3C3QA

Alix bro1-domain:chmip4b co-crystal structure
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
357
Chain Sequence
ATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ALIX-CHMP4 interactions in the human ESCRT pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Programmed cell death 6-interacting protein
total genus 118
structure length 357
sequence length 357
ec nomenclature
pdb deposition date 2008-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3c3qA00
3RAUA 3UM2A 3C3OA 3ULYA 2OEWA 3UM3A 3ZXPA 1ZB1A 2R02A 3UM1A 2XS1A 5CRVA 3C3QA 2R05A 2R03A 2OEVA 3UM0A 3C3RA 3R9MA 2XS8A 5CRUA
chains in the Genus database with same CATH superfamily
2XCCA 5BW8C 3RKVA 3ZU7B 5ENSD 2AWIA 4QFVA 3SQVA 4K5BA 2VYIA 3LEWA 4G24A 4LRZA 4JA9A 3TXMA 3ZFWA 1BD8A 3Q7AA 2B0OE 5M72A 3KAEA 5A6CA 4HRLA 2DBAA 3C3OA 2I9CA 4URKA 5AAOA 3KD7A 1Q2ZA 5ANLA 5AQAA 3EJNA 4HLEA 4GU5A 3D9LA 3RJVA 3L17A 2KBXA 3LDZA 1LD8A 2VSOE 3MKRA 3PUJA 4G8LA 1TNUA 2R05A 2DVWA 1OCRE 5KWDA 4QQIA 3MJWA 1UJKA 2R5SA 4BTAA 5AQBA 4EZJA 4WNGA 4CDRA 3B7SA 1B89A 1S63A 4AIFA 2DZOA 3MV3B 4XIFA 4U0UA 4U8HA 4DUIA 1TR4A 1H6PA 3G2SA 1OCCE 3RO2A 4AJWA 3SGHA 4DX5D 2OCCE 2RFMA 3EHMA 3PZ3A 3APCA 2L6BA 3NOGD 4AY5A 1LTXA 4APOA 2FULA 5JJTA 2LAHA 4E6HA 3ISMC 3BG1B 4GA2A 3ZHEA 1S64A 2L6JA 3UT4A 3FTUA 1JWFA 2X6HA 3GZSA 2OVFA 2XS8A 1X5BA 1Z5SC 1IKND 5EN5D 3E33A 2X6KA 4HS2A 4U0ZA 5AARA 2GRNB 3PZ1A 2VSYA 3Q7FA 3R7QA 3TWUA 1DNPA 4XKCA 4BEPA 3GZ1A 3CEQA 3Q47B 1E96B 3R9MA 5KBAA 4GTTA 2ETAA 3Q9NC 2NYJA 1E8XA 4N5CA 3FEYA 4HXIA 1NA3A 3U9WA 4CDNA 2J8SD 3IXEA 3CHMA 3CHRA 4KMOA 3FUJA 3SFXA 3NB2A 3CVXA 3C3RA 5ITZF 3UXGA 3LXUX 3TWXA 4C0MA 5FQ6A 3HXFA 3ZHEB 1Z6TA 1K3ZD 4UQXA 2VGEA 4GZ6A 3HXEA 1U3CA 4KYOB 3W9GA 4LSZE 4FJZA 4AY6A 4JW1A 3DWLG 5CCMA 4N5QA 3TJPA 3PNTB 2H6HA 2F8XK 4GB9A 2YQ8A 5BV0A 2WQHA 5T3RA 2BF0X 3VTYA 4HOQA 4DJAA 4U0SA 4GMLA 4GZCA 4JL0A 3KSLA 1OXJA 1MX4A 4FU3A 3ML8A 3ML9A 3B7BA 4H7XA 1SA4A 2XPYA 4L2LA 3ZNGA 1TNOA 3LVQE 4UUCA 4A55A 4O6FA 5CERB 3B7UX 3LCAA 5IY5E 4K5CA 2LXMA 2I6HA 2CHZA 4I17A 2Y1LE 3EIJA 4GZ3A 1FT2A 2I2OA 3UKUG 4U8YD 3PZ4A 4WWNA 4BSZB 1HZ4A 2VSNA 2QY7A 2XS1A 4EECA 4UQZA 3CK7A 2C0LA 3AU5A 3ZRHA 3TWRA 3CVYA 1UN8A 3EIQC 4YDYA 5EKQD 2WVIA 3PH0C 3Q49B 2VSXE 2DZNA 1S70B 1HG5A 4LERA 4DRXE 5CEAA 3U3WA 2VTBB 3MEKA 3UM3A 1Y6IA 1OWOA 3Q9UC 3MKQA 3I4GA 4LUNU 2V8SE 1WM5A 2DYRE 1LD7A 4WUYA 1PY1A 2X6JA 3HRAA 1TN7A 4HLLA 3V2OA 4HNAD 4J7WA 4EZKA 2MYOA 2FO7A 1WG0A 5CBOA 4KT6B 3FUNA 2FI7A 3G2WA 2ZU6B 1IHGA 1JCQA 2VQ2A 2WXIA 1QYMA 3SD5A 2FEZA 4KZ0A 3UT8A 2XGSA 2A5UA 3ZYKA 4TV3A 4DI3A 4I1OB 1EDUA 3JUIA 3L54A 5ANRA 4GTOA 3L22A 4I9EA 4ANVA 4NIKA 3QC1A 1UN9A 1H6OA 1MYOA 2BKGA 4FHKA 1KPSB 3R7RA 3D9PA 3PUKA 4B93B 1RW2A 3HXBA 2GRRB 2C2LA 3TL5A 3E30A 2EQXA 2NC9A 2L0TB 4ANXA 1E90A 3AG4E 1N4SA 2VTBA 4B8AA 5D0OD 3RRMB 3MKQB 2A4ZA 5AJDA 2WQ6A 4DI4A 1H2TC 3PRZA 3KS2A 2YINA 4UWGA 3FULA 2H6IA 4BFRA 3JQ0A 3FDHA 2XCBA 2DIWA 4PUCA 