5FIOA

Darpins as a new tool for experimental phasing in protein crystallography
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
160
structure length
160
Chain Sequence
b'GSDLGRKLLEAARAGQDDECRILMANGADVNAADNTGTTPLHLAAYSGHLEIVECLLKHGADVDASDVFGYTPLHLAAYWGHLEIVEVLLKNGADVNAMDSDGMTPLHLAAKWGYLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKAAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NI3C DARPIN MUTANT5 HG-SITE N1
publication title Darpins as a New Tool for Experimental Phasing in Protein Crystallography
rcsb
source organism Synthetic construct
molecule tags Metal binding protein
total genus 53
structure length 160
sequence length 160
ec nomenclature
pdb deposition date 2015-09-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5fioA00
1MX2A 4BERA 5KNGA 2HE0A 2J8SD 4BSZB 3T9KA 1K3ZD 1D9SA 3Q9UC 1SW6A 5HKPA 3V30A 4U96D 3ZUVB 4DX5D 4TUMA 1G3NB 3HG0D 3JXJA 4YDWA 5EYPF 4HI8A 1N0QA 1S70B 4HBDA 5FINA 5JMND 3SO8A 4BESA 4DX1A 5ENTD 2DVWA 1BD8A 2F8YA 4HRMB 1BU9A 4K5CA 3NOGD 5ENPD 1MX6A 2PNNA 2KBXA 3JXIA 4YDYA 4CZ2D 5EILA 3B7BA 4GMRA 3ZKJA 4O60A 5EIBE 4RLYA 2V5QC 1IHBA 4UUCA 5ENQD 2P2CP 1BI7B 1N11A 4U95D 2F8XK 2ETBA 1N0RA 1DCQA 4HRNA 4DUIA 4OAUC 3EHRA 2ETCA 3DEOA 4U8VD 2RFAA 4F6RD 5CEAA 5CECB 3TWUA 1NFIE 2V4HC 3KEAA 1DC2A 3TWSA 3B95A 4BETA 4G8LA 4DX2A 1IXVA 1IKND 5JA4D 5KWDA 3W9GA 3NBNB 3UI2A 4Z68A 5ENRD 4J7WA 2KXPC 3J5QB 3DEPA 4NIKA 5CBOA 3TWVA 1OY3D 1UOHA 2JABA 4QQIA 5EIDA 4F1PA 1TR4A 4LG6A 3TWRA 3V2XA 4K5BA 5HS0A 1BI8B 3NOCD 2XZDG 3UXGA 1MYOA 2A5EA 4ZHBA 3D9HA 1OT8A 2XZTG 2DZOA 1WG0A 2DWZA 2QYJA 5AAOA 4O1OA 3AJIA 5AQ9A 2AJAA 5ITZF 3ZU7B 2ETAA 4J8YA 3W9FA 4ATZD 2F37A 2Y1LE 4CYMD 1K1AA 5ENOD 3TWXA 3EU9A 4BEPA 5EYLA 1K1BA 2BKGA 2RFMA 4GPMA 4U8YD 4B93B 2BKKB 3ZNGA 5EN5D 3JUEA 1SVXA 3HRAA 5KNHD 1YMPA 4K5AB 2XENA 3C5RA 4C48B 2FO1E 5KBAA 5CEDB 3Q9NC 4LNUD 5ENSD 2NYJA 5AARA 4JB8P 3V31A 3EHQA 1QYMA 2XEHA 3T8KA 1BLXB 2QC9A 4LSZE 1MX4A 5AQAA 4DX7D 5AQ7A 5CBNA 4DX6D 1WDYA 4HB5A 5BXUA 4HLLA 2DZNA 5AN8A 4HNAD 1AP7A 2B0OE 1YYHA 5FIOA 3TWQA 3IXEA 4G8KA 2ZGDA 5D66A 4OAVB 4HQDA 1AWCB 3LJNA 4QFVA 1MJ0A 4O1PA 3F6QA 3V2OA 5BXOA 4HI9A 4DRXE 5AQBA 5HRYA 1A5EA 2L6BA 2VGEA 3AAAC 3J5PA 3V79K 2ZGGA 4ZFHA 2Y0BG 3UTMA 4N5QA 2XEEA 3TWTA 5CERB 1YCSB 4HRLA 4A63B 3TWWA 2MYOA
chains in the Genus database with same CATH superfamily
3PZ4A 3T9KA 4WUYA 1D9SA 2RKKA 4BX9A 3UX4A 4B8AA 3ASFA 2XGOA 4FLBA 5G04C 4PS8A 1X81A 1H6PA 3NOGD 5A23A 2PNNA 4YDYA 5CCLA 3ZKJA 2B6CA 1BI7B 2R03A 2LUHA 5FQ6A 2OEVA 3IHVA 3L08A 4N2SA 1NFIE 1H6KA 1IXVA 2L9BA 3U64A 2KATA 1NP7A 4NIKA 4LERA 1E8YA 3VLDA 2Y69E 2Q7FA 2AJAA 3EDTB 4ATZD 3QJZA 1KPSB 2R5SA 4GTPA 4Q94A 3Q78A 3B7UX 4WNDA 5ARGA 1HE8A 2IOLA 1QYMA 3BUAA 3T8KA 5ENNA 2OOEA 3FTZA 3CVQA 4PS3A 4EQFA 3FH8A 4UWLA 2VSXE 3IXEA 3D3MA 3ZN3A 4UWKA 1XGWA 5EDSA 2AVPA 4URKA 2XPIA 2Y0BG 2ILRA 4L9PA 1E8WA 3UPVA 4B0ZA 5CERB 3G2UA 3BG0B 4A63B 4J8DA 3EIJA 4FU3A 2WB2A 3UMVA 3ZIMA 2E2EA 1A17A 4BTBA 5JMND 4BESA 4U0UA 4GTTA 1BD8A 1BU9A 3KEZA 4U0ZA 3Q4AB 4B94A 4ANXA 3B7BA 4ILIA 2LAIA 3NZUA 5CMWA 3QB2A 3Q79A 1XNFA 2ETBA 1DVPA 3IBEA 3QWPA 4MRUA 5T3RA 3UM1A 1UJKA 3EUVA 3DEPA 2HO1A 2P9IG 2YINA 3D9HA 2XZTG 2QYJA 1EF1C 2LXLA 4BWRA 3L54A 2CHZA 2WXJA 3QDNA 4G24A 4LSZE 2XGSA 4WWPA 2J07A 3ZXPA 4DI4A 5FQ7A 3F6QA 1Y6IA 4CDRA 3ML9A 2XEEA 3OTNA 3TWWA 5JJTA 4RG9A 2KCLA 2GRRB 3Q9UC 5HKPA 2XS1A 1UN9A 1G3NB 1ZB1A 5H7PA 5D0OD 4Y6CA 2X6HA 3CVXA 4CEMA 5G04J 2A5UA 4JZYA 2A4ZA 2P2CP 2RG8A 4HRNA 1TN6A 1N4SA 3L6AA 4NACA 4KXKB 3CLJA 4IULA 3U66A 3W9GA 5AENA 1NA0A 3QARA 1JCSA 1QQEA 4APFA 4QQIA 5EIDA 3ASNE 3MGBA 4C9BB 1MYOA 3HXFA 3PH0C 4KZ0A 4I6EA 3W9FA 3URZA 1KZOA 4BEPA 4FHJA 3ZNGA 3HRAA 5KNHD 4U7EB 4OVVA 4U0SA 4DK5A 3I3NA 4JA9A 1DCEA 3ZGQA 3FUFA 3CVNA 1HO8A 1VDYA 2VSYA 2XCCA 3MEKA 1JWGA 2AXUA 2ZISA 3MKRA 4HNAD 2B0OE 