3C3QA

Alix bro1-domain:chmip4b co-crystal structure
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
357
Chain Sequence
ATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Programmed cell death 6-interacting protein
publication title ALIX-CHMP4 interactions in the human ESCRT pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 118
structure length 357
sequence length 357
ec nomenclature
pdb deposition date 2008-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3c3qA00
2R03A 2OEVA 2R05A 3C3OA 3C3QA 5CRUA 1ZB1A 3UM1A 3C3RA 3UM3A 2XS1A 2OEWA 3RAUA 3UM0A 2R02A 2XS8A 5CRVA 3UM2A 3ULYA 3R9MA 3ZXPA
chains in the Genus database with same CATH superfamily
4F1PA 2XRYA 4U63A 3T8KA 1QZ2A 4KXKB 5EYPF 4B8CB 4QQIA 2QYUA 5DBKA 2AW6A 2WXRA 1IQUA 4BX8A 4YDYA 1V54E 2XZDG 3CVWA 3BQOA 2WQHA 1O1TA 3DXKG 4GZ3A 3T8MA 3RU0A 2KCVA 2WMNA 5AQAA 4TXQA 5ANLA 2L0IA 3Q4AB 1OXJA 3QJZA 4G23A 5D2MC 1IQRA 1HO8A 2P9IG 3L6AA 1E96B 3LDZA 1IKND 2JABA 4N5QA 4YDWA 3RRNB 3KAEA 3RIBA 2C0MA 2NYJA 2J8SD 4EZJA 4UI9J 2GRPB 3ONKA 5CCLA 2IO3C 2ZGDA 3ML8A 1D8DA 3S7DA 4TUMA 2H6HA 4GMLA 4A1GA 4GMJA 3CR3A 3CK7A 1INZA 3HXFA 3RRUA 2KATA 3CSFA 2MYOA 5G04J 2BUGA 4HLLA 5ENNA 3SF4A 3S7JA 3CVUA 4HXIA 3DSUA 3TAXA 4YDOA 1TJFA 4GYYA 1S70B 3E4BA 3ZYLA 3FUKA 3ESLA 2LSUA 2IFUA 4DJAA 3FU3A 3ML9A 2VSXE 3UIPC 2P9UG 4EBAA 5FT9A 2DYSE 4ATZD 4LEUA 3ZGQA 4TXRA 2CHZA 2ZU6B 1DNPA 1DCEA 4BT9A 3ONLA 3ZNGA 1WDYA 2WMOA 4RG9A 1OCZE 4JVSA 3R9AB 1TN7A 2P9KG 4GZ6A 2F37A 3ZXSA 3KEAA 2PL2A 3FUNA 4O1PA 5D0QD 5CRVA 3NZUA 1HX8A 1MX4A 4L2LA 3LJNA 2V8SE 2VSOE 2CHXA 2YNQA 3HIZA 2B6CA 2X6KA 3FY4A 3ZHEB 2DWZA 2LAIA 2J4DA 3FFLA 2XCBA 4WNFA 4IRUA 1TEZA 3T5VA 4LUNU 3IEGA 4HOUA 1ELRA 3TWXA 3E33A 2R05A 2L6BA 2P9NG 4TV3A 3UT4A 1TYQG 2GW1A 1D9SA 5FZQA 2ZIRA 4N3CA 4KBQA 2QYJA 4K03A 3PH0C 3P1UA 4E85A 2KM4A 4UQXA 3IBEA 2GRLA 4A3VA 5BV1A 1K1AA 4Q94A 2KZTB 4GTVA 3QC1A 3SGHA 3CHQA 1MJ0A 1W3BA 5BW8C 4ATGA 5A23A 2IOSA 3P2BA 4HOQA 4DPRA 4DUIA 4E6HA 4APOA 2XPYA 4R7LA 3RKVA 2P58C 3ZYKA 4FULA 2BTDA 2L0TB 2R02A 4TUUA 1FCHA 1OWNA 4OAUC 1ELKA 3APDA 2PNNA 3CKCA 3Q78A 5CMWA 3O4ZA 3ZKJA 3N71A 3ZEFA 4AXHA 5T3RA 5G05J 2L6JA 4KVOA 4YDEA 4HRNA 5FZRA 2NC9A 2X6HA 4PH4B 2XENA 1BI7B 4FA6A 5AIJA 4AJWA 4EQFA 5BUZA 4KMOA 4GTMA 4CZ2D 2XEVA 4NQ0A 3TGOA 2R5SA 4DX1A 1H6KA 1ZBPA 3RRMB 3TJPA 3EJNA 4XI0A 1NA3A 2C0LA 4B94A 3V2XA 1TNZA 1ZB1A 1P5QA 3B7SA 4YVOA 3GZ2A 1E90A 3D9IA 1IYGA 1G3NB 3AG3E 3V2OA 2V5QC 1N0RA 4EZLA 2R03A 5FJYA 4JA9A 3VLFA 4GA2A 3MKRA 3UM1A 1NI1A 3NF1A 3EU5A 5EN5D 3L54A 2X6JA 4O60A 2IOLA 3AS4A 1H2UA 1N4RA 1B89A 1KLXA 2LNIA 3ULYA 5FWQA 5D0OD 4C9BB 4PS8A 5DIZA 4M7CA 1U3CA 4CRWA 1S64A 3SZ7A 3Q9UC 3SFYA 5LFAA 2VSNA 4F1SA 4UWGA 4GTSA 3EDTB 1WAO1 4BERA 3DXMG 4NRHB 3JQ1A 2HM8A 4GZCA 2X3MA 2UY1B 2LO6A 3JCKC 3PNLB 5A6CA 5ITZF 4A1SA 2VSYA 5BPPA 2XZTG 1TR4A 4WNDA 2RKKA 3AJIA 1EDUA 4I2ZA 4U07A 4HI9A 4U96D 5KCMA 5AQ7A 1QYMA 1HG2A 4GB9A 4G2VA 3FEYA 4ANVA 1Q2ZA 