3KEAA

Structure function studies of vaccinia virus host-range protein k1 reveal a novel ankyrin repeat interaction surface for k1s function
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
283
structure length
283
Chain Sequence
GMDLSRINTWKSKQLKSFLSSKDTFKADVHGHSASYYAIADNNVRLVCTLLNAGALKNLLENEFPLHQAATLEDTKIVKILLFSGLDDSQFDDKGNTALYYAVDSGNMQTVKLFVKKNWRLMFYGKTGWKTSFYHAVMLNDVSIVSYFLSEIPSTFDLAILLSCIHITIKNGHVDMMILLLDYMTSTNTNNSLLFIPDIKLAIDNKDIEMLQALFKYDINIYSANLENVLLDDAEIAKMIIEKHVEYKSDSYTKDLDIVKNNKLDEIISKNKELRLMYVNCVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords K1L
publication title Structure function studies of vaccinia virus host range protein k1 reveal a novel functional surface for ankyrin repeat proteins.
pubmed doi rcsb
source organism Vaccinia virus
total genus 81
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3keaA00
5CBNA 3T9KA 3TWVA 1MX2A 2V5QC 3ZU7B 1YYHA 4GPMA 3W9FA 2ZGDA 3V79K 3TWTA 3TWRA 5JA4D 4HRNA 4K5AB 4O60A 4ZHBA 1SVXA 3J5QB 5D66A 1BI7B 2P2CP 3TWWA 5BXOA 3C5RA 5ITZF 2XENA 2ZGGA 4HLLA 5KNGA 2QC9A 5ENPD 1A5EA 1DCQA 4YDWA 4NIKA 1N0RA 3HRAA 2KBXA 2ETCA 3TWXA 5AQ9A 3B95A 4YDYA 4O1OA 2XZDG 4BESA 2DVWA 5ENRD 3V31A 5CEDB 2BKKB 4JB8P 4DX7D 4HI9A 3ZUVB 1BI8B 3Q9NC 5EILA 3LJNA 1IKND 1MJ0A 1UOHA 4GMRA 1WDYA 1MYOA 4DUIA 2XEEA 1YMPA 3EHRA 3SO8A 4BERA 5HKPA 3TWUA 4ATZD 3F6QA 4K5BA 4F6RD 5JMND 5KWDA 2FO1E 4TUMA 2F37A 3JXIA 3Q9UC 2Y1LE 3EHQA 1OY3D 4U95D 5AQ7A 2B0OE 1BLXB 4DX1A 4B93B 2ETBA 3DEOA 4Z68A 4BEPA 4OAVB 5CECB 1D9SA 2AJAA 4HRMB 4BETA 5EIBE 4CZ2D 4U96D 2HE0A 2QYJA 2JABA 4G8LA 2XZTG 2RFAA 5EN5D 4F1PA 5EIDA 3UXGA 5AAOA 1AWCB 5CERB 4O1PA 1SW6A 4LNUD 1BD8A 3TWQA 4J8YA 5BXUA 5KNHD 5AARA 3ZNGA 3AAAC 2PNNA 1BU9A 1DC2A 1IHBA 4A63B 4U8VD 4HBDA 5HS0A 1IXVA 1NFIE 2DZOA 1WG0A 2DZNA 5FIOA 5ENTD 3JUEA 5KBAA 4HI8A 5ENQD 1S70B 4DRXE 2DWZA 2F8XK 4ZFHA 1YCSB 3KEAA 4HB5A 3B7BA 1K3ZD 1K1AA 4J7WA 5EYPF 1N0QA 1OT8A 3D9HA 3UTMA 3ZKJA 4LSZE 4OAUC 3TWSA 5FINA 4DX2A 2BKGA 5AN8A 3V30A 4LG6A 4UUCA 5AQAA 2NYJA 5AQBA 4QQIA 3NBNB 4HQDA 3V2XA 3EU9A 4N5QA 3IXEA 4QFVA 3T8KA 2VGEA 5CEAA 4CYMD 1G3NB 2A5EA 3JXJA 2V4HC 2Y0BG 3DEPA 4U8YD 2F8YA 3J5PA 5EYLA 4C48B 2KXPC 4BSZB 1TR4A 3HG0D 4RLYA 3W9GA 1N11A 5ENSD 1K1BA 2MYOA 3NOCD 4DX6D 4DX5D 1AP7A 4HNAD 2RFMA 4G8KA 2L6BA 5HRYA 4HRLA 1MX6A 3AJIA 4K5CA 1QYMA 2ETAA 2XEHA 2J8SD 5ENOD 3V2OA 5CBOA 3UI2A 3NOGD 1MX4A
chains in the Genus database with same CATH superfamily
2QFCA 3CHRA 5DBKA 5ITZF 4RQIA 2IONA 3V31A 2GGFA 3SQVA 1MYOA 2XEEA 4B0ZA 4EHMA 4BERA 5HKPA 1S0PA 4HOUA 4LNGA 2LO6A 3UT7A 3Q9UC 2DYSE 3B7UX 4NRHB 2XGMA 2BF0X 1FT1A 1TNZA 2IEJA 4G25A 2MOWA 5BV1A 2XPYA 4TUUA 3QAQA 5CERB 1OWOA 3CGHA 4FADA 1E7VA 1HZ4A 4C9BB 2VGXA 3JUEA 4HI8A 2VSXE 5E76A 3MV2B 3PE3A 3BQOA 1D8EA 3TWSA 4EZJA 3UT4A 4UI9K 2WXQA 4JXTA 2NYJA 4OVVA 4EECA 3T8KA 3FEYA 2A5EA 1Y8MA 3SFXA 2JLBA 1K1BA 3QK0A 3OXLA 5AJDA 3CSFA 3MV3B 3MKQB 3ULYA 1MX6A 4UWGA 4KZCA 2V4LA 3DSUA 4U8HA 3UI2A 3CHMA 3KS2A 4U07A 1HH8A 1N9AA 5AYWD 3KEZA 4APFA 4JVSA 2LSUA 4JHJA 4YDWA 3HRAA 2ETCA 3WG7E 4F3VA 3IBEA 4BESA 1UN8A 2I6HA 3FTXA 3U64A 1LD7A 2VGXB 3AG3E 4IULA 1YMPA 3X2QE 3MA5A 2GRRB 2WVIA 3CVYA 1ELKA 2WXPA 2Y1LE 3UKUG 1YA0A 4FHJA 1OWMA 1NL4A 3LY7A 4I9CA 2QYJA 4LNBA 3DBSA 2X6JA 3S2AA 3TWQA 2YNQA 1RW2A 2Y3AA 3BU8A 5ENNA 4UQZA 1IXVA 2DWZA 4ANXA 3CLJA 4JPSA 2PQRA 2QZAA 4C0MA 4LSZE 3D9LA 2ZISA 3ZXPA 4CEMA 3L13A 4DI4A 2EILE 4YNDA 2GRQB 1TR4A 5JJ6A 2R59A 3R7QA 2MYOA 2LNIA 1H2VC 5D0QD 4G8KA 1D8DA 1E8WA 1FPPA 4XIFA 3CSTA 5CBOA 4RVBA 4CGWA 1N54A 5ARFA 3T9KA 2V5QC 3C3RA 2V8SE 2H6GA 5D66A 3TWWA 2P2CP 4A3TA 5KNGA 4U0ZA 1UG3A 2IY0C 3TWXA 4HFGA 2R02A 3B95A 3EIJA 2YINA 2DVWA 2XQ0A 4FA6A 3DWLG 4ABNA 4GB9A 5FQ8A 2X6KA 5J90A 1TNYA 2FO1E 3EUVA 2GRNB 1FVHA 4A3VA 4B93B 4MKTA 1H6PA 3AU4A 3G2SA 4HRMB 2J07A 2J9QA 4F1PA 3UUXA 3EHMA 5KJMA 