4GMJA

Structure of human not1 mif4g domain co-crystallized with caf1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
HMLEENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords CCR4-NOT transcription complex subunit 1
publication title The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 229
sequence length 229
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gmjA00
1H2UA 2IOSA 4GMJA 2VSOE 4C9BB 2FULA 1N54A 2I2OA 3L6AA 4CEMA 4CT4A 3D3MA 1H6KA 4B8AA 2KZTB 4JHKA 2IU1A 3EIQC 3FEXA 1H2TC 4JHJA 2NSZA 1UG3A 1N52A 1HU3A 3FEYA 4B89A 4GMLA 2KZTA 2GGFA 3JUIA 2VSXE 2IOLA 4IULA 5ANRA 2ZU6B 1H2VC 4CRWA 2HM8A 2IONA 2RG8A 4LUNU 1PAQA 1UW4B 3RK6A 3EIJA 4B8CB
chains in the Genus database with same CATH superfamily
4BY6A 3ABKE 3Q47B 1QNFA 2V5QC 4CEMA 3TWXA 3EDTB 4RG9A 4ZHBA 4CDMA 1Z3YA 2CG3A 1K1AA 1QBQA 4LRZA 1MYOA 3ZU7B 2ZU6B 2C0MA 2WXHA 2WB2A 4GAAA 4U63A 4KYOB 1YMPA 1H0AA 4ILIA 3CK7A 4U07A 4UQZA 1WAO1 4HOQA 1DVPA 1K1BA 2FF4A 4CRWA 4KT6B 4HLEA 3BEEA 1G3NB 4I6EA 3JUEA 4BWRA 3DWLG 2XEHA 5BXUA 3D9JA 3N71A 4URKA 3SD5A 2RKKA 1E8XA 4N5QA 3LVQE 3PEUB 2PNNA 5EKQD 4UI9J 3TWUA 3W9FA 2I2OA 4GCOA 2PQNA 3QC1A 5EX3A 5B1AE 4DX5D 4WWNA 1NI1A 3PRZA 2UY1B 5G05C 4AJWA 3L54A 1H2VC 4DX2A 5AAOA 3FU0A 3J5PA 3SQVA 1N94A 4HRNA 2VSYA 1S0PA 5KJKA 3CVXA 3DEPA 2LAHA 3BU8A 4U95D 3PE4A 3JQ0A 3PZ2A 4MS6A 1JPLA 3Q7AA 3APDA 3I3NA 5JMND 5ANRA 4PH4B 5D2MC 2IO2C 3CVUA 2KBXA 2KXPC 4L1BA 4GZ6A 1H19A 4DI3A 5CCMA 2J49A 5A7DB 3DSSA 5ITZF 4QQIA 4FLHA 5ANLA 2IQCA 2WMOA 3HHMA 4XX5A 1JWGA 3FEYA 4FADA 1BI7B 4UQYA 4FP7A 2XHEA 2KATA 1PAQA 2P9KG 4LG6A 3NZSA 3B7RL 3ZW3A 2XZDG 3QJZA 1TN6A 1YA0A 2ONDA 3MKQA 2XEEA 3WG7E 4K5CA 4U0SA 5D66A 1TN8A 3ZRHA 4TUMA 5D0OD 4JW1A 4GZ5A 1S63A 1SA4A 3SF4A 4PDXA 1A17A 4U8HA 1Y8MA 5G05J 2BTDA 2QYJA 4WNEA 3I4GA 5HKPA 4E85A 1VDYA 5AARA 4B89A 2IEJA 4L9PA 3SO8A 3LS8A 2HE0A 1TNYA 3TWSA 5FQ8A 2H6IA 3C5RA 3HDXA 3FU5A 4J8DA 4BTAA 2DWZA 1BPOA 5CECB 4DPRA 4LNBA 3FUKA 1BU9A 3ZIMA 4J8SA 3SI5A 2X6JA 1O1SA 1KZPA 4O1PA 3JCKC 2CHWA 1MJ0A 3WXXA 1PY1A 4DI4A 3B7UX 1H6OA 4U8VD 3MKRA 4BETA 1H2TC 3ZXSA 3DXMG 2UY1A 2ETBA 4ILHB 3C98A 2Q7FA 5CMYA 3C3QA 5CCLA 3B13A 3VLFA 1IKND 4C9BB 4RG6A 1X81A 3UT4A 2QYUA 4I6GA 1WM5A 3DPYA 4AVXA 2V4HC 2R02A 4MBGA 5KJNA 3PNTB 2ILRA 3OXLA 2L6BA 4APOA 4LEUA 4I1MA 5LX8A 2OEVA 3D3MA 2WM9A 1JCQA 4JXTA 3AS4A 5DIZA 3DSXA 4GPMA 2PL2A 3CK8A 1FVFA 4FHJA 4ACKA 1S64A 1HG5A 5ENOD 2IU1A 3DBSA 3D9KA 4A1SA 2J4DA 3E32A 5FIOA 3UIPC 3ZVVA 3B7SA 2VTBA 5FZRA 4AV7A 4WNGA 3CHQA 3QWWA 4GTMA 3ML8A 3KD7A 3NB2A 3BG1B 4PS7A 4FJZA 4XKBA 2DVWA 3TG4A 2YINA 4TUUA 4HNAD 5ARFA 1ELWA 4EBAA 2XPIA 1KZOA 3ZYQA 4BSZB 2WQ7A 4U8YD 1FPPA 3CHPA 3I5PA 2KM4A 3D9PA 4ANXA 1OWPA 2AWIA 2VSNA 3LJ3A 3E30A 5CRUA 2WXRA 4AOFA 2R59A 5BNWA 3LPZA 4BTBA 4HBDA 2P9NG 2IOSA 3UKUG 2WXLA 3PEVB 4W9RA 4H7YA 3PUKA 4P29A 4NURA 4WNFA 2R03A 5A6CA 1E7VA 3Q75A 3D9NA 3DSTA 4A3VA 2WXGA 3DSUA 2HM8A 2WXIA 2PM7A 5BT1A 3MX3A 4B8CB 3R9MA 2IO3C 4BT8A 2IF4A 2AXVA 5CEDB 3TJPA 2I1KA 4I1AA 4K5BA 2DZOA 4JVSA 2NSZA 4RVBA 3CVLA 5FQ6A 4HRLA 2WXNA 2GRLA 2Y1LE 1KPSB 4CDNA 1TR4A 3FWVA 1ZU2A 1H2UA 3CV0A 2L6JA 3LXUX 3AG3E 2XRZA 5ENQD 2H6GA 3FP3A 3UT7A 3EHMA 3HVEA 2L0TB 3RO2A 4L7TA 4GU5A 3ASHA 3T5XA 2DCPA 4C0MA 2LO6A 2HR2A 2HYZA 2NYJA 3FH5A 5ENSD 2XGMA 3CSFA 3ASOE 1S70B 4EQFA 3JUIA 4N2QA 3G2WA 4ME2A 2DBAA 5H7PA 3KS2A 3ZN3A 5HS0A 3B7TA 2NXPA 3PZ3A 2AVPA 1HXIA 2VGEA 3CHMA 4I9CA 2VGYA 4Z68A 3T5VA 4Y6CA 3CSTA 1UJKA 3FUJA 1TNZA 4LNUD 4N3CA 2KC7A 4N3BA 3RKVA 3QB2A 1E7UA 3ENEA 3UKRG 4IULA 5BV1A 3EUVA 4XI9A 4K03A 2X3MA 3TWVA 3SZ7A 3IBEA 4KZ0A 3APFA 1OCZE 3JXIA 4YDEA 1E8ZA 3MZLB 1TEZA 4HOSA 3MJWA 3SBTB 2RFAA 4GYWA 3EIQC 3MV2B 4HVBA 3B7BA 1X5BA 3CVVA 3PVLA 4I6JA 2ETAA 5C2YA 3UUXA 3FUEA 1OXJA 4HOUA 3SBSA 4Q96A 4GCNA 3MV3B 3S7DA 4XE0A 2H6FA 3W9GA 5CBOA 2KZTA 5BXOA 5CBNA 3QAQA 2BEDA 4J8EA 4JEUA 4Q94A 4Y6WA 1NP7A 1OY3D 3PE3A 2ZISA 2IFUA 3Q78A 4AXHA 2I1JA 5FJYA 5CHEE 1AWCB 5CERB 2A5UA 4F1SA 4F53A 2OVBA 4RQIA 5G04C 3TWQA 2IONA 4FC8A 1OCOE 3JQ1A 4U7EB 4G11A 4LSZE 1K3ZD 3NF1A 1U3CA 4PS3A 2ETCA 3CVWA 1MQSA 3ZGQA 2EIKE 1TYQG 3Q5MA 3O48A 2X38A 3MYVA 3Q79A 4L2LA 2J07A 2XPZA 4GTSA 2H6HA 2VJ8A 2FI7A 2LXMA 4XIFA 4EZKA 3E4BA 3CK9A 3PZ1A 1BD8A 2F0YA 3ULQA 2R17C 5B3SE 3ZHEB 2AXZA 3S7JA 5T4YA 2B0OE 2YQ8A 4FULA 1N11A 5FT9A 4B0ZA 2HO1A 2CHZA 5G55A 1E8YA 1MX6A 3SGHA 4O6FA 1MZCA 2YHEA 3EU9A 3UM1A 3K9IA 5FTPA 3FFLA 3QWVA 1HS6A 2IOLA 3FUNA 1KLXA 4JD2G 2XPYA 3ZYMA 2P9UG 5LOZA 3EHQA 5G04J 3TWTA 2XEVA 4G8KA 1XNFA 4F6RD 4JPSA 5T8IA 4HLLA 4C48B 1MX2A 3S7FA 1FT1A 4DX7D 3UM3A 3ZKJA 3ISMC 3LVRE 3PZ4A 3R9AB 4GZDA 4LERA 2E0IA 2EIME 3E33A 3AG4E 3D9OA 1LD8A 3HG0D 4XEIG 2J4BA 5BW8C 1ZBPA 4HS2A 4OYSA 4WUYA 4LUNU 4A63B 4F3VA 2E2EA 3ZEFA 1IYGA 3ZFWA 1Z6TA 5BPPA 5EYLA 3VTXA 4JHRA 2P9PG 2Y4UA 1FCHA 4BFRA 