4GMJA

Structure of human not1 mif4g domain co-crystallized with caf1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
b'HMLEENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT transcription complex subunit 1
publication title The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 82
structure length 229
sequence length 229
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gmjA00
2IOSA 5ANRA 1UG3A 3EIQC 2ZU6B 4GMJA 4CT4A 4B8CB 1PAQA 2IU1A 1HU3A 3FEYA 3JUIA 4C9BB 2RG8A 2KZTB 3EIJA 1H2VC 3FEXA 2IONA 3RK6A 1UW4B 4LUNU 3D3MA 2FULA 4GMLA 2GGFA 4JHKA 2HM8A 4CRWA 2VSOE 4IULA 4JHJA 2IOLA 3L6AA 2I2OA 1H6KA 1H2TC 4CEMA 1H2UA 2NSZA 2VSXE 4B89A 1N54A 4B8AA 2KZTA 1N52A
chains in the Genus database with same CATH superfamily
3FH5A 2XGMA 2WXKA 1OXJA 4RLYA 2H6GA 4GZDA 2J08A 3URZA 3ZHEA 2WXFA 2WXIA 5KNGA 1KLXA 4D10C 1YMPA 1D8DA 2V0PA 4L1BA 3FUIA 4BTBA 3BUAA 1HXIA 3N71A 4G2VA 1H2TC 1MJ0A 3ZYMA 5KJNA 5CRUA 4HLEA 3S7FA 2H6HA 4OVUA 3ZUVB 4O6FA 5BV1A 2YHCA 3O4ZA 4EZKA 2KM4A 3MCXA 1KZOA 3KD7A 3OAWA 5CRVA 4K0RA 1EYHA 5KBAA 5AENA 3LY7A 3RAUA 2KBXA 3CQCB 5FQ4A 2GRPB 3VTYA 4BSZB 4KT6B 1A17A 2XEEA 1KZPA 5KJLA 3MEKA 1E8ZA 1SA5A 5BXUA 4DX7D 4B93B 2Q7FA 3UKUG 2P9PG 5G04J 5KNHD 2A4ZA 5JJ7A 3V30A 3KSLA 1N4PA 3RKVA 5CCLA 2ILRA 3TWQA 3P2BA 4L2YA 4L23A 4ANWA 1H0AA 1OY3D 3JQ1A 3RJVA 4J0UA 4J8DA 3FU6A 3CVQA 5ANLA 3PZ3A 5LCWC 3G2TA 3SHFA 3CR3A 1QQEA 5ENRD 2WMNA 2A5EA 1X81A 3I4GA 4O1OA 5AAOA 1TN8A 1H6OA 3LYAA 1S70B 2Y4UA 1TN6A 1HE8A 1HX8A 4GU5A 5J90A 2GRMA 3JUIA 2C2LA 2MOWA 4BESA 3PEVB 2NXPA 3V79K 2I1JA 1OCRE 5D2MC 3OXLA 2L0TB 1OUVA 3VLFA 4A63B 1NZNA 3TG4A 1UG3A 5LOZA 4I6EA 4I17A 3EJNA 1HU3A 2ZGGA 4C9BB 1Z3XA 2MHKA 3UIPC 3TWTA 1D8EA 5EYPF 3Q7FA 1ELKA 5FIOA 3FUMA 3TWXA 3U4TA 3ABKE 4PS7A 3TXNA 3MKQA 1IQUA 3X2QE 2XS1A 2L9BA 2GRQB 5JJTA 3HXCA 4PS8A 4C0MA 3QK0A 2R59A 3C3RA 4AP2A 3D9JA 4HBDA 4Q96A 2R17C 4GZ5A 4A1SA 1WM5A 3EDTB 4ILIA 2GRNB 3MV3B 4CEMA 3DSSA 5EDSA 1ZBPA 2KZTA 4G8KA 3T8MA 1JCRA 4K5AB 5KWDA 2P9UG 3EU5A 4LERA 4ACKA 3B7SA 3FP3A 4NACA 1MX4A 4YVOA 3NZSA 5FTPA 5CERB 1JCSA 3RRNB 3FU0A 3DSTA 4BWRA 3PE3A 1Z3YA 1DVPA 2EIKE 3FTYA 3Q49B 3AG1E 3ZU7B 1NA0A 1KT0A 3TWWA 3LVQE 4N5QA 4UI9C 3VLDA 3FTXA 3EUVA 3RRUA 3UQ3A 4KVOA 4B0ZA 4AOFA 2XEVA 4JPSA 2RG8A 4HRMB 5AARA 1WAO1 5CEDB 4LUNU 4F3VA 4YDYA 1NL4A 2JLBA 1MYOA 3TWSA 3D9OA 4E6HA 1E7UA 2WXQA 2F8XK 5LX8A 1P5QA 3ZEFA 3QWWA 4L7TA 1D9SA 4XI9A 4H7XA 2OCCE 1DNPA 4N3CA 3JUEA 2J8SD 4A1GA 3TG5A 3R7RA 4GA0A 5BNWA 3CVPA 4HOTA 2RKKA 3QKYA 2X6IA 3Q47B 3W9FA 2QZAA 2XEHA 2XPIA 2F37A 3IHYA 2XRZA 2E0IA 3FUFA 3CVUA 4UWFA 2IY0C 1H6KA 3NOCD 3FTSA 1SW6A 1VDYA 1O1SA 2BKGA 1JCQA 3G2VA 4TXPA 2L6JA 5EKQD 4LCTA 2JABA 1ELRA 1FT2A 2V4LA 2CG2A 3CSTA 3GYZA 2PZIA 4LRZA 4AY5A 4WNFA 1LD7A 2I1KA 3SGHA 3LVRE 2FO7A 2QYJA 3DSWA 5AJDA 2VJ8A 3DXMG 3FH8A 5LP0A 2VTBB 4CYMD 5T4YA 3ML9A 5EN5D 3DSVA 3ABLE 3EHQA 2WXMA 1N0QA 1UOHA 1SZ9A 1U3CA 1N0RA 3FFLA 4MBGA 5ENPD 4AIFA 1QBQA 4GA1A 4LEUA 3TWRA 4XKCA 4EHMA 1JWGA 1IHBA 2PM6A 5JA4D 3ZN3A 1UJKA 3HIZA 1Y8MA 1N54A 5JJ6A 2QYUA 4M3OA 4R7LA 2P2CP 3IXEA 4KZCA 2E2EA 3ZXPA 4YVQC 4JC8A 4DLQA 3CIAA 2LSVA 4JXTA 1MX2A 4GPKA 1E8XA 3CKBA 1LD8A 5HKPA 4TUMA 1ELWA 1U3DA 1IQRA 3UM1A 4K5BA 1HG5A 2QFCA 4G26A 1IYGA 5T8IA 3Q78A 1H6PA 4UQYA 3C72A 4FADA 2YNQA 2MYOA 4WNDA 1U2VG 3CHOA 2X6JA 1HG2A 3SQVA 2ZISA 1QZ2A 3RK6A 3MX3A 4H7YA 5KJMA 4LSZE 3DEPA 3T8KA 4J8FA 1BLXB 2LUHA 2KCLA 1WG0A 4BT8A 1OT8A 3JCKC 5FQ7A 4W9RA 4I1OB 3Q75A 5BW8C 2UY1B 4CDMA 1K1AA 3ML8A 3AS5A 2GGFA 2FI7A 3DSXA 1EDUA 4I1AA 3GZSA 4FHJA 1BI8B 4XKBA 1N4QA 5JMND 1Z5SC 5D66A 2EINE 1A5EA 4GTVA 5G04C 1TYQG 1JPLA 1MQSA 4L9PA 2I2OA 4BEPA 2HO1A 3UTMA 4BX9A 3ZGQA 3U66A 4KZ0A 4QFVA 4Q69A 1O1TA 4TXQA 3NB2A 5BXOA 4CZ2D 3PNTB 4M7CA 3UPVA 3CHRA 3UT7A 4AEZC 1N94A 2Y1LE 1WDYA 3S7JA 4HFGA 4LNGA 5JHAA 1TJFA 4JW1A 4DUIA 3HXFA 1HFAA 4JZYA 2LXMA 3SFYA 5BUZA 1IHGA 4OAVB 3B13A 4G8LA 4GTSA 3J5QB 5AQ7A 2GRRB 3QAQA 2XGOA 3OXFA 3CKCA 4V3IA 1XGWA 2X38A 4UUCA 3CVNA 4CGWA 3D9MA 1OWLA 5KJKA 3L54A 3EIJA 4CDNA 4MLPA 4CGVA 2MRIA 3AG3E 2BF0X 3ULQA 4LNBA 2M63A 4EBAA 1N52A 2F8YA 3KSQA 4TRQA 1NP7A 3E34A 3F6QA 4RG9A 3CHSA 3U64A 4FA6A 3FEYA 4BSXA 2XHEA 2QY7A 2ZIRA 3ZYKA 5ITZF 5ENQD 5BV0A 2VSOE 3MZLB 3RO2A 2ETAA 3AU4A 3AS8A 3UIOC 3PH0C 2IU1A 3PZDA 1GW6A 3SNXA 2I9CA 4HI8A 2GW1A 2DYSE 3GZ2A 3L16A 3CVWA 3ZPJA 1AP7A 3RO3A 3UM2A 4DX6D 4G24A 4EBAG 3D9NA 4WWNA 4RQIA 3PNLB 5ANRA 4U96D 3RSEG 5AIJA 3CHPA 3FTWA 3FULA 4JA7A 1NA3A 3CQGB 2HR2A 3GW4A 3AAAC 3HHMA 3B7BA 4Z68A 5ARGA 2WXRA 4FJZA 2X6HA 3S7BA 3UUXA 2LXLA 3SZ7A 4APFA 1TJCA 2OV8A 2VQ2A 4HXIA 4XEIG 5ENNA 4JVSA 3S7DA 2LO6A 3MKRA 1FCHA 4YDOA 4YDEA 1O5MA 4FC8A 4N3BA 2X6FA 3HG0D 3UINC 5A23A 3CHQA 3FWVA 1FT1A 3PVLA 3MA5A 3HVEB 3FUEA 1PY1A 1E8WA 2HYZA 2XCCA 4CRWA 1NFIE 2DWZA 4FULA 4ILHB 3LY9A 3BG0B 