4GMJA

Structure of human not1 mif4g domain co-crystallized with caf1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
HMLEENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords CCR4-NOT transcription complex subunit 1
total genus 82
structure length 229
sequence length 229
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gmjA00
4CT4A 1H2UA 2FULA 2NSZA 2IOLA 2KZTA 2VSOE 5ANRA 4CRWA 2HM8A 2IU1A 4B8CB 1H2VC 1PAQA 3L6AA 1HU3A 3EIJA 2I2OA 1H6KA 2IONA 1N54A 3EIQC 4IULA 2ZU6B 4C9BB 2GGFA 1N52A 4JHKA 2IOSA 1UG3A 2VSXE 4JHJA 4GMJA 4B89A 3D3MA 3RK6A 4LUNU 2RG8A 3FEYA 4CEMA 3FEXA 1H2TC 1UW4B 3JUIA 4B8AA 2KZTB 4GMLA
chains in the Genus database with same CATH superfamily
4FHJA 1LTXA 4HOQA 2VSOE 4U8VD 2XEEA 1MX4A 1NFIE 1PY1A 3OXFA 3ESLA 3SFZA 2DCPA 4ME2A 4Q96A 3BG1B 5T3RA 4XIFA 1JCSA 3E33A 4JPSA 1TYQG 2C0MA 2RD0A 4LCTA 5HRYA 3S7DA 3TWUA 3K9IA 3FUNA 2X38A 5HI7A 4D10C 3L82A 1RZ4A 3TWXA 2RKKA 4PS7A 1Z5SC 1H6KA 4U8YD 2CFZA 3B7UX 1H6PA 3FULA 4GZ5A 4WWPA 2QC9A 2GRLA 4DI4A 2BEDA 3CHQA 1KT0A 2XCBA 1E7UA 4UWHA 4FULA 1XNFA 3MYVA 4LEUA 4CCAA 5AIJA 1OUVA 3MJWA 4J6IA 5A23A 3AS4A 4FJYA 2YHCA 3Q7AA 3P1UA 1Z6TA 4BESA 3SHFA 4ILHB 3CHOA 2V0PA 3CVUA 4EBAA 1X81A 1U3DA 3QC1A 3JXIA 2UY1B 3EDTB 2IFUA 5AJLA 1PAQA 4TUUA 3GYZA 1S70B 2F8YA 4AOFA 4BEPA 2XS1A 3HHMA 3SBTB 1P5QA 3J5PA 2A5UA 4LSZE 5LOZA 5EYPF 1HS6A 2ZGDA 4EZJA 1TJCA 2LO6A 4KBQA 2MRIA 3R9MA 2IO3C 3ZRHA 4L7TA 4E85A 3S2AA 3Q47B 1OWOA 5CECB 2YHEA 4UWGA 3I3NA 3ZNGA 5T4YA 5FIOA 2GROB 4EHMA 5G05C 5FQ8A 1WY6A 3TG4A 4YDWA 1NI1A 4NIKA 4UQXA 2WQ7A 5CERB 5KWDA 3GW4A 3UI2A 1OCCE 3ISMC 2DBAA 3S7FA 4HB5A 4I2ZA 5G05J 3KAEA 3RRMB 1ELWA 1K8KG 5HQ8A 5LX8A 2XS8A 4A3VA 2QYUA 4AXHA 4AIFA 5CEDB 4HI9A 4JA7A 3E32A 2WMOA 4GPMA 2JLBA 3FUJA 3FH5A 4CGVA 3SZ7A 1X5BA 3ULEG 4XZ4A 4WWOA 5EX3A 2WXNA 5D2MC 4YDOA 2WMNA 3QDNA 3PE3A 4K5BA 1EF1C 1FT2A 2P9SG 3ZEFA 1QQEA 4BTBA 1N4QA 3CK8A 5EIBE 3I5PA 3KS2A 5H7PA 4I1MA 1UN8A 2XEVA 4LERA 3ONKA 4GZCA 2JABA 4R7LA 5EILA 5BV1A 4F7AA 3UM1A 4HFGA 1E8ZA 3NF1A 3Q4AB 3PZ3A 1BD8A 3F6QA 2I1KA 4U8HA 3HXDA 2F0YA 3EJNA 1OT8A 1HF8A 3QKYA 2WQHA 4AP2A 4OAUC 3RAUA 5B1AE 5AQ9A 2DVWA 4OVVA 3VTXA 4G25A 1O1TA 2LNIA 1AWCB 2BTDA 1H2UA 2NSZA 3QOUA 3AG3E 2VGXA 4RSYA 3ZKJA 2EIME 3GZSA 3EIJA 4GYYA 3JCKC 4RG6A 3RSEG 3PUKA 5HKPA 3CHMA 2YNQA 3LKUA 3E30A 3ASOE 3HVEB 1UJKA 5KJMA 4HOTA 4UQYA 2IOLA 3DEOA 4JW1A 3TWTA 2VSNA 4KT6B 3FU0A 2XCCA 1E96B 3Q15A 4JB8P 4U0UA 3NQPA 3CHPA 4N5QA 3LVRE 3G2SA 3EU9A 4FC8A 4ZFHA 1UN9A 2HYZA 2P9NG 4AEZC 3TXMA 1ZB1A 4DPRA 3MEKA 3SI5A 2KM4A 2L0IA 4LNGA 4EPZA 3DSTA 1Y6IA 4ACKA 5FQ7A 3HDXA 3UM3A 4U0SA 5JJ7A 1WDYA 3CV0A 2DYRE 3CVYA 2H6GA 2EIKE 1MX6A 3E37A 3HXEA 3D9HA 5KJLA 3G2WA 4GZDA 2V5FA 4CGWA 3RKVA 1IHGA 3Q75A 3IEGA 4KMOA 4GAAA 5BV0A 3L9TA 1NZNA 3AS5A 2ZIRA 3QB2A 4P29A 5LP0A 1KZOA 4I1AA 2FI7A 2X6KA 1IQUA 1N94A 4WWNA 4GTPA 3UT7A 3VLDA 2WXQA 2Y0BG 3LPZA 2PNNA 2MYOA 4KYOB 2F8XK 3HXFA 2XRZA 3CK7A 2EQXA 5D0OD 3CSFA 4GU5A 3ASNE 3MCXA 2VJ8A 1HXIA 3U3WA 3PREA 1HU3A 3QARA 1NA0A 5LCWC 3QNKA 5AQ7A 3ASGA 3GZ2A 1FCHA 1N4SA 3UKUG 3SFXA 4J8SA 4BT8A 4EECA 3FTUA 1H6OA 4GZ6A 2DWZA 5AQBA 3C98A 4JEHA 3D9OA 4U96D 2WXKA 2X6IA 1JWGA 3AG1E 4UI9J 2PQNA 2PZIA 2P9LG 4BX8A 4G11A 2WXLA 1MX2A 4CZ2D 3FTVA 3B7TA 4JL0A 1Y8MA 3RO3A 4L2LA 3UUXA 3SF4A 1K1BA 4EZKA 3LXUX 4UQZA 3PZDA 2KBXA 4RVBA 2IO2C 4GTVA 5B3SE 2AVPA 3ABLE 2PL2A 1TEZA 4B8AA 3S7JA 4A1SA 2V5QC 1NL4A 4AJWA 3KEAA 4CYMD 2V4LA 5ENNA 4AY6A 2VGYA 3JUEA 4G8LA 4LUNU 4GCOA 5G04J 3NOGD 4GYWA 4XEIG 4MLPA 1IQRA 3TWVA 1EYHA 4FP7A 3ZIMA 2IJGX 4NRHB 3FUDA 3U64A 2OEVA 3T8MA 4HNAD 4HQDA 2L6BA 3ZN3A 2AWIA 1D8DA 3KSLA 4ANVA 2L9BA 1SVXA 3EHMA 3AG2E 2FEZA 4TV3A 1S64A 4GB9A 5BPPA 5FJYA 4XKBA 3BU8A 1KT1A 4KZCA 1BLXB 3CVLA 1SZAA 4APFA 5EYLA 1ZU2A 2NC9A 1S63A 3TL5A 2QYJA 1Q2ZA 2MOWA 2IF4A 1E8YA 3KSQA 3EUVA 3Q78A 3HG0D 4UWFA 3L16A 3LYAA 5CCLA 2Y1LE 4JEUA 1Z3YA 4CRWA 3AS8A 4U04A 3CHSA 4GA0A 1TNYA 1TN8A 3ZVVA 5CEAA 4N2QA 4URKA 1HX8A 3APCA 3GZ1A 3ASFA 4HBDA 3V30A 4F1PA 3JQ1A 1V54E 4FADA 3T8KA 1LD8A 5ITZF 3TAXA 1WAO1 2BKGA 4IRUA 1ELKA 3UMVA 4K03A 2V4HC 3FHEA 1JUQA 3FUHA 3SY2A 3VLFA 3DBSA 4OVUA 3ULYA 1HH8A 4F53A 3SBSA 4G8KA 4N2SA 4DX1A 2VYIA 2I6HA 1N4PA 4NURA 2B6CA 3NOCD 4JHRA 5EX0A 2VGXB 2IONA 4PS8A 2WVIA 2R2LA 4CDRA 4M3OA 2R17C 1JCQA 3LJ3A 4XI0A 2B0OE 1UW4B 2J9QA 3D9NA 3IHYA 3LCAA 3MV2B 2DIWA 1QYMA 4G26A 4UUCA 4ABNA 3RU0A 3CVVA 3B7RL 1BU9A 3PZ4A 2P9PG 1TR4A 2XGSA 4PUCA 2ZISA 3JYSA 5J08A 3O4ZA 3KD7A 4BT9A 4DJAA 4W9RA 5FQ4A 1VDYA 4IULA 3ZYKA 2LSUA 3OAWA 3ONLA 5BT1A 3UQ3A 3QAQA 3RJVA 4MRUA 5JHBA 4MS6A 2VSXE 3L54A 4DUIA 2ETBA 3D3MA 3LVQE 2UWJG 5ARGA 2Q7FA 2VQ2A 3PH0C 4RG9A 2Y69E 1TNOA 2L0TB 2OEWA 4XE0A 4DX7D 4K0RA 3D9LA 2P2CP 5CBNA 3EU5A 3P2BA 2XZDG 1IYGA 3ABME 3FTSA 5EKQD 4BFRA 4F3VA 4DX2A 2ZGGA 4GCNA 1D9SA 