23A 5J90A 4K5BA 4FJYA 3CGHA 3EHRA 4JVSA 3Q49B 2WXQA 3NQPA 4XI0A 4BY6A 3SI5A 4AV7A 4DI4A 1Z5SC 5G55A
chains in the Genus database with same CATH topology
5FIOA 1QYMA 3EHQA 1BLXB 3V79K 1BD8A 4DUIA 4HI9A 4CYMD 4DX1A 3V30A 3JXJA 5KBAA 4O1PA 2J8SD 4NIKA 1OY3D 2RFAA 5ENRD 1MX2A 1A5EA 5ENPD 4LSZE 5KWDA 1N11A 2XEHA 2F8YA 3UI2A 2HE0A 2A5EA 5EN5D 1OT8A 4UUCA 4DRXE 5CEAA 3ZUVB 5CECB 1AP7A 4HB5A 1IKND 3TWXA 3NOGD 5EIBE 5KNGA 3HG0D 4HLLA 5BXUA 3AAAC 4U95D 1MX6A 3DEOA 3V2XA 2NYJA 5ENQD 4C48B 1NFIE 2KXPC 3TWQA 4F6RD 4HI8A 3AJIA 5EILA 3UXGA 5AQ7A 3Q9UC 5EIDA 2VGEA 1YMPA 3LJNA 3W9FA 1MX4A 4RLYA 2DWZA 2Y0BG 4U8VD 4A63B 4DX2A 5AAOA 3ZU7B 4ZHBA 3HRAA 5JMND 5ITZF 3D9HA 3TWVA 1UOHA 2ETAA 5ENSD 4HQDA 1TR4A 4HRMB 4K5AB 3TWUA 2F8XK 5AQBA 2DVWA 1AWCB 2XZTG 4B93B 4BESA 1WG0A 5CBNA 1SW6A 2B0OE 4OAVB 2BKGA 5ENOD 2AJAA 4HBDA 2PNNA 5HKPA 2QYJA 5BXOA 4OAUC 4LNUD 2JABA 2FO1E 4Z68A 1BU9A 1K1AA 5AN8A 2V5QC 2F37A 4U8YD 4BEPA 1WDYA 2XZDG 1IXVA 2P2CP 4LG6A 5D66A 5AARA 2MYOA 3UTMA 1MJ0A 3V31A 3NBNB 3ZNGA 3T8KA 3V2OA 5CBOA 3F6QA 4G8LA 4ATZD 2RFMA 5CEDB 4U96D 1D9SA 3SO8A 1MYOA 4ZFHA 3DEPA 3J5PA 4BERA 1N0QA 3TWRA 3B7BA 4GMRA 4HRLA 4N5QA 2ETBA 4QQIA 4J8YA 5ENTD 4TUMA 3TWWA 5CERB 3EU9A 5HRYA 3ZKJA 2ETCA 4O60A 5EYLA 2DZOA 1K1BA 1K3ZD 4YDYA 5KNHD 2BKKB 2KBXA 4DX7D 4BETA 2ZGGA 3T9KA 1S70B 3C5RA 1BI8B 3W9GA 5JA4D 5EYPF 5AQ9A 2DZNA 4K5BA 2QC9A 1N0RA 2XENA 4F1PA 3EHRA 3J5QB 4BSZB 4K5CA 4O1OA 5AQAA 2Y1LE 1SVXA 3NOCD 3TWSA 1IHBA 4DX5D 3IXEA 4CZ2D 3B95A 4G8KA 4J7WA 4DX6D 2XEEA 1DCQA 3Q9NC 4YDWA 1G3NB 4HNAD 5HS0A 1BI7B 2ZGDA 4GPMA 3JXIA 3KEAA 1YCSB 3JUEA 2L6BA 4JB8P 1DC2A 4QFVA 3TWTA 4HRNA 1YYHA 2V4HC 5FINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FIO A;  1QYM A;  3EHQ A;  1BLX B;  3V79 K;  1BD8 A;  4DUI A;  4HI9 A;  4CYM D;  4DX1 A;  3V30 A;  3JXJ A;  5KBA A;  4O1P A;  2J8S D;  4NIK A;  1OY3 D;  2RFA A;  5ENR D;  1MX2 A;  1A5E A;  5ENP D;  4LSZ E;  5KWD A;  1N11 A;  2XEH A;  2F8Y A;  3UI2 A;  2HE0 A;  2A5E A;  5EN5 D;  1OT8 A;  4UUC A;  4DRX E;  5CEA A;  3ZUV B;  5CEC B;  1AP7 A;  4HB5 A;  1IKN D;  3TWX A;  3NOG D;  5EIB E;  5KNG A;  3HG0 D;  4HLL A;  5BXU A;  3AAA C;  4U95 D;  1MX6 A;  3DEO A;  3V2X A;  2NYJ A;  5ENQ D;  4C48 B;  1NFI E;  2KXP C;  3TWQ A;  4F6R D;  4HI8 A;  3AJI A;  5EIL A;  3UXG A;  5AQ7 A;  3Q9U C;  5EID A;  2VGE A;  1YMP A;  3LJN A;  3W9F A;  1MX4 A;  4RLY A;  2DWZ A;  2Y0B G;  4U8V D;  4A63 B;  4DX2 A;  