2CHZA 4O60A 3SBTB 2OVFA 5D0OD 4AJWA 4Y6WA 5B3SE 3SO8A 2WB2A 2KC7A 3ESLA 3ZXSA 4PS3A 3AS4A 2R05A 3FU3A 1B89A 5HS0A 1BU9A 3EU9A 3LDZA 4XI0A 3PZ4A 4MRUA 4B8CB 3LXUX 3L08A 1S0PA 4UWKA 3BU8A 4GZ6A 4JL0A 2P9IG 4NURA 3J5PA 2BKKB 3D9LA 3UXGA 4GZ3A 5JHBA 2FEZA 2XS8A 1RW2A 4HRLA 1WY6A 3UMVA 2LAIA 2FO1E 2WXHA 2Y4TA 2B6CA 3Q9UC 1G3NB 4TXRA 5M72A 4BFRA 2YQ8A 2I6HA 2VSYA 4IRUA 4ATGA 2ETCA 3ZNGA 2XENA 5FT9A 3ISMC 3I4RB 3V2XA 3ZKJA 3AG4E 5BT1A 3Q7AA 4Y6CA 2V5FA 4ANUA 5CMWA 2AXVA 1TNOA 2WXNA 3U9WA 3Q9NC 4WNGA 2WXOA 4YNDA 3TJPA 3G2SA 2OVBA 4F1SA 2P9NG 3LS8A 4UWHA 2EIJE 3HXEA 1OWMA 2IOSA 2VYIA 2EIME 2V8SE 1QNFA 1BPOA 4ATZD 1YA0A 3C3OA 2XPYA 4U0ZA 1N95A 3CGHA 2XRYA 4DK5A 4C48B 4U8VD 3OTNA 5J08A 3E37A 4GA2A 5ENSD 3R9AB 4GAAA 4DX2A 2XQ0A 4HOUA 2B0OE 4G23A 3CVYA 4U7EB 3APCA 1HS6A 4I1MA 3DPYA 2DIWA 4MS6A 2VGEA 5FJYA 2LNIA 2OEWA 4GMRA 2PQNA 2J4DA 4FHKA 3MJWA 3FEXA 4YDWA 4NRHB 1OWOA 4A55A 2EQXA 2R02A 3ZIMA 1K3ZD 3T5VA 4N2SA 3QWVA 3ASDA 1SVXA 4IYPA 3NF1A 4LG6A 2V5QC 5A6CA 1TR4A 4IN3B 4GPMA 4GCOA 2QC9A 3CV0A 4DI4A 2DZNA 2ETBA 3E33A 2GROB 4UWLA 5E75A 3I5PA 1KT1A 4JHRA 3R9MA 2UY1A 3CVVA 3ASGA 4KVMA 3MYVA 4FJYA 3SD5A 4NIKA 2CG3A 2J09A 2WXGA 1JUQA 4AM9A 1HF8A 4U0UA 3B95A 5EILA 2J07A 3FUDA 1LF8A 1XNFA 1V55E 5D0QD 2KXPC 4U8HA 3G2UA 4UQXA 2IFUA 4F53A 4WWOA 4ACLA 3FUHA 2F0YA 3C5RA 3SF4A 5EYLA 4JHJA 1TNYA 3APDA 3G2WA 1UN8A 1Z6TA 3DBSA 1YCSB 4X8QA 2ONDA 1DC2A 1IXVA 1FVHA 2X6KA 3HYMB 4HNAD 4AXHA 1YYHA 3EHRA 3D9PA 3UX4A 3ZYLA 3S2AA 3ZVVA 4U07A 3NAWA 1N4RA 4AV7A 3KAEA 2XGSA 4UQZA 3QNKA 2WQHA 3RU0A 3Q15A 4C0EA 2NYJA 2J4BA 3APFA 2VGYA 3DSUA 1HO8A 5ENOD 1O1RA 5FZRA 4RG6A 2HM8A 3KEZA 3AG2E 3Q4AB 1V54E 4DRXE 5G05J 3ONLA 2KCKA 3EIQC 4BTAA 4APOA 3L13A 2IEJA 5FINA 4F1PA 3HXDA 3LCAA 3QB2A 1N4SA 2WQ6A 3PE4A 4RSYA 4WWPA 3CVLA 2BTDA 3CHMA 1H2UA 4E85A 2AWIA 4A3VA 2J49A 1BI7B 1E96B 3PZ1A 2VGXB 2ZXWE 3FTUA 3LPZA 5AJLA 4GTPA 4O1PA 4WNEA 3PUKA 3VLEA 4U8YD 5AN8A 2YINA 5B1AE 4JA9A 3LJNA 1INZA 3Q73A 3PRZA 2BEDA 3T9KA 4N39A 2DVWA 2AVPA 4G1TA 3LEWA 1MHQA 3SI5A 3E30A 2BUGA 4GYOA 3SFZA 4DLOA 2CFZA 3ESKA 3SFXA 3UM0A 4MKTA 2GRLA 4PDXA 3DXKG 4K5CA 3RRMB 1MZCA 3B7UX 3QOUA 2JEKA 4J6IA 3D9IA 3L6AA 3WG7E 4RVBA 5AQAA 1RZ4A 2H6IA 3HDXA 3FUNA 4FLBA 3PDNA 3ZFWA 1NI1A 3ENEA 4L2LA 5EIBE 3ULYA 2AW6A 3ASFA 2P9LG 5C2YA 1Q2ZA 4GB9A 4OYSA 3UT8A 4DX1A 3HVEA 4TV3A 5AQBA 4ANVA 3PZ2A 2RD0A 4DX5D 2FBNA 2Y3AA 4GTQA 5FQ8A 3B7TA 1EF1C 2WMOA 4CCAA 3CK7A 1MX6A 4N3AA 1AWCB 5KCMA 3ZHEB 3TWUA 4HORA 3L22A 4EQFA 4JB8P 3PUJA 3O48A 1K1BA 3E4BA 2LSUA 4PH4B 4BY6A 3DPDA 4Q94A 2XPZA 2RFAA 3UT4A 3R7QA 2OEVA 2L6BA 4I6JA 2ZU6B 4GMJA 1PAQA 4I2ZA 5C1DA 4GTTA 4OVVA 4BETA 1SA4A 4DI3A 1UW4B 4JD2G 5E76A 5CCMA 2H6FA 3ABME 5HI7A 2PL2A 4KXKB 2XZDG 4WUYA 3TGOA 5CEAA 3FUJA 2VSXE 4B89A 1K8KG 2EILE 3CEQA 3BEEA 1H19A 2HE0A 2WQ7A 5A7DB 1OWNA 1JWFA 2VSNA 2WPVA 4JHKA 4BX8A 4B94A 3QWPA 5CHEE 1W3BA 4OAUC 4HOQA 3T5XA 4CT4A 3BQOA 3LY8A 3V31A 4FP7A 2DBAA 3P1UA 3KS2A 4AVXA 2FULA 4GMLA 3DEOA 5LCWJ 2CHXA 3EHMA 3U3WA 3Q5MA 4HOSA 1FVFA 2R03A 4ABNA 2IO2C 4U63A 1UN9A 4GCNA 4I2WA 3PREA 4DPRA 4JEUA 1QYMA 3OXGA 5DIZA 3ZW3A 2PNNA 4HRNA 3TWVA 3D9HA 4BT9A 4UWGA 1E90A 3QARA 4GYYA 4I9CA 1HZ4A 3JXJA 1LTXA 3PEUB 4KMOA 2XZTG 2DYRE 4K03A 4XIFA 3CLJA 2IJGX 3I3NA 1OCZE 4G25A 3CVXA 2VTBA 4P29A 2LAHA 2P9SG 3TL5A 3MKQB 4J8EA 5CECB 4U0SA 3ASNE 4ANXA 2AXUA 4KYOB 4EZJA 3CSFA 2L0IA 3IBEA 5T3RA 2WM9A 5ENTD 5ARFA 3DRAA 2IF4A 3SBSA 2KZTB 3IEGA 4ZFHA 4GTRA 1UJJA 4ME2A 3ZYQA 4ZHBA 2Y69E 4I43A 2P9KG 1HH8A 2IO3C 4XX5A 1OCOE 5H7PA 1DCEA 4HI9A 1TNBA 3D3MA 2Y0BG 3FUKA 4NQ0A 3ULEG 3FTZA 4EPZA 4EECA 4G11A 4HB5A 5HQ8A 3ASOE 4UI9K 3TAXA 4GTMA 3AJIA 2XCBA 1OWPA 2AJAA 3HRAA 2RFMA 5FWQA 4PUCA 3FU5A 4GTOA 1DCQA 4UI9J 3UI2A 2CFUA 3V2OA 5FZSA 4KBQA 4LNUD 3QDNA 3FH7A 5DBKA 1SQMA 2R2LA 5HRYA 3VTXA 3K9IA 3RIBA 4U04A 4J8SA 2DCPA 3NBNB 5AQ9A 4BERA 4URKA 2IONA 4WAFA 1ZB1A 2FF4A 3NZUA 1PC2A 4N2QA 2NSZA 2OOEA 5FZQA 3C98A 5B1BE 4JEHA 4ILGA 5BPPA 5G05C 1FPPA 3CK9A 4F6RD 1TEZA 2R5SA 4A3TA 4AY6A 3L17A 3W9GA 3LJ3A 5EX0A 4J8YA 3NOGD 3Q79A 1ZU2A 4HQDA 3LKUA 4HVBA 5G2NA 2ZGDA 3CK8A 3IV0A 4J7WA 3JQ0A 2P58C 3BG1B 1E8YA 1X5BA 2KATA 4XZ4A 4U95D 3MV2B 3DWLG 4FLHA 3FY4A 3IHVA 5CBNA 3ZRHA 4B8AA 1SZAA 3FDHA 1S64A 4XE0A 2YHEA 3FHEA 1TNZA 2VGXA 3WXXA 4F7AA 1Y6IA 2CHWA 2DZOA 4DJAA 1N9AA 3ASHA 3AU5A 4N5CA 3IKOB 2C0LA 4CT0A 3B7RL 5IY5E 2IOLA 2KCVA 2WXPA 2AXZA 3JYSA 5EX3A 4HLLA 3QJZA 4GYWA 5FQ6A 3D9KA 2PQRA 2PM7A 2X3MA 1BD8A 1H2VC 2V4HC 3ONKA 1OCCE 2J9QA 2IQCA 1EPUA 1KPSB 1N11A 2WVIA 4QQIA 4EZLA 4TUUA 2C0MA 3E32A 3TXMA 2WXLA 3NQPA 3QC1A 4I6GA 3KEAA 2WXJA 5EIDA 3UM3A 1TN7A 3FTVA 5CBOA 3PS6A 3GZ1A 1L5JA 5G55A 4HS2A 5LFAA 4IULA 4FU3A 5AYWD 4CDRA 2A5UA 3SY2A 5CMYA 2UWJG 3HXBA 1S63A 1IKND 2NC9A 3JXIA 3L9TA 3L82A 1E7VA 4GZCA 3UKRG 3MGBA 1TNUA 4I9EA 3EHNA 3C3QA