2XRYA 3CVXA 4U0ZA 3PZ2A 5CRUA 2CHWA 3UM2A 4K5AB 5FZRA 3DWLG 5G2NA 2P58C 2WQ6A 1WG0A 3R7QA 1KLXA 4BETA 1Z3XA 4B93B 1OCRE 3Q9NC 2WXMA 4A55A 3UKRG 1RW2A 3HXCA 3UT8A 3FUKA 2QZAA 4DLQA 2H6HA 3CLJA 4DI3A 4CEMA 3FU5A 2A4ZA 3PDNA 5E76A 2KCKA 4XI9A 3HRAA 4L9PA 1MJ0A 4QQIA 3R7RA 2E0IA 4XKCA 4JC8A 4WNFA 5KNGA 4BERA 4O6FA 5LFAA 3UPVA 4HRMB 3FTZA 3MX3A 3OXLA 4KZ0A 3G2VA 3JUIA 4I6EA 3TJPA 3LY8A 2DZNA 2CG3A 3SO8A 2ETAA 3ENEA 5AYWD 2R05A 3ZXPA 4LNUD 2GRMA 4GA2A 3QWPA 4B89A 3CIAA 3V79K 4F1SA 4GMLA 3ZW3A 1O5MA 3VTYA 1WM5A 3C3QA 1EPUA 4U07A 2GRNB 2P9UG 4GTTA 1HG2A 2C0LA 2WB2A 5BXUA 1YYHA 4QFVA 1YMPA 3FUMA 4WNEA 3DSWA 5ANRA 3V2OA 2OVFA 2XPZA 5BNWA 3Q5MA 2IU1A 3RIBA 1KPSB 4WAFA 3ABKE 3U66A 3UT4A 5ENOD 2GGFA 2OV8A 4ATGA 4KXKB 2ZXWE 4HLLA 2J09A 1MQSA 4N5CA 2AW6A 4U95D 5FT9A 3FUIA 3Q73A 4BSXA 3Q49B 4FHKA 4EZLA 2KATA 4N3CA 2F37A 4G1TA 5JMND 4NACA 2YQ8A 1N95A 3ZUVB 4I6GA 4J0UA 2R59A 1IKND 4GYOA 4PDXA 3RK6A 2RG8A 5CCMA 3FUFA 4WUYA 4G2VA 4CT4A 1IHBA 2I1JA 3QWWA 1ZBPA 4I9EA 3G2TA 1SZ9A 2QFCA 1LD7A 4JHJA 4YVQC 3D9KA 3URZA 3FDHA 4O60A 1OXJA 4N3AA 4CDMA 5JA4D 3CKCA 3UXGA 1QZ2A 4K5CA 3HIZA 5KNHD 3PNLB 2ZU6B 2BUGA 3U4TA 5CRVA 3ML8A 3EHNA 3DSVA 4AV7A 4A1GA 1QNFA 5A6CA 4L1BA 3VLEA 4Y6CA 3ML9A 3CEQA 4YNDA 3CVNA 3V2XA 3SFYA 3L08A 3CGHA 3ZFWA 4AM9A 3PEUB 1FVFA 1HO8A 3AG4E 3AAAC 1FVHA 2XPYA 3CQGB 5D0QD 4I17A 1S0PA 2A5EA 1L5JA 4DLOA 1HZ4A 1OY3D 4H7YA 4APOA 1W3BA 3TGOA 4RLYA 4LG6A 1SQMA 2CHXA 3FTWA 3TWQA 3Q9UC 5IY5E 2AJAA 3T9KA 4I6JA 3W9GA 2PQRA 3W9FA 2I9CA 4TXRA 5CBOA 4DRXE 2ILRA 1INZA 1JPLA 3QK0A 3IBEA 4JVSA 4HI8A 4H7XA 2XHEA 5AARA 4MKTA 3LY7A 2NYJA 4ILGA 3FFLA 3E4BA 1SW6A 2Y4TA 1E7VA 5HS0A 3R9AB 2KZTB 2BF0X 5EIDA 3ASHA 3JQ0A 3RO2A 3MGBA 3APFA 4HORA 3LDZA 1UJJA 4BTAA 2NXPA 2FBNA 2EIJE 2KXPC 3UINC 1UOHA 1OCZE 4IN3B 4CT0A 5FQ6A 4KVOA 2HM8A 2OOEA 3APDA 3ZGQA 4C9BB 1JWFA 1U2VG 4M7CA 4X8QA 3DXKG 1MZCA 1XGWA 3PZ1A 1IXVA 4I2WA 2QY7A 3LY9A 1BI7B 3WG7E 4WNDA 5ENQD 2MHKA 3FU6A 4UWLA 5EN5D 5B1BE 3L6AA 3CR3A 3D9PA 4HRNA 5ENRD 5KCMA 3ZYMA 1TN7A 3FWVA 4I9CA 1N4RA 2WXJA 3L17A 3PE4A 5CHEE 3BG0B 5CMYA 1OWMA 2R03A 1BPOA 1UG3A 3PRZA 5AENA 3G2UA 3N71A 3Q79A 4JXTA 5FWQA 1DCQA 2KCVA 4HS2A 3NZUA 3FEXA 2LAHA 4ANUA 3UTMA 4N3BA 2FF4A 3DEPA 2FO7A 3NAWA 1TJFA 2IQCA 3B95A 3OTNA 5M72A 2RFMA 4IYPA 2HO1A 3S7BA 1KZPA 3HYMB 3MA5A 1O1SA 4C48B 4CDNA 4ACLA 3SGHA 3ZU7B 3OXGA 4C0MA 1SA5A 1ELRA 5AN8A 4B0ZA 3CK9A 3FY4A 3CVWA 5J90A 3EIQC 4LNBA 4DK5A 4GMRA 3U9WA 4DX5D 3HXBA 3MV3B 4G23A 1DCEA 2XGOA 3NBNB 3O48A 3NZSA 4OYSA 3FUEA 5LCWJ 1TN6A 4O1PA 4FU3A 2IY0C 4LRZA 2DZOA 4MBGA 2I2OA 2X6HA 4J7WA 4AVXA 5AQAA 4FJZA 4C0EA 1TNUA 2GRQB 3CVQA 3FTYA 4U7EB 5D66A 5AAOA 1SA4A 5C1DA 3IKOB 1OWPA 4U63A 1FPPA 1H0AA 4GPKA 4YDEA 5ARFA 4J8EA 5ENPD 4GTQA 3TXNA 4Y6WA 4YDYA 2Y3AA 1H2TC 2PM6A 4BWRA 4AY5A 3QWVA 2C2LA 1EDUA 3FTXA 3UIPC 1YA0A 3B7SA 3PNTB 3ESKA 3ZHEB 3DSSA 4OAVB 2WXRA 3ASDA 1A5EA 4FA6A 1MHQA 3DPYA 1V55E 3BQOA 3CHRA 2E2EA 4UI9C 5JJTA 3UIOC 3IV0A 1DVPA 4A3TA 4G24A 3T5VA 4ANWA 4O1OA 1DC2A 1TNBA 2OCCE 3C3OA 5FZSA 4BX9A 2GRRB 2P9IG 2RFAA 1N0RA 3D9JA 3TWSA 4I43A 3CSTA 4HXIA 1QBQA 3UM0A 4HVBA 5A7DB 2X3MA 2ETCA 2H6IA 2X6FA 5ENTD 3BEEA 5ENSD 1JCRA 3D9IA 1N54A 4E6HA 4EQFA 3WXXA 2JEKA 3DSUA 3CKBA 5DBKA 4A63B 4DX6D 5DIZA 3TWWA 4GTMA 2UY1A 1OWNA 1OCOE 2KC7A 5AJDA 4HOUA 4F6RD 4KVMA 2H6FA 3UX4A 3MZLB 4J8FA 3TG5A 3PVLA 3QJZA 3AU5A 3LEWA 2XENA 1LF8A 3DXMG 2WXPA 2GRPB 3ZHEA 2M63A 4GMJA 5KJNA 2WXGA 3ZYLA 2KCLA 2ONDA 3B13A 3J5QB 4PH4B 1BI8B 2L6JA 5JJ6A 2FULA 3DPDA 1E8WA 5JHAA 2P9KG 5CMWA 3CQCB 3X2QE 1YCSB 5BXOA 4HOSA 3DRAA 2VSYA 4JHKA 2VGEA 4V3IA 3I4GA 1H19A 3JXJA 4YVOA 3T5XA 2WXOA 2R02A 2XZTG 3FH8A 4WNGA 2KZTA 4HRLA 3B7BA 2GW1A 2CFUA 3E34A 3IHVA 2IEJA 1GW6A 1E8XA 3FH7A 4HLEA 2FO1E 3EHRA 2WM9A 4FLHA 2XPIA 4GTOA 4Z68A 2LXLA 1TNZA 3V31A 3FP3A 5C2YA 4I1OB 3D9MA 3FU3A 2AXZA 2LSVA 3MKRA 3RRUA 4ZHBA 3PEVB 2PM7A 2LAIA 3ZPJA 4ATZD 2VTBB 4TRQA 1MYOA 1B89A 4UWKA 2AXVA 2WXIA 1U3CA 5T8IA 4JD2G 4B8CB 1AP7A 3AU4A 2BKKB 3BUAA 2XGMA 2HR2A 4XX5A 1N52A 1NP7A 4J8YA 4UI9K 4GA1A 2J08A 5KJKA 5EDSA 4ANXA 5ANLA 3EHQA 3ZXSA 4TUMA 5G04C 2DYSE 5G55A 4TXQA 4GTSA 3ZYQA 5BUZA 1HE8A 2J4DA 1E90A 1HFAA 1D8EA 2VTBA 4PS3A 5FINA 2XEHA 5E75A 4ILIA 4N39A 3SNXA 4EBAG 3I4RB 2J8SD 3NB2A 3KEZA 5KBAA 4L23A 1PC2A 1N9AA 3C5RA 3C72A 3SQVA 4Q94A 4J8DA 2YINA 1K3ZD 3FEYA 3MKQB 2AXUA 2LXMA 3PS6A 4Q69A 2WXHA 3DSXA 3TWRA 4GTRA 1FT1A 2J4BA 2CG2A 4TXPA 2WXFA 4L2YA 4BSZB 2X6JA 3LJNA 2CHZA 3RRNB 4JZYA 5FZQA 3AJIA 4BY6A 2J07A 1A17A 1G3NB 3CVPA 1N0QA 3SD5A 2J49A 3PUJA 2Y4UA 2EINE 4B94A 1O1RA 5BW8C 4GZ3A 1HG5A 1K1AA 2V8SE 3MKQA 2WPVA 3HVEA 1OWLA 2HE0A 3L13A 3IXEA 3LS8A 3L22A 4RQIA 3ULQA 1NA3A 4JA9A 2OVBA 2R5SA 1H2VC 4FLBA 1DNPA 1N11A 4NQ0A 2LUHA 2IOSA 3C3RA 2XQ0A 3Q7FA 5FTPA 2EILE
chains in the Genus database with same CATH topology