5HS0A 3UXGA 2AXVA 3IHYA 3F6QA 3EIQC 3FTVA 5FQ7A 4GPMA 3CQGB 4A3TA 4I6EA 4RSYA 4RVBA 3LXUX 3ULEG 2ILRA 1TNUA 4U0ZA 3PVLA 3ASDA 5ENPD 4GMRA 2RFAA 3B7TA 4PS3A 5C2YA 2CFZA 3CHMA 2P9SG 1E7UA 3JYSA 4N2SA 2WM9A 3EHQA 4L1BA 3ABKE 2FO1E 2GRMA 4N5CA 4I6JA 1N95A 4XIFA 5E75A 3QWVA 5LCWC 4XKBA 3IKOB 1DC2A 2J49A 1UN9A 2H6FA 3T9KA 3MGBA 4FADA 4DRXE 3PUKA 4CT4A 1BU9A 2YHCA 4TRQA 3QWWA 3RO3A 3V79K 1H19A 1HZ4A 3TG5A 3RJVA 1PC2A 3S7BA 5KJMA 3NQPA 3ASOE 4U7EB 4V3IA 2GGFA 4JW1A 5J08A 5JMND 4F3VA 3IHVA 4LERA 4BEPA 3ABME 5KJNA 3C5RA 3HXBA 5JJ7A 2VTBB 2HR2A 3PEVB 3FTWA 5KBAA 1HXIA 4WNEA 3UKRG 3PREA 3CVVA 3D9PA 4AVXA 3ZRHA 2XPZA 5ARFA 3FH8A 4FLHA 4N3AA 3K9IA 1LD7A 3NZSA 4F7AA 1IXVA 1VDYA 3OAWA 3PDNA 4GAAA 2HE0A 3DEOA 3BEEA 3E37A 4BSZB 4I6GA 1LD8A 4I1OB 2XGOA 2PQRA 5D66A 3SO8A 2VQ2A 4L7TA 3MV3B 3PEUB 3UT7A 3UT8A 4K5CA 3S7FA 4DLQA 3R7QA 1YYHA 1HFAA 2OVFA 2WVIA 5FIOA 4ABNA 4HRLA 2XS1A 2WXNA 5EIDA 3VTXA 2X6FA 3APFA 3G2SA 3QAQA 2VGXB 2R17C 1JCRA 3OXGA 4K0RA 1RZ4A 1SVXA 2ETAA 3JXJA 4CGVA 4W9RA 1HG5A 2ZXWE 1E8XA 1D8EA 2OOEA 3QOUA 3PZ3A 3DPDA 3CVYA 3QKYA 2XGMA 3SBSA 1TNYA 3BG1B 3GW4A 3ZFWA 4FJZA 4I9CA 4APFA 3PE3A 1OY3D 4GTRA 2V4LA 3ZVVA 4OYSA 4I2WA 4JA7A 3SFZA 4HS2A 3SNXA 3B7RL 5LX8A 4PUCA 4GCOA 4ILHB 3UM0A 3ZHEA 4DI4A 1TN6A 5IY5E 3UKUG 3TXNA 1N4QA 4C0MA 1X5BA 4A55A 5CBOA 4N2QA 5ANRA 5FINA 4HNAD 4AOFA 4J7WA 2AVPA 3OXFA 1SZ9A 2PM6A 2P2CP 4ANXA 1Z6TA 4X8QA 2J9QA 3MKQB 4G11A 4RQIA 3PZDA 5C1DA 4HFGA 5HKPA 5EDSA 3C3QA 1E8WA 3Q73A 4Q96A 3V31A 5JJTA 2GRNB 1HF8A 3Q7AA 3U3WA 3LY9A 2KZTA 3WXXA 4AEZC 3ZN3A 2BKKB 5EILA 4G24A 4BESA 4IULA 2RD0A 4XI9A 2B0OE 1JUQA 3EHMA 2NSZA 3GYZA 4KVMA 2FBNA 1OUVA 4OVUA 1WG0A 4DX5D 2I1KA 3ABLE 2I6HA 3L13A 3X2QE 4GU5A 3KSLA 2EQXA 3CQCB 4CYMD 3FTSA 4CEMA 4M3OA 3JUEA 4HVBA 5H7PA 5AAOA 1DVPA 3W9FA 4ANWA 1SA5A 3C72A 3UQ3A 1TJCA 1S0PA 5ENOD 5J90A 1XGWA 5CRUA 3Q49B 3G2TA 1H6OA 4OAVB 4U0UA 2MRIA 2WXJA 3FU6A 3ZYQA 1OWOA 2WXLA 4L9PA 3I4GA 2JEKA 2EINE 4JHRA 5CBNA 3NOCD 5JA4D 3FTZA 3UMVA 2F0YA 4IN3B 4DX6D 1OT8A 3EIJA 3HXDA 4HOTA 4URKA 1MHQA 2J08A 3L22A 3DPYA 4CDRA 5KWDA 3G2UA 1V55E 3TWSA 5AQ9A 3T5XA 1WM5A 3B7BA 2H6GA 1UW4B 2PM7A 3UI2A 2ETBA 3SQVA 2VGEA 3I3NA 3ZU7B 3E34A 4AP2A 4LCTA 3NBNB 4U8YD 3CVNA 3FP3A 1JWFA 4J8FA 4HI8A 2I9CA 4TXPA 3RK6A 3PRZA 4WUYA 3SFXA 4GPKA 1FT2A 5LOZA 3GZSA 1N4SA 3D9LA 4RG6A 3JQ0A 4B0ZA 4J8DA 3QARA 1UJKA 4BT8A 3D9OA 2IQCA 2V5FA 1SZAA 2X38A 3UINC 3MJWA 4G1TA 2CG2A 4JEUA 1JCSA 2A5EA 4AV7A 1EF1C 4XKCA 4P29A 5LCWJ 1N52A 3U66A 4DK5A 2LAHA 2P9LG 5BNWA 3SY2A 1O5MA 2DZNA 1NP7A 3Q7FA 2IEJA 5ENRD 3AU5A 2ONDA 2C2LA 3EUVA 4Y6CA 3NOGD 5FZSA 2UY1A 3FUEA 1IHGA 4GTOA 2XCCA 4ILIA 4LNGA 3FUJA 2F8YA 2FI7A 2GROB 1U3DA 1E8YA 2DZOA 4J8EA 5G55A 4H7YA 3ZIMA 3BG0B 3CGHA 2CFUA 3U64A 3AG2E 4Y6WA 3HG0D 1K1BA 4MBGA 1E7VA 3VLDA 3NB2A 4C48B 4LSZE 3OTNA 2VJ8A 5G2NA 5AJLA 2KBXA 4G8KA 4BSXA 1TNBA 2WXIA 3IXEA 3FU0A 1MX2A 3D9KA 3PZ1A 4ACKA 4GZ5A 2M63A 1N4PA 4HLEA 3PS6A 2L9BA 