3MA5A 3LY7A 3VTXA 1AWCB 1WAO1 3JUIA 2VGEA 1K8KG 3HVEB 4GTMA 3FUMA 2VGXA 3OAWA 4BERA 3SNXA 2J8SD 3ASHA 4BX8A 5DIZA 3JXJA 4ANVA 1FVFA 4HI8A 3HXEA 5A7DB 2XPYA 4JEUA 4CZ2D 3PNTB 2ONDA 2KZTA 3L13A 4WWNA 5CRVA 4CDNA 2IF4A 3UUXA 1H0AA 3PE3A 3C98A 3KEAA 3TWSA 4FA6A 2WQ6A 4YDOA 3AS8A 4GA1A 4Z68A 5ENRD 3ZYKA 2MHKA 1TNOA 4OYSA 4JHRA 3L17A 3Q73A 4BTAA 4BFRA 2XZDG 3S7FA 4ZHBA 4R7LA 5AYWD 5BT1A 1U2VG 1UN8A 5KJNA 3NQPA 3VLFA 2PM6A 4B93B 2OV8A 2YNQA 5CCMA 4LEUA 3PEVB 1DNPA 4U04A 3ZVVA 1SZ9A 4WNFA 2FO7A 3TG4A 2WXOA 3CVPA 5JJ7A 3NF1A 5BV0A 3ABLE 2GRLA 3CK9A 3GZSA 3ZYQA 4GYOA 1IQRA 2P9KG 1O1RA 2IOSA 3E34A 3PZDA 3EJNA 4DRXE 1E7VA 3RO2A 3AAAC 3V79K 2LAHA 2C0MA 3B7TA 3TWTA 4I43A 1MX2A 2HE0A 3KSQA 2GRQB 2IONA 3ZRHA 1PAQA 4UWFA 3GW4A 4XI0A 4GA0A 4ILGA 4UWGA 3RU0A 2XCBA 3PZ2A 3CVLA 4O60A 3UT4A 4E85A 2EINE 4ILHB 2P58C 2V5FA 2R05A 2V4HC 3Q75A 4N5CA 4LUNU 1E96B 4HLEA 3R7QA 3J5QB 3ML8A 2X3MA 2L6JA 2NSZA 3MKQA 3QOUA 2CFUA 2KC7A 3FTXA 3NOCD 1ZU2A 3TAXA 4JEHA 4UWHA 4YVOA 2HM8A 3AG3E 1OXJA 2IJGX 3PRZA 4L23A 2IFUA 5ANRA 3ZU7B 2FEZA 2F37A 3CQGB 3ULYA 3TWXA 1JUQA 4LCTA 4J6IA 3FU0A 2P9UG 4GYYA 3BEEA 1FT1A 1NI1A 2NYJA 4AV7A 3R7RA 2QC9A 3ASDA 3Q7AA 2DIWA 4BSXA 2WQHA 3B7SA 1IQUA 1FPPA 5D66A 1QZ2A 4ACLA 4HI9A 5HRYA 2XHEA 2WXIA 5D0QD 4H7YA 1YCSB 4APOA 4E6HA 3LVQE 3DSXA 1Q2ZA 4XKCA 3CK7A 4TUMA 1INZA 3G2TA 4NRHB 3I4GA 3PUKA 4PS7A 2HR2A 4K0RA 5ENQD 4GA2A 1N11A 2P9PG 1JPLA 4GCNA 5CECB 3TJPA 3ZYMA 3PEUB 3B95A 2R02A 5EKQD 4AEZC 3RRMB 3C72A 3SQVA 2X38A 3HHMA 4K03A 4FHKA 4K5BA 3DBSA 3TG5A 5JHAA 5B1AE 3CVYA 4UI9K 4ATGA 1V55E 3SD5A 3L9TA 3LDZA 2UY1A 2BF0X 4AIFA 5CEDB 4CGWA 5J90A 4HB5A 4HLLA 5FWQA 4FJYA 2Y4UA 3LJNA 5BV1A 5LOZA 4L2YA 4N3BA 3SFYA 3SBSA 1Z6TA 3ZEFA 2DBAA 1B89A 4WWOA 4ANUA 5KNGA 3Q49B 4U8HA 5J08A 3SBTB 3V30A 4D10C 4HXIA 2FULA 2IO3C 4F1SA 4GZ6A 4PUCA 2R17C 5ENPD 3TL5A 3FTWA 1IHBA 2GRPB 4ABNA 4EZLA 1TNYA 2F8XK 1LTXA 1KT1A 1NZNA 3T5VA 1L5JA 1ZBPA 3TWUA 4B8CB 4I6JA 3ENEA 5KWDA 2PQRA 3RO3A 2VTBA 4J8EA 2CHWA 4F1PA 1TR4A 3UXGA 1N4RA 4UI9C 1KT0A 4PH4B 1E8XA 4CYMD 5ENOD 4J8SA 3EU9A 1K1BA 3DSTA 4GPMA 3JUEA 1HZ4A 1QBQA 4K5AB 2XENA 1OUVA 3WXXA 3Q9NC 1D8EA 4JB8P 4I2WA 2GW1A 1WDYA 4W9RA 1OWNA 4NQ0A 2HYZA 3LXUX 3FU6A 4GZDA 1N94A 3CR3A 1TNBA 4O1PA 1BPOA 3L82A 4LNGA 3OXGA 2CG2A 5CHEE 5FZQA 2WM9A 4GCOA 4Q96A 4TV3A 2VQ2A 5JJ6A 1K3ZD 4Y6WA 2H6HA 5FQ8A 2ZIRA 3FTVA 3E30A 3DSVA 1OCOE 3FU3A 2I1JA 5EILA 4RLYA 2V5QC 3I4RB 3PZ1A 3DRAA 3RSEG 3UT8A 2ZXWE 3SF4A 1FT2A 3LYAA 2V0PA 4TXQA 2IQCA 3ASGA 3UIOC 3AG2E 2M63A 3FUEA 3KS2A 1O5MA 3TWRA 5HS0A 2KM4A 3DSSA 4FULA 4GZ5A 1HS6A 2DWZA 3E33A 5AQ9A 4J8YA 2WXNA 4XX5A 2Y1LE 3MV2B 3SFXA 5EYLA 4U8YD 3U4TA 5EN5D 1SVXA 3X2QE 4G25A 1YMPA 4F3VA 3C5RA 2OVFA 5B1BE 3OXFA 4LNUD 3V31A 3CKBA 5BXUA 3MZLB 2J4DA 4G8KA 4UQYA 2ZGDA 3FH5A 3FTUA 4GAAA 4TXPA 4HVBA 1H2VC 4WAFA 3S7BA 5AQBA 2L6BA 2PZIA 3TGOA 1GW6A 3HXCA 2WXKA 4GTOA 5T4YA 5T8IA 4KYOB 2WXRA 1SW6A 4U63A 3T5XA 3LY8A 3ZYLA 1S64A 3ABME 4WNEA 1S70B 4HBDA 4N39A 3CVUA 3LPZA 1W3BA 4K5CA 4A1SA 1HG2A 4GMRA 2LO6A 2V4LA 5M72A 3CVWA 5AJLA 3CHQA 3DEOA 4U07A 3NZSA 1N4QA 2J08A 5JA4D 2IU1A 2KXPC 4KMOA 4RSYA 2WXMA 3CSFA 1X5BA 1H19A 3PZ3A 3ASOE 4BT8A 3UM3A 2XEVA 3UM0A 3HDXA 2BKKB 4XKBA 1TYQG 1LD8A 4UI9J 4HORA 1N9AA 5KBAA 1OWPA 3VTYA 1H2TC 3IHYA 4CT0A 1PC2A 3K9IA 5ENSD 1Z3XA 4DX7D 3L22A 3GZ2A 3RAUA 4DX6D 1N95A 5FQ4A 1Z5SC 4QFVA 4KZCA 1HU3A 4O6FA 2ZU6B 5LX8A 4G11A 3FTSA 4N5QA 4DJAA 3UM2A 3IV0A 5FTPA 3FUDA 3BU8A 3LCAA 4GZCA 4DLQA 3ZUVB 3TXNA 4A3VA 3FFLA 2AXVA 2OCCE 3UKUG 3IEGA 1S63A 3ISMC 4EZJA 3FP3A 5EIBE 3O4ZA 4MBGA 4CDMA 2GGFA 3FUNA 3ZHEB 3QNKA 4U95D 1SA5A 1N0RA 5KJKA 2J4BA 4OAUC 2X6JA 4HFGA 4I1MA 3CKCA 1H2UA 2E0IA 2R59A 2KCKA 5LFAA 2LXMA 2L0TB 3DPDA 3CV0A 3HXBA 3DSUA 3DSWA 3PVLA 2KCVA 4HOUA 1LF8A 3RJVA 2WMOA 4N3CA 3MX3A 2JLBA 3SZ7A 5KJLA 1P5QA 4KT6B 2DZNA 5LCWJ 5FJYA 3AS5A 