5AAO A;  3ZU7 B;  4ZHB A;  3HRA A;  5JMN D;  5ITZ F;  3D9H A;  3TWV A;  1UOH A;  2ETA A;  5ENS D;  4HQD A;  1TR4 A;  4HRM B;  4K5A B;  3TWU A;  2F8X K;  5AQB A;  2DVW A;  1AWC B;  2XZT G;  4B93 B;  4BES A;  1WG0 A;  5CBN A;  1SW6 A;  2B0O E;  4OAV B;  2BKG A;  5ENO D;  2AJA A;  4HBD A;  2PNN A;  5HKP A;  2QYJ A;  5BXO A;  4OAU C;  4LNU D;  2JAB A;  2FO1 E;  4Z68 A;  1BU9 A;  1K1A A;  5AN8 A;  2V5Q C;  2F37 A;  4U8Y D;  4BEP A;  1WDY A;  2XZD G;  1IXV A;  2P2C P;  4LG6 A;  5D66 A;  5AAR A;  2MYO A;  3UTM A;  1MJ0 A;  3V31 A;  3NBN B;  3ZNG A;  3T8K A;  3V2O A;  5CBO A;  3F6Q A;  4G8L A;  4ATZ D;  2RFM A;  5CED B;  4U96 D;  1D9S A;  3SO8 A;  1MYO A;  4ZFH A;  3DEP A;  3J5P A;  4BER A;  1N0Q A;  3TWR A;  3B7B A;  4GMR A;  4HRL A;  4N5Q A;  2ETB A;  4QQI A;  4J8Y A;  5ENT D;  4TUM A;  3TWW A;  5CER B;  3EU9 A;  5HRY A;  3ZKJ A;  2ETC A;  4O60 A;  5EYL A;  2DZO A;  1K1B A;  1K3Z D;  4YDY A;  5KNH D;  2BKK B;  2KBX A;  4DX7 D;  4BET A;  2ZGG A;  3T9K A;  1S70 B;  3C5R A;  1BI8 B;  3W9G A;  5JA4 D;  5EYP F;  5AQ9 A;  2DZN A;  4K5B A;  2QC9 A;  1N0R A;  2XEN A;  4F1P A;  3EHR A;  3J5Q B;  4BSZ B;  4K5C A;  4O1O A;  5AQA A;  2Y1L E;  1SVX A;  3NOC D;  3TWS A;  1IHB A;  4DX5 D;  3IXE A;  4CZ2 D;  3B95 A;  4G8K A;  4J7W A;  4DX6 D;  2XEE A;  1DCQ A;  3Q9N C;  4YDW A;  1G3N B;  4HNA D;  5HS0 A;  1BI7 B;  2ZGD A;  4GPM A;  3JXI A;  3KEA A;  1YCS B;  3JUE A;  2L6B A;  4JB8 P;  1DC2 A;  4QFV A;  3TWT A;  4HRN A;  1YYH A;  2V4H C;  5FIN A; 
#chains in the Genus database with same CATH topology
 1TN7 A;  3FHE A;  3CVL A;  3JYS A;  3LCA A;  3PE3 A;  5CEA A;  2WVI A;  4EBA A;  3RKV A;  4C48 B;  1SA4 A;  5M72 A;  3TWQ A;  3CHO A;  3E30 A;  4A3T A;  1TNO A;  1X5B A;  1FT2 A;  3D9H A;  2F0Y A;  1UOH A;  3CEQ A;  2CHX A;  3UM3 A;  3ASO E;  2XQ0 A;  3WXX A;  2L0I A;  3UT4 A;  2OVB A;  4F53 A;  2OEW A;  3GZ1 A;  2VSN A;  2WXG A;  4ACK A;  4GTT A;  3ZXP A;  2IOS A;  1K3Z D;  4ANX A;  5KNH D;  4L7T A;  3EIQ C;  4JHR A;  2ZGG A;  4FHJ A;  4GCN A;  5T8I A;  4L1B A;  4G25 A;  2CFZ A;  5CHE E;  3LDZ A;  4M3O A;  4Y6C A;  4BSZ B;  4O1O A;  3UIP C;  4BWR A;  5KJM A;  1OUV A;  4JA9 A;  1H6O A;  1N52 A;  3PNL B;  3G2W A;  4UQZ A;  2XS1 A;  4G2V A;  3JXI A;  3FUJ A;  3SY2 A;  3JUE A;  1DC2 A;  4HRN A;  2XRZ A;  1BU9 A;  3PRE A;  3LJ3 A;  4BX8 A;  4GTM A;  2V0P A;  4B0Z A;  3Q4A B;  3B7T A;  3R7Q A;  3ZPJ A;  1LTX A;  