5HI7A 2RG8A 2QY7A 1H0AA 3VTYA 4LNBA 4NURA 2KXPC 3ENEA 3W9GA 2EIKE 4O6FA 3DBSA 4JZYA 3V30A 1PAQA 5B1BE 4GA1A 1S63A 2KCKA 3EHNA 3KS2A 4WAFA 1H2VC 2OVBA 1N11A 2J09A 3ASNE 5JHBA 3ZW3A 3FHEA 3FWVA 4PDXA 5ENTD 4HOSA 3DRAA 1SA4A 3J5QB 3FTUA 4F53A 2WQ6A 1QNFA 5KJKA 1OCRE 3DSWA 1PY1A 4RLYA 1DCQA 1UN8A 3Q79A 1K3ZD 5AARA 3PUJA 1HE8A 2XGSA 1FVFA 3UM3A 2XPIA 1O1RA 3LVQE 5EIBE 4CCAA 3ULQA 2VTBA 1OCOE 1SQMA 2LXLA 4NACA 4HB5A 4J8YA 3L17A 4AY6A 3J5PA 3VLEA 4D10C 3AG1E 2FO7A 3SHFA 3TWVA 3CSTA 3FUFA 4K5BA 4U8VD 3TWRA 4CDMA 2AXUA 4KZCA 3HVEB 3LYAA 3FEXA 3HHMA 3UTMA 2JLBA 5AYWD 1MZCA 4MLPA 3AAAC 3LKUA 4DLOA 4XX5A 4J6IA 2HYZA 3APCA 2OEWA 3FTXA 3MZLB 5JHAA 2WXPA 5BV0A 4BWRA 3QNKA 1KPSB 4HBDA 3WG7E 1EPUA 2VGXA 2WXQA 3DWLG 3D9HA 1QQEA 4U95D 3LY8A 1N94A 2I2OA 4GTTA 1TNOA 1Z3XA 5BT1A 3FULA 5LP0A 1NL4A 2QFCA 1U2VG 2XQ0A 4GTQA 5BXUA 3E32A 3CHSA 5AJDA 1KZPA 3MEKA 2NXPA 1MX6A 2WXFA 4U04A 1N9AA 3FTYA 4F6RD 3JXIA 1IHBA 2Q7FA 4UWFA 1HH8A 3ASGA 2QZAA 2CG3A 4YVQC 3EU9A 3ISMC 2Y1LE 4I1AA 1E8ZA 4WWOA 3UUXA 4GA0A 2V0PA 2LXMA 4I43A 2Y4UA 4GZDA 2WXMA 5FQ4A 1L5JA 3CKBA 3CV0A 3UPVA 3CHPA 4EZKA 3TG4A 3MKQA 2OV8A 2WQ7A 5HRYA 3Q9NC 1RW2A 4ZHBA 3CVPA 2I1JA 5FQ6A 2GRRB 1N54A 3NAWA 2P9PG 5FQ8A 1OWPA 3GZ1A 4CGWA 1JWGA 2GRQB 3B7UX 3PZ2A 5BXOA 2DYRE 4JEHA 2YINA 4MS6A 3LS8A 4AM9A 4BY6A 2DCPA 4ILGA 4UWKA 3MV2B 3HDXA 3PZ4A 2A5UA 1ZU2A 1SW6A 5CEDB 4AIFA 2PQNA 1ELWA 1NA0A 2E2EA 3C3OA 4QFVA 5CECB 4JD2G 1YA0A 4FJYA 3Q47B 4IYPA 3ASFA 3KEZA 2LSVA 3ZUVB 1YMPA 4H7XA 5E76A 3L16A 4WWNA 2VYIA 4PS7A 5EX3A 2A4ZA 4C0EA 3FUDA 2V4HC 3C3RA 3AS8A 3D9NA 1NFIE 2FF4A 3KD7A 3KSQA 3I5PA 5KNHD 4EPZA 4BTBA 3CK9A 3URZA 2OEVA 5KNGA 2VGYA 4UWLA 3QDNA 1LF8A 3G2VA 1OWMA 4UQZA 3RAUA 1JCQA 1QBQA 1HS6A 3R7RA 4UI9C 4XZ4A 1FT1A 1WY6A 3L82A 4UUCA 1MYOA 2KC7A 4G8LA 2LUHA 3U4TA 3B95A 1MQSA 3TL5A 3DSVA 1KT0A 4WWPA 2XEHA 2CHWA 3CEQA 4LNUD 3SBTB 4GTPA 4UWHA 5G04C 3LEWA 2IF4A 2WPVA 5AN8A 3HXEA 4MRUA 2HO1A 5CERB 3TWTA 5FTPA 3OXLA 5ENQD 5CHEE 5CCMA 3ASHA 3O48A 3BU8A 2DBAA 3C98A 4ZFHA 2IJGX 4XE0A 4N39A 3CVLA 4FHKA 1BD8A 4LG6A 2RFMA 2Y3AA 3FU5A 1NZNA 2WXKA 4JHKA 4JL0A 4ME2A 3S2AA 3EHRA 1GW6A 1FPPA 4EBAG 4UQYA 4UI9K 2F8XK 4B93B 3G2WA 4FLBA 3FDHA 4EECA 3QK0A 2MHKA 1BI8B 3DSXA 3D9JA 4G26A 4EHMA 5EX0A 4J0UA 1TN8A 4GYWA 3UX4A 3ZYMA 4JB8P 4N3BA 2BF0X 3CIAA 3D9MA 3B13A 4U0SA 4ACLA 2WXHA 5CMYA 3QWPA 3FH7A 4HRMB 3FUHA 3SD5A 5T8IA 4B8AA 3FH5A 5T4YA 3PE4A 2AJAA 2IONA 4L2YA 1YCSB 4HQDA 3PNTB 4I9EA 1OWLA 5EKQD 2WB2A 2X6IA 5AENA 2XEEA 2UWJG 5EYLA 3MCXA 3CVXA 3JUIA 3L9TA 1BPOA 4MKTA 1Z3YA 4A63B 4B89A 3AU4A 3Q75A 4XEIG 3MA5A 2EILE 1O1SA 2YQ8A 2BKGA 4FU3A 4J8SA 4GYOA 2WXGA 3ZPJA 3AS5A 3E30A 2Y69E 3TWWA 2PZIA 1KZOA 2IY0C 3RO2A 2E0IA 3ZXPA 3FUIA 4BFRA 5ENSD 4AY5A 2Y4TA 1BLXB 5JJ6A 1HU3A 4JXTA 4BTAA 3SI5A 1H2TC 5M72A 2IO2C 3LJ3A 1LTXA 2EIME 3DSTA 4DI3A 2H6IA 3CLJA 4KT6B 1Z5SC 5G05C 3BUAA 2BEDA 1A17A 3LCAA 4Q69A 1Y6IA 2FEZA 4U8HA 2AWIA 2IU1A 3TXMA 1XNFA 3IV0A 