3NAWA 5BXOA 1A5EA 2VSOE 2Y3AA 2ZGGA 2AWIA 5LP0A 4WNGA 3MV3B 1AP7A 3C3OA 4BSZB 3CHOA 3T8MA 3ESLA 4P29A 4JHJA 2EIKE 3HG0D 3DXKG 1PY1A 2DVWA 3HVEA 2WXHA 1MX6A 2VJ8A 2F0YA 4H7XA 2IO2C 2GRMA 3R9AB 1DCQA 3APDA 1U3DA 4CCAA 3KSLA 4XEIG 5CEAA 4MS6A 3EU5A 1DC2A 3FDHA 3MJWA 4GMJA 4AY5A 1EYHA 1IYGA 3G2VA 3AG1E 3GZ1A 2C2LA 3FUKA 2NC9A 5HQ8A 1KLXA 4DI3A 2QZAA 3QWVA 4CT4A 3FWVA 3U3WA 4L1BA 3IKOB 4UQZA 1EDUA 2GROB 3CGHA 3MCXA 5IY5E 3WG7E 2NXPA 2OVBA 3QWWA 4MLPA 2GRNB 1UG3A 3E4BA 1BLXB 2CFZA 4I1AA 5JHBA 4KBQA 2UWJG 4GPKA 1FVHA 3GYZA 1H6OA 3UT7A 4BY6A 3JYSA 4GB9A 3LEWA 5E76A 3S7DA 1MJ0A 3DWLG 4TRQA 1S0PA 3J5PA 3UKRG 3EIQC 4ZFHA 3HYMB 2V8SE 3D9JA 3PNLB 1OWOA 3ABKE 2XQ0A 2BUGA 1SA4A 5FZSA 5BNWA 5ENTD 3ZHEA 3LKUA 1YA0A 4JW1A 3D9MA 4TUUA 4M7CA 2CHXA 2OEWA 4GTRA 4JVSA 4GTVA 3UIPC 4YNDA 1EPUA 3SY2A 4FADA 4HOTA 3SHFA 3Q7FA 5E75A 4AJWA 2XRZA 5CMYA 5BUZA 1N52A 2EIJE 4RQIA 2AW6A 5G55A 4JC8A 2A5EA 1JCRA 5G2NA 1HG5A 4ME2A 2EQXA 3AJIA 3P1UA 3AU4A 3RRUA 4B89A 4C48B 2FO1E 4ACKA 3FUHA 1OCZE 2VSNA 4GU5A 4G26A 5AQ7A 3UINC 3L16A 2VGXB 1YYHA 1Z3YA 2XPZA 2XGMA 3CIAA 4GMLA 2WXGA 3UQ3A 4N3AA 4V3IA 1O1TA 1RW2A 3FHEA 2H6FA 3UTMA 4HRLA 4I17A 1RZ4A 4FLHA 2KZTB 4U96D 1U3CA 2Y4TA 4DLOA 3C3RA 3FTYA 2LSVA 2WXFA 4JA7A 2I6HA 2F8YA 1V54E 3JXIA 2KBXA 2PM7A 4AVXA 1KZPA 2J09A 4CGVA 3QC1A 3D9OA 3CEQA 3CHSA 3RRNB 3DXMG 2YHEA 2L0IA 4JL0A 4AOFA 1N4PA 5C1DA 3D9LA 4BETA 4EECA 2AXZA 2VGYA 4DX2A 3ESKA 2QFCA 3R9MA 3TWVA 3JQ1A 1UOHA 3CK8A 4G2VA 3D9PA 4XI9A 3V2XA 1ELWA 1D8DA 3CHPA 5AAOA 4O1OA 2I1KA 4G1TA 5AJDA 3SFZA 1UW4B 3PE4A 5B3SE 4GTSA 4I9CA 4I2ZA 1OWMA 4G23A 4RVBA 4C0MA 4GYWA 1MQSA 3O48A 3QKYA 4Q69A 1MZCA 5AQAA 2LNIA 3E32A 4YVQC 4A55A 5CRUA 3TXMA 3D9IA 3V2OA 4IYPA 3CHMA 4XIFA 5G05C 1NL4A 4UQXA 3DPYA 4A1GA 4I9EA 3ONLA 2FBNA 4NURA 3EHNA 3SGHA 5LCWC 2WMNA 2LSUA 1OWLA 4KVOA 5FT9A 3NB2A 1E90A 4IRUA 3VLEA 4EBAG 5AIJA 4J0UA 1N0QA 5FINA 3SO8A 2WXPA 3KAEA 5BPPA 3LY9A 2IY0C 2XS8A 1OCCE 4UUCA 2BTDA 3U9WA 5EX3A 3JCKC 1O1SA 3BG1B 3EHRA 2ETCA 4EPZA 3MKQB 4F6RD 4JHKA 2DYRE 3AU5A 4IN3B 1WY6A 4J7WA 5CBOA 4AXHA 1NA3A 3HXDA 5FZRA 3ZPJA 3QAQA 4LG6A 2QYUA 2X6FA 5D2MC 2IEJA 2CG3A 4HS2A 2PQNA 4JXTA 3FU5A 3PREA 2J49A 5KJMA 5ARFA 2DCPA 3ULQA 3EHQA 1E7UA 4XZ4A 2WVIA 5AN8A 2YHCA 3FH7A 2X6KA 5FIOA 3TWQA 3CHRA 4OAVB 5BW8C 4A3TA 2H6GA 4EHMA 4MKTA 3AG4E 2C0LA 2MYOA 4L2LA 4GZ3A 1E8ZA 4DPRA 3G2SA 4DX5D 3C3QA 4YDWA 4I6GA 5EYPF 2EIME 1HH8A 5C2YA 2I9CA 2YQ8A 3CVVA 1HF8A 3APCA 3LVRE 3MYVA 2R2LA 2I2OA 3PDNA 1TJCA 3RK6A 3FEYA 2BEDA 4U8VD 3JQ0A 5KCMA 3RIBA 2EILE 2FI7A 1MHQA 1TN8A 3NBNB 3UI2A 1JCQA 4FC8A 1WM5A 3HIZA 2UY1B 2J9QA 2WQ7A 1OY3D 2JABA 3APFA 3Q15A 4JD2G 3D9NA 2QY7A 1BI8B 1SQMA 2WXLA 4F7AA 1WG0A 3ZXSA 4LRZA 4AP2A 4FP7A 5ITZF 1OCRE 2H6IA 4ANWA 2P9SG 3Q47B 1TN7A 2MOWA 2XRYA 2P9LG 3B13A 4YDEA 1TJFA 4HOQA 3PS6A 2XEHA 2PL2A 4TXRA 4F53A 4JPSA 1MX4A 4EBAA 3FUJA 5CBNA 1UJJA 4EZKA 1JWFA 3G2WA 5EX0A 3FULA 3ONKA 3LS8A 3B7RL 4C0EA 4HOSA 3FEXA 5ANLA 4XE0A 3AS4A 2WPVA 3CQCB 1LD7A 1ELKA 5G05J 1QNFA 2WXQA 3CSTA 4DX1A 2FF4A 4RG6A 1TEZA 4HRMB 1N54A 4N2QA 4I1OB 1HFAA 2X6IA 3PUJA 4J8FA 3QK0A 1HXIA 3BQOA 4DUIA 2VTBB 4LNBA 3ZFWA 3ULEG 2RFAA 4PDXA 3RKVA 5DBKA 3I5PA 4G8LA 1FCHA 3Q5MA 4AY6A 1IKND 3S2AA 1ELRA 5HI7A 4M3OA 3KD7A 3SI5A 3P2BA 3D9KA 4AM9A 4GTQA 2RD0A 3E37A 3N71A 1OT8A 2DZOA 3EHMA 4FJZA 2DYSE 2ETAA 1K1AA 1Y8MA 4OVUA 3FUIA 2BKGA 2RFMA 4X8QA 3OXLA 1IHGA 3ZW3A 4L7TA 3LJ3A 5AARA 2JEKA 3S7JA 2P9NG 5A6CA 1SZAA 1TNUA 1TNZA 3FY4A 4HQDA 2MRIA 4CRWA 2VYIA 4KVMA 1HX8A 4BT9A
chains in the Genus database with same CATH topology