1NZNA 4XI9A 3AS5A 3QB2A 4FU3A 4P29A 5LP0A 4FHJA 4HOQA 2VSOE 4I1AA 2FI7A 2X6KA 2E0IA 1IQUA 3R7RA 4WWNA 3UT7A 4XKCA 3VLDA 4LRZA 2WXQA 4JC8A 3LPZA 4WNFA 1PY1A 2I2OA 2X6HA 3OXFA 3ESLA 4KYOB 4O6FA 4AVXA 5LFAA 3SFZA 2DCPA 3UPVA 2XRZA 3CK7A 4ME2A 4Q96A 3FTZA 3MX3A 4FJZA 4C0EA 3OXLA 4KZ0A 2EQXA 5D0OD 3G2VA 3JUIA 3CSFA 4GU5A 3BG1B 3CVQA 3MCXA 4I6EA 5T3RA 3LY8A 3TJPA 2VJ8A 4XIFA 1HXIA 2CG3A 3FTYA 3U3WA 5C1DA 3PREA 1HU3A 3ENEA 3IKOB 1NA0A 1OWPA 3QARA 5AYWD 4JPSA 5LCWC 4U63A 1H0AA 3QNKA 4GPKA 2GRMA 2C0MA 4J8EA 5ARFA 4GA2A 3ASGA 2RD0A 4LCTA 3GZ2A 3QWPA 1FCHA 4Y6WA 3TXNA 4B89A 3S7DA 3CIAA 2Y3AA 1H2TC 2PM6A 4F1SA 4GMLA 4BWRA 3K9IA 3ZW3A 4AY5A 3FUNA 3QWVA 2C2LA 1EDUA 3FTXA 4J8SA 1YA0A 2X38A 3B7SA 4BT8A 3VTYA 4EECA 5HI7A 3FTUA 3PNTB 4GZ6A 3ESKA 4D10C 3ZHEB 1WM5A 4PS7A 3C98A 1H6KA 4JEHA 1EPUA 2CFZA 3D9OA 4U07A 2WXKA 2X6IA 3B7UX 3FULA 1HG2A 2WXRA 3ASDA 4GZ5A 2C0LA 2WB2A 1JWGA 4WWPA 4UI9J 2PQNA 2PZIA 4QFVA 4BX8A 4G11A 4FA6A 2WXLA 1MHQA 2GRLA 4DI4A 3FTVA 3FUMA 3B7TA 3CHQA 4JL0A 1KT0A 1Y8MA 2XCBA 4WNEA 3RO3A 4L2LA 5ANRA 1E7UA 3UUXA 2OVFA 2XPZA 5BNWA 3Q5MA 3CHRA 2E2EA 4UI9C 4UWHA 5JJTA 4FULA 3SF4A 1XNFA 2IU1A 3RIBA 4WAFA 4EZKA 3IV0A 3MYVA 3LXUX 1DVPA 4LEUA 4UQZA 4CCAA 5AIJA 1OUVA 3MJWA 3PZDA 3U66A 3UT4A 4RVBA 4A3TA 2GGFA 4J6IA 5A23A 2OV8A 4G24A 3T5VA 3AS4A 4FJYA 2YHCA 4ATGA 4KXKB 2AVPA 2J09A 1MQSA 3P1UA 1Z6TA 2PL2A 4N5CA 3SHFA 4ANWA 4ILHB 1TEZA 2AW6A 5FT9A 3CHOA 3FUIA 2V0PA 3CVUA 4BSXA 4B8AA 4EBAA 1U3DA 3Q49B 4FHKA 4EZLA 3QC1A 3S7JA 2KATA 2UY1B 4N3CA 5FZSA 4A1SA 3EDTB 4AJWA 4BX9A 2IFUA 4G1TA 5AJLA 1PAQA 4TUUA 3GYZA 3D9JA 4AOFA 4NACA 2V4LA 2YQ8A 4I6GA 4J0UA 2R59A 4I43A 3CSTA 5ENNA 4AY6A 2VGYA 3HHMA 4GYOA 4HXIA 3SBTB 4PDXA 4LUNU 1P5QA 2RG8A 4GCOA 3RK6A 3FUFA 5G04J 5CCMA 2A5UA 4WUYA 4GYWA 4G2VA 4HVBA 4MLPA 5A7DB 1IQRA 5LOZA 4CT4A 2X3MA 1EYHA 1HS6A 2I1JA 4FP7A 4EZJA 1TJCA 3QWWA 1ZBPA 2LO6A 2X6FA 4I9EA 3ZIMA 2IJGX 2MRIA 3G2TA 4KBQA 1SZ9A 3BEEA 3D9IA 1N54A 2QFCA 4E6HA 3ZRHA 4EQFA 4L7TA 4NRHB 3WXXA 3FUDA 3U64A 4E85A 2JEKA 4JHJA 3S2AA 3CKBA 3Q47B 5DBKA 3T8MA 1OWOA 4YVQC 3D9KA 3ZN3A 3URZA 3FDHA 2YHEA 4UWGA 5DIZA 2UY1A 3I3NA 1OWNA 4N3AA 2AWIA 4CDMA 3CKCA 5T4YA 2KC7A 4ANVA 1QZ2A 5AJDA 2L9BA 4HOUA 4KVMA 3UX4A 3MZLB 3EHMA 4J8FA 3TG5A 3PVLA 3HIZA 3QJZA 2FEZA 3AU5A 3LEWA 3PNLB 4TV3A 5G05C 4GB9A 2ZU6B 1LF8A 2WXPA 2BUGA 3ZHEA 2M63A 3U4TA 5BPPA 4GMJA 5FQ8A 5FJYA 2WXGA 4XKBA 3ML8A 3ZYLA 2KCLA 5KJNA 1KT1A 2ONDA 3B13A 3EHNA 4AV7A 4A1GA 1WY6A 3TG4A 1QNFA 4KZCA 4PH4B 5A6CA 2L6JA 4L1BA 5JJ6A 3VLEA 3CVLA 4UQXA 2WQ7A 2FULA 4Y6CA 3ML9A 1SZAA 3DPDA 3GW4A 3CEQA 4YNDA 4APFA 3CVNA 1E8WA 2DBAA 1ZU2A 2NC9A 3S7FA 5JHAA 3L08A 5CMWA 3TL5A 3CGHA 3CQCB 3ZFWA 4AM9A 3PEUB 1FVFA 4HOSA 2VSYA 1HO8A 4I2ZA 2MOWA 2IF4A 3KAEA 1FVHA 4JHKA 2XPYA 3I4GA 4V3IA 1ELWA 1H19A 3CQGB 5D0QD 3RRMB 4YVOA 4I17A 1E8YA 1S0PA 3T5XA 1L5JA 5HQ8A 4DLOA 1HZ4A 4H7YA 2WXOA 4APOA 5LX8A 4UWFA 3L16A 3LYAA 5CCLA 3FH8A 4WNGA 1W3BA 3TGOA 4A3VA 4JEUA 2KZTA 1Z3YA 4AIFA 4AXHA 3AS8A 4CRWA 4U04A 3CHSA 1SQMA 4GA0A 4JA7A 2CHXA 3ZVVA 2GW1A 2CFUA 2WMOA 3IHVA 4N2QA 2JLBA 1GW6A 1E8XA 4URKA 3FUJA 1HX8A 3FTWA 3APCA 3FH5A 4CGVA 3FH7A 3GZ1A 3SZ7A 3ASFA 4HLEA 2WM9A 4I6JA 4FLHA 1X5BA 2PQRA 2XPIA 3JQ1A 2I9CA 4FADA 3FP3A 5C2YA 4I1OB 4XZ4A 2ILRA 4WWOA 1INZA 1JPLA 3TAXA 1WAO1 3D9MA 5EX3A 2WXNA 3FU3A 3QK0A 2AXZA 2LSVA 4IRUA 2WMNA 3IBEA 3MKRA 3QDNA 3RRUA 1ELKA 3PE3A 3UMVA 4K03A 3PEVB 4JVSA 1EF1C 3FHEA 2PM7A 4H7XA 2LAIA 3ZPJA 2XHEA 3ZEFA 4MKTA 3LY7A 1QQEA 1JUQA 3FUHA 4BTBA 3VLFA 3DBSA 4ILGA 3FFLA 3E4BA 2VTBB 4OVUA 3CK8A 1HH8A 4TRQA 2Y4TA 1B89A 1E7VA 4UWKA 4F53A 3SBSA 3R9AB 2KZTB 3I5PA 3KS2A 2AXVA 4N2SA 4I1MA 1UN8A 2BF0X 2VYIA 2WXIA 1U3CA 5T8IA 2I6HA 3ASHA 2XEVA 4LERA 4NURA 3ONKA 4B8CB 3JQ0A 3RO2A 3AU4A 4GZCA 4JHRA 3MGBA 2XGMA 5EX0A 3APFA 2VGXB 4HORA 2HR2A 3LDZA 1UJJA 2IONA 4R7LA 4XX5A 4PS8A 2WVIA 4BTAA 5BV1A 1N52A 1NP7A 2NXPA 4CDRA 4UI9K 4F7AA 4GA1A 4HFGA 1E8ZA 2J08A 4M3OA 5KJKA 2R17C 3NF1A 3LJ3A 3Q4AB 5EDSA 2FBNA 4ANXA 4XI0A 1UW4B 5ANLA 3ZXSA 2J9QA 3D9NA 3IHYA 3LCAA 3MV2B 2I1KA 4U8HA 4IN3B 2DIWA 5G04C 4CT0A 3EJNA 4G26A 5FQ6A 5G55A 4ABNA 3RU0A 4KVOA 3ZYQA 2HM8A 1HE8A 5BUZA 3CVVA 1HF8A 3B7RL 2OOEA 2J4DA 3QKYA 2WQHA 4AP2A 1E90A 3APDA 3ZGQA 4C9BB 1HFAA 1JWFA 2VTBA 4PS3A 2XGSA 4OVVA 5E75A 3VTXA 4G25A 4ILIA 4N39A 4PUCA 3SNXA 4EBAG 1XGWA 2LNIA 3I4RB 4I2WA 2BTDA 2QY7A 3LY9A 3JYSA 1H2UA 3KEZA 4WNDA 2NSZA 3QOUA 5J08A 2MHKA 2VGXA 3FU6A 3O4ZA 3KD7A 4RSYA 4UWLA 4L23A 4BT9A 1PC2A 4DJAA 4Q94A 4W9RA 3GZSA 3L6AA 5FQ4A 3CR3A 1VDYA 3D9PA 3EIJA 4J8DA 4IULA 3ZYKA 2LSUA 3OAWA 4GYYA 3ONLA 5BT1A 3UQ3A 3JCKC 3QAQA 4MRUA 4RG6A 3RJVA 5JHBA 4MS6A 2VSXE 2YINA 3PUKA 5KCMA 3L54A 3CHMA 2YNQA 3LKUA 3ZYMA 3D3MA 3FEYA 3LVQE 3FWVA 3MKQB 2UWJG 5ARGA 3HVEB 1UJKA 2AXUA 2Q7FA 2VQ2A 4I9CA 5KJMA 