1N4R A;  3L17 A;  3ISM C;  2H6H A;  3LY8 A;  4KZC A;  5C2Y A;  4HLL A;  4ACL A;  3QAR A;  2I1J A;  1YMP A;  3W9F A;  4MRU A;  5T3R A;  3G2S A;  5FTP A;  1V55 E;  1X81 A;  4RSY A;  5JJT A;  3TGO A;  4IRU A;  2XZT G;  1WG0 A;  3ASN E;  3EHM A;  4G11 A;  2P9U G;  3RO2 A;  1OXJ A;  1TJF A;  2JAB A;  1K1A A;  2R02 A;  4TUU A;  2MYO A;  4WWP A;  3CVN A;  3NAW A;  3ZHE B;  3AS8 A;  3DEP A;  4BER A;  3QWP A;  3MGB A;  3SFY A;  4A3V A;  3HDX A;  1FCH A;  1OWM A;  4AIF A;  3UPV A;  2XGO A;  4UWF A;  4YDY A;  2WXL A;  1UN9 A;  4AVX A;  3IBE A;  3FUD A;  1JWF A;  3ZEF A;  4G24 A;  4GTV A;  5EYP F;  4J8F A;  5JHA A;  1HXI A;  2C2L A;  4L9P A;  2ILR A;  2OND A;  2V5F A;  3CR3 A;  4Q96 A;  4DX6 D;  3HXD A;  2J09 A;  1KT1 A;  4GTO A;  3PZ3 A;  1YCS B;  1HF8 A;  3S7D A;  4GZ5 A;  5C1D A;  5FIO A;  3V79 K;  4DX1 A;  1OY3 D;  3VTY A;  2V4L A;  2EIN E;  3PUJ A;  3NZU A;  3D9P A;  2I9C A;  5T4Y A;  1A17 A;  2MRI A;  3AAA C;  2MOW A;  4B8A A;  3HVE A;  5A23 A;  3T5V A;  4FAD A;  4DX2 A;  1O1R A;  3UKU G;  4C9B B;  4UWH A;  1E90 A;  4FHK A;  3FUI A;  3JQ1 A;  4BX9 A;  3QWW A;  4B93 B;  2I6H A;  5FWQ A;  5HKP A;  4NQ0 A;  3ABM E;  4DPR A;  3SNX A;  1N94 A;  3SFZ A;  2F37 A;  3LVQ E;  4AEZ C;  3TG5 A;  2IY0 C;  4GZ3 A;  3Q5M A;  1UJJ A;  2CG2 A;  2JLB A;  2GRP B;  1SZA A;  4JEH A;  2GW1 A;  1N0Q A;  2KCL A;  2DIW A;  2P9P G;  4N5Q A;  3P2B A;  3S7B A;  4B94 A;  2GRL A;  3ZKJ A;  5HRY A;  4LNB A;  2ETC A;  3QNK A;  1OCO E;  5CCM A;  2P9N G;  2VYI A;  3C3Q A;  2J4D A;  3UKR G;  1SQM A;  3BU8 A;  3VTX A;  1UJK A;  3SZ7 A;  4BSX A;  3TAX A;  4FLB A;  4U07 A;  1OWO A;  3C3O A;  3J5Q B;  5BUZ A;  4U8H A;  3ABL E;  4K5C A;  3U4T A;  1HE8 A;  2YHC A;  3B95 A;  4U0Z A;  2L6J A;  5ARF A;  3PZ2 A;  2YQ8 A;  4J0U A;  5HS0 A;  3QK0 A;  1KZO A;  2B6C A;  2ZIS A;  3DXM G;  1BD8 A;  2XHE A;  3BG0 B;  4NIK A;  2UWJ G;  2WPV A;  3S2A A;  2WXM A;  3ONK A;  4E85 A;  5ENN A;  1HU3 A;  4C0M A;  5EIB E;  2I2O A;  4I6E A;  5AJL A;  3PZD A;  1JPL A;  3APD A;  5LP0 A;  1E8Z A;  3SFX A;  4KVO A;  3UXG A;  2WQH A;  3PEU B;  4A63 B;  2GRM A;  4F7A A;  3QWV A;  2KM4 A;  4LCT A;  1P5Q A;  1TNY A;  3UM0 A;  2R59 A;  4JEU A;  3JCK C;  4OAV B;  2AJA A;  1HX8 A;  3FU3 A;  3FTX A;  4I9C A;  2FO1 E;  2VGX A;  4L2Y A;  2WM9 A;  4N2S A;  2WXH A;  1ELW A;  4GAA A;  1FT1 A;  1H0A A;  2IFU A;  2Y69 E;  4GZ6 A;  3ASD A;  4DLQ A;  4EEC A;  4E6H A;  