1MX2A 4BERA 5KNGA 2HE0A 2J8SD 4BSZB 3T9KA 1K3ZD 1D9SA 3Q9UC 1SW6A 5HKPA 3V30A 4U96D 3ZUVB 4DX5D 4TUMA 1G3NB 3HG0D 3JXJA 4YDWA 5EYPF 4HI8A 1N0QA 1S70B 4HBDA 5FINA 5JMND 3SO8A 4BESA 4DX1A 5ENTD 2DVWA 1BD8A 2F8YA 4HRMB 1BU9A 4K5CA 3NOGD 5ENPD 1MX6A 2PNNA 2KBXA 3JXIA 4YDYA 4CZ2D 5EILA 3B7BA 4GMRA 3ZKJA 4O60A 5EIBE 4RLYA 2V5QC 1IHBA 4UUCA 5ENQD 2P2CP 1BI7B 1N11A 4U95D 2F8XK 2ETBA 1N0RA 1DCQA 4HRNA 4DUIA 4OAUC 3EHRA 2ETCA 3DEOA 4U8VD 2RFAA 4F6RD 5CEAA 5CECB 3TWUA 1NFIE 2V4HC 3KEAA 1DC2A 3TWSA 3B95A 4BETA 4G8LA 4DX2A 1IXVA 1IKND 5JA4D 5KWDA 3W9GA 3NBNB 3UI2A 4Z68A 5ENRD 4J7WA 2KXPC 3J5QB 3DEPA 4NIKA 5CBOA 3TWVA 1OY3D 1UOHA 2JABA 4QQIA 5EIDA 4F1PA 1TR4A 4LG6A 3TWRA 3V2XA 4K5BA 5HS0A 1BI8B 3NOCD 2XZDG 3UXGA 1MYOA 2A5EA 4ZHBA 3D9HA 1OT8A 2XZTG 2DZOA 1WG0A 2DWZA 2QYJA 5AAOA 4O1OA 3AJIA 5AQ9A 2AJAA 5ITZF 3ZU7B 2ETAA 4J8YA 3W9FA 4ATZD 2F37A 2Y1LE 4CYMD 1K1AA 5ENOD 3TWXA 3EU9A 4BEPA 5EYLA 1K1BA 2BKGA 2RFMA 4GPMA 4U8YD 4B93B 2BKKB 3ZNGA 5EN5D 3JUEA 1SVXA 3HRAA 5KNHD 1YMPA 4K5AB 2XENA 3C5RA 4C48B 2FO1E 5KBAA 5CEDB 3Q9NC 4LNUD 5ENSD 2NYJA 5AARA 4JB8P 3V31A 3EHQA 1QYMA 2XEHA 3T8KA 1BLXB 2QC9A 4LSZE 1MX4A 5AQAA 4DX7D 5AQ7A 5CBNA 4DX6D 1WDYA 4HB5A 5BXUA 4HLLA 2DZNA 5AN8A 4HNAD 1AP7A 2B0OE 1YYHA 5FIOA 3TWQA 3IXEA 4G8KA 2ZGDA 5D66A 4OAVB 4HQDA 1AWCB 3LJNA 4QFVA 1MJ0A 4O1PA 3F6QA 3V2OA 5BXOA 4HI9A 4DRXE 5AQBA 5HRYA 1A5EA 2L6BA 2VGEA 3AAAC 3J5PA 3V79K 2ZGGA 4ZFHA 2Y0BG 3UTMA 4N5QA 2XEEA 3TWTA 5CERB 1YCSB 4HRLA 4A63B 3TWWA 2MYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MX2 A;  4BER A;  5KNG A;  2HE0 A;  2J8S D;  4BSZ B;  3T9K A;  1K3Z D;  1D9S A;  3Q9U C;  1SW6 A;  5HKP A;  3V30 A;  4U96 D;  3ZUV B;  4DX5 D;  4TUM A;  1G3N B;  3HG0 D;  3JXJ A;  4YDW A;  5EYP F;  4HI8 A;  1N0Q A;  1S70 B;  4HBD A;  5FIN A;  5JMN D;  3SO8 A;  4BES A;  4DX1 A;  5ENT D;  2DVW A;  1BD8 A;  2F8Y A;  4HRM B;  1BU9 A;  4K5C A;  3NOG D;  5ENP D;  1MX6 A;  2PNN A;  2KBX A;  3JXI A;  4YDY A;  4CZ2 D;  5EIL A;  3B7B A;  4GMR A;  3ZKJ A;  4O60 A;  5EIB E;  4RLY A;  2V5Q C;  1IHB A;  4UUC A;  5ENQ D;  2P2C P;  1BI7 B;  1N11 A;  4U95 D;  2F8X K;  2ETB A;  1N0R A;  1DCQ A;  4HRN A;  4DUI A;  4OAU C;  3EHR A;  2ETC A;  3DEO A;  4U8V D;  2RFA A;  4F6R D;  5CEA A;  5CEC B;  3TWU A;  1NFI E;  2V4H C;  3KEA A;  1DC2 A;  3TWS A;  3B95 A;  4BET A;  4G8L A;  4DX2 A;  1IXV A;  1IKN D;  5JA4 D;  5KWD A;  3W9G A;  3NBN B;  3UI2 A;  4Z68 A;  5ENR D;  4J7W A;  2KXP C;  3J5Q B;  3DEP A;  4NIK A;  5CBO A;  3TWV A;  1OY3 D;  1UOH A;  2JAB A;  4QQI A;  5EID A;  4F1P A;  1TR4 A;  4LG6 A;  3TWR A;  3V2X A;  4K5B A;  5HS0 A;  1BI8 B;  3NOC D;  2XZD G;  3UXG A;  1MYO A;  2A5E A;  4ZHB A;  3D9H A;  1OT8 A;  2XZT G;  2DZO A;  1WG0 A;  2DWZ A;  2QYJ A;  5AAO A;  4O1O A;  3AJI A;  5AQ9 A;  2AJA A;  5ITZ F;  3ZU7 B;  2ETA A;  4J8Y A;  3W9F A;  4ATZ D;  2F37 A;  2Y1L E;  4CYM D;  1K1A A;  5ENO D;  3TWX A;  3EU9 A;  4BEP A;  5EYL A;  1K1B A;  2BKG A;  2RFM A;  4GPM A;  4U8Y D;  4B93 B;  2BKK B;  3ZNG A;  5EN5 D;  3JUE A;  1SVX A;  3HRA A;  5KNH D;  1YMP A;  4K5A B;  2XEN A;  3C5R A;  4C48 B;  2FO1 E;  5KBA A;  5CED B;  3Q9N C;  4LNU D;  5ENS D;  2NYJ A;  5AAR A;  4JB8 P;  3V31 A;  3EHQ A;  1QYM A;  2XEH A;  3T8K A;  1BLX B;  2QC9 A;  4LSZ E;  1MX4 A;  5AQA A;  4DX7 D;  5AQ7 A;  5CBN A;  4DX6 D;  1WDY A;  4HB5 A;  5BXU A;  4HLL A;  2DZN A;  5AN8 A;  4HNA D;  1AP7 A;  2B0O E;  1YYH A;  5FIO A;  3TWQ A;  3IXE A;  4G8K A;  2ZGD A;  5D66 A;  4OAV B;  4HQD A;  1AWC B;  3LJN A;  4QFV A;  1MJ0 A;  4O1P A;  3F6Q A;  3V2O A;  5BXO A;  4HI9 A;  4DRX E;  5AQB A;  5HRY A;  1A5E A;  2L6B A;  2VGE A;  3AAA C;  3J5P A;  3V79 K;  2ZGG A;  4ZFH A;  2Y0B G;  3UTM A;  4N5Q A;  2XEE A;  3TWT A;  5CER B;  1YCS B;  4HRL A;  4A63 B;  3TWW A;  2MYO A; 
#chains in the Genus database with same CATH topology
