4GMJA

Structure of human not1 mif4g domain co-crystallized with caf1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
HMLEENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT transcription complex subunit 1
publication title The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 82
structure length 229
sequence length 229
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gmjA00
3EIJA 3RK6A 1UG3A 2IONA 2GGFA 3FEXA 4B8AA 2IU1A 3L6AA 4GMJA 5ANRA 4JHKA 1N52A 2IOLA 2KZTB 1H2TC 4IULA 2I2OA 4CRWA 1N54A 3JUIA 2VSXE 2VSOE 1HU3A 4LUNU 4CEMA 4B8CB 3FEYA 2RG8A 4JHJA 2NSZA 2IOSA 1H2VC 2FULA 4B89A 4CT4A 3EIQC 1H2UA 1UW4B 1PAQA 2KZTA 4C9BB 4GMLA 2HM8A 2ZU6B 1H6KA 3D3MA
chains in the Genus database with same CATH superfamily
3OXGA 3B7SA 2IU1A 2LAIA 4OYSA 1U3CA 1X81A 4NRHB 3DWLG 3JCKC 1PC2A 4GZCA 4XE0A 1P5QA 4N5QA 3AS4A 2GW1A 3C3OA 4TXRA 4CT4A 4FU3A 2PQRA 3NOGD 3AU5A 2UY1A 3PVLA 4CDRA 5CECB 4IN3B 2MOWA 2VGXA 2I9CA 3B7RL 4U0ZA 3ONLA 3FUJA 4KXKB 4XI0A 3U66A 3DRAA 4G24A 4C0EA 4K5AB 3EDTB 4JHJA 3QWVA 1YYHA 4GZ5A 2Y0BG 5JHAA 2OEVA 2ILRA 3URZA 1JCRA 3QARA 4FULA 2VGEA 1SW6A 3O4ZA 5ENTD 3EHMA 3NB2A 5FZQA 4RG9A 5JJ6A 4I6GA 4EBAG 4LNGA 4JA7A 3PUKA 4EECA 3GZ2A 1W3BA 5HI7A 2WXFA 3P2BA 4TUUA 3RK6A 4KVOA 2OVBA 2P9LG 5D66A 3FUIA 4AY6A 1BPOA 2IO3C 4CDNA 2NC9A 3TGOA 3U4TA 4C48B 2L0TB 2I1JA 3BG0B 3LY9A 4NIKA 4BERA 1AWCB 4B94A 2XGOA 2GROB 2P9IG 4G8LA 1OCOE 4JHRA 2PZIA 2R59A 2KZTB 5BUZA 2R05A 3DXKG 1FT2A 1QBQA 3RRUA 3FU3A 2ZXWE 4E85A 3VLEA 4B0ZA 2DZOA 1N4SA 3PEUB 2XHEA 4JXTA 3KEAA 3DPDA 3HXEA 2XEHA 2KXPC 2IJGX 2OV8A 3I5PA 1HG2A 4HLLA 4LG6A 1YCSB 5EYLA 3PE3A 4FLBA 3SI5A 1HX8A 1H6KA 3TL5A 1UG3A 5EIDA 1OCZE 4WWPA 4K5CA 3UIPC 3S7JA 5BV1A 3R9AB 3V2XA 3DSWA 2JLBA 4FP7A 1SZ9A 3BG1B 1H6OA 3BEEA 5BPPA 2MYOA 2VTBA 3AU4A 3FH7A 2UY1B 2LSVA 5FQ7A 1E8YA 5KNHD 2VGXB 3U3WA 5AARA 3OXFA 4HXIA 2Y4TA 5FTPA 2IQCA 4HOQA 5H7PA 4AV7A 1N11A 3LPZA 3L17A 1XNFA 2KBXA 3SBTB 5D2MC 5AIJA 1TNBA 4CEMA 4B8CB 3SO8A 5A6CA 3UUXA 3ZFWA 1OY3D 4GPKA 2H6GA 1WY6A 4L23A 3LJNA 4APOA 1IKND 2XGSA 4H7XA 3IHYA 1EF1C 4HOTA 4BT9A 4WNEA 3LKUA 4RLYA 3UM3A 3B7UX 1OWLA 3KSQA 4DX1A 2WXLA 3Q9NC 1DCQA 3HRAA 3C98A 4M3OA 5ENQD 3KEZA 4AOFA 5A7DB 4HOSA 2BKKB 4ANUA 3CV0A 5AYWD 3D9OA 4ZFHA 2OVFA 3D9MA 4HFGA 3SGHA 3TWUA 4Q94A 4WNGA 4JD2G 1N0QA 2B6CA 3C3QA 2KCLA 4ATZD 3BU8A 5JJTA 3G2VA 2WQ7A 3X2QE 4BX8A 3T9KA 1V55E 1SZAA 3CEQA 3TAXA 3T5VA 2LO6A 2XPIA 2FO7A 1E8ZA 1MHQA 5EX0A 4JW1A 5E76A 2HM8A 3OTNA 2A4ZA 1KT1A 3APDA 2Y3AA 2WXGA 4GA2A 3APFA 3DXMG 3IEGA 3G2WA 4JZYA 1MJ0A 4I2ZA 4IRUA 3OAWA 3PREA 2VTBB 4GA1A 4K03A 3JXIA 3UKUG 2P9KG 3SNXA 5AENA 2OOEA 3RRNB 3CHPA 3CR3A 4EZLA 4G8KA 5ENNA 1PY1A 1HS6A 3ZW3A 1E8WA 3Q7FA 4U63A 1YA0A 3JQ1A 3PZ3A 4FJZA 3FTUA 3ZPJA 5BW8C 2DWZA 1OCRE 3FEXA 4GTSA 4HRMB 5FQ4A 2WMOA 1EPUA 3UMVA 4F1SA 3IBEA 3FDHA 3N71A 3MJWA 3CHOA 4HRLA 1H6PA 2R02A 3FTXA 3L08A 2WPVA 1HF8A 4L2YA 5AQAA 2IO2C 4G26A 2J49A 3WXXA 1IHBA 4BSZB 1TN8A 3ZYQA 2LSUA 2E0IA 3ULEG 4XKBA 4JC8A 4JVSA 4F6RD 4J8YA 1QQEA 5J08A 3NF1A 2I6HA 5AQ7A 3GZSA 4FC8A 3V2OA 4CCAA 3DSSA 4E6HA 2WXPA 4WWOA 2F37A 2Q7FA 3I3NA 3L22A 1OXJA 1NA3A 4FJYA 4CGWA 4DLQA 3L82A 3ZYKA 3MA5A 3CVVA 1SA5A 2X38A 3LCAA 3HXDA 4TV3A 3FTVA 2QFCA 4MS6A 4TUMA 4N5CA 5B3SE 4UWHA 5T8IA 4XKCA 1X5BA 2FO1E 5AJLA 3GYZA 3O48A 2RG8A 2DBAA 4FHJA 4LCTA 4AVXA 3AS8A 3D9NA 5ENSD 4L9PA 3FTSA 4URKA 5LP0A 3ZVVA 1TJFA 2J09A 3LJ3A 3ZXSA 4H7YA 3FTZA 1OWOA 2RFMA 5CEDB 2F8YA 3E37A 3DEOA 4BT8A 2CHXA 3VLFA 4B89A 1K8KG 5G05J 3B7TA 4I6EA 4L2LA 2WM9A 1KZPA 3DEPA 2I2OA 3SBSA 4LERA 4I1AA 4V3IA 4GPMA 3HVEA 2C2LA 2H6IA 3PZDA 3ZEFA 3CKBA 2J08A 1TNZA 1V54E 3CSFA 3G2TA 1HXIA 1N0RA 3MCXA 1H19A 1O5MA 3L6AA 4U04A 4RG6A 5KJKA 1HE8A 4EBAA 4OVUA 4K0RA 3UM2A 4HRNA 4EPZA 4LUNU 1G3NB 1SVXA 3IHVA 2VYIA 3QB2A 4HI9A 4JB8P 3HHMA 4DJAA 4PH4B 4AM9A 5CCMA 3UTMA 1Z5SC 4YDYA 2I1KA 1HG5A 4P29A 3ABKE 3DBSA 1KT0A 5LFAA 2XEEA 4O6FA 3TWXA 3S7DA 3MGBA 4GCOA 4HS2A 5JMND 1OWPA 3RKVA 3DSVA 1TEZA 3L13A 3CQGB 2XZDG 2OCCE 4HORA 4J0UA 3BUAA 3CVXA 1IQUA 3PH0C 3NZUA 5ARGA 3EHQA 2HYZA 4KZCA 4L1BA 2BEDA 4GTVA 3PZ4A 4WUYA 5AQ9A 3TJPA 2AXZA 3ZKJA 1ELWA 1ELRA 2ETBA 5FQ6A 1NZNA 4YDOA 2P58C 3ZXPA 1O1TA 4N2SA 3Q15A 2Y1LE 5BXOA 4Q96A 3TWVA 3R7RA 3ASDA 2J4BA 4XIFA 5ANLA 1FVFA 2PL2A 4F3VA 3ASHA 2X6JA 5HQ8A 3ULYA 1IYGA 4FHKA 3QWWA 4I2WA 2JABA 4BX9A 4KBQA 1E96B 2V0PA 2VSXE 2BF0X 5A23A 4RSYA 4Q69A 1RZ4A 5J90A 1NFIE 5HKPA 1JCSA 3FWVA 3CK7A 4YDEA 3C3RA 1MYOA 3CVPA 2DCPA 3FUKA 1B89A 3HVEB 1YMPA 4ABNA 2JEKA 3AG1E 3KS2A 3ZYMA 3KD7A 3IKOB 3T8MA 4BTAA 3QK0A 2XRZA 5KJLA 4R7LA 1E90A 3SQVA 3ASNE 3RO3A 2XS1A 3ESKA 2A5EA 5KBAA 3CVQA 4OVVA 5ENOD 3E30A 4WAFA 5KJMA 2DIWA 1TNOA 1Z6TA 3CK8A 2PM7A 3FY4A 4G1TA 4C9BB 5C2YA 4YVOA 3DPYA 4UI9K 5LCWJ 2QC9A 4A55A 4BFRA 1H2TC 3ZN3A 5D0QD 2FBNA 4FA6A 1U2VG 