2OCCE 3PUJA 4A63B 3RO3A 1Z6TA 4U8VD 1NA0A 3SBTB 3FY4A 2C0MA 4FHKA 4EBAG 2MRIA 2WXJA 1SZAA 3FUJA 5BV0A 3R7RA 2RKKA 2AWIA 3V2XA 3RSEG 3FP3A 2Y0BG 1U2VG 4BSZB 4AVXA 2M63A 3AG4E 2PZIA 4K5CA 2XEHA 3LPZA 3SFYA 4JEUA 2IO2C 3W9FA 4K5AB 4NURA 1HS6A 3PH0C 4J0UA 2Y4TA 2QC9A 3KSQA 5ENPD 4NIKA 3LVQE 2EQXA 3L6AA 2XZDG 3ASOE 4YDOA 2WQHA 1UOHA 3CR3A 4XKBA 3SO8A 5HI7A 4PS3A 3ZYKA 5KWDA 2BTDA 4OYSA 3RIBA 3UM0A 5AQ7A 3FTWA 4WNEA 1OCRE 4UQYA 4BETA 1UN9A 3PRZA 2C0LA 5M72A 1Y6IA 1E8XA 4HOQA 2GROB 3Q79A 4ILHB 4B89A 2LAIA 2XEVA 4U63A 3T8MA 4GTPA 1YCSB 4JA7A 3LS8A 3NB2A 2LXMA 3D9HA 3Q78A 4ILIA 2CHZA 5FINA 5G04C 3S7JA 5AN8A 4LG6A 2L6JA 3PE4A 2UWJG 1FCHA 3U3WA 2MHKA 2I9CA 5J08A 5H7PA 2WXGA 3MCXA 4GTVA 4H7YA 4UWFA 4I1MA 1TEZA 2CG3A 2J49A 2PL2A 1AP7A 1INZA 3CHOA 3SY2A 4GMJA 1HF8A 1OXJA 3I4GA 4U0UA 3R9AB 3ZW3A 2XS1A 4I1OB 1BI7B 2ZGGA 2UY1A 1FT2A 3ML9A 2BEDA 2IQCA 4GYOA 3JQ0A 4GMRA 1MHQA 1Z5SC 3G2UA 2F37A 4GYWA 3D9JA 2CFUA 1Z3XA 2GRMA 4MS6A 2OOEA 4DI3A 4L1BA 4GYYA 4XE0A 2XCCA 4CDMA 4PS7A 2RFAA 3ZFWA 3HXEA 1WAO1 1TNUA 3HVEA 5AARA 4DLOA 1JPLA 3D9MA 3D9OA 4KYOB 3B7RL 1OCZE 3G2TA 5HS0A 2C2LA 3NZSA 3QKYA 3HDXA 2F8XK 1EYHA 2GW1A 4APOA 3ASNE 1OWPA 3B7BA 3PNTB 3UMVA 4WWPA 2UY1B 1O5MA 4DPRA 3PZ2A 4UQXA 5FQ4A 3B7SA 4U8YD 1SQMA 4N39A 4N3BA 3IKOB 3T5VA 2H6HA 3VLDA 2LSVA 2VJ8A 3OXFA 4P29A 4B8AA 3BG0B 3TL5A 1O1RA 3BEEA 4Y6CA 2WQ7A 3FEXA 1SVXA 1HE8A 3FU6A 2KBXA 4G24A 3MKRA 1SZ9A 3CVNA 1IKND 5AENA 4LUNU 1OWLA 1H0AA 5LP0A 3C3OA 4ATZD 2OV8A 5G04J 4AJWA 1E8ZA 3DSWA 4XX5A 3LDZA 1OY3D 3JYSA 3CEQA 4I2ZA 4ACLA 4Z68A 3N71A 3ZGQA 2VTBB 1H2UA 3OTNA 4BTBA 3ULEG 3GYZA 1KT1A 4XEIG 2AXZA 3CV0A 3FUKA 4M3OA 4WAFA 3U9WA 5JHAA 2Y69E 3SHFA 3E37A 3ZHEA 2FEZA 4JHKA 1WG0A 1LTXA 1KT0A 4GMLA 4BT8A 2IU1A 1N4RA 2WXNA 1ELWA 4DX2A 4IYPA 4UUCA 2EINE 5FQ6A 2OEVA 4PH4B 3FULA 5CEAA 3K9IA 2KCKA 2ZIRA 4RLYA 3DRAA 1NA3A 3ML8A 2R2LA 4CGVA 2QYUA 5CBNA 1MX2A 3T5XA 4O60A 1HU3A 2VYIA 3C5RA 1QQEA 3SD5A 1DCQA 4HOSA 1KZPA 1IYGA 3ISMC 2WMNA 4L2LA 4JL0A 1E96B 2GRPB 5KCMA 1MJ0A 2XGOA 4HVBA 4J8FA 3MZLB 1QBQA 2WXLA 1U3CA 4V3IA 4AXHA 4AP2A 3FFLA 4BEPA 5CECB 3AU5A 3ZXSA 4XKCA 2BUGA 1N95A 2R05A 4G1TA 1BU9A 1XNFA 3ASDA 4L7TA 1E90A 1NFIE 4UWLA 4BSXA 4AV7A 5KBAA 3SI5A 4JEHA 1TN7A 4MRUA 2L9BA 4AIFA 1K1AA 1K3ZD 3G2VA 3C3QA 3JQ1A 3DEPA 3LKUA 2WXKA 1JUQA 3DXMG 3AG1E 1MZCA 3FUFA 4KVOA 4DJAA 3CKCA 2P9IG 1PC2A 3KEAA 1UJKA 1YYHA 5CHEE 3PZ3A 2WXFA 3SNXA 1HXIA 5AQ9A 4I17A 4JW1A 2OVFA 5B3SE 4DX7D 3IV0A 1BI8B 3Q9NC 1QNFA 4GCOA 1A17A 3EIQC 3UINC 4I1AA 4DUIA 3DSSA 5CMWA 1U3DA 3SFZA 3NF1A 3FH5A 3TXNA 1HG5A 3KAEA 2ZXWE 1Q2ZA 2AJAA 1N94A 2XPZA 2WXIA 3D3MA 3DPYA 5LCWC 1AWCB 2FBNA 2FI7A 4Q69A 1V54E 3ZNGA 3HXCA 1EF1C 4NACA 2IOLA 3TG5A 3ONKA 2DZOA 2DZNA 2FO7A 2KZTA 1S70B 1SA4A 2H6FA 3ZYLA 3I3NA 3ABLE 1H2TC 2VSOE 2OEWA 3ZKJA 1H6KA 5FWQA 5ANLA 5AQBA 3NBNB 3EU9A 4HORA 3SGHA 4QFVA 2IOSA 2F0YA 4GA2A 3HG0D 5ENSD 3NOCD 2X6IA 3AS8A 1QZ2A 4HNAD 4KXKB 5FZQA 3FTUA 5BNWA 3JCKC 3NOGD 4GZDA 2IO3C 3Q15A 2WMOA 2XCBA 2X38A 2ONDA 2P9PG 5E75A 4GU5A 3UIPC 5LOZA 5G05C 4TRQA 3QOUA 4GTRA 4JC8A 5T3RA 1PAQA 4KZ0A 1S64A 2R03A 4WNFA 4KVMA 4UWKA 2KZTB 4GCNA 4B8CB 3ZEFA 4EPZA 3ASFA 2AXVA 2B0OE 2DBAA 3DEOA 3FUMA 1D9SA 4TXQA 1JWFA 2HE0A 2WB2A 4G8LA 2KCVA 5A6CA 1SW6A 2RG8A 5G2NA 4ANWA 4A1GA 3AAAC 4EZLA 2PNNA 4J6IA 2J4BA 4J8SA 2WXOA 2IF4A 3PUKA 3C98A 5CRVA 2J08A 3PNLB 5KJKA 2XRYA 4M7CA 2BKGA 3QWPA 3L9TA 4QQIA 4FLHA 2X3MA 1GW6A 2R17C 3L54A 2GRLA 3KD7A 2F8YA 3J5PA 4URKA 1JWGA 3D9KA 4LERA 2RFMA 4FJYA 3ULQA 1HO8A 4N2SA 3Q75A 5FZRA 4GZ6A 4CCAA 3B7TA 2LAHA 1TJFA 5LCWJ 3TWRA 2Q7FA 5JA4D 4A55A 4UWHA 2HYZA 1ZBPA 3ZIMA 3I4RB 3PVLA 1NP7A 5EKQD 2I1KA 2DCPA 2EIJE 2X6HA 4HI9A 3VLFA 1OUVA 3E33A 1WDYA 3VTXA 4BX8A 3MX3A 4DK5A 2L0TB 2J09A 3FU5A 3GW4A 4L23A 3LJ3A 2AXUA 3ASGA 2ETBA 2P9UG 1IQUA 3DSXA 1O1TA 3Q4AB 4L9PA 2P9SG 2XPIA 2IJGX 4KT6B 3FH8A 4O1PA 