5FIOA

Darpins as a new tool for experimental phasing in protein crystallography
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
160
structure length
160
Chain Sequence
GSDLGRKLLEAARAGQDDECRILMANGADVNAADNTGTTPLHLAAYSGHLEIVECLLKHGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords NI3C DARPIN MUTANT5 HG-SITE N1
publication title Darpins as a New Tool for Experimental Phasing in Protein Crystallography
rcsb
source organism Synthetic construct
total genus 53
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5fioA00
4DX2A 3HRAA 5AAOA 5AQAA 4OAVB 4A63B 1K3ZD 5ENTD 3NOCD 3NOGD 4N5QA 5EYPF 1AWCB 2XEHA 5CEDB 4U8YD 3F6QA 1MYOA 1UOHA 4QFVA 4G8KA 3T8KA 5ENPD 1YMPA 4BSZB 2PNNA 2F8YA 3UXGA 5KWDA 3EHQA 4HNAD 1IKND 2QYJA 2L6BA 4BESA 2ZGGA 5KNGA 3DEOA 5D66A 1SW6A 4HBDA 5AN8A 5ENOD 3Q9UC 5JA4D 3JXJA 1IXVA 3V2XA 1D9SA 1TR4A 3J5QB 4HQDA 4BEPA 2BKGA 3B7BA 4O1OA 4DX5D 4O1PA 1K1BA 4K5AB 1AP7A 4K5BA 1MJ0A 2XEEA 2KXPC 4LG6A 5CERB 1MX6A 4ATZD 3KEAA 5HS0A 4Z68A 1N11A 2Y1LE 4CZ2D 2DWZA 3TWRA 3B95A 4JB8P 3ZKJA 4U96D 5CBNA 3AAAC 3V31A 3TWUA 4CYMD 4OAUC 1SVXA 1MX4A 4HLLA 5ITZF 4DUIA 4G8LA 2ETBA 3EU9A 3D9HA 1G3NB 2ETAA 4DX1A 1BU9A 4YDWA 2NYJA 3V30A 5AARA 4ZHBA 2ZGDA 2DZNA 2QC9A 2VGEA 5ENSD 4HRMB 5EYLA 4U8VD 3JUEA 4RLYA 4HI8A 3W9GA 2XENA 5FINA 5KBAA 2XZDG 4TUMA 4LSZE 2XZTG 1A5EA 5JMND 2FO1E 4K5CA 4UUCA 3TWVA 2F8XK 5AQ9A 2ETCA 4B93B 2V4HC 3T9KA 5BXUA 2AJAA 2RFMA 5AQ7A 3JXIA 4YDYA 4LNUD 4HI9A 4O60A 3DEPA 1K1AA 5EILA 2RFAA 4GPMA 3ZNGA 3TWWA 1BI8B 5HKPA 3TWSA 2MYOA 2P2CP 4C48B 3TWTA 2KBXA 5EIDA 5EIBE 3J5PA 3ZU7B 1BD8A 1MX2A 1N0QA 1DC2A 4ZFHA 4DX7D 5AQBA 2V5QC 3TWQA 4HRNA 1DCQA 2B0OE 2DZOA 4QQIA 4DRXE 2F37A 2A5EA 5EN5D 3TWXA 2HE0A 3AJIA 5FIOA 2Y0BG 1WG0A 2BKKB 4F6RD 4J7WA 4HB5A 1NFIE 1N0RA 3EHRA 5HRYA 3HG0D 3V79K 1YYHA 3LJNA 1BI7B 3IXEA 3W9FA 4GMRA 5BXOA 4J8YA 5CBOA 3ZUVB 3UTMA 4F1PA 1IHBA 4NIKA 1QYMA 4DX6D 5KNHD 1WDYA 5ENRD 3V2OA 2DVWA 2J8SD 1BLXB 4BETA 5ENQD 1OY3D 1YCSB 3Q9NC 3SO8A 5CECB 3C5RA 4BERA 5CEAA 4HRLA 3NBNB 2JABA 3UI2A 1S70B 4U95D 1OT8A
chains in the Genus database with same CATH superfamily
2A5UA 2WXIA 3DXMG 2IQCA 4DJAA 3EDTB 1UJKA 4LNGA 2YHCA 5KWDA 2OV8A 3EHQA 2J07A 3CLJA 3OXLA 2X6JA 3B7TA 3V2XA 3S2AA 3QJZA 3E30A 4K5BA 3OAWA 3FTZA 2Y1LE 2WXMA 4U07A 2IU1A 3CSFA 4OAUC 1N95A 2P9KG 1OCOE 3DPYA 3SD5A 3ZGQA 2NXPA 1TYQG 1TN8A 3CHRA 4OVVA 4UUCA 4PS3A 4LRZA 1PAQA 4B93B 4RVBA 3TAXA 5CHEE 3AG3E 3DEPA 5EILA 3APDA 1BI8B 1LD8A 4H7YA 2P2CP 3UKRG 3J5PA 4GA2A 3RRUA 3MV3B 3QOUA 2F0YA 5BW8C 2UWJG 4APOA 4EBAG 1TEZA 2WMNA 4J7WA 4HB5A 1NFIE 4K0RA 4ILHB 3Q49B 5G2NA 2J9QA 5BXOA 2WXNA 4AV7A 2V8SE 1QBQA 1SA5A 3V2OA 2DVWA 3GYZA 3PE3A 4CDRA 3ULEG 4BERA 4U8HA 5FQ7A 4A63B 3CGHA 3TL5A 3APCA 2EINE 1DNPA 4U8YD 5ENNA 3ZYQA 2L6BA 4GB9A 2WXKA 5ENOD 4YVQC 1FCHA 2KCKA 5D0QD 4HQDA 1V54E 3DSVA 3R9AB 2IY0C 3U66A 2I1JA 2KXPC 2WB2A 4ATZD 3KEAA 4Z68A 4CZ2D 3CVQA 3LPZA 1OWMA 4ACLA 1UN9A 1Y6IA 3B7SA 4HOSA 4AXHA 4MRUA 2NYJA 4XKCA 2ZGDA 5CRUA 1DCEA 3KSQA 4E6HA 2QFCA 4DLQA 3B7RL 2PQRA 5KBAA 3UUXA 4AM9A 3D9OA 3OXGA 5FZSA 4GYOA 2RKKA 1N9AA 3ML9A 3LXUX 4O60A 1D8EA 4GPMA 1HZ4A 1U2VG 2XHEA 4GZ6A 1MX2A 2OEWA 1XNFA 4HRNA 4JEUA 3CVPA 3PZ3A 2KATA 4RG6A 1E7UA 5LX8A 2X6IA 4CT0A 1E90A 3ZHEB 2VYIA 3W9FA 2GROB 3UTMA 4I9CA 3OTNA 1PC2A 1MHQA 3UINC 4FULA 5ENQD 5T8IA 2JABA 3HRAA 3MA5A 4GMJA 4YDEA 3FUEA 1JWFA 5AENA 3JQ0A 2RG8A 1NA3A 4HBDA 4F53A 2GRMA 4N39A 4WNDA 4RG9A 4HORA 4I43A 2Y3AA 2GRQB 2WQHA 1HG5A 2XEEA 3CV0A 3B13A 1X81A 5BV0A 3PZ2A 4JB8P 1BPOA 2CG2A 4WNEA 4CYMD 1FT1A 1MX4A 2XRYA 2X6KA 3PUKA 4F1SA 5AARA 1SQMA 2FF4A 2WXQA 3S7JA 2VGEA 4AJWA 3SBTB 5EYLA 5BNWA 3W9GA 1HXIA 2AXZA 2HO1A 5J08A 2FO1E 4JXTA 4GTRA 3E34A 3L22A 1UG3A 3D9IA 3MCXA 3OXFA 4XEIG 3Q15A 3RK6A 3FTYA 3TXMA 3AS8A 2YHEA 4B0ZA 4C48B 3IV0A 3QWVA 4C9BB 