3ML8 A;  4I17 A;  3T9K A;  4CT4 A;  1K8K G;  4WWO A;  2WXN A;  3UM2 A;  2FEZ A;  1N0R A;  3OTN A;  2QZA A;  3T8M A;  4M7C A;  4UQX A;  5KJK A;  2WXK A;  1S63 A;  1WY6 A;  2OVF A;  1DCQ A;  4EZL A;  3RIB A;  2IEJ A;  1DCE A;  4GPM A;  2C0M A;  2WB2 A;  3U3W A;  1LF8 A;  1HH8 A;  1TN8 A;  4HOR A;  4X8Q A;  3JXJ A;  5KBA A;  2GRR B;  3FUE A;  4TXP A;  3AG2 E;  2L0T B;  4I1A A;  4GZC A;  3G2V A;  1AP7 A;  1H19 A;  1IKN D;  4WNE A;  3ML9 A;  5G04 C;  4KBQ A;  1N4Q A;  1YA0 A;  2YHE A;  4HS2 A;  4P29 A;  4N3A A;  2X6I A;  3QKY A;  3CV0 A;  4CRW A;  3KD7 A;  5ITZ F;  3EIJ A;  5AQB A;  1L5J A;  2DVW A;  4B89 A;  2MHK A;  4XX5 A;  4OAU C;  3FTU A;  3S7J A;  4U8Y D;  1EYH A;  2A5U A;  4AM9 A;  3Q78 A;  5CBO A;  3F6Q A;  3ULE G;  1ELR A;  4NUR A;  3KEZ A;  5CER B;  5G05 J;  4OVU A;  1ELK A;  3LY9 A;  4BFR A;  4DX7 D;  3HVE B;  2Q7F A;  3SHF A;  2WXP A;  2GRO B;  5HI7 A;  3ZW3 A;  3U66 A;  4EZJ A;  1QZ2 A;  3TJP A;  4APO A;  1NA3 A;  1G3N B;  2QYU A;  4HNA D;  2EIM E;  4YDO A;  2H6G A;  2LNI A;  2X6F A;  1RW2 A;  3OXG A;  1TNZ A;  3EHQ A;  3ONL A;  4HI9 A;  2WXO A;  3PS6 A;  4U63 A;  1TEZ A;  5ANL A;  3C72 A;  4FA6 A;  4YVQ C;  2CG3 A;  4GYW A;  3ABK E;  3FH7 A;  1N4S A;  4F3V A;  2XRY A;  2XGS A;  1IHG A;  3GZS A;  3DEO A;  1OWN A;  3CIA A;  3AJI A;  4RQI A;  3Q9U C;  1MZC A;  4GTP A;  4TRQ A;  3GYZ A;  4HQD A;  3DSU A;  1TR4 A;  4K5A B;  3QOU A;  3PRZ A;  3MCX A;  3FH8 A;  3UQ3 A;  2OV8 A;  4BEP A;  2UY1 B;  2P2C P;  4LG6 A;  1U3C A;  3R9M A;  3NBN B;  3ASG A;  5FZQ A;  4GU5 A;  2KAT A;  2R5S A;  2VTB A;  4U96 D;  2LXM A;  4RG9 A;  4GA2 A;  3CHS A;  3DBS A;  4O60 A;  4KXK B;  4EBA G;  4GTR A;  4I2Z A;  3FEY A;  3D9M A;  2XS8 A;  5EX3 A;  4I1M A;  4U04 A;  5AQ9 A;  2DZN A;  4Q94 A;  3ULQ A;  2QC9 A;  3L08 A;  3CKC A;  3EHN A;  4I1O B;  1JWG A;  3RJV A;  4J7W A;  5FQ6 A;  5LCW J;  3Q75 A;  4KZ0 A;  2FF4 A;  3O48 A;  1QBQ A;  3FTS A;  2P9S G;  4IUL A;  3D9N A;  4D10 C;  2J8S D;  3B7U X;  3RK6 A;  5EN5 D;  3APF A;  3EUV A;  5CCL A;  4AY6 A;  4IN3 B;  5EIL A;  5IY5 E;  2ION A;  3CVX A;  4BTB A;  4A1G A;  1KZP A;  2XGM A;  4XEI G;  1AWC B;  4ILG A;  4XI9 A;  1XNF A;  1WM5 A;  4AOF A;  1O1T A;  1E7V A;  1IXV A;  4UWK A;  4N5C A;  4G8L A;  4ATZ D;  1MHQ A;  2CFU A;  4GTQ A;  3PEV B;  3PDN A;  3D9O A;  2P9L G;  3E34 A;  1RZ4 A;  3BG1 B;  4GTS A;  2AXU A;  4HFG A;  3HYM B;  3KS2 A;  3B13 A;  3ZYK A;  