5FIOA

Darpins as a new tool for experimental phasing in protein crystallography
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
160
structure length
160
Chain Sequence
GSDLGRKLLEAARAGQDDECRILMANGADVNAADNTGTTPLHLAAYSGHLEIVECLLKHGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NI3C DARPIN MUTANT5 HG-SITE N1
publication title Darpins as a New Tool for Experimental Phasing in Protein Crystallography
rcsb
source organism Synthetic construct
molecule tags Metal binding protein
total genus 53
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5fioA00
2V4HC 4HQDA 4HRLA 1BD8A 1DCQA 4BSZB 3V2XA 3B95A 4B93B 1BU9A 1BI8B 5ENOD 2P2CP 5ENQD 2ZGGA 4CZ2D 1K3ZD 4O1PA 4YDYA 4U95D 3J5PA 3J5QB 1MX6A 4Z68A 5ITZF 2MYOA 3C5RA 4HRNA 3TWTA 2DZNA 3HRAA 5KBAA 3HG0D 5AQ9A 4F1PA 3SO8A 4NIKA 1SVXA 2B0OE 2J8SD 3TWWA 1MYOA 4K5BA 5HKPA 2F8XK 2BKKB 2L6BA 3IXEA 3EHRA 1K1AA 5JMND 3V2OA 2JABA 1S70B 1MJ0A 3V30A 2RFMA 3AJIA 1YYHA 1MX2A 3TWRA 1WG0A 5ENSD 2ZGDA 5CBOA 4GPMA 4DRXE 2XEEA 1YMPA 2Y1LE 2NYJA 1YCSB 5CEDB 2ETAA 2DWZA 2PNNA 1TR4A 4N5QA 1IXVA 5AQAA 3EU9A 5HS0A 3T9KA 3W9FA 1N0RA 4YDWA 3V31A 4QQIA 1NFIE 5CBNA 2AJAA 2QYJA 2VGEA 4J8YA 4LSZE 3TWQA 5AQBA 2HE0A 1AP7A 3ZKJA 3LJNA 4GMRA 4OAUC 3DEOA 2DZOA 5EN5D 3TWUA 4HRMB 1UOHA 5JA4D 2Y0BG 5FIOA 5EILA 1QYMA 4QFVA 4HI9A 4K5CA 2KBXA 1N0QA 3D9HA 4J7WA 4UUCA 4TUMA 3TWXA 5EYPF 5EIDA 1A5EA 5FINA 1SW6A 3UI2A 5AAOA 3ZUVB 1MX4A 2BKGA 3KEAA 4ZHBA 4U8YD 4JB8P 1DC2A 4CYMD 4HB5A 3JUEA 1BI7B 1N11A 2RFAA 4U8VD 5ENRD 4U96D 3DEPA 5EYLA 5KNGA 3TWSA 4BESA 4DX1A 4DX5D 4LNUD 5BXUA 4ZFHA 5HRYA 5AQ7A 2XENA 3F6QA 2QC9A 2F8YA 4C48B 3W9GA 3Q9NC 1IHBA 3JXJA 3UTMA 4BEPA 2A5EA 3NOGD 4G8LA 3UXGA 3JXIA 2XEHA 5KNHD 1OY3D 2ETCA 3B7BA 5AARA 4HI8A 4DX7D 4RLYA 4DX6D 2F37A 4DX2A 2XZDG 3NOCD 4ATZD 4LG6A 5AN8A 2V5QC 5KWDA 4A63B 2XZTG 4G8KA 4HNAD 4BETA 3ZNGA 2DVWA 2KXPC 3AAAC 3V79K 1D9SA 2FO1E 5BXOA 1IKND 4O1OA 4K5AB 5D66A 1OT8A 5CEAA 1BLXB 1WDYA 3Q9UC 5ENPD 3T8KA 4O60A 1AWCB 4OAVB 5CECB 4DUIA 1K1BA 3EHQA 3TWVA 4BERA 5ENTD 4F6RD 3ZU7B 5CERB 5EIBE 1G3NB 4HBDA 3NBNB 4HLLA 2ETBA
chains in the Genus database with same CATH superfamily
2V4HC 4I43A 4YNDA 1DCQA 3FUFA 4JXTA 4B93B 3DSWA 3ASNE 1S63A 3CVVA 2J8SD 4W9RA 4JC8A 3KD7A 3V2OA 1GW6A 2OVBA 3CQGB 4XKCA 4U63A 3TWRA 3QK0A 4GMJA 4A1SA 2XGSA 2XEEA 3NQPA 1TR4A 1QQEA 2P9LG 4FA6A 4J8YA 4FLHA 4X8QA 1UOHA 2KZTB 5BNWA 1RW2A 4M3OA 4ILIA 3ZFWA 3TWXA 3N71A 4XKBA 4LNBA 3I4RB 2H6HA 4APOA 5LCWJ 1TNOA 3CEQA 2B6CA 5G05C 3SF4A 4HOSA 3ZRHA 1IHGA 4JW1A 4A3VA 5A23A 3AU5A 3CHMA 1TYQG 1IHBA 4ACKA 3NOGD 2R17C 4F7AA 3L08A 4ABNA 4BY6A 2IY0C 3EDTB 2VSOE 3SD5A 3VLFA 4URKA 3AG1E 5CEAA 2PZIA 1PC2A 2GRPB 2XPIA 1IQRA 2PM7A 2LO6A 1HG2A 1Z5SC 1LD7A 1N4SA 3SNXA 4AM9A 4UQYA 3TWTA 2FBNA 1UJJA 3CHSA 3GW4A 3LYAA 5FTPA 2L6BA 1MJ0A 4EQFA 3UX4A 3MJWA 5C2YA 4NURA 2MRIA 3R7RA 3CKBA 5BW8C 2EINE 4JVSA 3LEWA 1Z3YA 1KZOA 4D10C 1NFIE 2X3MA 3OAWA 3QJZA 4KT6B 3CHRA 5EKQD 4K03A 2WVIA 2V4LA 3D3MA 3UQ3A 4WNDA 3C3RA 3D9LA 5LP0A 2ILRA 1U2VG 1JCQA 4HI9A 3R7QA 1ZBPA 2L0IA 4FHKA 3T5VA 3FTVA 3FUEA 1O1TA 1LD8A 3FTXA 5ANLA 3FUDA 1BI7B 3SZ7A 4UI9J 4CGVA 2IJGX 2QY7A 5AIJA 2LAHA 3UM2A 1YA0A 4C48B 3Q9NC 3TAXA 1TNZA 3UXGA 5KNHD 1ELWA 2Y3AA 3T5XA 4G8KA 4O6FA 3DSSA 4O1OA 2IQCA 3PE3A 3PH0C 4L23A 4GAAA 4TV3A 2OOEA 3S2AA 4BTBA 4XE0A 4RSYA 1TJFA 5EIBE 4E6HA 1N52A 4HQDA 4GTOA 5LFAA 2ZXWE 3LJ3A 5ENOD 4YDOA 4Z68A 1N4QA 3FEYA 2DZNA 4L2LA 4NIKA 3UIOC 1O5MA 2WQ6A 5JJ6A 4GTTA 5ENSD 4U04A 1QNFA 2PNNA 3CK7A 2GRLA 1IYGA 2J49A 3LY7A 1LTXA 1H6PA 2QYJA 3WXXA 3LJNA 3S7JA 3RIBA 3ASOE 1EDUA 3RJVA 3DRAA 2E2EA 1E8XA 3CSTA 3D9NA 3AG4E 2CFZA 3EIJA 5FT9A 1DC2A 1N11A 4GZ6A 5B1BE 4DX5D 4P29A 3EIQC 2BUGA 4PH4B 3Q7FA 2VTBB 1JCSA 2VSXE 3B7BA 4DX7D 3ABLE 2WXRA 1ELKA 2KCKA 5BXOA 5KJMA 1E8WA 5HI7A 2WXGA 1OT8A 5CCMA 