1TNBA 3IHVA 2WPVA 1N0QA 5FQ7A 4AIFA 2XCCA 2F8XK 3B95A 5J90A 2JLBA 4OAVB 3IKOB 2P9IG 1OUVA 5ENPD 4N5CA 3HXCA 2WXMA 4ABNA 3FH7A 3FH8A 1N54A 3LEWA 2MHKA 1HZ4A 4CT4A 4UUCA 3RO3A 5E75A 4WWPA 1Q2ZA 2NC9A 2R5SA 4N3AA 4OAUC 3KEZA 4JL0A 5E76A 4J0UA 4GTQA 2MOWA 3RJVA 2B6CA 2J9QA 1DCQA 3CQCB 3FU3A 1IHGA 3CVPA 4JA7A 2L9BA 4J8FA 4IRUA 5AIJA 1O5MA 3P1UA 2GRPB 3QNKA 3FTSA 1HH8A 2RG8A 1XGWA 5KWDA 4C0EA 4DLOA 4G2VA 1N4SA 1E90A 2FULA 3TWWA 5J08A 1HE8A 2FO1E 3FTWA 4G23A 2P9LG 3FHEA 1N4RA 3U64A 4AP2A 3QK0A 4NRHB 5AQAA 2EILE 4CZ2D 3D9HA 4GYOA 3RAUA 1OCCE 3FDHA 3DXKG 3PDNA 2GRQB 4O60A 3FTUA 2WXFA 5LP0A 3PREA 4MKTA 3CIAA 1JCRA 2OOEA 3SHFA 3FY4A 3MEKA 1HO8A 2LXLA 1TN7A 3ZUVB 3CHOA 4BEPA 4G25A 3ASDA 2WVIA 3Q15A 3KSLA 3CKBA 2ZIRA 4KZCA 4AY5A 5HQ8A 1W3BA 3F6QA 2X6FA 3C3RA 2J8SD 4KVOA 2FEZA 1KT0A 4G1TA 4FJYA 3EU5A 4APFA 3FU6A 4RSYA 5JHAA 3SFZA 3OXGA 4EHMA 2OCCE 4YVOA 1EYHA 4XI0A 4GTVA 4TXRA 4CYMD 1UJJA 3CEQA 4UWLA 3CVQA 3P2BA 3EHRA 5AN8A 3Q49B 3ULEG 1QYMA 3AG1E 3HRAA 3PUJA 5CMWA 3E34A 4TV3A 2MRIA 2WQHA 4V3IA 3OXFA 2ZGDA 3CLJA 5IY5E 3V79K 3T8KA 1DCEA 3D9IA 1FT2A 3NBNB 4JC8A 2X6HA 5FQ4A 3CVNA 3Q73A 5BV0A 2WXPA 5KNHD 2WXKA 4G26A 3L22A 3KAEA 4YDWA 1SVXA 4ILGA 5T3RA 2EINE 3SFXA 2F8YA 2LSUA 4GTTA 4NQ0A 1WG0A 4ACLA 4E6HA 4GTOA 4ATZD 5JHBA 1HU3A 3T8MA 1SA5A 5BUZA 1SQMA 1LD7A 2V5FA 4HI8A 3DRAA 1JCSA 3CR3A 4FU3A 4EECA 3V31A 2I6HA 4I17A 3L6AA 4IYPA 5B1BE 3DSVA 2BF0X 2F37A 4EZJA 4JHJA 1ELRA 4HFGA 3D9MA 3HXBA 3IXEA 3QWPA 5ENRD 5KJLA 5JJ7A 3AAAC 2BKKB 4GA1A 4GMJA 3FUDA 3TL5A 5LFAA 3GZ2A 2QY7A 4G8LA 4I43A 2C2LA 3KSQA 1OWOA 2JEKA 3SY2A 1L5JA 2VSXE 5A23A 4KMOA 2AW6A 5AYWD 1RW2A 1Y6IA 3CKCA 4HI9A 1FVHA 1N9AA 3ABLE 1LTXA 2C0LA 1UN9A 4I1OB 2LUHA 4GPKA 3MKQB 4M3OA 3JXJA 3L9TA 3G2TA 3UM2A 2AXUA 1IHBA 4IN3B 3G2VA 4JHKA 1NA3A 2Y3AA 5JA4D 4BESA 1TJCA 2GGFA 3S2AA 4TXQA 3D9LA 4DK5A 2EQXA 2J09A 4N2SA 3GZ1A 4FHKA 1JWFA 3RSEG 3CQGB 2Y69E 3R7RA 4J7WA 4GMRA 3T9KA 3DEOA 3U4TA 4Q69A 1WY6A 5C1DA 3U66A 3PZDA 3FUFA 4ANUA 3MCXA 4FLBA 4PUCA 4EPZA 3U3WA 2GW1A 1V54E 2WXQA 3CHRA 3UX4A 5ARGA 4A3TA 5D0QD 3GYZA 1NA0A 1E96B 1OWMA 1TNUA 4K5AB 1YYHA 1GW6A 1SZ9A 2GRRB 2P9SG 3AU4A 2XENA 3G2UA 3UT8A 3LCAA 3LJNA 5EYPF 3X2QE 2XCBA 4DRXE 1V55E 3IV0A 3QKYA 4GTPA 3QOUA 4BX9A 1OT8A 1B89A 4HORA 1HX8A 3FUIA 5LCWC 4JEHA 2UWJG 4R7LA 3ZPJA 3UTMA 3UXGA 3BQOA 2FO7A 3PH0C 4UWFA 1QQEA 5KNGA 2JABA 3ESKA 1UOHA 4H7XA 1HFAA 3ML9A 3QARA 1BLXB 3LY8A 2X6IA 2A4ZA 4M7CA 2VSOE 4YVQC 1ELKA 3PS6A 1TNOA 4QFVA 4G24A 1EDUA 3ONKA 3UPVA 2V0PA 4ATGA 4D10C 2I9CA 5KJMA 2XGSA 1BI8B 4ZFHA 3Q9NC 1O1RA 4EZLA 4CGVA 4AM9A 3APCA 3R7QA 3LY9A 1ZB1A 3AU5A 3FTVA 3HXFA 2VTBB 3Q7FA 2QFCA 3DPDA 1N52A 3FTXA 2ZXWE 2M63A 5FWQA 1OWNA 1NL4A 2V8SE 3SFYA 4GZCA 4X8QA 2V4LA 1O1TA 2ZGGA 4AY6A 1UN8A 1HF8A 3MGBA 4LCTA 3L17A 4AEZC 5M72A 3ZNGA 4UI9K 2DZNA 3FTZA 3HXDA 3UQ3A 4F7AA 3V2XA 4GB9A 4O1OA 4GMLA 1D8EA 2XRYA 3QDNA 5HI7A 5AJDA 2L0IA 4UWKA 4JZYA 1H6PA 5LCWJ 3OAWA 3TXNA 1K8KG 2CG2A 3L82A 3NOGD 2EIJE 2OVFA 2DYSE 1JUQA 1U3DA 1AP7A 1H6KA 3NQPA 3KEAA 5HRYA 2KCLA 1DNPA 3G2SA 2PM6A 4GZ3A 3FUHA 3URZA 2WXOA 3DSWA 4UWGA 3IEGA 5DBKA 3BG0B 3AS8A 3CHSA 4KBQA 4YDOA 4WAFA 2LAIA 4HQDA 4DX1A 1Z5SC 2VGXB 1D8DA 3HYMB 2YNQA 3O4ZA 4YDYA 3EIJA 3ZHEA 5AQBA 4GA0A 5G2NA 5FINA 1P5QA 1SZAA 4CGWA 4YNDA 1TJFA 4HB5A 3L16A 2AJAA 3RRUA 1UG3A 4BT9A 3AG2E 4GA2A 2OEWA 1EPUA 3VTYA 3IHYA 3HXEA 4OVVA 4UWHA 5KCMA 3C3OA 4XKCA 3HVEB 3TAXA 2J08A 2RFMA 3ULYA 1U2VG 3NOCD 4L2YA 4CT0A 4TXPA 2Y4TA 4GYYA 2RD0A 4N39A 3ZYKA 1NFIE 3VLEA 1UW4B 2XS8A 2R2LA 2MYOA 1NZNA 2VQ2A 3TWRA 4JA9A 3RRMB 2LNIA 1PC2A 3ASFA 3RU0A 5KBAA 3FULA 1INZA 2GRNB 2QC9A 3EJNA 1E8WA 4ANWA 4EBAG 4WWOA 2LSVA 4XZ4A 1DC2A 2GRMA 3CVYA 3C72A 3ESLA 3ABME 4GTRA 3MA5A 2PZIA 5AJLA 3GZSA 4DUIA 4FA6A 5CRVA 4K0RA 1IQUA 3FUMA 5AQ9A 3E37A 4F1PA 2WQ6A 5FZQA 3FTYA 3NAWA 3CGHA 3NZUA 5AQ7A 2XGOA 3TXMA 5EN5D 1IXVA 4HRMB 2XQ0A 4I2WA 5JJ6A 3RIBA 3UINC 5EIBE 2Y0BG 2DYRE 3LDZA 1SW6A 2YHCA 2WMNA 3EHNA 2BKGA 5EIDA 2IY0C 1N4PA 4BSXA 4BX8A 4ANVA 4TRQA 3FEXA 3VLDA 4BERA 1N4QA 5EX0A 3RRNB 4A55A 2XS1A 2XZTG 3AS5A 2BUGA 3L13A 5ENTD 3RK6A 1IQRA 2CFUA 4I9EA 2VGXA 3UIOC 4PS8A 2KZTB 4DLQA 5JJTA 1HG2A 2CFZA 4MLPA 3TGOA 4U0ZA 2FBNA 3ASNE 1YCSB 1OWLA 4MRUA 3Q9UC 1N95A 2KCVA 5EILA 2A5EA 3ASGA 4B8AA 4DJAA 4NIKA 4J8YA 4DX6D 2P2CP 4U04A 4U0UA 5FZSA 1EF1C 3HIZA 3GW4A 1MHQA 2OV8A 3ZXPA 3U9WA 2X6KA 4U96D 2GROB 2KCKA 3LYAA 4I2ZA 3LY7A 3TG5A 5EDSA 1KT1A 1Z3XA 3PNLB 2WXJA 4HOTA 4L23A 1OCRE 3ONLA 4UQXA 4OVUA 4A1GA 5ENNA 3L08A 2DIWA 1MX4A 2QZAA 3J5QB 4CDRA 4WNDA 1A5EA 4B94A 3UMVA 4J6IA 5AENA 4JB8P 3BUAA 2CHXA 4HXIA 4B93B 3ZYLA 1D9SA 4LNGA 3SNXA 2VYIA 1RZ4A 1WDYA 2IJGX 4RLYA 3Q4AB 3OTNA 3AJIA 3UI2A 3UM0A 3JYSA 4UI9C 4CCAA 2R05A 5CEAA 3S7BA 3I4RB 4KVMA 2P58C 3V2OA 2PQRA 3LKUA 1LF8A 1N0RA 4KXKB 3V30A 1QZ2A 4NACA