4LNUD 1OCCE 5KNHD 4HXIA 4Q96A 5LX8A 5KJLA 3HXDA 2YQ8A 4E6HA 4HOTA 5ENTD 4AY6A 3DSVA 2VSYA 4Q94A 4AY5A 3PZ1A 3R9MA 4OAUC 1OT8A 1JCQA 5AJLA 5G05J 5AQAA 3ZN3A 4BTAA 4N5QA 4I6JA 5EYLA 4X8QA 3MGBA 4U0SA 1XGWA 3MJWA 5HRYA 4HRLA 4LCTA 2NSZA 1JCSA 1QYMA 5ENOD 4I6GA 4JA9A 4HS2A 4CT0A 5B1AE 4UI9C 3RO2A 4FU3A 5EDSA 3CVWA 5A7DB 4K03A 4WNDA 5JJTA 4FULA 2LXLA 2BKKB 1ZU2A 2KCLA 4WWNA 2IFUA 5BT1A 4W9RA 2AVPA 4K5BA 3UM2A 4F6RD 4AOFA 2P9NG 4GA1A 1EPUA 1W3BA 4F1SA 4C0EA 3IHVA 3E4BA 2PM6A 3HVEB 5HQ8A 2HR2A 3D9PA 2WM9A 5EIBE 5D2MC 4CT4A 1ZB1A 4CZ2D 3QWWA 4PS8A 3APCA 1BD8A 3LCAA 3VLEA 4WWOA 3OAWA 3ONLA 3URZA 5A23A 5CRUA 3QC1A 5CCLA 2E2EA 3G2WA 5FIOA 4GZ3A 4XZ4A 5T8IA 4ZFHA 4L2YA 3D9IA 3RAUA 2PM7A 3L82A 3PZDA 1P5QA 4HQDA 3MEKA 1L5JA 3ZYQA 3E34A 4RG6A 4I43A 1WY6A 1E7UA 1JCRA 1N11A 4DX6D 2XHEA 1EDUA 4KBQA 2YHCA 4U7EB 4RG9A 4ATGA 3MKQA 1N4QA 3ZYMA 3J5QB 4DLQA 5BXOA 1Z3YA 1ELRA 4FC8A 3DSTA 4GTMA 1E8YA 4YDYA 4O1OA 2VGYA 3O48A 5FTPA 4I2WA 3LJNA 3BG1B 1RZ4A 3RJVA 1TJCA 3FUEA 3LY8A 5JJ7A 3TWUA 3S7DA 4N3AA 3JXIA 5FZSA 5C1DA 4TXRA 3IHYA 5BUZA 3UIOC 4GAAA 3OXGA 2QY7A 3VTYA 4YDEA 5DIZA 3LXUX 5EN5D 5AAOA 4ANUA 3UXGA 3ZHEB 1S63A 4R7LA 4ILGA 1LD8A 3ENEA 2KC7A 3CKBA 4HBDA 4JHRA 4UI9J 3QDNA 3RRNB 3L16A 3IEGA 3NAWA 3UTMA 3FTZA 1X81A 2VGEA 4YVOA 4CYMD 3JXJA 3HYMB 4C48B 2KXPC 3CHQA 5BW8C 5KJNA 3ZRHA 4EZKA 2EIME 3UQ3A 4GTQA 2J8SD 3FUHA 4HLEA 1N4SA 2I2OA 1MX4A 3LEWA 2XS8A 3CHPA 4GPMA 2ZGDA 5T4YA 3QJZA 3APFA 2XENA 3UM3A 1DNPA 3TXMA 4FLBA 4CDNA 2FULA 3CVLA 4LRZA 4EQFA 1LF8A 3ZUVB 1WM5A 5D0OD 3Q7FA 4K0RA 4BWRA 4GZCA 2V0PA 3FTSA 2AW6A 2KM4A 1HFAA 2P58C 3QWVA 4GTTA 3AG2E 2XRZA 4BT9A 3HXBA 4ACKA 1FVFA 4MLPA 4ME2A 3CQCB 4IN3B 5LFAA 3CK9A 3FH7A 2Y4UA 1H6OA 2OVBA 1DC2A 2WQ6A 1IHGA 3HXFA 2HO1A 3ESLA 5ENQD 3CVUA 1TN6A 4J7WA 5EYPF 3DPDA 3CVVA 3P2BA 2WXMA 4F7AA 2V4HC 5IY5E 3EDTB 3FDHA 1HX8A 4DX5D 1KLXA 3ZPJA 1TNBA 2ILRA 3CIAA 2L6BA 4G11A 4J8DA 4TXPA 3FHEA 3V2OA 3Q5MA 5JHBA 3FWVA 1H19A 4HRNA 3U4TA 4KMOA 3CVPA 3Q73A 5FT9A 2A5UA 3CK7A 1N4PA 3FU3A 5C2YA 3SBSA 2RD0A 4BFRA 3AS5A 3EHQA 3I5PA 3HHMA 3TG4A 2VQ2A 5ANRA 3S7FA 4DX1A 1PY1A 4OAVB 2YHEA 3SZ7A 1DCEA 3UX4A 1KZOA 2XZTG 2V5FA 3FUIA 5CCMA 4Y6WA 3U66A 1NZNA 4GZ5A 4XI9A 3E30A 2J4DA 2H6IA 3WXXA 2E0IA 4HB5A 2KATA 4AM9A 3FTYA 3IXEA 4GPKA 1G3NB 1TNOA 4PDXA 3GZ2A 2CFZA 1HG2A 4G26A 3PEUB 4YVQC 1V55E 4GTSA 3TWVA 2PQNA 3ZU7B 2R5SA 1O1SA 3RU0A 3V79K 3CVQA 2P9LG 4ZHBA 4HLLA 1UW4B 3LYAA 3NZUA 4E85A 1DVPA 3APDA 4LEUA 5B1BE 4PUCA 4WUYA 5ENRD 4JB8P 4OVUA 3TGOA 3CHSA 2DIWA 3KSLA 4U04A 5CMYA 4U95D 1NI1A 4A1SA 2FF4A 2EIKE 3CVXA 4FP7A 2JABA 3ESKA 5EIDA 3HIZA 2CHXA 4J8YA 5BXUA 3CQGB 1IHBA 3ABME 5ARGA 3FUNA 4N3CA 3RK6A 3ASHA 3P1UA 4N2QA 3TAXA 4J8EA 4XI0A 1BPOA 3FU0A 4N5CA 4BX9A 3V30A 4I6EA 2JEKA 5G55A 4CDRA 4G2VA 1KPSB 3W9GA 4TV3A 1OCOE 2LUHA 4MBGA 3AJIA 4NQ0A 1SA5A 1TN8A 4I9EA 4H7XA 4B94A 3Q49B 3FUDA 3QARA 3TWTA 4D10C 3TJPA 3E32A 3L17A 4RSYA 2XGSA 3L08A 2WPVA 3QB2A 4O6FA 1A5EA 4IRUA 3EJNA 1N0RA 2X6FA 1MQSA 5CEDB 4EBAA 5EILA 1N52A 3LVRE 4FJZA 2CHWA 2WXRA 1K8KG 3ABKE 3DXKG 3PS6A 4F53A 4CRWA 3BUAA 3UKRG 3EHRA 3RRUA 3Q47B 3F6QA 5JMND 3EHNA 4TUMA 1X5BA 3RRMB 3PREA 3L22A 2ZU6B 1BLXB 3GZSA 5BPPA 2NC9A 3C72A 2NXPA 3GZ1A 3SF4A 3NQPA 4G23A 4JZYA 4U96D 4BY6A 3PZ4A 4GA0A 3B13A 3D9NA 2VTBA 3RKVA 5FJYA 5FQ7A 1IQRA 3PEVB 3JUIA 4DRXE 1VDYA 2HM8A 3LY9A 2A4ZA 1UJJA 2P9KG 2L0IA 1N0QA 5EX0A 4WNGA 3UPVA 3MYVA 4ANVA 1OWNA 2B6CA 2VSNA 3ZVVA 3QNKA 3CK8A 3EU5A 5EX3A 1B89A 3Q7AA 2WXHA 3AS4A 4AEZC 3UT8A 2I1JA 3PDNA 3FTVA 1TYQG 5AIJA 4GTOA 3O4ZA 2DYRE 3S7BA 2ETAA 4JD2G 2CG2A 3UM1A
chains in the Genus database with same CATH topology
