4GMJA

Structure of human not1 mif4g domain co-crystallized with caf1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
229
Chain Sequence
b'HMLEENIQEKIAFIFNNLSQSNMTQKVEELKETVKEEFMPWVSQYLVMKRVSIEPNFHSLYSNFLDTLKNPEFNKMVLNETYRNIKVLLTSDKAAANFSDRSLLKNLGHWLGMITLAKNKPILHTDLDVKSLLLEAYVKGQQELLYVVPFVAKVLESSIRSVVFRPPNPWTMAIMNVLAELHQEHDLKLNLKFEIEVLCKNLALDINELKPGNLLKDKDRLKNLDEQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCR4-NOT transcription complex subunit 1
publication title The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 82
structure length 229
sequence length 229
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gmjA00
1H2VC 1H2TC 1H6KA 4LUNU 3D3MA 4JHJA 1N52A 3JUIA 2VSXE 2IOSA 3L6AA 1UW4B 2KZTB 4CRWA 2ZU6B 4JHKA 4B89A 1PAQA 4B8CB 2VSOE 1H2UA 3EIJA 2FULA 1HU3A 4GMLA 4B8AA 2RG8A 3RK6A 3FEXA 2NSZA 4C9BB 2HM8A 2KZTA 4IULA 4CT4A 2I2OA 1N54A 1UG3A 3FEYA 2IU1A 4CEMA 3EIQC 4GMJA 5ANRA 2IONA 2IOLA 2GGFA
chains in the Genus database with same CATH superfamily
3TXNA 4ANWA 4JHJA 4ILHB 5G04C 2C0MA 4G26A 3I4RB 4GZ6A 1FT2A 2LSUA 2HR2A 2XEHA 2DWZA 2XPIA 4GAAA 1DC2A 3L17A 3IEGA 3HXDA 4WNEA 3ESKA 3PE3A 1VDYA 1JCSA 4LG6A 4JW1A 1OUVA 3PNLB 3Q79A 3CK9A 2V5FA 1KZOA 2P9UG 4PS3A 3R9AB 2IOLA 1D8DA 3PZ1A 1P5QA 3MGBA 2UY1B 5FTPA 3AG3E 1FCHA 4C0MA 1DNPA 3CKCA 4NIKA 5KNGA 4EZKA 3FHEA 5EN5D 3AG4E 2I6HA 2GRRB 4GTOA 3RRMB 1YA0A 1K3ZD 4L2LA 4J8EA 4K5BA 2JLBA 3L9TA 3TWSA 3ZN3A 1D9SA 1QBQA 3DPYA 3EJNA 5KJNA 3QOUA 3URZA 2QFCA 5JJTA 4ATGA 2AW6A 3ASFA 4HRMB 4RSYA 3GW4A 2AVPA 4YDWA 3ONKA 4JHKA 4ANXA 2EIME 5FZSA 4L7TA 5EIDA 1RZ4A 4KZ0A 3ISMC 4O6FA 1OXJA 5EIBE 3L16A 3TXMA 3ZHEB 3ESLA 2KC7A 5KJLA 1WDYA 2XZTG 1O1RA 3HHMA 2J4DA 2VTBB 5BUZA 4U04A 4HS2A 1MX6A 3JXJA 4B93B 3G2SA 2VGEA 4CT0A 2X6IA 3R7QA 4JA7A 1MHQA 4DJAA 4UWLA 4MLPA 5LCWJ 4N3BA 4JPSA 4GZDA 4OVVA 2L0IA 4GTMA 3UM2A 2VQ2A 3T5XA 3LKUA 4HLLA 2IJGX 2KXPC 3BG1B 4ANUA 1YCSB 3T8MA 3QWWA 4GTSA 4PS8A 4R7LA 2UY1A 2WMOA 1N0RA 3PZDA 4DI3A 1UG3A 3ABKE 2P58C 3B95A 4TUUA 1SQMA 4G25A 2M63A 3MCXA 4A1GA 1GW6A 3RRUA 5G05C 2LUHA 5H7PA 2GRNB 4CDMA 3P1UA 4I6JA 2I1KA 3SFXA 4A1SA 4BTBA 1HU3A 3ZKJA 3ZNGA 1TEZA 2A5EA 1HG2A 1TYQG 3ZYKA 3FUFA 5ARGA 4RLYA 2ETBA 3EHQA 5J08A 2R5SA 4MBGA 2X6KA 1O1TA 3KAEA 1N4PA 4I17A 2WVIA 4JC8A 3B13A 4WNDA 4WWNA 3EDTB 4FP7A 4YDEA 4N5CA 2XZDG 1A17A 4JHRA 3SGHA 4N2SA 3FTYA 4JD2G 1DCQA 3QC1A 4W9RA 3CHRA 1BU9A 3PREA 3DSXA 3EHRA 3PVLA 1MQSA 3IHYA 5D0OD 2B0OE 3LXUX 5D0QD 2RD0A 1N4RA 5IY5E 4L9PA 3EU9A 4JB8P 4N5QA 1AP7A 3F6QA 2PNNA 5AENA 2OV8A 4QQIA 3WXXA 4HI8A 5AQ9A 3Q15A 2IO2C 4BSXA 3CVLA 3CSFA 3DPDA 3EHMA 5BXOA 3CEQA 2KZTB 3MEKA 1JWGA 4EPZA 3D9MA 2OEVA 3AS5A 3DXKG 4GYOA 1LD8A 4FADA 5CCLA 3HYMB 1EYHA 1E8WA 3C72A 4ILGA 5AQ7A 2RG8A 4TRQA 3WG7E 3VLDA 3FEYA 5AYWD 4ATZD 3QARA 1TJCA 3ZYLA 4FA6A 1DVPA 2IQCA 3NQPA 5G2NA 3SD5A 4XKBA 4EBAA 1WM5A 3APDA 1E7UA 4ILIA 1Z3XA 3RO3A 4EHMA 4HOUA 3IV0A 3UINC 5KJMA 4DRXE 2CHXA 1TNZA 3DSWA 1NA3A 1SA5A 3HXBA 1EF1C 3L08A 2XS8A 1QNFA 1NI1A 4PH4B 3L82A 3CQCB 2BEDA 2A5UA 5EX0A 2KM4A 1BI8B 3MKQB 3O4ZA 3CR3A 5AIJA 4V3IA 3E37A 4FLBA 3BUAA 1N4SA 3AAAC 1H0AA 3ZRHA 4DK5A 1TN8A 3ZIMA 3CVUA 5HS0A 1H6PA 3TWRA 3RIBA 5A23A 4F1SA 4XEIG 4B8AA 2J8SD 1TNOA 2P9KG 4LEUA 4LERA 2XQ0A 3V2XA 5D66A 3CHQA 3BQOA 4PUCA 3RJVA 4CRWA 4EQFA 4FULA 1FVHA 2BTDA 4BWRA 2MRIA 2KZTA 1YMPA 4URKA 3T5VA 3N71A 2ZGGA 3B7RL 4EZLA 1RW2A 1Z3YA 4BETA 5FQ6A 1U2VG 5LFAA 4LNGA 4D10C 4OAUC 3VLFA 2LNIA 2JABA 3ZFWA 1E7VA 4U7EB 3UM0A 3SFYA 1H2TC 3ZXPA 1S0PA 3JUIA 5EYPF 5EILA 2WXKA 3APCA 4HORA 3TWTA 5M72A 4FLHA 1SZAA 1FT1A 2X6JA 2PL2A 2VGXB 3Q7FA 2J9QA 5DBKA 5A7DB 2VSNA 4KXKB 2V4HC 4DX6D 4GPMA 2VSYA 2XGMA 3HXFA 2C2LA 2OVFA 4U95D 1QYMA 3FH8A 4XX5A 3CGHA 3Q7AA 4AIFA 4Y6WA 3QWPA 3I4GA 1QZ2A 3GZ2A 1ZB1A 2DYSE 2PQNA 1LF8A 3Q49B 3UM1A 3PS6A 4NQ0A 4FHJA 3ZYMA 3E30A 5HI7A 2GGFA 4I1OB 1NFIE 3CHPA 3MZLB 1NL4A 2J07A 3ONLA 3FTUA 3QDNA 1ELKA 4GTRA 3MKQA 2ETCA 2Y3AA 4UWFA 3MA5A 4Z68A 3T9KA 4EECA 2ZXWE 4UI9J 2LXMA 4UWGA 4BT8A 2V0PA 3TWUA 4O1PA 5FQ8A 4ABNA 2WM9A 4TXPA 4DX5D 2ILRA 5HRYA 3AG2E 1MYOA 5AARA 3Q4AB 4RG6A 3CQGB 5E76A 5B1AE 1Y8MA 3FUNA 3V2OA 3UT4A 3G2WA 4YNDA 3PZ2A 1FVFA 4UI9C 3IKOB 2VJ8A 2DZNA 4DI4A 2WXGA 4RVBA 4DUIA 3FWVA 2I2OA 3TJPA 4DPRA 4FU3A 4AM9A 4J7WA 4G2VA 4KVOA 4PS7A 5JMND 2DCPA 2XEVA 3RO2A 3S2AA 1IHGA 4BX9A 4U63A 4FJZA 4I2ZA 1BI7B 3NOGD 2MYOA 1NA0A 3B7SA 5FQ7A 3MKRA 5D2MC 5LP0A 4WNFA 4GTQA 2P9IG 1V55E 5T8IA 3U66A 3KSLA 1NZNA 4A55A 3D9JA 2KATA 3TWXA 3Q78A 2KCLA 3DSUA 4DLQA 1UJJA 3BEEA 3QNKA 3TWWA 3U3WA 1G3NB 2F37A 2IU1A 5EYLA 4DX1A 2IFUA 3SHFA 4ZHBA 3E32A 3B7UX 3OXGA 1OY3D 1WG0A 4G1TA 5JHAA 3RRNB 3OXFA 3JXIA 1HG5A 2XRYA 2E2EA 5AJDA 4BERA 2IY0C 2GRPB 4XI9A 4AY6A 4U8HA 2V5QC 3ZXSA 1MZCA 5BV0A 2AXVA 4F1PA 1ZBPA 2KCVA 1MJ0A 4J8YA 4GCNA 1UJKA 1OCCE 1HFAA 4UQZA 4HRLA 1S63A 1U3CA 4EZJA 