chains in the Genus database with same CATH topology
4I6JA 4ANUA 3FH5A 4M3OA 5CMWA 4R7LA 2ZU6B 2XGMA 4GMJA 2AXVA 4KZCA 2WXKA 1PAQA 2E2EA 4I2ZA 5C1DA 2WXNA 4OVVA 3URZA 4GZDA 2J08A 3ZHEA 3U9WA 2WXFA 4WNGA 4DI3A 4YVQC 1UW4B 2WXIA 2WXOA 1KLXA 4D10C 2V0PA 4L1BA 5E76A 4YNDA 3FUIA 4JC8A 3CIAA 2LSVA 4JXTA 3TJPA 4BTBA 4DLQA 1HXIA 5CCMA 5HI7A 4GPKA 2PL2A 3G2SA 2OVBA 4KXKB 4F1SA 3N71A 4WUYA 1E8XA 3TGOA 3LS8A 4G2VA 3CKBA 4UWHA 1H2TC 3FUJA 1ELWA 1U3DA 2VSXE 3ZYMA 4B89A 1IQRA 5KJNA 4HLEA 1OWMA 2IOSA 2VYIA 3S7FA 1HG5A 2V8SE 4OVUA 3CEQA 3BEEA 4O6FA 5BV1A 1H19A 2QFCA 2YHCA 1QNFA 2WQ7A 3O4ZA 4EZKA 1BPOA 4G26A 5A7DB 1IYGA 1OWNA 1YA0A 2KM4A 5T8IA 1JWFA 2VSNA 3MCXA 2WPVA 2XPYA 4U0ZA 3KD7A 3CGHA 2XRYA 4JHKA 3OAWA 4BX8A 4UQYA 4DK5A 4B94A 3QWPA 5CHEE 4K0RA 4FADA 3OTNA 5J08A 1EYHA 1W3BA 2YNQA 4GA2A 5AENA 4WNDA 3LY7A 4HOQA 3R9AB 4GAAA 3CQCB 3T5XA 3CHOA 5FQ4A 4CT4A 2X6JA 2XQ0A 1HG2A 3LY8A 4HOUA 3VTYA 4FP7A 2DBAA 3P1UA 4KT6B 3KS2A 1QZ2A 1A17A 4G23A 3RK6A 3CVYA 4AVXA 3MX3A 2FULA 4GMLA 3APCA 4H7YA 1HS6A 4I1MA 5KJLA 5KJMA 3MEKA 5LCWJ 2CHXA 2DIWA 1E8ZA 4J8FA 4MS6A 3EHMA 3U3WA 5FJYA 2LNIA 2KCLA 3Q5MA 4HOSA 4BT8A 2Q7FA 1FVFA 3JCKC 5FQ7A 4ABNA 4W9RA 4U63A 5G04J 2A4ZA 4I1OB 1UN9A 4GCNA 2PQNA 4I2WA 2J4DA 4FHKA 5BW8C 3PREA 5JJ7A 4DPRA 3MJWA 2UY1B 4JEUA 4CDMA 3FEXA 3RKVA 3ML8A 5CCLA 3AS5A 2GGFA 4NRHB 2ILRA 3OXGA 3P2BA 4L2YA 1OWOA 5DIZA 2FI7A 4L23A 3ZW3A 4ANWA 1H0AA 4A55A 2EQXA 3JQ1A 3ZIMA 3RJVA 3T5VA 4N2SA 4J0UA 4J8DA 3FU6A 3CVQA 5ANLA 3QWVA 5LCWC 3ASDA 1EDUA 4IYPA 4BT9A 4UWGA 1E90A 3NF1A 4I1AA 3GZSA 4FHJA 3G2TA 3QARA 4GYYA 4XKBA 3SHFA 4I9CA 3CR3A 1QQEA 5A6CA 2WMNA 4IN3B 1HZ4A 4GCOA 5G04C 1JPLA 1MQSA 3PEUB 3I4GA 3CV0A 4DI4A 4KMOA 2I2OA 4UWLA 4K03A 4XIFA 5E75A 3CLJA 2IJGX 3I5PA 3I3NA 3LYAA 1KT1A 2HO1A 4JHRA 2Y4UA 4BX9A 2UY1A 3ZGQA 1HE8A 4G25A 4KZ0A 3U66A 3CVXA 3CVVA 1HX8A 2VTBA 4QFVA 4GU5A 4P29A 5J90A 4Q69A 2GRMA 3JUIA 2LAHA 3ASGA 2C2LA 4KVMA 3TL5A 3MYVA 4FJYA 2MOWA 3PEVB 2NXPA 3PNTB 3SD5A 2CG3A 2J09A 3UPVA 3MKQB 3CHRA 2WXGA 3UT7A 4J8EA 1JUQA 2I1JA 4U0SA 4AM9A 1HF8A 4U0UA 3OXLA 2L0TB 2J07A 4AEZC 4ANXA 2AXUA 1OUVA 4KYOB 4EZJA 3VLFA 3S7JA 3CSFA 2L0IA 3FUDA 3IBEA 5T3RA 4HFGA 2WM9A 5JHAA 1NZNA 1LF8A 1XNFA 5ARFA 1TJFA 4JW1A 3TG4A 1UG3A 5LOZA 4I6EA 1HFAA 4I17A 3EJNA 5D0QD 1HU3A 4JZYA 2IF4A 4C9BB 1Z3XA 3SBSA 1IHGA 2KZTB 4U8HA 3G2UA 4UQXA 3B13A 2IFUA 4F53A 5BUZA 2MHKA 3IEGA 4WWOA 1ELKA 3QAQA 4ACLA 3FUHA 3SF4A 2XGOA 3OXFA 3CKCA 4JHJA 4V3IA 3APDA 3FUMA 3G2WA 1UJJA 1UN8A 4ME2A 3U4TA 1Z6TA 4PS7A 3ZYQA 3DBSA 1XGWA 3TXNA 2X38A 4I43A 3MKQA 2ONDA 3CVNA 4CGWA 1IQUA 3D9MA 1HH8A 1OWLA 4XX5A 5KJKA 3L54A 2L9BA 3EIJA 5JJTA 1FVHA 2X6KA 4PS8A 4C0MA 4CDNA 3QK0A 2R59A 3HYMB 4MLPA 4CGVA 4AP2A 2MRIA 3D9JA 3D3MA 4AXHA 4Q96A 2R17C 4GZ5A 4A1SA 1WM5A 3EDTB 3D9PA 3FUKA 4NQ0A 3UX4A 3S2AA 4ILIA 2BF0X 3ZYLA 3FTZA 3ULQA 3ZVVA 4U07A 3MV3B 4EPZA 4CEMA 4EECA 4AV7A 4G11A 3KAEA 5HQ8A 5EDSA 2M63A 2XGSA 1ZBPA 4UQZA 4EBAA 2KZTA 1N52A 4TRQA 1NP7A 3T8MA 4UI9K 3TAXA 3QNKA 2WQHA 3RU0A 4RG9A 2XCBA 3Q15A 1OWPA 3CHSA 3U64A 3FEYA 4C0EA 4FA6A 2J4BA 4BSXA 3APFA 2VGYA 5FWQA 1HO8A 2XHEA 2QY7A 4PUCA 3FU5A 3ZYKA 4LERA 4UI9J 5FZRA 4ACKA 2CFUA 4RG6A 2HM8A 3B7SA 5BV0A 2VSOE 3FP3A 4NACA 3KEZA 3MZLB 4YVOA 3RO2A 3NZSA 5FZSA 3Q4AB 3AU4A 3AS8A 5FTPA 5G05J 4KBQA 3RRNB 3QDNA 3FH7A 3FU0A 5DBKA 3ONLA 2KCKA 3EIQC 1SQMA 3PH0C 4BWRA 3PE3A 1Z3YA 4BTAA 4APOA 2IU1A 1DVPA 3L13A 3K9IA 3PZDA 3RIBA 1GW6A 3VTXA 4U04A 4J8SA 3SNXA 2I9CA 2DCPA 2GW1A 4URKA 3FTYA 3Q49B 2IONA 4WAFA 3GZ2A 3L16A 3CVWA 1NA0A 3LCAA 3QB2A 3ZPJA 1KT0A 3RO3A 3NZUA 2FF4A 3LVQE 4G24A 2WQ6A 4EBAG 3PE4A 3D9NA 4RSYA 4WWPA 3CVLA 1PC2A 4WWNA 2BTDA 3CHMA 4UI9C 3VLDA 4N2QA 1H2UA 2NSZA 2OOEA 4E85A 5FZQA 2AWIA 3C98A 3FTXA 3PNLB 4A3VA 5ANRA 4JEHA 4ILGA 3RRUA 3UQ3A 5BPPA 5G05C 4KVOA 5AIJA 4B0ZA 4AOFA 3CK9A 1TEZA 2XEVA 2R5SA 2RG8A 4JPSA 3CHPA 2J49A 4A3TA 1E96B 4AY6A 3FTWA 1WAO1 3FULA 4JA7A 4LUNU 1NA3A 3L17A 4F3VA 3CQGB 2VGXB 3FTUA 3LJ3A 2HR2A 2JLBA 3GW4A 3HHMA 3LPZA 5EX0A 5AJLA 3D9OA 4E6HA 4WNEA 1E7UA 2WXQA 3PUKA 5ARGA 3VLEA 2WXRA 4FJZA 1ZU2A 2X6HA 5LX8A 1P5QA 3S7BA 3UUXA 3LKUA 3SZ7A 4HVBA 2YINA 5G2NA 4APFA 1TJCA 4JA9A 3CK8A 2OV8A 3ZEFA 2VQ2A 3IV0A 3QWWA 4L7TA 3JQ0A 1INZA 4HXIA 3PRZA 4XI9A 2P58C 4H7XA 3BG1B 1E8YA 4N39A 1DNPA 2AVPA 4G1TA 4N3CA 5ENNA 1X5BA 3LEWA 2KATA 4XZ4A 4JVSA 1MHQA 3SI5A 3S7DA 2LO6A 3MV2B 4FLHA 3MKRA 1FCHA 4A1GA 2BUGA 4GYOA 3SFZA 3TG5A 4DLOA 2CFZA 3R7RA 3FY4A 3IHVA 4GA0A 3ZRHA 4FC8A 4B8AA 4N3BA 1SZAA 2X6FA 3CVPA 3ESKA 3FDHA 4XE0A 3QKYA 5BNWA 4HOTA 4MKTA 2YHEA 2X6IA 3Q47B 3FHEA 5A23A 2GRLA 4PDXA 3CHQA 3FWVA 2VGXA 3WXXA 4F7AA 1Y6IA 3PVLA 3RRMB 2CHWA 4DJAA 3MA5A 3HVEB 3ASHA 3B7UX 2XPIA 3AU5A 3FUEA 1PY1A 3IHYA 1E8WA 2JEKA 3QOUA 4N5CA 3IKOB 2E0IA 2HYZA 2XCCA 3FUFA 2C0LA 4J6IA 3D9IA 4UWFA 4CRWA 4CT0A 