 3PZ4 A;  3T9K A;  4WUY A;  1D9S A;  2RKK A;  4BX9 A;  3UX4 A;  4B8A A;  3ASF A;  2XGO A;  4FLB A;  5G04 C;  4PS8 A;  1X81 A;  1H6P A;  3NOG D;  5A23 A;  2PNN A;  4YDY A;  5CCL A;  3ZKJ A;  2B6C A;  1BI7 B;  2R03 A;  2LUH A;  5FQ6 A;  2OEV A;  3IHV A;  3L08 A;  4N2S A;  1NFI E;  1H6K A;  1IXV A;  2L9B A;  3U64 A;  2KAT A;  1NP7 A;  4NIK A;  4LER A;  1E8Y A;  3VLD A;  2Y69 E;  2Q7F A;  2AJA A;  3EDT B;  4ATZ D;  3QJZ A;  1KPS B;  2R5S A;  4GTP A;  4Q94 A;  3Q78 A;  3B7U X;  4WND A;  5ARG A;  1HE8 A;  2IOL A;  1QYM A;  3BUA A;  3T8K A;  5ENN A;  2OOE A;  3FTZ A;  3CVQ A;  4PS3 A;  4EQF A;  3FH8 A;  4UWL A;  2VSX E;  3IXE A;  3D3M A;  3ZN3 A;  4UWK A;  1XGW A;  5EDS A;  2AVP A;  4URK A;  2XPI A;  2Y0B G;  2ILR A;  4L9P A;  1E8W A;  3UPV A;  4B0Z A;  5CER B;  3G2U A;  3BG0 B;  4A63 B;  4J8D A;  3EIJ A;  4FU3 A;  2WB2 A;  3UMV A;  3ZIM A;  2E2E A;  1A17 A;  4BTB A;  5JMN D;  4BES A;  4U0U A;  4GTT A;  1BD8 A;  1BU9 A;  3KEZ A;  4U0Z A;  3Q4A B;  4B94 A;  4ANX A;  3B7B A;  4ILI A;  2LAI A;  3NZU A;  5CMW A;  3QB2 A;  3Q79 A;  1XNF A;  2ETB A;  1DVP A;  3IBE A;  3QWP A;  4MRU A;  5T3R A;  3UM1 A;  1UJK A;  3EUV A;  3DEP A;  2HO1 A;  2P9I G;  2YIN A;  3D9H A;  2XZT G;  2QYJ A;  1EF1 C;  2LXL A;  4BWR A;  3L54 A;  2CHZ A;  2WXJ A;  3QDN A;  4G24 A;  4LSZ E;  2XGS A;  4WWP A;  2J07 A;  3ZXP A;  4DI4 A;  5FQ7 A;  3F6Q A;  1Y6I A;  4CDR A;  3ML9 A;  2XEE A;  3OTN A;  3TWW A;  5JJT A;  4RG9 A;  2KCL A;  2GRR B;  3Q9U C;  5HKP A;  2XS1 A;  1UN9 A;  1G3N B;  1ZB1 A;  5H7P A;  5D0O D;  4Y6C A;  2X6H A;  3CVX A;  4CEM A;  5G04 J;  2A5U A;  4JZY A;  2A4Z A;  2P2C P;  2RG8 A;  4HRN A;  1TN6 A;  1N4S A;  3L6A A;  4NAC A;  4KXK B;  3CLJ A;  4IUL A;  3U66 A;  3W9G A;  5AEN A;  1NA0 A;  3QAR A;  1JCS A;  1QQE A;  4APF A;  4QQI A;  5EID A;  3ASN E;  3MGB A;  4C9B B;  1MYO A;  3HXF A;  3PH0 C;  4KZ0 A;  4I6E A;  3W9F A;  3URZ A;  1KZO A;  4BEP A;  4FHJ A;  3ZNG A;  3HRA A;  5KNH D;  4U7E B;  4OVV A;  4U0S A;  4DK5 A;  3I3N A;  4JA9 A;  1DCE A;  3ZGQ A;  3FUF A;  3CVN A;  1HO8 A;  1VDY A;  2VSY A;  2XCC A;  3MEK A;  1JWG A;  2AXU A;  2ZIS A;  3MKR A;  4HNA D;  2B0O E;  3MA5 A;  3LY7 A;  3VTX A;  1AWC B;  1WAO 1;  3JUI A;  2VGE A;  1K8K G;  3HVE B;  4GTM A;  3FUM A;  2VGX A;  3OAW A;  4BER A;  3SNX A;  2J8S D;  3ASH A;  4BX8 A;  5DIZ A;  3JXJ A;  4ANV A;  1FVF A;  4HI8 A;  3HXE A;  5A7D B;  2XPY A;  4JEU A;  4CZ2 D;  3PNT B;  2OND A;  2KZT A;  3L13 A;  4WWN A;  5CRV A;  4CDN A;  2IF4 A;  3UUX A;  1H0A A;  3PE3 A;  3C98 A;  3KEA A;  3TWS A;  4FA6 A;  2WQ6 A;  4YDO A;  3AS8 A;  4GA1 A;  4Z68 A;  5ENR D;  3ZYK A;  2MHK A;  1TNO A;  4OYS A;  4JHR A;  3L17 A;  3Q73 A;  4BTA A;  4BFR A;  2XZD G;  3S7F A;  4ZHB A;  4R7L A;  5AYW D;  5BT1 A;  1U2V G;  1UN8 A;  5KJN A;  3NQP A;  3VLF A;  2PM6 A;  4B93 B;  2OV8 A;  2YNQ A;  5CCM A;  4LEU A;  3PEV B;  1DNP A;  4U04 A;  3ZVV A;  1SZ9 A;  4WNF A;  2FO7 A;  3TG4 A;  2WXO A;  3CVP A;  5JJ7 A;  3NF1 A;  5BV0 A;  3ABL E;  2GRL A;  3CK9 A;  3GZS A;  3ZYQ A;  4GYO A;  1IQR A;  2P9K G;  1O1R A;  2IOS A;  3E34 A;  3PZD A;  3EJN A;  4DRX E;  1E7V A;  3RO2 A;  3AAA C;  3V79 K;  2LAH A;  2C0M A;  3B7T A;  3TWT A;  4I43 A;  1MX2 A;  2HE0 A;  3KSQ A;  2GRQ B;  2ION A;  3ZRH A;  1PAQ A;  4UWF A;  3GW4 A;  4XI0 A;  4GA0 A;  4ILG A;  4UWG A;  3RU0 A;  2XCB A;  3PZ2 A;  3CVL A;  4O60 A;  3UT4 A;  4E85 A;  2EIN E;  4ILH B;  2P58 C;  2V5F A;  2R05 A;  2V4H C;  3Q75 A;  4N5C A;  4LUN U;  1E96 B;  4HLE A;  3R7Q A;  3J5Q B;  3ML8 A;  2X3M A;  2L6J A;  2NSZ A;  3MKQ A;  3QOU A;  2CFU A;  2KC7 A;  3FTX A;  3NOC D;  1ZU2 A;  3TAX A;  4JEH A;  4UWH A;  4YVO A;  2HM8 A;  3AG3 E;  1OXJ A;  2IJG X;  3PRZ A;  4L23 A;  2IFU A;  5ANR A;  3ZU7 B;  2FEZ A;  2F37 A;  3CQG B;  3ULY A;  3TWX A;  1JUQ A;  4LCT A;  4J6I A;  3FU0 A;  2P9U G;  4GYY A;  3BEE A;  1FT1 A;  1NI1 A;  2NYJ A;  4AV7 A;  3R7R A;  2QC9 A;  3ASD A;  3Q7A A;  2DIW A;  4BSX A;  2WQH A;  3B7S A;  1IQU A;  1FPP A;  5D66 A;  1QZ2 A;  4ACL A;  4HI9 