5EIBE 2VTBA 2L6JA 2V5QC 2DZOA 3C72A 4HXIA 4KVMA 3EHRA 2V4LA 3SNXA 5AIJA 5FT9A 4GTVA 1BI7B 3IXEA 4GMRA 3UT7A 2MHKA 2V0PA 1FPPA 4JPSA 4EBAA 1TN7A 4GTSA 4JW1A 2ZISA 1YCSB 2CFZA 2AXUA 4CEMA 4WUYA 3QWPA 4QFVA 5FWQA 1EDUA 4EZKA 4XIFA 5CCMA 4HNAD 2JEKA 3U3WA 5AJDA 4WNFA 1D9SA 4UWKA 4O1OA 2HM8A 2R17C 1TN6A 2IO3C 5CMWA 4DK5A 3S7DA 2DWZA 4G26A 2LUHA 2OVBA 3L16A 4NACA 1QNFA 4CRWA 3FFLA 4TXPA 3CQCB 3EIJA 4AY5A 4J6IA 4IRUA 3FULA 1H6OA 1IQUA 3QNKA 4G25A 1EPUA 1KPSB 5FJYA 2P58C 5AQ9A 2F8XK 3CIAA 5BXUA 3AS4A 4PS7A 4TRQA 4HOUA 3SBSA 3ASFA 1D8DA 5BV1A 4TV3A 3C3QA 5KCMA 3C3OA 3SY2A 2UY1A 2KM4A 2NC9A 4D10C 3MJWA 4FADA 2B6CA 3EIQC 3IKOB 2E0IA 3NZSA 1H2TC 5JJ6A 4Y6CA 1TJCA 5CBOA 3HXBA 5FZQA 4NIKA 2XGMA 1QYMA 3PZ1A 4ANXA 1RZ4A 1OWLA 4M3OA 3FU6A 1P5QA 2BEDA 3PUJA 3HDXA 2H6GA 2X6HA 4DLOA 1VDYA 5LOZA 4CT4A 2VSNA 3TG4A 3GZSA 3HXEA 3RRMB 2ZIRA 3FU3A 2QYJA 2ZGGA 4GYWA 1FVFA 1KT0A 4XX5A 4ANWA 3MYVA 1TR4A 2DCPA 3G2TA 2P9NG 5CERB 2XRZA 1MX6A 2R05A 3AG2E 5EDSA 1G3NB 4LNBA 3ASHA 4GA0A 4J8FA 3FDHA 1ZU2A 3IHVA 4GCOA 1A5EA 5JMND 4K5CA 1OUVA 1E96B 3CEQA 2V4HC 3KEZA 3JXIA 4CGWA 3LVRE 3ABLE 3JCKC 3G2WA 3Q79A 1HS6A 4HOTA 4ILIA 5FQ6A 2DBAA 3I4RB 4ZFHA 5G04C 2QYUA 1KZOA 1SA4A 4BSXA 1DCQA 1GW6A 4FJYA 4I2ZA 1INZA 4PDXA 2FBNA 4WWOA 3HG0D 3T5XA 4N2QA 4DPRA 3CHPA 2EIKE 4RSYA 3Q4AB 1KT1A 2WQ6A 1TJFA 3SO8A 2IEJA 3IEGA 2PZIA 2DYSE 3MKQA 2FULA 4CGVA 2WXJA 2GGFA 5CEDB 3F6QA 2YNQA 4G8KA 2WXLA 4B94A 4JVSA 3ZYLA 2EQXA 3SFYA 5T4YA 1HE8A 3JQ1A 2L0IA 2BKGA 4JC8A 1N4PA 4ATGA 1HG2A 2Y4UA 3UT8A 4U96D 3AAAC 3AU5A 5ITZF 3ZN3A 2BUGA 1XGWA 2DIWA 3FUNA 3CKBA 4BT9A 2VSOE 5FINA 2XZTG 3FY4A 1W3BA 3TWVA 5JHBA 2AJAA 2I2OA 2GRLA 4YDYA 1Z5SC 2VTBB 1KLXA 1K1AA 1UJJA 2RFAA 4F7AA 2RD0A 3TG5A 2WQ7A 5ARGA 3SFXA 2WMOA 3NF1A 1H0AA 1QZ2A 3SFZA 2VJ8A 2LNIA 3D9MA 2IJGX 3T8MA 2WXPA 1WG0A 3Q7FA 3QB2A 3VTYA 3HXCA 3EJNA 3L82A 3ZUVB 1WY6A 1IHBA 3N71A 4ANUA 3UM3A 4A3TA 2J8SD 5BPPA 1ZBPA 3L9TA 3EHMA 3WG7E 2VGYA 2L9BA 4I1MA 3HXFA 3NOGD 3EHNA 1JCRA 3SQVA 3ONLA 1S64A 3NB2A 3RSEG 3GZ2A 2PQNA 3QC1A 4N3BA 4HVBA 3O48A 3ZEFA 2DYRE 3Q75A 5DBKA 3C98A 3VLFA 4U04A 2Y4TA 4V3IA 4LG6A 3UX4A 4FP7A 1OCCE 2X3MA 2GRNB 3D9HA 3CVLA 1FT2A 2QC9A 2I6HA 5ENSD 3PNLB 3FH5A 4HI8A 4RQIA 4BTAA 2P9IG 3L13A 3FH8A 4KYOB 2J4BA 5AQ7A 4FJZA 5FTPA 3DSSA 5M72A 4UI9K 4LEUA 3ZU7B 4GAAA 3LCAA 5AQBA 3RJVA 3CVYA 2IOLA 4GTOA 2HE0A 1EYHA 2Y0BG 4IN3B 4HFGA 1E8WA 5HI7A 1O1RA 4NURA 4BFRA 4YVOA 1LD7A 5HQ8A 3LY9A 1FVHA 4LUNU 2GRPB 4FU3A 3VLDA 2QZAA 1Q2ZA 4BTBA 2R5SA 2LSUA 5AQAA 4OAVB 2E2EA 4CDMA 3CVXA 1UOHA 4JHKA 4GYYA 4OYSA 1OWOA 3UMVA 3ZYKA 3JXJA 4UQZA 1MJ0A 4XI9A 3RRNB 4EZLA 3VTXA 3B95A 1TNUA 3VLEA 3TWUA 3O4ZA 2BF0X 5G05C 3FTWA 4ILGA 2ETAA 1O5MA 4AVXA 1JCQA 3DSUA 1EF1C 2PL2A 3D9NA 5JJTA 3ASNE 2VGXA 3DPDA 2RFMA 3DRAA 3E37A 3ESKA 4UWLA 4UQYA 4B89A 4FLHA 3ZNGA 4TUUA 3UIOC 3TWTA 3AS5A 5C2YA 4FA6A 2WXRA 4XI0A 5ARFA 3G2SA 1JPLA 1E8XA 4BX9A 1YYHA 3LJNA 3RO3A 5ANLA 4GA1A 2WXGA 4EHMA 3QKYA 5JJ7A 4Q94A 4MS6A 5KNHD 1NA0A 3JUIA 4FHJA 3MKQB 2OEVA 3FU5A 3C5RA 3P2BA 1U3DA 4Q96A 3E4BA 3NOCD 2C0LA 3R9MA 3BQOA 1MYOA 4X8QA 5D66A 5EX0A 3U4TA 2XQ0A 4TXRA 2PM6A 4U7EB 3KS2A 3AG4E 1K1BA 1AP7A 4URKA 1HF8A 4JZYA 3CVWA 3FUJA 3EU9A 2J09A 4U0UA 1N52A 2KZTA 4TUMA 4A55A 3FWVA 3MKRA 3T9KA 4GU5A 4WAFA 4I17A 5LP0A 1X5BA 4I6EA 4PS8A 4W9RA 1N0QA 1DC2A 1QQEA 4JA7A 2WPVA 5KJNA 3PE4A 4ME2A 4KMOA 4J0UA 4ABNA 2HR2A 5HRYA 3IBEA 2P9PG 5B3SE 1OWNA 2AVPA 4DX6D 4BETA 5EX3A 1S70B 1H19A 1IQRA 3NZUA 3Q78A 3D9JA 4I2WA 3ZPJA 3HXDA 2XS8A 2PNNA 4BX8A 2I1KA 3APFA 3EUVA 1SW6A 3Q9UC 4HLEA 5JA4D 3CK7A 2QY7A 3ESLA 3DWLG 1HX8A 3ISMC 4K5AB 4KXKB 3PREA 3CK8A 2OVFA 1N11A 5LCWJ 4C0EA 1N54A 1DVPA 4HLLA 4G8LA 4GTPA 2ZXWE 3ASOE 3TJPA 4EECA 3UT4A 2XENA 1L5JA 2XZDG 1JCSA 2J49A 5AYWD 4GZ3A 5A6CA 2ETCA 4UWFA 4BWRA 3JYSA 4I1OB 2NSZA 3WXXA 4LNUD 