3ZIM A;  2LUH A;  5G05 C;  3MJW A;  5JHB A;  4CDN A;  4J6I A;  5CMY A;  3BUA A;  3Q9N C;  2A4Z A;  2FUL A;  2R05 A;  3I4R B;  5KCM A;  3MKQ A;  3LPZ A;  2BTD A;  4O1P A;  4JHJ A;  2XCC A;  3EJN A;  1E8Y A;  5FQ8 A;  2C0L A;  2J4B A;  2XPY A;  2KZT A;  4LUN U;  3ZYQ A;  3Q47 B;  1JCR A;  4GMJ A;  2IJG X;  4TV3 A;  3HRA A;  5FZS A;  3K9I A;  3U9W A;  4IYP A;  3B7S A;  2LAI A;  3FFL A;  5EX0 A;  4C0E A;  3CVQ A;  4HBD A;  3IKO B;  2DYR E;  1S0P A;  4U7E B;  3U64 A;  1IQR A;  1SA5 A;  3OXL A;  3V2O A;  4ZFH A;  1KPS B;  2LO6 A;  4L23 A;  2IF4 A;  2QY7 A;  2EQX A;  2BF0 X;  3Q7F A;  3Q79 A;  1TJC A;  3T5X A;  5DBK A;  4OVV A;  5CMW A;  3TG4 A;  1VDY A;  1GW6 A;  4XIF A;  4DX5 D;  2HO1 A;  4FC8 A;  5AEN A;  4HOT A;  4YDW A;  3BEE A;  4UWL A;  3VLE A;  3KEA A;  4QFV A;  3AG4 E;  3V2X A;  5BV1 A;  2VTB B;  4R7L A;  5ENP D;  5LCW C;  4UUC A;  1W3B A;  3TWX A;  3CVW A;  2XPI A;  4HVB A;  3L9T A;  3UIO C;  5AIJ A;  1NZN A;  3ZFW A;  3PH0 C;  3MV2 B;  2YIN A;  4U8V D;  1ZBP A;  1Y8M A;  3SQV A;  2F8X K;  3Q73 A;  3EU5 A;  2FBN A;  5A7D B;  3IEG A;  2B0O E;  1LD7 A;  2QYJ A;  1PAQ A;  2H6I A;  1H2V C;  2PM6 A;  5AAR A;  3AS5 A;  3V31 A;  1MJ0 A;  4HLE A;  1UW4 B;  3SGH A;  5EKQ D;  2PZI A;  2VGY A;  3JQ0 A;  4Y6W A;  1JCS A;  1OCR E;  1UN8 A;  5ENT D;  2M63 A;  3TWW A;  4L2L A;  3EU9 A;  2WXI A;  3E32 A;  5EDS A;  3IHV A;  3SD5 A;  4WWN A;  4EHM A;  3CQC B;  1DVP A;  2QFC A;  5JA4 D;  2WXJ A;  1N95 A;  3QC1 A;  1D8E A;  2OEV A;  4CGV A;  1E7U A;  4A1S A;  3R9A B;  2IO3 C;  3HXE A;  4FUL A;  4KT6 B;  3FTW A;  4KMO A;  3FUL A;  3NZS A;  4ILH B;  3APC A;  2E0I A;  5H7P A;  2DBA A;  5CRU A;  1U3D A;  3V30 A;  1INZ A;  3FUH A;  1Q2Z A;  5KJL A;  1N11 A;  4Q69 A;  4CT0 A;  5B1A E;  5B3S E;  4ATG A;  1MX6 A;  2PQR A;  3G2U A;  1S64 A;  4AP2 A;  2JEK A;  3LXU X;  3ZVV A;  5BW8 C;  4GCO A;  3VLD A;  2WQ7 A;  3GW4 A;  3DPD A;  4DI3 A;  2Y4U A;  4JXT A;  3TWV A;  4U0S A;  5ENS D;  2HYZ A;  1EDU A;  1IQU A;  4BES A;  5LFA A;  3CST A;  2PNN A;  5BXO A;  3CK9 A;  3MKQ B;  2X38 A;  1NP7 A;  3RSE G;  5FIN A;  1WDY A;  5D2M C;  3HHM A;  3UTM A;  2AXV A;  3CHQ A;  1OWL A;  4YDE A;  2WXF A;  3ENE A;  1MYO A;  3LYA A;  2KZT B;  4GMR A;  4NRH B;  1HG2 A;  4XZ4 A;  4TUM A;  5ARG A;  1JCQ A;  5EYL A;  5JJ7 A;  1S70 B;  1KT0 A;  3W9G A;  4UQY A;  4HOS A;  4AY5 A;  4F1P A;  3ZRH A;  3LKU A;  3ZHE A;  1SVX A;  3IV0 A;  4CDM