A;  5HRY A;  2XHE A;  2WXI A;  5D0Q D;  4H7Y A;  1YCS B;  4APO A;  4E6H A;  3LVQ E;  3DSX A;  1Q2Z A;  4XKC A;  3CK7 A;  4TUM A;  1INZ A;  3G2T A;  4NRH B;  3I4G A;  3PUK A;  4PS7 A;  2HR2 A;  4K0R A;  5ENQ D;  4GA2 A;  1N11 A;  2P9P G;  1JPL A;  4GCN A;  5CEC B;  3TJP A;  3ZYM A;  3PEU B;  3B95 A;  2R02 A;  5EKQ D;  4AEZ C;  3RRM B;  3C72 A;  3SQV A;  2X38 A;  3HHM A;  4K03 A;  4FHK A;  4K5B A;  3DBS A;  3TG5 A;  5JHA A;  5B1A E;  3CVY A;  4UI9 K;  4ATG A;  1V55 E;  3SD5 A;  3L9T A;  3LDZ A;  2UY1 A;  2BF0 X;  4AIF A;  5CED B;  4CGW A;  5J90 A;  4HB5 A;  4HLL A;  5FWQ A;  4FJY A;  2Y4U A;  3LJN A;  5BV1 A;  5LOZ A;  4L2Y A;  4N3B A;  3SFY A;  3SBS A;  1Z6T A;  3ZEF A;  2DBA A;  1B89 A;  4WWO A;  4ANU A;  5KNG A;  3Q49 B;  4U8H A;  5J08 A;  3SBT B;  3V30 A;  4D10 C;  4HXI A;  2FUL A;  2IO3 C;  4F1S A;  4GZ6 A;  4PUC A;  2R17 C;  5ENP D;  3TL5 A;  3FTW A;  1IHB A;  2GRP B;  4ABN A;  4EZL A;  1TNY A;  2F8X K;  1LTX A;  1KT1 A;  1NZN A;  3T5V A;  1L5J A;  1ZBP A;  3TWU A;  4B8C B;  4I6J A;  3ENE A;  5KWD A;  2PQR A;  3RO3 A;  2VTB A;  4J8E A;  2CHW A;  4F1P A;  1TR4 A;  3UXG A;  1N4R A;  4UI9 C;  1KT0 A;  4PH4 B;  1E8X A;  4CYM D;  5ENO D;  4J8S A;  3EU9 A;  1K1B A;  3DST A;  4GPM A;  3JUE A;  1HZ4 A;  1QBQ A;  4K5A B;  2XEN A;  1OUV A;  3WXX A;  3Q9N C;  1D8E A;  4JB8 P;  4I2W A;  2GW1 A;  1WDY A;  4W9R A;  1OWN A;  4NQ0 A;  2HYZ A;  3LXU X;  3FU6 A;  4GZD A;  1N94 A;  3CR3 A;  1TNB A;  4O1P A;  1BPO A;  3L82 A;  4LNG A;  3OXG A;  2CG2 A;  5CHE E;  5FZQ A;  2WM9 A;  4GCO A;  4Q96 A;  4TV3 A;  2VQ2 A;  5JJ6 A;  1K3Z D;  4Y6W A;  2H6H A;  5FQ8 A;  2ZIR A;  3FTV A;  3E30 A;  3DSV A;  1OCO E;  3FU3 A;  2I1J A;  5EIL A;  4RLY A;  2V5Q C;  3I4R B;  3PZ1 A;  3DRA A;  3RSE G;  3UT8 A;  2ZXW E;  3SF4 A;  1FT2 A;  3LYA A;  2V0P A;  4TXQ A;  2IQC A;  3ASG A;  3UIO C;  3AG2 E;  2M63 A;  3FUE A;  3KS2 A;  1O5M A;  3TWR A;  5HS0 A;  2KM4 A;  3DSS A;  4FUL A;  4GZ5 A;  1HS6 A;  2DWZ A;  3E33 A;  5AQ9 A;  4J8Y A;  2WXN A;  4XX5 A;  2Y1L E;  3MV2 B;  3SFX A;  5EYL A;  4U8Y D;  3U4T A;  5EN5 D;  1SVX A;  3X2Q E;  4G25 A;  1YMP A;  4F3V A;  3C5R A;  2OVF A;  5B1B E;  3OXF A;  4LNU D;  3V31 A;  3CKB A;  5BXU A;  3MZL B;  2J4D A;  4G8K A;  4UQY A;  2ZGD A;  3FH5 A;  3FTU A;  4GAA A;  4TXP A;  4HVB A;  1H2V C;  4WAF A;  3S7B A;  5AQB A;  2L6B A;  2PZI A;  3TGO A;  1GW6 A;  3HXC A;  2WXK A;  4GTO A;  5T4Y A;  5T8I A;  4KYO B;  2WXR A;  1SW6 A;  4U63 A;  3T5X A;  3LY8 A;  3ZYL A;  1S64 A;  3ABM E;  4WNE A;  1S70 B;  4HBD A;  4N39 A;  3CVU A;  3LPZ A;  1W3B A;  4K5C A;  4A1S A;  1HG2 A;  4GMR A;  2LO6 A;  2V4L A;  5M72 A;  3CVW A;  5AJL A;  3CHQ A;  3DEO A;  4U07 A;  3NZS A;  1N4Q A;  2J08 A;  5JA4 D;  2IU1 A;  2KXP C;  4KMO A;  4RSY A;  2WXM A;  3CSF A;  1X5B A;  1H19 A;  3PZ3 A;  3ASO E;  4BT8 A;  3UM3 A;  2XEV A;  3UM0 A;  3HDX A;  2BKK B;  4XKB A;  1TYQ G;  1LD8 A;  4UI9 J;  4HOR A;  1N9A A;  5KBA A;  1OWP A;  3VTY A;  1H2T C;  3IHY A;  4CT0 A;  1PC2 A;  3K9I A;  5ENS D;  1Z3X A;  4DX7 D;  3L22 A;  3GZ2 A;  3RAU A;  4DX6 D;  1N95 A;  5FQ4 A;  1Z5S C;  4QFV A;  4KZC A;  1HU3 A;  4O6F A;  2ZU6 B;  5LX8 A;  4G11 A;  3FTS A;  4N5Q A;  4DJA A;  3UM2 A;  3IV0 A;  5FTP A;  3FUD A;  3BU8 A;  3LCA A;  4GZC A;  4DLQ A;  3ZUV B;  3TXN A;  4A3V A;  3FFL A;  2AXV A;  2OCC E;  3UKU G;  3IEG A;  1S63 A;  3ISM C;  4EZJ A;  3FP3 A;  5EIB E;  3O4Z A;  4MBG A;  4CDM A;  2GGF A;  3FUN A;  3ZHE B;  3QNK A;  4U95 D;  1SA5 A;  1N0R A;  5KJK A;  2J4B A;  4OAU C;  2X6J A;  4HFG A;  4I1M A;  3CKC A;  1H2U A;  2E0I A;  2R59 A;  2KCK A;  5LFA A;  2LXM A;  2L0T B;  3DPD A;  3CV0 A;  3HXB A;  3DSU A;  3DSW A;  3PVL A;  2KCV A;  4HOU A;  1LF8 A;  3RJV A;  2WMO A;  4N3C A;  3MX3 A;  2JLB A;  3SZ7 A;  5KJL A;  1P5Q A;  