5CBOA 3FU5A 3D9OA 2QY7A 5HKPA 2B6CA 3MV2B 3ULEG 3HG0D 5A6CA 3FUKA 1H19A 3RU0A 5LCWC 2X6HA 3TAXA 2WQHA 4P29A 3IXEA 4B94A 2QC9A 3DSVA 2NC9A 3QK0A 1SW6A 2GW1A 2GRMA 4HOQA 1INZA 3Q75A 3FEXA 3D9HA 4FHKA 1HXIA 1X81A 3K9IA 2CG2A 5ITZF 4JVSA 5KNHD 3TL5A 2BF0X 5CCMA 2R03A 3S7FA 4TUMA 2FO7A 3HXEA 3D9IA 5LOZA 4N39A 3EU5A 2WXRA 3CSTA 3FUIA 1FPPA 4G8KA 3UXGA 2FF4A 3SQVA 3PUKA 4XKCA 2OEWA 4HOSA 5ANLA 3ZHEA 4GZCA 5BNWA 4U0SA 3APFA 5FT9A 4RQIA 1KLXA 2VTBA 2OOEA 1N0QA 3CVPA 1TNBA 5JJ7A 2P9SG 2JEKA 3PDNA 3AU4A 4HNAD 1IHBA 4GZ3A 3J5QB 4L23A 3MJWA 4AEZC 2RKKA 2PM6A 3ZYQA 2R02A 1ZU2A 3CVWA 2WXQA 3PRZA 4E85A 1XGWA 1N11A 3TG5A 1EDUA 3ASOE 4APOA 4ACKA 4IRUA 2XEEA 1TNYA 2WXNA 4L2YA 3V30A 3LY7A 3NZUA 4FJYA 3AG1E 3L13A 3PZ3A 4M7CA 4B8CB 2Y4UA 4YDOA 1H6OA 4X8QA 4WWPA 5ENTD 3E34A 2C0LA 3UI2A 4LCTA 4TV3A 3S7JA 3ZU7B 5ENSD 4LSZE 3T8KA 4DX2A 3DBSA 3U9WA 2DIWA 3D9KA 5B3SE 3ULYA 5BT1A 4GYWA 1OWNA 4APFA 3PE4A 3LPZA 4C9BB 3Q5MA 4ANVA 3E4BA 4GMRA 3TWVA 2FEZA 2NXPA 5FWQA 3D3MA 2ETAA 4KMOA 4HXIA 4WUYA 3PH0C 4AV7A 3LEWA 2FULA 1SA4A 4U0ZA 3G2VA 2QYJA 3QJZA 4GYYA 2J4BA 2NSZA 5E75A 5ENQD 3SZ7A 4LUNU 1K8KG 3TGOA 3NOCD 1O5MA 5T4YA 1IYGA 4NRHB 3L22A 4K5CA 4O60A 3CK7A 1D8EA 1UOHA 2YHEA 2I9CA 4Q69A 2WXIA 2WXLA 1W3BA 3ASHA 4K0RA 4GPKA 2WXOA 4UI9K 2CG3A 5T3RA 3FP3A 2UWJG 3CHSA 4MRUA 2VSXE 1OWMA 1TN7A 5AAOA 2J09A 1BLXB 3I3NA 4PDXA 4GTVA 3BG0B 3CVQA 5CECB 4L1BA 1N94A 2KBXA 2BKKB 3CVYA 3AJIA 1B89A 1N9AA 3DRAA 3CVXA 2WXFA 4CCAA 5G55A 3QAQA 4BTAA 4KT6B 3SNXA 3GYZA 3PZ4A 5BXUA 4UUCA 4HBDA 1OT8A 3FUJA 1OCRE 2ZISA 4GMLA 4N2QA 3FULA 2XGSA 2HM8A 2ONDA 4CEMA 4U8YD 4UWKA 2LO6A 4U8VD 3KEZA 3HDXA 4U96D 4F3VA 3B7BA 5FINA 3IHVA 2IOSA 4IN3B 2DYRE 3ENEA 3FTVA 2E0IA 4Q94A 1N95A 3SBTB 3RAUA 3BU8A 2XCBA 3FTSA 2IF4A 3DEOA 1QQEA 3OXLA 3KS2A 3R7RA 2RFAA 3EHNA 4B89A 3LS8A 1Q2ZA 3FUEA 4BX8A 2QZAA 2ZIRA 3FUHA 5G04J 5ENRD 1KT1A 3LVRE 3DXMG 1H2VC 1IQUA 2H6HA 2NYJA 3B7TA 4WNGA 3FU3A 3FY4A 2WQ6A 1Z5SC 4B0ZA 2YHCA 3CLJA 3ML9A 1ELWA 3DEPA 4HLEA 2GROB 2FBNA 5ANRA 2IONA 1KZPA 3J5PA 4I43A 4KZCA 4I6GA 1E8XA 4A3VA 2ZU6B 2XCCA 4NURA 4OVUA 4U07A 3OAWA 4AVXA 3KSQA 1TN6A 4CDRA 5EX3A 2L6JA 4F53A 4TXRA 3NAWA 3Q9NC 3FH7A 4J8FA 4DLOA 4CZ2D 1H2UA 3JYSA 3I5PA 4Y6CA 4I6EA 2XS1A 4JEHA 3UTMA 1TR4A 1PC2A 5FZQA 3Q73A 4JEUA 4GU5A 3ABLE 5KBAA 3NZSA 2H6FA 3UT8A 2CHWA 4I9EA 2HYZA 2PZIA 4BFRA 5CMWA 1HX8A 3NF1A 1U3DA 4IULA 3HXCA 3KD7A 1N54A 3LJ3A 5KWDA 2VGXA 3QB2A 2GRLA 2BUGA 1JPLA 3VTYA 1UN8A 3MV3B 1PAQA 2FI7A 4M3OA 1Z6TA 4RG9A 1E8YA 1E90A 4I2WA 4GTPA 3ZW3A 4UQYA 1K1AA 1TJFA 2WXMA 4ME2A 3UKUG 3ULQA 4E6HA 3CV0A 3X2QE 5AQBA 2H6GA 2WB2A 1MX4A 3CHOA 4I1MA 3C98A 3V79K 3UUXA 3HRAA 3CVVA 3S7DA 2R05A 3RKVA 3SF4A 1O1SA 2H6IA 1HF8A 4AJWA 3L54A 3ZUVB 2P2CP 5ENPD 4K5AB 5HQ8A 2RFMA 2J08A 4WAFA 2LXLA 3G2UA 2XHEA 2PQRA 3LYAA 2CFUA 1K1BA 2Y69E 3FDHA 1NP7A 3LCAA 3FU6A 1OWLA 2YINA 4KYOB 1XNFA 2BKGA 2R17C 1BPOA 3JCKC 3FUDA 3ML8A 2X38A 1JWFA 3ASNE 3ASGA 1IKND 3RSEG 3SBSA 5G05J 5C2YA 3MX3A 4BEPA 2P9PG 3C5RA 4GMJA 5FIOA 5J90A 1A5EA 5JHBA 2ZGDA 2A4ZA 3VLEA 3R9MA 3FTWA 5CEDB 4DX7D 4MS6A 4N3CA 4AXHA 2WXHA 4XZ4A 1N4QA 4AY5A 3LJNA 3JQ0A 4JZYA 4JA9A 1E96B 2R2LA 5CERB 2EQXA 1OCOE 3AU5A 4WWOA 1PY1A 2DZOA 4JL0A 1JUQA 4G8LA 5BV1A 4HOTA 4ZFHA 3W9FA 2PM7A 2AXZA 4XIFA 1LD7A 3D9NA 3ABME 3UQ3A 3PEVB 2V4LA 4H7XA 2XPZA 3SY2A 4LRZA 3SO8A 4MKTA 4GZ5A 5AJLA 2AWIA 4HQDA 3C3OA 2VSOE 1HE8A 4F7AA 3FTZA 3U64A 1WAO1 4J8DA 2GRQB 3JUEA 3O48A 3DSTA 3SI5A 1H6KA 3ZPJA 2IO3C 4GA0A 1S64A 1LTXA 5AN8A 2F0YA 3ASDA 3PNTB 3V31A 2R59A 2XRZA 2Y0BG 1UN9A 4CGWA 3U4TA 3AS8A 3NBNB 3DSSA 3UT7A 2L6BA 1DCEA 2KCKA 2CHZA 4J6IA 3GZ1A 3QWVA 4EBAG 3LY8A 3EIJA 4XI0A 3LY9A 3MYVA 2WPVA 2V8SE 4C48B 3HVEB 3Q9UC 2VYIA 4GTTA 3NB2A 2OCCE 2OVBA 3AS4A 1V54E 4QFVA 5ARFA 4GA2A 1N52A 3TG4A 5CRVA 4N3AA 2LAHA 4OYSA 5B1BE 2AXUA 2I1JA 4BY6A 2Y4TA 3RK6A 3ZGQA 2QYUA 3ZEFA 2EIKE 4HRNA 3FUMA 5CRUA 5AQAA 3CVNA 3KEAA 4LNBA 1MX2A 2EILE 2P9NG 4HB5A 1IQRA 1SZ9A 2F8XK 1X5BA 2WQ7A 1Y6IA 3EIQC 4J8SA 4CDNA 1OCZE 3L6AA 2WXJA 3C3QA 5JJ6A 5FZRA 5CMYA 4KBQA 4U0UA 3CIAA 5C1DA 4A63B 3FU0A 3UIOC 5ENNA 3UM3A 3PEUB 4G23A 3S7BA 2HE0A 1HZ4A 3DWLG 1AWCB 3UKRG 4LNUD 2X6FA 2DBAA 4ACLA 4HFGA 5ENOD 2LSVA 4Q96A 2IEJA 3Q47B 1HO8A 3W9GA 4GB9A 3LDZA 3D9LA 3HIZA 4CYMD 4AP2A 2XGOA 1JCRA 1S70B 1JCQA 4NACA 3G2TA 2CFZA 4C0EA 4CGVA 3GZSA 4AOFA 4K03A 3FFLA 1KT0A 4OAVB 1WY6A 3JQ1A 2YNQA 2XENA 4J0UA 5KCMA 3QKYA 4H7YA 5CHEE 2EINE 3CK8A 3HVEA 4YVOA 5JA4D 2VGYA 2DVWA 3SFZA 1BD8A 1SVXA 1HH8A 2WMNA 1OWOA 4HVBA 4GCOA 3UIPC 3VTXA 2Y1LE 4KVMA 4G24A 4CT4A 1ELRA 1E8ZA 2Q7FA 1KPSB 3TWQA 5DIZA 4FC8A 1TNUA 1IXVA 3FTXA 3PUJA 2YQ8A 5EKQD 5CBNA 4UQXA 3UPVA 4XE0A 3CKBA 5KJKA 2AJAA 4F6RD 4IYPA 1YYHA 2F8YA 4I9CA 3OTNA 2WXPA 2EIJE 4HI9A 1HS6A 3ZVVA 2MHKA 3P2BA 2FO1E 4TXQA 5LX8A 3IBEA 5CEAA 5EDSA 2J49A 5FJYA 3CHMA 3EUVA 4BESA 1EPUA 3D9PA 3UX4A 4GA1A 5BW8C 4I1AA 3C3RA 4A3TA 1L5JA 2X3MA 2MOWA 4BT9A 1OWPA 3FH5A 1UW4B 3E33A 4UWHA 4O1OA 2L0TB 2LAIA 4YDYA 2P9LG 4G11A 4JXTA 3LVQE 5FQ4A 3UMVA 4BSZB 2HO1A 2L9BA 4YVQC 5BPPA 2XPYA