5CBNA 3T9KA 3TWVA 1MX2A 2V5QC 3ZU7B 1YYHA 4GPMA 3W9FA 2ZGDA 3V79K 3TWTA 3TWRA 5JA4D 4HRNA 4K5AB 4O60A 4ZHBA 1SVXA 3J5QB 5D66A 1BI7B 2P2CP 3TWWA 5BXOA 3C5RA 5ITZF 2XENA 2ZGGA 4HLLA 5KNGA 2QC9A 5ENPD 1A5EA 1DCQA 4YDWA 4NIKA 1N0RA 3HRAA 2KBXA 2ETCA 3TWXA 5AQ9A 3B95A 4YDYA 4O1OA 2XZDG 4BESA 2DVWA 5ENRD 3V31A 5CEDB 2BKKB 4JB8P 4DX7D 4HI9A 3ZUVB 1BI8B 3Q9NC 5EILA 3LJNA 1IKND 1MJ0A 1UOHA 4GMRA 1WDYA 1MYOA 4DUIA 2XEEA 1YMPA 3EHRA 3SO8A 4BERA 5HKPA 3TWUA 4ATZD 3F6QA 4K5BA 4F6RD 5JMND 5KWDA 2FO1E 4TUMA 2F37A 3JXIA 3Q9UC 2Y1LE 3EHQA 1OY3D 4U95D 5AQ7A 2B0OE 1BLXB 4DX1A 4B93B 2ETBA 3DEOA 4Z68A 4BEPA 4OAVB 5CECB 1D9SA 2AJAA 4HRMB 4BETA 5EIBE 4CZ2D 4U96D 2HE0A 2QYJA 2JABA 4G8LA 2XZTG 2RFAA 5EN5D 4F1PA 5EIDA 3UXGA 5AAOA 1AWCB 5CERB 4O1PA 1SW6A 4LNUD 1BD8A 3TWQA 4J8YA 5BXUA 5KNHD 5AARA 3ZNGA 3AAAC 2PNNA 1BU9A 1DC2A 1IHBA 4A63B 4U8VD 4HBDA 5HS0A 1IXVA 1NFIE 2DZOA 1WG0A 2DZNA 5FIOA 5ENTD 3JUEA 5KBAA 4HI8A 5ENQD 1S70B 4DRXE 2DWZA 2F8XK 4ZFHA 1YCSB 3KEAA 4HB5A 3B7BA 1K3ZD 1K1AA 4J7WA 5EYPF 1N0QA 1OT8A 3D9HA 3UTMA 3ZKJA 4LSZE 4OAUC 3TWSA 5FINA 4DX2A 2BKGA 5AN8A 3V30A 4LG6A 4UUCA 5AQAA 2NYJA 5AQBA 4QQIA 3NBNB 4HQDA 3V2XA 3EU9A 4N5QA 3IXEA 4QFVA 3T8KA 2VGEA 5CEAA 4CYMD 1G3NB 2A5EA 3JXJA 2V4HC 2Y0BG 3DEPA 4U8YD 2F8YA 3J5PA 5EYLA 4C48B 2KXPC 4BSZB 1TR4A 3HG0D 4RLYA 3W9GA 1N11A 5ENSD 1K1BA 2MYOA 3NOCD 4DX6D 4DX5D 1AP7A 4HNAD 2RFMA 4G8KA 2L6BA 5HRYA 4HRLA 1MX6A 3AJIA 4K5CA 1QYMA 2ETAA 2XEHA 2J8SD 5ENOD 3V2OA 5CBOA 3UI2A 3NOGD 1MX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBN A;  3T9K A;  3TWV A;  1MX2 A;  2V5Q C;  3ZU7 B;  1YYH A;  4GPM A;  3W9F A;  2ZGD A;  3V79 K;  3TWT A;  3TWR A;  5JA4 D;  4HRN A;  4K5A B;  4O60 A;  4ZHB A;  1SVX A;  3J5Q B;  5D66 A;  1BI7 B;  2P2C P;  3TWW A;  5BXO A;  3C5R A;  5ITZ F;  2XEN A;  2ZGG A;  4HLL A;  5KNG A;  2QC9 A;  5ENP D;  1A5E A;  1DCQ A;  4YDW A;  4NIK A;  1N0R A;  3HRA A;  2KBX A;  2ETC A;  3TWX A;  5AQ9 A;  3B95 A;  4YDY A;  4O1O A;  2XZD G;  4BES A;  2DVW A;  5ENR D;  3V31 A;  5CED B;  2BKK B;  4JB8 P;  4DX7 D;  4HI9 A;  3ZUV B;  1BI8 B;  3Q9N C;  5EIL A;  3LJN A;  1IKN D;  1MJ0 A;  1UOH A;  4GMR A;  1WDY A;  1MYO A;  4DUI A;  2XEE A;  1YMP A;  3EHR A;  3SO8 A;  4BER A;  5HKP A;  3TWU A;  4ATZ D;  3F6Q A;  4K5B A;  4F6R D;  5JMN D;  5KWD A;  2FO1 E;  4TUM A;  2F37 A;  3JXI A;  3Q9U C;  2Y1L E;  3EHQ A;  1OY3 D;  4U95 D;  5AQ7 A;  2B0O E;  1BLX B;  4DX1 A;  4B93 B;  2ETB A;  3DEO A;  4Z68 A;  4BEP A;  4OAV B;  5CEC B;  1D9S A;  2AJA A;  4HRM B;  4BET A;  5EIB E;  4CZ2 D;  4U96 D;  2HE0 A;  2QYJ A;  2JAB A;  4G8L A;  2XZT G;  2RFA A;  5EN5 D;  4F1P A;  5EID A;  3UXG A;  5AAO A;  1AWC B;  5CER B;  4O1P A;  1SW6 A;  4LNU D;  1BD8 A;  3TWQ A;  4J8Y A;  5BXU A;  5KNH D;  5AAR A;  3ZNG A;  3AAA C;  2PNN A;  1BU9 A;  1DC2 A;  1IHB A;  4A63 B;  4U8V D;  4HBD A;  5HS0 A;  1IXV A;  1NFI E;  2DZO A;  1WG0 A;  2DZN A;  5FIO A;  5ENT D;  3JUE A;  5KBA A;  4HI8 A;  5ENQ D;  1S70 B;  4DRX E;  2DWZ A;  2F8X K;  4ZFH A;  1YCS B;  3KEA A;  4HB5 A;  3B7B A;  1K3Z D;  1K1A A;  4J7W A;  5EYP F;  1N0Q A;  1OT8 A;  3D9H A;  3UTM A;  3ZKJ A;  4LSZ E;  4OAU C;  3TWS A;  5FIN A;  4DX2 A;  2BKG A;  5AN8 A;  3V30 A;  4LG6 A;  4UUC A;  5AQA A;  2NYJ A;  5AQB A;  4QQI A;  3NBN B;  4HQD A;  3V2X A;  3EU9 A;  4N5Q A;  3IXE A;  4QFV A;  3T8K A;  2VGE A;  5CEA A;  4CYM D;  1G3N B;  2A5E A;  3JXJ A;  2V4H C;  2Y0B G;  3DEP A;  4U8Y D;  2F8Y A;  3J5P A;  5EYL A;  4C48 B;  2KXP C;  4BSZ B;  1TR4 A;  3HG0 D;  4RLY A;  3W9G A;  1N11 A;  5ENS D;  1K1B A;  2MYO A;  3NOC D;  4DX6 D;  4DX5 D;  1AP7 A;  4HNA D;  2RFM A;  4G8K A;  2L6B A;  5HRY A;  4HRL A;  1MX6 A;  3AJI A;  4K5C A;  1QYM A;  2ETA A;  2XEH A;  2J8S D;  5ENO D;  3V2O A;  5CBO A;  3UI2 A;  3NOG D;  1MX4 A; 
#chains in the Genus database with same CATH topology