chains in the Genus database with same CATH topology
2A4ZA 4BT8A 2J9QA 2VSOE 4BY6A 2IF4A 4YVQC 1ELKA 3Q47B 2AXVA 1QNFA 3MX3A 3PS6A 3CQCB 3TJPA 4CEMA 2I1KA 3FU3A 1IHGA 3EDTB 4RG9A 4I1AA 4CDMA 4QFVA 1Z3YA 4G24A 2CG3A 3CVPA 4JA7A 4JVSA 2L9BA 2NSZA 4J8FA 1EDUA 4RVBA 3ONKA 3CVLA 3UPVA 4IRUA 4LRZA 5AIJA 3P1UA 5FQ6A 2V0PA 2WXNA 3QNKA 2GRLA 2ZU6B 4ATGA 2I9CA 4D10C 5KJMA 2C0MA 3FTSA 2WXHA 1HH8A 2RG8A 4CDNA 1XGWA 2XGSA 4C0EA 3FWVA 1ZU2A 1H2UA 4DLOA 4G2VA 2WB2A 4GAAA 3CV0A 4KYOB 4U63A 1E90A 2FULA 2L6JA 4EZLA 3LXUX 1H0AA 4CGVA 5J08A 1HE8A 3APCA 4ILIA 4AM9A 3R7QA 3LY9A 3CK7A 3FTWA 4G23A 2XRZA 4U07A 4UQZA 3AU5A 3FP3A 3FTVA 3UT7A 2VTBB 1WAO1 4HOQA 3EHMA 3FHEA 2QFCA 3DPDA 1DVPA 1N52A 3HVEA 3U64A 3FTXA 4AP2A 2L0TB 2M63A 1OWNA 5FWQA 3RO2A 3QK0A 4L7TA 4GU5A 3ASHA 2FF4A 2V8SE 4NRHB 4CRWA 4KT6B 4HLEA 4GZCA 3BEEA 2V4LA 3T5XA 2DCPA 4GYOA 4C0MA 2LO6A 4AY6A 1UN8A 1HF8A 4I6EA 3FDHA 3MGBA 4BWRA 4LCTA 2HR2A 2HYZA 3L17A 4AEZC 5M72A 4UI9K 3FH5A 2XGMA 3FTZA 3CSFA 3D9JA 3PDNA 3UQ3A 4F7AA 3N71A 4GB9A 3FTUA 4GMLA 2WXFA 2XRYA 3QDNA 3JUIA 3SD5A 4EQFA 4URKA 5LP0A 4N2QA 3PREA 1E8XA 5HI7A 5AJDA 2L0IA 4UWKA 4JZYA 5LCWJ 3G2WA 3LVQE 4ME2A 4MKTA 3PEUB 3CIAA 3OAWA 2DBAA 5EKQD 4UI9J 2OOEA 3KS2A 2CG2A 3SHFA 3TXNA 3ZN3A 3FY4A 3MEKA 2OVFA 2I2OA 4GCOA 2PQNA 3QC1A 5EX3A 1HO8A 3B7TA 2NXPA 4WWNA 3CHOA 1JUQA 1U3DA 3PRZA 1H6KA 2UY1B 3NQPA 2AVPA 4G25A 3ASDA 2KCLA 1DNPA 1HXIA 2WVIA 3Q15A 3G2SA 5G05C 2PM6A 3CHMA 4AJWA 3CKBA 3L54A 4I9CA 2VGYA 1H2VC 3T5VA 4KZCA 4AY5A 5HQ8A 4GZ3A 3FUHA 4Y6CA 3FU0A 3CSTA 1W3BA 2VSYA 1UJKA 3URZA 2X6FA 1S0PA 2WXOA 5KJKA 3FUJA 4N3CA 4UWGA 3CVXA 4KVOA 3IEGA 2KC7A 5DBKA 2LAHA 3AS8A 2FEZA 1KT0A 3BG0B 3CHSA 4G1TA 4N3BA 3RKVA 3QB2A 4FJYA 3PE4A 3JQ0A 4KBQA 1E7UA 1JPLA 4MS6A 4APFA 4WAFA 3FU6A 4RSYA 5JHAA 3SFZA 2LAIA 3APDA 3ENEA 3OXGA 3I3NA 4IULA 5BV1A 5ANRA 4PH4B 4XI9A 4YVOA 4K03A 2X3MA 2VGXB 1EYHA 4XI0A 3HYMB 3SZ7A 2YNQA 3O4ZA 3IBEA 3CVUA 4KZ0A 3APFA 3EIJA 3ZHEA 4L1BA 4GZ6A 1E8ZA 4GA0A 3MZLB 5G2NA 1UJJA 1H19A 4DI3A 5CCMA 3CEQA 2J49A 5A7DB 4UWLA 1P5QA 1SZAA 3CVQA 4CGWA 1TEZA 4FLHA 1TJFA 4YNDA 4HOSA 3MJWA 3SBTB 4GYWA 3EIQC 3L16A 3MV2B 3P2BA 5ANLA 3RRUA 2IQCA 2WMOA 3HHMA 4XX5A 1UG3A 1JWGA 3FEYA 4BT9A 4HVBA 3Q49B 4GA2A 4FADA 4UQYA 1X5BA 3CVVA 4FP7A 2XHEA 1EPUA 3VTYA 2KATA 3IHYA 3PUJA 5CMWA 1PAQA 3PVLA 4I6JA 4TV3A 3NZSA 5C2YA 4OVVA 4UWHA 3UUXA 3B7RL 2MRIA 3FUEA 3QJZA 3ZW3A 4HOUA 2WQHA 4V3IA 5KCMA 1YA0A 2ONDA 3SBSA 3MKQA 4Q96A 4XKCA 3OXFA 3CLJA 3HVEB 4GCNA 3MV3B 3TAXA 3S7DA 4U0SA 4XE0A 2J08A 3D9IA 3ZRHA 4JC8A 4L2YA 2X6HA 5FQ4A 4CT0A 3CVNA 2KZTA 5BV0A 2Y4TA 4GYYA 2RD0A 4N39A 5D0OD 2WXPA 2WXKA 4G26A 3ZYKA 3L22A 3QAQA 4J8EA 3KAEA 4JW1A 3VLEA 4GZ5A 4JEUA 1UW4B 4ILGA 3SF4A 4PDXA 4Q94A 4Y6WA 1A17A 1NP7A 4U8HA 1Y8MA 3PE3A 5T3RA 5G05J 1NZNA 2VQ2A 2IFUA 4AXHA 2I1JA 5FJYA 5CHEE 2LSUA 4NQ0A 2BTDA 4ACLA 4JA9A 3RRMB 4E6HA 4WNEA 3I4GA 2LNIA 5JHBA 1PC2A 2A5UA 4F1SA 4E85A 1VDYA 1HU3A 3ASFA 3T8MA 4B89A 3RU0A 4F53A 5BUZA 2OVBA 1SQMA 2V5FA 3FULA 1INZA 3LS8A 5G04C 2IONA 3EJNA 1E8WA 4FC8A 3JQ1A 5FQ8A 4G11A 3CR3A 4FU3A 4ANWA 4EBAG 4WWOA 4EECA 2LSVA 4XZ4A 2GRMA 3HDXA 2I6HA 4I17A 3NF1A 1U3CA 3CVYA 3ESLA 3FU5A 3L6AA 4PS3A 4J8DA 4IYPA 3MA5A 4BTAA 2PZIA 1BPOA 3CVWA 1MQSA 2BF0X 5AJLA 4DPRA 3FUKA 3ZGQA 4EZJA 4JHJA 3GZSA 1ELRA 3ZIMA 4HFGA 3D9MA 4J8SA 3Q5MA 3O48A 2X38A 3QWPA 3SI5A 2X6JA 5KJLA 3MYVA 5JJ7A 4L2LA 4FA6A 3JCKC 2CHWA 4K0RA 2J07A 1IQUA 2XPZA 3FUMA 4GA1A 3WXXA 2WQ6A 4GMJA 3FUDA 5FZQA 3TL5A 2VJ8A 1PY1A 2FI7A 3FTYA 4XIFA 4DI4A 4EZKA 3B7UX 3CGHA 3E4BA 3NZUA 3CK9A 5LFAA 3GZ2A 2QY7A 2XGOA 4I43A 2C2LA 3TXMA 3MKRA 1H2TC 3ZXSA 1OWOA 3ULQA 2JEKA 2R17C 2UY1A 4ILHB 3C98A 2XQ0A 4I2WA 5JJ6A 1L5JA 2VSXE 2Q7FA 3ZHEB 2AXZA 5A23A 3RIBA 5CMYA 3S7JA 4KMOA 5T4YA 5CCLA 2AW6A 2YQ8A 4FULA 3B13A 3VLFA 5AYWD 5FT9A 3LDZA 4B0ZA 2HO1A 2YHCA 2WMNA 2CHZA 4C9BB 3EHNA 5G55A 1Y6IA 1E8YA 4RG6A 3CKCA 3SGHA 3UT4A 4BSXA 4I6GA 4O6FA 2YHEA 4ANVA 4BX8A 3K9IA 4TRQA 1WM5A 3FEXA 1FVHA 4AVXA 3VLDA 5FTPA 3FFLA 5EX0A 5KJNA 3PNTB 3QWVA 1HS6A 2IOLA 2C0LA 1UN9A 2ILRA 3RRNB 3OXLA 4A55A 3AS5A 2BUGA 1KLXA 3FUNA 3L13A 4I1OB 4GPKA 3MKQB 4APOA 4M3OA 3RK6A 1IQRA 2CFUA 4I9EA 4LEUA 2VGXA 3G2TA 2XPYA 2AXUA 4I1MA 3ZYMA 5LX8A 4IN3B 3D3MA 4PS8A 2KZTB 3G2VA 4JHKA 4DLQA 5JJTA 5LOZA 1HG2A 1NA3A 2WM9A 2Y3AA 5G04J 2CFZA 2XEVA 4MLPA 3TGOA 4U0ZA 1XNFA 2FBNA 4JXTA 1TJCA 4JPSA 5T8IA 2GGFA 3S2AA 3AS4A 3D9LA 5DIZA 1OWLA 4DK5A 4MRUA 2PL2A 2EQXA 2J09A 3S7FA 3CK8A 4NACA 4N2SA 2KCVA 1FVFA 3GZ1A 4FHKA 1JWFA 4FHJA 4ACKA 3LVRE 3ASGA 1HG5A 3CQGB 3R9AB 4GZDA 4B8AA 4DJAA 2IU1A 4LERA 2E0IA 3R7RA 3DBSA 3D9KA 4A1SA 2J4DA 3U4TA 4U04A 4Q69A 3ZVVA 3B7SA 4U0UA 3D9OA 2VTBA 1WY6A 1EF1C 5FZSA 5FZRA 2J4BA 3PZDA 5BW8C 4AV7A 1ZBPA 5C1DA 3U66A 3HIZA 3GW4A 1MHQA 4HS2A 4OYSA 2OV8A 4LUNU 4WNGA 3CHQA 4WUYA 3QWWA 3FUFA 