3CVUA 3B7RL 4FULA 4ILHB 3LY9A 2IOLA 3L6AA 2KCVA 1H6KA 3BG0B 3FTSA 2CHZA 4RVBA 2WXPA 2AXZA 3JYSA 3SBTB 1VDYA 5EX3A 3HDXA 3FUNA 4FLBA 3QJZA 2XRZA 2OVFA 4GYWA 3G2VA 5FQ6A 5D0OD 3D9KA 2PQRA 3PDNA 4AJWA 2PM7A 2X3MA 2L6JA 4Y6WA 3ZFWA 3ENEA 4L2LA 2WB2A 2AW6A 5EKQD 1H2VC 3ASFA 3ONKA 2J9QA 2IQCA 1EPUA 4LCTA 2KC7A 1ELRA 2V4LA 3ESLA 4PS3A 5C2YA 3AS4A 3ZXSA 2WVIA 2CG2A 3FU3A 3CSTA 3GYZA 1B89A 4GB9A 2PZIA 4LRZA 4OYSA 3UT8A 4TUUA 4EZLA 2C0MA 4AY5A 3LDZA 4WNFA 4XI0A 2WXLA 3HVEA 3TXMA 3NQPA 3SGHA 2I1KA 3QC1A 3LVRE 4TV3A 2FO7A 4MRUA 4B8CB 4ANVA 5AJDA 2VJ8A 4I6GA 2WXJA 3LXUX 2RD0A 3FH8A 2FBNA 2Y3AA 3L08A 5LP0A 3FTVA 1S0PA 2VTBB 3B7TA 3GZ1A 3PS6A 1EF1C 1L5JA 2WMOA 4UWKA 5FQ8A 4GZ6A 4JL0A 5G55A 5T4YA 3CK7A 4HS2A 4CCAA 4N3AA 5LFAA 4IULA 4FU3A 3ML9A 4NURA 5AYWD 5KCMA 4CDRA 3ZHEB 3D9LA 2A5UA 2WXMA 4GZ3A 2FEZA 5JHBA 4HORA 3L22A 4EQFA 1SZ9A 1WY6A 3UMVA 1U3CA 2LAIA 3PUJA 2WXHA 3FFLA 2Y4TA 5CMYA 2UWJG 3O48A 3E4BA 4AIFA 2LSUA 4PH4B 4GA1A 4LEUA 4BY6A 4XKCA 3DPDA 2NC9A 5M72A 4BFRA 1JWGA 2YQ8A 4Q94A 2I6HA 2PM6A 2VSYA 4IRUA 1E7VA 3ZN3A 4ATGA 2XPZA 1UJKA 4GZCA 3UT4A 5FT9A 3I4RB 3R7QA 3HIZA 5BT1A 1Y8MA 3MGBA 4I9EA 1N54A 3EHNA 5JJ6A 4Y6CA 2V5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IOS A;  5ANR A;  1UG3 A;  3EIQ C;  2ZU6 B;  4GMJ A;  4CT4 A;  4B8C B;  1PAQ A;  2IU1 A;  1HU3 A;  3FEY A;  3JUI A;  4C9B B;  2RG8 A;  2KZT B;  3EIJ A;  1H2V C;  3FEX A;  2ION A;  3RK6 A;  1UW4 B;  4LUN U;  3D3M A;  2FUL A;  4GML A;  2GGF A;  4JHK A;  2HM8 A;  4CRW A;  2VSO E;  4IUL A;  4JHJ A;  2IOL A;  3L6A A;  2I2O A;  1H6K A;  1H2T C;  4CEM A;  1H2U A;  2NSZ A;  2VSX E;  4B89 A;  1N54 A;  4B8A A;  2KZT A;  1N52 A; 
#chains in the Genus database with same CATH topology
 3FH5 A;  2XGM A;  2WXK A;  1OXJ A;  4RLY A;  2H6G A;  4GZD A;  2J08 A;  3URZ A;  3ZHE A;  2WXF A;  2WXI A;  5KNG A;  1KLX A;  4D10 C;  1YMP A;  1D8D A;  2V0P A;  4L1B A;  3FUI A;  4BTB A;  3BUA A;  1HXI A;  3N71 A;  4G2V A;  1H2T C;  1MJ0 A;  3ZYM A;  5KJN A;  5CRU A;  4HLE A;  3S7F A;  2H6H A;  4OVU A;  3ZUV B;  4O6F A;  5BV1 A;  2YHC A;  3O4Z A;  4EZK A;  2KM4 A;  3MCX A;  1KZO A;  3KD7 A;  3OAW A;  5CRV A;  4K0R A;  1EYH A;  5KBA A;  5AEN A;  3LY7 A;  3RAU A;  2KBX A;  3CQC B;  5FQ4 A;  2GRP B;  3VTY A;  4BSZ B;  4KT6 B;  1A17 A;  2XEE A;  1KZP A;  5KJL A;  3MEK A;  1E8Z A;  1SA5 A;  5BXU A;  4DX7 D;  4B93 B;  2Q7F A;  3UKU G;  2P9P G;  5G04 J;  5KNH D;  2A4Z A;  5JJ7 A;  3V30 A;  3KSL A;  1N4P A;  3RKV A;  5CCL A;  2ILR A;  3TWQ A;  3P2B A;  4L2Y A;  4L23 A;  4ANW A;  1H0A A;  1OY3 D;  3JQ1 A;  3RJV A;  4J0U A;  4J8D A;  3FU6 A;  3CVQ A;  5ANL A;  3PZ3 A;  5LCW C;  3G2T A;  3SHF A;  3CR3 A;  1QQE A;  5ENR D;  2WMN A;  2A5E A;  1X81 A;  3I4G A;  4O1O A;  5AAO A;  1TN8 A;  1H6O A;  3LYA A;  1S70 B;  2Y4U A;  1TN6 A;  1HE8 A;  1HX8 A;  4GU5 A;  5J90 A;  2GRM A;  3JUI A;  2C2L A;  2MOW A;  4BES A;  3PEV B;  2NXP A;  3V79 K;  2I1J A;  1OCR E;  5D2M C;  3OXL A;  2L0T B;  1OUV A;  3VLF A;  4A63 B;  1NZN A;  3TG4 A;  1UG3 A;  5LOZ A;  4I6E A;  4I17 A;  3EJN A;  1HU3 A;  2ZGG A;  4C9B B;  1Z3X A;  2MHK A;  3UIP C;  3TWT A;  1D8E A;  5EYP F;  3Q7F A;  1ELK A;  5FIO A;  3FUM A;  3TWX A;  3U4T A;  3ABK E;  4PS7 A;  3TXN A;  3MKQ A;  1IQU A;  3X2Q E;  2XS1 A;  2L9B A;  2GRQ B;  5JJT A;  3HXC A;  4PS8 A;  4C0M A;  3QK0 A;  2R59 A;  3C3R A;  4AP2 A;  3D9J A;  4HBD A;  4Q96 A;  2R17 C;  4GZ5 A;  4A1S A;  1WM5 A;  3EDT B;  4ILI A;  2GRN B;  3MV3 B;  4CEM A;  3DSS A;  5EDS A;  1ZBP A;  2KZT A;  4G8K A;  3T8M A;  1JCR A;  4K5A B;  5KWD A;  2P9U G;  3EU5 A;  4LER A;  4ACK A;  3B7S A;  3FP3 A;  4NAC A;  1MX4 A;  4YVO A;  3NZS A;  5FTP A;  5CER B;  1JCS A;  3RRN B;  3FU0 A;  3DST A;  4BWR A;  3PE3 A;  1Z3Y A;  1DVP A;  2EIK E;  3FTY A;  3Q49 B;  3AG1 E;  3ZU7 B;  1NA0 A;  1KT0 A;  3TWW A;  3LVQ E;  4N5Q A;  4UI9 C;  3VLD A;  3FTX A;  3EUV A;  3RRU A;  3UQ3 A;  4KVO A;  4B0Z A;  4AOF A;  2XEV A;  4JPS A;  2RG8 A;  4HRM B;  5AAR A;  1WAO 1;  5CED B;  4LUN U;  4F3V A;  4YDY A;  1NL4 A;  2JLB A;  1MYO A;  3TWS A;  3D9O A;  4E6H A;  1E7U A;  2WXQ A;  2F8X K;  5LX8 A;  1P5Q A;  3ZEF A;  3QWW A;  4L7T A;  1D9S A;  4XI9 A;  4H7X A;  2OCC E;  1DNP A;  4N3C A;  3JUE A;  2J8S D;  4A1G A;  3TG5 A;  3R7R A;  4GA0 A;  5BNW A;  3CVP A;  4HOT A;  2RKK A;  3QKY A;  2X6I A;  3Q47 B;  3W9F A;  2QZA A;  2XEH A;  2XPI A;  2F37 A;  3IHY A;  2XRZ A;  2E0I A;  3FUF A;  3CVU A;  4UWF A;  2IY0 C;  1H6K A;  3NOC D;  3FTS A;  1SW6 A;  1VDY A;  1O1S A;  2BKG A;  1JCQ A;  3G2V A;  4TXP A;  2L6J A;  5EKQ D;  4LCT A;  2JAB A;  1ELR A;  1FT2 A;  2V4L A;  2CG2 A;  3CST A;  3GYZ A;  2PZI A;  4LRZ A;  4AY5 A;  4WNF A;  1LD7 A;  2I1K A;  3SGH A;  3LVR E;  2FO7 A;  2QYJ A;  3DSW A;  