3Q73A 1K8KG 2P9UG 4O6FA 4J8EA 5EKQD 3E33A 3ZHEA 3QARA 4DX7D 2PM7A 3FEXA 2F37A 1NL4A 3LDZA 4I1AA 2BKKB 3PS6A 2IF4A 4UWGA 3ABKE 1LF8A 1O1TA 4N2SA 4J8YA 4F1PA 3FUKA 3RKVA 1MZCA 4JHJA 5AJLA 3Q9NC 3ULYA 4XKBA 3MGBA 4U95D 2XEVA 4UI9J 1OT8A 3ZVVA 3FUFA 4YDOA 3ASGA 4FC8A 4WWPA 2LO6A 2KCLA 3FH7A 3TGOA 3PDNA 2EIME 3C3RA 5ENPD 2R59A 1IKND 4BESA 5KNGA 4FLBA 4A1GA 2VQ2A 3SF4A 3CHMA 5J90A 3SZ7A 1HH8A 4JHRA 3D3MA 4O1PA 3U9WA 3CHOA 3UKUG 2L0TB 4BY6A 4DUIA 1BU9A 4YDWA 3BEEA 4ZHBA 3MV2B 1SZ9A 3PZ4A 2VGXB 5FQ4A 1ZB1A 4GZCA 4GZDA 2LXLA 2ZU6B 3PNTB 3CVVA 3FUIA 1NZNA 3G2UA 4GTTA 1E8ZA 5HKPA 4CDNA 3CKCA 4G23A 1OCZE 5CMYA 3ONKA 4ANVA 2XCCA 2A5EA 3ZIMA 1O1SA 1IHGA 4UWHA 3UM2A 3TXNA 4KZ0A 2R03A 4N3AA 3HVEA 3S7BA 4KBQA 3KD7A 4IULA 1OWPA 2R2LA 3LYAA 5BUZA 2XCBA 1N4RA 3FU0A 3ULQA 4N5CA 3HYMB 3I4GA 1RW2A 4GCNA 3CR3A 2MRIA 4L7TA 1HU3A 3DEOA 4JA9A 3B7BA 5HS0A 4E85A 4B8CB 3TWRA 4NQ0A 4TXQA 2WVIA 2KZTB 4DX1A 4JD2G 4UQXA 3ASDA 5A23A 3E32A 4B8AA 4L1BA 2CG3A 1S0PA 3CHSA 4FHKA 4ACKA 3P1UA 4APFA 3TWWA 2I9CA 2WM9A 2XPYA 3CSTA 4DI4A 1H6KA 2OOEA 4KVOA 1KZPA 4G2VA 5E75A 3FUDA 4KZCA 1JWGA 5FIOA 1MQSA 4F6RD 1N0RA 3I5PA 5ANRA 2IO2C 1H6PA 3L17A 4H7XA 1WAO1 2XPZA 1S63A 2UY1B 4G1TA 3T5VA 1BLXB 3DXKG 2HYZA 3CVUA 3UI2A 3ZKJA 3D9LA 1K3ZD 5ENTD 4A1SA 1AWCB 3ZYMA 3EU5A 3HIZA 1ELWA 4L23A 2F8YA 5G55A 3FTXA 3RO2A 4I9EA 3DSTA 4G11A 5AN8A 1IXVA 4DX5D 3U64A 3D9PA 1E8YA 2LSVA 1PY1A 2J4DA 3V31A 5FZRA 3ZFWA 3URZA 1H2VC 2C0MA 2WXFA 5LFAA 4RLYA 3Q47B 4M7CA 1OXJA 1SZAA 5CCLA 5DIZA 5JHAA 3TWSA 2CHWA 3L08A 3DSXA 3LS8A 4J8SA 3G2VA 2WXOA 3PEVB 3FTSA 4QQIA 3ML8A 4HS2A 1JUQA 2A4ZA 4IYPA 5G05J 4P29A 5FQ8A 2Y69E 2X38A 5T3RA 2Q7FA 2CHXA 1IYGA 2FI7A 5AAOA 3X2QE 3D9KA 2H6FA 3CK9A 5EYPF 2XEHA 3CVNA 4L9PA 4AIFA 4Y6WA 5KJLA 1YMPA 4BSZB 3LJ3A 1V55E 2IFUA 3B7UX 3CHQA 1UN8A 1B89A 1Y8MA 3QAQA 3J5QB 4BEPA 2R02A 4N3CA 5A7DB 3FP3A 3BU8A 2CHZA 3BUAA 1TNZA 4EPZA 4MLPA 2CFUA 1SVXA 2YINA 4GTMA 4J8DA 3SI5A 4DI3A 3RIBA 1WM5A 4PUCA 4YNDA 3ENEA 3UM1A 2XGOA 4GPKA 3ZW3A 4LSZE 3DSWA 3PVLA 3PH0C 2VSYA 4GTQA 5E76A 4HI9A 2YQ8A 2VSXE 2FO7A 2XS1A 2P9SG 5H7PA 2IOSA 5IY5E 3ZXPA 4AOFA 2X6FA 3ZXSA 3UIPC 4C0MA 4MKTA 5EN5D 3LEWA 3TWXA 3HVEB 2LXMA 3L54A 3UPVA 1U3CA 2JLBA 1E7VA 5BT1A 1WDYA 3AG1E 3GZ1A 1OY3D 5CRVA 1ELKA 5CEAA 1NI1A 3LVQE 4DX2A 3QDNA 3PEUB 4EZJA 4XZ4A 3IHYA 4JEHA 4N5QA 3NQPA 1Z6TA 5D2MC 3UXGA 3L6AA 1N4QA 3FTUA 3UM0A 2GW1A 2LAHA 3PZDA 2ONDA 2XGSA 3K9IA 3BG0B 4GMLA 4GZ5A 2P9LG 2WXHA 3LY8A 2AW6A 2M63A 1Z3XA 2IONA 2ETBA 1HFAA 4I6JA 4K03A 3V30A 1LTXA 2DZNA 2OCCE 3LY7A 4HRMB 4AP2A 4PH4B 2LAIA 3MX3A 4U63A 2GRRB 1OCRE 1Z3YA 5D0OD 5LCWC 3LKUA 3SGHA 1A17A 5EIDA 5C1DA 1HO8A 1BD8A 3Q7AA 2EIJE 1TNBA 1TNYA 4LCTA 4XE0A 1TNOA 3R7RA 3HHMA 3AU4A 3QWWA 2ILRA 5KJKA 3S7FA 4BT8A 3DBSA 3FEYA 4CCAA 4WNGA 5KJMA 4G24A 1YA0A 1H2UA 3FTVA 3FUHA 4HRLA 3NBNB 3NAWA 2KC7A 2KCVA 1NP7A 1ELRA 5B1BE 3T8KA 3MZLB 4F3VA 4HOQA 2XPIA 3SHFA 3FHEA 3MEKA 2EILE 3PRZA 4R7LA 4UI9C 3R7QA 5CBNA 3RU0A 4MBGA 3FUMA 4U0ZA 1N94A 5G04J 4AEZC 3BG1B 2C2LA 1N4SA 4U8VD 3JUEA 4WWNA 3UQ3A 2BTDA 3GW4A 3ZRHA 2AWIA 1UW4B 3RAUA 4Q69A 4I6GA 3I3NA 3KAEA 3KSLA 2V5FA 2MYOA 3ABME 2KBXA 4OVUA 2AXVA 4NRHB 2H6IA 3Q5MA 3QK0A 2J08A 3TWQA 2B0OE 4DRXE 3AJIA 4JL0A 4EQFA 5B1AE 2H6HA 4AY6A 3V79K 3CQGB 4LERA 5ENRD 4L2LA 4KT6B 4U0SA 2MOWA 4L2YA 5CECB 2FEZA 4A3VA
chains in the Genus database with same CATH topology