3U9WA 2X6KA 3ML8A 4ANUA 3KD7A 2KCKA 3LYAA 3MCXA 3LY7A 4FLBA 4I2ZA 4PUCA 4EPZA 3TG5A 3U3WA 4F3VA 5EDSA 2E2EA 3BG1B 4PS7A 3ZEFA 1KT1A 3ZFWA 1IYGA 1Z6TA 2GW1A 4FJZA 2WXQA 1Z3XA 3CHRA 3UX4A 3PNLB 4XKBA 5ARGA 5BPPA 3TG4A 2WXJA 2YINA 4TUUA 3VTXA 5ARFA 4A3TA 1ELWA 4HOTA 4JHRA 4EBAA 5D0QD 3GYZA 1NA0A 2XPIA 4L23A 1E96B 3ONLA 2Y4UA 4UQXA 1FCHA 4OVUA 1OWMA 4A1GA 4BFRA 1GW6A 3ZYQA 5ENNA 3L08A 3IHVA 2WQ7A 1SZ9A 2DIWA 2WPVA 4CDRA 3CHPA 3I5PA 4WNDA 3AU4A 4B94A 2KM4A 5FQ7A 3D9PA 3UMVA 4J6IA 4AIFA 4ANXA 1OWPA 5AENA 2AWIA 2VSNA 2XCCA 3LJ3A 2CHXA 4HXIA 2WXRA 4AOFA 3G2UA 3UT8A 2R59A 3LCAA 3ZYLA 5J90A 2JLBA 5BNWA 3LPZA 2XCBA 3SNXA 2VYIA 3IKOB 2IJGX 3IV0A 3QKYA 1OUVA 3Q4AB 3QOUA 4BX9A 4BTBA 1B89A 3OTNA 4HORA 4N5CA 2WXMA 4ABNA 3FH7A 2IOSA 2WXLA 3FH8A 1HX8A 1N54A 3FUIA 3LEWA 3PEVB 4W9RA 5LCWC 4H7YA 4JEHA 2MHKA 1HZ4A 3JYSA 3PUKA 2UWJG 4CT4A 4R7LA 4UI9C 3RO3A 4CCAA 5E75A 3ZPJA 4P29A 4WWPA 4NURA 3S7BA 2NC9A 4WNFA 2FO7A 3I4RB 3PH0C 2R5SA 4N3AA 4KVMA 5A6CA 4UWFA 1E7VA 1QQEA 3D9NA 2P58C 3KEZA 2PQRA 4A3VA 3ESKA 4JL0A 3LKUA 5E76A 2WXGA 4H7XA 1HFAA 3ML9A 2HM8A 1LF8A 2WXIA 4J0UA 3QARA 2PM7A 4KXKB 5BT1A 2MOWA 3LY8A 3RJVA 1QZ2A 4B8CB 2X6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2U A;  2IOS A;  4GMJ A;  2VSO E;  4C9B B;  2FUL A;  1N54 A;  2I2O A;  3L6A A;  4CEM A;  4CT4 A;  3D3M A;  1H6K A;  4B8A A;  2KZT B;  4JHK A;  2IU1 A;  3EIQ C;  3FEX A;  1H2T C;  4JHJ A;  2NSZ A;  1UG3 A;  1N52 A;  1HU3 A;  3FEY A;  4B89 A;  4GML A;  2KZT A;  2GGF A;  3JUI A;  2VSX E;  2IOL A;  4IUL A;  5ANR A;  2ZU6 B;  1H2V C;  4CRW A;  2HM8 A;  2ION A;  2RG8 A;  4LUN U;  1PAQ A;  1UW4 B;  3RK6 A;  3EIJ A;  4B8C B; 
#chains in the Genus database with same CATH topology
 4BY6 A;  3ABK E;  3Q47 B;  1QNF A;  2V5Q C;  4CEM A;  3TWX A;  3EDT B;  4RG9 A;  4ZHB A;  4CDM A;  1Z3Y A;  2CG3 A;  1K1A A;  1QBQ A;  4LRZ A;  1MYO A;  3ZU7 B;  2ZU6 B;  2C0M A;  2WXH A;  2WB2 A;  4GAA A;  4U63 A;  4KYO B;  1YMP A;  1H0A A;  4ILI A;  3CK7 A;  4U07 A;  4UQZ A;  1WAO 1;  4HOQ A;  1DVP A;  1K1B A;  2FF4 A;  4CRW A;  4KT6 B;  4HLE A;  3BEE A;  1G3N B;  4I6E A;  3JUE A;  4BWR A;  3DWL G;  2XEH A;  5BXU A;  3D9J A;  3N71 A;  4URK A;  3SD5 A;  2RKK A;  1E8X A;  4N5Q A;  3LVQ E;  3PEU B;  2PNN A;  5EKQ D;  4UI9 J;  3TWU A;  3W9F A;  2I2O A;  4GCO A;  2PQN A;  3QC1 A;  5EX3 A;  5B1A E;  4DX5 D;  4WWN A;  1NI1 A;  3PRZ A;  2UY1 B;  5G05 C;  4AJW A;  3L54 A;  1H2V C;  4DX2 A;  5AAO A;  3FU0 A;  3J5P A;  3SQV A;  1N94 A;  4HRN A;  2VSY A;  1S0P A;  5KJK A;  3CVX A;  3DEP A;  2LAH A;  3BU8 A;  4U95 D;  3PE4 A;  3JQ0 A;  3PZ2 A;  4MS6 A;  1JPL A;  3Q7A A;  3APD A;  3I3N A;  5JMN D;  5ANR A;  4PH4 B;  5D2M C;  2IO2 C;  3CVU A;  2KBX A;  2KXP C;  4L1B A;  4GZ6 A;  1H19 A;  4DI3 A;  5CCM A;  2J49 A;  5A7D B;  3DSS A;  5ITZ F;  4QQI A;  4FLH A;  5ANL A;  2IQC A;  2WMO A;  3HHM A;  4XX5 A;  1JWG A;  3FEY A;  4FAD A;  1BI7 B;  4UQY A;  4FP7 A;  2XHE A;  2KAT A;  1PAQ A;  2P9K G;  4LG6 A;  3NZS A;  3B7R L;  3ZW3 A;  2XZD G;  3QJZ A;  1TN6 A;  1YA0 A;  2OND A;  3MKQ A;  2XEE A;  3WG7 E;  4K5C A;  4U0S A;  5D66 A;  1TN8 A;  3ZRH A;  4TUM A;  5D0O D;  4JW1 A;  4GZ5 A;  1S63 A;  1SA4 A;  3SF4 A;  4PDX A;  1A17 A;  4U8H A;  1Y8M A;  5G05 J;  2BTD A;  2QYJ A;  4WNE A;  3I4G A;  5HKP A;  4E85 A;  1VDY A;  5AAR A;  4B89 A;  2IEJ A;  4L9P A;  3SO8 A;  3LS8 A;  2HE0 A;  1TNY A;  3TWS A;  5FQ8 A;  2H6I A;  3C5R A;  3HDX A;  3FU5 A;  4J8D A;  4BTA A;  2DWZ A;  1BPO A;  5CEC B;  4DPR A;  4LNB A;  3FUK A;  1BU9 A;  3ZIM A;  4J8S A;  3SI5 A;  2X6J A;  1O1S A;  1KZP A;  4O1P A;  3JCK C;  2CHW A;  1MJ0 A;  3WXX A;  1PY1 A;  4DI4 A;  3B7U X;  1H6O A;  4U8V D;  3MKR A;  4BET A;  1H2T C;  3ZXS A;  3DXM G;  2UY1 A;  2ETB A;  4ILH B;  3C98 A;  2Q7F A;  5CMY A;  3C3Q A;  5CCL A;  3B13 A;  3VLF A;  1IKN D;  4C9B B;  4RG6 A;  1X81 A;  3UT4 A;  2QYU A;  4I6G A;  1WM5 A;  3DPY A;  4AVX A;  2V4H C;  2R02 A;  4MBG A;  5KJN A;  3PNT B;  2ILR A;  3OXL A;  2L6B A;  4APO A;  4LEU A;  4I1M A;  5LX8 A;  2OEV A;  3D3M A;  2WM9 A;  1JCQ A;  4JXT A;  3AS4 A;  5DIZ A;  3DSX A;  4GPM A;  2PL2 A;  3CK8 A;  1FVF A;  4FHJ A;  4ACK A;  1S64 A;  1HG5 A;  5ENO D;  2IU1 A;  3DBS A;  3D9K A;  4A1S A;  2J4D A;  3E32 A;  5FIO A;  3UIP C;  3ZVV A;  3B7S A;  2VTB A;  5FZR A;  4AV7 A;  4WNG A;  3CHQ A;  3QWW A;  4GTM A;  3ML8 A;  3KD7 A;  3NB2 A;  3BG1 B;  4PS7 A;  4FJZ A;  4XKB A;  2DVW A;  3TG4 A;  2YIN A;  4TUU A;  4HNA D;  5ARF A;  1ELW A;  4EBA A;  2XPI A;  1KZO A;  3ZYQ A;  4BSZ B;  2WQ7 A;  4U8Y D;  1FPP A;  3CHP A;  3I5P A;  2KM4 A;  3D9P A;  4ANX A;  1OWP A;  2AWI A;  2VSN A;  3LJ3 A;  3E30 A;  5CRU A;  2WXR A;  4AOF A;  2R59 A;  5BNW A;  3LPZ A;  4BTB A;  4HBD A;  2P9N G;  2IOS A;  