chains in the Genus database with same CATH topology
4V3IA 3TXNA 4FLBA 4ANWA 3RKVA 3ZRHA 1H0AA 4JHJA 2JEKA 3PDNA 4ILHB 5G04C 3SF4A 3AU4A 4AJWA 1HF8A 4DK5A 2C0MA 3L54A 3ZIMA 3CVUA 4G26A 3I4RB 4GZ6A 3RIBA 2LSUA 4GZ3A 5HQ8A 5A23A 2HR2A 4L23A 4F1SA 2J08A 4B8AA 4WAFA 3G2UA 3MJWA 2XPIA 2XHEA 2PQRA 3LYAA 2CFUA 4GAAA 4AEZC 4LEUA 2PM6A 3ZYQA 3L17A 3IEGA 4LERA 3FDHA 2XQ0A 1ZU2A 4WNEA 1NP7A 3LCAA 3FU6A 3ESKA 3PE3A 1OWLA 3CHQA 3CVWA 2WXQA 2YINA 4KYOB 4PUCA 1VDYA 1XNFA 3PRZA 4E85A 1XGWA 2R17C 1BPOA 3JCKC 3RJVA 4JW1A 4CRWA 1OUVA 3PNLB 3TG5A 1EDUA 4APOA 3FUDA 4ACKA 3ML8A 4EQFA 4IRUA 2X38A 4FULA 1JWFA 1FVHA 2BTDA 3CK9A 3ASGA 4BWRA 2MRIA 3SBSA 2KZTA 2WXNA 2V5FA 5G05J 3MX3A 5C2YA 4L2YA 4GMJA 4URKA 3LY7A 4PS3A 5J90A 3R9AB 2IOLA 5JHBA 2A4ZA 3NZUA 3VLEA 3T5VA 3N71A 1P5QA 3MGBA 3FTWA 3B7RL 2UY1B 4FJYA 5FTPA 4EZLA 3L13A 4MS6A 4N3CA 4AXHA 1Z3YA 1FCHA 2WXHA 2Y4UA 4B8CB 4XZ4A 4AY5A 5FQ6A 5LFAA 4C0MA 3JQ0A 4D10C 4WWPA 4JZYA 3VLFA 1DNPA 3CKCA 4EZKA 2LNIA 3FHEA 4JA9A 3ZFWA 1E7VA 2I6HA 1E96B 3RRMB 2C0LA 1YA0A 4LCTA 4L2LA 4TV3A 2EQXA 4J8EA 3S7JA 3AU5A 1H2TC 4WWOA 1PY1A 1S0PA 2JLBA 4JL0A 1JUQA 3JUIA 3DBSA 3U9WA 5BV1A 4HOTA 2WXKA 2DIWA 3D9KA 2PM7A 2AXZA 4XIFA 3APCA 3ZN3A 5BT1A 4HORA 3D9NA 5M72A 4FLHA 4GYWA 1SZAA 3UQ3A 1OWNA 2X6JA 2PL2A 2VGXB 3PEVB 4APFA 2J9QA 3PE4A 5DBKA 3LPZA 5A7DB 2V4LA 2VSNA 3EJNA 4H7XA 4C9BB 4KXKB 5KJNA 3Q5MA 3QOUA 2XPZA 2VSYA 4LRZA 3URZA 4ANVA 2XGMA 2QFCA 3E4BA 4MKTA 4GZ5A 5JJTA 2C2LA 5AJLA 2OVFA 2AWIA 2FEZA 4ATGA 2NXPA 5FWQA 3D3MA 3FH8A 4KMOA 2AW6A 3ASFA 4RSYA 3GW4A 2AVPA 4HXIA 4WUYA 3PH0C 4AV7A 4XX5A 3CGHA 3ONKA 4JHKA 4ANXA 2VSOE 1HE8A 3LEWA 4AIFA 4DPRA 4F7AA 2FULA 4L7TA 3QWPA 4Y6WA 3I4GA 1QZ2A 3GZ2A 3FTZA 5FZSA 4U0ZA 3G2VA 2PQNA 1LF8A 3U64A 3QJZA 4GYYA 2J4BA 2NSZA 3Q49B 4KZ0A 3PS6A 1WAO1 4NQ0A 4FHJA 4J8DA 5E75A 3ZYMA 4O6FA 5HI7A 3O48A 3SZ7A 3L16A 3SI5A 3TXMA 2GGFA 4LUNU 3ZHEB 4I1OB 3TGOA 3CHPA 3MZLB 1H6KA 3ESLA 2KC7A 5KJLA 2J07A 3ZPJA 3ONLA 5T4YA 3HHMA 1IYGA 4NRHB 3FTUA 3L22A 3QDNA 1ELKA 2J4DA 4GA0A 3CK7A 2VTBB 3MKQA 5BUZA 4U04A 2YHEA 2I9CA 4HS2A 3ASDA 3PNTB 2Y3AA 2WXIA 4Q69A 2WXLA 4UWFA 1W3BA 3ASHA 3MA5A 2R59A 4EECA 2XRZA 4K0RA 4GPKA 1UN9A 2WXOA 4UI9K 4CGWA 3G2SA 2CG3A 3AS8A 3U4TA 4CT0A 4UI9J 2X6IA 4UWGA 5T3RA 3R7QA 4BT8A 3FP3A 3UT7A 2UWJG 3CHSA 4JA7A 4MRUA 2VSXE 1MHQA 2V0PA 1OWMA 4DJAA 2KCKA 4UWLA 2CHZA 5FQ8A 4ABNA 4J6IA 2WM9A 3GZ1A 3QWVA 2J09A 4EBAG 2ILRA 3LY8A 4MLPA 3I3NA 5LCWJ 3EIJA 4N3BA 4JPSA 4PDXA 3Q4AB 3BG0B 4XI0A 4GZDA 3CVQA 3LY9A 4OVVA 4RG6A 4L1BA 3MYVA 2WPVA 3CQGB 5E76A 2V8SE 1Y8MA 3CVYA 2L0IA 3HVEB 2VYIA 2VQ2A 3T5XA 3FUNA 3LKUA 2OVBA 1B89A 3AS4A 4QFVA 3UT4A 3G2WA 3CVXA 2WXFA 5ARFA 4GA2A 4CCAA 2IJGX 4YNDA 5G55A 3QAQA 1N52A 4BTAA 4KT6B 1FVFA 3BG1B 4UI9C 3SNXA 3GYZA 4ANUA 3TG4A 3IKOB 4N3AA 3T8MA 2VJ8A 3QWWA 2LAHA 3FUJA 4OYSA 2AXUA 2I1JA 4BY6A 4GMLA 4PS8A 4R7LA 2Y4TA 3RK6A 4DI4A 2UY1A 2WMOA 4N2QA 3FULA 2XGSA 3PZDA 2HM8A 2WXGA 4RVBA 3FWVA 2I2OA 3ZGQA 4DI3A 1UG3A 3TJPA 2P58C 2ONDA 4CEMA 3ZEFA 4TUUA 1SQMA 4FU3A 2M63A 3MCXA 2LO6A 4G25A 4UWKA 4AM9A 4A1GA 4G2VA 1GW6A 3KEZA 3HDXA 3RRUA 3FUMA 4F3VA 5G05C 4KVOA 4PS7A 2DCPA 3IHVA 2IOSA 4IN3B 4CDMA 3ENEA 2XEVA 3P1UA 3CVNA 3RO2A 3FTVA 4I6JA 2E0IA 2I1KA 4Q94A 3S2AA 1IHGA 3SBTB 4A1SA 4BTBA 4BX9A 4U63A 1HU3A 2XCBA 4FJZA 4I2ZA 1IQRA 1TEZA 3FTSA 1HG2A 1SZ9A 1NA0A 1X5BA 3B7SA 3ZYKA 2WQ7A 5FQ7A 2IF4A 3MKRA 1Y6IA 3FUFA 3EIQC 5LP0A 4WNFA 5ARGA 1QQEA 4J8SA 5T8IA 3OXLA 3KS2A 3U66A 3R7RA 4CDNA 1NZNA 4A55A 3D9JA 5J08A 2R5SA 3L6AA 2WXJA 3EHNA 2X6KA 2KATA 4B89A 3KAEA 5JJ6A 3LS8A 2KCLA 5FZRA 5CMYA 4I17A 2WVIA 4JC8A 4KBQA 4DLQA 3FUEA 4U0UA 4BX8A 3B13A 1UJJA 3CIAA 5C1DA 3BEEA 3QNKA 3U3WA 3FU0A 4WNDA 5ENNA 3FUHA 4WWNA 2IU1A 1KT1A 5G04J 3LVRE 3PEUB 3EDTB 4G23A 3S7BA 4FP7A 1H2VC 1IQUA 2IFUA 3B7TA 4N5CA 3SHFA 1HZ4A 4WNGA 3B7UX 2X6FA 1A17A 2DBAA 3FU3A 3OXGA 4JHRA 3SGHA 3FY4A 4N2SA 4ACLA 3FTYA 4HFGA 2WQ6A 4G1TA 3QC1A 2LSVA 4W9RA 4Q96A 5JHAA 3Q47B 3CHRA 3RRNB 1HO8A 4B0ZA 2YHCA 4GB9A 3CLJA 3LDZA 3ML9A 1ELWA 3D9LA 3OXFA 3PREA 4HLEA 1HG5A 3HIZA 2XRYA 2FBNA 5ANRA 2IONA 3PVLA 2E2EA 1MQSA 2XGOA 5AJDA 4AP2A 3IHYA 4I43A 4KZCA 5D0OD 4I6GA 4XI9A 4AY6A 1E8XA 3LXUX 4U8HA 4NACA 3G2TA 4A3VA 5D0QD 3ZXSA 2RD0A 5BV0A 2ZU6B 2AXVA 2CFZA 2XCCA 4C0EA 4NURA 4CGVA 3GZSA 4OVUA 4U07A 3OAWA 4AOFA 4K03A 4AVXA 3FFLA 1ZBPA 1KT0A 2KCVA 1WY6A 3JQ1A 5AENA 2OV8A 2YNQA 4GCNA 3WXXA 4CDRA 4J0UA 5KCMA 5EX3A 1UJKA 2L6JA 3Q15A 4F53A 1HFAA 3QKYA 4UQZA 4BSXA 3CVLA 3CSFA 4H7YA 5CHEE 3DPDA 3CK8A 3EHMA 3CEQA 3HVEA 1U3CA 4YVOA 3FH7A 2KZTB 2VGYA 4EZJA 4J8FA 3SFZA 2WMNA 3MEKA 1HH8A 3FU5A 4DLOA 3D9OA 1JWGA 4EPZA 1H2UA 3JYSA 1OWOA 