2GRPB 4AV7A 3FTXA 4N2QA 4BT9A 1O5MA 5EX3A 4CCAA 3FFLA 3OXLA 1AP7A 3FTYA 1IXVA 3T5VA 4J8DA 4FHJA 4C48B 4ATZD 4BSXA 3L08A 1KZPA 3D9MA 3QNKA 2C0MA 4ANUA 4ILGA 3CKCA 4MLPA 3P1UA 5KJMA 5FTPA 3UM0A 5ENQD 2LUHA 2EIJE 1N4QA 4OVUA 2P9UG 3FUFA 3Q15A 3UIPC 3CVQA 2XRZA 4U8VD 2BUGA 3QB2A 3Q79A 3ZW3A 2DWZA 1H6KA 3CVNA 2WM9A 1TNBA 4BETA 3FTVA 2OOEA 4XEIG 3EHQA 1QNFA 2ETCA 2WXOA 3DXMG 2LAIA 2XEHA 3ZKJA 1N4RA 2F0YA 3IHYA 2OEVA 4RSYA 3FUEA 2XGMA 3E4BA 4HOSA 2HE0A 1UOHA 4CT4A 5AYWD 3JQ1A 2BEDA 4U63A 3AAAC 3PS6A 1EYHA 4J8YA 4L1BA 4U96D 3ABKE 3T5XA 1WY6A 3V2XA 2XRYA 5KJKA 4Y6WA 5CBNA 4O1OA 2WXLA 2V0PA 4XX5A 3E34A 2ZIRA 1JCSA 3CVWA 4BESA 2I1JA 3HG0D 2Y3AA 3AS5A 4ANWA 5B1BE 3MV2B 5CEDB 3V79K 5EYPF 5CECB 5ENRD 4K03A 4EBAA 4Y6CA 2XPZA 1K1BA 3DXKG 4A1SA 2OVBA 3CK9A 4G8KA 3CLJA 3FTWA 5LFAA 1IQUA 4JHJA 1A5EA 3B95A 1ELKA 1TYQG 3AS8A 2Y4TA 1JCRA 1AWCB 2IOSA 1BI8B 3IV0A 2VGYA 2ZGDA 5FZQA 3SHFA 3IEGA 4CGVA 3UKRG 4GZDA 1K1AA 4KZCA 1H2VC 2IJGX 2AW6A 1WDYA 2IF4A 3B13A 3UM1A 3S7JA 1OT8A 3KEZA 2KCLA 5DBKA 5D66A 3WG7E 3C5RA 2UWJG 4GA0A 5FQ7A 2E0IA 1KLXA 3HYMB 3MGBA 5J08A 3UM2A 4ILHB 2XQ0A 1DCQA 4G11A 1A17A 3ZXPA 2V5FA 1SA5A 1X81A 2XHEA 3CHQA 5CRVA 3LS8A 4Q94A 3G2UA 2J07A 3P2BA 4MKTA 4JB8P 4OAVB 3R9AB 2IFUA 4KBQA 4DLQA 2IQCA 3LY9A 3RK6A 3TWWA 4RG9A 2LXLA 1KZOA 5A7DB 4OAUC 2XGOA 2A5EA 2CG3A 5T4YA 4FULA 2PQRA 4HB5A 3EU9A 2RD0A 4JPSA 5D0QD 2V4LA 2MHKA 3U64A 2IO2C 3QDNA 3MX3A 4U04A 4L2YA 4I2WA 4XZ4A 1HF8A 2ILRA 2PZIA 1IHBA 2WXMA 4UI9C 4YVQC 3DSSA 2KCVA 4M7CA 4NQ0A 3FUKA 2XEEA 1KT0A 3J5QB 1OWPA 2HYZA 3L9TA 5H7PA 3C98A 4I1MA 2FO1E 4BTBA 4IRUA 3FHEA 5J90A 1UG3A 5FQ4A 2KATA 4DLOA 1BLXB 1P5QA 1TJFA 5AJLA 3MZLB 4MBGA 4GYOA 3ZYMA 2P9KG 3UMVA 3DSVA 3HDXA 4RLYA 4P29A 1U3DA 1Y8MA 3ASFA 3SO8A 3GYZA 3HIZA 1MQSA 3IBEA 4I6GA 2FF4A 2CFZA 1OCZE 3NBNB 3CK8A 3NOCD 5ENOD 2ZXWE 2WXQA 3PZ2A 5BNWA 5EYLA 3UIOC 4A3TA 4CRWA 3Q73A 5JHBA 2Y0BG 2J49A 4R7LA 5T8IA 3DSUA 3G2VA 5B3SE 1W3BA 3E37A 3J5PA 3HXCA 1OUVA 2BKKB 3PZDA 4MRUA 2PM7A 3CHOA 4AOFA 4ACKA 4FLHA 4XI9A 3AG3E 1JPLA 3APFA 3QWVA 3CR3A 3UPVA 3ONKA 2KXPC 3GW4A 4LCTA 3TWQA 3OAWA 5AQ7A 2PM6A 1PAQA 1NZNA 3O4ZA 2IU1A 1NI1A 1YA0A 3TXNA 3LY8A 4LNUD 1FPPA 1TNYA 1INZA 4TUUA 5FIOA 4DX7D 4GMRA 3FTSA 4B89A 5BXOA 5JMND 3QAQA 2L9BA 3UINC 4GCOA 1N52A 3JCKC 3JUEA 3PDNA 4LNBA 5ENNA 3BUAA 3ZGQA 3LJ3A 3MCXA 4NURA 4WAFA 3Q5MA 2OEWA 3UT7A 4TXQA 3ZUVB 4YVOA 5AQ9A 1YYHA 2J4DA 4HFGA 5G04C 5JJ6A 2PQNA 5G55A 3FUMA 1LF8A 3FWVA 5BXUA 3TGOA 2EIKE 1MJ0A 1ZB1A 2IONA 2M63A 4JEHA 3UX4A 5JJ7A 4HVBA 5E75A 4O1PA 2E2EA 4PDXA 4NRHB 4YDEA 2UY1B 4ZHBA 1E8ZA 1YMPA 2KZTB 3FH5A 3S2AA 4BX8A 2P9IG 4L23A 3RIBA 4Q96A 3CKBA 4G1TA 2IEJA 1ZBPA 3CHSA 4MS6A 3CSFA 4EHMA 2PL2A 2GRLA 4F53A 5CHEE 3S7BA 1HE8A 3V31A 4DK5A 3L6AA 4U07A 5EIBE 1TNZA 3E32A 1NP7A 2WXKA 2X3MA 4J8FA 3ULQA 1DCEA 3QK0A 5KNHD 3DPYA 2R03A 4GPMA 2P9LG 2AVPA 3PE4A 2P2CP 2DCPA 1U2VG 3AJIA 3OTNA 2AXUA 3D3MA 4UI9K 1FT1A 4IULA 3ONLA 4ILIA 1QQEA 