 2QFC A;  3CHR A;  5DBK A;  5ITZ F;  4RQI A;  2ION A;  3V31 A;  2GGF A;  3SQV A;  1MYO A;  2XEE A;  4B0Z A;  4EHM A;  4BER A;  5HKP A;  1S0P A;  4HOU A;  4LNG A;  2LO6 A;  3UT7 A;  3Q9U C;  2DYS E;  3B7U X;  4NRH B;  2XGM A;  2BF0 X;  1FT1 A;  1TNZ A;  2IEJ A;  4G25 A;  2MOW A;  5BV1 A;  2XPY A;  4TUU A;  3QAQ A;  5CER B;  1OWO A;  3CGH A;  4FAD A;  1E7V A;  1HZ4 A;  4C9B B;  2VGX A;  3JUE A;  4HI8 A;  2VSX E;  5E76 A;  3MV2 B;  3PE3 A;  3BQO A;  1D8E A;  3TWS A;  4EZJ A;  3UT4 A;  4UI9 K;  2WXQ A;  4JXT A;  2NYJ A;  4OVV A;  4EEC A;  3T8K A;  3FEY A;  2A5E A;  1Y8M A;  3SFX A;  2JLB A;  1K1B A;  3QK0 A;  3OXL A;  5AJD A;  3CSF A;  3MV3 B;  3MKQ B;  3ULY A;  1MX6 A;  4UWG A;  4KZC A;  2V4L A;  3DSU A;  4U8H A;  3UI2 A;  3CHM A;  3KS2 A;  4U07 A;  1HH8 A;  1N9A A;  5AYW D;  3KEZ A;  4APF A;  4JVS A;  2LSU A;  4JHJ A;  4YDW A;  3HRA A;  2ETC A;  3WG7 E;  4F3V A;  3IBE A;  4BES A;  1UN8 A;  2I6H A;  3FTX A;  3U64 A;  1LD7 A;  2VGX B;  3AG3 E;  4IUL A;  1YMP A;  3X2Q E;  3MA5 A;  2GRR B;  2WVI A;  3CVY A;  1ELK A;  2WXP A;  2Y1L E;  3UKU G;  1YA0 A;  4FHJ A;  1OWM A;  1NL4 A;  3LY7 A;  4I9C A;  2QYJ A;  4LNB A;  3DBS A;  2X6J A;  3S2A A;  3TWQ A;  2YNQ A;  1RW2 A;  2Y3A A;  3BU8 A;  5ENN A;  4UQZ A;  1IXV A;  2DWZ A;  4ANX A;  3CLJ A;  4JPS A;  2PQR A;  2QZA A;  4C0M A;  4LSZ E;  3D9L A;  2ZIS A;  3ZXP A;  4CEM A;  3L13 A;  4DI4 A;  2EIL E;  4YND A;  2GRQ B;  1TR4 A;  5JJ6 A;  2R59 A;  3R7Q A;  2MYO A;  2LNI A;  1H2V C;  5D0Q D;  4G8K A;  1D8D A;  1E8W A;  1FPP A;  4XIF A;  3CST A;  5CBO A;  4RVB A;  4CGW A;  1N54 A;  5ARF A;  3T9K A;  2V5Q C;  3C3R A;  2V8S E;  2H6G A;  5D66 A;  3TWW A;  2P2C P;  4A3T A;  5KNG A;  4U0Z A;  1UG3 A;  2IY0 C;  3TWX A;  4HFG A;  2R02 A;  3B95 A;  3EIJ A;  2YIN A;  2DVW A;  2XQ0 A;  4FA6 A;  3DWL G;  4ABN A;  4GB9 A;  5FQ8 A;  2X6K A;  5J90 A;  1TNY A;  2FO1 E;  3EUV A;  2GRN B;  1FVH A;  4A3V A;  4B93 B;  4MKT A;  1H6P A;  3AU4 A;  3G2S A;  4HRM B;  2J07 A;  2J9Q A;  4F1P A;  3UUX A;  3EHM A;  5KJM A;  2OCC E;  3PUJ A;  4A63 B;  3RO3 A;  1Z6T A;  4U8V D;  1NA0 A;  3SBT B;  3FY4 A;  2C0M A;  4FHK A;  4EBA G;  2MRI A;  2WXJ A;  1SZA A;  3FUJ A;  5BV0 A;  3R7R A;  2RKK A;  2AWI A;  3V2X A;  3RSE G;  3FP3 A;  2Y0B G;  1U2V G;  4BSZ B;  4AVX A;  2M63 A;  3AG4 E;  2PZI A;  4K5C A;  2XEH A;  3LPZ A;  3SFY A;  4JEU A;  2IO2 C;  3W9F A;  4K5A B;  4NUR A;  1HS6 A;  3PH0 C;  4J0U A;  2Y4T A;  2QC9 A;  3KSQ A;  5ENP D;  4NIK A;  3LVQ E;  2EQX A;  3L6A A;  2XZD G;  3ASO E;  4YDO A;  2WQH A;  1UOH A;  3CR3 A;  4XKB A;  3SO8 A;  5HI7 A;  4PS3 A;  3ZYK A;  5KWD A;  2BTD A;  4OYS A;  3RIB A;  3UM0 A;  5AQ7 A;  3FTW A;  4WNE A;  1OCR E;  4UQY A;  4BET A;  1UN9 A;  3PRZ A;  2C0L A;  5M72 A;  1Y6I A;  1E8X A;  4HOQ A;  2GRO B;  3Q79 A;  4ILH B;  4B89 A;  2LAI A;  2XEV A;  4U63 A;  3T8M A;  4GTP A;  1YCS B;  4JA7 A;  3LS8 A;  3NB2 A;  2LXM A;  3D9H A;  3Q78 A;  4ILI A;  2CHZ A;  5FIN A;  5G04 C;  3S7J A;  5AN8 A;  4LG6 A;  2L6J A;  3PE4 A;  2UWJ G;  1FCH A;  3U3W A;  2MHK A;  2I9C A;  5J08 A;  5H7P A;  2WXG A;  3MCX A;  4GTV A;  4H7Y A;  4UWF A;  4I1M A;  1TEZ A;  2CG3 A;  2J49 A;  2PL2 A;  1AP7 A;  1INZ A;  3CHO A;  3SY2 A;  4GMJ A;  1HF8 A;  1OXJ A;  3I4G A;  4U0U A;  3R9A B;  3ZW3 A;  2XS1 A;  4I1O B;  1BI7 B;  2ZGG A;  2UY1 A;  1FT2 A;  3ML9 A;  2BED A;  2IQC A;  4GYO A;  3JQ0 A;  4GMR A;  1MHQ A;  1Z5S C;  3G2U A;  2F37 A;  4GYW A;  3D9J A;  2CFU A;  1Z3X A;  2GRM A;  4MS6 A;  2OOE A;  4DI3 A;  4L1B A;  4GYY A;  4XE0 A;  2XCC A;  4CDM A;  4PS7 A;  2RFA A;  3ZFW A;  3HXE A;  1WAO 1;  1TNU A;  3HVE A;  5AAR A;  4DLO A;  1JPL A;  3D9M A;  3D9O A;  4KYO B;  3B7R L;  1OCZ E;  3G2T A;  5HS0 A;  2C2L A;  3NZS A;  3QKY A;  3HDX A;  2F8X K;  1EYH A;  2GW1 A;  4APO A;  3ASN E;  1OWP A;  3B7B A;  3PNT B;  3UMV A;  4WWP A;  2UY1 B;  1O5M A;  4DPR A;  3PZ2 A;  4UQX A;  5FQ4 A;  3B7S A;  4U8Y D;  1SQM A;  4N39 A;  4N3B A;  3IKO B;  3T5V A;  2H6H A;  3VLD A;  