5AJD A;  2VJ8 A;  3DXM G;  3FH8 A;  5LP0 A;  2VTB B;  4CYM D;  5T4Y A;  3ML9 A;  5EN5 D;  3DSV A;  3ABL E;  3EHQ A;  2WXM A;  1N0Q A;  1UOH A;  1SZ9 A;  1U3C A;  1N0R A;  3FFL A;  4MBG A;  5ENP D;  4AIF A;  1QBQ A;  4GA1 A;  4LEU A;  3TWR A;  4XKC A;  4EHM A;  1JWG A;  1IHB A;  2PM6 A;  5JA4 D;  3ZN3 A;  1UJK A;  3HIZ A;  1Y8M A;  1N54 A;  5JJ6 A;  2QYU A;  4M3O A;  4R7L A;  2P2C P;  3IXE A;  4KZC A;  2E2E A;  3ZXP A;  4YVQ C;  4JC8 A;  4DLQ A;  3CIA A;  2LSV A;  4JXT A;  1MX2 A;  4GPK A;  1E8X A;  3CKB A;  1LD8 A;  5HKP A;  4TUM A;  1ELW A;  1U3D A;  1IQR A;  3UM1 A;  4K5B A;  1HG5 A;  2QFC A;  4G26 A;  1IYG A;  5T8I A;  3Q78 A;  1H6P A;  4UQY A;  3C72 A;  4FAD A;  2YNQ A;  2MYO A;  4WND A;  1U2V G;  3CHO A;  2X6J A;  1HG2 A;  3SQV A;  2ZIS A;  1QZ2 A;  3RK6 A;  3MX3 A;  4H7Y A;  5KJM A;  4LSZ E;  3DEP A;  3T8K A;  4J8F A;  1BLX B;  2LUH A;  2KCL A;  1WG0 A;  4BT8 A;  1OT8 A;  3JCK C;  5FQ7 A;  4W9R A;  4I1O B;  3Q75 A;  5BW8 C;  2UY1 B;  4CDM A;  1K1A A;  3ML8 A;  3AS5 A;  2GGF A;  2FI7 A;  3DSX A;  1EDU A;  4I1A A;  3GZS A;  4FHJ A;  1BI8 B;  4XKB A;  1N4Q A;  5JMN D;  1Z5S C;  5D66 A;  2EIN E;  1A5E A;  4GTV A;  5G04 C;  1TYQ G;  1JPL A;  1MQS A;  4L9P A;  2I2O A;  4BEP A;  2HO1 A;  3UTM A;  4BX9 A;  3ZGQ A;  3U66 A;  4KZ0 A;  4QFV A;  4Q69 A;  1O1T A;  4TXQ A;  3NB2 A;  5BXO A;  4CZ2 D;  3PNT B;  4M7C A;  3UPV A;  3CHR A;  3UT7 A;  4AEZ C;  1N94 A;  2Y1L E;  1WDY A;  3S7J A;  4HFG A;  4LNG A;  5JHA A;  1TJF A;  4JW1 A;  4DUI A;  3HXF A;  1HFA A;  4JZY A;  2LXM A;  3SFY A;  5BUZ A;  1IHG A;  4OAV B;  3B13 A;  4G8L A;  4GTS A;  3J5Q B;  5AQ7 A;  2GRR B;  3QAQ A;  2XGO A;  3OXF A;  3CKC A;  4V3I A;  1XGW A;  2X38 A;  4UUC A;  3CVN A;  4CGW A;  3D9M A;  1OWL A;  5KJK A;  3L54 A;  3EIJ A;  4CDN A;  4MLP A;  4CGV A;  2MRI A;  3AG3 E;  2BF0 X;  3ULQ A;  4LNB A;  2M63 A;  4EBA A;  1N52 A;  2F8Y A;  3KSQ A;  4TRQ A;  1NP7 A;  3E34 A;  3F6Q A;  4RG9 A;  3CHS A;  3U64 A;  4FA6 A;  3FEY A;  4BSX A;  2XHE A;  2QY7 A;  2ZIR A;  3ZYK A;  5ITZ F;  5ENQ D;  5BV0 A;  2VSO E;  3MZL B;  3RO2 A;  2ETA A;  3AU4 A;  3AS8 A;  3UIO C;  3PH0 C;  2IU1 A;  3PZD A;  1GW6 A;  3SNX A;  2I9C A;  4HI8 A;  2GW1 A;  2DYS E;  3GZ2 A;  3L16 A;  3CVW A;  3ZPJ A;  1AP7 A;  3RO3 A;  3UM2 A;  4DX6 D;  4G24 A;  4EBA G;  3D9N A;  4WWN A;  4RQI A;  3PNL B;  5ANR A;  4U96 D;  3RSE G;  5AIJ A;  3CHP A;  3FTW A;  3FUL A;  4JA7 A;  1NA3 A;  3CQG B;  2HR2 A;  3GW4 A;  3AAA C;  3HHM A;  3B7B A;  4Z68 A;  5ARG A;  2WXR A;  4FJZ A;  2X6H A;  3S7B A;  3UUX A;  2LXL A;  3SZ7 A;  4APF A;  1TJC A;  2OV8 A;  2VQ2 A;  4HXI A;  4XEI G;  5ENN A;  4JVS A;  3S7D A;  2LO6 A;  3MKR A;  1FCH A;  4YDO A;  4YDE A;  1O5M A;  4FC8 A;  4N3B A;  2X6F A;  3HG0 D;  3UIN C;  5A23 A;  3CHQ A;  3FWV A;  1FT1 A;  3PVL A;  3MA5 A;  3HVE B;  3FUE A;  1PY1 A;  1E8W A;  2HYZ A;  2XCC A;  4CRW A;  1NFI E;  2DWZ A;  4FUL A;  4ILH B;  3LY9 A;  3BG0 B;  2CHZ A;  4O60 A;  3SBT B;  2OVF A;  5D0O D;  4AJW A;  4Y6W A;  5B3S E;  3SO8 A;  2WB2 A;  2KC7 A;  3ESL A;  3ZXS A;  4PS3 A;  3AS4 A;  2R05 A;  3FU3 A;  1B89 A;  5HS0 A;  1BU9 A;  3EU9 A;  3LDZ A;  4XI0 A;  3PZ4 A;  4MRU A;  4B8C B;  3LXU X;  3L08 A;  1S0P A;  4UWK A;  3BU8 A;  4GZ6 A;  4JL0 A;  2P9I G;  4NUR A;  3J5P A;  2BKK B;  3D9L A;  3UXG A;  4GZ3 A;  5JHB A;  2FEZ A;  2XS8 A;  1RW2 A;  4HRL A;  1WY6 A;  3UMV A;  2LAI A;  2FO1 E;  2WXH A;  2Y4T A;  2B6C A;  3Q9U C;  1G3N B;  4TXR A;  5M72 A;  4BFR A;  2YQ8 A;  2I6H A;  2VSY A;  4IRU A;  4ATG A;  2ETC A;  3ZNG A;  2XEN A;  5FT9 A;  3ISM C;  3I4R B;  3V2X A;  3ZKJ A;  3AG4 E;  5BT1 A;  3Q7A A;  4Y6C A;  2V5F A;  4ANU A;  5CMW A;  2AXV A;  1TNO A;  2WXN A;  3U9W A;  3Q9N C;  4WNG A;  2WXO A;  4YND A;  3TJP A;  3G2S A;  2OVB A;  4F1S A;  2P9N G;  3LS8 A;  4UWH A;  2EIJ E;  3HXE A;  1OWM A;  2IOS A;  2VYI A;  2EIM E;  2V8S E;  1QNF A;  1BPO A;  4ATZ D;  1YA0 A;  3C3O A;  2XPY A;  4U0Z A;  1N95 A;  3CGH A;  2XRY A;  4DK5 A;  4C48 B;  4U8V D;  3OTN A;  5J08 A;  3E37 A;  4GA2 A;  5ENS D;  3R9A B;  4GAA A;  4DX2 A;  2XQ0 A;  4HOU A;  2B0O E;  4G23 A;  3CVY A;  4U7E B;  3APC A;  1HS6 A;  4I1M A;  3DPY A;  2DIW A;  4MS6 A;  2VGE A;  5FJY A;  2LNI A;  2OEW A;  4GMR A;  2PQN A;  2J4D A;  4FHK A;  3MJW A;  3FEX A;  4YDW A;  4NRH B;  1OWO A;  4A55 A;  2EQX A;  2R02 A;  3ZIM A;  1K3Z D;  3T5V A;  4N2S A;  3QWV A;  3ASD A;  1SVX A;  4IYP A;  3NF1 A;  4LG6 A;  2V5Q C;  5A6C A;  1TR4 A;  4IN3 B;  4GPM A;  4GCO A;  2QC9 A;  3CV0 A;  4DI4 A;  2DZN A;  2ETB A;  3E33 A;  2GRO B;  4UWL A;  5E75 A;  3I5P A;  1KT1 A;  4JHR A;  3R9M A;  2UY1 A;  3CVV A;  3ASG A;  4KVM A;  3MYV A;  4FJY A;  3SD5 A;  4NIK A;  2CG3 A;  2J09 A;  2WXG A;  1JUQ A;  4AM9 A;  1HF8 