3UUXA 3ULYA 3FUDA 4G2VA 1NL4A 1N0RA 2UY1A 2R2LA 5DIZA 2KZTA 2NXPA 1SZAA 5CCLA 2XZTG 3ASHA 3KEAA 1YCSB 4GTPA 1N9AA 4RG6A 2WMOA 4W9RA 4WWPA 4JXTA 3LVRE 2HM8A 2GW1A 4B0ZA 3ESKA 4GTRA 5BUZA 4I6EA 3G2TA 2XENA 2I1KA 2P9NG 3S7DA 4BWRA 3UQ3A 4LNGA 4TXPA 3FU0A 4AEZC 5C1DA 2Q7FA 4ZFHA 3LY7A 4PS3A 4J8EA 1IYGA 4A63B 4OYSA 3DBSA 2EINE 3ZYLA 3T9KA 3QWPA 4JD2G 5EDSA 3RSEG 1D8EA 4BERA 4OVVA 1MHQA 3URZA 3CVPA 1VDYA 5FQ8A 1H2UA 1BI7B 2GRQB 4GTMA 3SY2A 4F6RD 3SZ7A 4M3OA 2H6GA 3EUVA 3AU4A 5BPPA 5KJNA 5G04J 4ABNA 3W9FA 1SW6A 4ATGA 3F6QA 1TN8A 2P9PG 3C3QA 4WNFA 5LOZA 2WMNA 4RVBA 3ZN3A 2YHEA 5A23A 4WNEA 2LNIA 2H6FA 4CT0A 3D9NA 3B7TA 3HXDA 5G2NA 1K8KG 5EILA 5CMWA 5HQ8A 2BTDA 3T8KA 4BT8A 3I5PA 4U7EB 5AENA 1D9SA 4DPRA 1O1RA 5ENPD 2ZGGA 4AP2A 2P9SG 4LEUA 2AJAA 3D9OA 4GYWA 3WXXA 2JEKA 3GZ2A 5KCMA 4HI9A 4N3BA 4I1AA 3UTMA 1BU9A 3O48A 4EZLA 3BG0B 3TWVA 2QFCA 4G23A 3K9IA 4UQYA 1MX2A 1L5JA 4CEMA 1D8DA 4F1PA 5EIDA 3QKYA 4IYPA 4FJYA 3Q4AB 3FH8A 1TJCA 1DC2A 4B8CB 2X38A 4GZ5A 4WNDA 5D2MC 1TEZA 3ULEG 1Z3YA 4IN3B 4AM9A 3FUHA 1E7UA 3IHVA 3DPDA 3D9HA 3CIAA 4HQDA 4N3CA 2HR2A 4GYYA 2KC7A 3V30A 2WXFA 3QWWA 3KSQA 5HI7A 4YDOA 4J6IA 3ASGA 3QARA 5FZSA 2B6CA 2KM4A 3NZSA 5G05J 3PEVB 4KXKB 2WXRA 5HKPA 2DYSE 3DSWA 4BY6A 2YNQA 4A3VA 3FU6A 3EHRA 2J4BA 2L0IA 3MYVA 4XKBA 1UW4B 2CHXA 3DSXA 3QJZA 4G25A 2IOLA 3D9IA 4I43A 1JWGA 3RAUA 1XNFA 3EU5A 3JYSA 4JZYA 3L82A 2R02A 2WPVA 3VLEA 3VLDA 3SFYA 1HG2A 3EDTB 4PS7A 1O1TA 3SI5A 2IY0C 2LO6A 4KVMA 1N4PA 4AVXA 5LP0A 4CZ2D 2XEVA 1FVFA 4FC8A 5FZRA 1NA0A 3TWTA 5LCWJ 3VTXA 4I6JA 4DX2A 1EPUA 4Z68A 1HO8A 3JXJA 2JABA 4GMJA 1N95A 2XPIA 4H7YA 3ENEA 3MA5A 3UI2A 2HO1A 2ZISA 4YDWA 4HI8A 4UI9J 4I9CA 3I3NA 4C0EA 4F7AA 4HRNA 3VLFA 3CQGB 5LX8A 4F1SA 3FU3A 2WXNA 3BQOA 2YHCA 2LSVA 4V3IA 3TG4A 3SF4A 3CVUA 3T8MA 4I2ZA 2CG2A 3PEUB 4LG6A 3BU8A 4F3VA 1RZ4A 3LKUA 1HU3A 2IO3C 3ABME 3CV0A 3PNLB 4JC8A 3CGHA 3JXIA 4PH4B 4UWKA 4D10C 2NSZA 1E7VA 5CRUA 4HRMB 2GRMA 1HXIA 1V55E 1HH8A 3LPZA 3HVEA 2V5QC 1OWMA 2VJ8A 4KVOA 2OV8A 2WXHA 1O1SA 3NF1A 2ETBA 3FU5A 3ESLA 3ZEFA 1N11A 1SQMA 3IKOB 4K0RA 4XE0A 3ASDA 3SBTB 3AG2E 1PC2A 3ZXSA 1N94A 4L7TA 2QYUA 4E85A 1SZ9A 2EIME 4FADA 2X6IA 4DX1A 5HRYA 5FJYA 4EBAG 4ME2A 3FY4A 3LYAA 3QOUA 3X2QE 4Q69A 3CQCB 3ABLE 2X6FA 2V4HC 3RU0A 2QYJA 4ACLA 4K5AB 5FINA 2F37A 1MZCA 4C9BB 2RKKA 3PE3A 3NQPA 1OCOE 1FCHA 2PNNA 5ARFA 2QC9A 1WAO1 2CFUA 1HFAA 4GTVA 3HVEB 5CMYA 3RO3A 3TG5A 1Z3XA 4JHKA 3U4TA 5JHAA 2FBNA 1MX6A 5E76A 3SFZA 2ONDA 3S7FA 3FTZA 4J8SA 1SVXA 4UWFA 3SNXA 3L13A 4TRQA 4A1GA 3L16A 4GCNA 2EILE 2J08A 1OY3D 4FP7A 4APFA 4GAAA 1ELWA 4UWHA 1OWNA 2WXJA 1GW6A 3ZYQA 4EQFA 5LCWC 2AXVA 3DEOA 3DRAA 4FLBA 4HOUA 3AS4A 2WB2A 3I4RB 5AN8A 1ZU2A 3D9JA 4UWLA 1G3NB 2J09A 4DX6D 1N0QA 1TN6A 3FEXA 2Y4UA 4N2SA 2WQ7A 3AG1E 4FA6A 5KJLA 5EX0A 2P58C 4JA7A 1H0AA 1V54E 3RRUA 4HOTA 3CVVA 4BX9A 1NFIE 3EHNA 1OWLA 1KT1A 2J9QA 4YNDA 3ASNE 2MOWA 3CHPA 1E8WA 4GTQA 4HBDA 1QBQA 3CVLA 3RRNB 1DVPA 1UJJA 