4G24A 5CRUA 5FQ4A 4O60A 4DUIA 3EUVA 4N3AA 3NBNB 2V0PA 3APCA 1TNYA 2J4DA 3FULA 4FLBA 4ME2A 3V2XA 3HHMA 2XS1A 3QWWA 2WQ7A 2GRQB 3Q79A 4O1PA 4JEHA 3PEVB 2MYOA 3CK9A 4DPRA 3KS2A 4GA0A 2FEZA 1UJKA 3FUNA 4B0ZA 1MX2A 1WG0A 3B13A 5HS0A 1DCEA 2VGXA 3FTYA 1MZCA 3PNTB 3RKVA 1Q2ZA 2WPVA 4OAUC 3DEOA 4NACA 5BUZA 4DLOA 1N9AA 1E8YA 1SZAA 3CVLA 3E32A 4UQXA 1OCRE 4U8YD 2IU1A 2XRYA 3Q7AA 3JUEA 4RVBA 1FCHA 3AS5A 4BESA 1OCZE 4LNUD 2C2LA 5LOZA 5G55A 2NC9A 2A5UA 4IRUA 3GZ2A 3JXIA 4Q69A 1OY3D 3LCAA 3VLDA 2X6FA 3ZIMA 3ZNGA 4XZ4A 3B7TA 1HZ4A 3P2BA 3FUKA 4UI9K 4HLLA 1V55E 5CRVA 4TUUA 4HORA 1QBQA 1K3ZD 4EZKA 3Q5MA 3ASFA 5KBAA 5AQ9A 2AVPA 5ARFA 2B0OE 3BQOA 4L9PA 3EHRA 3V30A 1RZ4A 2ZISA 3UINC 3ZVVA 1JPLA 4AXHA 1E7UA 2GROB 2HO1A 2M63A 3G2TA 3ZKJA 4PS8A 4MS6A 3D9IA 1HF8A 4GZ3A 3CVQA 5EILA 1QYMA 1KPSB 2E0IA 4FP7A 3C3OA 4J7WA 1LF8A 5EIDA 3FH8A 4TXPA 5A7DB 3G2VA 1SA5A 4CYMD 4H7YA 1TJCA 4ZFHA 3D9OA 5AQ7A 2F8YA 1HXIA 3W9GA 3JYSA 1NA3A 4XX5A 3S7FA 4L2YA 3U66A 4RLYA 3UT7A 4DLQA 4ILHB 4E85A 1EYHA 3NF1A 5AENA 1S0PA 2R59A 4JHJA 2R03A 4MRUA 1WDYA 2ONDA 3E33A 3E30A 3UUXA 3BUAA 2VQ2A 2WM9A 2RD0A 4LUNU 4FC8A 1KT0A 4XEIG 3TGOA 4HRNA 2MOWA 4U7EB 4KZ0A 5E75A 4CDMA 3FTZA 2LXLA 2LAIA 3CV0A 3TJPA 3PUJA 3ZYMA 2ZGDA 2NYJA 3PZ1A 3PE4A 2DBAA 5H7PA 3W9FA 3B7RL 3APDA 2A4ZA 2KATA 2JLBA 2WXHA 3SFZA 3DXKG 3IHVA 2CG2A 3RRUA 2C0LA 4GZCA 4GMRA 4KYOB 4QFVA 4AJWA 4EPZA 2WXOA 3NB2A 4GTVA 3QOUA 2BKGA 3KEAA 5HQ8A 1N4PA 3CVWA 4JZYA 3AU4A 1MQSA 2XHEA 4ANVA 1H6KA 4U8HA 1UG3A 4KXKB 3CQCB 5FZRA 2KXPC 4Q94A 3R9AB 2IOSA 2RKKA 1SQMA 2FI7A 1N94A 3RO3A 3E4BA 4MBGA 5M72A 1Y8MA 3UM1A 2VJ8A 3IV0A 4YDYA 5G04J 1N95A 4JA7A 1JWFA 5ITZF 3ASGA 1FT2A 1SVXA 2YHCA 4K5BA 5HKPA 3S7BA 2RG8A 4N2SA 3L17A 2DIWA 4ATGA 2EILE 4NQ0A 3I4GA 1JWGA 2Y1LE 2P9UG 1YCSB 4N5QA 1IXVA 1JUQA 2GRMA 4G11A 5CBNA 2WQHA 1U3CA 3CHPA 3O4ZA 4XI0A 4NRHB 4Q96A 4OVUA 1N4RA 2KBXA 2C0MA 3WG7E 3FTUA 3L13A 5FINA 1SW6A 3UI2A 1UN9A 2OV8A 3FFLA 5JHAA 4H7XA 2OEWA 4PUCA 3FUHA 5KJNA 3QC1A 2VGYA 5A6CA 2AW6A 2QZAA 3QKYA 3OTNA 1PAQA 4WWOA 4EBAA 5AARA 3X2QE 2F37A 4ATZD 4B8AA 3UPVA 3MKQA 2WB2A 4I2ZA 2FO1E 5ENPD 4G25A 4CT0A 2IEJA 4AY6A 1UW4B 4CCAA 3FDHA 4GTQA 2QYUA 3LKUA 1BD8A 3HXCA 3PRZA 3ASDA 2AXZA 4C9BB 1BU9A 1B89A 2UY1A 4I6GA 2J4BA 4J6IA 3J5PA 3HRAA 2LNIA 3JQ1A 3QWVA 4XIFA 3OXGA 2BF0X 4GMLA 4G26A 3OXFA 3SFXA 1TNUA 5FQ7A 3IEGA 3Q15A 4EBAG 1X81A 5AQAA 4BFRA 1WY6A 1FVHA 3V31A 4FJZA 4G1TA 4I2WA 3HVEA 3TWUA 2IOLA 2KCVA 4BWRA 4CEMA 5JA4D 2Y0BG 5JJ7A 3L54A 2L9BA 3MX3A 2VSYA 4LNGA 2RFAA 2I1KA 1JCRA 4GTRA 2QC9A 3SGHA 4BEPA 3EHNA 4CRWA 3GYZA 3QNKA 3D9KA 3D9MA 1INZA 1D8DA 1EF1C 4GTSA 3G2UA 3DSVA 5KWDA 2YQ8A 3SY2A 5JHBA 3KAEA 3AAAC 4JHRA 2EIJE 3V79K 1HH8A 2V5FA 4K5AB 4DJAA 1A17A 4LRZA 2DCPA 4GYWA 1AWCB 3GZ1A 4F6RD 5FQ6A 5LCWC 4PS3A 3K9IA 4BT8A 4CZ2D 4JHKA 3ZHEA 3VLEA 4U95D 1SZ9A 1TN8A 5BV0A 2CFUA 4JEUA 5DIZA 1Z3XA 3I5PA 3FTSA 4GPMA 3CVUA 4IULA 1TNBA 4FU3A 2GGFA 3T9KA 4QQIA 2I6HA 4A1GA 4LSZE 4C0EA 5B1AE 1AP7A 3ZYLA 4HRMB 4J8DA 3TXNA 3ISMC 4GB9A 4TXRA 4ZHBA 3UIPC 3ZYKA 1TEZA 2H6GA 4JB8P 2XCCA 2DYRE 3DEPA 4JD2G 4JA9A 5BT1A 2IO3C 3PZ4A 3FU3A 2VGXB 3QDNA 3CVNA 4I1MA 3ONLA 4M7CA 3P1UA 3UM3A 3NOCD 3RO2A 2X6KA 2F0YA 4BTAA 3CHQA 5D66A 3ENEA 1BLXB 3CKCA 3ML8A 4AVXA 3G2SA 5CERB 3MEKA 3MYVA 3ZXSA 4UI9C 4N5CA 5ANRA 2IO2C 3AS8A 4J8SA 3SHFA 1OWOA 1H19A 3HG0D 4RQIA 2WMOA 5J08A 4TRQA 2BKKB 2AXUA 5T3RA 2RFMA 4DRXE 4L1BA 4A3TA 3FH7A 2CHZA 3UT4A 3Q4AB 5EX0A 3FEXA 2XQ0A 2BTDA 3GZSA 3ULEG 4GTPA 5AQBA 3LDZA 3PZDA 2DZOA 5EDSA 5FIOA 3FP3A 1KZPA 1FT1A 3B7UX 4DI3A 3LS8A 3MV2B 4J8EA 4HXIA 3IHYA 1KLXA 5C1DA 3D9PA 2NXPA 4U8VD 5EYLA 3TWSA 4DX1A 4J0UA 5ARGA 2GRNB 3ZGQA 2P9SG 4AOFA 3URZA 4HI8A 4DX6D 3MKRA 2J07A 3Q49B 4DK5A 4PS7A 3TL5A 3ULYA 4JL0A 4BX9A 3T8KA 4OAVB 2CHXA 5CECB 1ZB1A 4I1AA 5D0OD 5ENTD 3MA5A 4RG6A 3FUIA 2WXQA 