4DX2A 3HRAA 5AAOA 5AQAA 4OAVB 4A63B 1K3ZD 5ENTD 3NOCD 3NOGD 4N5QA 5EYPF 1AWCB 2XEHA 5CEDB 4U8YD 3F6QA 1MYOA 1UOHA 4QFVA 4G8KA 3T8KA 5ENPD 1YMPA 4BSZB 2PNNA 2F8YA 3UXGA 5KWDA 3EHQA 4HNAD 1IKND 2QYJA 2L6BA 4BESA 2ZGGA 5KNGA 3DEOA 5D66A 1SW6A 4HBDA 5AN8A 5ENOD 3Q9UC 5JA4D 3JXJA 1IXVA 3V2XA 1D9SA 1TR4A 3J5QB 4HQDA 4BEPA 2BKGA 3B7BA 4O1OA 4DX5D 4O1PA 1K1BA 4K5AB 1AP7A 4K5BA 1MJ0A 2XEEA 2KXPC 4LG6A 5CERB 1MX6A 4ATZD 3KEAA 5HS0A 4Z68A 1N11A 2Y1LE 4CZ2D 2DWZA 3TWRA 3B95A 4JB8P 3ZKJA 4U96D 5CBNA 3AAAC 3V31A 3TWUA 4CYMD 4OAUC 1SVXA 1MX4A 4HLLA 5ITZF 4DUIA 4G8LA 2ETBA 3EU9A 3D9HA 1G3NB 2ETAA 4DX1A 1BU9A 4YDWA 2NYJA 3V30A 5AARA 4ZHBA 2ZGDA 2DZNA 2QC9A 2VGEA 5ENSD 4HRMB 5EYLA 4U8VD 3JUEA 4RLYA 4HI8A 3W9GA 2XENA 5FINA 5KBAA 2XZDG 4TUMA 4LSZE 2XZTG 1A5EA 5JMND 2FO1E 4K5CA 4UUCA 3TWVA 2F8XK 5AQ9A 2ETCA 4B93B 2V4HC 3T9KA 5BXUA 2AJAA 2RFMA 5AQ7A 3JXIA 4YDYA 4LNUD 4HI9A 4O60A 3DEPA 1K1AA 5EILA 2RFAA 4GPMA 3ZNGA 3TWWA 1BI8B 5HKPA 3TWSA 2MYOA 2P2CP 4C48B 3TWTA 2KBXA 5EIDA 5EIBE 3J5PA 3ZU7B 1BD8A 1MX2A 1N0QA 1DC2A 4ZFHA 4DX7D 5AQBA 2V5QC 3TWQA 4HRNA 1DCQA 2B0OE 2DZOA 4QQIA 4DRXE 2F37A 2A5EA 5EN5D 3TWXA 2HE0A 3AJIA 5FIOA 2Y0BG 1WG0A 2BKKB 4F6RD 4J7WA 4HB5A 1NFIE 1N0RA 3EHRA 5HRYA 3HG0D 3V79K 1YYHA 3LJNA 1BI7B 3IXEA 3W9FA 4GMRA 5BXOA 4J8YA 5CBOA 3ZUVB 3UTMA 4F1PA 1IHBA 4NIKA 1QYMA 4DX6D 5KNHD 1WDYA 5ENRD 3V2OA 2DVWA 2J8SD 1BLXB 4BETA 5ENQD 1OY3D 1YCSB 3Q9NC 3SO8A 5CECB 3C5RA 4BERA 5CEAA 4HRLA 3NBNB 2JABA 3UI2A 1S70B 4U95D 1OT8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DX2 A;  3HRA A;  5AAO A;  5AQA A;  4OAV B;  4A63 B;  1K3Z D;  5ENT D;  3NOC D;  3NOG D;  4N5Q A;  5EYP F;  1AWC B;  2XEH A;  5CED B;  4U8Y D;  3F6Q A;  1MYO A;  1UOH A;  4QFV A;  4G8K A;  3T8K A;  5ENP D;  1YMP A;  4BSZ B;  2PNN A;  2F8Y A;  3UXG A;  5KWD A;  3EHQ A;  4HNA D;  1IKN D;  2QYJ A;  2L6B A;  4BES A;  2ZGG A;  5KNG A;  3DEO A;  5D66 A;  1SW6 A;  4HBD A;  5AN8 A;  5ENO D;  3Q9U C;  5JA4 D;  3JXJ A;  1IXV A;  3V2X A;  1D9S A;  1TR4 A;  3J5Q B;  4HQD A;  4BEP A;  2BKG A;  3B7B A;  4O1O A;  4DX5 D;  4O1P A;  1K1B A;  4K5A B;  1AP7 A;  4K5B A;  1MJ0 A;  2XEE A;  2KXP C;  4LG6 A;  5CER B;  1MX6 A;  4ATZ D;  3KEA A;  5HS0 A;  4Z68 A;  1N11 A;  2Y1L E;  4CZ2 D;  2DWZ A;  3TWR A;  3B95 A;  4JB8 P;  3ZKJ A;  4U96 D;  5CBN A;  3AAA C;  3V31 A;  3TWU A;  4CYM D;  4OAU C;  1SVX A;  1MX4 A;  4HLL A;  5ITZ F;  4DUI A;  4G8L A;  2ETB A;  3EU9 A;  3D9H A;  1G3N B;  2ETA A;  4DX1 A;  1BU9 A;  4YDW A;  2NYJ A;  3V30 A;  5AAR A;  4ZHB A;  2ZGD A;  2DZN A;  2QC9 A;  2VGE A;  5ENS D;  4HRM B;  5EYL A;  4U8V D;  3JUE A;  4RLY A;  4HI8 A;  3W9G A;  2XEN A;  5FIN A;  5KBA A;  2XZD G;  4TUM A;  4LSZ E;  2XZT G;  1A5E A;  5JMN D;  2FO1 E;  4K5C A;  4UUC A;  3TWV A;  2F8X K;  5AQ9 A;  2ETC A;  4B93 B;  2V4H C;  3T9K A;  5BXU A;  2AJA A;  2RFM A;  5AQ7 A;  3JXI A;  4YDY A;  4LNU D;  4HI9 A;  4O60 A;  3DEP A;  1K1A A;  5EIL A;  2RFA A;  4GPM A;  3ZNG A;  3TWW A;  1BI8 B;  5HKP A;  3TWS A;  2MYO A;  2P2C P;  4C48 B;  3TWT A;  2KBX A;  5EID A;  5EIB E;  3J5P A;  3ZU7 B;  1BD8 A;  1MX2 A;  1N0Q A;  1DC2 A;  4ZFH A;  4DX7 D;  5AQB A;  2V5Q C;  3TWQ A;  4HRN A;  1DCQ A;  2B0O E;  2DZO A;  4QQI A;  4DRX E;  2F37 A;  2A5E A;  5EN5 D;  3TWX A;  2HE0 A;  3AJI A;  5FIO A;  2Y0B G;  1WG0 A;  2BKK B;  4F6R D;  4J7W A;  4HB5 A;  1NFI E;  1N0R A;  3EHR A;  5HRY A;  3HG0 D;  3V79 K;  1YYH A;  3LJN A;  1BI7 B;  3IXE A;  3W9F A;  4GMR A;  5BXO A;  4J8Y A;  5CBO A;  3ZUV B;  3UTM A;  4F1P A;  1IHB A;  4NIK A;  1QYM A;  4DX6 D;  5KNH D;  1WDY A;  5ENR D;  3V2O A;  2DVW A;  2J8S D;  1BLX B;  4BET A;  5ENQ D;  1OY3 D;  1YCS B;  3Q9N C;  3SO8 A;  5CEC B;  3C5R A;  4BER A;  5CEA A;  4HRL A;  3NBN B;  2JAB A;  3UI2 A;  1S70 B;  4U95 D;  1OT8 A; 
#chains in the Genus database with same CATH topology