A;  4CZ2 D;  5G2N A;  2PL2 A;  2ZIR A;  3LVR E;  4I9E A;  2R17 C;  3UMV A;  3DST A;  1YYH A;  1QYM A;  4N39 A;  3L82 A;  2FI7 A;  3ZXS A;  4CYM D;  5FJY A;  4PS8 A;  4CCA A;  5CRV A;  5KWD A;  1NI1 A;  3D9I A;  2J49 A;  2Y3A A;  2A5E A;  1V54 E;  3ZUV B;  4HB5 A;  2WMN A;  3E4B A;  1FVH A;  1OCC E;  3ZU7 B;  4ZHB A;  1H6K A;  3E37 A;  1WAO 1;  5BT1 A;  5CBN A;  3UX4 A;  2WXR A;  3HXF A;  4LEU A;  2EIJ E;  3C98 A;  4I6G A;  2XZD G;  5D66 A;  4J8S A;  3T8K A;  2KCV A;  4V3I A;  5BV0 A;  4B8C B;  4QQI A;  1EPU A;  3P1U A;  4WNG A;  3PE4 A;  1LD8 A;  2OOE A;  3DRA A;  3CSF A;  1SZ9 A;  2L9B A;  5ANR A;  3KSL A;  3ZYL A;  4ABN A;  3QB2 A;  2J07 A;  2Y1L E;  4JHK A;  4G8K A;  2WMO A;  1N9A A;  4ANW A;  3CLJ A;  1HZ4 A;  2RD0 A;  5LX8 A;  3HXC A;  1Z3X A;  1ZU2 A;  3UUX A;  1PC2 A;  1Y6I A;  4KYO B;  4OYS A;  2IOL A;  3BQO A;  4HOQ A;  4URK A;  4I6J A;  3MKR A;  2GRN B;  4MKT A;  3L16 A;  3NB2 A;  2ZXW E;  3NOG D;  3L6A A;  5E76 A;  1UG3 A;  2NYJ A;  2VGX B;  3MX3 A;  4GA0 A;  2EIL E;  5EID A;  4PDX A;  3LEW A;  4LRZ A;  4ME2 A;  4UI9 J;  3G2T A;  2IU1 A;  3KAE A;  3RRU A;  1Z6T A;  5D0O D;  1HS6 A;  4GA1 A;  4APF A;  2R03 A;  4BT8 A;  3D9L A;  1E96 B;  1D8D A;  3AS4 A;  3PZ1 A;  3URZ A;  3QDN A;  4LNU D;  3ULY A;  3ZNG A;  4NAC A;  4PH4 B;  2X6J A;  5CED B;  4N3C A;  3SO8 A;  2VSO E;  4RG6 A;  4PUC A;  1BPO A;  4JC8 A;  4MLP A;  2BKK B;  1TYQ G;  1HFA A;  1ZB1 A;  4FJZ A;  4ANU A;  1BI8 B;  3TL5 A;  1O1S A;  4WAF A;  3VLF A;  3MYV A;  3RRN B;  3AG1 E;  2X6K A;  1E8W A;  4A55 A;  2J08 A;  1XGW A;  2NC9 A;  4DLO A;  3UT8 A;  2BUG A;  3TXN A;  4G1T A;  3RU0 A;  2RFA A;  4JZY A;  4XKB A;  2F8Y A;  3DWL G;  2HE0 A;  5FQ7 A;  4FU3 A;  2CHZ A;  5CEC B;  4DJA A;  3CQG B;  3GZ2 A;  3HG0 D;  2Y4T A;  1N54 A;  4HI8 A;  3MA5 A;  2VGE A;  3LJN A;  4I43 A;  4RLY A;  3CVP A;  2FO7 A;  3MEK A;  3AG3 E;  2XPZ A;  2IQC A;  1FPP A;  2CHW A;  3FY4 A;  2P9K G;  3FH5 A;  3X2Q E;  3DPY A;  4Z68 A;  2R2L A;  3KSQ A;  5E75 A;  4CDR A;  3NF1 A;  3WG7 E;  3ESL A;  1B89 A;  4G26 A;  4JW1 A;  3B7R L;  3TWR A;  4TXQ A;  3OXF A;  4N2Q A;  4K03 A;  4K0R A;  2LAH A;  2H6F A;  3UIN C;  2X6H A;  5G04 J;  3PNT B;  3PUK A;  2LSU A;  1O5M A;  1IYG A;  5B1B E;  3FUN A;  1PY1 A;  4WNF A;  3TWS A;  5FZR A;  4UWG A;  2XEE A;  2AVP A;  3ASF A;  3S7F A;  4EQF A;  3TWT A;  2IO2 C;  2V4H C;  4FP7 A;  4H7X A;  2RKK A;  5BPP A;  1BLX