4HQDA 4ILGA 2ONDA 3MEKA 3LY7A 3PZ1A 3UIOC 5ANRA 4BWRA 1K1AA 3QKYA 4J8DA 4U07A 3VTXA 4GAAA 2XGMA 2P2CP 5CMWA 4G2VA 3ML8A 4N39A 3RO2A 1ELKA 2H6FA 3FUNA 3TWTA 4MBGA 3PNLB 4UQYA 1MQSA 4QQIA 3ESLA 2EILE 1E7UA 3ZUVB 5BXUA 3AG3E 2LXLA 3JUEA 3W9GA 4UQXA 3G2SA 3NBNB 4RQIA 3S7FA 1O1SA 5EKQD 1JWGA 2QZAA 4HLEA 3MYVA 1OWNA 1JUQA 4G25A 3QOUA 4BSXA 1OCCE 5HRYA 2LAHA 2CHWA 2P9SG 1TNUA 4GTOA 2Y4UA 2V8SE 3UT7A 2HR2A 2GRPB 2VSNA 1N9AA 4UWLA 1S70B 4UWKA 1BLXB 3FULA 3DSUA 3MKRA 4I17A 4KYOB 2P9PG 3ONKA 3FUMA 4LEUA 2XENA 3FEYA 4HI8A 1H2UA 4GTTA 3CVWA 3W9FA 4J7WA 5KNGA 3E33A 3MZLB 1HH8A 1S64A 1UJKA 4L7TA 4JHKA 4XX5A 4A1GA 1KPSB 3Q73A 3Q78A 2X6KA 4Y6CA 3ISMC 1AP7A 3HYMB 2V5QC 3D9JA 4WNFA 4A1SA 3E4BA 2C0MA 2XPYA 1TYQG 2GRQB 4HVBA 2L6JA 4I43A 2R17C 4GTMA 2XEVA 4ME2A 3ML9A 1DVPA 3AAAC 1Y6IA 3E34A 2Y69E 1N54A 2UWJG 4DK5A 4XI9A 2EIME 2L9BA 1KZOA 3Q49B 3APCA 4I6JA 4DI4A 2DYSE 2P9NG 2MRIA 1DCEA 2V5FA 3SFYA 3ASOE 4N3BA 3J5QB 3ZNGA 2YQ8A 5EIBE 3HDXA 4DX7D 1N4PA 2QY7A 2BUGA 3WG7E 4GZ3A 3LVRE 2NYJA 3KSLA 3ZU7B 4W9RA 4G11A 5LCWC 4TXQA 4O1PA 4O60A 2DZNA 4JEUA 1TNYA 2QYJA 1WM5A 1D8EA 2WXKA 2GRRB 3V31A 3I4GA 2YHCA 2FI7A 2WMNA 4J8SA 3FUEA 1OT8A 1N95A 5AN8A 5KJNA 1E8XA 3UX4A 1UN9A 4LSZE 3PNTB 2J8SD 4BTBA 3K9IA 3CSTA 4GCNA 4ACLA 3DSTA 3CIAA 2J07A 4UUCA 3CVNA 2RD0A 4JL0A 2L0IA 2PNNA 2ZGGA 3FH8A 3UINC 1MX6A 3SHFA 3SD5A 3BQOA 1EYHA 3UI2A 4OAVB 5BV0A 1S0PA 4I9CA 3MV3B 2MHKA 4LNBA 3D9LA 3VLDA 1ZU2A 3TWWA 2GGFA 3JXJA 2IOLA 2ETAA 2KCKA 2AVPA 5ENPD 1U3DA 4J8EA 1ZB1A 1NA0A 2CFZA 4G23A 3Q75A 1RW2A 4GB9A 2LNIA 2ZGDA 3LDZA 1HU3A 4BEPA 1WDYA 3ABME 2EQXA 2EIJE 3HXCA 2XRYA 3EU5A 5EILA 4IYPA 1A17A 1UN8A 3ZHEA 2F8XK 2VJ8A 2WXOA 2WXJA 4U8YD 4TRQA 2EINE 1IQRA 3RSEG 4M7CA 3HIZA 3PZ2A 2WXRA 3QC1A 1H2VC 2FF4A 4ANXA 2FULA 1LTXA 3MKQA 4FADA 4ACKA 3RJVA 2LUHA 2EIKE 2GRMA 2XPZA 3UKRG 2DYRE 2YINA 3CHQA 3T5XA 2WQHA 4NURA 3CK9A 5T3RA 1SQMA 2AXUA 2V4HC 4GMLA 5DIZA 3FH5A 1FVHA 2HE0A 4ANVA 4N3AA 4Z68A 1K1BA 3CGHA 4CRWA 1OWMA 2R2LA 5JHBA 4GZDA 4I9EA 3CVYA 2X6HA 3D9PA 3SZ7A 4HB5A 2CHZA 3RU0A 2WXHA 5KWDA 4WWNA 3ABLE 3JYSA 2WXNA 4MLPA 4XZ4A 4A63B 4CZ2D 3T8KA 5ARFA 1BU9A 2X3MA 3EU9A 4GTRA 4ZHBA 2BKGA 2R03A 3KAEA 1HO8A 3UT8A 3QNKA 3L54A 4LNUD 3TG4A 3ZGQA 3E32A 3D9IA 2WQ6A 3FHEA 5EDSA 1TN7A 4QFVA 2IONA 4BESA 2WXIA 4I1OB 4KVMA 3IXEA 5CERB 4DX6D 2AJAA 3R7QA 3MX3A 2RKKA 4PDXA 3NOCD 3V30A 1FT1A 4FLHA 1O1RA 4O1OA 2WVIA 5LOZA 2IY0C 3JQ0A 1DC2A 2IEJA 5G55A 2M63A 1TR4A 3L16A 4Y6WA 2CG2A 4N3CA 4DI3A 3B95A 2NSZA 3AS5A 2WB2A 5JA4D 4B93B 3TWQA 3CLJA 1Z3YA 2YNQA 4B8AA 3LVQE 4AIFA 3FU0A 5G05C 3QJZA 3FUDA 2NXPA 3PDNA 3ZHEB 5CBOA 4KMOA 3SFXA 2WXMA 3TG5A 4UWFA 3C72A 2ZU6B 5B1AE 3HG0D 1A5EA 3S2AA 1NI1A 4U8HA 4CYMD 4PUCA 3MKQB 2RFAA 3QAQA 5CRVA 1JWFA 5E75A 1LF8A 4F1PA 2AW6A 4U95D 5IY5E 2B0OE 3PUJA 4JPSA 2E2EA 2IFUA 1TN6A 1BD8A 4HBDA 5BNWA 2X6IA 1WAO1 2J4DA 5ITZF 3FTYA 2XS8A 4YDWA 5ENRD 4JA9A 1JCQA 1DNPA 1Z3XA 3PE4A 4UI9J 3Q5MA 4ANWA 1N52A 5B1BE 3C5RA 1UJJA 3JUIA 5AAOA 3ASFA 4KT6B 2CFUA 1UOHA 3D9HA 4U7EB 4DX2A 3ZIMA 5CBNA 3CQCB 1GW6A 2AXVA 3EUVA 3PS6A 2XCBA 2IF4A 3CHMA 2BTDA 4GA0A 1FCHA 4X8QA 3Q4AB 3ENEA 4NQ0A 4BETA 4N2QA 1MX2A 5BT1A 4XEIG 3UM1A 2C0LA 2PM6A 5C1DA 1HZ4A 3F6QA 4D10C 3UXGA 3CHSA 3B7BA 1EDUA 5FZRA 1JPLA 4A3TA 1IHGA 2ETCA 3CVUA 3L9TA 1D8DA 5CCLA 1BI8B 5FIOA 4A3VA 1D9SA 3FU6A 3PEVB 2KCVA 2J9QA 2QYUA 3TXNA 3GW4A 4GTPA 3MV2B 3LY8A 4F53A 3QWPA 3AG4E 5FT9A 4MRUA 2CG3A 1ZBPA 2XQ0A 4EHMA 5HS0A 3QDNA 2VSYA 5D0OD 4EZJA 3ULQA 3CVLA 3LYAA 4ILHB 1OUVA 3R9MA 5M72A 4LRZA 3UT4A 5T4YA 2H6HA 5G04J 5CHEE 4UWGA 5G2NA 4ILIA 1N94A 1PAQA 3RRMB 3D3MA 4WNDA 3AJIA 1FPPA 3CKCA 4ATGA 4NACA 4PS7A 3SFZA 2P9UG 3HXFA 4AP2A 5JJ7A 4CGVA 1QYMA 5EYPF 4OAUC 2YHEA 3Q7AA 2F0YA 2ZIRA 3TWSA 2KM4A 1QNFA 3ZYLA 3NAWA 4GZ6A 3EIQC 3EJNA 1S63A 1MZCA 3RIBA 4CT0A 3CHRA 1KLXA 3EIJA 2L6BA 3EHRA 1VDYA 1LD7A 3HXBA 4GMJA 5CEAA 3Q9UC 4GU5A 4PS3A 3J5PA 4U0SA 4EQFA 2IOSA 3ASGA 5LX8A 1UW4B 2DVWA 3LXUX 1N4QA 3UPVA 3FFLA 4DUIA 5EX3A 5EN5D 3NZSA 3AG2E 5DBKA 5CRUA 2HO1A 4UI9C 2VGYA 2VSOE 2WXQA 2ZISA 4YNDA 3LS8A 4K5BA 4GYOA 2FEZA 4UQZA 2XCCA 3SY2A 4PS8A 4TXPA 3Q47B 3NQPA 3GZ1A 4DX5D 1IXVA 4F7AA 5AJDA 3P1UA 3U64A 1L5JA 1E7VA 1SA4A 4U96D 2V4LA 3FUHA 1WG0A 1XGWA 4HOUA 4DPRA 2XZTG 5KCMA 3FU5A 1QZ2A 3UM0A 1Y8MA 1N4RA 3RAUA 5FJYA 2R5SA 3LEWA 1LD8A 3UQ3A 4C0MA 2X6FA 4RVBA 1TJCA 1BI7B 3FTWA 4U8VD 5FQ8A 1NL4A 2A5UA 3D9KA 4CDMA 5FZSA 3TXMA 4BY6A 2PQNA 4GMRA 2VQ2A 4AEZC 3IV0A 4DLOA 3U9WA 5AQBA 2KC7A 3OXLA 1HFAA 4AY5A 2LXMA 4GTQA 3B13A 5FINA 3SF4A 4YVQC 3G2UA 2GRLA 2KZTA 4J8FA 3V79K 4J6IA 3VTYA 4HNAD 1NP7A 1K3ZD 4MKTA 5FWQA 4I1MA 3PRZA 2AWIA 4GYYA 3FP3A 3I4RB 2GRNB 3Q79A 4U0UA 5CMYA 4APFA 4GYWA 4JEHA 3FUFA 5G04C 1MX4A 4EZKA 3DSXA 3S7BA 3ZRHA 4AJWA 4DRXE 4AXHA 4IULA 1H0AA 3TWRA 1INZA 2KATA 1Q2ZA 3EHNA 4KZ0A 2OEWA