 2A5U A;  2WXI A;  3DXM G;  2IQC A;  4DJA A;  3EDT B;  1UJK A;  4LNG A;  2YHC A;  5KWD A;  2OV8 A;  3EHQ A;  2J07 A;  3CLJ A;  3OXL A;  2X6J A;  3B7T A;  3V2X A;  3S2A A;  3QJZ A;  3E30 A;  4K5B A;  3OAW A;  3FTZ A;  2Y1L E;  2WXM A;  4U07 A;  2IU1 A;  3CSF A;  4OAU C;  1N95 A;  2P9K G;  1OCO E;  3DPY A;  3SD5 A;  3ZGQ A;  2NXP A;  1TYQ G;  1TN8 A;  3CHR A;  4OVV A;  4UUC A;  4PS3 A;  4LRZ A;  1PAQ A;  4B93 B;  4RVB A;  3TAX A;  5CHE E;  3AG3 E;  3DEP A;  5EIL A;  3APD A;  1BI8 B;  1LD8 A;  4H7Y A;  2P2C P;  3UKR G;  3J5P A;  4GA2 A;  3RRU A;  3MV3 B;  3QOU A;  2F0Y A;  5BW8 C;  2UWJ G;  4APO A;  4EBA G;  1TEZ A;  2WMN A;  4J7W A;  4HB5 A;  1NFI E;  4K0R A;  4ILH B;  3Q49 B;  5G2N A;  2J9Q A;  5BXO A;  2WXN A;  4AV7 A;  2V8S E;  1QBQ A;  1SA5 A;  3V2O A;  2DVW A;  3GYZ A;  3PE3 A;  4CDR A;  3ULE G;  4BER A;  4U8H A;  5FQ7 A;  4A63 B;  3CGH A;  3TL5 A;  3APC A;  2EIN E;  1DNP A;  4U8Y D;  5ENN A;  3ZYQ A;  2L6B A;  4GB9 A;  2WXK A;  5ENO D;  4YVQ C;  1FCH A;  2KCK A;  5D0Q D;  4HQD A;  1V54 E;  3DSV A;  3R9A B;  2IY0 C;  3U66 A;  2I1J A;  2KXP C;  2WB2 A;  4ATZ D;  3KEA A;  4Z68 A;  4CZ2 D;  3CVQ A;  3LPZ A;  1OWM A;  4ACL A;  1UN9 A;  1Y6I A;  3B7S A;  4HOS A;  4AXH A;  4MRU A;  2NYJ A;  4XKC A;  2ZGD A;  5CRU A;  1DCE A;  3KSQ A;  4E6H A;  2QFC A;  4DLQ A;  3B7R L;  2PQR A;  5KBA A;  3UUX A;  4AM9 A;  3D9O A;  3OXG A;  5FZS A;  4GYO A;  2RKK A;  1N9A A;  3ML9 A;  3LXU X;  4O60 A;  1D8E A;  4GPM A;  1HZ4 A;  1U2V G;  2XHE A;  4GZ6 A;  1MX2 A;  2OEW A;  1XNF A;  4HRN A;  4JEU A;  3CVP A;  3PZ3 A;  2KAT A;  4RG6 A;  1E7U A;  5LX8 A;  2X6I A;  4CT0 A;  1E90 A;  3ZHE B;  2VYI A;  3W9F A;  2GRO B;  3UTM A;  4I9C A;  3OTN A;  1PC2 A;  1MHQ A;  3UIN C;  4FUL A;  5ENQ D;  5T8I A;  2JAB A;  3HRA A;  3MA5 A;  4GMJ A;  4YDE A;  3FUE A;  1JWF A;  5AEN A;  3JQ0 A;  2RG8 A;  1NA3 A;  4HBD A;  4F53 A;  2GRM A;  4N39 A;  4WND A;  4RG9 A;  4HOR A;  4I43 A;  2Y3A A;  2GRQ B;  2WQH A;  1HG5 A;  2XEE A;  3CV0 A;  3B13 A;  1X81 A;  5BV0 A;  3PZ2 A;  4JB8 P;  1BPO A;  2CG2 A;  4WNE A;  4CYM D;  1FT1 A;  1MX4 A;  2XRY A;  2X6K A;  3PUK A;  4F1S A;  5AAR A;  1SQM A;  2FF4 A;  2WXQ A;  3S7J A;  2VGE A;  4AJW A;  3SBT B;  5EYL A;  5BNW A;  3W9G A;  1HXI A;  2AXZ A;  2HO1 A;  5J08 A;  2FO1 E;  4JXT A;  4GTR A;  3E34 A;  3L22 A;  1UG3 A;  3D9I A;  3MCX A;  3OXF A;  4XEI G;  3Q15 A;  3RK6 A;  3FTY A;  3TXM A;  3AS8 A;  2YHE A;  4B0Z A;  4C48 B;  3IV0 A;  3QWV A;  4C9B B;  5EIB E;  2VTB A;  2L6J A;  2V5Q C;  2DZO A;  3C72 A;  4HXI A;  4KVM A;  3EHR A;  2V4L A;  3SNX A;  5AIJ A;  5FT9 A;  4GTV A;  1BI7 B;  3IXE A;  4GMR A;  3UT7 A;  2MHK A;  2V0P A;  1FPP A;  4JPS A;  4EBA A;  1TN7 A;  4GTS A;  4JW1 A;  2ZIS A;  1YCS B;  2CFZ A;  2AXU A;  4CEM A;  4WUY A;  3QWP A;  4QFV A;  5FWQ A;  1EDU A;  4EZK A;  4XIF A;  5CCM A;  4HNA D;  2JEK A;  3U3W A;  5AJD A;  4WNF A;  1D9S A;  4UWK A;  4O1O A;  2HM8 A;  2R17 C;  1TN6 A;  2IO3 C;  5CMW A;  4DK5 A;  3S7D A;  2DWZ A;  4G26 A;  2LUH A;  2OVB A;  3L16 A;  4NAC A;  1QNF A;  4CRW A;  3FFL A;  4TXP A;  3CQC B;  3EIJ A;  4AY5 A;  4J6I A;  4IRU A;  3FUL A;  1H6O A;  1IQU A;  3QNK A;  4G25 A;  1EPU A;  1KPS B;  5FJY A;  2P58 C;  5AQ9 A;  2F8X K;  3CIA A;  5BXU A;  3AS4 A;  4PS7 A;  4TRQ A;  4HOU A;  3SBS A;  3ASF A;  1D8D A;  5BV1 A;  4TV3 A;  3C3Q A;  5KCM A;  3C3O A;  3SY2 A;  2UY1 A;  2KM4 A;  2NC9 A;  4D10 C;  3MJW A;  4FAD A;  2B6C A;  3EIQ C;  3IKO B;  2E0I A;  3NZS A;  1H2T C;  5JJ6 A;  4Y6C A;  1TJC A;  5CBO A;  3HXB A;  5FZQ A;  4NIK A;  2XGM A;  1QYM A;  3PZ1 A;  4ANX A;  1RZ4 A;  1OWL A;  4M3O A;  3FU6 A;  1P5Q A;  2BED A;  3PUJ A;  3HDX A;  2H6G A;  2X6H A;  4DLO A;  1VDY A;  5LOZ A;  4CT4 A;  2VSN A;  3TG4 A;  3GZS A;  3HXE A;  3RRM B;  2ZIR A;  3FU3 A;  2QYJ A;  2ZGG A;  4GYW A;  1FVF A;  1KT0 A;  4XX5 A;  4ANW A;  3MYV A;  1TR4 A;  2DCP A;  3G2T A;  2P9N G;  5CER B;  2XRZ A;  1MX6 A;  2R05 A;  3AG2 E;  5EDS A;  1G3N B;  4LNB A;  3ASH A;  4GA0 A;  4J8F A;  3FDH A;  1ZU2 A;  3IHV A;  4GCO A;  1A5E A;  5JMN D;  4K5C A;  1OUV A;  1E96 B;  3CEQ A;  2V4H C;  