3ASOE 3C72A 4JVSA 5JA4D 3CSTA 4PS8A 2QZAA 2VGXB 4GTSA 4N3AA 3ZIMA 1BPOA 2GROB 4HORA 3NAWA 4L9PA 4CGWA 3OXGA 3APDA 1N54A 3B7RL 5FT9A 4X8QA 2CHWA 5C2YA 1HX8A 4TXRA 3FUIA 2MRIA 2WXGA 3BEEA 2WXPA 1ELRA 3DSTA 1HS6A 2GGFA 4WWOA 3U66A 4XI0A 4CDMA 3PREA 4TUMA 3SBSA 3DEPA 3N71A 2KCKA 1FVHA 2Y69E 2JLBA 3OXFA 5ENTD 4G26A 4GA1A 2RFAA 1XGWA 3TAXA 5HS0A 4U95D 3D9KA 1QZ2A 5ARGA 3FP3A 4CYMD 4O60A 4RQIA 2R17C 4JHRA 2VGXA 3TWSA 2RG8A 3ZVVA 2F8YA 5KNGA 5AIJA 3ZPJA 5BV1A 3Q75A 4B94A 4N39A 1EF1C 4JEUA 5FWQA 5G05C 1S0PA 4AXHA 3Q78A 3NZUA 5B1AE 1IQRA 3FH7A 1H19A 4NACA 4EPZA 2R59A 1JUQA 2AXZA 2LSUA 2XZDG 3LJNA 3HHMA 4J0UA 1E8YA 5BT1A 3PVLA 4GPKA
chains in the Genus database with same CATH topology
3RAUA 3UM2A 3C3OA 2OJQA 3ULYA 2OEWA 3UM3A 4JIOA 3ZXPA 1ZB1A 2R02A 3UM1A 2XS1A 5CRVA 3C3QA 2R05A 2R03A 2OEVA 3UM0A 3C3RA 3R9MA 2XS8A 2OEXA 5CRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RAU A;  3UM2 A;  3C3O A;  3ULY A;  2OEW A;  3UM3 A;  3ZXP A;  1ZB1 A;  2R02 A;  3UM1 A;  2XS1 A;  5CRV A;  3C3Q A;  2R05 A;  2R03 A;  2OEV A;  3UM0 A;  3C3R A;  3R9M A;  2XS8 A;  5CRU A; 
#chains in the Genus database with same CATH topology
 2XCC A;  5BW8 C;  3RKV A;  3ZU7 B;  5ENS D;  2AWI A;  4QFV A;  3SQV A;  4K5B A;  2VYI A;  3LEW A;  4G24 A;  4LRZ A;  4JA9 A;  3TXM A;  3ZFW A;  1BD8 A;  3Q7A A;  2B0O E;  5M72 A;  3KAE A;  5A6C A;  4HRL A;  2DBA A;  3C3O A;  2I9C A;  4URK A;  5AAO A;  3KD7 A;  1Q2Z A;  5ANL A;  5AQA A;  3EJN A;  4HLE A;  4GU5 A;  3D9L A;  3RJV A;  3L17 A;  2KBX A;  3LDZ A;  1LD8 A;  2VSO E;  3MKR A;  3PUJ A;  4G8L A;  1TNU A;  2R05 A;  2DVW A;  1OCR E;  5KWD A;  4QQI A;  3MJW A;  1UJK A;  2R5S A;  4BTA A;  5AQB A;  4EZJ A;  4WNG A;  4CDR A;  3B7S A;  1B89 A;  1S63 A;  4AIF A;  2DZO A;  3MV3 B;  4XIF A;  4U0U A;  4U8H A;  4DUI A;  1TR4 A;  1H6P A;  3G2S A;  1OCC E;  3RO2 A;  4AJW A;  3SGH A;  4DX5 D;  2OCC E;  2RFM A;  3EHM A;  3PZ3 A;  3APC A;  2L6B A;  3NOG D;  4AY5 A;  1LTX A;  4APO A;  2FUL A;  5JJT A;  2LAH A;  4E6H A;  3ISM C;  3BG1 B;  4GA2 A;  3ZHE A;  1S64 A;  2L6J A;  3UT4 A;  3FTU A;  1JWF A;  2X6H A;  3GZS A;  2OVF A;  2XS8 A;  1X5B A;  1Z5S C;  1IKN D;  5EN5 D;  3E33 A;  2X6K A;  4HS2 A;  4U0Z A;  5AAR A;  2GRN B;  3PZ1 A;  2VSY A;  3Q7F A;  3R7Q A;  3TWU A;  1DNP A;  4XKC A;  4BEP A;  3GZ1 A;  3CEQ A;  3Q47 B;  1E96 B;  3R9M A;  5KBA A;  4GTT A;  2ETA A;  3Q9N C;  2NYJ A;  1E8X A;  4N5C A;  3FEY A;  4HXI A;  1NA3 A;  3U9W A;  4CDN A;  2J8S D;  3IXE A;  3CHM A;  3CHR A;  4KMO A;  3FUJ A;  3SFX A;  3NB2 A;  3CVX A;  3C3R A;  5ITZ F;  3UXG A;  3LXU X;  3TWX A;  4C0M A;  5FQ6 A;  3HXF A;  3ZHE B;  1Z6T A;  1K3Z D;  4UQX A;  2VGE A;  4GZ6 A;  3HXE A;  1U3C A;  4KYO B;  3W9G A;  4LSZ E;  4FJZ A;  4AY6 A;  4JW1 A;  3DWL G;  5CCM A;  4N5Q A;  3TJP A;  3PNT B;  2H6H A;  2F8X K;  4GB9 A;  2YQ8 A;  5BV0 A;  2WQH A;  5T3R A;  2BF0 X;  3VTY A;  4HOQ A;  4DJA