5HQ8A 4JC8A 2OCCE 4YNDA 4FHJA 2ZISA 2YHEA 3QB2A 3TWUA 2ETCA 4I1MA 2DVWA 1N0QA 2J4BA 2J07A 4JPSA 4Z68A 4G25A 4GCNA 3CVQA 4FC8A 4I17A 3DSSA 3ESKA 2ZGGA 3Q5MA 4KYOB 1Y8MA 2FULA 2QC9A 3CHRA 5ARGA 2XRZA 3MYVA 3TWQA 1JPLA 5B1AE 2EIJE 3FUMA 3RSEG 3UM2A 3UIOC 1AWCB 1A5EA 4FP7A 4KZ0A 3LPZA 2Y0BG 3HVEA 4K5AB 4DX7D 1UG3A 3CHOA 4CT0A 4O1OA 4CDNA 3D3MA 1FVHA 3DEPA 1H6PA 2R2LA 3HXCA 3CK8A 1AP7A 4HORA 3I4RB 4OVVA 5B3SE 2XHEA 5A7DB 1EYHA 5CEAA 4ANUA 3LVRE 4NIKA 1KT1A 2DIWA 4LRZA 4BETA 4WNGA 3LY7A 3L08A 2MOWA 4L23A 3U9WA 1UOHA 2WXOA 1K8KG 3Q15A 4BX9A 2R59A 1X81A 4DX2A 2KCLA 4JHJA 5AQBA 3HRAA 3AG4E 1UJJA 3HYMB 2XS8A 1OCCE 2AXZA 3MX3A 3R9MA 5KJLA
chains in the Genus database with same CATH topology
2R03A 2OEXA 2OEVA 2R05A 3C3OA 3C3QA 5CRUA 1ZB1A 3UM1A 3C3RA 3UM3A 2XS1A 2OEWA 3RAUA 3UM0A 2R02A 4JIOA 2XS8A 2OJQA 5CRVA 3UM2A 3ULYA 3R9MA 3ZXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R03 A;  2OEV A;  2R05 A;  3C3O A;  3C3Q A;  5CRU A;  1ZB1 A;  3UM1 A;  3C3R A;  3UM3 A;  2XS1 A;  2OEW A;  3RAU A;  3UM0 A;  2R02 A;  2XS8 A;  5CRV A;  3UM2 A;  3ULY A;  3R9M A;  3ZXP A; 
#chains in the Genus database with same CATH topology
 4F1P A;  2XRY A;  4U63 A;  3T8K A;  1QZ2 A;  4KXK B;  5EYP F;  4B8C B;  4QQI A;  2QYU A;  5DBK A;  2AW6 A;  2WXR A;  1IQU A;  4BX8 A;  4YDY A;  1V54 E;  2XZD G;  3CVW A;  3BQO A;  2WQH A;  1O1T A;  3DXK G;  4GZ3 A;  3T8M A;  3RU0 A;  2KCV A;  2WMN A;  5AQA A;  4TXQ A;  5ANL A;  2L0I A;  3Q4A B;  1OXJ A;  3QJZ A;  4G23 A;  5D2M C;  1IQR A;  1HO8 A;  2P9I G;  3L6A A;  1E96 B;  3LDZ A;  1IKN D;  2JAB A;  4N5Q A;  4YDW A;  3RRN B;  3KAE A;  3RIB A;  2C0M A;  2NYJ A;  2J8S D;  4EZJ A;  4UI9 J;  2GRP B;  3ONK A;  5CCL A;  2IO3 C;  2ZGD A;  3ML8 A;  1D8D A;  3S7D A;  4TUM A;  2H6H A;  4GML A;  4A1G A;  4GMJ A;  3CR3 A;  3CK7 A;  1INZ A;  3HXF A;  3RRU A;  2KAT A;  3CSF A;  2MYO A;  5G04 J;  2BUG A;  4HLL A;  5ENN A;  3SF4 A;  3S7J A;  3CVU A;  4HXI A;  3DSU A;  3TAX A;  4YDO A;  1TJF A;  4GYY A;  1S70 B;  3E4B A;  3ZYL A;  3FUK A;  3ESL A;  2LSU A;  2IFU A;  4DJA A;  3FU3 A;  3ML9 A;  2VSX E;  3UIP C;  2P9U G;  4EBA A;  5FT9 A;  2DYS E;  4ATZ D;  4LEU A;  3ZGQ A;  4TXR A;  2CHZ A;  2ZU6 B;  1DNP A;  1DCE A;  4BT9 A;  3ONL A;  3ZNG A;  1WDY A;  2WMO A;  4RG9 A;  1OCZ E;  4JVS A;  3R9A B;  1TN7 A;  2P9K G;  4GZ6 A;  2F37 A;  3ZXS A;  3KEA A;  2PL2 A;  3FUN A;  4O1P A;  5D0Q D;  5CRV A;  3NZU A;  1HX8 A;  1MX4 A;  4L2L A;  3LJN A;  2V8S E;  2VSO E;  2CHX A;  2YNQ A;  3HIZ A;  2B6C A;  2X6K A;  3FY4 A;  3ZHE B;  2DWZ A;  2LAI A;  2J4D A;  3FFL A;  2XCB A;  4WNF A;  4IRU A;  1TEZ A;  3T5V A;  4LUN U;  3IEG A;  4HOU A;  1ELR A;  3TWX A;  3E33 A;  2R05 A;  2L6B A;  2P9N G;  4TV3 A;  3UT4 A;  1TYQ G;  2GW1 A;  1D9S A;  5FZQ A;  2ZIR A;  4N3C A;  4KBQ A;  2QYJ A;  4K03 A;  3PH0 C;  3P1U A;  4E85 A;  2KM4 A;  4UQX A;  3IBE A;  2GRL A;  4A3V A;  5BV1 A;  