2LSV A;  2VJ8 A;  3OXF A;  4P29 A;  4B8A A;  3BG0 B;  3TL5 A;  1O1R A;  3BEE A;  4Y6C A;  2WQ7 A;  3FEX A;  1SVX A;  1HE8 A;  3FU6 A;  2KBX A;  4G24 A;  3MKR A;  1SZ9 A;  3CVN A;  1IKN D;  5AEN A;  4LUN U;  1OWL A;  1H0A A;  5LP0 A;  3C3O A;  4ATZ D;  2OV8 A;  5G04 J;  4AJW A;  1E8Z A;  3DSW A;  4XX5 A;  3LDZ A;  1OY3 D;  3JYS A;  3CEQ A;  4I2Z A;  4ACL A;  4Z68 A;  3N71 A;  3ZGQ A;  2VTB B;  1H2U A;  3OTN A;  4BTB A;  3ULE G;  3GYZ A;  1KT1 A;  4XEI G;  2AXZ A;  3CV0 A;  3FUK A;  4M3O A;  4WAF A;  3U9W A;  5JHA A;  2Y69 E;  3SHF A;  3E37 A;  3ZHE A;  2FEZ A;  4JHK A;  1WG0 A;  1LTX A;  1KT0 A;  4GML A;  4BT8 A;  2IU1 A;  1N4R A;  2WXN A;  1ELW A;  4DX2 A;  4IYP A;  4UUC A;  2EIN E;  5FQ6 A;  2OEV A;  4PH4 B;  3FUL A;  5CEA A;  3K9I A;  2KCK A;  2ZIR A;  4RLY A;  3DRA A;  1NA3 A;  3ML8 A;  2R2L A;  4CGV A;  2QYU A;  5CBN A;  1MX2 A;  3T5X A;  4O60 A;  1HU3 A;  2VYI A;  3C5R A;  1QQE A;  3SD5 A;  1DCQ A;  4HOS A;  1KZP A;  1IYG A;  3ISM C;  2WMN A;  4L2L A;  4JL0 A;  1E96 B;  2GRP B;  5KCM A;  1MJ0 A;  2XGO A;  4HVB A;  4J8F A;  3MZL B;  1QBQ A;  2WXL A;  1U3C A;  4V3I A;  4AXH A;  4AP2 A;  3FFL A;  4BEP A;  5CEC B;  3AU5 A;  3ZXS A;  4XKC A;  2BUG A;  1N95 A;  2R05 A;  4G1T A;  1BU9 A;  1XNF A;  3ASD A;  4L7T A;  1E90 A;  1NFI E;  4UWL A;  4BSX A;  4AV7 A;  5KBA A;  3SI5 A;  4JEH A;  1TN7 A;  4MRU A;  2L9B A;  4AIF A;  1K1A A;  1K3Z D;  3G2V A;  3C3Q A;  3JQ1 A;  3DEP A;  3LKU A;  2WXK A;  1JUQ A;  3DXM G;  3AG1 E;  1MZC A;  3FUF A;  4KVO A;  4DJA A;  3CKC A;  2P9I G;  1PC2 A;  3KEA A;  1UJK A;  1YYH A;  5CHE E;  3PZ3 A;  2WXF A;  3SNX A;  1HXI A;  5AQ9 A;  4I17 A;  4JW1 A;  2OVF A;  5B3S E;  4DX7 D;  3IV0 A;  1BI8 B;  3Q9N C;  1QNF A;  4GCO A;  1A17 A;  3EIQ C;  3UIN C;  4I1A A;  4DUI A;  3DSS A;  5CMW A;  1U3D A;  3SFZ A;  3NF1 A;  3FH5 A;  3TXN A;  1HG5 A;  3KAE A;  2ZXW E;  1Q2Z A;  2AJA A;  1N94 A;  2XPZ A;  2WXI A;  3D3M A;  3DPY A;  5LCW C;  1AWC B;  2FBN A;  2FI7 A;  4Q69 A;  1V54 E;  3ZNG A;  3HXC A;  1EF1 C;  4NAC A;  2IOL A;  3TG5 A;  3ONK A;  2DZO A;  2DZN A;  2FO7 A;  2KZT A;  1S70 B;  1SA4 A;  2H6F A;  3ZYL A;  3I3N A;  3ABL E;  1H2T C;  2VSO E;  2OEW A;  3ZKJ A;  1H6K A;  5FWQ A;  5ANL A;  5AQB A;  3NBN B;  3EU9 A;  4HOR A;  3SGH A;  4QFV A;  2IOS A;  2F0Y A;  4GA2 A;  3HG0 D;  5ENS D;  3NOC D;  2X6I A;  3AS8 A;  1QZ2 A;  4HNA D;  4KXK B;  5FZQ A;  3FTU A;  5BNW A;  3JCK C;  3NOG D;  4GZD A;  2IO3 C;  3Q15 A;  2WMO A;  2XCB A;  2X38 A;  2OND A;  2P9P G;  5E75 A;  4GU5 A;  3UIP C;  5LOZ A;  5G05 C;  4TRQ A;  3QOU A;  4GTR A;  4JC8 A;  5T3R A;  1PAQ A;  4KZ0 A;  1S64 A;  2R03 A;  4WNF A;  4KVM A;  4UWK A;  2KZT B;  4GCN A;  4B8C B;  3ZEF A;  4EPZ A;  3ASF A;  2AXV A;  2B0O E;  2DBA A;  3DEO A;  3FUM A;  1D9S A;  4TXQ A;  1JWF A;  2HE0 A;  2WB2 A;  4G8L A;  2KCV A;  5A6C A;  1SW6 A;  2RG8 A;  5G2N A;  4ANW A;  4A1G A;  3AAA C;  4EZL A;  2PNN A;  4J6I A;  2J4B A;  4J8S A;  2WXO A;  2IF4 A;  3PUK A;  3C98 A;  5CRV A;  2J08 A;  3PNL B;  5KJK A;  2XRY A;  4M7C A;  2BKG A;  3QWP A;  3L9T A;  4QQI A;  4FLH A;  2X3M A;  1GW6 A;  2R17 C;  3L54 A;  2GRL A;  3KD7 A;  2F8Y A;  3J5P A;  4URK A;  1JWG A;  3D9K A;  4LER A;  2RFM A;  4FJY A;  3ULQ A;  1HO8 A;  4N2S A;  3Q75 A;  5FZR A;  4GZ6 A;  4CCA A;  3B7T A;  2LAH A;  1TJF A;  5LCW J;  3TWR A;  2Q7F A;  5JA4 D;  4A55 A;  4UWH A;  2HYZ A;  1ZBP A;  3ZIM A;  3I4R B;  3PVL A;  1NP7 A;  5EKQ D;  2I1K A;  2DCP A;  2EIJ E;  2X6H A;  4HI9 A;  3VLF A;  1OUV A;  3E33 A;  1WDY A;  3VTX A;  4BX8 A;  3MX3 A;  4DK5 A;  2L0T B;  2J09 A;  3FU5 A;  3GW4 A;  4L23 A;  3LJ3 A;  2AXU A;  3ASG A;  2ETB A;  2P9U G;  1IQU A;  3DSX A;  1O1T A;  3Q4A B;  4L9P A;  2P9S G;  2XPI A;  2IJG X;  4KT6 B;  3FH8 A;  4O1P A;  4LNU D;  1OCC E;  5KNH D;  4HXI