3I5PA 4Y6CA 4HVBA 2QY7A 4GCOA 3MV2B 3VTXA 3D9MA 4KVMA 4G24A 5A6CA 4I6EA 4CT4A 1ELRA 3FUKA 3AS5A 1H19A 3RU0A 4JEHA 1E8ZA 2Q7FA 4GYOA 5LCWC 2X6HA 3TAXA 4FADA 1PC2A 2WQHA 4P29A 4B94A 5FZQA 5DIZA 5CCLA 4JEUA 4FC8A 3FTXA 3PUJA 4GU5A 2NC9A 2YQ8A 3QK0A 5EKQD 4UQXA 3HYMB 2GW1A 3UPVA 1EYHA 2GRMA 1E8WA 3NZSA 3UT8A 4XE0A 3CKBA 2CHWA 4I9EA 2HYZA 2PZIA 4HOQA 4ILGA 4BFRA 5KJKA 1INZA 5CMWA 1HX8A 3NF1A 2RG8A 3FEXA 1U3DA 4IULA 4IYPA 3KD7A 4TRQA 3VLDA 1N54A 4FHKA 3FEYA 4I9CA 5AYWD 3OTNA 2WXPA 1HXIA 3LJ3A 3QARA 1HS6A 3ZVVA 1TJCA 3ZYLA 2MHKA 3P2BA 2VGXA 3QB2A 2GRLA 2BUGA 1JPLA 4FA6A 1DVPA 5LX8A 3K9IA 2IQCA 3NQPA 3VTYA 3IBEA 5G2NA 2CG2A 5EDSA 2J49A 1UN8A 5FJYA 3MV3B 3SD5A 3CHMA 4JVSA 1PAQA 4XKBA 4EBAA 3TL5A 2FI7A 4M3OA 1Z6TA 2BF0X 5CCMA 1EPUA 4RG9A 3S7FA 1E8YA 1WM5A 3D9PA 2FO7A 3APDA 1E90A 4I2WA 3UX4A 1E7UA 4GA1A 3D9IA 5LOZA 4ILIA 3ZW3A 5BW8C 1Z3XA 4UQYA 4I1AA 3RO3A 4N39A 4A3TA 1L5JA 2WXRA 3CSTA 2X3MA 4HOUA 3IV0A 2MOWA 4BT9A 3FUIA 1OWPA 1TJFA 5KJMA 2CHXA 3FH5A 1UW4B 2FF4A 1NA3A 3PUKA 2WXMA 4UWHA 1EF1C 2L0TB 3L08A 4XKCA 2LAIA 4ME2A 3ULQA 5ANLA 4HOSA 1QNFA 4PH4B 3ZHEA 4GZCA 4E6HA 5BNWA 3CV0A 4U0SA 3APFA 4G11A 4JXTA 3LVQE 5FQ4A 3UMVA 3CQCB 5FT9A 2A5UA 2HO1A 2WB2A 2L9BA 1KLXA 5EX0A 2VTBA 2KM4A 2OOEA 3CHOA 3CVPA 3C98A 4I1MA 4YVQC 3MKQB 3O4ZA 5BPPA 3CR3A 3UUXA 5JJ7A 5AIJA 3CVVA 2XPYA 3S7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H2V C;  1H2T C;  1H6K A;  4LUN U;  3D3M A;  4JHJ A;  1N52 A;  3JUI A;  2VSX E;  2IOS A;  3L6A A;  1UW4 B;  2KZT B;  4CRW A;  2ZU6 B;  4JHK A;  4B89 A;  1PAQ A;  4B8C B;  2VSO E;  1H2U A;  3EIJ A;  2FUL A;  1HU3 A;  4GML A;  4B8A A;  2RG8 A;  3RK6 A;  3FEX A;  2NSZ A;  4C9B B;  2HM8 A;  2KZT A;  4IUL A;  4CT4 A;  2I2O A;  1N54 A;  1UG3 A;  3FEY A;  2IU1 A;  4CEM A;  3EIQ C;  4GMJ A;  5ANR A;  2ION A;  2IOL A;  2GGF A; 
#chains in the Genus database with same CATH topology
 3TXN A;  4ANW A;  4JHJ A;  4ILH B;  5G04 C;  2C0M A;  4G26 A;  3I4R B;  4GZ6 A;  1FT2 A;  2LSU A;  2HR2 A;  2XEH A;  2DWZ A;  2XPI A;  4GAA A;  1DC2 A;  3L17 A;  3IEG A;  3HXD A;  4WNE A;  3ESK A;  3PE3 A;  1VDY A;  1JCS A;  4LG6 A;  4JW1 A;  1OUV A;  3PNL B;  3Q79 A;  3CK9 A;  2V5F A;  1KZO A;  2P9U G;  4PS3 A;  3R9A B;  2IOL A;  1D8D A;  3PZ1 A;  1P5Q A;  3MGB A;  2UY1 B;  5FTP A;  3AG3 E;  1FCH A;  4C0M A;  1DNP A;  3CKC A;  4NIK A;  5KNG A;  4EZK A;  3FHE A;  5EN5 D;  3AG4 E;  2I6H A;  2GRR B;  4GTO A;  3RRM B;  1YA0 A;  1K3Z D;  4L2L A;  4J8E A;  4K5B A;  2JLB A;  3L9T A;  3TWS A;  3ZN3 A;  1D9S A;  1QBQ A;  3DPY A;  3EJN A;  5KJN A;  3QOU A;  3URZ A;  2QFC A;  5JJT A;  4ATG A;  2AW6 A;  3ASF A;  4HRM B;  4RSY A;  3GW4 A;  2AVP A;  4YDW A;  3ONK A;  4JHK A;  4ANX A;  2EIM E;  5FZS A;  4L7T A;  5EID A;  1RZ4 A;  4KZ0 A;  3ISM C;  4O6F A;  1OXJ A;  5EIB E;  3L16 A;  3TXM A;  3ZHE B;  3ESL A;  2KC7 A;  5KJL A;  1WDY A;  2XZT G;  1O1R A;  3HHM A;  2J4D A;  2VTB B;  5BUZ A;  4U04 A;  4HS2 A;  1MX6 A;  3JXJ A;  4B93 B;  3G2S A;  2VGE A;  4CT0 A;  2X6I A;  3R7Q A;  4JA7 A;  1MHQ A;  4DJA A;  4UWL A;  4MLP A;  5LCW J;  4N3B A;  4JPS A;  4GZD A;  4OVV A;  2L0I A;  4GTM A;  3UM2 A;  2VQ2 A;  3T5X A;  3LKU A;  4HLL A;  2IJG X;  2KXP C;  3BG1 B;  4ANU A;  1YCS B;  3T8M A;  3QWW A;  4GTS A;  4PS8 A;  4R7L A;  2UY1 A;  2WMO A;  1N0R A;  3PZD A;  4DI3 A;  1UG3 A;  3ABK E;  2P58 C;  3B95 A;  4TUU A;  1SQM A;  4G25 A;  2M63 A;  3MCX A;  4A1G A;  1GW6 A;  3RRU A;  5G05 C;  2LUH A;  5H7P A;  2GRN B;  4CDM A;  3P1U A;  4I6J A;  2I1K A;  3SFX A;  4A1S A;  4BTB A;  1HU3 A;  3ZKJ A;  3ZNG A;  1TEZ A;  2A5E A;  1HG2 A;  1TYQ G;  3ZYK A;  3FUF A;  5ARG A;  4RLY A;  2ETB A;  3EHQ A;  5J08 A;  2R5S A;  4MBG A;  2X6K A;  1O1T A;  3KAE A;  1N4P A;  4I17 A;  2WVI A;  4JC8 A;  3B13 A;  4WND A;  4WWN A;  3EDT B;  4FP7 A;  4YDE A;  4N5C A;  2XZD G;  1A17 A;  4JHR A;  3SGH A;  4N2S A;  3FTY A;  4JD2 G;  1DCQ A;  3QC1 A;  4W9R A;  3CHR A;  1BU9 A;  3PRE A;  3DSX A;  3EHR A;  3PVL A;  1MQS A;  3IHY A;  5D0O D;  2B0O E;  3LXU X;  5D0Q D;  2RD0 A;  1N4R A;  5IY5 E;  4L9P A;  3EU9 A;  4JB8 P;  4N5Q A;  1AP7 A;  3F6Q A;  2PNN A;  5AEN A;  2OV8 A;  4QQI A;  3WXX A;  4HI8 A;  5AQ9 A;  3Q15 A;  2IO2 C;  4BSX A;  3CVL A;  3CSF A;  3DPD A;  3EHM A;  5BXO A;  3CEQ A;  2KZT B;  3MEK A;  1JWG A;  4EPZ A;  3D9M A;  2OEV A;  3AS5 A;  3DXK G;  4GYO A;  1LD8 A;  4FAD A;  5CCL A;  3HYM B;  1EYH A;  1E8W A;  3C72 A;  4ILG A;  5AQ7 A;  2RG8 A;  4TRQ A;  3WG7 E;  3VLD A;  3FEY A;  5AYW D;  4ATZ D;  3QAR A;  1TJC A;  3ZYL A;  4FA6 A;  1DVP A;  2IQC A;  3NQP A;  5G2N A;  3SD5 A;  4XKB A;  4EBA A;  1WM5 A;  3APD A;  1E7U A;  4ILI A;  1Z3X A;  3RO3 A;  4EHM A;  4HOU A;  3IV0 A;  3UIN C;  5KJM A;  4DRX E;  2CHX A;  1TNZ A;  3DSW A;  1NA3 A;  1SA5 A;  3HXB A;  1EF1 