A;  4U0S A;  4GML A;  4GZC A;  4JL0 A;  3KSL A;  1OXJ A;  1MX4 A;  4FU3 A;  3ML8 A;  3ML9 A;  3B7B A;  4H7X A;  1SA4 A;  2XPY A;  4L2L A;  3ZNG A;  1TNO A;  3LVQ E;  4UUC A;  4A55 A;  4O6F A;  5CER B;  3B7U X;  3LCA A;  5IY5 E;  4K5C A;  2LXM A;  2I6H A;  2CHZ A;  4I17 A;  2Y1L E;  3EIJ A;  4GZ3 A;  1FT2 A;  2I2O A;  3UKU G;  4U8Y D;  3PZ4 A;  4WWN A;  4BSZ B;  1HZ4 A;  2VSN A;  2QY7 A;  2XS1 A;  4EEC A;  4UQZ A;  3CK7 A;  2C0L A;  3AU5 A;  3ZRH A;  3TWR A;  3CVY A;  1UN8 A;  3EIQ C;  4YDY A;  5EKQ D;  2WVI A;  3PH0 C;  3Q49 B;  2VSX E;  2DZN A;  1S70 B;  1HG5 A;  4LER A;  4DRX E;  5CEA A;  3U3W A;  2VTB B;  3MEK A;  3UM3 A;  1Y6I A;  1OWO A;  3Q9U C;  3MKQ A;  3I4G A;  4LUN U;  2V8S E;  1WM5 A;  2DYR E;  1LD7 A;  4WUY A;  1PY1 A;  2X6J A;  3HRA A;  1TN7 A;  4HLL A;  3V2O A;  4HNA D;  4J7W A;  4EZK A;  2MYO A;  2FO7 A;  1WG0 A;  5CBO A;  4KT6 B;  3FUN A;  2FI7 A;  3G2W A;  2ZU6 B;  1IHG A;  1JCQ A;  2VQ2 A;  2WXI A;  1QYM A;  3SD5 A;  2FEZ A;  4KZ0 A;  3UT8 A;  2XGS A;  2A5U A;  3ZYK A;  4TV3 A;  4DI3 A;  4I1O B;  1EDU A;  3JUI A;  3L54 A;  5ANR A;  4GTO A;  3L22 A;  4I9E A;  4ANV A;  4NIK A;  3QC1 A;  1UN9 A;  1H6O A;  1MYO A;  2BKG A;  4FHK A;  1KPS B;  3R7R A;  3D9P A;  3PUK A;  4B93 B;  1RW2 A;  3HXB A;  2GRR B;  2C2L A;  3TL5 A;  3E30 A;  2EQX A;  2NC9 A;  2L0T B;  4ANX A;  1E90 A;  3AG4 E;  1N4S A;  2VTB A;  4B8A A;  5D0O D;  3RRM B;  3MKQ B;  2A4Z A;  5AJD A;  2WQ6 A;  4DI4 A;  1H2T C;  3PRZ A;  3KS2 A;  2YIN A;  4UWG A;  3FUL A;  2H6I A;  4BFR A;  3JQ0 A;  3FDH A;  2XCB A;  2DIW A;  4PUC A;  2GRP B;  4AV7 A;  3FTX A;  4N2Q A;  4BT9 A;  1O5M A;  5EX3 A;  4CCA A;  3FFL A;  3OXL A;  1AP7 A;  3FTY A;  1IXV A;  3T5V A;  4J8D A;  4FHJ A;  4C48 B;  4ATZ D;  4BSX A;  3L08 A;  1KZP A;  3D9M A;  3QNK A;  2C0M A;  4ANU A;  4ILG A;  3CKC A;  4MLP A;  3P1U A;  5KJM A;  5FTP A;  3UM0 A;  5ENQ D;  2LUH A;  2EIJ E;  1N4Q A;  4OVU A;  2P9U G;  3FUF A;  3Q15 A;  3UIP C;  3CVQ A;  2XRZ A;  4U8V D;  2BUG A;  3QB2 A;  3Q79 A;  3ZW3 A;  2DWZ A;  1H6K A;  3CVN A;  2WM9 A;  1TNB A;  4BET A;  3FTV A;  2OOE A;  4XEI G;  3EHQ A;  1QNF A;  2ETC A;  2WXO A;  3DXM G;  2LAI A;  2XEH A;  3ZKJ A;  1N4R A;  2F0Y A;  3IHY A;  2OEV A;  4RSY A;  3FUE A;  2XGM A;  3E4B A;  4HOS A;  2HE0 A;  1UOH A;  4CT4 A;  5AYW D;  3JQ1 A;  2BED A;  4U63 A;  3AAA C;  3PS6 A;  1EYH A;  4J8Y A;  4L1B A;  4U96 D;  3ABK E;  3T5X A;  1WY6 A;  3V2X A;  2XRY A;  5KJK A;  4Y6W A;  5CBN A;  4O1O A;  2WXL A;  2V0P A;  4XX5 A;  3E34 A;  2ZIR A;  1JCS A;  3CVW A;  4BES A;  2I1J A;  3HG0 D;  2Y3A A;  3AS5 A;  4ANW A;  5B1B E;  3MV2 B;  5CED B;  3V79 K;  5EYP F;  5CEC B;  5ENR D;  4K03 A;  4EBA A;  4Y6C A;  2XPZ A;  1K1B A;  3DXK G;  4A1S A;  2OVB A;  3CK9 A;  4G8K A;  3CLJ A;  3FTW A;  5LFA A;  1IQU A;  4JHJ A;  1A5E A;  3B95 A;  1ELK A;  1TYQ G;  3AS8 A;  2Y4T A;  1JCR A;  1AWC B;  2IOS A;  1BI8 