A;  4Q96 A;  5LX8 A;  5KJL A;  3HXD A;  2YQ8 A;  4E6H A;  4HOT A;  5ENT D;  4AY6 A;  3DSV A;  2VSY A;  4Q94 A;  4AY5 A;  3PZ1 A;  3R9M A;  4OAU C;  1OT8 A;  1JCQ A;  5AJL A;  5G05 J;  5AQA A;  3ZN3 A;  4BTA A;  4N5Q A;  4I6J A;  5EYL A;  4X8Q A;  3MGB A;  4U0S A;  1XGW A;  3MJW A;  5HRY A;  4HRL A;  4LCT A;  2NSZ A;  1JCS A;  1QYM A;  5ENO D;  4I6G A;  4JA9 A;  4HS2 A;  4CT0 A;  5B1A E;  4UI9 C;  3RO2 A;  4FU3 A;  5EDS A;  3CVW A;  5A7D B;  4K03 A;  4WND A;  5JJT A;  4FUL A;  2LXL A;  2BKK B;  1ZU2 A;  2KCL A;  4WWN A;  2IFU A;  5BT1 A;  4W9R A;  2AVP A;  4K5B A;  3UM2 A;  4F6R D;  4AOF A;  2P9N G;  4GA1 A;  1EPU A;  1W3B A;  4F1S A;  4C0E A;  3IHV A;  3E4B A;  2PM6 A;  3HVE B;  5HQ8 A;  2HR2 A;  3D9P A;  2WM9 A;  5EIB E;  5D2M C;  4CT4 A;  1ZB1 A;  4CZ2 D;  3QWW A;  4PS8 A;  3APC A;  1BD8 A;  3LCA A;  3VLE A;  4WWO A;  3OAW A;  3ONL A;  3URZ A;  5A23 A;  5CRU A;  3QC1 A;  5CCL A;  2E2E A;  3G2W A;  5FIO A;  4GZ3 A;  4XZ4 A;  5T8I A;  4ZFH A;  4L2Y A;  3D9I A;  3RAU A;  2PM7 A;  3L82 A;  3PZD A;  1P5Q A;  4HQD A;  3MEK A;  1L5J A;  3ZYQ A;  3E34 A;  4RG6 A;  4I43 A;  1WY6 A;  1E7U A;  1JCR A;  1N11 A;  4DX6 D;  2XHE A;  1EDU A;  4KBQ A;  2YHC A;  4U7E B;  4RG9 A;  4ATG A;  3MKQ A;  1N4Q A;  3ZYM A;  3J5Q B;  4DLQ A;  5BXO A;  1Z3Y A;  1ELR A;  4FC8 A;  3DST A;  4GTM A;  1E8Y A;  4YDY A;  4O1O A;  2VGY A;  3O48 A;  5FTP A;  4I2W A;  3LJN A;  3BG1 B;  1RZ4 A;  3RJV A;  1TJC A;  3FUE A;  3LY8 A;  5JJ7 A;  3TWU A;  3S7D A;  4N3A A;  3JXI A;  5FZS A;  5C1D A;  4TXR A;  3IHY A;  5BUZ A;  3UIO C;  4GAA A;  3OXG A;  2QY7 A;  3VTY A;  4YDE A;  5DIZ A;  3LXU X;  5EN5 D;  5AAO A;  4ANU A;  3UXG A;  3ZHE B;  1S63 A;  4R7L A;  4ILG A;  1LD8 A;  3ENE A;  2KC7 A;  3CKB A;  4HBD A;  4JHR A;  4UI9 J;  3QDN A;  3RRN B;  3L16 A;  3IEG A;  3NAW A;  3UTM A;  3FTZ A;  1X81 A;  2VGE A;  4YVO A;  4CYM D;  3JXJ A;  3HYM B;  4C48 B;  2KXP C;  3CHQ A;  5BW8 C;  5KJN A;  3ZRH A;  4EZK A;  2EIM E;  3UQ3 A;  4GTQ A;  2J8S D;  3FUH A;  4HLE A;  1N4S A;  2I2O A;  1MX4 A;  3LEW A;  2XS8 A;  3CHP A;  4GPM A;  2ZGD A;  5T4Y A;  3QJZ A;  3APF A;  2XEN A;  3UM3 A;  1DNP A;  3TXM A;  4FLB A;  4CDN A;  2FUL A;  3CVL A;  4LRZ A;  4EQF A;  1LF8 A;  3ZUV B;  1WM5 A;  5D0O D;  3Q7F A;  4K0R A;  4BWR A;  4GZC A;  2V0P A;  3FTS A;  2AW6 A;  2KM4 A;  1HFA A;  2P58 C;  3QWV A;  4GTT A;  3AG2 E;  2XRZ A;  4BT9 A;  3HXB A;  4ACK A;  1FVF A;  4MLP A;  4ME2 A;  3CQC B;  4IN3 B;  5LFA A;  3CK9 A;  3FH7 A;  2Y4U A;  1H6O A;  2OVB A;  1DC2 A;  2WQ6 A;  1IHG A;  3HXF A;  2HO1 A;  3ESL A;  5ENQ D;  3CVU A;  1TN6 A;  4J7W A;  5EYP F;  3DPD A;  3CVV A;  3P2B A;  2WXM A;  4F7A A;  2V4H C;  5IY5 E;  3EDT B;  3FDH A;  1HX8 A;  4DX5 D;  1KLX A;  3ZPJ A;  1TNB A;  2ILR A;  3CIA A;  2L6B A;  4G11 A;  4J8D A;  4TXP A;  3FHE A;  3V2O A;  3Q5M A;  5JHB A;  3FWV A;  1H19 A;  4HRN A;  3U4T A;  4KMO A;  3CVP A;  3Q73 A;  5FT9 A;  2A5U A;  3CK7 A;  1N4P A;  3FU3 A;  5C2Y A;  3SBS A;  2RD0 A;  4BFR A;  3AS5 A;  3EHQ A;  3I5P A;  3HHM A;  3TG4 A;  2VQ2 A;  5ANR A;  3S7F A;  4DX1 A;  1PY1 A;  4OAV B;  2YHE A;  3SZ7 A;  1DCE A;  3UX4 A;  1KZO A;  2XZT G;  2V5F A;  3FUI A;  5CCM A;  4Y6W A;  3U66 A;  1NZN A;  4GZ5 A;  4XI9 A;  3E30 A;  2J4D A;  2H6I A;  3WXX A;  2E0I A;  4HB5 A;  2KAT A;  4AM9 A;  3FTY A;  3IXE A;  4GPK A;  1G3N B;  1TNO A;  4PDX A;  3GZ2 A;  2CFZ A;  1HG2 A;  4G26 A;  3PEU B;  4YVQ C;  1V55 E;  4GTS A;  3TWV A;  2PQN A;  3ZU7 B;  2R5S A;  1O1S A;  3RU0 A;  3V79 K;  3CVQ A;  2P9L G;  4ZHB A;  4HLL A;  1UW4 B;  3LYA A;  3NZU A;  4E85 A;  1DVP A;  3APD A;  4LEU A;  5B1B E;  4PUC A;  4WUY A;  5ENR D;  4JB8 P;  4OVU A;  3TGO A;  3CHS A;  2DIW A;  3KSL A;  4U04 A;  5CMY A;  4U95 D;  1NI1 A;  4A1S A;  2FF4 A;  2EIK E;  3CVX A;  4FP7 A;  2JAB