A;  4U0U A;  3B95 A;  5EIL A;  2J07 A;  3FUD A;  1LF8 A;  1XNF A;  1V55 E;  5D0Q D;  2KXP C;  4U8H A;  3G2U A;  4UQX A;  2IFU A;  4F53 A;  4WWO A;  4ACL A;  3FUH A;  2F0Y A;  3C5R A;  3SF4 A;  5EYL A;  4JHJ A;  1TNY A;  3APD A;  3G2W A;  1UN8 A;  1Z6T A;  3DBS A;  1YCS B;  4X8Q A;  2OND A;  1DC2 A;  1IXV A;  1FVH A;  2X6K A;  3HYM B;  4HNA D;  4AXH A;  1YYH A;  3EHR A;  3D9P A;  3UX4 A;  3ZYL A;  3S2A A;  3ZVV A;  4U07 A;  3NAW A;  1N4R A;  4AV7 A;  3KAE A;  2XGS A;  4UQZ A;  3QNK A;  2WQH A;  3RU0 A;  3Q15 A;  4C0E A;  2NYJ A;  2J4B A;  3APF A;  2VGY A;  3DSU A;  1HO8 A;  5ENO D;  1O1R A;  5FZR A;  4RG6 A;  2HM8 A;  3KEZ A;  3AG2 E;  3Q4A B;  1V54 E;  4DRX E;  5G05 J;  3ONL A;  2KCK A;  3EIQ C;  4BTA A;  4APO A;  3L13 A;  2IEJ A;  5FIN A;  4F1P A;  3HXD A;  3LCA A;  3QB2 A;  1N4S A;  2WQ6 A;  3PE4 A;  4RSY A;  4WWP A;  3CVL A;  2BTD A;  3CHM A;  1H2U A;  4E85 A;  2AWI A;  4A3V A;  2J49 A;  1BI7 B;  1E96 B;  3PZ1 A;  2VGX B;  2ZXW E;  3FTU A;  3LPZ A;  5AJL A;  4GTP A;  4O1P A;  4WNE A;  3PUK A;  3VLE A;  4U8Y D;  5AN8 A;  2YIN A;  5B1A E;  4JA9 A;  3LJN A;  1INZ A;  3Q73 A;  3PRZ A;  2BED A;  3T9K A;  4N39 A;  2DVW A;  2AVP A;  4G1T A;  3LEW A;  1MHQ A;  3SI5 A;  3E30 A;  2BUG A;  4GYO A;  3SFZ A;  4DLO A;  2CFZ A;  3ESK A;  3SFX A;  3UM0 A;  4MKT A;  2GRL A;  4PDX A;  3DXK G;  4K5C A;  3RRM B;  1MZC A;  3B7U X;  3QOU A;  2JEK A;  4J6I A;  3D9I A;  3L6A A;  3WG7 E;  4RVB A;  5AQA A;  1RZ4 A;  2H6I A;  3HDX A;  3FUN A;  4FLB A;  3PDN A;  3ZFW A;  1NI1 A;  3ENE A;  4L2L A;  5EIB E;  3ULY A;  2AW6 A;  3ASF A;  2P9L G;  5C2Y A;  1Q2Z A;  4GB9 A;  4OYS A;  3UT8 A;  4DX1 A;  3HVE A;  4TV3 A;  5AQB A;  4ANV A;  3PZ2 A;  2RD0 A;  4DX5 D;  2FBN A;  2Y3A A;  4GTQ A;  5FQ8 A;  3B7T A;  1EF1 C;  2WMO A;  4CCA A;  3CK7 A;  1MX6 A;  4N3A A;  1AWC B;  5KCM A;  3ZHE B;  3TWU A;  4HOR A;  3L22 A;  4EQF A;  4JB8 P;  3PUJ A;  3O48 A;  1K1B A;  3E4B A;  2LSU A;  4PH4 B;  4BY6 A;  3DPD A;  4Q94 A;  2XPZ A;  2RFA A;  3UT4 A;  3R7Q A;  2OEV A;  2L6B A;  4I6J A;  2ZU6 B;  4GMJ A;  1PAQ A;  4I2Z A;  5C1D A;  4GTT A;  4OVV A;  4BET A;  1SA4 A;  4DI3 A;  1UW4 B;  4JD2 G;  5E76 A;  5CCM A;  2H6F A;  3ABM E;  5HI7 A;  2PL2 A;  4KXK B;  2XZD G;  4WUY A;  3TGO A;  5CEA A;  3FUJ A;  2VSX E;  4B89 A;  1K8K G;  2EIL E;  3CEQ A;  3BEE A;  1H19 A;  2HE0 A;  2WQ7 A;  5A7D B;  1OWN A;  1JWF A;  2VSN A;  2WPV A;  4JHK A;  4BX8 A;  4B94 A;  3QWP A;  5CHE E;  1W3B A;  4OAU C;  4HOQ A;  3T5X A;  4CT4 A;  3BQO A;  3LY8 A;  3V31 A;  4FP7 A;  2DBA A;  3P1U A;  3KS2 A;  4AVX A;  2FUL A;  4GML A;  3DEO A;  5LCW J;  2CHX A;  3EHM A;  3U3W A;  3Q5M A;  4HOS A;  1FVF A;  2R03 A;  4ABN A;  2IO2 C;  4U63 A;  1UN9 A;  4GCN A;  4I2W A;  3PRE A;  4DPR A;  4JEU A;  1QYM A;  3OXG A;  5DIZ A;  3ZW3 A;  2PNN A;  4HRN A;  3TWV A;  3D9H A;  4BT9 A;  4UWG A;  1E90 A;  3QAR A;  4GYY A;  4I9C A;  1HZ4 A;  3JXJ A;  1LTX A;  3PEU B;  4KMO A;  2XZT G;  2DYR E;  4K03 A;  4XIF A;  3CLJ A;  2IJG X;  3I3N A;  1OCZ E;  4G25 A;  3CVX A;  2VTB A;  4P29 A;  2LAH A;  2P9S G;  3TL5 A;  3MKQ B;  4J8E A;  5CEC B;  4U0S A;  3ASN E;  4ANX A;  2AXU A;  4KYO B;  4EZJ A;  3CSF A;  2L0I A;  3IBE A;  5T3R A;  2WM9 A;  5ENT D;  5ARF A;  3DRA A;  2IF4 A;  3SBS A;  2KZT B;  3IEG A;  4ZFH A;  4GTR A;  1UJJ A;  4ME2 A;  3ZYQ A;  4ZHB A;  2Y69 E;  4I43 A;  2P9K G;  1HH8 A;  2IO3 C;  4XX5 A;  1OCO E;  5H7P A;  1DCE A;  4HI9 A;  1TNB A;  3D3M A;  2Y0B G;  3FUK A;  4NQ0 A;  3ULE G;  3FTZ A;  4EPZ A;  4EEC A;  4G11 A;  4HB5 A;  5HQ8 A;  3ASO E;  4UI9 K;  3TAX A;  4GTM A;  3AJI A;  2XCB A;  1OWP A;  2AJA A;  3HRA A;  2RFM A;  5FWQ A;  4PUC A;  3FU5 A;  4GTO A;  1DCQ A;  4UI9 J;  3UI2 A;  2CFU A;  3V2O A;  5FZS A;  4KBQ A;  4LNU D;  3QDN A;  3FH7 A;  5DBK A;  1SQM A;  2R2L A;  5HRY A;  3VTX A;  3K9I A;  3RIB A;  4U04 A;  4J8S A;  2DCP A;  3NBN B;  5AQ9 A;  4BER A;  4URK A;  2ION A;  4WAF A;  1ZB1 A;  2FF4 A;  3NZU A;  1PC2 A;  4N2Q A;  2NSZ A;  2OOE A;  5FZQ A;  3C98 A;  5B1B E;  4JEH A;  4ILG A;  5BPP A;  5G05 C;  1FPP A;  3CK9 A;  4F6R D;  1TEZ A;  2R5S A;  4A3T A;  4AY6 A;  3L17 A;  3W9G A;  3LJ3 A;  5EX0 A;  4J8Y A;  3NOG D;  3Q79 A;  1ZU2 A;  4HQD A;  3LKU A;  4HVB A;  5G2N A;  2ZGD A;  3CK8 A;  3IV0 A;  4J7W A;  3JQ0 A;  2P58 C;  3BG1 B;  1E8Y A;  1X5B A;  2KAT A;  4XZ4 A;  4U95 D;  3MV2 B;  3DWL G;  4FLH A;  3FY4 A;  3IHV A;  5CBN A;  3ZRH A;  4B8A A;  1SZA A;  3FDH A;  1S64 A;  4XE0 A;  2YHE A;  3FHE A;  1TNZ A;  2VGX A;  3WXX A;  4F7A A;  1Y6I A;  2CHW A;  2DZO A;  4DJA A;  1N9A A;  3ASH A;  3AU5 A;  4N5C A;  3IKO B;  2C0L A;  4CT0 A;  3B7R L;  5IY5 E;  2IOL A;  2KCV A;  2WXP A;  2AXZ A;  3JYS A;  5EX3 A;  4HLL A;  3QJZ A;  4GYW A;  5FQ6 A;  3D9K A;  2PQR A;  2PM7 A;  2X3M A;  1BD8 A;  1H2V C;  2V4H C;  3ONK A;  1OCC E;  2J9Q A;  2IQC A;  1EPU A;  1KPS B;  1N11 A;  2WVI A;  4QQI A;  4EZL A;  4TUU A;  2C0M A;  3E32 A;  3TXM A;  2WXL A;  3NQP A;  3QC1 A;  4I6G A;  3KEA A;  2WXJ A;  5EID A;  3UM3 A;  1TN7 A;  3FTV A;  5CBO A;  3PS6 A;  3GZ1 A;  1L5J A;  5G55 A;  4HS2 A;  5LFA A;  4IUL A;  4FU3 A;  5AYW D;  4CDR A;  2A5U A;  3SY2 A;  5CMY A;  2UWJ G;  3HXB A;  1S63 A;  1IKN D;  2NC9 A;  3JXI A;  3L9T A;  3L82 A;  1E7V A;  4GZC A;  3UKR G;  3MGB A;  1TNU A;  4I9E A;  3EHN A;  3C3Q A; 