4BSZB 4I1OB 2KCLA 1MX6A 2AXVA 4GCNA 4UWKA 3C5RA 4IYPA 3L16A 2J08A 2Q7FA 1Y6IA 3DPYA 5B3SE 3AJIA 3MZLB 4I9EA 2WXNA 4F1SA 4FHJA 2X6JA 1TN6A 1W3BA 2QFCA 3Q73A 5CHEE 3LPZA 4B94A 3LY8A 4U0ZA 3ZW3A 4WWPA 4ILGA 3UT8A 1DNPA 3FWVA 4K5CA 4WUYA 3UMVA 3NZUA 1A5EA 3MGBA 4HB5A 3DWLG 4HOUA 1WAO1 3PZ3A 3G2WA 2XEHA 3U3WA 4WNFA 3ZXPA 4KBQA 3CK8A 2UWJG 4A63B 3UKUG 1QZ2A 2OVFA 4EZJA 1OWNA 5JJTA 4BERA 3ESLA 2L6JA 4GZ5A 4HRLA 3JCKC 5AJLA 5D2MC 4FADA 2KZTA 4I6JA 3JQ0A 1P5QA 1EPUA 1MYOA 4ANWA 2P9IG 3LVQE 3HXEA 3R9MA 5DBKA 1H6OA 1OCCE 4GA2A 3HYMB 3BU8A 1UN8A 2FF4A 3DSTA 4A55A 3KSLA 4U0SA 3ZN3A 3CSFA 3KEZA 2L0TB 2AJAA 2HE0A 3CVXA 2GRRB 4AY5A 1HU3A 3PZ2A 3DSXA 3ZPJA 3FU6A 5KJLA 1U3DA 5AAOA 2XGOA 1Z6TA 3PNLB 3OXLA 3S7DA 4IN3B 1K8KG 5FJYA 4AIFA 3FUMA 3RSEG 2XENA 2LSVA 3JXJA 2A5EA 3BEEA 2EIME 4HS2A 1E96B 2P58C 5T4YA 2R02A 3PEUB 5FZSA 2PL2A 1MHQA 4GYYA 1NL4A 4I9CA 1ELRA 1DVPA 4HOQA 1K1BA 3TWVA 5CMWA 2P9KG 5CCLA 4AP2A 2AWIA 3ZU7B 3AG2E 2WXLA 5BV1A 1XGWA 3FTWA 4MLPA 3QARA 1OXJA 3SO8A 1H2VC 5IY5E 3ABKE 3C98A 4N2QA 3AG3E 2F8XK 3MKQB 5JMND 2KM4A 2VYIA 5LX8A 4UWGA 3HDXA 2X38A 3Q47B 4CDNA 5KCMA 3JUIA 1HFAA 2IFUA 3I3NA 1SA4A 4YVOA 3ULQA 2OEVA 4R7LA 2UY1B 1E8ZA 5EX3A 5EN5D 3PVLA 3RRNB 3LY9A 4Y6WA 3UKRG 4HVBA 1N0QA 3RK6A 4UUCA 4WNEA 3ZUVB 4FULA 4KVOA 1PY1A 3AS4A 3QB2A 2P9NG 3CIAA 2YNQA 5HRYA 1X5BA 3ASHA 4HFGA 3DXMG 3SQVA 4LERA 1E90A 4DX2A 4KVMA 5T8IA 3E37A 3HVEB 4YVQC 3C72A 3SI5A 4BETA 1FPPA 3HXDA 4TXQA 3CLJA 4L7TA 3L6AA 3KSQA 2ZU6B 2R5SA 4F3VA 4G23A 3ZEFA 5ENQD 3RAUA 1O1SA 3FUJA 2HR2A 2R05A 3APFA 3L9TA 1H2TC 2WXFA 4B8CB 4KZCA 4F53A 4GTMA 3LXUX 1K1AA 2PM6A 2JABA 3CGHA 2X6HA 3HXFA 3U9WA 1YYHA 5CBOA 4N3BA 1YMPA 3O48A 4I17A 2ETAA 2Y4TA 2VTBA 1OWMA 2YINA 4GPKA 4MKTA 3TWQA 4V3IA 4JPSA 3ZHEB 3SBSA 3HXBA 1HS6A 3PREA 5AJDA 5G04C 4LEUA 2LXMA 4ANXA 3FU0A 4GCOA 1TN7A 1H2UA 3TG5A 3U4TA 1MX4A 3ONKA 1KT1A 2VSNA 4YDEA 5ENRD 3ZYQA 4LCTA 4BSXA 3F6QA 3FU5A 3RRMB 3CR3A 2WXMA 2FO7A 3UTMA 2I9CA 2PQNA 3DPDA 2IONA 2WXJA 4C0MA 2XS8A 3UM0A 3EU5A 1H0AA 2XZTG 1IKND 1IQUA 2BEDA 1ZU2A 3IBEA 3FY4A 4ANUA 1HX8A 4HBDA 2ETBA 3CVPA 3BG0B 4GYOA 4I6EA 4CT4A 2EIKE 2P9PG 3RU0A 2Y69E 4ACLA 2R2LA 2IF4A 4J8FA 2ZGGA 3PUKA 2CHWA 2YHEA 3SFYA 2XGMA 1NZNA 3J5QB 2XCBA 3NZSA 3NAWA 3QWPA 4EHMA 3U64A 4F1PA 2XPYA 2GW1A 3LVRE 4UWFA 5KJKA 3FH5A 2LSUA 5E76A 3TWWA 5AYWD 2WXIA 3SBTB 3IXEA 1S70B 4UWLA 5G2NA 1E7VA 4OYSA 2EQXA 2J09A 1N54A 3IKOB 4YDWA 2NSZA 2VGEA 4B89A 3Q75A 3L22A 2DYSE 3MCXA 5G05J 4DI4A 3VTXA 5EYPF 2X6IA 4KMOA 3DSUA 3PS6A 1S64A 4N39A 4Y6CA 2OCCE 1VDYA 4UQZA 5BXUA 3CHOA 5ENNA 2XRZA 2ZIRA 3VTYA 3ESKA 2ETCA 1D8EA 3HIZA 1HE8A 2V5QC 1NP7A 2DVWA 4PDXA 2LUHA 4WWNA 3PDNA 1BPOA 1HO8A 3ML9A 2WXKA 3EHQA 1NA0A 3EJNA 3EHMA 4CGWA 4N3CA 5BPPA 4AV7A 3B95A 5CMYA 3E34A 1BI8B 2WMNA 4G2VA 2P2CP 5J90A 4APFA 4GU5A 2CG3A 4K0RA 2J9QA 2FULA 4WAFA 3QAQA 5FWQA 1O1RA 2H6FA 4EZLA 3BG1B 3CVYA 3C3QA 4OVVA 1FVFA 1XNFA 2I1JA 3L82A 5CEDB 2DWZA 3EU9A 4GZDA 1HG5A 1N0RA 4RG9A 2HM8A 3FHEA 3MV3B 2XEVA 3DBSA 3Q78A 2HYZA 1OWLA 4WNGA 3D9HA 4TUMA 2MHKA 2KC7A 4HOTA 4AEZC 4GA1A 1OUVA 4BX8A 2JEKA 4U96D 5FQ8A 5KNGA 3ABME 2H6IA 1OWPA 4CDRA 1NI1A 4FJYA 4UWHA 3B7SA 4G8LA 2PQRA 1WM5A 2XPZA 4BT9A 4HLEA 2XZDG 1L5JA 4LG6A 5AN8A 3D9JA 4HNAD 4EECA 5D0QD 2Y4UA 1D9SA 4U0UA 2WXPA 2V8SE 1OCOE 3Q9UC 4U07A 3T8MA 5FZQA 1V54E 3TXMA 4XI9A 3TG4A 1G3NB 2I2OA
chains in the Genus database with same CATH topology