A;  3ESK A;  5EID A;  3HIZ A;  2CHX A;  4J8Y A;  5BXU A;  3CQG B;  1IHB A;  3ABM E;  5ARG A;  3FUN A;  4N3C A;  3RK6 A;  3ASH A;  3P1U A;  4N2Q A;  3TAX A;  4J8E A;  4XI0 A;  1BPO A;  3FU0 A;  4N5C A;  4BX9 A;  3V30 A;  4I6E A;  2JEK A;  5G55 A;  4CDR A;  4G2V A;  1KPS B;  3W9G A;  4TV3 A;  1OCO E;  2LUH A;  4MBG A;  3AJI A;  4NQ0 A;  1SA5 A;  1TN8 A;  4I9E A;  4H7X A;  4B94 A;  3Q49 B;  3FUD A;  3QAR A;  3TWT A;  4D10 C;  3TJP A;  3E32 A;  3L17 A;  4RSY A;  2XGS A;  3L08 A;  2WPV A;  3QB2 A;  4O6F A;  1A5E A;  4IRU A;  3EJN A;  1N0R A;  2X6F A;  1MQS A;  5CED B;  4EBA A;  5EIL A;  1N52 A;  3LVR E;  4FJZ A;  2CHW A;  2WXR A;  1K8K G;  3ABK E;  3DXK G;  3PS6 A;  4F53 A;  4CRW A;  3BUA A;  3UKR G;  3EHR A;  3RRU A;  3Q47 B;  3F6Q A;  5JMN D;  3EHN A;  4TUM A;  1X5B A;  3RRM B;  3PRE A;  3L22 A;  2ZU6 B;  1BLX B;  3GZS A;  5BPP A;  2NC9 A;  3C72 A;  2NXP A;  3GZ1 A;  3SF4 A;  3NQP A;  4G23 A;  4JZY A;  4U96 D;  4BY6 A;  3PZ4 A;  4GA0 A;  3B13 A;  3D9N A;  2VTB A;  3RKV A;  5FJY A;  5FQ7 A;  1IQR A;  3PEV B;  3JUI A;  4DRX E;  1VDY A;  2HM8 A;  3LY9 A;  2A4Z A;  1UJJ A;  2P9K G;  2L0I A;  1N0Q A;  5EX0 A;  4WNG A;  3UPV A;  3MYV A;  4ANV A;  1OWN A;  2B6C A;  2VSN A;  3ZVV A;  3QNK A;  3CK8 A;  3EU5 A;  5EX3 A;  1B89 A;  3Q7A A;  2WXH A;  3AS4 A;  4AEZ C;  3UT8 A;  2I1J A;  3PDN A;  3FTV A;  1TYQ G;  5AIJ A;  4GTO A;  3O4Z A;  2DYR E;  3S7B A;  2ETA A;  4JD2 G;  2CG2 A;  3UM1 A; 
#chains in the Genus database with same CATH homology
 5CBN A;  3T9K A;  3TWV A;  1MX2 A;  2V5Q C;  3ZU7 B;  1YYH A;  4GPM A;  3W9F A;  2ZGD A;  3V79 K;  3TWT A;  3TWR A;  5JA4 D;  4HRN A;  4K5A B;  4O60 A;  4ZHB A;  1SVX A;  3J5Q B;  5D66 A;  1BI7 B;  2P2C P;  3TWW A;  5BXO A;  3C5R A;  5ITZ F;  2XEN A;  2ZGG A;  4HLL A;  5KNG A;  2QC9 A;  5ENP D;  1A5E A;  1DCQ A;  4YDW A;  4NIK A;  1N0R A;  3HRA A;  2KBX A;  2ETC A;  3TWX A;  5AQ9 A;  3B95 A;  4YDY A;  4O1O A;  2XZD G;  4BES A;  2DVW A;  5ENR D;  3V31 A;  5CED B;  2BKK B;  4JB8 P;  4DX7 D;  4HI9 A;  3ZUV B;  1BI8 B;  3Q9N C;  5EIL A;  3LJN A;  1IKN D;  1MJ0 A;  1UOH A;  4GMR A;  1WDY A;  1MYO A;  4DUI A;  2XEE A;  1YMP A;  3EHR A;  3SO8 A;  4BER A;  5HKP A;  3TWU A;  4ATZ D;  3F6Q A;  4K5B A;  4F6R D;  5JMN D;  5KWD A;  2FO1 E;  4TUM A;  2F37 A;  3JXI A;  3Q9U C;  2Y1L E;  3EHQ A;  1OY3 D;  4U95 D;  5AQ7 A;  2B0O E;  1BLX B;  4DX1 A;  4B93 B;  2ETB A;  3DEO A;  4Z68 A;  4BEP A;  4OAV B;  5CEC B;  1D9S A;  2AJA A;  4HRM B;  4BET A;  5EIB E;  4CZ2 D;  4U96 D;  2HE0 A;  2QYJ A;  2JAB A;  4G8L A;  2XZT G;  2RFA A;  5EN5 D;  4F1P A;  5EID A;  3UXG A;  5AAO A;  1AWC B;  5CER B;  4O1P A;  1SW6 A;  4LNU D;  1BD8 A;  3TWQ A;  4J8Y A;  5BXU A;  5KNH D;  5AAR A;  3ZNG A;  3AAA C;  2PNN A;  1BU9 A;  1DC2 A;  1IHB A;  4A63 B;  4U8V D;  4HBD A;  5HS0 A;  1IXV A;  1NFI E;  2DZO A;  1WG0 A;  2DZN A;  5FIO A;  5ENT D;  3JUE A;  5KBA A;  4HI8 A;  5ENQ D;  1S70 B;  4DRX E;  2DWZ A;  2F8X K;  4ZFH A;  1YCS B;  3KEA A;  4HB5 A;  3B7B A;  1K3Z D;  1K1A A;  4J7W A;  5EYP F;  1N0Q A;  1OT8 A;  3D9H A;  3UTM A;  3ZKJ A;  4LSZ E;  4OAU C;  3TWS A;  5FIN A;  4DX2 A;  2BKG A;  5AN8 A;  3V30 A;  4LG6 A;  4UUC A;  5AQA A;  2NYJ A;  5AQB A;  4QQI A;  3NBN B;  4HQD A;  3V2X A;  3EU9 A;  4N5Q A;  3IXE A;  4QFV A;  3T8K A;  2VGE A;  5CEA A;  4CYM D;  1G3N B;  2A5E A;  3JXJ A;  2V4H C;  2Y0B G;  3DEP A;  4U8Y D;  2F8Y A;  3J5P A;  5EYL A;  4C48 B;  2KXP C;  4BSZ B;  1TR4 A;  3HG0 D;  4RLY A;  3W9G A;  1N11 A;  5ENS D;  1K1B A;  2MYO A;  3NOC D;  4DX6 D;  4DX5 D;  1AP7 A;  4HNA D;  2RFM A;  4G8K A;  2L6B A;  5HRY A;  4HRL A;  1MX6 A;  3AJI A;  4K5C A;  1QYM A;  2ETA A;  2XEH A;  2J8S D;  5ENO D;  3V2O A;  5CBO A;  3UI2 A;  3NOG D;  1MX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...