B;  3IV0 A;  2VGY A;  2ZGD A;  5FZQ A;  3SHF A;  3IEG A;  4CGV A;  3UKR G;  4GZD A;  1K1A A;  4KZC A;  1H2V C;  2IJG X;  2AW6 A;  1WDY A;  2IF4 A;  3B13 A;  3UM1 A;  3S7J A;  1OT8 A;  3KEZ A;  2KCL A;  5DBK A;  5D66 A;  3WG7 E;  3C5R A;  2UWJ G;  4GA0 A;  5FQ7 A;  2E0I A;  1KLX A;  3HYM B;  3MGB A;  5J08 A;  3UM2 A;  4ILH B;  2XQ0 A;  1DCQ A;  4G11 A;  1A17 A;  3ZXP A;  2V5F A;  1SA5 A;  1X81 A;  2XHE A;  3CHQ A;  5CRV A;  3LS8 A;  4Q94 A;  3G2U A;  2J07 A;  3P2B A;  4MKT A;  4JB8 P;  4OAV B;  3R9A B;  2IFU A;  4KBQ A;  4DLQ A;  2IQC A;  3LY9 A;  3RK6 A;  3TWW A;  4RG9 A;  2LXL A;  1KZO A;  5A7D B;  4OAU C;  2XGO A;  2A5E A;  2CG3 A;  5T4Y A;  4FUL A;  2PQR A;  4HB5 A;  3EU9 A;  2RD0 A;  4JPS A;  5D0Q D;  2V4L A;  2MHK A;  3U64 A;  2IO2 C;  3QDN A;  3MX3 A;  4U04 A;  4L2Y A;  4I2W A;  4XZ4 A;  1HF8 A;  2ILR A;  2PZI A;  1IHB A;  2WXM A;  4UI9 C;  4YVQ C;  3DSS A;  2KCV A;  4M7C A;  4NQ0 A;  3FUK A;  2XEE A;  1KT0 A;  3J5Q B;  1OWP A;  2HYZ A;  3L9T A;  5H7P A;  3C98 A;  4I1M A;  2FO1 E;  4BTB A;  4IRU A;  3FHE A;  5J90 A;  1UG3 A;  5FQ4 A;  2KAT A;  4DLO A;  1BLX B;  1P5Q A;  1TJF A;  5AJL A;  3MZL B;  4MBG A;  4GYO A;  3ZYM A;  2P9K G;  3UMV A;  3DSV A;  3HDX A;  4RLY A;  4P29 A;  1U3D A;  1Y8M A;  3ASF A;  3SO8 A;  3GYZ A;  3HIZ A;  1MQS A;  3IBE A;  4I6G A;  2FF4 A;  2CFZ A;  1OCZ E;  3NBN B;  3CK8 A;  3NOC D;  5ENO D;  2ZXW E;  2WXQ A;  3PZ2 A;  5BNW A;  5EYL A;  3UIO C;  4A3T A;  4CRW A;  3Q73 A;  5JHB A;  2Y0B G;  2J49 A;  4R7L A;  5T8I A;  3DSU A;  3G2V A;  5B3S E;  1W3B A;  3E37 A;  3J5P A;  3HXC A;  1OUV A;  2BKK B;  3PZD A;  4MRU A;  2PM7 A;  3CHO A;  4AOF A;  4ACK A;  4FLH A;  4XI9 A;  3AG3 E;  1JPL A;  3APF A;  3QWV A;  3CR3 A;  3UPV A;  3ONK A;  2KXP C;  3GW4 A;  4LCT A;  3TWQ A;  3OAW A;  5AQ7 A;  2PM6 A;  1PAQ A;  1NZN A;  3O4Z A;  2IU1 A;  1NI1 A;  1YA0 A;  3TXN A;  3LY8 A;  4LNU D;  1FPP A;  1TNY A;  1INZ A;  4TUU A;  5FIO A;  4DX7 D;  4GMR A;  3FTS A;  4B89 A;  5BXO A;  5JMN D;  3QAQ A;  2L9B A;  3UIN C;  4GCO A;  1N52 A;  3JCK C;  3JUE A;  3PDN A;  4LNB A;  5ENN A;  3BUA A;  3ZGQ A;  3LJ3 A;  3MCX A;  4NUR A;  4WAF A;  3Q5M A;  2OEW A;  3UT7 A;  4TXQ A;  3ZUV B;  4YVO A;  5AQ9 A;  1YYH A;  2J4D A;  4HFG A;  5G04 C;  5JJ6 A;  2PQN A;  5G55 A;  3FUM A;  1LF8 A;  3FWV A;  5BXU A;  3TGO A;  2EIK E;  1MJ0 A;  1ZB1 A;  2ION A;  2M63 A;  4JEH A;  3UX4 A;  5JJ7 A;  4HVB A;  5E75 A;  4O1P A;  2E2E A;  4PDX A;  4NRH B;  4YDE A;  2UY1 B;  4ZHB A;  1E8Z A;  1YMP A;  2KZT B;  3FH5 A;  3S2A A;  4BX8 A;  2P9I G;  4L23 A;  3RIB A;  4Q96 A;  3CKB A;  4G1T A;  2IEJ A;  1ZBP A;  3CHS A;  4MS6 A;  3CSF A;  4EHM A;  2PL2 A;  2GRL A;  4F53 A;  5CHE E;  3S7B A;  1HE8 A;  3V31 A;  4DK5 A;  3L6A A;  4U07 A;  5EIB E;  1TNZ A;  3E32 A;  1NP7 A;  2WXK A;  2X3M A;  4J8F A;  3ULQ A;  1DCE A;  3QK0 A;  5KNH D;  3DPY A;  2R03 A;  4GPM A;  2P9L G;  2AVP