3UKU G;  2WXL A;  3PEV B;  4W9R A;  4H7Y A;  3PUK A;  4P29 A;  4NUR A;  4WNF A;  2R03 A;  5A6C A;  1E7V A;  3Q75 A;  3D9N A;  3DST A;  4A3V A;  2WXG A;  3DSU A;  2HM8 A;  2WXI A;  2PM7 A;  5BT1 A;  3MX3 A;  4B8C B;  3R9M A;  2IO3 C;  4BT8 A;  2IF4 A;  2AXV A;  5CED B;  3TJP A;  2I1K A;  4I1A A;  4K5B A;  2DZO A;  4JVS A;  2NSZ A;  4RVB A;  3CVL A;  5FQ6 A;  4HRL A;  2WXN A;  2GRL A;  2Y1L E;  1KPS B;  4CDN A;  1TR4 A;  3FWV A;  1ZU2 A;  1H2U A;  3CV0 A;  2L6J A;  3LXU X;  3AG3 E;  2XRZ A;  5ENQ D;  2H6G A;  3FP3 A;  3UT7 A;  3EHM A;  3HVE A;  2L0T B;  3RO2 A;  4L7T A;  4GU5 A;  3ASH A;  3T5X A;  2DCP A;  4C0M A;  2LO6 A;  2HR2 A;  2HYZ A;  2NYJ A;  3FH5 A;  5ENS D;  2XGM A;  3CSF A;  3ASO E;  1S70 B;  4EQF A;  3JUI A;  4N2Q A;  3G2W A;  4ME2 A;  2DBA A;  5H7P A;  3KS2 A;  3ZN3 A;  5HS0 A;  3B7T A;  2NXP A;  3PZ3 A;  2AVP A;  1HXI A;  2VGE A;  3CHM A;  4I9C A;  2VGY A;  4Z68 A;  3T5V A;  4Y6C A;  3CST A;  1UJK A;  3FUJ A;  1TNZ A;  4LNU D;  4N3C A;  2KC7 A;  4N3B A;  3RKV A;  3QB2 A;  1E7U A;  3ENE A;  3UKR G;  4IUL A;  5BV1 A;  3EUV A;  4XI9 A;  4K03 A;  2X3M A;  3TWV A;  3SZ7 A;  3IBE A;  4KZ0 A;  3APF A;  1OCZ E;  3JXI A;  4YDE A;  1E8Z A;  3MZL B;  1TEZ A;  4HOS A;  3MJW A;  3SBT B;  2RFA A;  4GYW A;  3EIQ C;  3MV2 B;  4HVB A;  3B7B A;  1X5B A;  3CVV A;  3PVL A;  4I6J A;  2ETA A;  5C2Y A;  3UUX A;  3FUE A;  1OXJ A;  4HOU A;  3SBS A;  4Q96 A;  4GCN A;  3MV3 B;  3S7D A;  4XE0 A;  2H6F A;  3W9G A;  5CBO A;  2KZT A;  5BXO A;  5CBN A;  3QAQ A;  2BED A;  4J8E A;  4JEU A;  4Q94 A;  4Y6W A;  1NP7 A;  1OY3 D;  3PE3 A;  2ZIS A;  2IFU A;  3Q78 A;  4AXH A;  2I1J A;  5FJY A;  5CHE E;  1AWC B;  5CER B;  2A5U A;  4F1S A;  4F53 A;  2OVB A;  4RQI A;  5G04 C;  3TWQ A;  2ION A;  4FC8 A;  1OCO E;  3JQ1 A;  4U7E B;  4G11 A;  4LSZ E;  1K3Z D;  3NF1 A;  1U3C A;  4PS3 A;  2ETC A;  3CVW A;  1MQS A;  3ZGQ A;  2EIK E;  1TYQ G;  3Q5M A;  3O48 A;  2X38 A;  3MYV A;  3Q79 A;  4L2L A;  2J07 A;  2XPZ A;  4GTS A;  2H6H A;  2VJ8 A;  2FI7 A;  2LXM A;  4XIF A;  4EZK A;  3E4B A;  3CK9 A;  3PZ1 A;  1BD8 A;  2F0Y A;  3ULQ A;  2R17 C;  5B3S E;  3ZHE B;  2AXZ A;  3S7J A;  5T4Y A;  2B0O E;  2YQ8 A;  4FUL A;  1N11 A;  5FT9 A;  4B0Z A;  2HO1 A;  2CHZ A;  5G55 A;  1E8Y A;  1MX6 A;  3SGH A;  4O6F A;  1MZC A;  2YHE A;  3EU9 A;  3UM1 A;  3K9I A;  5FTP A;  3FFL A;  3QWV A;  1HS6 A;  2IOL A;  3FUN A;  1KLX A;  4JD2 G;  2XPY A;  3ZYM A;  2P9U G;  5LOZ A;  3EHQ A;  5G04 J;  3TWT A;  2XEV A;  4G8K A;  1XNF A;  4F6R D;  4JPS A;  5T8I A;  4HLL A;  4C48 B;  1MX2 A;  3S7F A;  1FT1 A;  4DX7 D;  3UM3 A;  3ZKJ A;  3ISM C;  3LVR E;  3PZ4 A;  3R9A B;  4GZD A;  4LER A;  2E0I A;  2EIM E;  3E33 A;  3AG4 E;  3D9O A;  1LD8 A;  3HG0 D;  4XEI G;  2J4B A;  5BW8 C;  1ZBP A;  4HS2 A;  4OYS A;  4WUY A;  4LUN U;  4A63 B;  4F3V A;  2E2E A;  3ZEF A;  1IYG A;  3ZFW A;  1Z6T A;  5BPP A;  5EYL A;  3VTX A;  4JHR A;  2P9P G;  2Y4U A;  1FCH A;  4BFR A;  1TNB A;  3IHV A;  2WPV A;  1N0Q A;  5FQ7 A;  4AIF A;  2XCC A;  2F8X K;  3B95 A;  5J90 A;  2JLB A;  4OAV B;  3IKO B;  2P9I G;  1OUV A;  5ENP D;  4N5C A;  3HXC A;  2WXM A;  4ABN A;  3FH7 A;  3FH8 A;  1N54 A;  3LEW A;  2MHK A;  1HZ4 A;  4CT4 A;  4UUC A;  3RO3 A;  5E75 A;  4WWP A;  1Q2Z A;  2NC9 A;  2R5S A;  4N3A A;  4OAU C;  3KEZ A;  4JL0 A;  5E76 A;  4J0U A;  4GTQ A;  2MOW A;  3RJV A;  2B6C A;  2J9Q A;  1DCQ A;  3CQC B;  3FU3 A;  1IHG A;  3CVP A;  4JA7 A;  2L9B A;  4J8F A;  4IRU A;  5AIJ A;  1O5M A;  3P1U A;  2GRP B;  3QNK A;  3FTS A;  1HH8 A;  2RG8 A;  1XGW A;  5KWD A;  4C0E A;  4DLO A;  4G2V A;  1N4S A;  1E90 A;  2FUL A;  3TWW A;  5J08 A;  1HE8 A;  2FO1 E;  3FTW A;  4G23 A;  2P9L G;  3FHE A;  1N4R A;  3U64 A;  4AP2 A;  3QK0 A;  4NRH B;  5AQA A;  2EIL E;  4CZ2 D;  3D9H A;  4GYO A;  3RAU A;  1OCC E;  3FDH A;  3DXK G;  3PDN A;  2GRQ B;  4O60 A;  3FTU A;  2WXF A;  5LP0 A;  3PRE A;  4MKT A;  3CIA A;  1JCR A;  2OOE A;  3SHF A;  3FY4 A;  3MEK A;  1HO8 A;  2LXL A;  1TN7 A;  3ZUV B;  3CHO A;  4BEP A;  4G25 A;  3ASD A;  2WVI A;  3Q15 A;  3KSL A;  3CKB A;  2ZIR A;  4KZC A;  4AY5 A;  5HQ8 A;  1W3B A;  3F6Q A;  2X6F A;  3C3R A;  2J8S D;  4KVO A;  2FEZ A;  1KT0 A;  4G1T A;  4FJY A;  3EU5 A;  4APF A;  3FU6 A;  4RSY A;  5JHA A;  3SFZ A;  3OXG A;  4EHM A;  2OCC E;  4YVO A;  1EYH A;  4XI0 A;  4GTV A;  4TXR A;  4CYM D;  1UJJ A;  3CEQ A;  4UWL A;  3CVQ A;  3P2B A;  3EHR A;  5AN8 A;  3Q49 B;  3ULE G;  1QYM A;  3AG1 E;  3HRA A;  3PUJ A;  5CMW A;  3E34 A;  4TV3 A;  2MRI A;  2WQH A;  4V3I A;  3OXF A;  2ZGD A;  3CLJ A;  5IY5 E;  3V79 K;  3T8K A;  1DCE A;  3D9I A;  1FT2 A;  3NBN B;  4JC8 A;  2X6H A;  5FQ4 A;  3CVN A;  3Q73 A;  5BV0 A;  2WXP A;  5KNH D;  2WXK A;  4G26 A;  3L22 A;  3KAE A;  4YDW A;  1SVX A;  