1K1A A;  4Q94 A;  2KZT B;  4GTV A;  3QC1 A;  3SGH A;  3CHQ A;  1MJ0 A;  1W3B A;  5BW8 C;  4ATG A;  5A23 A;  2IOS A;  3P2B A;  4HOQ A;  4DPR A;  4DUI A;  4E6H A;  4APO A;  2XPY A;  4R7L A;  3RKV A;  2P58 C;  3ZYK A;  4FUL A;  2BTD A;  2L0T B;  2R02 A;  4TUU A;  1FCH A;  1OWN A;  4OAU C;  1ELK A;  3APD A;  2PNN A;  3CKC A;  3Q78 A;  5CMW A;  3O4Z A;  3ZKJ A;  3N71 A;  3ZEF A;  4AXH A;  5T3R A;  5G05 J;  2L6J A;  4KVO A;  4YDE A;  4HRN A;  5FZR A;  2NC9 A;  2X6H A;  4PH4 B;  2XEN A;  1BI7 B;  4FA6 A;  5AIJ A;  4AJW A;  4EQF A;  5BUZ A;  4KMO A;  4GTM A;  4CZ2 D;  2XEV A;  4NQ0 A;  3TGO A;  2R5S A;  4DX1 A;  1H6K A;  1ZBP A;  3RRM B;  3TJP A;  3EJN A;  4XI0 A;  1NA3 A;  2C0L A;  4B94 A;  3V2X A;  1TNZ A;  1ZB1 A;  1P5Q A;  3B7S A;  4YVO A;  3GZ2 A;  1E90 A;  3D9I A;  1IYG A;  1G3N B;  3AG3 E;  3V2O A;  2V5Q C;  1N0R A;  4EZL A;  2R03 A;  5FJY A;  4JA9 A;  3VLF A;  4GA2 A;  3MKR A;  3UM1 A;  1NI1 A;  3NF1 A;  3EU5 A;  5EN5 D;  3L54 A;  2X6J A;  4O60 A;  2IOL A;  3AS4 A;  1H2U A;  1N4R A;  1B89 A;  1KLX A;  2LNI A;  3ULY A;  5FWQ A;  5D0O D;  4C9B B;  4PS8 A;  5DIZ A;  4M7C A;  1U3C A;  4CRW A;  1S64 A;  3SZ7 A;  3Q9U C;  3SFY A;  5LFA A;  2VSN A;  4F1S A;  4UWG A;  4GTS A;  3EDT B;  1WAO 1;  4BER A;  3DXM G;  4NRH B;  3JQ1 A;  2HM8 A;  4GZC A;  2X3M A;  2UY1 B;  2LO6 A;  3JCK C;  3PNL B;  5A6C A;  5ITZ F;  4A1S A;  2VSY A;  5BPP A;  2XZT G;  1TR4 A;  4WND A;  2RKK A;  3AJI A;  1EDU A;  4I2Z A;  4U07 A;  4HI9 A;  4U96 D;  5KCM A;  5AQ7 A;  1QYM A;  1HG2 A;  4GB9 A;  4G2V A;  3FEY A;  4ANV A;  1Q2Z A;  5HS0 A;  3UXG A;  2AXV A;  3IHY A;  3F6Q A;  3EIQ C;  3FTV A;  5FQ7 A;  4GPM A;  3CQG B;  4A3T A;  4I6E A;  4RSY A;  4RVB A;  3LXU X;  3ULE G;  2ILR A;  1TNU A;  4U0Z A;  3PVL A;  3ASD A;  5ENP D;  4GMR A;  2RFA A;  3B7T A;  4PS3 A;  5C2Y A;  2CFZ A;  3CHM A;  2P9S G;  1E7U A;  3JYS A;  4N2S A;  2WM9 A;  3EHQ A;  4L1B A;  3ABK E;  2FO1 E;  2GRM A;  4N5C A;  4I6J A;  1N95 A;  4XIF A;  5E75 A;  3QWV A;  5LCW C;  4XKB A;  3IKO B;  1DC2 A;  2J49 A;  1UN9 A;  2H6F A;  3T9K A;  3MGB A;  4FAD A;  4DRX E;  3PUK A;  4CT4 A;  1BU9 A;  2YHC A;  4TRQ A;  3QWW A;  3RO3 A;  3V79 K;  1H19 A;  1HZ4 A;  3TG5 A;  3RJV A;  1PC2 A;  3S7B A;  5KJM A;  3NQP A;  3ASO E;  4U7E B;  4V3I A;  2GGF A;  4JW1 A;  5J08 A;  5JMN D;  4F3V A;  3IHV A;  4LER A;  4BEP A;  3ABM E;  5KJN A;  3C5R A;  3HXB A;  5JJ7 A;  2VTB B;  2HR2 A;  3PEV B;  3FTW A;  5KBA A;  1HXI A;  4WNE A;  3UKR G;  3PRE A;  3CVV A;  3D9P A;  4AVX A;  3ZRH A;  2XPZ A;  5ARF A;  3FH8 A;  4FLH A;  4N3A A;  3K9I A;  1LD7 A;  3NZS A;  4F7A A;  1IXV A;  1VDY A;  3OAW A;  3PDN A;  4GAA A;  2HE0 A;  3DEO A;  3BEE A;  3E37 A;  4BSZ B;  4I6G A;  1LD8 A;  4I1O B;  2XGO A;  2PQR A;  5D66 A;  3SO8 A;  2VQ2 A;  4L7T A;  3MV3 B;  3PEU B;  3UT7 A;  3UT8 A;  4K5C A;  3S7F A;  4DLQ A;  3R7Q A;  1YYH A;  1HFA A;  2OVF A;  2WVI A;  