4HOTA 4UQYA 3PS6A 2IOLA 2WXJA 3PH0C 4Q69A 2WXHA 3L17A 3PE4A 4JW1A 4RG9A 5CHEE 3BG0B 5CMYA 1OWMA 2VSNA 2J4BA 2CG2A 2L0TB 4XE0A 4KT6B 3FU0A 2WXFA 4L2YA 4K0RA 2XCCA 3D9LA 1E96B 3Q15A 1BPOA 1UG3A 3PRZA 5AENA 2X6JA 3G2UA 3N71A 4U0UA 4JXTA 2CHZA 2KCVA 5FWQA 3RRNB 3P2BA 3NQPA 4HS2A 3NZUA 3CHPA 3FEXA 4JZYA 5FZQA 3LVRE 3G2SA 4FC8A 4BY6A 2J07A 2LAHA 4ANUA 1UN9A 1IYGA 1A17A 2HYZA 4N3BA 5G05J 3CVPA 2FF4A 4AEZC 2FO7A 3FTSA 5EKQD 3SD5A 2J49A 3TXMA 4BFRA 3PUJA 4DPRA 4F3VA 2Y4UA 1TJFA 3MEKA 4GCNA 3SI5A 4B94A 2XRYA 2IQCA 2KM4A 2L0IA 3CVXA 5BW8C 3OTNA 4GZ3A 4U0ZA 1HG5A 5M72A 4IYPA 2HO1A 3S7BA 4EPZA 2CHWA 3HYMB 2V8SE 3MKQA 3MA5A 2WPVA 3HVEA 1Y6IA 4ACKA 1OWLA 5FZRA 3L13A 4CDNA 5FQ7A 3HDXA 3LS8A 4ACLA 5G2NA 2P58C 3L22A 3SGHA 3ULQA 4U0SA 2WQ6A 5JJ7A 3OXGA 3CV0A 3R7QA 1NA3A 4C0MA 1KLXA 1Z3XA 4JA9A 1ELRA 2OVBA 2R5SA 3CVYA 4B0ZA 2WXMA 4A55A 3CK9A 1H2VC 3FY4A 4FLBA 3CVWA 1DNPA 5J90A 4NQ0A 3EIQC 4DK5A 3U9WA 3UT8A 2IOSA 5KJLA 3G2WA 3MV3B 4GZDA 2V5FA 4CGWA 3FUKA 4G23A 2XGOA 3RKVA 4DLQA 3O48A 2XQ0A 1IHGA 3CLJA 3NZSA 3FUEA 4OYSA 4CEMA 3FU5A 4DI3A 5LCWJ 3IEGA 4KMOA 2A4ZA 3PDNA 4GAAA 5FTPA 5BV0A 5E76A 2KCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CT4 A;  1H2U A;  2FUL A;  2NSZ A;  2IOL A;  2KZT A;  2VSO E;  5ANR A;  4CRW A;  2HM8 A;  2IU1 A;  4B8C B;  1H2V C;  1PAQ A;  3L6A A;  1HU3 A;  3EIJ A;  2I2O A;  1H6K A;  2ION A;  1N54 A;  3EIQ C;  4IUL A;  2ZU6 B;  4C9B B;  2GGF A;  1N52 A;  4JHK A;  2IOS A;  1UG3 A;  2VSX E;  4JHJ A;  4GMJ A;  4B89 A;  3D3M A;  3RK6 A;  4LUN U;  2RG8 A;  3FEY A;  4CEM A;  3FEX A;  1H2T C;  1UW4 B;  3JUI A;  4B8A A;  2KZT B;  4GML A; 
#chains in the Genus database with same CATH topology
 4FHJ A;  1LTX A;  4HOQ A;  2VSO E;  4U8V D;  2XEE A;  1MX4 A;  1NFI E;  1PY1 A;  3OXF A;  3ESL A;  3SFZ A;  2DCP A;  4ME2 A;  4Q96 A;  3BG1 B;  5T3R A;  4XIF A;  1JCS A;  3E33 A;  4JPS A;  1TYQ G;  2C0M A;  2RD0 A;  4LCT A;  5HRY A;  3S7D A;  3TWU A;  3K9I A;  3FUN A;  2X38 A;  5HI7 A;  4D10 C;  3L82 A;  1RZ4 A;  3TWX A;  2RKK A;  4PS7 A;  1Z5S C;  1H6K A;  4U8Y D;  2CFZ A;  3B7U X;  1H6P A;  3FUL A;  4GZ5 A;  4WWP A;  2QC9 A;  2GRL A;  4DI4 A;  2BED A;  3CHQ A;  1KT0 A;  2XCB A;  1E7U A;  4UWH A;  4FUL A;  1XNF A;  3MYV A;  4LEU A;  4CCA A;  5AIJ A;  1OUV A;  3MJW A;  4J6I A;  5A23 A;  3AS4 A;  4FJY A;  2YHC A;  3Q7A A;  3P1U A;  1Z6T A;  4BES A;  3SHF A;  4ILH B;  3CHO A;  2V0P A;  3CVU A;  4EBA A;  1X81 A;  1U3D A;  3QC1 A;  3JXI A;  2UY1 B;  3EDT B;  2IFU A;  5AJL A;  1PAQ A;  4TUU A;  3GYZ A;  1S70 B;  2F8Y A;  4AOF A;  4BEP A;  2XS1 A;  3HHM A;  3SBT B;  1P5Q A;  3J5P A;  2A5U A;  4LSZ E;  5LOZ A;  5EYP F;  1HS6 A;  2ZGD A;  4EZJ A;  1TJC A;  2LO6 A;  4KBQ A;  2MRI A;  3R9M A;  2IO3 C;  3ZRH A;  4L7T A;  4E85 A;  3S2A A;  3Q47 B;  1OWO A;  5CEC B;  2YHE A;  4UWG A;  3I3N A;  3ZNG A;  5T4Y A;  5FIO A;  2GRO B;  4EHM A;  5G05 C;  5FQ8 A;  1WY6 A;  3TG4 A;  4YDW A;  1NI1 A;  4NIK A;  4UQX A;  2WQ7 A;  5CER B;  5KWD A;  3GW4 A;  3UI2 A;  1OCC E;  3ISM C;  2DBA A;  3S7F A;  4HB5 A;  4I2Z A;  5G05 J;  3KAE A;  3RRM B;  1ELW A;  1K8K G;  5HQ8 A;  5LX8 A;  2XS8 A;  4A3V A;  2QYU A;  4AXH A;  4AIF A;  5CED B;  4HI9 A;  4JA7 A;  3E32 A;  2WMO A;  4GPM A;  2JLB A;  3FUJ A;  3FH5 A;  4CGV A;  3SZ7 A;  1X5B A;  3ULE G;  4XZ4 A;  4WWO A;  5EX3 A;  2WXN A;  5D2M C;  4YDO A;  2WMN A;  3QDN A;  3PE3 A;  4K5B A;  1EF1 C;  1FT2 A;  2P9S G;  3ZEF A;  1QQE A;  4BTB A;  1N4Q A;  3CK8 A;  5EIB E;  3I5P A;  3KS2 A;  5H7P A;  4I1M A;  1UN8 A;  2XEV A;  4LER A;  3ONK A;  4GZC A;  2JAB A;  4R7L A;  5EIL A;  5BV1 A;  4F7A A;  3UM1 A;  4HFG A;  1E8Z A;  3NF1 A;  3Q4A B;  3PZ3 A;  1BD8 A;  3F6Q A;  2I1K A;  4U8H A;  3HXD A;  2F0Y A;  3EJN A;  1OT8 A;  1HF8 A;  3QKY A;  2WQH A;  4AP2 A;  4OAU C;  3RAU A;  5B1A E;  5AQ9 A;  2DVW A;  4OVV A;  3VTX A;  4G25 A;  1O1T A;  2LNI A;  1AWC B;  2BTD A;  1H2U A;  2NSZ A;  3QOU A;  3AG3 E;  2VGX A;  4RSY A;  3ZKJ A;  2EIM E;  3GZS A;  3EIJ A;  4GYY A;  3JCK C;  4RG6 A;  3RSE G;  3PUK A;  5HKP A;  3CHM A;  2YNQ A;  3LKU A;  3E30 A;  3ASO E;  3HVE B;  1UJK A;  5KJM A;  4HOT A;  4UQY A;  2IOL A;  3DEO A;  4JW1 A;  3TWT A;  2VSN A;  4KT6 B;  3FU0 A;  2XCC A;  1E96 B;  3Q15 A;  4JB8 P;  4U0U A;  3NQP A;  3CHP A;  4N5Q A;  3LVR E;  3G2S A;  3EU9 A;  4FC8 A;  4ZFH A;  1UN9 A;  2HYZ A;  2P9N G;  4AEZ C;  3TXM A;  1ZB1 A;  4DPR A;  3MEK A;  3SI5 A;  2KM4 A;  2L0I A;  4LNG A;  4EPZ A;  3DST A;  1Y6I A;  4ACK A;  5FQ7 A;  3HDX A;  3UM3 A;  4U0S A;  5JJ7 A;  1WDY A;  3CV0 A;  2DYR E;  3CVY A;  2H6G A;  2EIK E;  1MX6 A;  3E37 A;  3HXE A;  3D9H A;  5KJL A;  3G2W A;  4GZD A;  2V5F A;  4CGW A;  3RKV A;  1IHG A;  3Q75 A;  3IEG A;  4KMO A;  4GAA A;  5BV0 A;  