4KT6 B;  2DZN A;  5LCW J;  5FJY A;  3AS5 A;  3NAW A;  5BXO A;  1A5E A;  2VSO E;  2Y3A A;  2ZGG A;  2AWI A;  5LP0 A;  4WNG A;  3MV3 B;  1AP7 A;  3C3O A;  4BSZ B;  3CHO A;  3T8M A;  3ESL A;  4P29 A;  4JHJ A;  2EIK E;  3HG0 D;  3DXK G;  1PY1 A;  2DVW A;  3HVE A;  2WXH A;  1MX6 A;  2VJ8 A;  2F0Y A;  4H7X A;  2IO2 C;  2GRM A;  3R9A B;  1DCQ A;  3APD A;  1U3D A;  4CCA A;  3KSL A;  4XEI G;  5CEA A;  4MS6 A;  3EU5 A;  1DC2 A;  3FDH A;  3MJW A;  4GMJ A;  4AY5 A;  1EYH A;  1IYG A;  3G2V A;  3AG1 E;  3GZ1 A;  2C2L A;  3FUK A;  2NC9 A;  5HQ8 A;  1KLX A;  4DI3 A;  2QZA A;  3QWV A;  4CT4 A;  3FWV A;  3U3W A;  4L1B A;  3IKO B;  4UQZ A;  1EDU A;  2GRO B;  3CGH A;  3MCX A;  5IY5 E;  3WG7 E;  2NXP A;  2OVB A;  3QWW A;  4MLP A;  2GRN B;  1UG3 A;  3E4B A;  1BLX B;  2CFZ A;  4I1A A;  5JHB A;  4KBQ A;  2UWJ G;  4GPK A;  1FVH A;  3GYZ A;  1H6O A;  3UT7 A;  4BY6 A;  3JYS A;  4GB9 A;  3LEW A;  5E76 A;  3S7D A;  1MJ0 A;  3DWL G;  4TRQ A;  1S0P A;  3J5P A;  3UKR G;  3EIQ C;  4ZFH A;  3HYM B;  2V8S E;  3D9J A;  3PNL B;  1OWO A;  3ABK E;  2XQ0 A;  2BUG A;  1SA4 A;  5FZS A;  5BNW A;  5ENT D;  3ZHE A;  3LKU A;  1YA0 A;  4JW1 A;  3D9M A;  4TUU A;  4M7C A;  2CHX A;  2OEW A;  4GTR A;  4JVS A;  4GTV A;  3UIP C;  4YND A;  1EPU A;  3SY2 A;  4FAD A;  4HOT A;  3SHF A;  3Q7F A;  5E75 A;  4AJW A;  2XRZ A;  5CMY A;  5BUZ A;  1N52 A;  2EIJ E;  4RQI A;  2AW6 A;  5G55 A;  4JC8 A;  2A5E A;  1JCR A;  5G2N A;  1HG5 A;  4ME2 A;  2EQX A;  3AJI A;  3P1U A;  3AU4 A;  3RRU A;  4B89 A;  4C48 B;  2FO1 E;  4ACK A;  3FUH A;  1OCZ E;  2VSN A;  4GU5 A;  4G26 A;  5AQ7 A;  3UIN C;  3L16 A;  2VGX B;  1YYH A;  1Z3Y A;  2XPZ A;  2XGM A;  3CIA A;  4GML A;  2WXG A;  3UQ3 A;  4N3A A;  4V3I A;  1O1T A;  1RW2 A;  3FHE A;  2H6F A;  3UTM A;  4HRL A;  4I17 A;  1RZ4 A;  4FLH A;  2KZT B;  4U96 D;  1U3C A;  2Y4T A;  4DLO A;  3C3R A;  3FTY A;  2LSV A;  2WXF A;  4JA7 A;  2I6H A;  2F8Y A;  1V54 E;  3JXI A;  2KBX A;  2PM7 A;  4AVX A;  1KZP A;  2J09 A;  4CGV A;  3QC1 A;  3D9O A;  3CEQ A;  3CHS A;  3RRN B;  3DXM G;  2YHE A;  2L0I A;  4JL0 A;  4AOF A;  1N4P A;  5C1D A;  3D9L A;  4BET A;  4EEC A;  2AXZ A;  2VGY A;  4DX2 A;  3ESK A;  2QFC A;  3R9M A;  3TWV A;  3JQ1 A;  1UOH A;  3CK8 A;  4G2V A;  3D9P A;  4XI9 A;  3V2X A;  1ELW A;  1D8D A;  3CHP A;  5AAO A;  4O1O A;  2I1K A;  4G1T A;  5AJD A;  3SFZ A;  1UW4 B;  3PE4 A;  5B3S E;  4GTS A;  4I9C A;  4I2Z A;  1OWM A;  4G23 A;  4RVB A;  4C0M A;  4GYW A;  1MQS A;  3O48 A;  3QKY A;  4Q69 A;  1MZC A;  5AQA A;  2LNI A;  3E32 A;  4YVQ C;  4A55 A;  5CRU A;  3TXM A;  3D9I A;  3V2O A;  4IYP A;  3CHM A;  4XIF A;  5G05 C;  1NL4 A;  4UQX A;  3DPY A;  4A1G A;  4I9E A;  3ONL A;  2FBN A;  4NUR A;  3EHN A;  3SGH A;  5LCW C;  2WMN A;  2LSU A;  1OWL A;  4KVO A;  5FT9 A;  3NB2 A;  1E90 A;  4IRU A;  3VLE A;  4EBA G;  5AIJ A;  4J0U A;  1N0Q A;  5FIN A;  3SO8 A;  2WXP A;  3KAE A;  5BPP A;  3LY9 A;  2IY0 C;  2XS8 A;  1OCC E;  4UUC A;  2BTD A;  3U9W A;  5EX3 A;  3JCK C;  1O1S A;  3BG1 B;  3EHR A;  2ETC A;  4EPZ A;  3MKQ B;  4F6R D;  4JHK A;  2DYR E;  3AU5 A;  4IN3 B;  1WY6 A;  4J7W A;  5CBO A;  4AXH A;  1NA3 A;  3HXD A;  5FZR A;  3ZPJ A;  3QAQ A;  4LG6 A;  2QYU A;  2X6F A;  5D2M C;  2IEJ A;  2CG3 A;  4HS2 A;  2PQN A;  4JXT A;  3FU5 A;  3PRE A;  2J49 A;  5KJM A;  5ARF A;  2DCP A;  3ULQ A;  3EHQ A;  1E7U A;  4XZ4 A;  2WVI A;  5AN8 A;  2YHC A;  3FH7 A;  2X6K A;  5FIO A;  3TWQ A;  3CHR A;  4OAV B;  5BW8 C;  4A3T A;  2H6G A;  4EHM A;  4MKT A;  3AG4 E;  2C0L A;  2MYO A;  4L2L A;  4GZ3 A;  1E8Z A;  4DPR A;  3G2S A;  4DX5 D;  3C3Q A;  4YDW A;  4I6G A;  5EYP F;  2EIM E;  1HH8 A;  5C2Y A;  2I9C A;  2YQ8 A;  3CVV A;  1HF8 A;  3APC A;  3LVR E;  3MYV A;  2R2L A;  2I2O A;  3PDN A;  1TJC A;  3RK6 A;  3FEY A;  2BED A;  4U8V D;  3JQ0 A;  5KCM A;  