C;  3L08 A;  2XS8 A;  1QNF A;  1NI1 A;  4PH4 B;  3L82 A;  3CQC B;  2BED A;  2A5U A;  5EX0 A;  2KM4 A;  1BI8 B;  3MKQ B;  3O4Z A;  3CR3 A;  5AIJ A;  4V3I A;  3E37 A;  4FLB A;  3BUA A;  1N4S A;  3AAA C;  1H0A A;  3ZRH A;  4DK5 A;  1TN8 A;  3ZIM A;  3CVU A;  5HS0 A;  1H6P A;  3TWR A;  3RIB A;  5A23 A;  4F1S A;  4XEI G;  4B8A A;  2J8S D;  1TNO A;  2P9K G;  4LEU A;  4LER A;  2XQ0 A;  3V2X A;  5D66 A;  3CHQ A;  3BQO A;  4PUC A;  3RJV A;  4CRW A;  4EQF A;  4FUL A;  1FVH A;  2BTD A;  4BWR A;  2MRI A;  2KZT A;  1YMP A;  4URK A;  3T5V A;  3N71 A;  2ZGG A;  3B7R L;  4EZL A;  1RW2 A;  1Z3Y A;  4BET A;  5FQ6 A;  1U2V G;  5LFA A;  4LNG A;  4D10 C;  4OAU C;  3VLF A;  2LNI A;  2JAB A;  3ZFW A;  1E7V A;  4U7E B;  3UM0 A;  3SFY A;  1H2T C;  3ZXP A;  1S0P A;  3JUI A;  5EYP F;  5EIL A;  2WXK A;  3APC A;  4HOR A;  3TWT A;  5M72 A;  4FLH A;  1SZA A;  1FT1 A;  2X6J A;  2PL2 A;  2VGX B;  3Q7F A;  2J9Q A;  5DBK A;  5A7D B;  2VSN A;  4KXK B;  2V4H C;  4DX6 D;  4GPM A;  2VSY A;  2XGM A;  3HXF A;  2C2L A;  2OVF A;  4U95 D;  1QYM A;  3FH8 A;  4XX5 A;  3CGH A;  3Q7A A;  4AIF A;  4Y6W A;  3QWP A;  3I4G A;  1QZ2 A;  3GZ2 A;  1ZB1 A;  2DYS E;  2PQN A;  1LF8 A;  3Q49 B;  3UM1 A;  3PS6 A;  4NQ0 A;  4FHJ A;  3ZYM A;  3E30 A;  5HI7 A;  2GGF A;  4I1O B;  1NFI E;  3CHP A;  3MZL B;  1NL4 A;  2J07 A;  3ONL A;  3FTU A;  3QDN A;  1ELK A;  4GTR A;  3MKQ A;  2ETC A;  2Y3A A;  4UWF A;  3MA5 A;  4Z68 A;  3T9K A;  4EEC A;  2ZXW E;  4UI9 J;  2LXM A;  4UWG A;  4BT8 A;  2V0P A;  3TWU A;  4O1P A;  5FQ8 A;  4ABN A;  2WM9 A;  4TXP A;  4DX5 D;  2ILR A;  5HRY A;  3AG2 E;  1MYO A;  5AAR A;  3Q4A B;  4RG6 A;  3CQG B;  5E76 A;  5B1A E;  1Y8M A;  3FUN A;  3V2O A;  3UT4 A;  3G2W A;  4YND A;  3PZ2 A;  1FVF A;  4UI9 C;  3IKO B;  2VJ8 A;  2DZN A;  4DI4 A;  2WXG A;  4RVB A;  4DUI A;  3FWV A;  2I2O A;  3TJP A;  4DPR A;  4FU3 A;  4AM9 A;  4J7W A;  4G2V A;  4KVO A;  4PS7 A;  5JMN D;  2DCP A;  2XEV A;  3RO2 A;  3S2A A;  1IHG A;  4BX9 A;  4U63 A;  4FJZ A;  4I2Z A;  1BI7 B;  3NOG D;  2MYO A;  1NA0 A;  3B7S A;  5FQ7 A;  3MKR A;  5D2M C;  5LP0 A;  4WNF A;  4GTQ A;  2P9I G;  1V55 E;  5T8I A;  3U66 A;  3KSL A;  1NZN A;  4A55 A;  3D9J A;  2KAT A;  3TWX A;  3Q78 A;  2KCL A;  3DSU A;  4DLQ A;  1UJJ A;  3BEE A;  3QNK A;  3TWW A;  3U3W A;  1G3N B;  2F37 A;  2IU1 A;  5EYL A;  4DX1 A;  2IFU A;  3SHF A;  4ZHB A;  3E32 A;  3B7U X;  3OXG A;  1OY3 D;  1WG0 A;  4G1T A;  5JHA A;  3RRN B;  3OXF A;  3JXI A;  1HG5 A;  2XRY A;  2E2E A;  5AJD A;  4BER A;  2IY0 C;  2GRP B;  4XI9 A;  4AY6 A;  4U8H A;  2V5Q C;  3ZXS A;  1MZC A;  5BV0 A;  2AXV A;  4F1P A;  1ZBP A;  2KCV A;  1MJ0 A;  4J8Y A;  4GCN A;  1UJK A;  1OCC E;  1HFA A;  4UQZ A;  4HRL A;  1S63 A;  1U3C A;  4EZJ A;  5CBO A;  3FU5 A;  3D9O A;  2QY7 A;  5HKP A;  2B6C A;  3MV2 B;  3ULE G;  3HG0 D;  5A6C A;  3FUK A;  1H19 A;  3RU0 A;  5LCW C;  2X6H A;  3TAX A;  2WQH A;  4P29 A;  3IXE A;  4B94 A;  2QC9 A;  3DSV A;  2NC9 A;  3QK0 A;  1SW6 A;  2GW1 A;  2GRM A;  4HOQ A;  1INZ A;  3Q75 A;  3FEX A;  3D9H A;  4FHK A;  1HXI A;  1X81 A;  3K9I A;  2CG2 A;  5ITZ F;  4JVS A;  5KNH D;  3TL5 A;  2BF0 X;  5CCM A;  2R03 A;  3S7F A;  4TUM A;  2FO7 A;  3HXE A;  3D9I A;  5LOZ A;  4N39 A;  3EU5 A;  2WXR A;  3CST A;  3FUI A;  1FPP A;  4G8K A;  3UXG A;  2FF4 A;  3SQV A;  3PUK A;  4XKC A;  2OEW A;  4HOS A;  5ANL A;  3ZHE A;  4GZC A;  5BNW A;  4U0S A;  3APF A;  5FT9 A;  4RQI A;  1KLX A;  2VTB A;  2OOE A;  1N0Q A;  3CVP A;  1TNB A;  5JJ7 A;  2P9S G;  2JEK A;  3PDN A;  3AU4 A;  4HNA D;  1IHB A;  4GZ3 A;  3J5Q B;  4L23 A;  3MJW A;  4AEZ C;  2RKK A;  2PM6 A;  3ZYQ A;  2R02 A;  1ZU2 A;  3CVW A;  2WXQ A;  3PRZ A;  4E85 A;  1XGW A;  1N11 A;  3TG5 A;  1EDU A;  3ASO E;  4APO A;  4ACK A;  4IRU A;  2XEE A;  1TNY A;  2WXN A;  4L2Y A;  3V30 A;  3LY7 A;  3NZU A;  4FJY A;  3AG1 E;  3L13 A;  3PZ3 A;  4M7C A;  4B8C B;  2Y4U A;  4YDO A;  1H6O A;  4X8Q A;  4WWP A;  5ENT D;  3E34 A;  2C0L A;  3UI2 A;  4LCT A;  4TV3 A;  3S7J A;  3ZU7 B;  5ENS D;  4LSZ E;  3T8K A;  4DX2 A;  3DBS A;  3U9W A;  2DIW A;  3D9K A;  5B3S E;  3ULY A;  5BT1 A;  4GYW A;  1OWN A;  4APF A;  3PE4 A;  3LPZ A;  4C9B B;  3Q5M A;  4ANV A;  3E4B A;  4GMR A;  3TWV A;  2FEZ A;  2NXP A;  5FWQ A;  3D3M A;  2ETA A;  4KMO A;  4HXI A;  4WUY A;  3PH0 C;  4AV7 A;  3LEW A;  2FUL A;  1SA4 A;  4U0Z A;  3G2V A;  2QYJ A;  3QJZ A;  4GYY A;  2J4B A;  2NSZ A;  5E75 A;  5ENQ D;  3SZ7 A;  4LUN U;  1K8K G;  3TGO A;  3NOC D;  1O5M A;  5T4Y A;  1IYG A;  4NRH B;  3L22 A;  4K5C A;  4O60 A;  3CK7 A;  1D8E A;  1UOH A;  2YHE A;  2I9C A;  4Q69 A;  2WXI A;  2WXL A;  1W3B A;  3ASH A;  4K0R A;  4GPK A;  2WXO A;  4UI9 K;  2CG3 A;  5T3R A;  3FP3 A;  2UWJ G;  3CHS A;  4MRU A;  2VSX E;  1OWM A;  1TN7 A;  5AAO A;  2J09 A;  1BLX B;  3I3N A;  