3L9T A;  1NZN A;  3AS5 A;  2ZIR A;  3QB2 A;  4P29 A;  5LP0 A;  1KZO A;  4I1A A;  2FI7 A;  2X6K A;  1IQU A;  1N94 A;  4WWN A;  4GTP A;  3UT7 A;  3VLD A;  2WXQ A;  2Y0B G;  3LPZ A;  2PNN A;  2MYO A;  4KYO B;  2F8X K;  3HXF A;  2XRZ A;  3CK7 A;  2EQX A;  5D0O D;  3CSF A;  4GU5 A;  3ASN E;  3MCX A;  2VJ8 A;  1HXI A;  3U3W A;  3PRE A;  1HU3 A;  3QAR A;  1NA0 A;  5LCW C;  3QNK A;  5AQ7 A;  3ASG A;  3GZ2 A;  1FCH A;  1N4S A;  3UKU G;  3SFX A;  4J8S A;  4BT8 A;  4EEC A;  3FTU A;  1H6O A;  4GZ6 A;  2DWZ A;  5AQB A;  3C98 A;  4JEH A;  3D9O A;  4U96 D;  2WXK A;  2X6I A;  1JWG A;  3AG1 E;  4UI9 J;  2PQN A;  2PZI A;  2P9L G;  4BX8 A;  4G11 A;  2WXL A;  1MX2 A;  4CZ2 D;  3FTV A;  3B7T A;  4JL0 A;  1Y8M A;  3RO3 A;  4L2L A;  3UUX A;  3SF4 A;  1K1B A;  4EZK A;  3LXU X;  4UQZ A;  3PZD A;  2KBX A;  4RVB A;  2IO2 C;  4GTV A;  5B3S E;  2AVP A;  3ABL E;  2PL2 A;  1TEZ A;  4B8A A;  3S7J A;  4A1S A;  2V5Q C;  1NL4 A;  4AJW A;  3KEA A;  4CYM D;  2V4L A;  5ENN A;  4AY6 A;  2VGY A;  3JUE A;  4G8L A;  4LUN U;  4GCO A;  5G04 J;  3NOG D;  4GYW A;  4XEI G;  4MLP A;  1IQR A;  3TWV A;  1EYH A;  4FP7 A;  3ZIM A;  2IJG X;  4NRH B;  3FUD A;  3U64 A;  2OEV A;  3T8M A;  4HNA D;  4HQD A;  2L6B A;  3ZN3 A;  2AWI A;  1D8D A;  3KSL A;  4ANV A;  2L9B A;  1SVX A;  3EHM A;  3AG2 E;  2FEZ A;  4TV3 A;  1S64 A;  4GB9 A;  5BPP A;  5FJY A;  4XKB A;  3BU8 A;  1KT1 A;  4KZC A;  1BLX B;  3CVL A;  1SZA A;  4APF A;  5EYL A;  1ZU2 A;  2NC9 A;  1S63 A;  3TL5 A;  2QYJ A;  1Q2Z A;  2MOW A;  2IF4 A;  1E8Y A;  3KSQ A;  3EUV A;  3Q78 A;  3HG0 D;  4UWF A;  3L16 A;  3LYA A;  5CCL A;  2Y1L E;  4JEU A;  1Z3Y A;  4CRW A;  3AS8 A;  4U04 A;  3CHS A;  4GA0 A;  1TNY A;  1TN8 A;  3ZVV A;  5CEA A;  4N2Q A;  4URK A;  1HX8 A;  3APC A;  3GZ1 A;  3ASF A;  4HBD A;  3V30 A;  4F1P A;  3JQ1 A;  1V54 E;  4FAD A;  3T8K A;  1LD8 A;  5ITZ F;  3TAX A;  1WAO 1;  2BKG A;  4IRU A;  1ELK A;  3UMV A;  4K03 A;  2V4H C;  3FHE A;  1JUQ A;  3FUH A;  3SY2 A;  3VLF A;  3DBS A;  4OVU A;  3ULY A;  1HH8 A;  4F53 A;  3SBS A;  4G8K A;  4N2S A;  4DX1 A;  2VYI A;  2I6H A;  1N4P A;  4NUR A;  2B6C A;  3NOC D;  4JHR A;  5EX0 A;  2VGX B;  2ION A;  4PS8 A;  2WVI A;  2R2L A;  4CDR A;  4M3O A;  2R17 C;  1JCQ A;  3LJ3 A;  4XI0 A;  2B0O E;  1UW4 B;  2J9Q A;  3D9N A;  3IHY A;  3LCA A;  3MV2 B;  2DIW A;  1QYM A;  4G26 A;  4UUC A;  4ABN A;  3RU0 A;  3CVV A;  3B7R L;  1BU9 A;  3PZ4 A;  2P9P G;  1TR4 A;  2XGS A;  4PUC A;  2ZIS A;  3JYS A;  5J08 A;  3O4Z A;  3KD7 A;  4BT9 A;  4DJA A;  4W9R A;  5FQ4 A;  1VDY A;  4IUL A;  3ZYK A;  2LSU A;  3OAW A;  3ONL A;  5BT1 A;  3UQ3 A;  3QAQ A;  3RJV A;  4MRU A;  5JHB A;  4MS6 A;  2VSX E;  3L54 A;  4DUI A;  2ETB A;  3D3M A;  3LVQ E;  2UWJ G;  5ARG A;  2Q7F A;  2VQ2 A;  3PH0 C;  4RG9 A;  2Y69 E;  1TNO A;  2L0T B;  2OEW A;  4XE0 A;  4DX7 D;  4K0R A;  3D9L A;  2P2C P;  5CBN A;  3EU5 A;  3P2B A;  2XZD G;  1IYG A;  3ABM E;  3FTS A;  5EKQ D;  4BFR A;  4F3V A;  4DX2 A;  2ZGG A;  4GCN A;  1D9S A;  2XRY A;  3CVX A;  4U0Z A;  3PZ2 A;  5CRU A;  2CHW A;  3UM2 A;  4K5A B;  5FZR A;  3DWL G;  5G2N A;  2P58 C;  2WQ6 A;  1WG0 A;  3R7Q A;  1KLX A;  4BET A;  1Z3X A;  4B93 B;  1OCR E;  3Q9N C;  2WXM A;  4A55 A;  3UKR G;  1RW2 A;  3HXC A;  3UT8 A;  3FUK A;  2QZA A;  4DLQ A;  2H6H A;  3CLJ A;  4DI3 A;  4CEM A;  3FU5 A;  2A4Z A;  3PDN A;  5E76 A;  2KCK A;  4XI9 A;  3HRA A;  4L9P A;  1MJ0 A;  4QQI A;  3R7R A;  2E0I A;  4XKC A;  4JC8 A;  4WNF A;  5KNG A;  4BER A;  4O6F A;  5LFA A;  3UPV A;  4HRM B;  3FTZ A;  3MX3 A;  3OXL A;  4KZ0 A;  3G2V A;  3JUI A;  4I6E A;  3TJP A;  3LY8 A;  2DZN A;  2CG3 A;  3SO8 A;  2ETA A;  3ENE A;  5AYW D;  2R05 A;  3ZXP A;  4LNU D;  2GRM A;  4GA2 A;  3QWP A;  4B89 A;  3CIA A;  3V79 K;  4F1S A;  4GML A;  3ZW3 A;  1O5M A;  3VTY A;  1WM5 A;  3C3Q A;  1EPU A;  4U07 A;  2GRN B;  2P9U G;  4GTT A;  1HG2 A;  2C0L A;  2WB2 A;  5BXU A;  1YYH A;  4QFV A;  1YMP A;  3FUM A;  4WNE A;  3DSW A;  5ANR A;  3V2O A;  2OVF A;  2XPZ A;  5BNW A;  3Q5M A;  2IU1 A;  3RIB A;  1KPS B;  4WAF A;  3ABK E;  3U66 A;  3UT4 A;  5ENO D;  2GGF A;  2OV8 A;  4ATG A;  4KXK B;  2ZXW E;  4HLL A;  2J09 A;  1MQS A;  4N5C A;  2AW6 A;  4U95 D;  5FT9 A;  3FUI A;  3Q73 A;  4BSX A;  3Q49 B;  4FHK A;  4EZL A;  2KAT A;  4N3C A;  2F37 A;  4G1T A;  5JMN D;  4NAC A;  2YQ8 A;  1N95 A;  3ZUV B;  4I6G A;  4J0U A;  2R59 A;  1IKN D;  4GYO A;  4PDX A;  3RK6 A;  2RG8 A;  5CCM A;  3FUF A;  4WUY A;  4G2V A;  4CT4 A;  1IHB A;  2I1J A;  3QWW A;  1ZBP A;  4I9E A;  3G2T A;  1SZ9 A;  2QFC A;  1LD7 A;  4JHJ A;  4YVQ C;  3D9K A;  3URZ A;  3FDH A;  4O60 A;  1OXJ A;  4N3A A;  4CDM A;  5JA4 D;  3CKC A;  3UXG A;  1QZ2 A;  4K5C A;  3HIZ A;  5KNH D;  3PNL B;  2ZU6 B;  2BUG A;  3U4T A;  5CRV A;  3ML8 