B;  5BNW A;  4DUI A;  3MV3 B;  3ASH A;  3CK8 A;  3LS8 A;  3CHP A;  4LSZ E;  4BT9 A;  3UI2 A;  4XE0 A;  1QNF A;  4N3B A;  4KVM A;  3N71 A;  2GGF A;  5JJ6 A;  3RAU A;  1EF1 C;  2WQ6 A;  5FQ4 A;  2KXP C;  4F6R D;  3R7R A;  5AQ7 A;  1QQE A;  4RVB A;  2VSX E;  1MQS A;  2DWZ A;  1H2U A;  5JMN D;  4FLH A;  3TWU A;  4ILI A;  5D0Q D;  2BKG A;  2V8S E;  3C3R A;  4UI9 C;  3QJZ A;  2V5Q C;  4YND A;  3Q15 A;  3QAQ A;  3HIZ A;  4GZD A;  4LNG A;  3CKB A;  4MS6 A;  1D9S A;  4HRL A;  2OCC E;  3HXB A;  4GYY A;  5AJD A;  2AW6 A;  1H6P A;  1HO8 A;  5A6C A;  1U2V G;  3CVY A;  2UY1 A;  2XEN A;  4I2W A;  4JPS A;  3ESK A;  5AQA A;  3FU6 A;  5KJN A;  1NA0 A;  3IXE A;  3FU5 A;  2X3M A;  2PM7 A;  1BI7 B;  2ZGD A;  3DSS A;  4JL0 A;  4WUY A;  3RO3 A;  4UI9 K;  2PQN A;  2L6B A;  4J8E A;  4AXH A;  3I4G A;  2VSY A;  5ENR D;  4PS3 A;  3PZ4 A;  3TXM A;  4EZK A;  4CGW A;  3EDT B;  1OT8 A;  3DXK G;  3FUK A;  2P9I G;  3SF4 A;  1N4P A;  3DSX A;  5KNG A;  3DSV A;  4GML A;  5BXU A;  4U95 D;  3FEX A;  1JUQ A;  2NSZ A;  1NL4 A;  3CVV A;  3O4Z A;  2DYS E;  2AXZ A;  3LY7 A;  3FP3 A;  2DCP A;  3MZL B;  2LXL A;  2GRQ B;  4HRM B;  3I5P A;  4J8D A;  1DNP A;  3AU5 A;  5AN8 A;  3L22 A;  3FDH A;  2HR2 A;  4W9R A;  4LER A;  3D9J A;  4GPK A;  2KC7 A;  3FUF A;  3SBS A;  1H2T C;  2J9Q A;  2BED A;  2RFM A;  2VJ8 A;  3CK7 A;  3J5P A;  3B7B A;  2EIK E;  4JD2 G;  4J8Y A;  4EPZ A;  2DZO A;  3FTV A;  4AJW A;  3L54 A;  3UT7 A;  2LSV A;  3C5R A;  3E33 A;  1TNB A;  4CEM A;  3DSW A;  4GB9 A;  3FU0 A;  3D9K A;  4XKC A;  3NOC D;  1IHB A;  4H7Y A;  2ZU6 B;  3FWV A;  3I3N A;  4DK5 A;  4ANV A;  4TXR A;  4JB8 P;  3CHR A;  5HQ8 A;  2XEV A;  1E8X A;  4YVO A;  3CHM A;  2KCK A;  3FTZ A;  1MX2 A;  1A5E A;  5J08 A;  2XEH A;  3Q7A A;  3CVU A;  4DRX E;  3ZYM A;  3UM1 A;  2VQ2 A;  5ENQ D;  2YNQ A;  2I1K A;  1NFI E;  4GYO A;  2XCB A;  3ZN3 A;  1MX4 A;  2NXP A;  2Y0B G;  3FUM A;  5AAO A;  1OCZ E;  4U0U A;  5LOZ A;  2ETA A;  3SBT B;  4BTA A;  2HM8 A;  1SW6 A;  5ENO D;  1OWP A;  2AWI A;  5FT9 A;  4WND A;  3JUI A;  4MBG A;  3L13 A;  1TNU A;  3IHY A;  4HXI A;  3ZGQ A;  3FTY A;  2E2E A;  3D3M A;  5AYW D;  4JA7 A;  1Z3Y A;  3RRM B;  2ETB A;  2P58 C;  4PS7 A;  3PVL A;  1FVF A;  4F1S A;  1TN6 A;  2RG8 A;  1K1B A;  3AU4 A;  2KBX A;  4HOU A;  1HG5 A;  4BET A;  3OAW A;  1KLX A;  5DIZ A;  4O6F A;  4G23 A;  5J90 A;  4K5B A;  4FJY A;  3CGH A;  3EHR A;  4JVS A;  3Q49 B;  2WXQ A;  3NQP A;  4XI0 A;  4BY6 A;  3SI5 A;  4AV7 A;  4DI4 A;  1Z5S C;  5G55 A; 