4PDX A;  4GTV A;  3BG0 B;  3CVQ A;  5CEC B;  4L1B A;  1N94 A;  2KBX A;  2BKK B;  3CVY A;  3AJI A;  1B89 A;  1N9A A;  3DRA A;  3CVX A;  2WXF A;  4CCA A;  5G55 A;  3QAQ A;  4BTA A;  4KT6 B;  3SNX A;  3GYZ A;  3PZ4 A;  5BXU A;  4UUC A;  4HBD A;  1OT8 A;  3FUJ A;  1OCR E;  2ZIS A;  4GML A;  4N2Q A;  3FUL A;  2XGS A;  2HM8 A;  2OND A;  4CEM A;  4U8Y D;  4UWK A;  2LO6 A;  4U8V D;  3KEZ A;  3HDX A;  4U96 D;  4F3V A;  3B7B A;  5FIN A;  3IHV A;  2IOS A;  4IN3 B;  2DYR E;  3ENE A;  3FTV A;  2E0I A;  4Q94 A;  1N95 A;  3SBT B;  3RAU A;  3BU8 A;  2XCB A;  3FTS A;  2IF4 A;  3DEO A;  1QQE A;  3OXL A;  3KS2 A;  3R7R A;  2RFA A;  3EHN A;  4B89 A;  3LS8 A;  1Q2Z A;  3FUE A;  4BX8 A;  2QZA A;  2ZIR A;  3FUH A;  5G04 J;  5ENR D;  1KT1 A;  3LVR E;  3DXM G;  1H2V C;  1IQU A;  2H6H A;  2NYJ A;  3B7T A;  4WNG A;  3FU3 A;  3FY4 A;  2WQ6 A;  1Z5S C;  4B0Z A;  2YHC A;  3CLJ A;  3ML9 A;  1ELW A;  3DEP A;  4HLE A;  2GRO B;  2FBN A;  5ANR A;  2ION A;  1KZP A;  3J5P A;  4I43 A;  4KZC A;  4I6G A;  1E8X A;  4A3V A;  2ZU6 B;  2XCC A;  4NUR A;  4OVU A;  4U07 A;  3OAW A;  4AVX A;  3KSQ A;  1TN6 A;  4CDR A;  5EX3 A;  2L6J A;  4F53 A;  4TXR A;  3NAW A;  3Q9N C;  3FH7 A;  4J8F A;  4DLO A;  4CZ2 D;  1H2U A;  3JYS A;  3I5P A;  4Y6C A;  4I6E A;  2XS1 A;  4JEH A;  3UTM A;  1TR4 A;  1PC2 A;  5FZQ A;  3Q73 A;  4JEU A;  4GU5 A;  3ABL E;  5KBA A;  3NZS A;  2H6F A;  3UT8 A;  2CHW A;  4I9E A;  2HYZ A;  2PZI A;  4BFR A;  5CMW A;  1HX8 A;  3NF1 A;  1U3D A;  4IUL A;  3HXC A;  3KD7 A;  1N54 A;  3LJ3 A;  5KWD A;  2VGX A;  3QB2 A;  2GRL A;  2BUG A;  1JPL A;  3VTY A;  1UN8 A;  3MV3 B;  1PAQ A;  2FI7 A;  4M3O A;  1Z6T A;  4RG9 A;  1E8Y A;  1E90 A;  4I2W A;  4GTP A;  3ZW3 A;  4UQY A;  1K1A A;  1TJF A;  2WXM A;  4ME2 A;  3UKU G;  3ULQ A;  4E6H A;  3CV0 A;  3X2Q E;  5AQB A;  2H6G A;  2WB2 A;  1MX4 A;  3CHO A;  4I1M A;  3C98 A;  3V79 K;  3UUX A;  3HRA A;  3CVV A;  3S7D A;  2R05 A;  3RKV A;  3SF4 A;  1O1S A;  2H6I A;  1HF8 A;  4AJW A;  3L54 A;  3ZUV B;  2P2C P;  5ENP D;  4K5A B;  5HQ8 A;  2RFM A;  2J08 A;  4WAF A;  2LXL A;  3G2U A;  2XHE A;  2PQR A;  3LYA A;  2CFU A;  1K1B A;  2Y69 E;  3FDH A;  1NP7 A;  3LCA A;  3FU6 A;  1OWL A;  2YIN A;  4KYO B;  1XNF A;  2BKG A;  2R17 C;  1BPO A;  3JCK C;  3FUD A;  3ML8 A;  2X38 A;  1JWF A;  3ASN E;  3ASG A;  1IKN D;  3RSE G;  3SBS A;  5G05 J;  5C2Y A;  3MX3 A;  4BEP A;  2P9P G;  3C5R A;  4GMJ A;  5FIO A;  5J90 A;  1A5E A;  5JHB A;  2ZGD A;  2A4Z A;  3VLE A;  3R9M A;  3FTW A;  5CED B;  4DX7 D;  4MS6 A;  4N3C A;  4AXH A;  2WXH A;  4XZ4 A;  1N4Q A;  4AY5 A;  3LJN A;  3JQ0 A;  4JZY A;  4JA9 A;  1E96 B;  2R2L A;  5CER B;  2EQX A;  1OCO E;  3AU5 A;  4WWO A;  1PY1 A;  2DZO A;  4JL0 A;  1JUQ A;  4G8L A;  5BV1 A;  4HOT A;  4ZFH A;  3W9F A;  2PM7 A;  2AXZ A;  4XIF A;  1LD7 A;  3D9N A;  3ABM E;  3UQ3 A;  3PEV B;  2V4L A;  4H7X A;  2XPZ A;  3SY2 A;  4LRZ A;  3SO8 A;  4MKT A;  4GZ5 A;  5AJL A;  2AWI A;  4HQD A;  3C3O A;  2VSO E;  1HE8 A;  4F7A A;  3FTZ A;  3U64 A;  1WAO 1;  4J8D A;  2GRQ B;  3JUE A;  3O48 A;  3DST A;  3SI5 A;  1H6K A;  3ZPJ A;  2IO3 C;  4GA0 A;  1S64 A;  1LTX A;  5AN8 A;  2F0Y A;  3ASD A;  3PNT B;  3V31 A;  2R59 A;  2XRZ A;  2Y0B G;  1UN9 A;  4CGW A;  3U4T A;  3AS8 A;  3NBN B;  3DSS A;  3UT7 A;  2L6B A;  1DCE A;  2KCK A;  2CHZ A;  4J6I A;  3GZ1 A;  3QWV A;  4EBA G;  3LY8 A;  3EIJ A;  4XI0 A;  3LY9 A;  3MYV A;  2WPV A;  2V8S E;  4C48 B;  3HVE B;  3Q9U C;  2VYI A;  4GTT A;  3NB2 A;  2OCC E;  2OVB A;  3AS4 A;  1V54 E;  4QFV A;  5ARF A;  4GA2 A;  1N52 A;  3TG4 A;  5CRV A;  4N3A A;  2LAH A;  4OYS A;  5B1B E;  2AXU A;  2I1J A;  4BY6 A;  2Y4T A;  3RK6 A;  3ZGQ A;  2QYU A;  3ZEF A;  2EIK E;  4HRN A;  3FUM A;  5CRU A;  5AQA A;  3CVN A;  3KEA A;  4LNB A;  1MX2 A;  2EIL E;  2P9N G;  4HB5 A;  1IQR A;  1SZ9 A;  2F8X K;  1X5B A;  2WQ7 A;  1Y6I A;  3EIQ C;  4J8S A;  4CDN A;  1OCZ E;  3L6A A;  2WXJ A;  3C3Q A;  5JJ6 A;  5FZR A;  5CMY A;  4KBQ A;  4U0U A;  3CIA A;  5C1D A;  4A63 B;  3FU0 A;  3UIO C;  5ENN A;  3UM3 A;  3PEU B;  4G23 A;  3S7B A;  2HE0 A;  1HZ4 A;  3DWL G;  1AWC B;  3UKR G;  4LNU D;  2X6F A;  2DBA A;  4ACL A;  4HFG A;  5ENO D;  2LSV A;  4Q96 A;  2IEJ A;  3Q47 B;  1HO8 A;  3W9G A;  4GB9 A;  3LDZ A;  3D9L A;  3HIZ A;  4CYM D;  4AP2 A;  2XGO A;  1JCR A;  1S70 B;  1JCQ A;  4NAC A;  3G2T A;  2CFZ A;  4C0E A;  4CGV A;  3GZS A;  4AOF A;  4K03 A;  3FFL A;  1KT0 A;  4OAV B;  1WY6 A;  3JQ1 A;  2YNQ A;  2XEN A;  4J0U A;  5KCM A;  3QKY A;  4H7Y A;  5CHE E;  2EIN E;  3CK8 A;  3HVE A;  4YVO A;  5JA4 D;  2VGY A;  2DVW A;  3SFZ A;  1BD8 A;  1SVX A;  1HH8 A;  2WMN A;  1OWO A;  4HVB A;  4GCO A;  3UIP C;  3VTX A;  2Y1L E;  4KVM A;  4G24 A;  4CT4 A;  1ELR A;  1E8Z A;  2Q7F A;  1KPS B;  3TWQ A;  5DIZ A;  4FC8 A;  1TNU A;  1IXV A;  3FTX A;  3PUJ A;  2YQ8 A;  5EKQ D;  5CBN A;  4UQX A;  3UPV A;  4XE0 A;  3CKB A;  5KJK A;  2AJA A;  4F6R D;  4IYP A;  1YYH A;  2F8Y A;  4I9C A;  3OTN A;  2WXP A;  2EIJ E;  4HI9 A;  1HS6 A;  3ZVV A;  2MHK A;  3P2B A;  2FO1 E;  4TXQ A;  5LX8 A;  3IBE A;  5CEA A;  5EDS A;  2J49 A;  5FJY A;  3CHM A;  3EUV A;  4BES A;  1EPU A;  3D9P A;  3UX4 A;  4GA1 A;  5BW8 C;  4I1A A;  3C3R A;  4A3T A;  1L5J A;  2X3M A;  2MOW A;  4BT9 A;  1OWP A;  3FH5 A;  1UW4 B;  3E33 A;  4UWH A;  4O1O A;  2L0T B;  2LAI A;  4YDY A;  2P9L G;  4G11 A;  4JXT A;  3LVQ E;  5FQ4 A;  3UMV A;  4BSZ B;  2HO1 A;  2L9B A;  4YVQ C;  5BPP A;  2XPY A; 