A;  3EHN A;  3DSV A;  4AV7 A;  4A1G A;  1QNF A;  5A6C A;  4L1B A;  3VLE A;  4Y6C A;  3ML9 A;  3CEQ A;  4YND A;  3CVN A;  3V2X A;  3SFY A;  3L08 A;  3CGH A;  3ZFW A;  4AM9 A;  3PEU B;  1FVF A;  1HO8 A;  3AG4 E;  3AAA C;  1FVH A;  2XPY A;  3CQG B;  5D0Q D;  4I17 A;  1S0P A;  2A5E A;  1L5J A;  4DLO A;  1HZ4 A;  1OY3 D;  4H7Y A;  4APO A;  1W3B A;  3TGO A;  4RLY A;  4LG6 A;  1SQM A;  2CHX A;  3FTW A;  3TWQ A;  3Q9U C;  5IY5 E;  2AJA A;  3T9K A;  4I6J A;  3W9G A;  2PQR A;  3W9F A;  2I9C A;  4TXR A;  5CBO A;  4DRX E;  2ILR A;  1INZ A;  1JPL A;  3QK0 A;  3IBE A;  4JVS A;  4HI8 A;  4H7X A;  2XHE A;  5AAR A;  4MKT A;  3LY7 A;  2NYJ A;  4ILG A;  3FFL A;  3E4B A;  1SW6 A;  2Y4T A;  1E7V A;  5HS0 A;  3R9A B;  2KZT B;  2BF0 X;  5EID A;  3ASH A;  3JQ0 A;  3RO2 A;  3MGB A;  3APF A;  4HOR A;  3LDZ A;  1UJJ A;  4BTA A;  2NXP A;  2FBN A;  2EIJ E;  2KXP C;  3UIN C;  1UOH A;  1OCZ E;  4IN3 B;  4CT0 A;  5FQ6 A;  4KVO A;  2HM8 A;  2OOE A;  3APD A;  3ZGQ A;  4C9B B;  1JWF A;  1U2V G;  4M7C A;  4X8Q A;  3DXK G;  1MZC A;  1XGW A;  3PZ1 A;  1IXV A;  4I2W A;  2QY7 A;  3LY9 A;  1BI7 B;  3WG7 E;  4WND A;  5ENQ D;  2MHK A;  3FU6 A;  4UWL A;  5EN5 D;  5B1B E;  3L6A A;  3CR3 A;  3D9P A;  4HRN A;  5ENR D;  5KCM A;  3ZYM A;  1TN7 A;  3FWV A;  4I9C A;  1N4R A;  2WXJ A;  3L17 A;  3PE4 A;  5CHE E;  3BG0 B;  5CMY A;  1OWM A;  2R03 A;  1BPO A;  1UG3 A;  3PRZ A;  5AEN A;  3G2U A;  3N71 A;  3Q79 A;  4JXT A;  5FWQ A;  1DCQ A;  2KCV A;  4HS2 A;  3NZU A;  3FEX A;  2LAH A;  4ANU A;  3UTM A;  4N3B A;  2FF4 A;  3DEP A;  2FO7 A;  3NAW A;  1TJF A;  2IQC A;  3B95 A;  3OTN A;  5M72 A;  2RFM A;  4IYP A;  2HO1 A;  3S7B A;  1KZP A;  3HYM B;  3MA5 A;  1O1S A;  4C48 B;  4CDN A;  4ACL A;  3SGH A;  3ZU7 B;  3OXG A;  4C0M A;  1SA5 A;  1ELR A;  5AN8 A;  4B0Z A;  3CK9 A;  3FY4 A;  3CVW A;  5J90 A;  3EIQ C;  4LNB A;  4DK5 A;  4GMR A;  3U9W A;  4DX5 D;  3HXB A;  3MV3 B;  4G23 A;  1DCE A;  2XGO A;  3NBN B;  3O48 A;  3NZS A;  4OYS A;  3FUE A;  5LCW J;  1TN6 A;  4O1P A;  4FU3 A;  2IY0 C;  4LRZ A;  2DZO A;  4MBG A;  2I2O A;  2X6H A;  4J7W A;  4AVX A;  5AQA A;  4FJZ A;  4C0E A;  1TNU A;  2GRQ B;  3CVQ A;  3FTY A;  4U7E B;  5D66 A;  5AAO A;  1SA4 A;  5C1D A;  3IKO B;  1OWP A;  4U63 A;  1FPP A;  1H0A A;  4GPK A;  4YDE A;  5ARF A;  4J8E A;  5ENP D;  4GTQ A;  3TXN A;  4Y6W A;  4YDY A;  2Y3A A;  1H2T C;  2PM6 A;  4BWR A;  4AY5 A;  3QWV A;  2C2L A;  1EDU A;  3FTX A;  3UIP C;  1YA0 A;  3B7S A;  3PNT B;  3ESK A;  3ZHE B;  3DSS A;  4OAV B;  2WXR A;  3ASD A;  1A5E A;  4FA6 A;  1MHQ A;  3DPY A;  1V55 E;  3BQO A;  3CHR A;  2E2E A;  4UI9 C;  5JJT A;  3UIO C;  3IV0 A;  1DVP A;  4A3T A;  4G24 A;  3T5V A;  4ANW A;  4O1O A;  1DC2 A;  1TNB A;  2OCC E;  3C3O A;  5FZS A;  4BX9 A;  2GRR B;  2P9I G;  2RFA A;  1N0R A;  3D9J A;  3TWS A;  4I43 A;  3CST A;  4HXI A;  1QBQ A;  3UM0 A;  4HVB A;  5A7D B;  2X3M A;  2ETC A;  2H6I A;  2X6F A;  5ENT D;  3BEE A;  5ENS D;  1JCR A;  3D9I A;  1N54 A;  4E6H A;  4EQF A;  3WXX A;  2JEK A;  3DSU A;  3CKB A;  5DBK A;  4A63 B;  4DX6 D;  5DIZ A;  3TWW A;  4GTM A;  2UY1 A;  1OWN A;  1OCO E;  2KC7 A;  5AJD A;  4HOU A;  4F6R D;  4KVM A;  2H6F A;  3UX4 A;  3MZL B;  4J8F A;  3TG5 A;  3PVL A;  3QJZ A;  3AU5 A;  3LEW A;  2XEN A;  1LF8 A;  3DXM G;  2WXP A;  2GRP B;  3ZHE A;  2M63 A;  4GMJ A;  5KJN A;  2WXG A;  3ZYL A;  2KCL A;  2OND A;  3B13 A;  3J5Q B;  4PH4 B;  1BI8 B;  2L6J A;  5JJ6 A;  2FUL A;  3DPD A;  1E8W A;  5JHA A;  2P9K G;  5CMW A;  3CQC B;  3X2Q E;  1YCS B;  5BXO A;  4HOS A;  3DRA A;  2VSY A;  4JHK A;  2VGE A;  4V3I A;  3I4G A;  1H19 A;  3JXJ A;  4YVO A;  3T5X A;  2WXO A;  2R02 A;  2XZT G;  3FH8 A;  4WNG A;  2KZT A;  4HRL A;  3B7B A;  2GW1 A;  2CFU A;  3E34 A;  3IHV A;  2IEJ A;  1GW6 A;  1E8X A;  3FH7 A;  4HLE A;  2FO1 E;  3EHR A;  2WM9 A;  4FLH A;  2XPI A;  4GTO A;  4Z68 A;  2LXL A;  1TNZ A;  3V31 A;  3FP3 A;  5C2Y A;  4I1O B;  3D9M A;  3FU3 A;  2AXZ A;  2LSV A;  3MKR A;  3RRU A;  4ZHB A;  3PEV B;  2PM7 A;  2LAI A;  3ZPJ A;  4ATZ D;  2VTB B;  4TRQ A;  1MYO A;  1B89 A;  4UWK A;  2AXV A;  2WXI A;  1U3C A;  5T8I A;  4JD2 G;  4B8C B;  1AP7 A;  3AU4 A;  2BKK B;  3BUA A;  2XGM A;  2HR2 A;  4XX5 A;  1N52 A;  1NP7 A;  4J8Y A;  4UI9 K;  4GA1 A;  2J08 A;  5KJK A;  5EDS A;  4ANX A;  5ANL A;  3EHQ A;  3ZXS A;  4TUM A;  5G04 C;  2DYS E;  5G55 A;  4TXQ A;  4GTS A;  3ZYQ A;  5BUZ A;  1HE8 A;  2J4D A;  1E90 A;  1HFA A;  1D8E A;  2VTB A;  4PS3 A;  5FIN A;  2XEH A;  5E75 A;  4ILI A;  4N39 A;  3SNX A;  4EBA G;  3I4R B;  2J8S D;  3NB2 A;  3KEZ A;  5KBA A;  4L23 A;  1PC2 A;  1N9A A;  3C5R A;  3C72 A;  3SQV A;  4Q94 A;  4J8D A;  2YIN A;  1K3Z D;  3FEY A;  3MKQ B;  2AXU A;  2LXM A;  3PS6 A;  4Q69 A;  2WXH A;  3DSX A;  3TWR A;  4GTR A;  1FT1 A;  2J4B A;  2CG2 A;  4TXP A;  2WXF A;  4L2Y A;  4BSZ B;  2X6J A;  3LJN A;  2CHZ A;  3RRN B;  4JZY A;  5FZQ A;  3AJI A;  4BY6 A;  2J07 A;  1A17 A;  1G3N B;  3CVP A;  1N0Q A;  3SD5 A;  2J49 A;  3PUJ A;  2Y4U A;  2EIN E;  4B94 A;  1O1R A;  5BW8 C;  4GZ3 A;  1HG5 A;  1K1A A;  2V8S E;  3MKQ A;  2WPV A;  3HVE A;  1OWL A;  2HE0 A;  3L13 A;  3IXE A;  3LS8 A;  3L22 A;  4RQI A;  3ULQ A;  1NA3 A;  4JA9 A;  2OVB A;  2R5S A;  1H2V C;  4FLB A;  1DNP A;  1N11 A;  4NQ0 A;  2LUH A;  2IOS A;  3C3R A;  2XQ0 A;  3Q7F A;  5FTP A;  2EIL E; 