chains in the Genus database with same CATH topology
4L2YA 1JWGA 4G26A 1Z3YA 2J49A 2YNQA 3OXGA 3B7SA 4HLEA 4B8AA 2IU1A 3WXXA 3MYVA 2LAIA 4OYSA 1U3CA 1OWNA 3LVQE 4NRHB 3ZYQA 1JUQA 3FU0A 5G05C 2LSUA 3JCKC 2E0IA 3QJZA 4G25A 4AIFA 3QOUA 1PC2A 4XKBA 3FUDA 4BSXA 4GZCA 4JVSA 4JC8A 4XE0A 2LAHA 2CHWA 1QQEA 2NXPA 1P5QA 3PDNA 3ZHEB 3NF1A 5J08A 2Y4UA 3AS4A 2I6HA 3GZSA 4KMOA 2V8SE 2WXMA 3UT7A 2GW1A 2HR2A 3TG5A 4UWFA 4CT4A 2VSNA 4FU3A 2PQRA 4FC8A 4CCAA 4UWLA 3AU5A 2UY1A 2ZU6B 3PVLA 4CDRA 4IN3B 2MOWA 3S2AA 2VGXA 4E6HA 4UWKA 2I9CA 3B7RL 3FULA 4U8HA 4U0ZA 2WXPA 4PUCA 3MKQB 3ONLA 3FUJA 4KXKB 3MKRA 4XI0A 3U66A 4I17A 4WWOA 2Q7FA 4G24A 3ONKA 3FUMA 3I3NA 4KYOB 4LEUA 4C0EA 3L22A 3EDTB 1NA3A 3FEYA 4JHJA 3QWVA 4FJYA 4CGWA 4DLQA 4GZ5A 3ZYKA 3MA5A 3QAQA 3CVVA 1JWFA 1H2UA 2X38A 5JHAA 3CVWA 3LCAA 5E75A 2ILRA 1LF8A 2AW6A 3URZA 4TV3A 3FTVA 3MZLB 1HH8A 3QARA 3PUJA 4JPSA 1UJKA 2E2EA 2IFUA 4FULA 4L7TA 2QFCA 3O4ZA 4MS6A 4JHKA 4N5CA 4XX5A 4UWHA 5T8IA 4XKCA 1X5BA 5BNWA 2X6IA 5AJLA 3EHMA 4A1GA 5FZQA 4DJAA 3GYZA 3O48A 4RG9A 1WAO1 5JJ6A 2X6KA 4I6GA 4Y6CA 2RG8A 3HYMB 4EBAG 2J4DA 2DBAA 3FTYA 3D9JA 4JA7A 4FHJA 3PUKA 4JA9A 4LCTA 4WNFA 4AVXA 4EECA 3AS8A 4A1SA 3D9NA 3E4BA 3GZ2A 1W3BA 2C0MA 1DNPA 2XPYA 5HI7A 2WXFA 3P2BA 1Z3XA 4HVBA 2L6JA 4I43A 4TUUA 2R17C 3FTSA 3PE4A 3RK6A 4UI9J 3Q5MA 2XEVA 4KVOA 2OVBA 3ML9A 4ME2A 1DVPA 3ZVVA 4URKA 1TJFA 2J09A 5LP0A 4ANWA 3LJ3A 3ZXSA 1Y6IA 1N52A 4H7YA 3FTZA 3FUIA 4AY6A 1BPOA 1UJJA 1N54A 1OWOA 3JUIA 2NC9A 2UWJG 4CDNA 4XI9A 4DK5A 3ASFA 3TGOA 4KT6B 3U4TA 2L9BA 3Q49B 2CFUA 2L0TB 4BT8A 2I1JA 3BG0B 3LY9A 2CHXA 3VLFA 3APCA 4B89A 4I6JA 4DI4A 3ZIMA 2MRIA 4B94A 5G05J 2V5FA 2XGOA 3B7TA 3CQCB 4N3BA 1GW6A 4I6EA 2AXVA 2YQ8A 3PS6A 4L2LA 2XCBA 4JHRA 2WM9A 3HDXA 2IF4A 2PZIA 3CHMA 2QY7A 2BUGA 2R59A 4GZ3A 2KZTB 3LVRE 5BUZA 2BTDA 4GA0A 2I2OA 1FCHA 4W9RA 4G11A 5LCWC 3Q4AB 3ENEA 3SBSA 3RRUA 4LERA 3FU3A 4E85A 4NQ0A 4JEUA 3VLEA 4B0ZA 4N2QA 4I1AA 4V3IA 5BT1A 1WM5A 3HVEA 2WXKA 3PEUB 2C0LA 2C2LA 3PZDA 3ZEFA 2PM6A 3CKBA 5C1DA 1HZ4A 2XHEA 2J08A 3I4GA 4D10C 2YHCA 4JXTA 3CSFA 3CHSA 1HXIA 3G2TA 2FI7A 3MCXA 2WMNA 1H19A 4J8SA 3L6AA 4U04A 1EDUA 3FUEA 3DPDA 5FZRA 4RG6A 1JPLA 4A3TA 5KJNA 5KJKA 1HE8A 1IHGA 4EBAA 4OVUA 1E8XA 2IJGX 4K0RA 3CVUA 3UX4A 4EPZA 2OV8A 1UN9A 4LUNU 3IHVA 2VYIA 3PNTB 3I5PA 3QB2A 4BTBA 5CCLA 1HG2A 3K9IA 3CSTA 3HHMA 3PE3A 4FLBA 3SI5A 4PH4B 4A3VA 1HX8A 4AM9A 1H6KA 3FU6A 3PEVB 4GCNA 4ACLA 5CCMA 1UG3A 3TL5A 4WWPA 2KCVA 3CIAA 2I1KA 1HG5A 2J07A 4P29A 3S7JA 3CVNA 2J9QA 2RD0A 3DBSA 3TXNA 3GW4A 5BV1A 1KT0A 5LFAA 4JL0A 4O6FA 3MV2B 3S7DA 3R9AB 3MGBA 3LY8A 4F53A 3QWPA 2JLBA 2L0IA 5FT9A 4MRUA 2CG3A 4GCOA 4HS2A 1ZBPA 2XQ0A 4FP7A 3QDNA 2VSYA 5D0OD 1OWPA 1SZ9A 3RKVA 4EZJA 3ULQA 2VTBB 3CVLA 1TEZA 3L13A 3BG1B 3LYAA 3CQGB 4ILHB 3FH8A 3SHFA 3BEEA 5BPPA 1OUVA 3SD5A 5M72A 4LRZA 2VTBA 3UT4A 3AU4A 5T4YA 3FH7A 1EYHA 2UY1B 2LSVA 5G04J 4HORA 5CHEE 5FQ7A 1E8YA 4J0UA 2VGXB 3CVXA 4UWGA 1IQUA 3PH0C 5BV0A 3NZUA 1S0PA 4I9CA 5G2NA 3MV3B 4ILIA 2MHKA 5ARGA 3U3WA 1PAQA 3D9LA 3VLDA 3OXFA 1ZU2A 2HYZA 4HXIA 2Y4TA 4KZCA 3RRMB 3D3MA 4L1BA 4WNDA 5FTPA 2IQCA 2GGFA 4HOQA 3CKCA 4ATGA 4NACA 1HF8A 4AV7A 4PS7A 3SFZA 4AP2A 3LPZA 3L17A 4WUYA 5JJ7A 2IOLA 4CGVA 1XNFA 3TJPA 3SBTB 2AXZA 2KCKA 2AVPA 5AIJA 2YHEA 1ELWA 1ELRA 1U3DA 2KM4A 5FQ6A 4B8CB 4CEMA 5A6CA 1NZNA 3UUXA 2P58C 3ZFWA 4J8EA 4N2SA 1QNFA 3ZYLA 4GZ6A 1NA0A 3EIQC 2CFZA 3EJNA 3Q15A 3RIBA 4G23A 4CT0A 4GPKA 4Q96A 3CHRA 1KLXA 3EIJA 1WY6A 4GB9A 2LNIA 4L23A 1VDYA 3R7RA 3ASDA 2J4BA 4XIFA 3LDZA 4GMJA 5ANLA 4APOA 4GU5A 1FVFA 4PS3A 2PL2A 4F3VA 1HU3A 3ASHA 2XGSA 4H7XA 2EQXA 4U0SA 2X6JA 4EQFA 3IHYA 1EF1C 5HQ8A 4HOTA 2IOSA 3ASGA 4BT9A 2XRYA 5LX8A 1UW4B 4WNEA 1IYGA 3LXUX 3LKUA 4IYPA 1A17A 4FHKA 3QWWA 3B7UX 1UN8A 1OWLA 3UPVA 3FFLA 4I2WA 3ZHEA 2WXLA 5EX3A 2VJ8A 2WXOA 2WXJA 3NZSA 4BX9A 3C98A 4TRQA 5DBKA 2HO1A 1IQRA 4M3OA 4UI9C 4KBQA 2VGYA 3HIZA 1E96B 2V0PA 2VSXE 2VSOE 2BF0X 2WXQA 3KEZA 4YNDA 4AOFA 5A23A 4RSYA 4Q69A 3LS8A 5J90A 5A7DB 4HOSA 4GYOA 3FWVA 2WXRA 3CK7A 3QC1A 2FEZA 1H2VC 4UQZA 2FF4A 2XCCA 2FULA 4ANXA 3MKQA 3CV0A 4ANUA 4FADA 4ACKA 3RJVA 5AYWD 4PS8A 3Q47B 3NQPA 3D9OA 3GZ1A 3CVPA 2OVFA 2DCPA 3D9MA 4F7AA 2GRMA 4HFGA 5AJDA 3SGHA 2XPZA 3FUKA 3P1UA 3U64A 1B89A 1L5JA 1E7VA 3HVEB 4Q94A 2V4LA 3FUHA 4WNGA 4ABNA 2JEKA 1XGWA 3KS2A 3ZYMA 4HOUA 3KD7A 3IKOB 3T8MA 2YINA 3CHQA 3T5XA 2WQHA 4BTAA 4NURA 4DPRA 3CK9A 5T3RA 1SQMA 5KCMA 3FU5A 2KCLA 3QK0A 2AXUA 1QZ2A 5JJTA 3G2VA 4R7LA 5KJLA 2WQ7A 2XRZA 4GMLA 1E90A 5DIZA 3FH5A 1FVHA 1Y8MA 4ANVA 3RO3A 4BX8A 5FJYA 4N3AA 3ESKA 2R5SA 3CVQA 4OVVA 3LEWA 1SZAA 3CEQA 3CGHA 3TAXA 4CRWA 1OWMA 4WAFA 3T5VA 3UQ3A 5JHBA 2LO6A 2XPIA 4GZDA 4I9EA 3CVYA 2FO7A 1E8ZA 2DIWA 1MHQA 5EX0A 4JW1A 5E76A 4C0MA 5KJMA 1Z6TA 2X6HA 3D9PA 2X6FA 4RVBA 3SZ7A 3CK8A 2CHZA 1TJCA 2PM7A 3FY4A 3RU0A 