4ILG A;  5T3R A;  2EIN E;  3SFX A;  2F8Y A;  2LSU A;  4GTT A;  4NQ0 A;  1WG0 A;  4ACL A;  4E6H A;  4GTO A;  4ATZ D;  5JHB A;  1HU3 A;  3T8M A;  1SA5 A;  5BUZ A;  1SQM A;  1LD7 A;  2V5F A;  4HI8 A;  3DRA A;  1JCS A;  3CR3 A;  4FU3 A;  4EEC A;  3V31 A;  2I6H A;  4I17 A;  3L6A A;  4IYP A;  5B1B E;  3DSV A;  2BF0 X;  2F37 A;  4EZJ A;  4JHJ A;  1ELR A;  4HFG A;  3D9M A;  3HXB A;  3IXE A;  3QWP A;  5ENR D;  5KJL A;  5JJ7 A;  3AAA C;  2BKK B;  4GA1 A;  4GMJ A;  3FUD A;  3TL5 A;  5LFA A;  3GZ2 A;  2QY7 A;  4G8L A;  4I43 A;  2C2L A;  3KSQ A;  1OWO A;  2JEK A;  3SY2 A;  1L5J A;  2VSX E;  5A23 A;  4KMO A;  2AW6 A;  5AYW D;  1RW2 A;  1Y6I A;  3CKC A;  4HI9 A;  1FVH A;  1N9A A;  3ABL E;  1LTX A;  2C0L A;  1UN9 A;  4I1O B;  2LUH A;  4GPK A;  3MKQ B;  4M3O A;  3JXJ A;  3L9T A;  3G2T A;  3UM2 A;  2AXU A;  1IHB A;  4IN3 B;  3G2V A;  4JHK A;  1NA3 A;  2Y3A A;  5JA4 D;  4BES A;  1TJC A;  2GGF A;  3S2A A;  4TXQ A;  3D9L A;  4DK5 A;  2EQX A;  2J09 A;  4N2S A;  3GZ1 A;  4FHK A;  1JWF A;  3RSE G;  3CQG B;  2Y69 E;  3R7R A;  4J7W A;  4GMR A;  3T9K A;  3DEO A;  3U4T A;  4Q69 A;  1WY6 A;  5C1D A;  3U66 A;  3PZD A;  3FUF A;  4ANU A;  3MCX A;  4FLB A;  4PUC A;  4EPZ A;  3U3W A;  2GW1 A;  1V54 E;  2WXQ A;  3CHR A;  3UX4 A;  5ARG A;  4A3T A;  5D0Q D;  3GYZ A;  1NA0 A;  1E96 B;  1OWM A;  1TNU A;  4K5A B;  1YYH A;  1GW6 A;  1SZ9 A;  2GRR B;  2P9S G;  3AU4 A;  2XEN A;  3G2U A;  3UT8 A;  3LCA A;  3LJN A;  5EYP F;  3X2Q E;  2XCB A;  4DRX E;  1V55 E;  3IV0 A;  3QKY A;  4GTP A;  3QOU A;  4BX9 A;  1OT8 A;  1B89 A;  4HOR A;  1HX8 A;  3FUI A;  5LCW C;  4JEH A;  2UWJ G;  4R7L A;  3ZPJ A;  3UTM A;  3UXG A;  3BQO A;  2FO7 A;  3PH0 C;  4UWF A;  1QQE A;  5KNG A;  2JAB A;  3ESK A;  1UOH A;  4H7X A;  1HFA A;  3ML9 A;  3QAR A;  1BLX B;  3LY8 A;  2X6I A;  2A4Z A;  4M7C A;  2VSO E;  4YVQ C;  1ELK A;  3PS6 A;  1TNO A;  4QFV A;  4G24 A;  1EDU A;  3ONK A;  3UPV A;  2V0P A;  4ATG A;  4D10 C;  2I9C A;  5KJM A;  2XGS A;  1BI8 B;  4ZFH A;  3Q9N C;  1O1R A;  4EZL A;  4CGV A;  4AM9 A;  3APC A;  3R7Q A;  3LY9 A;  1ZB1 A;  3AU5 A;  3FTV A;  3HXF A;  2VTB B;  3Q7F A;  2QFC A;  3DPD A;  1N52 A;  3FTX A;  2ZXW E;  2M63 A;  5FWQ A;  1OWN A;  1NL4 A;  2V8S E;  3SFY A;  4GZC A;  4X8Q A;  2V4L A;  1O1T A;  2ZGG A;  4AY6 A;  1UN8 A;  1HF8 A;  3MGB A;  4LCT A;  3L17 A;  4AEZ C;  5M72 A;  3ZNG A;  4UI9 K;  2DZN A;  3FTZ A;  3HXD A;  3UQ3 A;  4F7A A;  3V2X A;  4GB9 A;  4O1O A;  4GML A;  1D8E A;  2XRY A;  3QDN A;  5HI7 A;  5AJD A;  2L0I A;  4UWK A;  4JZY A;  1H6P A;  5LCW J;  3OAW A;  3TXN A;  1K8K G;  2CG2 A;  3L82 A;  3NOG D;  2EIJ E;  2OVF A;  2DYS E;  1JUQ A;  1U3D A;  1AP7 A;  1H6K A;  3NQP A;  3KEA A;  5HRY A;  2KCL A;  1DNP A;  3G2S A;  2PM6 A;  4GZ3 A;  3FUH A;  3URZ A;  2WXO A;  3DSW A;  4UWG A;  3IEG A;  5DBK A;  3BG0 B;  3AS8 A;  3CHS A;  4KBQ A;  4YDO A;  4WAF A;  2LAI A;  4HQD A;  4DX1 A;  1Z5S C;  2VGX B;  1D8D A;  3HYM B;  2YNQ A;  3O4Z A;  4YDY A;  3EIJ A;  3ZHE A;  5AQB A;  4GA0 A;  5G2N A;  5FIN A;  1P5Q A;  1SZA A;  4CGW A;  4YND A;  1TJF A;  4HB5 A;  3L16 A;  2AJA A;  3RRU A;  1UG3 A;  4BT9 A;  3AG2 E;  4GA2 A;  2OEW A;  1EPU A;  3VTY A;  3IHY A;  3HXE A;  4OVV A;  4UWH A;  5KCM A;  3C3O A;  4XKC A;  3HVE B;  3TAX A;  2J08 A;  2RFM A;  3ULY A;  1U2V G;  3NOC D;  4L2Y A;  4CT0 A;  4TXP A;  2Y4T A;  4GYY A;  2RD0 A;  4N39 A;  3ZYK A;  1NFI E;  3VLE A;  1UW4 B;  2XS8 A;  2R2L A;  2MYO A;  1NZN A;  2VQ2 A;  3TWR A;  4JA9 A;  3RRM B;  2LNI A;  1PC2 A;  3ASF A;  3RU0 A;  5KBA A;  3FUL A;  1INZ A;  2GRN B;  2QC9 A;  3EJN A;  1E8W A;  4ANW A;  4EBA G;  4WWO A;  2LSV A;  4XZ4 A;  1DC2 A;  2GRM A;  3CVY A;  3C72 A;  3ESL A;  3ABM E;  4GTR A;  3MA5 A;  2PZI A;  5AJL A;  3GZS A;  4DUI A;  4FA6 A;  5CRV A;  4K0R A;  1IQU A;  3FUM A;  5AQ9 A;  3E37 A;  4F1P A;  2WQ6 A;  5FZQ A;  3FTY A;  3NAW A;  3CGH A;  3NZU A;  5AQ7 A;  2XGO A;  3TXM A;  5EN5 D;  1IXV A;  4HRM B;  2XQ0 A;  4I2W A;  5JJ6 A;  3RIB A;  3UIN C;  5EIB E;  2Y0B G;  2DYR E;  3LDZ A;  1SW6 A;  2YHC A;  2WMN A;  3EHN A;  2BKG A;  5EID A;  2IY0 C;  1N4P A;  4BSX A;  4BX8 A;  4ANV A;  4TRQ A;  3FEX A;  3VLD A;  4BER A;  1N4Q A;  5EX0 A;  3RRN B;  4A55 A;  2XS1 A;  2XZT G;  3AS5 A;  2BUG A;  3L13 A;  5ENT D;  3RK6 A;  1IQR A;  2CFU A;  4I9E A;  2VGX A;  3UIO C;  4PS8 A;  2KZT B;  4DLQ A;  5JJT A;  1HG2 A;  2CFZ A;  4MLP A;  3TGO A;  4U0Z A;  2FBN A;  3ASN E;  1YCS B;  1OWL A;  4MRU A;  3Q9U C;  1N95 A;  2KCV A;  5EIL A;  2A5E A;  3ASG A;  4B8A A;  4DJA A;  4NIK A;  4J8Y A;  4DX6 D;  2P2C P;  4U04 A;  4U0U A;  5FZS A;  1EF1 C;  3HIZ A;  3GW4 A;  1MHQ A;  2OV8 A;  3ZXP A;  3U9W A;  2X6K A;  4U96 D;  2GRO B;  2KCK A;  3LYA A;  4I2Z A;  3LY7 A;  3TG5 A;  5EDS A;  1KT1 A;  1Z3X A;  3PNL B;  2WXJ A;  4HOT A;  4L23 A;  1OCR E;  3ONL A;  4UQX A;  4OVU A;  4A1G A;  5ENN A;  3L08 A;  2DIW A;  1MX4 A;  2QZA A;  3J5Q B;  4CDR A;  4WND A;  1A5E A;  4B94 A;  3UMV A;  4J6I A;  5AEN A;  4JB8 P;  3BUA A;  2CHX A;  4HXI A;  4B93 B;  3ZYL A;  1D9S A;  4LNG A;  3SNX A;  2VYI A;  1RZ4 A;  1WDY A;  2IJG X;  4RLY A;  3Q4A B;  3OTN A;  3AJI A;  3UI2 A;  3UM0 A;  3JYS A;  4UI9 C;  4CCA A;  2R05 A;  5CEA A;  3S7B A;  3I4R B;  4KVM A;  2P58 C;  3V2O A;  2PQR A;  3LKU A;  1LF8 A;  1N0R A;  4KXK B;  3V30 A;  1QZ2 A;  4NAC A; 