#chains in the Genus database with same CATH homology
 1NZN A;  4XI9 A;  3AS5 A;  3QB2 A;  4FU3 A;  4P29 A;  5LP0 A;  4FHJ A;  4HOQ A;  2VSO E;  4I1A A;  2FI7 A;  2X6K A;  2E0I A;  1IQU A;  3R7R A;  4WWN A;  3UT7 A;  4XKC A;  3VLD A;  4LRZ A;  2WXQ A;  4JC8 A;  3LPZ A;  4WNF A;  1PY1 A;  2I2O A;  2X6H A;  3OXF A;  3ESL A;  4KYO B;  4O6F A;  4AVX A;  5LFA A;  3SFZ A;  2DCP A;  3UPV A;  2XRZ A;  3CK7 A;  4ME2 A;  4Q96 A;  3FTZ A;  3MX3 A;  4FJZ A;  4C0E A;  3OXL A;  4KZ0 A;  2EQX A;  5D0O D;  3G2V A;  3JUI A;  3CSF A;  4GU5 A;  3BG1 B;  3CVQ A;  3MCX A;  4I6E A;  5T3R A;  3LY8 A;  3TJP A;  2VJ8 A;  4XIF A;  1HXI A;  2CG3 A;  3FTY A;  3U3W A;  5C1D A;  3PRE A;  1HU3 A;  3ENE A;  3IKO B;  1NA0 A;  1OWP A;  3QAR A;  5AYW D;  4JPS A;  5LCW C;  4U63 A;  1H0A A;  3QNK A;  4GPK A;  2GRM A;  2C0M A;  4J8E A;  5ARF A;  4GA2 A;  3ASG A;  2RD0 A;  4LCT A;  3GZ2 A;  3QWP A;  1FCH A;  4Y6W A;  3TXN A;  4B89 A;  3S7D A;  3CIA A;  2Y3A A;  1H2T C;  2PM6 A;  4F1S A;  4GML A;  4BWR A;  3K9I A;  3ZW3 A;  4AY5 A;  3FUN A;  3QWV A;  2C2L A;  1EDU A;  3FTX A;  4J8S A;  1YA0 A;  2X38 A;  3B7S A;  4BT8 A;  3VTY A;  4EEC A;  5HI7 A;  3FTU A;  3PNT B;  4GZ6 A;  3ESK A;  4D10 C;  3ZHE B;  1WM5 A;  4PS7 A;  3C98 A;  1H6K A;  4JEH A;  1EPU A;  2CFZ A;  3D9O A;  4U07 A;  2WXK A;  2X6I A;  3B7U X;  3FUL A;  1HG2 A;  2WXR A;  3ASD A;  4GZ5 A;  2C0L A;  2WB2 A;  1JWG A;  4WWP A;  4UI9 J;  2PQN A;  2PZI A;  4QFV A;  4BX8 A;  4G11 A;  4FA6 A;  2WXL A;  1MHQ A;  2GRL A;  4DI4 A;  3FTV A;  3FUM A;  3B7T A;  3CHQ A;  4JL0 A;  1KT0 A;  1Y8M A;  2XCB A;  4WNE A;  3RO3 A;  4L2L A;  5ANR A;  1E7U A;  3UUX A;  2OVF A;  2XPZ A;  5BNW A;  3Q5M A;  3CHR A;  2E2E A;  4UI9 C;  4UWH A;  5JJT A;  4FUL A;  3SF4 A;  1XNF A;  2IU1 A;  3RIB A;  4WAF A;  4EZK A;  3IV0 A;  3MYV A;  3LXU X;  1DVP A;  4LEU A;  4UQZ A;  4CCA A;  5AIJ A;  1OUV A;  3MJW A;  3PZD A;  3U66 A;  3UT4 A;  4RVB A;  4A3T A;  2GGF A;  4J6I A;  5A23 A;  2OV8 A;  4G24 A;  3T5V A;  3AS4 A;  4FJY A;  2YHC A;  4ATG A;  4KXK B;  2AVP A;  2J09 A;  1MQS A;  3P1U A;  1Z6T A;  2PL2 A;  4N5C A;  3SHF A;  4ANW A;  4ILH B;  1TEZ A;  2AW6 A;  5FT9 A;  3CHO A;  3FUI A;  2V0P A;  3CVU A;  4BSX A;  4B8A A;  4EBA A;  1U3D A;  3Q49 B;  4FHK A;  4EZL A;  3QC1 A;  3S7J A;  2KAT A;  2UY1 B;  4N3C A;  5FZS A;  4A1S A;  3EDT B;  4AJW A;  4BX9 A;  2IFU A;  4G1T A;  5AJL A;  1PAQ A;  4TUU A;  3GYZ A;  3D9J A;  4AOF A;  4NAC A;  2V4L A;  2YQ8 A;  4I6G A;  4J0U A;  2R59 A;  4I43 A;  3CST A;  5ENN A;  4AY6 A;  2VGY A;  3HHM A;  4GYO A;  4HXI A;  3SBT B;  4PDX A;  4LUN U;  1P5Q A;  2RG8 A;  4GCO A;  3RK6 A;  3FUF A;  5G04 J;  5CCM A;  2A5U A;  4WUY A;  4GYW A;  4G2V A;  4HVB A;  4MLP A;  5A7D B;  1IQR A;  5LOZ A;  4CT4 A;  2X3M A;  1EYH A;  1HS6 A;  2I1J A;  4FP7 A;  4EZJ A;  1TJC A;  3QWW A;  1ZBP A;  2LO6 A;  2X6F A;  4I9E A;  3ZIM A;  2IJG X;  2MRI A;  3G2T A;  4KBQ A;  1SZ9 A;  3BEE A;  3D9I A;  1N54 A;  2QFC A;  4E6H A;  3ZRH A;  4EQF A;  4L7T A;  4NRH B;  3WXX A;  3FUD A;  3U64 A;  4E85 A;  2JEK A;  4JHJ A;  3S2A A;  3CKB A;  3Q47 B;  5DBK A;  3T8M A;  1OWO A;  4YVQ C;  3D9K A;  3ZN3 A;  3URZ A;  3FDH A;  2YHE A;  4UWG A;  5DIZ A;  2UY1 A;  3I3N A;  1OWN A;  4N3A A;  2AWI A;  4CDM A;  3CKC A;  5T4Y A;  2KC7 A;  4ANV A;  1QZ2 A;  5AJD A;  2L9B A;  4HOU A;  4KVM A;  3UX4 A;  3MZL B;  3EHM A;  4J8F A;  3TG5 A;  3PVL A;  3HIZ A;  3QJZ A;  2FEZ A;  3AU5 A;  3LEW A;  3PNL B;  4TV3 A;  5G05 C;  4GB9 A;  2ZU6 B;  1LF8 A;  2WXP A;  2BUG A;  3ZHE A;  2M63 A;  3U4T A;  5BPP A;  4GMJ A;  5FQ8 A;  5FJY A;  2WXG A;  4XKB A;  3ML8 A;  3ZYL A;  2KCL A;  5KJN A;  1KT1 A;  2OND A;  3B13 A;  3EHN A;  4AV7 A;  4A1G A;  1WY6 A;  3TG4 A;  1QNF A;  4KZC A;  4PH4 B;  5A6C A;  2L6J A;  4L1B A;  5JJ6 A;  3VLE A;  3CVL A;  4UQX A;  2WQ7 A;  2FUL A;  4Y6C A;  3ML9 A;  1SZA A;  3DPD A;  3GW4 A;  3CEQ A;  4YND A;  4APF A;  3CVN A;  1E8W A;  2DBA A;  1ZU2 A;  2NC9 A;  3S7F A;  5JHA A;  3L08 A;  5CMW A;  3TL5 A;  3CGH A;  3CQC B;  3ZFW A;  4AM9 A;  3PEU B;  1FVF A;  4HOS A;  2VSY A;  1HO8 A;  4I2Z A;  2MOW A;  2IF4 A;  3KAE A;  1FVH A;  4JHK A;  2XPY A;  