3FTWA 2WXHA 4G1TA 5FQ8A 4C9BB 2HM8A 4WWNA 3JYSA 3D9KA 2A5UA 2WXNA 3OTNA 4CDMA 5FZSA 5C2YA 4MLPA 3TXMA 4YVOA 4BY6A 4UI9K 2A4ZA 1KT1A 2PQNA 3APDA 2Y3AA 2WXGA 4GA2A 4XZ4A 5LCWJ 5ARFA 3APFA 4A55A 4BFRA 1H2TC 3ZN3A 3IEGA 3G2WA 2VQ2A 2X3MA 3IV0A 4JZYA 4AEZC 4DLOA 5D0QD 3U9WA 4I2ZA 4IRUA 3OAWA 2KC7A 3OXLA 1HFAA 3KAEA 4AY5A 1HO8A 3PREA 2FBNA 3B13A 3UT8A 3QNKA 3SF4A 3L54A 4YVQC 4FA6A 4GA1A 3G2UA 4K03A 3TG4A 3ZGQA 2GRLA 2KZTA 3SNXA 3D9IA 2WQ6A 4J8FA 5AENA 3FHEA 4J6IA 5EDSA 4QFVA 4ILGA 2OOEA 2ONDA 3RRNB 2IONA 3VTYA 3CHPA 3MEKA 1NP7A 3LY7A 4MKTA 2WXIA 4I1OB 5FWQA 4I1MA 3PRZA 4KVMA 5ANRA 3CR3A 4BWRA 3R7QA 2AWIA 3MX3A 3QKYA 4GYYA 4J8DA 4U07A 3FP3A 4EZLA 3I4RB 5ENNA 4PDXA 1PY1A 4U0UA 5CMYA 4APFA 1HS6A 4GYWA 4GAAA 4JEHA 3VTXA 3ZW3A 1E8WA 3FUFA 2XGMA 5G04C 4EZKA 4FLHA 5CMWA 4G2VA 2WVIA 3ML8A 4N39A 4U63A 5LOZA 3S7BA 3RO2A 1YA0A 3JQ0A 3JQ1A 3ZRHA 1ELKA 4FJZA 3FTUA 4AJWA 3FUNA 3ZPJA 5BW8C 3FEXA 5G55A 3PNLB 2M63A 4UQYA 4AXHA 1MQSA 4IULA 5FQ4A 3ESLA 2WMOA 1EPUA 1E7UA 3L16A 4Y6WA 3UMVA 1H0AA 2CG2A 4N3CA 4DI3A 4F1SA 2NSZA 3IBEA 3FDHA 3AS5A 2WB2A 1INZA 3N71A 4UQXA 3MJWA 2KATA 3CHOA 3EHNA 3G2SA 3FTXA 3S7FA 3CLJA 3L08A 2WPVA 4KZ0A 5EKQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EIJ A;  3RK6 A;  1UG3 A;  2ION A;  2GGF A;  3FEX A;  4B8A A;  2IU1 A;  3L6A A;  4GMJ A;  5ANR A;  4JHK A;  1N52 A;  2IOL A;  2KZT B;  1H2T C;  4IUL A;  2I2O A;  4CRW A;  1N54 A;  3JUI A;  2VSX E;  2VSO E;  1HU3 A;  4LUN U;  4CEM A;  4B8C B;  3FEY A;  2RG8 A;  4JHJ A;  2NSZ A;  2IOS A;  1H2V C;  2FUL A;  4B89 A;  4CT4 A;  3EIQ C;  1H2U A;  1UW4 B;  1PAQ A;  2KZT A;  4C9B B;  4GML A;  2HM8 A;  2ZU6 B;  1H6K A;  3D3M A; 
#chains in the Genus database with same CATH topology
 3OXG A;  3B7S A;  2IU1 A;  2LAI A;  4OYS A;  1U3C A;  1X81 A;  4NRH B;  3DWL G;  3JCK C;  1PC2 A;  4GZC A;  4XE0 A;  1P5Q A;  4N5Q A;  3AS4 A;  2GW1 A;  3C3O A;  4TXR A;  4CT4 A;  4FU3 A;  2PQR A;  3NOG D;  3AU5 A;  2UY1 A;  3PVL A;  4CDR A;  5CEC B;  4IN3 B;  2MOW A;  2VGX A;  2I9C A;  3B7R L;  4U0Z A;  3ONL A;  3FUJ A;  4KXK B;  4XI0 A;  3U66 A;  3DRA A;  4G24 A;  4C0E A;  4K5A B;  3EDT B;  4JHJ A;  3QWV A;  1YYH A;  4GZ5 A;  2Y0B G;  5JHA A;  2OEV A;  2ILR A;  3URZ A;  1JCR A;  3QAR A;  4FUL A;  2VGE A;  1SW6 A;  3O4Z A;  5ENT D;  3EHM A;  3NB2 A;  5FZQ A;  4RG9 A;  5JJ6 A;  4I6G A;  4EBA G;  4LNG A;  4JA7 A;  3PUK A;  4EEC A;  3GZ2 A;  1W3B A;  5HI7 A;  2WXF A;  3P2B A;  4TUU A;  3RK6 A;  4KVO A;  2OVB A;  2P9L G;  5D66 A;  3FUI A;  4AY6 A;  1BPO A;  2IO3 C;  4CDN A;  2NC9 A;  3TGO A;  3U4T A;  4C48 B;  2L0T B;  2I1J A;  3BG0 B;  3LY9 A;  4NIK A;  4BER A;  1AWC B;  4B94 A;  2XGO A;  2GRO B;  2P9I G;  4G8L A;  1OCO E;  4JHR A;  2PZI A;  2R59 A;  2KZT B;  5BUZ A;  2R05 A;  3DXK G;  1FT2 A;  1QBQ A;  3RRU A;  3FU3 A;  2ZXW E;  4E85 A;  3VLE A;  4B0Z A;  2DZO A;  1N4S A;  3PEU B;  2XHE A;  4JXT A;  3KEA A;  3DPD A;  3HXE A;  2XEH A;  2KXP C;  2IJG X;  2OV8 A;  3I5P A;  1HG2 A;  4HLL A;  4LG6 A;  1YCS B;  5EYL A;  3PE3 A;  4FLB A;  3SI5 A;  1HX8 A;  1H6K A;  3TL5 A;  1UG3 A;  5EID A;  1OCZ E;  4WWP A;  4K5C A;  3UIP C;  3S7J A;  5BV1 A;  3R9A B;  3V2X A;  3DSW A;  2JLB A;  4FP7 A;  1SZ9 A;  3BG1 B;  1H6O A;  3BEE A;  5BPP A;  2MYO A;  2VTB A;  3AU4 A;  3FH7 A;  2UY1 B;  2LSV A;  5FQ7 A;  1E8Y A;  5KNH D;  2VGX B;  3U3W A;  5AAR A;  3OXF A;  4HXI A;  2Y4T A;  5FTP A;  2IQC A;  4HOQ A;  5H7P A;  4AV7 A;  1N11 A;  3LPZ A;  3L17 A;  1XNF A;  2KBX A;  3SBT B;  5D2M C;  5AIJ A;  1TNB A;  4CEM A;  4B8C B;  3SO8 A;  5A6C A;  3UUX A;  3ZFW A;  1OY3 D;  4GPK A;  2H6G A;  1WY6 A;  4L23 A;  3LJN A;  4APO A;  1IKN D;  2XGS A;  4H7X A;  3IHY A;  1EF1 C;  4HOT A;  4BT9 A;  4WNE A;  3LKU A;  4RLY A;  3UM3 A;  3B7U X;  1OWL A;  3KSQ A;  4DX1 A;  2WXL A;  3Q9N C;  1DCQ A;  3HRA A;  3C98 A;  4M3O A;  5ENQ D;  3KEZ A;  4AOF A;  5A7D B;  4HOS A;  2BKK B;  4ANU A;  3CV0 A;  5AYW D;  3D9O A;  4ZFH A;  2OVF A;  3D9M A;  4HFG A;  3SGH A;  3TWU A;  4Q94 A;  4WNG A;  4JD2 G;  1N0Q A;  2B6C A;  3C3Q A;  2KCL A;  4ATZ D;  3BU8 A;  5JJT A;  3G2V A;  2WQ7 A;  3X2Q E;  4BX8 A;  3T9K A;  1V55 E;  1SZA A;  3CEQ A;  3TAX A;  3T5V A;  2LO6 A;  2XPI A;  2FO7 A;  1E8Z A;  1MHQ A;  5EX0 A;  4JW1 A;  5E76 A;  2HM8 A;  3OTN A;  2A4Z A;  1KT1 A;  3APD A;  2Y3A A;  2WXG A;  4GA2 A;  3APF A;  3DXM G;  3IEG A;  3G2W A;  4JZY A;  1MJ0 A;  4I2Z A;  4IRU A;  3OAW A;  3PRE A;  2VTB B;  4GA1 A;  4K03 A;  3JXI A;  3UKU G;  2P9K G;  3SNX A;  5AEN A;  2OOE A;  3RRN B;  3CHP A;  3CR3 A;  4EZL A;  4G8K A;  5ENN A;  1PY1 A;  1HS6 A;  3ZW3 A;  1E8W A;  3Q7F A;  4U63 A;  1YA0 A;  3JQ1 A;  3PZ3 A;  4FJZ A;  3FTU A;  3ZPJ A;  5BW8 C;  2DWZ A;  1OCR E;  3FEX A;  4GTS A;  4HRM B;  5FQ4 A;  2WMO