2V4HC 4HQDA 4HRLA 1BD8A 1DCQA 4BSZB 3V2XA 3B95A 4B93B 1BU9A 1BI8B 5ENOD 2P2CP 5ENQD 2ZGGA 4CZ2D 1K3ZD 4O1PA 4YDYA 4U95D 3J5PA 3J5QB 1MX6A 4Z68A 5ITZF 2MYOA 3C5RA 4HRNA 3TWTA 2DZNA 3HRAA 5KBAA 3HG0D 5AQ9A 4F1PA 3SO8A 4NIKA 1SVXA 2B0OE 2J8SD 3TWWA 1MYOA 4K5BA 5HKPA 2F8XK 2BKKB 2L6BA 3IXEA 3EHRA 1K1AA 5JMND 3V2OA 2JABA 1S70B 1MJ0A 3V30A 2RFMA 3AJIA 1YYHA 1MX2A 3TWRA 1WG0A 5ENSD 2ZGDA 5CBOA 4GPMA 4DRXE 2XEEA 1YMPA 2Y1LE 2NYJA 1YCSB 5CEDB 2ETAA 2DWZA 2PNNA 1TR4A 4N5QA 1IXVA 5AQAA 3EU9A 5HS0A 3T9KA 3W9FA 1N0RA 4YDWA 3V31A 4QQIA 1NFIE 5CBNA 2AJAA 2QYJA 2VGEA 4J8YA 4LSZE 3TWQA 5AQBA 2HE0A 1AP7A 3ZKJA 3LJNA 4GMRA 4OAUC 3DEOA 2DZOA 5EN5D 3TWUA 4HRMB 1UOHA 5JA4D 2Y0BG 5FIOA 5EILA 1QYMA 4QFVA 4HI9A 4K5CA 2KBXA 1N0QA 3D9HA 4J7WA 4UUCA 4TUMA 3TWXA 5EYPF 5EIDA 1A5EA 5FINA 1SW6A 3UI2A 5AAOA 3ZUVB 1MX4A 2BKGA 3KEAA 4ZHBA 4U8YD 4JB8P 1DC2A 4CYMD 4HB5A 3JUEA 1BI7B 1N11A 2RFAA 4U8VD 5ENRD 4U96D 3DEPA 5EYLA 5KNGA 3TWSA 4BESA 4DX1A 4DX5D 4LNUD 5BXUA 4ZFHA 5HRYA 5AQ7A 2XENA 3F6QA 2QC9A 2F8YA 4C48B 3W9GA 3Q9NC 1IHBA 3JXJA 3UTMA 4BEPA 2A5EA 3NOGD 4G8LA 3UXGA 3JXIA 2XEHA 5KNHD 1OY3D 2ETCA 3B7BA 5AARA 4HI8A 4DX7D 4RLYA 4DX6D 2F37A 4DX2A 2XZDG 3NOCD 4ATZD 4LG6A 5AN8A 2V5QC 5KWDA 4A63B 2XZTG 4G8KA 4HNAD 4BETA 3ZNGA 2DVWA 2KXPC 3AAAC 3V79K 1D9SA 2FO1E 5BXOA 1IKND 4O1OA 4K5AB 5D66A 1OT8A 5CEAA 1BLXB 1WDYA 3Q9UC 5ENPD 3T8KA 4O60A 1AWCB 4OAVB 5CECB 4DUIA 1K1BA 3EHQA 3TWVA 4BERA 5ENTD 4F6RD 3ZU7B 5CERB 5EIBE 1G3NB 4HBDA 3NBNB 4HLLA 2ETBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4H C;  4HQD A;  4HRL A;  1BD8 A;  1DCQ A;  4BSZ B;  3V2X A;  3B95 A;  4B93 B;  1BU9 A;  1BI8 B;  5ENO D;  2P2C P;  5ENQ D;  2ZGG A;  4CZ2 D;  1K3Z D;  4O1P A;  4YDY A;  4U95 D;  3J5P A;  3J5Q B;  1MX6 A;  4Z68 A;  5ITZ F;  2MYO A;  3C5R A;  4HRN A;  3TWT A;  2DZN A;  3HRA A;  5KBA A;  3HG0 D;  5AQ9 A;  4F1P A;  3SO8 A;  4NIK A;  1SVX A;  2B0O E;  2J8S D;  3TWW A;  1MYO A;  4K5B A;  5HKP A;  2F8X K;  2BKK B;  2L6B A;  3IXE A;  3EHR A;  1K1A A;  5JMN D;  3V2O A;  2JAB A;  1S70 B;  1MJ0 A;  3V30 A;  2RFM A;  3AJI A;  1YYH A;  1MX2 A;  3TWR A;  1WG0 A;  5ENS D;  2ZGD A;  5CBO A;  4GPM A;  4DRX E;  2XEE A;  1YMP A;  2Y1L E;  2NYJ A;  1YCS B;  5CED B;  2ETA A;  2DWZ A;  2PNN A;  1TR4 A;  4N5Q A;  1IXV A;  5AQA A;  3EU9 A;  5HS0 A;  3T9K A;  3W9F A;  1N0R A;  4YDW A;  3V31 A;  4QQI A;  1NFI E;  5CBN A;  2AJA A;  2QYJ A;  2VGE A;  4J8Y A;  4LSZ E;  3TWQ A;  5AQB A;  2HE0 A;  1AP7 A;  3ZKJ A;  3LJN A;  4GMR A;  4OAU C;  3DEO A;  2DZO A;  5EN5 D;  3TWU A;  4HRM B;  1UOH A;  5JA4 D;  2Y0B G;  5FIO A;  5EIL A;  1QYM A;  4QFV A;  4HI9 A;  4K5C A;  2KBX A;  1N0Q A;  3D9H A;  4J7W A;  4UUC A;  4TUM A;  3TWX A;  5EYP F;  5EID A;  1A5E A;  5FIN A;  1SW6 A;  3UI2 A;  5AAO A;  3ZUV B;  1MX4 A;  2BKG A;  3KEA A;  4ZHB A;  4U8Y D;  4JB8 P;  1DC2 A;  4CYM D;  4HB5 A;  3JUE A;  1BI7 B;  1N11 A;  2RFA A;  4U8V D;  5ENR D;  4U96 D;  3DEP A;  5EYL A;  5KNG A;  3TWS A;  4BES A;  4DX1 A;  4DX5 D;  4LNU D;  5BXU A;  4ZFH A;  5HRY A;  5AQ7 A;  2XEN A;  3F6Q A;  2QC9 A;  2F8Y A;  4C48 B;  3W9G A;  3Q9N C;  1IHB A;  3JXJ A;  3UTM A;  4BEP A;  2A5E A;  3NOG D;  4G8L A;  3UXG A;  3JXI A;  2XEH A;  5KNH D;  1OY3 D;  2ETC A;  3B7B A;  5AAR A;  4HI8 A;  4DX7 D;  4RLY A;  4DX6 D;  2F37 A;  4DX2 A;  2XZD G;  3NOC D;  4ATZ D;  4LG6 A;  5AN8 A;  2V5Q C;  5KWD A;  4A63 B;  2XZT G;  4G8K A;  4HNA D;  4BET A;  3ZNG A;  2DVW A;  2KXP C;  3AAA C;  3V79 K;  1D9S A;  2FO1 E;  5BXO A;  1IKN D;  4O1O A;  4K5A B;  5D66 A;  1OT8 A;  5CEA A;  1BLX B;  1WDY A;  3Q9U C;  5ENP D;  3T8K A;  4O60 A;  1AWC B;  4OAV B;  5CEC B;  4DUI A;  1K1B A;  3EHQ A;  3TWV A;  4BER A;  5ENT D;  4F6R D;  3ZU7 B;  5CER B;  5EIB E;  1G3N B;  4HBD A;  3NBN B;  4HLL A;  2ETB A; 
#chains in the Genus database with same CATH topology