#chains in the Genus database with same CATH homology
 5FIO A;  1QYM A;  3EHQ A;  1BLX B;  3V79 K;  1BD8 A;  4DUI A;  4HI9 A;  4CYM D;  4DX1 A;  3V30 A;  3JXJ A;  5KBA A;  4O1P A;  2J8S D;  4NIK A;  1OY3 D;  2RFA A;  5ENR D;  1MX2 A;  1A5E A;  5ENP D;  4LSZ E;  5KWD A;  1N11 A;  2XEH A;  2F8Y A;  3UI2 A;  2HE0 A;  2A5E A;  5EN5 D;  1OT8 A;  4UUC A;  4DRX E;  5CEA A;  3ZUV B;  5CEC B;  1AP7 A;  4HB5 A;  1IKN D;  3TWX A;  3NOG D;  5EIB E;  5KNG A;  3HG0 D;  4HLL A;  5BXU A;  3AAA C;  4U95 D;  1MX6 A;  3DEO A;  3V2X A;  2NYJ A;  5ENQ D;  4C48 B;  1NFI E;  2KXP C;  3TWQ A;  4F6R D;  4HI8 A;  3AJI A;  5EIL A;  3UXG A;  5AQ7 A;  3Q9U C;  5EID A;  2VGE A;  1YMP A;  3LJN A;  3W9F A;  1MX4 A;  4RLY A;  2DWZ A;  2Y0B G;  4U8V D;  4A63 B;  4DX2 A;  5AAO A;  3ZU7 B;  4ZHB A;  3HRA A;  5JMN D;  5ITZ F;  3D9H A;  3TWV A;  1UOH A;  2ETA A;  5ENS D;  4HQD A;  1TR4 A;  4HRM B;  4K5A B;  3TWU A;  2F8X K;  5AQB A;  2DVW A;  1AWC B;  2XZT G;  4B93 B;  4BES A;  1WG0 A;  5CBN A;  1SW6 A;  2B0O E;  4OAV B;  2BKG A;  5ENO D;  2AJA A;  4HBD A;  2PNN A;  5HKP A;  2QYJ A;  5BXO A;  4OAU C;  4LNU D;  2JAB A;  2FO1 E;  4Z68 A;  1BU9 A;  1K1A A;  5AN8 A;  2V5Q C;  2F37 A;  4U8Y D;  4BEP A;  1WDY A;  2XZD G;  1IXV A;  2P2C P;  4LG6 A;  5D66 A;  5AAR A;  2MYO A;  3UTM A;  1MJ0 A;  3V31 A;  3NBN B;  3ZNG A;  3T8K A;  3V2O A;  5CBO A;  3F6Q A;  4G8L A;  4ATZ D;  2RFM A;  5CED B;  4U96 D;  1D9S A;  3SO8 A;  1MYO A;  4ZFH A;  3DEP A;  3J5P A;  4BER A;  1N0Q A;  3TWR A;  3B7B A;  4GMR A;  4HRL A;  4N5Q A;  2ETB A;  4QQI A;  4J8Y A;  5ENT D;  4TUM A;  3TWW A;  5CER B;  3EU9 A;  5HRY A;  3ZKJ A;  2ETC A;  4O60 A;  5EYL A;  2DZO A;  1K1B A;  1K3Z D;  4YDY A;  5KNH D;  2BKK B;  2KBX A;  4DX7 D;  4BET A;  2ZGG A;  3T9K A;  1S70 B;  3C5R A;  1BI8 B;  3W9G A;  5JA4 D;  5EYP F;  5AQ9 A;  2DZN A;  4K5B A;  2QC9 A;  1N0R A;  2XEN A;  4F1P A;  3EHR A;  3J5Q B;  4BSZ B;  4K5C A;  4O1O A;  5AQA A;  2Y1L E;  1SVX A;  3NOC D;  3TWS A;  1IHB A;  4DX5 D;  3IXE A;  4CZ2 D;  3B95 A;  4G8K A;  4J7W A;  4DX6 D;  2XEE A;  1DCQ A;  3Q9N C;  4YDW A;  1G3N B;  4HNA D;  5HS0 A;  1BI7 B;  2ZGD A;  4GPM A;  3JXI A;  3KEA A;  1YCS B;  3JUE A;  2L6B A;  4JB8 P;  1DC2 A;  4QFV A;  3TWT A;  4HRN A;  1YYH A;  2V4H C;  5FIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...