A;  1EPU A;  3UMV A;  4F1S A;  3IBE A;  3FDH A;  3N71 A;  3MJW A;  3CHO A;  4HRL A;  1H6P A;  2R02 A;  3FTX A;  3L08 A;  2WPV A;  1HF8 A;  4L2Y A;  5AQA A;  2IO2 C;  4G26 A;  2J49 A;  3WXX A;  1IHB A;  4BSZ B;  1TN8 A;  3ZYQ A;  2LSU A;  2E0I A;  3ULE G;  4XKB A;  4JC8 A;  4JVS A;  4F6R D;  4J8Y A;  1QQE A;  5J08 A;  3NF1 A;  2I6H A;  5AQ7 A;  3GZS A;  4FC8 A;  3V2O A;  4CCA A;  3DSS A;  4E6H A;  2WXP A;  4WWO A;  2F37 A;  2Q7F A;  3I3N A;  3L22 A;  1OXJ A;  1NA3 A;  4FJY A;  4CGW A;  4DLQ A;  3L82 A;  3ZYK A;  3MA5 A;  3CVV A;  1SA5 A;  2X38 A;  3LCA A;  3HXD A;  4TV3 A;  3FTV A;  2QFC A;  4MS6 A;  4TUM A;  4N5C A;  5B3S E;  4UWH A;  5T8I A;  4XKC A;  1X5B A;  2FO1 E;  5AJL A;  3GYZ A;  3O48 A;  2RG8 A;  2DBA A;  4FHJ A;  4LCT A;  4AVX A;  3AS8 A;  3D9N A;  5ENS D;  4L9P A;  3FTS A;  4URK A;  5LP0 A;  3ZVV A;  1TJF A;  2J09 A;  3LJ3 A;  3ZXS A;  4H7Y A;  3FTZ A;  1OWO A;  2RFM A;  5CED B;  2F8Y A;  3E37 A;  3DEO A;  4BT8 A;  2CHX A;  3VLF A;  4B89 A;  1K8K G;  5G05 J;  3B7T A;  4I6E A;  4L2L A;  2WM9 A;  1KZP A;  3DEP A;  2I2O A;  3SBS A;  4LER A;  4I1A A;  4V3I A;  4GPM A;  3HVE A;  2C2L A;  2H6I A;  3PZD A;  3ZEF A;  3CKB A;  2J08 A;  1TNZ A;  1V54 E;  3CSF A;  3G2T A;  1HXI A;  1N0R A;  3MCX A;  1H19 A;  1O5M A;  3L6A A;  4U04 A;  4RG6 A;  5KJK A;  1HE8 A;  4EBA A;  4OVU A;  4K0R A;  3UM2 A;  4HRN A;  4EPZ A;  4LUN U;  1G3N B;  1SVX A;  3IHV A;  2VYI A;  3QB2 A;  4HI9 A;  4JB8 P;  3HHM A;  4DJA A;  4PH4 B;  4AM9 A;  5CCM A;  3UTM A;  1Z5S C;  4YDY A;  2I1K A;  1HG5 A;  4P29 A;  3ABK E;  3DBS A;  1KT0 A;  5LFA A;  2XEE A;  4O6F A;  3TWX A;  3S7D A;  3MGB A;  4GCO A;  4HS2 A;  5JMN D;  1OWP A;  3RKV A;  3DSV A;  1TEZ A;  3L13 A;  3CQG B;  2XZD G;  2OCC E;  4HOR A;  4J0U A;  3BUA A;  3CVX A;  1IQU A;  3PH0 C;  3NZU A;  5ARG A;  3EHQ A;  2HYZ A;  4KZC A;  4L1B A;  2BED A;  4GTV A;  3PZ4 A;  4WUY A;  5AQ9 A;  3TJP A;  2AXZ A;  3ZKJ A;  1ELW A;  1ELR A;  2ETB A;  5FQ6 A;  1NZN A;  4YDO A;  2P58 C;  3ZXP A;  1O1T A;  4N2S A;  3Q15 A;  2Y1L E;  5BXO A;  4Q96 A;  3TWV A;  3R7R A;  3ASD A;  2J4B A;  4XIF A;  5ANL A;  1FVF A;  2PL2 A;  4F3V A;  3ASH A;  2X6J A;  5HQ8 A;  3ULY A;  1IYG A;  4FHK A;  3QWW A;  4I2W A;  2JAB A;  4BX9 A;  4KBQ A;  1E96 B;  2V0P A;  2VSX E;  2BF0 X;  5A23 A;  4RSY A;  4Q69 A;  1RZ4 A;  5J90 A;  1NFI E;  5HKP A;  1JCS A;  3FWV A;  3CK7 A;  4YDE A;  3C3R A;  1MYO A;  3CVP A;  2DCP A;  3FUK A;  1B89 A;  3HVE B;  1YMP A;  4ABN A;  2JEK A;  3AG1 E;  3KS2 A;  3ZYM A;  3KD7 A;  3IKO B;  3T8M A;  4BTA A;  3QK0 A;  2XRZ A;  5KJL A;  4R7L A;  1E90 A;  3SQV A;  3ASN E;  3RO3 A;  2XS1 A;  3ESK A;  2A5E A;  5KBA A;  3CVQ A;  4OVV A;  5ENO D;  3E30 A;  4WAF A;  5KJM A;  2DIW A;  1TNO A;  1Z6T A;  3CK8 A;  2PM7 A;  3FY4 A;  4G1T A;  4C9B B;  5C2Y A;  4YVO A;  3DPY A;  4UI9 K;  5LCW J;  2QC9 A;  4A55 A;  4BFR A;  1H2T C;  3ZN3 A;  5D0Q D;  2FBN A;  4FA6 A;  1U2V G;  4HQD A;  4ILG A;  2OND A;  3MEK A;  3LY7 A;  3PZ1 A;  3UIO C;  5ANR A;  4BWR A;  1K1A A;  3QKY A;  4J8D A;  4U07 A;  3VTX A;  4GAA A;  2XGM A;  2P2C P;  5CMW A;  4G2V A;  3ML8 A;  4N39 A;  3RO2 A;  1ELK A;  2H6F A;  3FUN A;  3TWT A;  4MBG A;  3PNL B;  4UQY A;  1MQS A;  4QQI A;  3ESL A;  2EIL E;  1E7U A;  3ZUV B;  5BXU A;  3AG3 E;  2LXL A;  3JUE A;  3W9G A;  4UQX A;  3G2S A;  3NBN B;  4RQI A;  3S7F A;  1O1S A;  5EKQ D;  1JWG A;  2QZA A;  4HLE A;  3MYV A;  1OWN A;  1JUQ A;  4G25 A;  3QOU A;  4BSX A;  1OCC E;  5HRY A;  2LAH A;  2CHW A;  2P9S G;  1TNU A;  4GTO A;  2Y4U A;  2V8S E;  3UT7 A;  2HR2 A;  2GRP B;  2VSN A;  1N9A A;  4UWL A;  1S70 B;  4UWK A;  1BLX B;  3FUL A;  3DSU A;  3MKR A;  4I17 A;  4KYO B;  2P9P G;  3ONK A;  3FUM A;  4LEU A;  2XEN A;  3FEY A;  4HI8 A;  1H2U A;  4GTT A;  3CVW A;  3W9F A;  4J7W A;  5KNG A;  3E33 A;  3MZL B;  1HH8 A;  1S64 A;  1UJK A;  4L7T A;  4JHK A;  4XX5 A;  4A1G A;  1KPS B;  3Q73 A;  3Q78 A;  2X6K A;  4Y6C A;  3ISM C;  1AP7 A;  3HYM B;  2V5Q C;  3D9J A;  4WNF A;  4A1S A;  3E4B A;  2C0M A;  2XPY A;  1TYQ G;  2GRQ B;  4HVB A;  2L6J A;  4I43 A;  2R17 C;  4GTM A;  2XEV A;  4ME2 A;  3ML9 A;  1DVP A;  3AAA C;  1Y6I A;  3E34 A;  2Y69 E;  1N54 A;  2UWJ G;  4DK5 A;  4XI9 A;  2EIM E;  2L9B A;  1KZO A;  3Q49 B;  3APC A;  4I6J A;  4DI4 A;  2DYS E;  2P9N G;  2MRI A;  1DCE A;  2V5F A;  3SFY A;  3ASO E;  4N3B A;  3J5Q B;  3ZNG A;  2YQ8 A;  5EIB E;  3HDX A;  4DX7 D;  1N4P A;  2QY7 A;  2BUG A;  3WG7 E;  4GZ3 A;  3LVR E;  2NYJ A;  3KSL A;  3ZU7 B;  4W9R A;  4G11 A;  5LCW C;  4TXQ A;  4O1P A;  4O60 A;  2DZN A;  4JEU A;  1TNY A;  2QYJ A;  1WM5 A;  1D8E A;  2WXK A;  2GRR B;  3V31 A;  3I4G A;  2YHC A;  2FI7 A;  2WMN A;  4J8S A;  3FUE A;  1OT8 A;  1N95 A;  5AN8 A;  5KJN A;  1E8X