A;  3PE4 A;  2P2C P;  2DCP A;  1U2V G;  3AJI A;  3OTN A;  2AXU A;  3D3M A;  4UI9 K;  1FT1 A;  4IUL A;  3ONL A;  4ILI A;  1QQE A;  3UUX A;  3ULY A;  3FUD A;  4G2V A;  1NL4 A;  1N0R A;  2UY1 A;  2R2L A;  5DIZ A;  2KZT A;  2NXP A;  1SZA A;  5CCL A;  2XZT G;  3ASH A;  3KEA A;  1YCS B;  4GTP A;  1N9A A;  4RG6 A;  2WMO A;  4W9R A;  4WWP A;  4JXT A;  3LVR E;  2HM8 A;  2GW1 A;  4B0Z A;  3ESK A;  4GTR A;  5BUZ A;  4I6E A;  3G2T A;  2XEN A;  2I1K A;  2P9N G;  3S7D A;  4BWR A;  3UQ3 A;  4LNG A;  4TXP A;  3FU0 A;  4AEZ C;  5C1D A;  2Q7F A;  4ZFH A;  3LY7 A;  4PS3 A;  4J8E A;  1IYG A;  4A63 B;  4OYS A;  3DBS A;  2EIN E;  3ZYL A;  3T9K A;  3QWP A;  4JD2 G;  5EDS A;  3RSE G;  1D8E A;  4BER A;  4OVV A;  1MHQ A;  3URZ A;  3CVP A;  1VDY A;  5FQ8 A;  1H2U A;  1BI7 B;  2GRQ B;  4GTM A;  3SY2 A;  4F6R D;  3SZ7 A;  4M3O A;  2H6G A;  3EUV A;  3AU4 A;  5BPP A;  5KJN A;  5G04 J;  4ABN A;  3W9F A;  1SW6 A;  4ATG A;  3F6Q A;  1TN8 A;  2P9P G;  3C3Q A;  4WNF A;  5LOZ A;  2WMN A;  4RVB A;  3ZN3 A;  2YHE A;  5A23 A;  4WNE A;  2LNI A;  2H6F A;  4CT0 A;  3D9N A;  3B7T A;  3HXD A;  5G2N A;  1K8K G;  5EIL A;  5CMW A;  5HQ8 A;  2BTD A;  3T8K A;  4BT8 A;  3I5P A;  4U7E B;  5AEN A;  1D9S A;  4DPR A;  1O1R A;  5ENP D;  2ZGG A;  4AP2 A;  2P9S G;  4LEU A;  2AJA A;  3D9O A;  4GYW A;  3WXX A;  2JEK A;  3GZ2 A;  5KCM A;  4HI9 A;  4N3B A;  4I1A A;  3UTM A;  1BU9 A;  3O48 A;  4EZL A;  3BG0 B;  3TWV A;  2QFC A;  4G23 A;  3K9I A;  4UQY A;  1MX2 A;  1L5J A;  4CEM A;  1D8D A;  4F1P A;  5EID A;  3QKY A;  4IYP A;  4FJY A;  3Q4A B;  3FH8 A;  1TJC A;  1DC2 A;  4B8C B;  2X38 A;  4GZ5 A;  4WND A;  5D2M C;  1TEZ A;  3ULE G;  1Z3Y A;  4IN3 B;  4AM9 A;  3FUH A;  1E7U A;  3IHV A;  3DPD A;  3D9H A;  3CIA A;  4HQD A;  4N3C A;  2HR2 A;  4GYY A;  2KC7 A;  3V30 A;  2WXF A;  3QWW A;  3KSQ A;  5HI7 A;  4YDO A;  4J6I A;  3ASG A;  3QAR A;  5FZS A;  2B6C A;  2KM4 A;  3NZS A;  5G05 J;  3PEV B;  4KXK B;  2WXR A;  5HKP A;  2DYS E;  3DSW A;  4BY6 A;  2YNQ A;  4A3V A;  3FU6 A;  3EHR A;  2J4B A;  2L0I A;  3MYV A;  4XKB A;  1UW4 B;  2CHX A;  3DSX A;  3QJZ A;  4G25 A;  2IOL A;  3D9I A;  4I43 A;  1JWG A;  3RAU A;  1XNF A;  3EU5 A;  3JYS A;  4JZY A;  3L82 A;  2R02 A;  2WPV A;  3VLE A;  3VLD A;  3SFY A;  1HG2 A;  3EDT B;  4PS7 A;  1O1T A;  3SI5 A;  2IY0 C;  2LO6 A;  4KVM A;  1N4P A;  4AVX A;  5LP0 A;  4CZ2 D;  2XEV A;  1FVF A;  4FC8 A;  5FZR A;  1NA0 A;  3TWT A;  5LCW J;  3VTX A;  4I6J A;  4DX2 A;  1EPU A;  4Z68 A;  1HO8 A;  3JXJ A;  2JAB A;  4GMJ A;  1N95 A;  2XPI A;  4H7Y A;  3ENE A;  3MA5 A;  3UI2 A;  2HO1 A;  2ZIS A;  4YDW A;  4HI8 A;  4UI9 J;  4I9C A;  3I3N A;  4C0E A;  4F7A A;  4HRN A;  3VLF A;  3CQG B;  5LX8 A;  4F1S A;  3FU3 A;  2WXN A;  3BQO A;  2YHC A;  2LSV A;  4V3I A;  3TG4 A;  3SF4 A;  3CVU A;  3T8M A;  4I2Z A;  2CG2 A;  3PEU B;  4LG6 A;  3BU8 A;  4F3V A;  1RZ4 A;  3LKU A;  1HU3 A;  2IO3 C;  3ABM E;  3CV0 