3KEZ A;  3JXI A;  4CGW A;  3LVR E;  3ABL E;  3JCK C;  3G2W A;  3Q79 A;  1HS6 A;  4HOT A;  4ILI A;  5FQ6 A;  2DBA A;  3I4R B;  4ZFH A;  5G04 C;  2QYU A;  1KZO A;  1SA4 A;  4BSX A;  1DCQ A;  1GW6 A;  4FJY A;  4I2Z A;  1INZ A;  4PDX A;  2FBN A;  4WWO A;  3HG0 D;  3T5X A;  4N2Q A;  4DPR A;  3CHP A;  2EIK E;  4RSY A;  3Q4A B;  1KT1 A;  2WQ6 A;  1TJF A;  3SO8 A;  2IEJ A;  3IEG A;  2PZI A;  2DYS E;  3MKQ A;  2FUL A;  4CGV A;  2WXJ A;  2GGF A;  5CED B;  3F6Q A;  2YNQ A;  4G8K A;  2WXL A;  4B94 A;  4JVS A;  3ZYL A;  2EQX A;  3SFY A;  5T4Y A;  1HE8 A;  3JQ1 A;  2L0I A;  2BKG A;  4JC8 A;  1N4P A;  4ATG A;  1HG2 A;  2Y4U A;  3UT8 A;  4U96 D;  3AAA C;  3AU5 A;  5ITZ F;  3ZN3 A;  2BUG A;  1XGW A;  2DIW A;  3FUN A;  3CKB A;  4BT9 A;  2VSO E;  5FIN A;  2XZT G;  3FY4 A;  1W3B A;  3TWV A;  5JHB A;  2AJA A;  2I2O A;  2GRL A;  4YDY A;  1Z5S C;  2VTB B;  1KLX A;  1K1A A;  1UJJ A;  2RFA A;  4F7A A;  2RD0 A;  3TG5 A;  2WQ7 A;  5ARG A;  3SFX A;  2WMO A;  3NF1 A;  1H0A A;  1QZ2 A;  3SFZ A;  2VJ8 A;  2LNI A;  3D9M A;  2IJG X;  3T8M A;  2WXP A;  1WG0 A;  3Q7F A;  3QB2 A;  3VTY A;  3HXC A;  3EJN A;  3L82 A;  3ZUV B;  1WY6 A;  1IHB A;  3N71 A;  4ANU A;  3UM3 A;  4A3T A;  2J8S D;  5BPP A;  1ZBP A;  3L9T A;  3EHM A;  3WG7 E;  2VGY A;  2L9B A;  4I1M A;  3HXF A;  3NOG D;  3EHN A;  1JCR A;  3SQV A;  3ONL A;  1S64 A;  3NB2 A;  3RSE G;  3GZ2 A;  2PQN A;  3QC1 A;  4N3B A;  4HVB A;  3O48 A;  3ZEF A;  2DYR E;  3Q75 A;  5DBK A;  3C98 A;  3VLF A;  4U04 A;  2Y4T A;  4V3I A;  4LG6 A;  3UX4 A;  4FP7 A;  1OCC E;  2X3M A;  2GRN B;  3D9H A;  3CVL A;  1FT2 A;  2QC9 A;  2I6H A;  5ENS D;  3PNL B;  3FH5 A;  4HI8 A;  4RQI A;  4BTA A;  2P9I G;  3L13 A;  3FH8 A;  4KYO B;  2J4B A;  5AQ7 A;  4FJZ A;  5FTP A;  3DSS A;  5M72 A;  4UI9 K;  4LEU A;  3ZU7 B;  4GAA A;  3LCA A;  5AQB A;  3RJV A;  3CVY A;  2IOL A;  4GTO A;  2HE0 A;  1EYH A;  2Y0B G;  4IN3 B;  4HFG A;  1E8W A;  5HI7 A;  1O1R A;  4NUR A;  4BFR A;  4YVO A;  1LD7 A;  5HQ8 A;  3LY9 A;  1FVH A;  4LUN U;  2GRP B;  4FU3 A;  3VLD A;  2QZA A;  1Q2Z A;  4BTB A;  2R5S A;  2LSU A;  5AQA A;  4OAV B;  2E2E A;  4CDM A;  3CVX A;  1UOH A;  4JHK A;  4GYY A;  4OYS A;  1OWO A;  3UMV A;  3ZYK A;  3JXJ A;  4UQZ A;  1MJ0 A;  4XI9 A;  3RRN B;  4EZL A;  3VTX A;  3B95 A;  1TNU A;  3VLE A;  3TWU A;  3O4Z A;  2BF0 X;  5G05 C;  3FTW A;  4ILG A;  2ETA A;  1O5M A;  4AVX A;  1JCQ A;  3DSU A;  1EF1 C;  2PL2 A;  3D9N A;  5JJT A;  3ASN E;  2VGX A;  3DPD A;  2RFM A;  3DRA A;  3E37 A;  3ESK A;  4UWL A;  4UQY A;  4B89 A;  4FLH A;  3ZNG A;  4TUU A;  3UIO C;  3TWT A;  3AS5 A;  5C2Y A;  4FA6 A;  2WXR A;  4XI0 A;  5ARF A;  3G2S A;  1JPL A;  1E8X A;  4BX9 A;  1YYH A;  3LJN A;  3RO3 A;  5ANL A;  4GA1 A;  2WXG A;  4EHM A;  3QKY A;  5JJ7 A;  4Q94 A;  4MS6 A;  5KNH D;  1NA0 A;  3JUI A;  4FHJ A;  3MKQ B;  2OEV A;  3FU5 A;  3C5R A;  3P2B A;  1U3D A;  4Q96 A;  3E4B A;  3NOC D;  2C0L A;  3R9M A;  3BQO A;  1MYO A;  4X8Q A;  5D66 A;  5EX0 A;  3U4T A;  2XQ0 A;  4TXR A;  2PM6 A;  4U7E B;  3KS2 A;  3AG4 E;  1K1B A;  1AP7 A;  4URK A;  1HF8 A;  4JZY A;  3CVW A;  3FUJ A;  3EU9 A;  2J09 A;  4U0U A;  1N52 A;  2KZT A;  4TUM A;  4A55 A;  3FWV A;  3MKR A;  3T9K A;  4GU5 A;  4WAF A;  4I17 A;  5LP0 A;  1X5B A;  4I6E A;  4PS8 A;  4W9R A;  1N0Q A;  1DC2 A;  1QQE A;  4JA7 A;  2WPV A;  5KJN A;  3PE4 A;  4ME2 A;  4KMO A;  4J0U A;  4ABN A;  2HR2 A;  5HRY A;  3IBE A;  2P9P G;  5B3S E;  1OWN A;  2AVP A;  4DX6 D;  4BET A;  5EX3 A;  1S70 B;  1H19 A;  1IQR A;  3NZU A;  3Q78 A;  3D9J A;  4I2W A;  3ZPJ A;  3HXD A;  2XS8 A;  2PNN A;  4BX8 A;  2I1K A;  3APF A;  3EUV A;  1SW6 A;  3Q9U C;  4HLE A;  5JA4 D;  3CK7 A;  2QY7 A;  3ESL A;  3DWL G;  1HX8 A;  3ISM C;  4K5A B;  4KXK B;  3PRE A;  3CK8 A;  2OVF A;  1N11 A;  5LCW