#chains in the Genus database with same CATH homology
 2A4Z A;  4BT8 A;  2J9Q A;  2VSO E;  4BY6 A;  2IF4 A;  4YVQ C;  1ELK A;  3Q47 B;  2AXV A;  1QNF A;  3MX3 A;  3PS6 A;  3CQC B;  3TJP A;  4CEM A;  2I1K A;  3FU3 A;  1IHG A;  3EDT B;  4RG9 A;  4I1A A;  4CDM A;  4QFV A;  1Z3Y A;  4G24 A;  2CG3 A;  3CVP A;  4JA7 A;  4JVS A;  2L9B A;  2NSZ A;  4J8F A;  1EDU A;  4RVB A;  3ONK A;  3CVL A;  3UPV A;  4IRU A;  4LRZ A;  5AIJ A;  3P1U A;  5FQ6 A;  2V0P A;  2WXN A;  3QNK A;  2GRL A;  2ZU6 B;  4ATG A;  2I9C A;  4D10 C;  5KJM A;  2C0M A;  3FTS A;  2WXH A;  1HH8 A;  2RG8 A;  4CDN A;  1XGW A;  2XGS A;  4C0E A;  3FWV A;  1ZU2 A;  1H2U A;  4DLO A;  4G2V A;  2WB2 A;  4GAA A;  3CV0 A;  4KYO B;  4U63 A;  1E90 A;  2FUL A;  2L6J A;  4EZL A;  3LXU X;  1H0A A;  4CGV A;  5J08 A;  1HE8 A;  3APC A;  4ILI A;  4AM9 A;  3R7Q A;  3LY9 A;  3CK7 A;  3FTW A;  4G23 A;  2XRZ A;  4U07 A;  4UQZ A;  3AU5 A;  3FP3 A;  3FTV A;  3UT7 A;  2VTB B;  1WAO 1;  4HOQ A;  3EHM A;  3FHE A;  2QFC A;  3DPD A;  1DVP A;  1N52 A;  3HVE A;  3U64 A;  3FTX A;  4AP2 A;  2L0T B;  2M63 A;  1OWN A;  5FWQ A;  3RO2 A;  3QK0 A;  4L7T A;  4GU5 A;  3ASH A;  2FF4 A;  2V8S E;  4NRH B;  4CRW A;  4KT6 B;  4HLE A;  4GZC A;  3BEE A;  2V4L A;  3T5X A;  2DCP A;  4GYO A;  4C0M A;  2LO6 A;  4AY6 A;  1UN8 A;  1HF8 A;  4I6E A;  3FDH A;  3MGB A;  4BWR A;  4LCT A;  2HR2 A;  2HYZ A;  3L17 A;  4AEZ C;  5M72 A;  4UI9 K;  3FH5 A;  2XGM A;  3FTZ A;  3CSF A;  3D9J A;  3PDN A;  3UQ3 A;  4F7A A;  3N71 A;  4GB9 A;  3FTU A;  4GML A;  2WXF A;  2XRY A;  3QDN A;  3JUI A;  3SD5 A;  4EQF A;  4URK A;  5LP0 A;  4N2Q A;  3PRE A;  1E8X A;  5HI7 A;  5AJD A;  2L0I A;  4UWK A;  4JZY A;  5LCW J;  3G2W A;  3LVQ E;  4ME2 A;  4MKT A;  3PEU B;  3CIA A;  3OAW A;  2DBA A;  5EKQ D;  4UI9 J;  2OOE A;  3KS2 A;  2CG2 A;  3SHF A;  3TXN A;  3ZN3 A;  3FY4 A;  3MEK A;  2OVF A;  2I2O A;  4GCO A;  2PQN A;  3QC1 A;  5EX3 A;  1HO8 A;  3B7T A;  2NXP A;  4WWN A;  3CHO A;  1JUQ A;  1U3D A;  3PRZ A;  1H6K A;  2UY1 B;  3NQP A;  2AVP A;  4G25 A;  3ASD A;  2KCL A;  1DNP A;  1HXI A;  2WVI A;  3Q15 A;  3G2S A;  5G05 C;  2PM6 A;  3CHM A;  4AJW A;  3CKB A;  3L54 A;  4I9C A;  2VGY A;  1H2V C;  3T5V A;  4KZC A;  4AY5 A;  5HQ8 A;  4GZ3 A;  3FUH A;  4Y6C A;  3FU0 A;  3CST A;  1W3B A;  2VSY A;  1UJK A;  3URZ A;  2X6F A;  1S0P A;  2WXO A;  5KJK A;  3FUJ A;  4N3C A;  4UWG A;  3CVX A;  4KVO A;  3IEG A;  2KC7 A;  5DBK A;  2LAH A;  3AS8 A;  2FEZ A;  1KT0 A;  3BG0 B;  3CHS A;  4G1T A;  4N3B A;  3RKV A;  3QB2 A;  4FJY A;  3PE4 A;  3JQ0 A;  4KBQ A;  1E7U A;  1JPL A;  4MS6 A;  4APF A;  4WAF A;  3FU6 A;  4RSY A;  5JHA A;  3SFZ A;  2LAI A;  3APD A;  3ENE A;  3OXG A;  3I3N A;  4IUL A;  5BV1 A;  5ANR A;  4PH4 B;  4XI9 A;  4YVO A;  4K03 A;  2X3M A;  2VGX B;  1EYH A;  4XI0 A;  3HYM B;  3SZ7 A;  2YNQ A;  3O4Z A;  3IBE A;  3CVU A;  4KZ0 A;  3APF A;  3EIJ A;  3ZHE A;  4L1B A;  4GZ6 A;  1E8Z A;  4GA0 A;  3MZL B;  5G2N A;  1UJJ A;  1H19 A;  4DI3 A;  5CCM A;  3CEQ A;  2J49 A;  5A7D B;  4UWL A;  1P5Q A;  1SZA A;  3CVQ A;  4CGW A;  1TEZ A;  4FLH A;  1TJF A;  4YND A;  4HOS A;  3MJW A;  3SBT B;  4GYW A;  3EIQ C;  3L16 A;  3MV2 B;  3P2B A;  5ANL A;  3RRU A;  2IQC A;  2WMO A;  3HHM A;  4XX5 A;  1UG3 A;  1JWG A;  3FEY A;  4BT9 A;  4HVB A;  3Q49 B;  4GA2 A;  4FAD A;  4UQY A;  1X5B A;  3CVV A;  4FP7 A;  2XHE A;  1EPU A;  3VTY A;  2KAT A;  3IHY A;  3PUJ A;  5CMW A;  1PAQ A;  3PVL A;  4I6J A;  4TV3 A;  3NZS A;  5C2Y A;  4OVV A;  4UWH A;  3UUX A;  3B7R L;  2MRI A;  3FUE A;  3QJZ A;  3ZW3 A;  4HOU A;  2WQH A;  4V3I A;  5KCM A;  1YA0 A;  2OND A;  3SBS A;  3MKQ A;  4Q96 A;  4XKC A;  3OXF A;  3CLJ A;  3HVE B;  4GCN A;  3MV3 B;  3TAX A;  3S7D A;  4U0S A;  4XE0 A;  2J08 A;  3D9I A;  3ZRH A;  4JC8 A;  4L2Y A;  2X6H A;  5FQ4 A;  4CT0 A;  3CVN A;  2KZT A;  5BV0 A;  2Y4T A;  4GYY A;  2RD0 A;  4N39 A;  5D0O D;  2WXP A;  2WXK A;  4G26 A;  3ZYK A;  3L22 A;  3QAQ A;  4J8E A;  3KAE A;  4JW1 A;  3VLE A;  4GZ5 A;  4JEU A;  1UW4 B;  4ILG A;  3SF4 A;  4PDX A;  4Q94 A;  4Y6W A;  1A17 A;  1NP7 A;  4U8H A;  1Y8M A;  3PE3 A;  5T3R A;  5G05 J;  1NZN A;  2VQ2 A;  2IFU A;  4AXH A;  2I1J A;  5FJY A;  5CHE