#chains in the Genus database with same CATH homology
 4V3I A;  3TXN A;  4FLB A;  4ANW A;  3RKV A;  3ZRH A;  1H0A A;  4JHJ A;  2JEK A;  3PDN A;  4ILH B;  5G04 C;  3SF4 A;  3AU4 A;  4AJW A;  1HF8 A;  4DK5 A;  2C0M A;  3L54 A;  3ZIM A;  3CVU A;  4G26 A;  3I4R B;  4GZ6 A;  3RIB A;  2LSU A;  4GZ3 A;  5HQ8 A;  5A23 A;  2HR2 A;  4L23 A;  4F1S A;  2J08 A;  4B8A A;  4WAF A;  3G2U A;  3MJW A;  2XPI A;  2XHE A;  2PQR A;  3LYA A;  2CFU A;  4GAA A;  4AEZ C;  4LEU A;  2PM6 A;  3ZYQ A;  3L17 A;  3IEG A;  4LER A;  3FDH A;  2XQ0 A;  1ZU2 A;  4WNE A;  1NP7 A;  3LCA A;  3FU6 A;  3ESK A;  3PE3 A;  1OWL A;  3CHQ A;  3CVW A;  2WXQ A;  2YIN A;  4KYO B;  4PUC A;  1VDY A;  1XNF A;  3PRZ A;  4E85 A;  1XGW A;  2R17 C;  1BPO A;  3JCK C;  3RJV A;  4JW1 A;  4CRW A;  1OUV A;  3PNL B;  3TG5 A;  1EDU A;  4APO A;  3FUD A;  4ACK A;  3ML8 A;  4EQF A;  4IRU A;  2X38 A;  4FUL A;  1JWF A;  1FVH A;  2BTD A;  3CK9 A;  3ASG A;  4BWR A;  2MRI A;  3SBS A;  2KZT A;  2WXN A;  2V5F A;  5G05 J;  3MX3 A;  5C2Y A;  4L2Y A;  4GMJ A;  4URK A;  3LY7 A;  4PS3 A;  5J90 A;  3R9A B;  2IOL A;  5JHB A;  2A4Z A;  3NZU A;  3VLE A;  3T5V A;  3N71 A;  1P5Q A;  3MGB A;  3FTW A;  3B7R L;  2UY1 B;  4FJY A;  5FTP A;  4EZL A;  3L13 A;  4MS6 A;  4N3C A;  4AXH A;  1Z3Y A;  1FCH A;  2WXH A;  2Y4U A;  4B8C B;  4XZ4 A;  4AY5 A;  5FQ6 A;  5LFA A;  4C0M A;  3JQ0 A;  4D10 C;  4WWP A;  4JZY A;  3VLF A;  1DNP A;  3CKC A;  4EZK A;  2LNI A;  3FHE A;  4JA9 A;  3ZFW A;  1E7V A;  2I6H A;  1E96 B;  3RRM B;  2C0L A;  1YA0 A;  4LCT A;  4L2L A;  4TV3 A;  2EQX A;  4J8E A;  3S7J A;  3AU5 A;  1H2T C;  4WWO A;  1PY1 A;  1S0P A;  2JLB A;  4JL0 A;  1JUQ A;  3JUI A;  3DBS A;  3U9W A;  5BV1 A;  4HOT A;  2WXK A;  2DIW A;  3D9K A;  2PM7 A;  2AXZ A;  4XIF A;  3APC A;  3ZN3 A;  5BT1 A;  4HOR A;  3D9N A;  5M72 A;  4FLH A;  4GYW A;  1SZA A;  3UQ3 A;  1OWN A;  2X6J A;  2PL2 A;  2VGX B;  3PEV B;  4APF A;  2J9Q A;  3PE4 A;  5DBK A;  3LPZ A;  5A7D B;  2V4L A;  2VSN A;  3EJN A;  4H7X A;  4C9B B;  4KXK B;  5KJN A;  3Q5M A;  3QOU A;  2XPZ A;  2VSY A;  4LRZ A;  3URZ A;  4ANV A;  2XGM A;  2QFC A;  3E4B A;  4MKT A;  4GZ5 A;  5JJT A;  2C2L A;  5AJL A;  2OVF A;  2AWI A;  2FEZ A;  4ATG A;  2NXP A;  5FWQ A;  3D3M A;  3FH8 A;  4KMO A;  2AW6 A;  3ASF A;  4RSY A;  3GW4 A;  2AVP A;  4HXI A;  4WUY A;  3PH0 C;  4AV7 A;  4XX5 A;  3CGH A;  3ONK A;  4JHK A;  4ANX A;  2VSO E;  1HE8 A;  3LEW A;  4AIF A;  4DPR A;  4F7A A;  2FUL A;  4L7T A;  3QWP A;  4Y6W A;  3I4G A;  1QZ2 A;  3GZ2 A;  3FTZ A;  5FZS A;  4U0Z A;  3G2V A;  2PQN A;  1LF8 A;  3U64 A;  3QJZ A;  4GYY A;  2J4B A;  2NSZ A;  3Q49 B;  4KZ0 A;  3PS6 A;  1WAO 1;  4NQ0 A;  4FHJ A;  4J8D A;  5E75 A;  3ZYM A;  4O6F A;  5HI7 A;  3O48 A;  3SZ7 A;  3L16 A;  3SI5 A;  3TXM A;  2GGF A;  4LUN U;  3ZHE B;  4I1O B;  3TGO A;  3CHP A;  3MZL B;  1H6K A;  3ESL A;  2KC7 A;  5KJL A;  2J07 A;  3ZPJ A;  3ONL A;  5T4Y A;  3HHM A;  1IYG A;  4NRH B;  3FTU A;  3L22 A;  3QDN A;  1ELK A;  2J4D A;  4GA0 A;  3CK7 A;  2VTB B;  3MKQ A;  5BUZ A;  4U04 A;  2YHE A;  2I9C A;  4HS2 A;  3ASD A;  3PNT B;  2Y3A A;  2WXI A;  4Q69 A;  2WXL A;  4UWF A;  1W3B A;  3ASH A;  3MA5 A;  2R59 A;  4EEC A;  2XRZ A;  4K0R A;  4GPK A;  1UN9 A;  2WXO A;  4UI9 K;  4CGW A;  3G2S A;  2CG3 A;  3AS8 A;  3U4T A;  4CT0 A;  4UI9 J;  2X6I A;  4UWG A;  5T3R A;  3R7Q A;  4BT8 A;  3FP3 A;  3UT7 A;  2UWJ G;  3CHS A;  4JA7 A;  4MRU A;  2VSX E;  1MHQ A;  2V0P A;  1OWM A;  4DJA A;  2KCK A;  4UWL A;  2CHZ A;  5FQ8 A;  4ABN A;  4J6I A;  2WM9 A;  3GZ1 A;  3QWV A;  2J09 A;  4EBA G;  2ILR A;  3LY8 A;  4MLP A;  3I3N A;  5LCW J;  3EIJ A;  4N3B A;  4JPS A;  4PDX A;  3Q4A B;  3BG0 B;  4XI0 A;  4GZD A;  3CVQ A;  3LY9 A;  4OVV A;  4RG6 A;  4L1B A;  3MYV A;  2WPV A;  3CQG B;  5E76 A;  2V8S E;  1Y8M A;  3CVY A;  2L0I A;  3HVE B;  2VYI A;  2VQ2 A;  3T5X A;  3FUN A;  3LKU A;  2OVB A;  1B89 A;  3AS4 A;  4QFV A;  3UT4 A;  3G2W A;  3CVX A;  2WXF A;  5ARF A;  4GA2 A;  4CCA A;  2IJG X;  4YND A;  5G55 A;  3QAQ A;  1N52 A;  4BTA A;  4KT6 B;  1FVF A;  3BG1 B;  4UI9 C;  3SNX A;  3GYZ A;  4ANU A;  3TG4 A;  3IKO B;  4N3A A;  3T8M A;  2VJ8 A;  