 2V4H C;  4I43 A;  4YND A;  1DCQ A;  3FUF A;  4JXT A;  4B93 B;  3DSW A;  3ASN E;  1S63 A;  3CVV A;  2J8S D;  4W9R A;  4JC8 A;  3KD7 A;  3V2O A;  1GW6 A;  2OVB A;  3CQG B;  4XKC A;  4U63 A;  3TWR A;  3QK0 A;  4GMJ A;  4A1S A;  2XGS A;  2XEE A;  3NQP A;  1TR4 A;  1QQE A;  2P9L G;  4FA6 A;  4J8Y A;  4FLH A;  4X8Q A;  1UOH A;  2KZT B;  5BNW A;  1RW2 A;  4M3O A;  4ILI A;  3ZFW A;  3TWX A;  3N71 A;  4XKB A;  4LNB A;  3I4R B;  2H6H A;  4APO A;  5LCW J;  1TNO A;  3CEQ A;  2B6C A;  5G05 C;  3SF4 A;  4HOS A;  3ZRH A;  1IHG A;  4JW1 A;  4A3V A;  5A23 A;  3AU5 A;  3CHM A;  1TYQ G;  1IHB A;  4ACK A;  3NOG D;  2R17 C;  4F7A A;  3L08 A;  4ABN A;  4BY6 A;  2IY0 C;  3EDT B;  2VSO E;  3SD5 A;  3VLF A;  4URK A;  3AG1 E;  5CEA A;  2PZI A;  1PC2 A;  2GRP B;  2XPI A;  1IQR A;  2PM7 A;  2LO6 A;  1HG2 A;  1Z5S C;  1LD7 A;  1N4S A;  3SNX A;  4AM9 A;  4UQY A;  3TWT A;  2FBN A;  1UJJ A;  3CHS A;  3GW4 A;  3LYA A;  5FTP A;  2L6B A;  1MJ0 A;  4EQF A;  3UX4 A;  3MJW A;  5C2Y A;  4NUR A;  2MRI A;  3R7R A;  3CKB A;  5BW8 C;  2EIN E;  4JVS A;  3LEW A;  1Z3Y A;  1KZO A;  4D10 C;  1NFI E;  2X3M A;  3OAW A;  3QJZ A;  4KT6 B;  3CHR A;  5EKQ D;  4K03 A;  2WVI A;  2V4L A;  3D3M A;  3UQ3 A;  4WND A;  3C3R A;  3D9L A;  5LP0 A;  2ILR A;  1U2V G;  1JCQ A;  4HI9 A;  3R7Q A;  1ZBP A;  2L0I A;  4FHK A;  3T5V A;  3FTV A;  3FUE A;  1O1T A;  1LD8 A;  3FTX A;  5ANL A;  3FUD A;  1BI7 B;  3SZ7 A;  4UI9 J;  4CGV A;  2IJG X;  2QY7 A;  5AIJ A;  2LAH A;  3UM2 A;  1YA0 A;  4C48 B;  3Q9N C;  3TAX A;  1TNZ A;  3UXG A;  5KNH D;  1ELW A;  2Y3A A;  3T5X A;  4G8K A;  4O6F A;  3DSS A;  4O1O A;  2IQC A;  3PE3 A;  3PH0 C;  4L23 A;  4GAA A;  4TV3 A;  2OOE A;  3S2A A;  4BTB A;  4XE0 A;  4RSY A;  1TJF A;  5EIB E;  4E6H A;  1N52 A;  4HQD A;  4GTO A;  5LFA A;  2ZXW E;  3LJ3 A;  5ENO D;  4YDO A;  4Z68 A;  1N4Q A;  3FEY A;  2DZN A;  4L2L A;  4NIK A;  3UIO C;  1O5M A;  2WQ6 A;  5JJ6 A;  4GTT A;  5ENS D;  4U04 A;  1QNF A;  2PNN A;  3CK7 A;  2GRL A;  1IYG A;  2J49 A;  3LY7 A;  1LTX A;  1H6P A;  2QYJ A;  3WXX A;  3LJN A;  3S7J A;  3RIB A;  3ASO E;  1EDU A;  3RJV A;  3DRA A;  2E2E A;  1E8X A;  3CST A;  3D9N A;  3AG4 E;  2CFZ A;  3EIJ A;  5FT9 A;  1DC2 A;  1N11 A;  4GZ6 A;  5B1B E;  4DX5 D;  4P29 A;  3EIQ C;  2BUG A;  4PH4 B;  3Q7F A;  2VTB B;  1JCS A;  2VSX E;  3B7B A;  4DX7 D;  3ABL E;  2WXR A;  1ELK A;  2KCK A;  5BXO A;  5KJM A;  1E8W A;  5HI7 A;  2WXG A;  1OT8 A;  5CCM A;  4G24 A;  5CRU A;  5FQ4 A;  4O60 A;  4DUI A;  3EUV A;  4N3A A;  3NBN B;  2V0P A;  3APC A;  1TNY A;  2J4D A;  3FUL A;  4FLB A;  4ME2 A;  3V2X A;  3HHM A;  2XS1 A;  3QWW A;  2WQ7 A;  2GRQ B;  3Q79 A;  4O1P A;  4JEH A;  3PEV B;  2MYO A;  3CK9 A;  4DPR A;  3KS2 A;  4GA0 A;  2FEZ A;  1UJK A;  3FUN A;  4B0Z A;  1MX2 A;  1WG0 A;  3B13 A;  5HS0 A;  1DCE A;  2VGX A;  3FTY A;  1MZC A;  3PNT B;  3RKV A;  1Q2Z A;  2WPV A;  4OAU C;  3DEO A;  4NAC A;  5BUZ A;  4DLO A;  1N9A A;  1E8Y A;  1SZA A;  3CVL A;  3E32 A;  4UQX A;  1OCR E;  4U8Y D;  2IU1 A;  2XRY A;  3Q7A A;  3JUE A;  4RVB A;  1FCH A;  3AS5 A;  4BES A;  1OCZ E;  4LNU D;  2C2L A;  5LOZ A;  5G55 A;  2NC9 A;  2A5U A;  4IRU A;  3GZ2 A;  3JXI A;  4Q69 A;  1OY3 D;  3LCA A;  3VLD A;  2X6F A;  3ZIM A;  3ZNG A;  4XZ4 A;  3B7T A;  1HZ4 A;  3P2B A;  3FUK A;  4UI9 K;  4HLL A;  1V55 E;  5CRV A;  4TUU A;  4HOR A;  1QBQ A;  1K3Z D;  4EZK A;  3Q5M A;  3ASF A;  5KBA A;  5AQ9 A;  2AVP A;  5ARF A;  2B0O E;  3BQO A;  4L9P A;  3EHR A;  3V30 A;  1RZ4 A;  2ZIS A;  3UIN C;  3ZVV A;  1JPL A;  4AXH A;  1E7U A;  2GRO B;  2HO1 A;  2M63 A;  3G2T A;  3ZKJ A;  4PS8 A;  4MS6 A;  3D9I A;  1HF8 A;  4GZ3 A;  3CVQ A;  5EIL A;  1QYM A;  1KPS B;  2E0I A;  4FP7 A;  3C3O A;  4J7W A;  1LF8 A;  5EID A;  3FH8 A;  4TXP A;  5A7D B;  3G2V A;  1SA5 A;  4CYM D;  4H7Y A;  1TJC A;  4ZFH A;  3D9O A;  5AQ7 A;  2F8Y A;  1HXI A;  3W9G A;  3JYS A;  1NA3 A;  4XX5 A;  3S7F A;  4L2Y A;  3U66 A;  4RLY A;  3UT7 A;  4DLQ A;  4ILH B;  4E85 A;  1EYH A;  3NF1 A;  5AEN A;  1S0P A;  2R59 A;  4JHJ A;  2R03 A;  4MRU A;  1WDY A;  2OND A;  3E33 A;  3E30 A;  3UUX A;  3BUA A;  2VQ2 A;  2WM9 