5FIO A;  4ABN A;  4HRL A;  2XS1 A;  2WXN A;  5EID A;  3VTX A;  2X6F A;  3APF A;  3G2S A;  3QAQ A;  2VGX B;  2R17 C;  1JCR A;  3OXG A;  4K0R A;  1RZ4 A;  1SVX A;  2ETA A;  3JXJ A;  4CGV A;  4W9R A;  1HG5 A;  2ZXW E;  1E8X A;  1D8E A;  2OOE A;  3QOU A;  3PZ3 A;  3DPD A;  3CVY A;  3QKY A;  2XGM A;  3SBS A;  1TNY A;  3BG1 B;  3GW4 A;  3ZFW A;  4FJZ A;  4I9C A;  4APF A;  3PE3 A;  1OY3 D;  4GTR A;  2V4L A;  3ZVV A;  4OYS A;  4I2W A;  4JA7 A;  3SFZ A;  4HS2 A;  3SNX A;  3B7R L;  5LX8 A;  4PUC A;  4GCO A;  4ILH B;  3UM0 A;  3ZHE A;  4DI4 A;  1TN6 A;  5IY5 E;  3UKU G;  3TXN A;  1N4Q A;  4C0M A;  1X5B A;  4A55 A;  5CBO A;  4N2Q A;  5ANR A;  5FIN A;  4HNA D;  4AOF A;  4J7W A;  2AVP A;  3OXF A;  1SZ9 A;  2PM6 A;  2P2C P;  4ANX A;  1Z6T A;  4X8Q A;  2J9Q A;  3MKQ B;  4G11 A;  4RQI A;  3PZD A;  5C1D A;  4HFG A;  5HKP A;  5EDS A;  3C3Q A;  1E8W A;  3Q73 A;  4Q96 A;  3V31 A;  5JJT A;  2GRN B;  1HF8 A;  3Q7A A;  3U3W A;  3LY9 A;  2KZT A;  3WXX A;  4AEZ C;  3ZN3 A;  2BKK B;  5EIL A;  4G24 A;  4BES A;  4IUL A;  2RD0 A;  4XI9 A;  2B0O E;  1JUQ A;  3EHM A;  2NSZ A;  3GYZ A;  4KVM A;  2FBN A;  1OUV A;  4OVU A;  1WG0 A;  4DX5 D;  2I1K A;  3ABL E;  2I6H A;  3L13 A;  3X2Q E;  4GU5 A;  3KSL A;  2EQX A;  3CQC B;  4CYM D;  3FTS A;  4CEM A;  4M3O A;  3JUE A;  4HVB A;  5H7P A;  5AAO A;  1DVP A;  3W9F A;  4ANW A;  1SA5 A;  3C72 A;  3UQ3 A;  1TJC A;  1S0P A;  5ENO D;  5J90 A;  1XGW A;  5CRU A;  3Q49 B;  3G2T A;  1H6O A;  4OAV B;  4U0U A;  2MRI A;  2WXJ A;  3FU6 A;  3ZYQ A;  1OWO A;  2WXL A;  4L9P A;  3I4G A;  2JEK A;  2EIN E;  4JHR A;  5CBN A;  3NOC D;  5JA4 D;  3FTZ A;  3UMV A;  2F0Y A;  4IN3 B;  4DX6 D;  1OT8 A;  3EIJ A;  3HXD A;  4HOT A;  4URK A;  1MHQ A;  2J08 A;  3L22 A;  3DPY A;  4CDR A;  5KWD A;  3G2U A;  1V55 E;  3TWS A;  5AQ9 A;  3T5X A;  1WM5 A;  3B7B A;  2H6G A;  1UW4 B;  2PM7 A;  3UI2 A;  2ETB A;  3SQV A;  2VGE A;  3I3N A;  3ZU7 B;  3E34 A;  4AP2 A;  4LCT A;  3NBN B;  4U8Y D;  3CVN A;  3FP3 A;  1JWF A;  4J8F A;  4HI8 A;  2I9C A;  4TXP A;  3RK6 A;  3PRZ A;  4WUY A;  3SFX A;  4GPK A;  1FT2 A;  5LOZ A;  3GZS A;  1N4S A;  3D9L A;  4RG6 A;  3JQ0 A;  4B0Z A;  4J8D A;  3QAR A;  1UJK A;  4BT8 A;  3D9O A;  2IQC A;  2V5F A;  1SZA A;  2X38 A;  3UIN C;  3MJW A;  4G1T A;  2CG2 A;  4JEU A;  1JCS A;  2A5E A;  4AV7 A;  1EF1 C;  4XKC A;  4P29 A;  5LCW J;  1N52 A;  3U66 A;  4DK5 A;  2LAH A;  2P9L G;  5BNW A;  3SY2 A;  1O5M A;  2DZN A;  1NP7 A;  3Q7F A;  2IEJ A;  5ENR D;  3AU5 A;  2OND A;  2C2L A;  3EUV A;  4Y6C A;  3NOG D;  5FZS A;  2UY1 A;  3FUE A;  1IHG A;  4GTO A;  2XCC A;  4ILI A;  4LNG A;  3FUJ A;  2F8Y A;  2FI7 A;  2GRO B;  1U3D A;  1E8Y A;  2DZO A;  4J8E A;  5G55 A;  4H7Y A;  3ZIM A;  3BG0 B;  3CGH A;  2CFU A;  3U64 A;  3AG2 E;  4Y6W A;  3HG0 D;  1K1B A;  4MBG A;  1E7V A;  3VLD A;  3NB2 A;  4C48 B;  4LSZ E;  3OTN A;  2VJ8 A;  5G2N A;  5AJL A;  2KBX A;  4G8K A;  4BSX A;  1TNB