3QWW A;  2LAH A;  3FUJ A;  4OYS A;  2AXU A;  2I1J A;  4BY6 A;  4GML A;  4PS8 A;  4R7L A;  2Y4T A;  3RK6 A;  4DI4 A;  2UY1 A;  2WMO A;  4N2Q A;  3FUL A;  2XGS A;  3PZD A;  2HM8 A;  2WXG A;  4RVB A;  3FWV A;  2I2O A;  3ZGQ A;  4DI3 A;  1UG3 A;  3TJP A;  2P58 C;  2OND A;  4CEM A;  3ZEF A;  4TUU A;  1SQM A;  4FU3 A;  2M63 A;  3MCX A;  2LO6 A;  4G25 A;  4UWK A;  4AM9 A;  4A1G A;  4G2V A;  1GW6 A;  3KEZ A;  3HDX A;  3RRU A;  3FUM A;  4F3V A;  5G05 C;  4KVO A;  4PS7 A;  2DCP A;  3IHV A;  2IOS A;  4IN3 B;  4CDM A;  3ENE A;  2XEV A;  3P1U A;  3CVN A;  3RO2 A;  3FTV A;  4I6J A;  2E0I A;  2I1K A;  4Q94 A;  3S2A A;  1IHG A;  3SBT B;  4A1S A;  4BTB A;  4BX9 A;  4U63 A;  1HU3 A;  2XCB A;  4FJZ A;  4I2Z A;  1IQR A;  1TEZ A;  3FTS A;  1HG2 A;  1SZ9 A;  1NA0 A;  1X5B A;  3B7S A;  3ZYK A;  2WQ7 A;  5FQ7 A;  2IF4 A;  3MKR A;  1Y6I A;  3FUF A;  3EIQ C;  5LP0 A;  4WNF A;  5ARG A;  1QQE A;  4J8S A;  5T8I A;  3OXL A;  3KS2 A;  3U66 A;  3R7R A;  4CDN A;  1NZN A;  4A55 A;  3D9J A;  5J08 A;  2R5S A;  3L6A A;  2WXJ A;  3EHN A;  2X6K A;  2KAT A;  4B89 A;  3KAE A;  5JJ6 A;  3LS8 A;  2KCL A;  5FZR A;  5CMY A;  4I17 A;  2WVI A;  4JC8 A;  4KBQ A;  4DLQ A;  3FUE A;  4U0U A;  4BX8 A;  3B13 A;  1UJJ A;  3CIA A;  5C1D A;  3BEE A;  3QNK A;  3U3W A;  3FU0 A;  4WND A;  5ENN A;  3FUH A;  4WWN A;  2IU1 A;  1KT1 A;  5G04 J;  3LVR E;  3PEU B;  3EDT B;  4G23 A;  3S7B A;  4FP7 A;  1H2V C;  1IQU A;  2IFU A;  3B7T A;  4N5C A;  3SHF A;  1HZ4 A;  4WNG A;  3B7U X;  2X6F A;  1A17 A;  2DBA A;  3FU3 A;  3OXG A;  4JHR A;  3SGH A;  3FY4 A;  4N2S A;  4ACL A;  3FTY A;  4HFG A;  2WQ6 A;  4G1T A;  3QC1 A;  2LSV A;  4W9R A;  4Q96 A;  5JHA A;  3Q47 B;  3CHR A;  3RRN B;  1HO8 A;  4B0Z A;  2YHC A;  4GB9 A;  3CLJ A;  3LDZ A;  3ML9 A;  1ELW A;  3D9L A;  3OXF A;  3PRE A;  4HLE A;  1HG5 A;  3HIZ A;  2XRY A;  2FBN A;  5ANR A;  2ION A;  3PVL A;  2E2E A;  1MQS A;  2XGO A;  5AJD A;  4AP2 A;  3IHY A;  4I43 A;  4KZC A;  5D0O D;  4I6G A;  4XI9 A;  4AY6 A;  1E8X A;  3LXU X;  4U8H A;  4NAC A;  3G2T A;  4A3V A;  5D0Q D;  3ZXS A;  2RD0 A;  5BV0 A;  2ZU6 B;  2AXV A;  2CFZ A;  2XCC A;  4C0E A;  4NUR A;  4CGV A;  3GZS A;  4OVU A;  4U07 A;  3OAW A;  4AOF A;  4K03 A;  4AVX A;  3FFL A;  1ZBP A;  1KT0 A;  2KCV A;  1WY6 A;  3JQ1 A;  5AEN A;  2OV8 A;  2YNQ A;  4GCN A;  3WXX A;  4CDR A;  4J0U A;  5KCM A;  5EX3 A;  1UJK A;  2L6J A;  3Q15 A;  4F53 A;  1HFA A;  3QKY A;  4UQZ A;  4BSX A;  3CVL A;  3CSF A;  4H7Y A;  5CHE E;  3DPD A;  3CK8 A;  3EHM A;  3CEQ A;  3HVE A;  1U3C A;  4YVO A;  3FH7 A;  2KZT B;  2VGY A;  4EZJ A;  4J8F A;  3SFZ A;  2WMN A;  3MEK A;  1HH8 A;  3FU5 A;  4DLO A;  3D9O A;  1JWG A;  4EPZ A;  1H2U A;  3JYS A;  1OWO A;  3I5P A;  4Y6C A;  4HVB A;  2QY7 A;  4GCO A;  3MV2 B;  3VTX A;  3D9M A;  4KVM A;  4G24 A;  5A6C A;  4I6E A;  4CT4 A;  1ELR A;  3FUK A;  3AS5 A;  1H19 A;  3RU0 A;  4JEH A;  1E8Z A;  2Q7F A;  4GYO A;  5LCW C;  2X6H A;  3TAX A;  4FAD A;  1PC2 A;  2WQH A;  4P29 A;  4B94 A;  5FZQ A;  5DIZ A;  5CCL A;  4JEU A;  4FC8 A;  3FTX A;  3PUJ A;  4GU5 A;  2NC9 A;  2YQ8 A;  3QK0 A;  5EKQ D;  4UQX A;  3HYM B;  2GW1 A;  3UPV A;  1EYH A;  2GRM A;  1E8W A;  3NZS A;  3UT8 A;  4XE0 A;  3CKB A;  2CHW A;  4I9E A;  2HYZ A;  2PZI A;  4HOQ A;  4ILG A;  4BFR A;  5KJK A;  1INZ A;  5CMW A;  1HX8 A;  3NF1 A;  2RG8 A;  3FEX A;  1U3D A;  4IUL A;  4IYP A;  3KD7 A;  4TRQ A;  3VLD A;  1N54 A;  4FHK A;  3FEY A;  4I9C A;  5AYW D;  3OTN A;  2WXP A;  1HXI A;  3LJ3 A;  3QAR A;  1HS6 A;  3ZVV A;  1TJC A;  3ZYL A;  2MHK A;  3P2B A;  2VGX A;  3QB2 A;  2GRL A;  2BUG A;  1JPL A;  4FA6 A;  1DVP A;  5LX8 A;  3K9I A;  2IQC A;  3NQP A;  3VTY A;  3IBE A;  5G2N A;  2CG2 A;  5EDS A;  2J49 A;  1UN8 A;  5FJY A;  3MV3 B;  3SD5 A;  3CHM A;  4JVS A;  1PAQ A;  4XKB A;  4EBA A;  3TL5 A;  2FI7 A;  4M3O A;  1Z6T A;  2BF0 X;  5CCM A;  1EPU A;  4RG9 A;  3S7F A;  1E8Y A;  1WM5 A;  3D9P A;  2FO7 A;  3APD A;  1E90 A;  4I2W A;  3UX4 A;  1E7U A;  4GA1 A;  3D9I A;  5LOZ A;  4ILI A;  3ZW3 A;  5BW8 C;  1Z3X A;  4UQY A;  4I1A A;  3RO3 A;  4N39 A;  4A3T A;  1L5J A;  2WXR A;  3CST A;  2X3M A;  4HOU A;  3IV0 A;  2MOW A;  4BT9 A;  3FUI A;  1OWP A;  1TJF A;  5KJM A;  2CHX A;  3FH5 A;  1UW4 B;  2FF4 A;  1NA3 A;  3PUK A;  2WXM A;  4UWH A;  1EF1 C;  2L0T B;  3L08 A;  4XKC A;  2LAI A;  4ME2 A;  3ULQ A;  5ANL A;  4HOS A;  1QNF A;  4PH4 B;  3ZHE A;  4GZC A;  4E6H A;  5BNW A;  3CV0 A;  4U0S A;  3APF A;  4G11 A;  4JXT A;  3LVQ E;  5FQ4 A;  3UMV A;  3CQC B;  5FT9 A;  2A5U A;  2HO1 A;  2WB2 A;  2L9B A;  1KLX A;  5EX0 A;  2VTB A;  2KM4 A;  2OOE A;  3CHO A;  3CVP A;  3C98 A;  4I1M A;  4YVQ C;  3MKQ B;  3O4Z A;  5BPP A;  3CR3 A;  3UUX A;  5JJ7 A;  5AIJ A;  3CVV A;  2XPY A;  3S7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...