E;  2LSU A;  4NQ0 A;  2BTD A;  4ACL A;  4JA9 A;  3RRM B;  4E6H A;  4WNE A;  3I4G A;  2LNI A;  5JHB A;  1PC2 A;  2A5U A;  4F1S A;  4E85 A;  1VDY A;  1HU3 A;  3ASF A;  3T8M A;  4B89 A;  3RU0 A;  4F53 A;  5BUZ A;  2OVB A;  1SQM A;  2V5F A;  3FUL A;  1INZ A;  3LS8 A;  5G04 C;  2ION A;  3EJN A;  1E8W A;  4FC8 A;  3JQ1 A;  5FQ8 A;  4G11 A;  3CR3 A;  4FU3 A;  4ANW A;  4EBA G;  4WWO A;  4EEC A;  2LSV A;  4XZ4 A;  2GRM A;  3HDX A;  2I6H A;  4I17 A;  3NF1 A;  1U3C A;  3CVY A;  3ESL A;  3FU5 A;  3L6A A;  4PS3 A;  4J8D A;  4IYP A;  3MA5 A;  4BTA A;  2PZI A;  1BPO A;  3CVW A;  1MQS A;  2BF0 X;  5AJL A;  4DPR A;  3FUK A;  3ZGQ A;  4EZJ A;  4JHJ A;  3GZS A;  1ELR A;  3ZIM A;  4HFG A;  3D9M A;  4J8S A;  3Q5M A;  3O48 A;  2X38 A;  3QWP A;  3SI5 A;  2X6J A;  5KJL A;  3MYV A;  5JJ7 A;  4L2L A;  4FA6 A;  3JCK C;  2CHW A;  4K0R A;  2J07 A;  1IQU A;  2XPZ A;  3FUM A;  4GA1 A;  3WXX A;  2WQ6 A;  4GMJ A;  3FUD A;  5FZQ A;  3TL5 A;  2VJ8 A;  1PY1 A;  2FI7 A;  3FTY A;  4XIF A;  4DI4 A;  4EZK A;  3B7U X;  3CGH A;  3E4B A;  3NZU A;  3CK9 A;  5LFA A;  3GZ2 A;  2QY7 A;  2XGO A;  4I43 A;  2C2L A;  3TXM A;  3MKR A;  1H2T C;  3ZXS A;  1OWO A;  3ULQ A;  2JEK A;  2R17 C;  2UY1 A;  4ILH B;  3C98 A;  2XQ0 A;  4I2W A;  5JJ6 A;  1L5J A;  2VSX E;  2Q7F A;  3ZHE B;  2AXZ A;  5A23 A;  3RIB A;  5CMY A;  3S7J A;  4KMO A;  5T4Y A;  5CCL A;  2AW6 A;  2YQ8 A;  4FUL A;  3B13 A;  3VLF A;  5AYW D;  5FT9 A;  3LDZ A;  4B0Z A;  2HO1 A;  2YHC A;  2WMN A;  2CHZ A;  4C9B B;  3EHN A;  5G55 A;  1Y6I A;  1E8Y A;  4RG6 A;  3CKC A;  3SGH A;  3UT4 A;  4BSX A;  4I6G A;  4O6F A;  2YHE A;  4ANV A;  4BX8 A;  3K9I A;  4TRQ A;  1WM5 A;  3FEX A;  1FVH A;  4AVX A;  3VLD A;  5FTP A;  3FFL A;  5EX0 A;  5KJN A;  3PNT B;  3QWV A;  1HS6 A;  2IOL A;  2C0L A;  1UN9 A;  2ILR A;  3RRN B;  3OXL A;  4A55 A;  3AS5 A;  2BUG A;  1KLX A;  3FUN A;  3L13 A;  4I1O B;  4GPK A;  3MKQ B;  4APO A;  4M3O A;  3RK6 A;  1IQR A;  2CFU A;  4I9E A;  4LEU A;  2VGX A;  3G2T A;  2XPY A;  2AXU A;  4I1M A;  3ZYM A;  5LX8 A;  4IN3 B;  3D3M A;  4PS8 A;  2KZT B;  3G2V A;  4JHK A;  4DLQ A;  5JJT A;  5LOZ A;  1HG2 A;  1NA3 A;  2WM9 A;  2Y3A A;  5G04 J;  2CFZ A;  2XEV A;  4MLP A;  3TGO A;  4U0Z A;  1XNF A;  2FBN A;  4JXT A;  1TJC A;  4JPS A;  5T8I A;  2GGF A;  3S2A A;  3AS4 A;  3D9L A;  5DIZ A;  1OWL A;  4DK5 A;  4MRU A;  2PL2 A;  2EQX A;  2J09 A;  3S7F A;  3CK8 A;  4NAC A;  4N2S A;  2KCV A;  1FVF A;  3GZ1 A;  4FHK A;  1JWF A;  4FHJ A;  4ACK A;  3LVR E;  3ASG A;  1HG5 A;  3CQG B;  3R9A B;  4GZD A;  4B8A A;  4DJA A;  2IU1 A;  4LER A;  2E0I A;  3R7R A;  3DBS A;  3D9K A;  4A1S A;  2J4D A;  3U4T A;  4U04 A;  4Q69 A;  3ZVV A;  3B7S A;  4U0U A;  3D9O A;  2VTB A;  1WY6 A;  1EF1 C;  5FZS A;  5FZR A;  2J4B A;  3PZD A;  5BW8 C;  4AV7 A;  1ZBP A;  5C1D A;  3U66 A;  3HIZ A;  3GW4 A;  1MHQ A;  4HS2 A;  4OYS A;  2OV8 A;  4LUN U;  4WNG A;  3CHQ A;  4WUY A;  3QWW A;  3FUF A;  3U9W A;  2X6K A;  3ML8 A;  4ANU A;  3KD7 A;  2KCK A;  3LYA A;  3MCX A;  3LY7 A;  4FLB A;  4I2Z A;  4PUC A;  4EPZ A;  3TG5 A;  3U3W A;  4F3V A;  5EDS A;  2E2E A;  3BG1 B;  4PS7 A;  3ZEF A;  1KT1 A;  3ZFW A;  1IYG A;  1Z6T A;  2GW1 A;  4FJZ A;  2WXQ A;  1Z3X A;  3CHR A;  3UX4 A;  3PNL B;  4XKB A;  5ARG A;  5BPP A;  3TG4 A;  2WXJ A;  2YIN A;  4TUU A;  3VTX A;  5ARF A;  4A3T A;  1ELW A;  4HOT A;  4JHR A;  4EBA A;  5D0Q D;  3GYZ A;  1NA0 A;  2XPI A;  4L23 A;  1E96 B;  3ONL A;  2Y4U A;  4UQX A;  1FCH A;  4OVU A;  1OWM A;  4A1G A;  4BFR A;  1GW6 A;  3ZYQ A;  5ENN A;  3L08 A;  3IHV A;  2WQ7 A;  1SZ9 A;  2DIW A;  2WPV A;  4CDR A;  3CHP A;  3I5P A;  4WND A;  3AU4 A;  4B94 A;  2KM4 A;  5FQ7 A;  3D9P A;  3UMV A;  4J6I A;  4AIF A;  4ANX A;  1OWP A;  5AEN A;  2AWI A;  2VSN A;  2XCC A;  3LJ3 A;  2CHX A;  4HXI A;  2WXR A;  4AOF A;  3G2U A;  3UT8 A;  2R59 A;  3LCA A;  3ZYL A;  5J90 A;  2JLB A;  5BNW A;  3LPZ A;  2XCB A;  3SNX A;  2VYI A;  3IKO B;  2IJG X;  3IV0 A;  3QKY A;  1OUV A;  3Q4A B;  3QOU A;  4BX9 A;  4BTB A;  1B89 A;  3OTN A;  4HOR A;  4N5C A;  2WXM A;  4ABN A;  3FH7 A;  2IOS A;  2WXL A;  3FH8 A;  1HX8 A;  1N54 A;  3FUI A;  3LEW A;  3PEV B;  4W9R A;  5LCW C;  4H7Y A;  4JEH A;  2MHK A;  1HZ4 A;  3JYS A;  3PUK A;  2UWJ G;  4CT4 A;  4R7L A;  4UI9 C;  3RO3 A;  4CCA A;  5E75 A;  3ZPJ A;  4P29 A;  4WWP A;  4NUR A;  3S7B A;  2NC9 A;  4WNF A;  2FO7 A;  3I4R B;  3PH0 C;  2R5S A;  4N3A A;  4KVM A;  5A6C A;  4UWF A;  1E7V A;  1QQE A;  3D9N A;  2P58 C;  3KEZ A;  2PQR A;  4A3V A;  3ESK A;  4JL0 A;  3LKU A;  5E76 A;  2WXG A;  4H7X A;  1HFA A;  3ML9 A;  2HM8 A;  1LF8 A;  2WXI A;  4J0U A;  3QAR A;  2PM7 A;  4KXK B;  5BT1 A;  2MOW A;  3LY8 A;  3RJV A;  1QZ2 A;  4B8C B;  2X6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...