3RIB A;  2EIL E;  2FI7 A;  1MHQ A;  1TN8 A;  3NBN B;  3UI2 A;  1JCQ A;  4FC8 A;  1WM5 A;  3HIZ A;  2UY1 B;  2J9Q A;  2WQ7 A;  1OY3 D;  2JAB A;  3APF A;  3Q15 A;  4JD2 G;  3D9N A;  2QY7 A;  1BI8 B;  1SQM A;  2WXL A;  4F7A A;  1WG0 A;  3ZXS A;  4LRZ A;  4AP2 A;  4FP7 A;  5ITZ F;  1OCR E;  2H6I A;  4ANW A;  2P9S G;  3Q47 B;  1TN7 A;  2MOW A;  2XRY A;  2P9L G;  3B13 A;  4YDE A;  1TJF A;  4HOQ A;  3PS6 A;  2XEH A;  2PL2 A;  4TXR A;  4F53 A;  4JPS A;  1MX4 A;  4EBA A;  3FUJ A;  5CBN A;  1UJJ A;  4EZK A;  1JWF A;  3G2W A;  5EX0 A;  3FUL A;  3ONK A;  3LS8 A;  3B7R L;  4C0E A;  4HOS A;  3FEX A;  5ANL A;  4XE0 A;  3AS4 A;  2WPV A;  3CQC B;  1LD7 A;  1ELK A;  5G05 J;  1QNF A;  2WXQ A;  3CST A;  4DX1 A;  2FF4 A;  4RG6 A;  1TEZ A;  4HRM B;  1N54 A;  4N2Q A;  4I1O B;  1HFA A;  2X6I A;  3PUJ A;  4J8F A;  3QK0 A;  1HXI A;  3BQO A;  4DUI A;  2VTB B;  4LNB A;  3ZFW A;  3ULE G;  2RFA A;  4PDX A;  3RKV A;  5DBK A;  3I5P A;  4G8L A;  1FCH A;  3Q5M A;  4AY6 A;  1IKN D;  3S2A A;  1ELR A;  5HI7 A;  4M3O A;  3KD7 A;  3SI5 A;  3P2B A;  3D9K A;  4AM9 A;  4GTQ A;  2RD0 A;  3E37 A;  3N71 A;  1OT8 A;  2DZO A;  3EHM A;  4FJZ A;  2DYS E;  2ETA A;  1K1A A;  1Y8M A;  4OVU A;  3FUI A;  2BKG A;  2RFM A;  4X8Q A;  3OXL A;  1IHG A;  3ZW3 A;  4L7T A;  3LJ3 A;  5AAR A;  2JEK A;  3S7J A;  2P9N G;  5A6C A;  1SZA A;  1TNU A;  1TNZ A;  3FY4 A;  4HQD A;  2MRI A;  4CRW A;  2VYI A;  4KVM A;  1HX8 A;  4BT9 A; 
#chains in the Genus database with same CATH homology
 1MX2 A;  4BER A;  5KNG A;  2HE0 A;  2J8S D;  4BSZ B;  3T9K A;  1K3Z D;  1D9S A;  3Q9U C;  1SW6 A;  5HKP A;  3V30 A;  4U96 D;  3ZUV B;  4DX5 D;  4TUM A;  1G3N B;  3HG0 D;  3JXJ A;  4YDW A;  5EYP F;  4HI8 A;  1N0Q A;  1S70 B;  4HBD A;  5FIN A;  5JMN D;  3SO8 A;  4BES A;  4DX1 A;  5ENT D;  2DVW A;  1BD8 A;  2F8Y A;  4HRM B;  1BU9 A;  4K5C A;  3NOG D;  5ENP D;  1MX6 A;  2PNN A;  2KBX A;  3JXI A;  4YDY A;  4CZ2 D;  5EIL A;  3B7B A;  4GMR A;  3ZKJ A;  4O60 A;  5EIB E;  4RLY A;  2V5Q C;  1IHB A;  4UUC A;  5ENQ D;  2P2C P;  1BI7 B;  1N11 A;  4U95 D;  2F8X K;  2ETB A;  1N0R A;  1DCQ A;  4HRN A;  4DUI A;  4OAU C;  3EHR A;  2ETC A;  3DEO A;  4U8V D;  2RFA A;  4F6R D;  5CEA A;  5CEC B;  3TWU A;  1NFI E;  2V4H C;  3KEA A;  1DC2 A;  3TWS A;  3B95 A;  4BET A;  4G8L A;  4DX2 A;  1IXV A;  1IKN D;  5JA4 D;  5KWD A;  3W9G A;  3NBN B;  3UI2 A;  4Z68 A;  5ENR D;  4J7W A;  2KXP C;  3J5Q B;  3DEP A;  4NIK A;  5CBO A;  3TWV A;  1OY3 D;  1UOH A;  2JAB A;  4QQI A;  5EID A;  4F1P A;  1TR4 A;  4LG6 A;  3TWR A;  3V2X A;  4K5B A;  5HS0 A;  1BI8 B;  3NOC D;  2XZD G;  3UXG A;  1MYO A;  2A5E A;  4ZHB A;  3D9H A;  1OT8 A;  2XZT G;  2DZO A;  1WG0 A;  2DWZ A;  2QYJ A;  5AAO A;  4O1O A;  3AJI A;  5AQ9 A;  2AJA A;  5ITZ F;  3ZU7 B;  2ETA A;  4J8Y A;  3W9F A;  4ATZ D;  2F37 A;  2Y1L E;  4CYM D;  1K1A A;  5ENO D;  3TWX A;  3EU9 A;  4BEP A;  5EYL A;  1K1B A;  2BKG A;  2RFM A;  4GPM A;  4U8Y D;  4B93 B;  2BKK B;  3ZNG A;  5EN5 D;  3JUE A;  1SVX A;  3HRA A;  5KNH D;  1YMP A;  4K5A B;  2XEN A;  3C5R A;  4C48 B;  2FO1 E;  5KBA A;  5CED B;  3Q9N C;  4LNU D;  5ENS D;  2NYJ A;  5AAR A;  4JB8 P;  3V31 A;  3EHQ A;  1QYM A;  2XEH A;  3T8K A;  1BLX B;  2QC9 A;  4LSZ E;  1MX4 A;  5AQA A;  4DX7 D;  5AQ7 A;  5CBN A;  4DX6 D;  1WDY A;  4HB5 A;  5BXU A;  4HLL A;  2DZN A;  5AN8 A;  4HNA D;  1AP7 A;  2B0O E;  1YYH A;  5FIO A;  3TWQ A;  3IXE A;  4G8K A;  2ZGD A;  5D66 A;  4OAV B;  4HQD A;  1AWC B;  3LJN A;  4QFV A;  1MJ0 A;  4O1P A;  3F6Q A;  3V2O A;  5BXO A;  4HI9 A;  4DRX E;  5AQB A;  5HRY A;  1A5E A;  2L6B A;  2VGE A;  3AAA C;  3J5P A;  3V79 K;  2ZGG A;  4ZFH A;  2Y0B G;  3UTM A;  4N5Q A;  2XEE A;  3TWT A;  5CER B;  1YCS B;  4HRL A;  4A63 B;  3TWW A;  2MYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...