A;  3PNL B;  4JC8 A;  3CGH A;  3JXI A;  4PH4 B;  4UWK A;  4D10 C;  2NSZ A;  1E7V A;  5CRU A;  4HRM B;  2GRM A;  1HXI A;  1V55 E;  1HH8 A;  3LPZ A;  3HVE A;  2V5Q C;  1OWM A;  2VJ8 A;  4KVO A;  2OV8 A;  2WXH A;  1O1S A;  3NF1 A;  2ETB A;  3FU5 A;  3ESL A;  3ZEF A;  1N11 A;  1SQM A;  3IKO B;  4K0R A;  4XE0 A;  3ASD A;  3SBT B;  3AG2 E;  1PC2 A;  3ZXS A;  1N94 A;  4L7T A;  2QYU A;  4E85 A;  1SZ9 A;  2EIM E;  4FAD A;  2X6I A;  4DX1 A;  5HRY A;  5FJY A;  4EBA G;  4ME2 A;  3FY4 A;  3LYA A;  3QOU A;  3X2Q E;  4Q69 A;  3CQC B;  3ABL E;  2X6F A;  2V4H C;  3RU0 A;  2QYJ A;  4ACL A;  4K5A B;  5FIN A;  2F37 A;  1MZC A;  4C9B B;  2RKK A;  3PE3 A;  3NQP A;  1OCO E;  1FCH A;  2PNN A;  5ARF A;  2QC9 A;  1WAO 1;  2CFU A;  1HFA A;  4GTV A;  3HVE B;  5CMY A;  3RO3 A;  3TG5 A;  1Z3X A;  4JHK A;  3U4T A;  5JHA A;  2FBN A;  1MX6 A;  5E76 A;  3SFZ A;  2OND A;  3S7F A;  3FTZ A;  4J8S A;  1SVX A;  4UWF A;  3SNX A;  3L13 A;  4TRQ A;  4A1G A;  3L16 A;  4GCN A;  2EIL E;  2J08 A;  1OY3 D;  4FP7 A;  4APF A;  4GAA A;  1ELW A;  4UWH A;  1OWN A;  2WXJ A;  1GW6 A;  3ZYQ A;  4EQF A;  5LCW C;  2AXV A;  3DEO A;  3DRA A;  4FLB A;  4HOU A;  3AS4 A;  2WB2 A;  3I4R B;  5AN8 A;  1ZU2 A;  3D9J A;  4UWL A;  1G3N B;  2J09 A;  4DX6 D;  1N0Q A;  1TN6 A;  3FEX A;  2Y4U A;  4N2S A;  2WQ7 A;  3AG1 E;  4FA6 A;  5KJL A;  5EX0 A;  2P58 C;  4JA7 A;  1H0A A;  1V54 E;  3RRU A;  4HOT A;  3CVV A;  4BX9 A;  1NFI E;  3EHN A;  1OWL A;  1KT1 A;  2J9Q A;  4YND A;  3ASN E;  2MOW A;  3CHP A;  1E8W A;  4GTQ A;  4HBD A;  1QBQ A;  3CVL A;  3RRN B;  1DVP A;  1UJJ A;  3ASO E;  3C72 A;  4JVS A;  5JA4 D;  3CST A;  4PS8 A;  2QZA A;  2VGX B;  4GTS A;  4N3A A;  3ZIM A;  1BPO A;  2GRO B;  4HOR A;  3NAW A;  4L9P A;  4CGW A;  3OXG A;  3APD A;  1N54 A;  3B7R L;  5FT9 A;  4X8Q A;  2CHW A;  5C2Y A;  1HX8 A;  4TXR A;  3FUI A;  2MRI A;  2WXG A;  3BEE A;  2WXP A;  1ELR A;  3DST A;  1HS6 A;  2GGF A;  4WWO A;  3U66 A;  4XI0 A;  4CDM A;  3PRE A;  4TUM A;  3SBS A;  3DEP A;  3N71 A;  2KCK A;  1FVH A;  2Y69 E;  2JLB A;  3OXF A;  5ENT D;  4G26 A;  4GA1 A;  2RFA A;  1XGW A;  3TAX A;  5HS0 A;  4U95 D;  3D9K A;  1QZ2 A;  5ARG A;  3FP3 A;  4CYM D;  4O60 A;  4RQI A;  2R17 C;  4JHR A;  2VGX A;  3TWS A;  2RG8 A;  3ZVV A;  2F8Y A;  5KNG A;  5AIJ A;  3ZPJ A;  5BV1 A;  3Q75 A;  4B94 A;  4N39 A;  1EF1 C;  4JEU A;  5FWQ A;  5G05 C;  1S0P A;  4AXH A;  3Q78 A;  3NZU A;  5B1A E;  1IQR A;  3FH7 A;  1H19 A;  4NAC A;  4EPZ A;  2R59 A;  1JUQ A;  2AXZ A;  2LSU A;  2XZD G;  3LJN A;  3HHM A;  4J0U A;  1E8Y A;  5BT1 A;  3PVL A;  4GPK A; 
#chains in the Genus database with same CATH homology
 3RAU A;  3UM2 A;  3C3O A;  2OJQ A;  3ULY A;  2OEW A;  3UM3 A;  4JIO A;  3ZXP A;  1ZB1 A;  2R02 A;  3UM1 A;  2XS1 A;  5CRV A;  3C3Q A;  2R05 A;  2R03 A;  2OEV A;  3UM0 A;  3C3R A;  3R9M A;  2XS8 A;  2OEX A;  5CRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...