#chains in the Genus database with same CATH homology
 4I6J A;  4ANU A;  3FH5 A;  4M3O A;  5CMW A;  4R7L A;  2ZU6 B;  2XGM A;  4GMJ A;  2AXV A;  4KZC A;  2WXK A;  1PAQ A;  2E2E A;  4I2Z A;  5C1D A;  2WXN A;  4OVV A;  3URZ A;  4GZD A;  2J08 A;  3ZHE A;  3U9W A;  2WXF A;  4WNG A;  4DI3 A;  4YVQ C;  1UW4 B;  2WXI A;  2WXO A;  1KLX A;  4D10 C;  2V0P A;  4L1B A;  5E76 A;  4YND A;  3FUI A;  4JC8 A;  3CIA A;  2LSV A;  4JXT A;  3TJP A;  4BTB A;  4DLQ A;  1HXI A;  5CCM A;  5HI7 A;  4GPK A;  2PL2 A;  3G2S A;  2OVB A;  4KXK B;  4F1S A;  3N71 A;  4WUY A;  1E8X A;  3TGO A;  3LS8 A;  4G2V A;  3CKB A;  4UWH A;  1H2T C;  3FUJ A;  1ELW A;  1U3D A;  2VSX E;  3ZYM A;  4B89 A;  1IQR A;  5KJN A;  4HLE A;  1OWM A;  2IOS A;  2VYI A;  3S7F A;  1HG5 A;  2V8S E;  4OVU A;  3CEQ A;  3BEE A;  4O6F A;  5BV1 A;  1H19 A;  2QFC A;  2YHC A;  1QNF A;  2WQ7 A;  3O4Z A;  4EZK A;  1BPO A;  4G26 A;  5A7D B;  1IYG A;  1OWN A;  1YA0 A;  2KM4 A;  5T8I A;  1JWF A;  2VSN A;  3MCX A;  2WPV A;  2XPY A;  4U0Z A;  3KD7 A;  3CGH A;  2XRY A;  4JHK A;  3OAW A;  4BX8 A;  4UQY A;  4DK5 A;  4B94 A;  3QWP A;  5CHE E;  4K0R A;  4FAD A;  3OTN A;  5J08 A;  1EYH A;  1W3B A;  2YNQ A;  4GA2 A;  5AEN A;  4WND A;  3LY7 A;  4HOQ A;  3R9A B;  4GAA A;  3CQC B;  3T5X A;  3CHO A;  5FQ4 A;  4CT4 A;  2X6J A;  2XQ0 A;  1HG2 A;  3LY8 A;  4HOU A;  3VTY A;  4FP7 A;  2DBA A;  3P1U A;  4KT6 B;  3KS2 A;  1QZ2 A;  1A17 A;  4G23 A;  3RK6 A;  3CVY A;  4AVX A;  3MX3 A;  2FUL A;  4GML A;  3APC A;  4H7Y A;  1HS6 A;  4I1M A;  5KJL A;  5KJM A;  3MEK A;  5LCW J;  2CHX A;  2DIW A;  1E8Z A;  4J8F A;  4MS6 A;  3EHM A;  3U3W A;  5FJY A;  2LNI A;  2KCL A;  3Q5M A;  4HOS A;  4BT8 A;  2Q7F A;  1FVF A;  3JCK C;  5FQ7 A;  4ABN A;  4W9R A;  4U63 A;  5G04 J;  2A4Z A;  4I1O B;  1UN9 A;  4GCN A;  2PQN A;  4I2W A;  2J4D A;  4FHK A;  5BW8 C;  3PRE A;  5JJ7 A;  4DPR A;  3MJW A;  2UY1 B;  4JEU A;  4CDM A;  3FEX A;  3RKV A;  3ML8 A;  5CCL A;  3AS5 A;  2GGF A;  4NRH B;  2ILR A;  3OXG A;  3P2B A;  4L2Y A;  1OWO A;  5DIZ A;  2FI7 A;  4L23 A;  3ZW3 A;  4ANW A;  1H0A A;  4A55 A;  2EQX A;  3JQ1 A;  3ZIM A;  3RJV A;  3T5V A;  4N2S A;  4J0U A;  4J8D A;  3FU6 A;  3CVQ A;  5ANL A;  3QWV A;  5LCW C;  3ASD A;  1EDU A;  4IYP A;  4BT9 A;  4UWG A;  1E90 A;  3NF1 A;  4I1A A;  3GZS A;  4FHJ A;  3G2T A;  3QAR A;  4GYY A;  4XKB A;  3SHF A;  4I9C A;  3CR3 A;  1QQE A;  5A6C A;  2WMN A;  4IN3 B;  1HZ4 A;  4GCO A;  5G04 C;  1JPL A;  1MQS A;  3PEU B;  3I4G A;  3CV0 A;  4DI4 A;  4KMO A;  2I2O A;  4UWL A;  4K03 A;  4XIF A;  5E75 A;  3CLJ A;  2IJG X;  3I5P A;  3I3N A;  3LYA A;  1KT1 A;  2HO1 A;  4JHR A;  2Y4U A;  4BX9 A;  2UY1 A;  3ZGQ A;  1HE8 A;  4G25 A;  4KZ0 A;  3U66 A;  3CVX A;  3CVV A;  1HX8 A;  2VTB A;  4QFV A;  4GU5 A;  4P29 A;  5J90 A;  4Q69 A;  2GRM A;  3JUI A;  2LAH A;  3ASG A;  2C2L A;  4KVM A;  3TL5 A;  3MYV A;  4FJY A;  2MOW A;  3PEV B;  2NXP A;  3PNT B;  3SD5 A;  2CG3 A;  2J09 A;  3UPV A;  3MKQ B;  3CHR A;  2WXG A;  3UT7 A;  4J8E A;  1JUQ A;  2I1J A;  4U0S A;  4AM9 A;  1HF8 A;  4U0U A;  3OXL A;  2L0T B;  2J07 A;  4AEZ C;  4ANX A;  2AXU A;  1OUV A;  4KYO B;  4EZJ A;  3VLF A;  3S7J A;  3CSF A;  2L0I A;  3FUD A;  3IBE A;  5T3R A;  4HFG A;  2WM9 A;  5JHA A;  1NZN A;  1LF8 A;  1XNF A;  5ARF A;  1TJF A;  4JW1 A;  3TG4 A;  1UG3 A;  5LOZ A;  4I6E A;  1HFA A;  4I17 A;  3EJN A;  5D0Q D;  1HU3 A;  4JZY A;  2IF4 A;  4C9B B;  1Z3X A;  3SBS A;  1IHG A;  2KZT B;  4U8H A;  3G2U A;  4UQX A;  3B13 A;  2IFU A;  4F53 A;  5BUZ A;  2MHK A;  3IEG A;  4WWO A;  1ELK A;  3QAQ A;  4ACL A;  3FUH A;  3SF4 A;  2XGO A;  3OXF A;  3CKC A;  4JHJ A;  4V3I A;  3APD A;  3FUM A;  3G2W A;  1UJJ A;  1UN8 A;  4ME2 A;  3U4T A;  1Z6T A;  4PS7 A;  3ZYQ A;  3DBS A;  1XGW A;  3TXN A;  2X38 A;  4I43 A;  3MKQ A;  2OND A;  3CVN A;  4CGW A;  1IQU A;  3D9M A;  1HH8 A;  1OWL A;  4XX5 A;  5KJK A;  3L54 A;  2L9B A;  3EIJ A;  5JJT A;  1FVH A;  2X6K A;  4PS8 A;  4C0M A;  4CDN A;  3QK0 A;  2R59 A;  3HYM B;  4MLP A;  4CGV A;  4AP2 A;  2MRI A;  3D9J A;  3D3M A;  4AXH A;  4Q96 A;  2R17 C;  4GZ5 A;  4A1S A;  1WM5 A;  3EDT B;  3D9P A;  3FUK A;  4NQ0 A;  3UX4 A;  3S2A A;  4ILI A;  2BF0 