A;  3UX4 A;  1UN9 A;  4LSZ E;  3PNT B;  2J8S D;  4BTB A;  3K9I A;  3CST A;  4GCN A;  4ACL A;  3DST A;  3CIA A;  2J07 A;  4UUC A;  3CVN A;  2RD0 A;  4JL0 A;  2L0I A;  2PNN A;  2ZGG A;  3FH8 A;  3UIN C;  1MX6 A;  3SHF A;  3SD5 A;  3BQO A;  1EYH A;  3UI2 A;  4OAV B;  5BV0 A;  1S0P A;  4I9C A;  3MV3 B;  2MHK A;  4LNB A;  3D9L A;  3VLD A;  1ZU2 A;  3TWW A;  2GGF A;  3JXJ A;  2IOL A;  2ETA A;  2KCK A;  2AVP A;  5ENP D;  1U3D A;  4J8E A;  1ZB1 A;  1NA0 A;  2CFZ A;  4G23 A;  3Q75 A;  1RW2 A;  4GB9 A;  2LNI A;  2ZGD A;  3LDZ A;  1HU3 A;  4BEP A;  1WDY A;  3ABM E;  2EQX A;  2EIJ E;  3HXC A;  2XRY A;  3EU5 A;  5EIL A;  4IYP A;  1A17 A;  1UN8 A;  3ZHE A;  2F8X K;  2VJ8 A;  2WXO A;  2WXJ A;  4U8Y D;  4TRQ A;  2EIN E;  1IQR A;  3RSE G;  4M7C A;  3HIZ A;  3PZ2 A;  2WXR A;  3QC1 A;  1H2V C;  2FF4 A;  4ANX A;  2FUL A;  1LTX A;  3MKQ A;  4FAD A;  4ACK A;  3RJV A;  2LUH A;  2EIK E;  2GRM A;  2XPZ A;  3UKR G;  2DYR E;  2YIN A;  3CHQ A;  3T5X A;  2WQH A;  4NUR A;  3CK9 A;  5T3R A;  1SQM A;  2AXU A;  2V4H C;  4GML A;  5DIZ A;  3FH5 A;  1FVH A;  2HE0 A;  4ANV A;  4N3A A;  4Z68 A;  1K1B A;  3CGH A;  4CRW A;  1OWM A;  2R2L A;  5JHB A;  4GZD A;  4I9E A;  3CVY A;  2X6H A;  3D9P A;  3SZ7 A;  4HB5 A;  2CHZ A;  3RU0 A;  2WXH A;  5KWD A;  4WWN A;  3ABL E;  3JYS A;  2WXN A;  4MLP A;  4XZ4 A;  4A63 B;  4CZ2 D;  3T8K A;  5ARF A;  1BU9 A;  2X3M A;  3EU9 A;  4GTR A;  4ZHB A;  2BKG A;  2R03 A;  3KAE A;  1HO8 A;  3UT8 A;  3QNK A;  3L54 A;  4LNU D;  3TG4 A;  3ZGQ A;  3E32 A;  3D9I A;  2WQ6 A;  3FHE A;  5EDS A;  1TN7 A;  4QFV A;  2ION A;  4BES A;  2WXI A;  4I1O B;  4KVM A;  3IXE A;  5CER B;  4DX6 D;  2AJA A;  3R7Q A;  3MX3 A;  2RKK A;  4PDX A;  3NOC D;  3V30 A;  1FT1 A;  4FLH A;  1O1R A;  4O1O A;  2WVI A;  5LOZ A;  2IY0 C;  3JQ0 A;  1DC2 A;  2IEJ A;  5G55 A;  2M63 A;  1TR4 A;  3L16 A;  4Y6W A;  2CG2 A;  4N3C A;  4DI3 A;  3B95 A;  2NSZ A;  3AS5 A;  2WB2 A;  5JA4 D;  4B93 B;  3TWQ A;  3CLJ A;  1Z3Y A;  2YNQ A;  4B8A A;  3LVQ E;  4AIF A;  3FU0 A;  5G05 C;  3QJZ A;  3FUD A;  2NXP A;  3PDN A;  3ZHE B;  5CBO A;  4KMO A;  3SFX A;  2WXM A;  3TG5 A;  4UWF A;  3C72 A;  2ZU6 B;  5B1A E;  3HG0 D;  1A5E A;  3S2A A;  1NI1 A;  4U8H A;  4CYM D;  4PUC A;  3MKQ B;  2RFA A;  3QAQ A;  5CRV A;  1JWF A;  5E75 A;  1LF8 A;  4F1P A;  2AW6 A;  4U95 D;  5IY5 E;  2B0O E;  3PUJ A;  4JPS A;  2E2E A;  2IFU A;  1TN6 A;  1BD8 A;  4HBD A;  5BNW A;  2X6I A;  1WAO 1;  2J4D A;  5ITZ F;  3FTY A;  2XS8 A;  4YDW A;  5ENR D;  4JA9 A;  1JCQ A;  1DNP A;  1Z3X A;  3PE4 A;  4UI9 J;  3Q5M A;  4ANW A;  1N52 A;  5B1B E;  3C5R A;  1UJJ A;  3JUI A;  5AAO A;  3ASF A;  4KT6 B;  2CFU A;  1UOH A;  3D9H A;  4U7E B;  4DX2 A;  3ZIM A;  5CBN A;  3CQC B;  1GW6 A;  2AXV A;  3EUV A;  3PS6 A;  2XCB A;  2IF4 A;  3CHM A;  2BTD A;  4GA0 A;  1FCH A;  4X8Q A;  3Q4A B;  3ENE A;  4NQ0 A;  4BET A;  4N2Q A;  1MX2 A;  5BT1 A;  4XEI G;  3UM1 A;  2C0L A;  2PM6 A;  5C1D A;  1HZ4 A;  3F6Q A;  4D10 C;  3UXG A;  3CHS A;  3B7B A;  1EDU A;  5FZR A;  1JPL A;  4A3T A;  1IHG A;  2ETC A;  3CVU A;  3L9T A;  1D8D A;  5CCL A;  1BI8 B;  5FIO A;  4A3V A;  1D9S A;  3FU6 A;  3PEV B;  2KCV A;  2J9Q A;  2QYU A;  3TXN A;  3GW4 A;  4GTP A;  3MV2 B;  3LY8 A;  4F53 A;  3QWP A;  3AG4 E;  5FT9 A;  4MRU A;  2CG3 A;  1ZBP A;  2XQ0 A;  4EHM A;  5HS0 A;  3QDN A;  2VSY A;  5D0O D;  4EZJ A;  3ULQ A;  3CVL A;  3LYA A;  4ILH B;  1OUV A;  3R9M A;  5M72 A;  4LRZ A;  3UT4 A;  5T4Y A;  2H6H A;  5G04 J;  5CHE E;  4UWG A;  5G2N A;  4ILI A;  1N94 A;  1PAQ A;  3RRM B;  3D3M A;  4WND A;  3AJI A;  1FPP A;  3CKC A;  4ATG A;  4NAC A;  4PS7 A;  3SFZ A;  2P9U G;  3HXF A;  4AP2 A;  5JJ7 A;  4CGV A;  1QYM A;  5EYP F;  4OAU C;  2YHE A;  3Q7A A;  2F0Y A;  2ZIR A;  3TWS A;  2KM4 A;  1QNF A;  3ZYL A;  3NAW A;  4GZ6 A;  3EIQ C;  3EJN A;  1S63 A;  1MZC A;  3RIB A;  4CT0 A;  3CHR A;  1KLX A;  3EIJ A;  2L6B A;  3EHR A;  1VDY A;  1LD7 A;  3HXB A;  4GMJ A;  5CEA A;  3Q9U C;  4GU5 A;  4PS3 A;  3J5P A;  4U0S A;  4EQF A;  2IOS A;  3ASG A;  5LX8 A;  1UW4 B;  2DVW A;  3LXU X;  1N4Q A;  3UPV A;  3FFL A;  4DUI A;  5EX3 A;  5EN5 D;  3NZS A;  3AG2 E;  5DBK A;  5CRU A;  2HO1 A;  4UI9 C;  2VGY A;  2VSO E;  2WXQ A;  2ZIS A;  4YND A;  3LS8 A;  4K5B A;  4GYO A;  2FEZ A;  4UQZ A;  2XCC A;  3SY2 A;  4PS8 A;  4TXP A;  3Q47 B;  3NQP A;  3GZ1 A;  4DX5 D;  1IXV A;  4F7A A;  5AJD A;  3P1U A;  3U64 A;  1L5J A;  1E7V A;  1SA4 A;  4U96 D;  2V4L A;  3FUH A;  1WG0 A;  1XGW A;  4HOU A;  4DPR A;  2XZT G;  5KCM A;  3FU5 A;  1QZ2 A;  3UM0 A;  1Y8M A;  1N4R A;  3RAU A;  5FJY A;  2R5S A;  3LEW A;  1LD8 A;  3UQ3 A;  4C0M A;  2X6F A;  4RVB A;  1TJC A;  1BI7 B;  3FTW A;  4U8V D;  5FQ8 A;  1NL4 A;  2A5U A;  3D9K A;  4CDM A;  5FZS A;  3TXM A;  4BY6 A;  2PQN A;  4GMR A;  2VQ2 A;  4AEZ C;  3IV0 A;  4DLO A;  3U9W A;  5AQB A;  2KC7 A;  3OXL A;  1HFA A;  4AY5 A;  2LXM A;  4GTQ A;  3B13 A;  5FIN A;  3SF4 A;  4YVQ C;  3G2U A;  2GRL A;  2KZT A;  4J8F A;  3V79 K;  4J6I A;  3VTY A;  4HNA D;  1NP7 A;  1K3Z D;  4MKT A;  5FWQ A;  4I1M A;  3PRZ A;  2AWI A;  4GYY A;  3FP3 A;  3I4R B;  2GRN B;  3Q79 A;  4U0U A;  5CMY A;  4APF A;  4GYW A;  4JEH A;  3FUF A;  5G04 C;  1MX4 A;  4EZK A;  3DSX A;  3S7B A;  3ZRH A;  4AJW A;  4DRX E;  4AXH A;  4IUL A;  1H0A A;  3TWR A;  1INZ A;  2KAT A;  1Q2Z A;  3EHN A;  4KZ0 A;  2OEW A; 