A;  2WXI A;  3IXE A;  3FU0 A;  1MX2 A;  3D9K A;  3PZ1 A;  4ACK A;  4GZ5 A;  2M63 A;  1N4P A;  4HLE A;  3PS6 A;  2L9B A;  5HI7 A;  2RG8 A;  2QY7 A;  1H0A A;  3VTY A;  4LNB A;  4NUR A;  2KXP C;  3ENE A;  3W9G A;  2EIK E;  4O6F A;  3DBS A;  4JZY A;  3V30 A;  1PAQ A;  5B1B E;  4GA1 A;  1S63 A;  2KCK A;  3EHN A;  3KS2 A;  4WAF A;  1H2V C;  2OVB A;  1N11 A;  2J09 A;  3ASN E;  5JHB A;  3ZW3 A;  3FHE A;  3FWV A;  4PDX A;  5ENT D;  4HOS A;  3DRA A;  1SA4 A;  3J5Q B;  3FTU A;  4F53 A;  2WQ6 A;  1QNF A;  5KJK A;  1OCR E;  3DSW A;  1PY1 A;  4RLY A;  1DCQ A;  1UN8 A;  3Q79 A;  1K3Z D;  5AAR A;  3PUJ A;  1HE8 A;  2XGS A;  1FVF A;  3UM3 A;  2XPI A;  1O1R A;  3LVQ E;  5EIB E;  4CCA A;  3ULQ A;  2VTB A;  1OCO E;  1SQM A;  2LXL A;  4NAC A;  4HB5 A;  4J8Y A;  3L17 A;  4AY6 A;  3J5P A;  3VLE A;  4D10 C;  3AG1 E;  2FO7 A;  3SHF A;  3TWV A;  3CST A;  3FUF A;  4K5B A;  4U8V D;  3TWR A;  4CDM A;  2AXU A;  4KZC A;  3HVE B;  3LYA A;  3FEX A;  3HHM A;  3UTM A;  2JLB A;  5AYW D;  1MZC A;  4MLP A;  3AAA C;  3LKU A;  4DLO A;  4XX5 A;  4J6I A;  2HYZ A;  3APC A;  2OEW A;  3FTX A;  3MZL B;  5JHA A;  2WXP A;  5BV0 A;  4BWR A;  3QNK A;  1KPS B;  4HBD A;  3WG7 E;  1EPU A;  2VGX A;  2WXQ A;  3DWL G;  3D9H A;  1QQE A;  4U95 D;  3LY8 A;  1N94 A;  2I2O A;  4GTT A;  1TNO A;  1Z3X A;  5BT1 A;  3FUL A;  5LP0 A;  1NL4 A;  2QFC A;  1U2V G;  2XQ0 A;  4GTQ A;  5BXU A;  3E32 A;  3CHS A;  5AJD A;  1KZP A;  3MEK A;  2NXP A;  1MX6 A;  2WXF A;  4U04 A;  1N9A A;  3FTY A;  4F6R D;  3JXI A;  1IHB A;  2Q7F A;  4UWF A;  1HH8 A;  3ASG A;  2QZA A;  2CG3 A;  4YVQ C;  3EU9 A;  3ISM C;  2Y1L E;  4I1A A;  1E8Z A;  4WWO A;  3UUX A;  4GA0 A;  2V0P A;  2LXM A;  4I43 A;  2Y4U A;  4GZD A;  2WXM A;  5FQ4 A;  1L5J A;  3CKB A;  3CV0 A;  3UPV A;  3CHP A;  4EZK A;  3TG4 A;  3MKQ A;  2OV8 A;  2WQ7 A;  5HRY A;  3Q9N C;  1RW2 A;  4ZHB A;  3CVP A;  2I1J A;  5FQ6 A;  2GRR B;  1N54 A;  3NAW A;  2P9P G;  5FQ8 A;  1OWP A;  3GZ1 A;  4CGW A;  1JWG A;  2GRQ B;  3B7U X;  3PZ2 A;  5BXO A;  2DYR E;  4JEH A;  2YIN A;  4MS6 A;  3LS8 A;  4AM9 A;  4BY6 A;  2DCP A;  4ILG A;  4UWK A;  3MV2 B;  3HDX A;  3PZ4 A;  2A5U A;  1ZU2 A;  1SW6 A;  5CED B;  4AIF A;  2PQN A;  1ELW A;  1NA0 A;  2E2E A;  3C3O A;  4QFV A;  5CEC B;  4JD2 G;  1YA0 A;  4FJY A;  3Q47 B;  4IYP A;  3ASF A;  3KEZ A;  2LSV A;  3ZUV B;  1YMP A;  4H7X A;  5E76 A;  3L16 A;  4WWN A;  2VYI A;  4PS7 A;  5EX3 A;  2A4Z A;  4C0E A;  3FUD A;  2V4H C;  3C3R A;  3AS8 A;  3D9N A;  1NFI E;  2FF4 A;  3KD7 A;  3KSQ A;  3I5P A;  5KNH D;  4EPZ A;  4BTB A;  3CK9 A;  3URZ A;  2OEV A;  5KNG A;  2VGY A;  4UWL A;  3QDN A;  1LF8 A;  3G2V A;  1OWM A;  4UQZ A;  3RAU A;  1JCQ A;  1QBQ A;  1HS6 A;  3R7R A;  4UI9 C;  4XZ4 A;  1FT1 A;  1WY6 A;  3L82 A;  4UUC A;  1MYO A;  2KC7 A;  4G8L A;  2LUH A;  3U4T A;  3B95 A;  1MQS A;  3TL5 A;  3DSV A;  1KT0 A;  4WWP A;  2XEH A;  2CHW A;  3CEQ A;  4LNU D;  3SBT B;  4GTP A;  4UWH A;  5G04 C;  3LEW A;  2IF4 A;  2WPV A;  5AN8 A;  3HXE A;  4MRU A;  2HO1 A;  5CER B;  3TWT A;  5FTP A;  3OXL A;  5ENQ D;  5CHE E;  5CCM A;  3ASH A;  3O48 A;  3BU8 A;  2DBA A;  3C98 A;  4ZFH A;  2IJG X;  4XE0 A;  4N39 A;  3CVL A;  4FHK A;  1BD8 A;  4LG6 A;  2RFM A;  2Y3A A;  3FU5 A;  1NZN A;  2WXK A;  4JHK A;  4JL0 A;  4ME2 A;  3S2A A;  3EHR A;  1GW6 A;  1FPP A;  4EBA G;  4UQY A;  4UI9 K;  2F8X K;  4B93 B;  3G2W A;  4FLB A;  3FDH A;  4EEC A;  3QK0 A;  2MHK A;  1BI8 B;  3DSX A;  3D9J A;  4G26 A;  4EHM A;  5EX0 A;  4J0U A;  1TN8 A;  4GYW A;  3UX4 A;  3ZYM A;  4JB8 P;  4N3B A;  2BF0 X;  3CIA A;  3D9M A;  3B13 A;  4U0S A;  4ACL A;  2WXH A;  5CMY A;  3QWP A;  3FH7 A;  4HRM B;  3FUH A;  3SD5 A;  5T8I A;  4B8A A;  3FH5 A;  5T4Y A;  3PE4 A;  2AJA A;  2ION A;  4L2Y A;  1YCS B;  4HQD A;  3PNT B;  4I9E A;  1OWL A;  5EKQ D;  2WB2 A;  2X6I A;  5AEN A;  2XEE A;  2UWJ G;  5EYL A;  3MCX A;  3CVX A;  3JUI A;  3L9T A;  1BPO A;  4MKT A;  1Z3Y A;  4A63 B;  4B89 A;  3AU4 A;  3Q75 A;  4XEI G;  3MA5 A;  2EIL E;  1O1S A;  2YQ8 A;  2BKG A;  4FU3 A;  4J8S A;  4GYO A;  2WXG A;  3ZPJ A;  3AS5 A;  3E30 A;  2Y69 E;  3TWW A;  2PZI A;  1KZO A;  2IY0 C;  3RO2 A;  2E0I A;  3ZXP A;  3FUI A;  4BFR A;  5ENS D;  4AY5 A;  2Y4T A;  1BLX B;  5JJ6 A;  1HU3 A;  4JXT A;  4BTA A;  3SI5 A;  1H2T C;  5M72 A;  2IO2 C;  3LJ3 A;  1LTX A;  2EIM E;  3DST A;  4DI3 A;  2H6I A;  3CLJ A;  4KT6 B;  1Z5S C;  5G05 C;  3BUA A;  2BED A;  1A17 A;  3LCA A;  4Q69 A;  1Y6I A;  2FEZ A;  4U8H A;  2AWI A;  2IU1 A;  3TXM A;  1XNF A;  3IV0 A;  5HQ8 A;  4JC8 A;  2OCC E;  4YND A;  4FHJ A;  2ZIS A;  2YHE A;  3QB2 A;  3TWU A;  2ETC A;  4I1M A;  2DVW A;  1N0Q A;  2J4B A;  2J07 A;  4JPS A;  4Z68 A;  4G25 A;  4GCN A;  3CVQ A;  4FC8 A;  4I17 A;  3DSS A;  3ESK A;  2ZGG A;  3Q5M A;  4KYO B;  1Y8M A;  2FUL A;  2QC9 A;  3CHR A;  5ARG A;  2XRZ A;  3MYV A;  3TWQ A;  1JPL A;  5B1A E;  2EIJ E;  3FUM A;  3RSE G;  3UM2 A;  3UIO C;  1AWC B;  1A5E A;  4FP7 A;  4KZ0 A;  3LPZ A;  2Y0B G;  3HVE A;  4K5A B;  4DX7 D;  1UG3 A;  3CHO A;  4CT0 A;  4O1O A;  4CDN A;  3D3M A;  1FVH A;  3DEP A;  1H6P A;  2R2L A;  3HXC A;  3CK8 A;  1AP7 A;  4HOR A;  3I4R B;  4OVV A;  5B3S E;  2XHE A;  5A7D B;  1EYH A;  5CEA A;  4ANU A;  3LVR E;  4NIK A;  1KT1 A;  2DIW A;  4LRZ A;  4BET A;  4WNG A;  3LY7 A;  3L08 A;  2MOW A;  4L23 A;  3U9W A;  1UOH A;  2WXO A;  1K8K G;  3Q15 A;  4BX9 A;  2R59 A;  1X81 A;  4DX2 A;  2KCL A;  4JHJ A;  5AQB A;  3HRA A;  3AG4 E;  1UJJ A;  3HYM B;  2XS8 A;  1OCC E;  2AXZ A;  3MX3 A;  3R9M A;  5KJL A; 
#chains in the Genus database with same CATH homology
 2R03 A;  2OEX A;  2OEV A;  2R05 A;  3C3O A;  3C3Q A;  5CRU A;  1ZB1 A;  3UM1 A;  3C3R A;  3UM3 A;  2XS1 A;  2OEW A;  3RAU A;  3UM0 A;  2R02 A;  4JIO A;  2XS8 A;  2OJQ A;  5CRV A;  3UM2 A;  3ULY A;  3R9M A;  3ZXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...