X;  3ZYL A;  3FTZ A;  3ULQ A;  3ZVV A;  4U07 A;  3MV3 B;  4EPZ A;  4CEM A;  4EEC A;  4AV7 A;  4G11 A;  3KAE A;  5HQ8 A;  5EDS A;  2M63 A;  2XGS A;  1ZBP A;  4UQZ A;  4EBA A;  2KZT A;  1N52 A;  4TRQ A;  1NP7 A;  3T8M A;  4UI9 K;  3TAX A;  3QNK A;  2WQH A;  3RU0 A;  4RG9 A;  2XCB A;  3Q15 A;  1OWP A;  3CHS A;  3U64 A;  3FEY A;  4C0E A;  4FA6 A;  2J4B A;  4BSX A;  3APF A;  2VGY A;  5FWQ A;  1HO8 A;  2XHE A;  2QY7 A;  4PUC A;  3FU5 A;  3ZYK A;  4LER A;  4UI9 J;  5FZR A;  4ACK A;  2CFU A;  4RG6 A;  2HM8 A;  3B7S A;  5BV0 A;  2VSO E;  3FP3 A;  4NAC A;  3KEZ A;  3MZL B;  4YVO A;  3RO2 A;  3NZS A;  5FZS A;  3Q4A B;  3AU4 A;  3AS8 A;  5FTP A;  5G05 J;  4KBQ A;  3RRN B;  3QDN A;  3FH7 A;  3FU0 A;  5DBK A;  3ONL A;  2KCK A;  3EIQ C;  1SQM A;  3PH0 C;  4BWR A;  3PE3 A;  1Z3Y A;  4BTA A;  4APO A;  2IU1 A;  1DVP A;  3L13 A;  3K9I A;  3PZD A;  3RIB A;  1GW6 A;  3VTX A;  4U04 A;  4J8S A;  3SNX A;  2I9C A;  2DCP A;  2GW1 A;  4URK A;  3FTY A;  3Q49 B;  2ION A;  4WAF A;  3GZ2 A;  3L16 A;  3CVW A;  1NA0 A;  3LCA A;  3QB2 A;  3ZPJ A;  1KT0 A;  3RO3 A;  3NZU A;  2FF4 A;  3LVQ E;  4G24 A;  2WQ6 A;  4EBA G;  3PE4 A;  3D9N A;  4RSY A;  4WWP A;  3CVL A;  1PC2 A;  4WWN A;  2BTD A;  3CHM A;  4UI9 C;  3VLD A;  4N2Q A;  1H2U A;  2NSZ A;  2OOE A;  4E85 A;  5FZQ A;  2AWI A;  3C98 A;  3FTX A;  3PNL B;  4A3V A;  5ANR A;  4JEH A;  4ILG A;  3RRU A;  3UQ3 A;  5BPP A;  5G05 C;  4KVO A;  5AIJ A;  4B0Z A;  4AOF A;  3CK9 A;  1TEZ A;  2XEV A;  2R5S A;  2RG8 A;  4JPS A;  3CHP A;  2J49 A;  4A3T A;  1E96 B;  4AY6 A;  3FTW A;  1WAO 1;  3FUL A;  4JA7 A;  4LUN U;  1NA3 A;  3L17 A;  4F3V A;  3CQG B;  2VGX B;  3FTU A;  3LJ3 A;  2HR2 A;  2JLB A;  3GW4 A;  3HHM A;  3LPZ A;  5EX0 A;  5AJL A;  3D9O A;  4E6H A;  4WNE A;  1E7U A;  2WXQ A;  3PUK A;  5ARG A;  3VLE A;  2WXR A;  4FJZ A;  1ZU2 A;  2X6H A;  5LX8 A;  1P5Q A;  3S7B A;  3UUX A;  3LKU A;  3SZ7 A;  4HVB A;  2YIN A;  5G2N A;  4APF A;  1TJC A;  4JA9 A;  3CK8 A;  2OV8 A;  3ZEF A;  2VQ2 A;  3IV0 A;  3QWW A;  4L7T A;  3JQ0 A;  1INZ A;  4HXI A;  3PRZ A;  4XI9 A;  2P58 C;  4H7X A;  3BG1 B;  1E8Y A;  4N39 A;  1DNP A;  2AVP A;  4G1T A;  4N3C A;  5ENN A;  1X5B A;  3LEW A;  2KAT A;  4XZ4 A;  4JVS A;  1MHQ A;  3SI5 A;  3S7D A;  2LO6 A;  3MV2 B;  4FLH A;  3MKR A;  1FCH A;  4A1G A;  2BUG A;  4GYO A;  3SFZ A;  3TG5 A;  4DLO A;  2CFZ A;  3R7R A;  3FY4 A;  3IHV A;  4GA0 A;  3ZRH A;  4FC8 A;  4B8A A;  4N3B A;  1SZA A;  2X6F A;  3CVP A;  3ESK A;  3FDH A;  4XE0 A;  3QKY A;  5BNW A;  4HOT A;  4MKT A;  2YHE A;  2X6I A;  3Q47 B;  3FHE A;  5A23 A;  2GRL A;  4PDX A;  3CHQ A;  3FWV A;  2VGX A;  3WXX A;  4F7A A;  1Y6I A;  3PVL A;  3RRM B;  2CHW A;  4DJA A;  3MA5 A;  3HVE B;  3ASH A;  3B7U X;  2XPI A;  3AU5 A;  3FUE A;  1PY1 A;  3IHY A;  1E8W A;  2JEK A;  3QOU A;  4N5C A;  3IKO B;  2E0I A;  2HYZ A;  2XCC A;  3FUF A;  2C0L A;  4J6I A;  3D9I A;  4UWF A;  4CRW A;  4CT0 A;  3CVU A;  3B7R L;  4FUL A;  4ILH B;  3LY9 A;  2IOL A;  3L6A A;  2KCV A;  1H6K A;  3BG0 B;  3FTS A;  2CHZ A;  4RVB A;  2WXP A;  2AXZ A;  3JYS A;  3SBT B;  1VDY A;  5EX3 A;  3HDX A;  3FUN A;  4FLB A;  3QJZ A;  2XRZ A;  2OVF A;  4GYW A;  3G2V A;  5FQ6 A;  5D0O D;  3D9K A;  2PQR A;  3PDN A;  4AJW A;  2PM7 A;  2X3M A;  2L6J A;  4Y6W A;  3ZFW A;  3ENE A;  4L2L A;  2WB2 A;  2AW6 A;  5EKQ D;  1H2V C;  3ASF A;  3ONK A;  2J9Q A;  2IQC A;  1EPU A;  4LCT A;  2KC7 A;  1ELR A;  2V4L A;  3ESL A;  4PS3 A;  5C2Y A;  3AS4 A;  3ZXS A;  2WVI A;  2CG2 A;  3FU3 A;  3CST A;  3GYZ A;  1B89 A;  4GB9 A;  2PZI A;  4LRZ A;  4OYS A;  3UT8 A;  4TUU A;  4EZL A;  2C0M A;  4AY5 A;  3LDZ A;  4WNF A;  4XI0 A;  2WXL A;  3HVE A;  3TXM A;  3NQP A;  3SGH A;  2I1K A;  3QC1 A;  3LVR E;  4TV3 A;  2FO7 A;  4MRU A;  4B8C B;  4ANV A;  5AJD A;  2VJ8 A;  4I6G A;  2WXJ A;  3LXU X;  2RD0 A;  3FH8 A;  2FBN A;  2Y3A A;  3L08 A;  5LP0 A;  3FTV A;  1S0P A;  2VTB B;  3B7T A;  3GZ1 A;  3PS6 A;  1EF1 C;  1L5J A;  2WMO A;  4UWK A;  5FQ8 A;  4GZ6 A;  4JL0 A;  5G55 A;  5T4Y A;  3CK7 A;  4HS2 A;  4CCA A;  4N3A A;  5LFA A;  4IUL A;  4FU3 A;  3ML9 A;  4NUR A;  5AYW D;  5KCM A;  4CDR A;  3ZHE B;  3D9L A;  2A5U A;  2WXM A;  4GZ3 A;  2FEZ A;  5JHB A;  4HOR A;  3L22 A;  4EQF A;  1SZ9 A;  1WY6 A;  3UMV A;  1U3C A;  2LAI A;  3PUJ A;  2WXH A;  3FFL A;  2Y4T A;  5CMY A;  2UWJ G;  3O48 A;  3E4B A;  4AIF A;  2LSU A;  4PH4 B;  4GA1 A;  4LEU A;  4BY6 A;  4XKC A;  3DPD A;  2NC9 A;  5M72 A;  4BFR A;  1JWG A;  2YQ8 A;  4Q94 A;  2I6H A;  2PM6 A;  2VSY A;  4IRU A;  1E7V A;  3ZN3 A;  4ATG A;  2XPZ A;  1UJK A;  4GZC A;  3UT4 A;  5FT9 A;  3I4R B;  3R7Q A;  3HIZ A;  5BT1 A;  1Y8M A;  3MGB A;  4I9E A;  1N54 A;  3EHN A;  5JJ6 A;  4Y6C A;  2V5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...