A;  2RD0 A;  4LUN U;  4FC8 A;  1KT0 A;  4XEI G;  3TGO A;  4HRN A;  2MOW A;  4U7E B;  4KZ0 A;  5E75 A;  4CDM A;  3FTZ A;  2LXL A;  2LAI A;  3CV0 A;  3TJP A;  3PUJ A;  3ZYM A;  2ZGD A;  2NYJ A;  3PZ1 A;  3PE4 A;  2DBA A;  5H7P A;  3W9F A;  3B7R L;  3APD A;  2A4Z A;  2KAT A;  2JLB A;  2WXH A;  3SFZ A;  3DXK G;  3IHV A;  2CG2 A;  3RRU A;  2C0L A;  4GZC A;  4GMR A;  4KYO B;  4QFV A;  4AJW A;  4EPZ A;  2WXO A;  3NB2 A;  4GTV A;  3QOU A;  2BKG A;  3KEA A;  5HQ8 A;  1N4P A;  3CVW A;  4JZY A;  3AU4 A;  1MQS A;  2XHE A;  4ANV A;  1H6K A;  4U8H A;  1UG3 A;  4KXK B;  3CQC B;  5FZR A;  2KXP C;  4Q94 A;  3R9A B;  2IOS A;  2RKK A;  1SQM A;  2FI7 A;  1N94 A;  3RO3 A;  3E4B A;  4MBG A;  5M72 A;  1Y8M A;  3UM1 A;  2VJ8 A;  3IV0 A;  4YDY A;  5G04 J;  1N95 A;  4JA7 A;  1JWF A;  5ITZ F;  3ASG A;  1FT2 A;  1SVX A;  2YHC A;  4K5B A;  5HKP A;  3S7B A;  2RG8 A;  4N2S A;  3L17 A;  2DIW A;  4ATG A;  2EIL E;  4NQ0 A;  3I4G A;  1JWG A;  2Y1L E;  2P9U G;  1YCS B;  4N5Q A;  1IXV A;  1JUQ A;  2GRM A;  4G11 A;  5CBN A;  2WQH A;  1U3C A;  3CHP A;  3O4Z A;  4XI0 A;  4NRH B;  4Q96 A;  4OVU A;  1N4R A;  2KBX A;  2C0M A;  3WG7 E;  3FTU A;  3L13 A;  5FIN A;  1SW6 A;  3UI2 A;  1UN9 A;  2OV8 A;  3FFL A;  5JHA A;  4H7X A;  2OEW A;  4PUC A;  3FUH A;  5KJN A;  3QC1 A;  2VGY A;  5A6C A;  2AW6 A;  2QZA A;  3QKY A;  3OTN A;  1PAQ A;  4WWO A;  4EBA A;  5AAR A;  3X2Q E;  2F37 A;  4ATZ D;  4B8A A;  3UPV A;  3MKQ A;  2WB2 A;  4I2Z A;  2FO1 E;  5ENP D;  4G25 A;  4CT0 A;  2IEJ A;  4AY6 A;  1UW4 B;  4CCA A;  3FDH A;  4GTQ A;  2QYU A;  3LKU A;  1BD8 A;  3HXC A;  3PRZ A;  3ASD A;  2AXZ A;  4C9B B;  1BU9 A;  1B89 A;  2UY1 A;  4I6G A;  2J4B A;  4J6I A;  3J5P A;  3HRA A;  2LNI A;  3JQ1 A;  3QWV A;  4XIF A;  3OXG A;  2BF0 X;  4GML A;  4G26 A;  3OXF A;  3SFX A;  1TNU A;  5FQ7 A;  3IEG A;  3Q15 A;  4EBA G;  1X81 A;  5AQA A;  4BFR A;  1WY6 A;  1FVH A;  3V31 A;  4FJZ A;  4G1T A;  4I2W A;  3HVE A;  3TWU A;  2IOL A;  2KCV A;  4BWR A;  4CEM A;  5JA4 D;  2Y0B G;  5JJ7 A;  3L54 A;  2L9B A;  3MX3 A;  2VSY A;  4LNG A;  2RFA A;  2I1K A;  1JCR A;  4GTR A;  2QC9 A;  3SGH A;  4BEP A;  3EHN A;  4CRW A;  3GYZ A;  3QNK A;  3D9K A;  3D9M A;  1INZ A;  1D8D A;  1EF1 C;  4GTS A;  3G2U A;  3DSV A;  5KWD A;  2YQ8 A;  3SY2 A;  5JHB A;  3KAE A;  3AAA C;  4JHR A;  2EIJ E;  3V79 K;  1HH8 A;  2V5F A;  4K5A B;  4DJA A;  1A17 A;  4LRZ A;  2DCP A;  4GYW A;  1AWC B;  3GZ1 A;  4F6R D;  5FQ6 A;  5LCW C;  4PS3 A;  3K9I A;  4BT8 A;  4CZ2 D;  4JHK A;  3ZHE A;  3VLE A;  4U95 D;  1SZ9 A;  1TN8 A;  5BV0 A;  2CFU A;  4JEU A;  5DIZ A;  1Z3X A;  3I5P A;  3FTS A;  4GPM A;  3CVU A;  4IUL A;  1TNB A;  4FU3 A;  2GGF A;  3T9K A;  4QQI A;  2I6H A;  4A1G A;  4LSZ E;  4C0E A;  5B1A E;  1AP7 A;  3ZYL A;  4HRM B;  4J8D A;  3TXN A;  3ISM C;  4GB9 A;  4TXR A;  4ZHB A;  3UIP C;  3ZYK A;  1TEZ A;  2H6G A;  4JB8 P;  2XCC A;  2DYR E;  3DEP A;  4JD2 G;  4JA9 A;  5BT1 A;  2IO3 C;  3PZ4 A;  3FU3 A;  2VGX B;  3QDN A;  3CVN A;  4I1M A;  3ONL A;  4M7C A;  3P1U A;  3UM3 A;  3NOC D;  3RO2 A;  2X6K A;  2F0Y A;  4BTA A;  3CHQ A;  5D66 A;  3ENE A;  1BLX B;  3CKC A;  3ML8 A;  4AVX A;  3G2S A;  5CER B;  3MEK A;  3MYV A;  3ZXS A;  4UI9 C;  4N5C A;  5ANR A;  2IO2 C;  3AS8 A;  4J8S A;  3SHF A;  1OWO A;  1H19 A;  3HG0 D;  4RQI A;  2WMO A;  5J08 A;  4TRQ A;  2BKK B;  2AXU A;  5T3R A;  2RFM A;  4DRX E;  4L1B A;  4A3T A;  3FH7 A;  2CHZ A;  3UT4 A;  3Q4A B;  5EX0 A;  3FEX A;  2XQ0 A;  2BTD A;  3GZS A;  3ULE G;  4GTP A;  5AQB A;  3LDZ A;  3PZD A;  2DZO A;  5EDS A;  5FIO A;  3FP3 A;  1KZP A;  1FT1 A;  3B7U X;  4DI3 A;  3LS8 A;  3MV2 B;  4J8E A;  4HXI A;  3IHY A;  1KLX A;  5C1D A;  3D9P A;  2NXP A;  4U8V D;  5EYL A;  3TWS A;  4DX1 A;  4J0U A;  5ARG A;  2GRN B;  3ZGQ A;  2P9S G;  4AOF