J;  4C0E A;  1N54 A;  1DVP A;  4HLL A;  4G8L A;  4GTP A;  2ZXW E;  3ASO E;  3TJP A;  4EEC A;  3UT4 A;  2XEN A;  1L5J A;  2XZD G;  1JCS A;  2J49 A;  5AYW D;  4GZ3 A;  5A6C A;  2ETC A;  4UWF A;  4BWR A;  3JYS A;  4I1O B;  2NSZ A;  3WXX A;  4LNU D;  3Q73 A;  1K8K G;  2P9U G;  4O6F A;  4J8E A;  5EKQ D;  3E33 A;  3ZHE A;  3QAR A;  4DX7 D;  2PM7 A;  3FEX A;  2F37 A;  1NL4 A;  3LDZ A;  4I1A A;  2BKK B;  3PS6 A;  2IF4 A;  4UWG A;  3ABK E;  1LF8 A;  1O1T A;  4N2S A;  4J8Y A;  4F1P A;  3FUK A;  3RKV A;  1MZC A;  4JHJ A;  5AJL A;  3Q9N C;  3ULY A;  4XKB A;  3MGB A;  4U95 D;  2XEV A;  4UI9 J;  1OT8 A;  3ZVV A;  3FUF A;  4YDO A;  3ASG A;  4FC8 A;  4WWP A;  2LO6 A;  2KCL A;  3FH7 A;  3TGO A;  3PDN A;  2EIM E;  3C3R A;  5ENP D;  2R59 A;  1IKN D;  4BES A;  5KNG A;  4FLB A;  4A1G A;  2VQ2 A;  3SF4 A;  3CHM A;  5J90 A;  3SZ7 A;  1HH8 A;  4JHR A;  3D3M A;  4O1P A;  3U9W A;  3CHO A;  3UKU G;  2L0T B;  4BY6 A;  4DUI A;  1BU9 A;  4YDW A;  3BEE A;  4ZHB A;  3MV2 B;  1SZ9 A;  3PZ4 A;  2VGX B;  5FQ4 A;  1ZB1 A;  4GZC A;  4GZD A;  2LXL A;  2ZU6 B;  3PNT B;  3CVV A;  3FUI A;  1NZN A;  3G2U A;  4GTT A;  1E8Z A;  5HKP A;  4CDN A;  3CKC A;  4G23 A;  1OCZ E;  5CMY A;  3ONK A;  4ANV A;  2XCC A;  2A5E A;  3ZIM A;  1O1S A;  1IHG A;  4UWH A;  3UM2 A;  3TXN A;  4KZ0 A;  2R03 A;  4N3A A;  3HVE A;  3S7B A;  4KBQ A;  3KD7 A;  4IUL A;  1OWP A;  2R2L A;  3LYA A;  5BUZ A;  2XCB A;  1N4R A;  3FU0 A;  3ULQ A;  4N5C A;  3HYM B;  3I4G A;  1RW2 A;  4GCN A;  3CR3 A;  2MRI A;  4L7T A;  1HU3 A;  3DEO A;  4JA9 A;  3B7B A;  5HS0 A;  4E85 A;  4B8C B;  3TWR A;  4NQ0 A;  4TXQ A;  2WVI A;  2KZT B;  4DX1 A;  4JD2 G;  4UQX A;  3ASD A;  5A23 A;  3E32 A;  4B8A A;  4L1B A;  2CG3 A;  1S0P A;  3CHS A;  4FHK A;  4ACK A;  3P1U A;  4APF A;  3TWW A;  2I9C A;  2WM9 A;  2XPY A;  3CST A;  4DI4 A;  1H6K A;  2OOE A;  4KVO A;  1KZP A;  4G2V A;  5E75 A;  3FUD A;  4KZC A;  1JWG A;  5FIO A;  1MQS A;  4F6R D;  1N0R A;  3I5P A;  5ANR A;  2IO2 C;  1H6P A;  3L17 A;  4H7X A;  1WAO 1;  2XPZ A;  1S63 A;  2UY1 B;  4G1T A;  3T5V A;  1BLX B;  3DXK G;  2HYZ A;  3CVU A;  3UI2 A;  3ZKJ A;  3D9L A;  1K3Z D;  5ENT D;  4A1S A;  1AWC B;  3ZYM A;  3EU5 A;  3HIZ A;  1ELW A;  4L23 A;  2F8Y A;  5G55 A;  3FTX A;  3RO2 A;  4I9E A;  3DST A;  4G11 A;  5AN8 A;  1IXV A;  4DX5 D;  3U64 A;  3D9P A;  1E8Y A;  2LSV A;  1PY1 A;  2J4D A;  3V31 A;  5FZR A;  3ZFW A;  3URZ A;  1H2V C;  2C0M A;  2WXF A;  5LFA A;  4RLY A;  3Q47 B;  4M7C A;  1OXJ A;  1SZA A;  5CCL A;  5DIZ A;  5JHA A;  3TWS A;  2CHW A;  3L08 A;  3DSX A;  3LS8 A;  4J8S A;  3G2V A;  2WXO A;  3PEV B;  3FTS A;  4QQI A;  3ML8 A;  4HS2 A;  1JUQ A;  2A4Z A;  4IYP A;  5G05 J;  4P29 A;  5FQ8 A;  2Y69 E;  2X38 A;  5T3R A;  2Q7F A;  2CHX A;  1IYG A;  2FI7 A;  5AAO A;  3X2Q E;  3D9K A;  2H6F A;  3CK9 A;  5EYP F;  2XEH A;  3CVN A;  4L9P A;  4AIF A;  4Y6W A;  5KJL A;  1YMP A;  4BSZ B;  3LJ3 A;  1V55 E;  2IFU A;  3B7U X;  3CHQ A;  1UN8 A;  1B89 A;  1Y8M A;  3QAQ A;  3J5Q B;  4BEP A;  2R02 A;  4N3C A;  5A7D B;  3FP3 A;  3BU8 A;  2CHZ A;  3BUA A;  1TNZ A;  4EPZ A;  4MLP A;  2CFU A;  1SVX A;  2YIN A;  4GTM A;  4J8D A;  3SI5 A;  4DI3 A;  3RIB A;  1WM5 A;  4PUC A;  4YND A;  3ENE A;  3UM1 A;  2XGO A;  4GPK A;  3ZW3 A;  4LSZ E;  3DSW A;  3PVL A;  3PH0 C;  2VSY A;  4GTQ A;  5E76 A;  4HI9 A;  2YQ8 A;  2VSX E;  2FO7 A;  2XS1 A;  2P9S G;  5H7P A;  2IOS A;  5IY5 E;  3ZXP A;  4AOF A;  2X6F A;  3ZXS A;  3UIP C;  4C0M A;  4MKT A;  5EN5 D;  3LEW A;  3TWX A;  3HVE B;  2LXM A;  3L54 A;  3UPV A;  1U3C A;  2JLB A;  1E7V A;  5BT1 A;  1WDY A;  3AG1 E;  3GZ1 A;  1OY3 D;  5CRV A;  1ELK A;  5CEA A;  1NI1 A;  3LVQ E;  4DX2 A;  3QDN A;  3PEU B;  4EZJ A;  4XZ4 A;  3IHY A;  4JEH A;  4N5Q A;  3NQP A;  1Z6T A;  5D2M C;  3UXG A;  