3I4G A;  4V3I A;  1ELW A;  1H19 A;  3CQG B;  5D0Q D;  3RRM B;  4YVO A;  4I17 A;  1E8Y A;  1S0P A;  3T5X A;  1L5J A;  5HQ8 A;  4DLO A;  1HZ4 A;  4H7Y A;  2WXO A;  4APO A;  5LX8 A;  4UWF A;  3L16 A;  3LYA A;  5CCL A;  3FH8 A;  4WNG A;  1W3B A;  3TGO A;  4A3V A;  4JEU A;  2KZT A;  1Z3Y A;  4AIF A;  4AXH A;  3AS8 A;  4CRW A;  4U04 A;  3CHS A;  1SQM A;  4GA0 A;  4JA7 A;  2CHX A;  3ZVV A;  2GW1 A;  2CFU A;  2WMO A;  3IHV A;  4N2Q A;  2JLB A;  1GW6 A;  1E8X A;  4URK A;  3FUJ A;  1HX8 A;  3FTW A;  3APC A;  3FH5 A;  4CGV A;  3FH7 A;  3GZ1 A;  3SZ7 A;  3ASF A;  4HLE A;  2WM9 A;  4I6J A;  4FLH A;  1X5B A;  2PQR A;  2XPI A;  3JQ1 A;  2I9C A;  4FAD A;  3FP3 A;  5C2Y A;  4I1O B;  4XZ4 A;  2ILR A;  4WWO A;  1INZ A;  1JPL A;  3TAX A;  1WAO 1;  3D9M A;  5EX3 A;  2WXN A;  3FU3 A;  3QK0 A;  2AXZ A;  2LSV A;  4IRU A;  2WMN A;  3IBE A;  3MKR A;  3QDN A;  3RRU A;  1ELK A;  3PE3 A;  3UMV A;  4K03 A;  3PEV B;  4JVS A;  1EF1 C;  3FHE A;  2PM7 A;  4H7X A;  2LAI A;  3ZPJ A;  2XHE A;  3ZEF A;  4MKT A;  3LY7 A;  1QQE A;  1JUQ A;  3FUH A;  4BTB A;  3VLF A;  3DBS A;  4ILG A;  3FFL A;  3E4B A;  2VTB B;  4OVU A;  3CK8 A;  1HH8 A;  4TRQ A;  2Y4T A;  1B89 A;  1E7V A;  4UWK A;  4F53 A;  3SBS A;  3R9A B;  2KZT B;  3I5P A;  3KS2 A;  2AXV A;  4N2S A;  4I1M A;  1UN8 A;  2BF0 X;  2VYI A;  2WXI A;  1U3C A;  5T8I A;  2I6H A;  3ASH A;  2XEV A;  4LER A;  4NUR A;  3ONK A;  4B8C B;  3JQ0 A;  3RO2 A;  3AU4 A;  4GZC A;  4JHR A;  3MGB A;  2XGM A;  5EX0 A;  3APF A;  2VGX B;  4HOR A;  2HR2 A;  3LDZ A;  1UJJ A;  2ION A;  4R7L A;  4XX5 A;  4PS8 A;  2WVI A;  4BTA A;  5BV1 A;  1N52 A;  1NP7 A;  2NXP A;  4CDR A;  4UI9 K;  4F7A A;  4GA1 A;  4HFG A;  1E8Z A;  2J08 A;  4M3O A;  5KJK A;  2R17 C;  3NF1 A;  3LJ3 A;  3Q4A B;  5EDS A;  2FBN A;  4ANX A;  4XI0 A;  1UW4 B;  5ANL A;  3ZXS A;  2J9Q A;  3D9N A;  3IHY A;  3LCA A;  3MV2 B;  2I1K A;  4U8H A;  4IN3 B;  2DIW A;  5G04 C;  4CT0 A;  3EJN A;  4G26 A;  5FQ6 A;  5G55 A;  4ABN A;  3RU0 A;  4KVO A;  3ZYQ A;  2HM8 A;  1HE8 A;  5BUZ A;  3CVV A;  1HF8 A;  3B7R L;  2OOE A;  2J4D A;  3QKY A;  2WQH A;  4AP2 A;  1E90 A;  3APD A;  3ZGQ A;  4C9B B;  1HFA A;  1JWF A;  2VTB A;  4PS3 A;  2XGS A;  4OVV A;  5E75 A;  3VTX A;  4G25 A;  4ILI A;  4N39 A;  4PUC A;  3SNX A;  4EBA G;  1XGW A;  2LNI A;  3I4R B;  4I2W A;  2BTD A;  2QY7 A;  3LY9 A;  3JYS A;  1H2U A;  3KEZ A;  4WND A;  2NSZ A;  3QOU A;  5J08 A;  2MHK A;  2VGX A;  3FU6 A;  3O4Z A;  3KD7 A;  4RSY A;  4UWL A;  4L23 A;  4BT9 A;  1PC2 A;  4DJA A;  4Q94 A;  4W9R A;  3GZS A;  3L6A A;  5FQ4 A;  3CR3 A;  1VDY A;  3D9P A;  3EIJ A;  4J8D A;  4IUL A;  3ZYK A;  2LSU A;  3OAW A;  4GYY A;  3ONL A;  5BT1 A;  3UQ3 A;  3JCK C;  3QAQ A;  4MRU A;  4RG6 A;  3RJV A;  5JHB A;  4MS6 A;  2VSX E;  2YIN A;  3PUK A;  5KCM A;  3L54 A;  3CHM A;  2YNQ A;  3LKU A;  3ZYM A;  3D3M A;  3FEY A;  3LVQ E;  3FWV A;  3MKQ B;  2UWJ G;  5ARG A;  3HVE B;  1UJK A;  2AXU A;  2Q7F A;  2VQ2 A;  4I9C A;  5KJM A;  4HOT A;  4UQY A;  3PS6 A;  2IOL A;  2WXJ A;  3PH0 C;  4Q69 A;  2WXH A;  3L17 A;  3PE4 A;  4JW1 A;  4RG9 A;  5CHE E;  3BG0 B;  5CMY A;  1OWM A;  2VSN A;  2J4B A;  2CG2 A;  2L0T B;  4XE0 A;  4KT6 B;  3FU0 A;  2WXF A;  4L2Y A;  4K0R A;  2XCC A;  3D9L A;  1E96 B;  3Q15 A;  1BPO A;  1UG3 A;  3PRZ A;  5AEN A;  2X6J A;  3G2U A;  3N71 A;  4U0U A;  4JXT A;  2CHZ A;  2KCV A;  5FWQ A;  3RRN B;  3P2B A;  3NQP A;  4HS2 A;  3NZU A;  3CHP A;  3FEX A;  4JZY A;  5FZQ A;  3LVR E;  3G2S A;  4FC8 A;  4BY6 A;  2J07 A;  2LAH A;  4ANU A;  1UN9 A;  1IYG A;  1A17 A;  2HYZ A;  4N3B A;  5G05 J;  3CVP A;  2FF4 A;  4AEZ C;  2FO7 A;  3FTS A;  5EKQ D;  3SD5 A;  2J49 A;  3TXM A;  4BFR A;  3PUJ A;  4DPR A;  4F3V A;  2Y4U A;  1TJF A;  3MEK A;  4GCN A;  3SI5 A;  4B94 A;  2XRY A;  2IQC A;  2KM4 A;  2L0I A;  3CVX A;  5BW8 C;  3OTN A;  4GZ3 A;  4U0Z A;  1HG5 A;  5M72 A;  4IYP A;  2HO1 A;  3S7B A;  4EPZ A;  2CHW A;  3HYM B;  2V8S E;  3MKQ A;  3MA5 A;  2WPV A;  3HVE A;  1Y6I A;  4ACK A;  1OWL A;  5FZR A;  3L13 A;  4CDN A;  5FQ7 A;  3HDX A;  3LS8 A;  4ACL A;  5G2N A;  2P58 C;  3L22 A;  3SGH A;  3ULQ A;  4U0S A;  2WQ6 A;  5JJ7 A;  3OXG A;  3CV0 A;  3R7Q A;  1NA3 A;  4C0M A;  1KLX A;  1Z3X A;  4JA9 A;  1ELR A;  2OVB A;  2R5S A;  3CVY A;  4B0Z A;  2WXM A;  4A55 A;  3CK9 A;  1H2V C;  3FY4 A;  4FLB A;  3CVW A;  1DNP A;  5J90 A;  4NQ0 A;  3EIQ C;  4DK5 A;  3U9W A;  3UT8 A;  2IOS A;  5KJL A;  3G2W A;  3MV3 B;  4GZD A;  2V5F A;  4CGW A;  3FUK A;  4G23 A;  2XGO A;  3RKV A;  4DLQ A;  3O48 A;  2XQ0 A;  1IHG A;  3CLJ A;  3NZS A;  3FUE A;  4OYS A;  4CEM A;  3FU5 A;  4DI3 A;  5LCW J;  3IEG A;  4KMO A;  2A4Z A;  3PDN A;  4GAA A;  5FTP A;  5BV0 A;  5E76 A;  2KCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...