#chains in the Genus database with same CATH homology
 4L2Y A;  1JWG A;  4G26 A;  1Z3Y A;  2J49 A;  2YNQ A;  3OXG A;  3B7S A;  4HLE A;  4B8A A;  2IU1 A;  3WXX A;  3MYV A;  2LAI A;  4OYS A;  1U3C A;  1OWN A;  3LVQ E;  4NRH B;  3ZYQ A;  1JUQ A;  3FU0 A;  5G05 C;  2LSU A;  3JCK C;  2E0I A;  3QJZ A;  4G25 A;  4AIF A;  3QOU A;  1PC2 A;  4XKB A;  3FUD A;  4BSX A;  4GZC A;  4JVS A;  4JC8 A;  4XE0 A;  2LAH A;  2CHW A;  1QQE A;  2NXP A;  1P5Q A;  3PDN A;  3ZHE B;  3NF1 A;  5J08 A;  2Y4U A;  3AS4 A;  2I6H A;  3GZS A;  4KMO A;  2V8S E;  2WXM A;  3UT7 A;  2GW1 A;  2HR2 A;  3TG5 A;  4UWF A;  4CT4 A;  2VSN A;  4FU3 A;  2PQR A;  4FC8 A;  4CCA A;  4UWL A;  3AU5 A;  2UY1 A;  2ZU6 B;  3PVL A;  4CDR A;  4IN3 B;  2MOW A;  3S2A A;  2VGX A;  4E6H A;  4UWK A;  2I9C A;  3B7R L;  3FUL A;  4U8H A;  4U0Z A;  2WXP A;  4PUC A;  3MKQ B;  3ONL A;  3FUJ A;  4KXK B;  3MKR A;  4XI0 A;  3U66 A;  4I17 A;  4WWO A;  2Q7F A;  4G24 A;  3ONK A;  3FUM A;  3I3N A;  4KYO B;  4LEU A;  4C0E A;  3L22 A;  3EDT B;  1NA3 A;  3FEY A;  4JHJ A;  3QWV A;  4FJY A;  4CGW A;  4DLQ A;  4GZ5 A;  3ZYK A;  3MA5 A;  3QAQ A;  3CVV A;  1JWF A;  1H2U A;  2X38 A;  5JHA A;  3CVW A;  3LCA A;  5E75 A;  2ILR A;  1LF8 A;  2AW6 A;  3URZ A;  4TV3 A;  3FTV A;  3MZL B;  1HH8 A;  3QAR A;  3PUJ A;  4JPS A;  1UJK A;  2E2E A;  2IFU A;  4FUL A;  4L7T A;  2QFC A;  3O4Z A;  4MS6 A;  4JHK A;  4N5C A;  4XX5 A;  4UWH A;  5T8I A;  4XKC A;  1X5B A;  5BNW A;  2X6I A;  5AJL A;  3EHM A;  4A1G A;  5FZQ A;  4DJA A;  3GYZ A;  3O48 A;  4RG9 A;  1WAO 1;  5JJ6 A;  2X6K A;  4I6G A;  4Y6C A;  2RG8 A;  3HYM B;  4EBA G;  2J4D A;  2DBA A;  3FTY A;  3D9J A;  4JA7 A;  4FHJ A;  3PUK A;  4JA9 A;  4LCT A;  4WNF A;  4AVX A;  4EEC A;  3AS8 A;  4A1S A;  3D9N A;  3E4B A;  3GZ2 A;  1W3B A;  2C0M A;  1DNP A;  2XPY A;  5HI7 A;  2WXF A;  3P2B A;  1Z3X A;  4HVB A;  2L6J A;  4I43 A;  4TUU A;  2R17 C;  3FTS A;  3PE4 A;  3RK6 A;  4UI9 J;  3Q5M A;  2XEV A;  4KVO A;  2OVB A;  3ML9 A;  4ME2 A;  1DVP A;  3ZVV A;  4URK A;  1TJF A;  2J09 A;  5LP0 A;  4ANW A;  3LJ3 A;  3ZXS A;  1Y6I A;  1N52 A;  4H7Y A;  3FTZ A;  3FUI A;  4AY6 A;  1BPO A;  1UJJ A;  1N54 A;  1OWO A;  3JUI A;  2NC9 A;  2UWJ G;  4CDN A;  4XI9 A;  4DK5 A;  3ASF A;  3TGO A;  4KT6 B;  3U4T A;  2L9B A;  3Q49 B;  2CFU A;  2L0T B;  4BT8 A;  2I1J A;  3BG0 B;  3LY9 A;  2CHX A;  3VLF A;  3APC A;  4B89 A;  4I6J A;  4DI4 A;  3ZIM A;  2MRI A;  4B94 A;  5G05 J;  2V5F A;  2XGO A;  3B7T A;  3CQC B;  4N3B A;  1GW6 A;  4I6E A;  2AXV A;  2YQ8 A;  3PS6 A;  4L2L A;  2XCB A;  4JHR A;  2WM9 A;  3HDX A;  2IF4 A;  2PZI A;  3CHM A;  2QY7 A;  2BUG A;  2R59 A;  4GZ3 A;  2KZT B;  3LVR E;  5BUZ A;  2BTD A;  4GA0 A;  2I2O A;  1FCH A;  4W9R A;  4G11 A;  5LCW C;  3Q4A B;  3ENE A;  3SBS A;  3RRU A;  4LER A;  3FU3 A;  4E85 A;  4NQ0 A;  4JEU A;  3VLE A;  4B0Z A;  4N2Q A;  4I1A A;  4V3I A;  5BT1 A;  1WM5 A;  3HVE A;  2WXK A;  3PEU B;  2C0L A;  2C2L A;  3PZD A;  3ZEF A;  2PM6 A;  3CKB A;  5C1D A;  1HZ4 A;  2XHE A;  2J08 A;  3I4G A;  4D10 C;  2YHC A;  4JXT A;  3CSF A;  3CHS A;  1HXI A;  3G2T A;  2FI7 A;  3MCX A;  2WMN A;  1H19 A;  4J8S A;  3L6A A;  4U04 A;  1EDU A;  3FUE A;  3DPD A;  5FZR A;  4RG6 A;  1JPL A;  4A3T A;  5KJN A;  5KJK A;  1HE8 A;  1IHG A;  4EBA A;  4OVU A;  1E8X A;  2IJG X;  4K0R A;  3CVU A;  3UX4 A;  4EPZ A;  2OV8 A;  1UN9 A;  4LUN U;  3IHV A;  2VYI A;  3PNT B;  3I5P A;  3QB2 A;  4BTB A;  5CCL A;  1HG2 A;  3K9I A;  3CST A;  3HHM A;  3PE3 A;  4FLB A;  3SI5 A;  4PH4 B;  4A3V A;  1HX8 A;  4AM9 A;  1H6K A;  3FU6 A;  3PEV B;  4GCN A;  4ACL A;  5CCM A;  1UG3 A;  3TL5 A;  4WWP A;  2KCV A;  3CIA A;  2I1K A;  1HG5 A;  2J07 A;  4P29 A;  3S7J A;  3CVN A;  2J9Q A;  2RD0 A;  3DBS A;  3TXN A;  3GW4 A;  5BV1 A;  1KT0 A;  5LFA A;  4JL0 A;  4O6F A;  3MV2 B;  3S7D A;  3R9A B;  3MGB A;  3LY8 A;  4F53 A;  3QWP A;  2JLB A;  2L0I A;  5FT9 A;  4MRU A;  2CG3 A;  4GCO A;  4HS2 A;  1ZBP A;  2XQ0 A;  4FP7 A;  3QDN A;  2VSY A;  5D0O D;  1OWP A;  1SZ9 A;  3RKV A;  4EZJ A;  3ULQ A;  2VTB B;  3CVL A;  1TEZ A;  3L13 A;  3BG1 B;  3LYA A;  3CQG B;  4ILH B;  3FH8 A;  3SHF A;  3BEE A;  5BPP A;  1OUV A;  3SD5 A;  5M72 A;  4LRZ A;  2VTB A;  3UT4 A;  3AU4 A;  5T4Y A;  3FH7 A;  1EYH A;  2UY1 B;  2LSV A;  5G04 J;  4HOR A;  5CHE E;  5FQ7 A;  1E8Y A;  4J0U A;  2VGX B;  3CVX A;  4UWG A;  1IQU A;  3PH0 C;  5BV0 A;  3NZU A;  1S0P A;  4I9C A;  5G2N A;  3MV3 B;  4ILI A;  2MHK A;  5ARG A;  3U3W A;  1PAQ A;  3D9L A;  3VLD A;  3OXF A;  1ZU2 A;  2HYZ A;  4HXI A;  2Y4T A;  4KZC A;  3RRM B;  3D3M A;  4L1B A;  4WND A;  5FTP A;  2IQC A;  2GGF A;  4HOQ A;  3CKC A;  4ATG A;  4NAC A;  1HF8 A;  4AV7 A;  4PS7 A;  3SFZ A;  4AP2 A;  3LPZ A;  3L17 A;  4WUY A;  5JJ7 A;  2IOL A;  4CGV A;  1XNF A;  3TJP A;  3SBT B;  2AXZ A;  2KCK A;  2AVP A;  5AIJ A;  2YHE A;  1ELW A;  1ELR A;  1U3D A;  2KM4 A;  5FQ6 A;  4B8C B;  4CEM A;  5A6C A;  1NZN A;  3UUX A;  2P58 C;  3ZFW A;  4J8E A;  4N2S A;  1QNF A;  3ZYL A;  4GZ6 A;  1NA0 A;  3EIQ C;  2CFZ A;  3EJN A;  3Q15 A;  3RIB A;  4G23 A;  4CT0 A;  4GPK A;  4Q96 A;  3CHR A;  1KLX A;  3EIJ A;  1WY6 A;  4GB9 A;  2LNI A;  4L23 A;  1VDY A;  3R7R A;  3ASD A;  2J4B A;  4XIF A;  3LDZ A;  4GMJ A;  5ANL A;  4APO A;  4GU5 A;  1FVF A;  4PS3 A;  2PL2 A;  4F3V A;  1HU3 A;  3ASH A;  2XGS A;  4H7X A;  2EQX A;  4U0S A;  2X6J A;  4EQF A;  3IHY A;  1EF1 C;  5HQ8 A;  4HOT A;  2IOS A;  3ASG A;  4BT9 A;  2XRY A;  5LX8 A;  1UW4 B;  4WNE A;  1IYG A;  3LXU X;  3LKU A;  4IYP A;  1A17 A;  4FHK A;  3QWW A;  3B7U X;  1UN8 A;  1OWL A;  3UPV A;  3FFL A;  4I2W A;  3ZHE A;  2WXL A;  5EX3 A;  2VJ8 A;  2WXO A;  2WXJ A;  3NZS A;  4BX9 A;  3C98 A;  4TRQ A;  5DBK A;  2HO1 A;  1IQR A;  4M3O A;  4UI9 C;  4KBQ A;  2VGY A;  3HIZ A;  1E96 B;  2V0P A;  2VSX E;  2VSO E;  2BF0 X;  2WXQ A;  3KEZ A;  4YND A;  4AOF A;  5A23 A;  4RSY A;  4Q69 A;  3LS8 A;  5J90 A;  5A7D B;  4HOS A;  4GYO A;  3FWV A;  2WXR A;  3CK7 A;  3QC1 A;  2FEZ A;  1H2V C;  4UQZ A;  2FF4 A;  2XCC A;  2FUL A;  4ANX A;  3MKQ A;  3CV0 A;  4ANU A;  4FAD A;  4ACK A;  3RJV A;  5AYW D;  4PS8 A;  3Q47 B;  3NQP A;  3D9O A;  3GZ1 A;  3CVP A;  2OVF A;  2DCP A;  3D9M A;  4F7A A;  2GRM A;  4HFG A;  5AJD A;  3SGH A;  2XPZ A;  3FUK A;  3P1U A;  3U64 A;  1B89 A;  1L5J A;  1E7V A;  3HVE B;  4Q94 A;  2V4L A;  3FUH A;  4WNG A;  4ABN A;  2JEK A;  1XGW A;  3KS2 A;  3ZYM A;  4HOU A;  3KD7 A;  3IKO B;  3T8M A;  2YIN A;  3CHQ A;  3T5X A;  2WQH A;  4BTA A;  4NUR A;  4DPR A;  3CK9 A;  5T3R A;  1SQM A;  5KCM A;  3FU5 A;  2KCL A;  3QK0 A;  2AXU A;  1QZ2 A;  5JJT A;  3G2V A;  4R7L A;  5KJL A;  2WQ7 A;  2XRZ A;  4GML A;  1E90 A;  5DIZ A;  3FH5 A;  1FVH A;  1Y8M A;  4ANV A;  3RO3 A;  4BX8 A;  5FJY A;  4N3A A;  3ESK A;  2R5S A;  3CVQ A;  4OVV A;  3LEW A;  1SZA A;  3CEQ A;  3CGH A;  3TAX A;  4CRW A;  1OWM A;  4WAF A;  3T5V A;  3UQ3 A;  5JHB A;  2LO6 A;  2XPI A;  4GZD A;  4I9E A;  3CVY A;  2FO7 A;  1E8Z A;  2DIW A;  1MHQ A;  5EX0 A;  4JW1 A;  5E76 A;  4C0M A;  5KJM A;  1Z6T A;  2X6H A;  3D9P A;  2X6F A;  4RVB A;  3SZ7 A;  3CK8 A;  2CHZ A;  1TJC A;  2PM7 A;  3FY4 A;  3RU0 A;  3FTW A;  2WXH A;  4G1T A;  5FQ8 A;  4C9B B;  2HM8 A;  4WWN A;  3JYS A;  3D9K A;  2A5U A;  2WXN A;  3OTN A;  4CDM A;  5FZS A;  5C2Y A;  4MLP A;  3TXM A;  4YVO A;  4BY6 A;  4UI9 K;  2A4Z A;  1KT1 A;  2PQN A;  3APD A;  2Y3A A;  2WXG A;  4GA2 A;  4XZ4 A;  5LCW J;  5ARF A;  3APF A;  4A55 A;  4BFR A;  1H2T C;  3ZN3 A;  3IEG A;  3G2W A;  2VQ2 A;  2X3M A;  3IV0 A;  4JZY A;  4AEZ C;  4DLO A;  5D0Q D;  3U9W A;  4I2Z A;  4IRU A;  3OAW A;  2KC7 A;  3OXL A;  1HFA A;  3KAE A;  4AY5 A;  1HO8 A;  3PRE A;  2FBN A;  3B13 A;  3UT8 A;  3QNK A;  3SF4 A;  3L54 A;  4YVQ C;  4FA6 A;  4GA1 A;  3G2U A;  4K03 A;  3TG4 A;  3ZGQ A;  2GRL A;  2KZT A;  3SNX A;  3D9I A;  2WQ6 A;  4J8F A;  5AEN A;  3FHE A;  4J6I A;  5EDS A;  4QFV A;  4ILG A;  2OOE A;  2OND A;  3RRN B;  2ION A;  3VTY A;  3CHP A;  3MEK A;  1NP7 A;  3LY7 A;  4MKT A;  2WXI A;  4I1O B;  5FWQ A;  4I1M A;  3PRZ A;  4KVM A;  5ANR A;  3CR3 A;  4BWR A;  3R7Q A;  2AWI A;  3MX3 A;  3QKY A;  4GYY A;  4J8D A;  4U07 A;  3FP3 A;  4EZL A;  3I4R B;  5ENN A;  4PDX A;  1PY1 A;  4U0U A;  5CMY A;  4APF A;  1HS6 A;  4GYW A;  4GAA A;  4JEH A;  3VTX A;  3ZW3 A;  1E8W A;  3FUF A;  2XGM A;  5G04 C;  4EZK A;  4FLH A;  5CMW A;  4G2V A;  2WVI A;  3ML8 A;  4N39 A;  4U63 A;  5LOZ A;  3S7B A;  3RO2 A;  1YA0 A;  3JQ0 A;  3JQ1 A;  3ZRH A;  1ELK A;  4FJZ A;  3FTU A;  4AJW A;  3FUN A;  3ZPJ A;  5BW8 C;  3FEX A;  5G55 A;  3PNL B;  2M63 A;  4UQY A;  4AXH A;  1MQS A;  4IUL A;  5FQ4 A;  3ESL A;  2WMO A;  1EPU A;  1E7U A;  3L16 A;  4Y6W A;  3UMV A;  1H0A A;  2CG2 A;  4N3C A;  4DI3 A;  4F1S A;  2NSZ A;  3IBE A;  3FDH A;  3AS5 A;  2WB2 A;  1INZ A;  3N71 A;  4UQX A;  3MJW A;  2KAT A;  3CHO A;  3EHN A;  3G2S A;  3FTX A;  3S7F A;  3CLJ A;  3L08 A;  2WPV A;  4KZ0 A;  5EKQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...