3L6A A;  1N4Q A;  3FTU A;  3UM0 A;  2GW1 A;  2LAH A;  3PZD A;  2OND A;  2XGS A;  3K9I A;  3BG0 B;  4GML A;  4GZ5 A;  2P9L G;  2WXH A;  3LY8 A;  2AW6 A;  2M63 A;  1Z3X A;  2ION A;  2ETB A;  1HFA A;  4I6J A;  4K03 A;  3V30 A;  1LTX A;  2DZN A;  2OCC E;  3LY7 A;  4HRM B;  4AP2 A;  4PH4 B;  2LAI A;  3MX3 A;  4U63 A;  2GRR B;  1OCR E;  1Z3Y A;  5D0O D;  5LCW C;  3LKU A;  3SGH A;  1A17 A;  5EID A;  5C1D A;  1HO8 A;  1BD8 A;  3Q7A A;  2EIJ E;  1TNB A;  1TNY A;  4LCT A;  4XE0 A;  1TNO A;  3R7R A;  3HHM A;  3AU4 A;  3QWW A;  2ILR A;  5KJK A;  3S7F A;  4BT8 A;  3DBS A;  3FEY A;  4CCA A;  4WNG A;  5KJM A;  4G24 A;  1YA0 A;  1H2U A;  3FTV A;  3FUH A;  4HRL A;  3NBN B;  3NAW A;  2KC7 A;  2KCV A;  1NP7 A;  1ELR A;  5B1B E;  3T8K A;  3MZL B;  4F3V A;  4HOQ A;  2XPI A;  3SHF A;  3FHE A;  3MEK A;  2EIL E;  3PRZ A;  4R7L A;  4UI9 C;  3R7Q A;  5CBN A;  3RU0 A;  4MBG A;  3FUM A;  4U0Z A;  1N94 A;  5G04 J;  4AEZ C;  3BG1 B;  2C2L A;  1N4S A;  4U8V D;  3JUE A;  4WWN A;  3UQ3 A;  2BTD A;  3GW4 A;  3ZRH A;  2AWI A;  1UW4 B;  3RAU A;  4Q69 A;  4I6G A;  3I3N A;  3KAE A;  3KSL A;  2V5F A;  2MYO A;  3ABM E;  2KBX A;  4OVU A;  2AXV A;  4NRH B;  2H6I A;  3Q5M A;  3QK0 A;  2J08 A;  3TWQ A;  2B0O E;  4DRX E;  3AJI A;  4JL0 A;  4EQF A;  5B1A E;  2H6H A;  4AY6 A;  3V79 K;  3CQG B;  4LER A;  5ENR D;  4L2L A;  4KT6 B;  4U0S A;  2MOW A;  4L2Y A;  5CEC B;  2FEZ A;  4A3V A; 
#chains in the Genus database with same CATH homology
 4DX2 A;  3HRA A;  5AAO A;  5AQA A;  4OAV B;  4A63 B;  1K3Z D;  5ENT D;  3NOC D;  3NOG D;  4N5Q A;  5EYP F;  1AWC B;  2XEH A;  5CED B;  4U8Y D;  3F6Q A;  1MYO A;  1UOH A;  4QFV A;  4G8K A;  3T8K A;  5ENP D;  1YMP A;  4BSZ B;  2PNN A;  2F8Y A;  3UXG A;  5KWD A;  3EHQ A;  4HNA D;  1IKN D;  2QYJ A;  2L6B A;  4BES A;  2ZGG A;  5KNG A;  3DEO A;  5D66 A;  1SW6 A;  4HBD A;  5AN8 A;  5ENO D;  3Q9U C;  5JA4 D;  3JXJ A;  1IXV A;  3V2X A;  1D9S A;  1TR4 A;  3J5Q B;  4HQD A;  4BEP A;  2BKG A;  3B7B A;  4O1O A;  4DX5 D;  4O1P A;  1K1B A;  4K5A B;  1AP7 A;  4K5B A;  1MJ0 A;  2XEE A;  2KXP C;  4LG6 A;  5CER B;  1MX6 A;  4ATZ D;  3KEA A;  5HS0 A;  4Z68 A;  1N11 A;  2Y1L E;  4CZ2 D;  2DWZ A;  3TWR A;  3B95 A;  4JB8 P;  3ZKJ A;  4U96 D;  5CBN A;  3AAA C;  3V31 A;  3TWU A;  4CYM D;  4OAU C;  1SVX A;  1MX4 A;  4HLL A;  5ITZ F;  4DUI A;  4G8L A;  2ETB A;  3EU9 A;  3D9H A;  1G3N B;  2ETA A;  4DX1 A;  1BU9 A;  4YDW A;  2NYJ A;  3V30 A;  5AAR A;  4ZHB A;  2ZGD A;  2DZN A;  2QC9 A;  2VGE A;  5ENS D;  4HRM B;  5EYL A;  4U8V D;  3JUE A;  4RLY A;  4HI8 A;  3W9G A;  2XEN A;  5FIN A;  5KBA A;  2XZD G;  4TUM A;  4LSZ E;  2XZT G;  1A5E A;  5JMN D;  2FO1 E;  4K5C A;  4UUC A;  3TWV A;  2F8X K;  5AQ9 A;  2ETC A;  4B93 B;  2V4H C;  3T9K A;  5BXU A;  2AJA A;  2RFM A;  5AQ7 A;  3JXI A;  4YDY A;  4LNU D;  4HI9 A;  4O60 A;  3DEP A;  1K1A A;  5EIL A;  2RFA A;  4GPM A;  3ZNG A;  3TWW A;  1BI8 B;  5HKP A;  3TWS A;  2MYO A;  2P2C P;  4C48 B;  3TWT A;  2KBX A;  5EID A;  5EIB E;  3J5P A;  3ZU7 B;  1BD8 A;  1MX2 A;  1N0Q A;  1DC2 A;  4ZFH A;  4DX7 D;  5AQB A;  2V5Q C;  3TWQ A;  4HRN A;  1DCQ A;  2B0O E;  2DZO A;  4QQI A;  4DRX E;  2F37 A;  2A5E A;  5EN5 D;  3TWX A;  2HE0 A;  3AJI A;  5FIO A;  2Y0B G;  1WG0 A;  2BKK B;  4F6R D;  4J7W A;  4HB5 A;  1NFI E;  1N0R A;  3EHR A;  5HRY A;  3HG0 D;  3V79 K;  1YYH A;  3LJN A;  1BI7 B;  3IXE A;  3W9F A;  4GMR A;  5BXO A;  4J8Y A;  5CBO A;  3ZUV B;  3UTM A;  4F1P A;  1IHB A;  4NIK A;  1QYM A;  4DX6 D;  5KNH D;  1WDY A;  5ENR D;  3V2O A;  2DVW A;  2J8S D;  1BLX B;  4BET A;  5ENQ D;  1OY3 D;  1YCS B;  3Q9N C;  3SO8 A;  5CEC B;  3C5R A;  4BER A;  5CEA A;  4HRL A;  3NBN B;  2JAB A;  3UI2 A;  1S70 B;  4U95 D;  1OT8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...