A;  3URZ A;  4HI8 A;  4DX6 D;  3MKR A;  2J07 A;  3Q49 B;  4DK5 A;  4PS7 A;  3TL5 A;  3ULY A;  4JL0 A;  4BX9 A;  3T8K A;  4OAV B;  2CHX A;  5CEC B;  1ZB1 A;  4I1A A;  5D0O D;  5ENT D;  3MA5 A;  4RG6 A;  3FUI A;  2WXQ A;  4BSZ B;  4I1O B;  2KCL A;  1MX6 A;  2AXV A;  4GCN A;  4UWK A;  3C5R A;  4IYP A;  3L16 A;  2J08 A;  2Q7F A;  1Y6I A;  3DPY A;  5B3S E;  3AJI A;  3MZL B;  4I9E A;  2WXN A;  4F1S A;  4FHJ A;  2X6J A;  1TN6 A;  1W3B A;  2QFC A;  3Q73 A;  5CHE E;  3LPZ A;  4B94 A;  3LY8 A;  4U0Z A;  3ZW3 A;  4WWP A;  4ILG A;  3UT8 A;  1DNP A;  3FWV A;  4K5C A;  4WUY A;  3UMV A;  3NZU A;  1A5E A;  3MGB A;  4HB5 A;  3DWL G;  4HOU A;  1WAO 1;  3PZ3 A;  3G2W A;  2XEH A;  3U3W A;  4WNF A;  3ZXP A;  4KBQ A;  3CK8 A;  2UWJ G;  4A63 B;  3UKU G;  1QZ2 A;  2OVF A;  4EZJ A;  1OWN A;  5JJT A;  4BER A;  3ESL A;  2L6J A;  4GZ5 A;  4HRL A;  3JCK C;  5AJL A;  5D2M C;  4FAD A;  2KZT A;  4I6J A;  3JQ0 A;  1P5Q A;  1EPU A;  1MYO A;  4ANW A;  2P9I G;  3LVQ E;  3HXE A;  3R9M A;  5DBK A;  1H6O A;  1OCC E;  4GA2 A;  3HYM B;  3BU8 A;  1UN8 A;  2FF4 A;  3DST A;  4A55 A;  3KSL A;  4U0S A;  3ZN3 A;  3CSF A;  3KEZ A;  2L0T B;  2AJA A;  2HE0 A;  3CVX A;  2GRR B;  4AY5 A;  1HU3 A;  3PZ2 A;  3DSX A;  3ZPJ A;  3FU6 A;  5KJL A;  1U3D A;  5AAO A;  2XGO A;  1Z6T A;  3PNL B;  3OXL A;  3S7D A;  4IN3 B;  1K8K G;  5FJY A;  4AIF A;  3FUM A;  3RSE G;  2XEN A;  2LSV A;  3JXJ A;  2A5E A;  3BEE A;  2EIM E;  4HS2 A;  1E96 B;  2P58 C;  5T4Y A;  2R02 A;  3PEU B;  5FZS A;  2PL2 A;  1MHQ A;  4GYY A;  1NL4 A;  4I9C A;  1ELR A;  1DVP A;  4HOQ A;  1K1B A;  3TWV A;  5CMW A;  2P9K G;  5CCL A;  4AP2 A;  2AWI A;  3ZU7 B;  3AG2 E;  2WXL A;  5BV1 A;  1XGW A;  3FTW A;  4MLP A;  3QAR A;  1OXJ A;  3SO8 A;  1H2V C;  5IY5 E;  3ABK E;  3C98 A;  4N2Q A;  3AG3 E;  2F8X K;  3MKQ B;  5JMN D;  2KM4 A;  2VYI A;  5LX8 A;  4UWG A;  3HDX A;  2X38 A;  3Q47 B;  4CDN A;  5KCM A;  3JUI A;  1HFA A;  2IFU A;  3I3N A;  1SA4 A;  4YVO A;  3ULQ A;  2OEV A;  4R7L A;  2UY1 B;  1E8Z A;  5EX3 A;  5EN5 D;  3PVL A;  3RRN B;  3LY9 A;  4Y6W A;  3UKR G;  4HVB A;  1N0Q A;  3RK6 A;  4UUC A;  4WNE A;  3ZUV B;  4FUL A;  4KVO A;  1PY1 A;  3AS4 A;  3QB2 A;  2P9N G;  3CIA A;  2YNQ A;  5HRY A;  1X5B A;  3ASH A;  4HFG A;  3DXM G;  3SQV A;  4LER A;  1E90 A;  4DX2 A;  4KVM A;  5T8I A;  3E37 A;  3HVE B;  4YVQ C;  3C72 A;  3SI5 A;  4BET A;  1FPP A;  3HXD A;  4TXQ A;  3CLJ A;  4L7T A;  3L6A A;  3KSQ A;  2ZU6 B;  2R5S A;  4F3V A;  4G23 A;  3ZEF A;  5ENQ D;  3RAU A;  1O1S A;  3FUJ A;  2HR2 A;  2R05 A;  3APF A;  3L9T A;  1H2T C;  2WXF A;  4B8C B;  4KZC A;  4F53 A;  4GTM A;  3LXU X;  1K1A A;  2PM6 A;  2JAB A;  3CGH A;  2X6H A;  3HXF A;  3U9W A;  1YYH A;  5CBO A;  4N3B A;  1YMP A;  3O48 A;  4I17 A;  2ETA A;  2Y4T A;  2VTB A;  1OWM A;  2YIN A;  4GPK A;  4MKT A;  3TWQ A;  4V3I A;  4JPS A;  3ZHE B;  3SBS A;  3HXB A;  1HS6 A;  3PRE A;  5AJD A;  5G04 C;  4LEU A;  2LXM A;  4ANX A;  3FU0 A;  4GCO A;  1TN7 A;  1H2U A;  3TG5 A;  3U4T A;  1MX4 A;  3ONK A;  1KT1 A;  2VSN A;  4YDE A;  5ENR D;  3ZYQ A;  4LCT A;  4BSX A;  3F6Q A;  3FU5 A;  3RRM B;  3CR3 A;  2WXM A;  2FO7 A;  3UTM A;  2I9C A;  2PQN A;  3DPD A;  2ION A;  2WXJ A;  4C0M A;  2XS8 A;  3UM0 A;  3EU5 A;  1H0A A;  2XZT G;  1IKN D;  1IQU A;  2BED A;  1ZU2 A;  3IBE A;  3FY4 A;  4ANU A;  1HX8 A;  4HBD A;  2ETB A;  3CVP A;  3BG0 B;  4GYO A;  4I6E A;  4CT4 A;  2EIK E;  2P9P G;  3RU0 A;  2Y69 E;  4ACL A;  2R2L A;  2IF4 A;  4J8F A;  2ZGG A;  3PUK A;  2CHW A;  2YHE A;  3SFY A;  2XGM A;  1NZN A;  3J5Q B;  2XCB A;  3NZS A;  3NAW A;  3QWP A;  4EHM A;  3U64 A;  4F1P A;  2XPY A;  2GW1 A;  3LVR E;  4UWF A;  5KJK A;  3FH5 A;  2LSU A;  5E76 A;  3TWW A;  5AYW D;  2WXI A;  3SBT B;  3IXE A;  1S70 B;  4UWL A;  5G2N A;  1E7V A;  4OYS A;  2EQX A;  2J09 A;  1N54 A;  3IKO B;  4YDW A;  2NSZ A;  2VGE A;  4B89 A;  3Q75 A;  3L22 A;  2DYS E;  3MCX A;  5G05 J;  4DI4 A;  3VTX A;  5EYP F;  2X6I A;  4KMO A;  3DSU A;  3PS6 A;  1S64 A;  4N39 A;  4Y6C A;  2OCC E;  1VDY A;  4UQZ A;  5BXU A;  3CHO A;  5ENN A;  2XRZ A;  2ZIR A;  3VTY A;  3ESK A;  2ETC A;  1D8E A;  3HIZ A;  1HE8 A;  2V5Q C;  1NP7 A;  2DVW A;  4PDX A;  2LUH A;  4WWN A;  3PDN A;  1BPO A;  1HO8 A;  3ML9 A;  2WXK A;  3EHQ A;  1NA0 A;  3EJN A;  3EHM A;  4CGW A;  4N3C A;  5BPP A;  4AV7 A;  3B95 A;  5CMY A;  3E34 A;  1BI8 B;  2WMN A;  4G2V A;  2P2C P;  5J90 A;  4APF A;  4GU5 A;  2CG3 A;  4K0R A;  2J9Q A;  2FUL A;  4WAF A;  3QAQ A;  5FWQ A;  1O1R A;  2H6F A;  4EZL A;  3BG1 B;  3CVY A;  3C3Q A;  4OVV A;  1FVF A;  1XNF A;  2I1J A;  3L82 A;  5CED B;  2DWZ A;  3EU9 A;  4GZD A;  1HG5 A;  1N0R A;  4RG9 A;  2HM8 A;  3FHE A;  3MV3 B;  2XEV A;  3DBS A;  3Q78 A;  2HYZ A;  1OWL A;  4WNG A;  3D9H A;  4TUM A;  2MHK A;  2KC7 A;  4HOT A;  4AEZ C;  4GA1 A;  1OUV A;  4BX8 A;  2JEK A;  4U96 D;  5FQ8 A;  5KNG A;  3ABM E;  2H6I A;  1OWP A;  4CDR A;  1NI1 A;  4FJY A;  4UWH A;  3B7S A;  4G8L A;  2PQR A;  1WM5 A;  2XPZ A;  4BT9 A;  4HLE A;  2XZD G;  1L5J A;  4LG6 A;  5AN8 A;  3D9J A;  4HNA D;  4EEC A;  5D0Q D;  2Y4U A;  1D9S A;  4U0U A;  2WXP A;  2V8S E;  1OCO E;  3Q9U C;  4U07 A;  3T8M A;  5FZQ A;  1V54 E;  3TXM A;  4XI9 A;  3TG4 A;  1G3N B;  2I2O A; 
#chains in the Genus database with same CATH homology
 2V4H C;  4HQD A;  4HRL A;  1BD8 A;  1DCQ A;  4BSZ B;  3V2X A;  3B95 A;  4B93 B;  1BU9 A;  1BI8 B;  5ENO D;  2P2C P;  5ENQ D;  2ZGG A;  4CZ2 D;  1K3Z D;  4O1P A;  4YDY A;  4U95 D;  3J5P A;  3J5Q B;  1MX6 A;  4Z68 A;  5ITZ F;  2MYO A;  3C5R A;  4HRN A;  3TWT A;  2DZN A;  3HRA A;  5KBA A;  3HG0 D;  5AQ9 A;  4F1P A;  3SO8 A;  4NIK A;  1SVX A;  2B0O E;  2J8S D;  3TWW A;  1MYO A;  4K5B A;  5HKP A;  2F8X K;  2BKK B;  2L6B A;  3IXE A;  3EHR A;  1K1A A;  5JMN D;  3V2O A;  2JAB A;  1S70 B;  1MJ0 A;  3V30 A;  2RFM A;  3AJI A;  1YYH A;  1MX2 A;  3TWR A;  1WG0 A;  5ENS D;  2ZGD A;  5CBO A;  4GPM A;  4DRX E;  2XEE A;  1YMP A;  2Y1L E;  2NYJ A;  1YCS B;  5CED B;  2ETA A;  2DWZ A;  2PNN A;  1TR4 A;  4N5Q A;  1IXV A;  5AQA A;  3EU9 A;  5HS0 A;  3T9K A;  3W9F A;  1N0R A;  4YDW A;  3V31 A;  4QQI A;  1NFI E;  5CBN A;  2AJA A;  2QYJ A;  2VGE A;  4J8Y A;  4LSZ E;  3TWQ A;  5AQB A;  2HE0 A;  1AP7 A;  3ZKJ A;  3LJN A;  4GMR A;  4OAU C;  3DEO A;  2DZO A;  5EN5 D;  3TWU A;  4HRM B;  1UOH A;  5JA4 D;  2Y0B G;  5FIO A;  5EIL A;  1QYM A;  4QFV A;  4HI9 A;  4K5C A;  2KBX A;  1N0Q A;  3D9H A;  4J7W A;  4UUC A;  4TUM A;  3TWX A;  5EYP F;  5EID A;  1A5E A;  5FIN A;  1SW6 A;  3UI2 A;  5AAO A;  3ZUV B;  1MX4 A;  2BKG A;  3KEA A;  4ZHB A;  4U8Y D;  4JB8 P;  1DC2 A;  4CYM D;  4HB5 A;  3JUE A;  1BI7 B;  1N11 A;  2RFA A;  4U8V D;  5ENR D;  4U96 D;  3DEP A;  5EYL A;  5KNG A;  3TWS A;  4BES A;  4DX1 A;  4DX5 D;  4LNU D;  5BXU A;  4ZFH A;  5HRY A;  5AQ7 A;  2XEN A;  3F6Q A;  2QC9 A;  2F8Y A;  4C48 B;  3W9G A;  3Q9N C;  1IHB A;  3JXJ A;  3UTM A;  4BEP A;  2A5E A;  3NOG D;  4G8L A;  3UXG A;  3JXI A;  2XEH A;  5KNH D;  1OY3 D;  2ETC A;  3B7B A;  5AAR A;  4HI8 A;  4DX7 D;  4RLY A;  4DX6 D;  2F37 A;  4DX2 A;  2XZD G;  3NOC D;  4ATZ D;  4LG6 A;  5AN8 A;  2V5Q C;  5KWD A;  4A63 B;  2XZT G;  4G8K A;  4HNA D;  4BET A;  3ZNG A;  2DVW A;  2KXP C;  3AAA C;  3V79 K;  1D9S A;  2FO1 E;  5BXO A;  1IKN D;  4O1O A;  4K5A B;  5D66 A;  1OT8 A;  5CEA A;  1BLX B;  1WDY A;  3Q9U C;  5ENP D;  3T8K A;  4O60 A;  1AWC B;  4OAV B;  5CEC B;  4DUI A;  1K1B A;  3EHQ A;  3TWV A;  4BER A;  5ENT D;  4F6R D;  3ZU7 B;  5CER B;  5EIB E;  1G3N B;  4HBD A;  3NBN B;  4HLL A;  2ETB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...