3C3QA

Alix bro1-domain:chmip4b co-crystal structure
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
357
structure length
357
Chain Sequence
ATFISVQLKKTSEVDLAKPLVKFIQQTYPSGGEEQAQYCRAAEELSKLRRAAVGRPLDKHEGALETLLRYYDQICSIEPKFPFSENQICLTFTWKDAFDKGSLFGGSVKLALASLGYEKSCVLFNCAALASQIAAEQNLDNDEGLKIAAKHYQFASGAFLHIKETVLSALSREPTVDISPDTVGTLSLIMLAQAQEVFFLKATRDKMKDAIIAKLANQAADYFGDAFKQCQYKDTLPKEVFPVLAAKHCIMQANAEYHQSILAKQQKKFGEEIARLQHAAELIKTVASRYDEYVNVKDFSDKINRALAAAKKDNDFIYHDRVPDLKDLDPIGKATLVKSTPVNVPISQKFTDLFEKM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 6-interacting protein
publication title ALIX-CHMP4 interactions in the human ESCRT pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 118
structure length 357
sequence length 357
ec nomenclature
pdb deposition date 2008-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.280 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat alix/aip1 like domains 3c3qA00
5CRVA 2XS1A 3ULYA 2R05A 3C3OA 2R03A 3UM0A 1ZB1A 3UM2A 3C3QA 2OEVA 3ZXPA 3RAUA 2XS8A 2R02A 3UM1A 3C3RA 3UM3A 5CRUA 2OEWA 3R9MA
chains in the Genus database with same CATH superfamily
3D9HA 3RSEG 2VGXA 3PVLA 4F1SA 1N94A 3LY7A 4KBQA 3DSWA 3ONLA 4WAFA 3PNTB 4TXQA 4ZFHA 1ZBPA 3SF4A 3LEWA 4BFRA 4XEIG 2HE0A 1TN8A 2EIJE 3E34A 4DX7D 3CHPA 4WNGA 2X3MA 4U0UA 2FI7A 5J08A 3TAXA 2V4HC 3IV0A 4N5QA 4A55A 2XCBA 1S63A 4FLHA 4GMRA 1A17A 4G25A 5G05C 2OEWA 4U8HA 3R7RA 2NSZA 1QZ2A 3G2VA 3MKRA 4JHKA 2MRIA 4PS3A 4U96D 3TXNA 2VSYA 2P9SG 2IJGX 1ELRA 4PS8A 5CCLA 5CMYA 3ZXSA 3TWSA 3ABME 4R7LA 3TGOA 1V55E 3DSTA 3T8MA 3Q47B 3JCKC 4WWPA 4GAAA 4ILHB 4GB9A 2LSVA 3ZFWA 1L5JA 2X6HA 3UI2A 4O1PA 5BV1A 4U95D 3VLEA 2PQRA 4I17A 3Q73A 4XE0A 1E90A 4K5AB 3ZYKA 4G26A 4TRQA 1TJFA 3ML8A 3Q7AA 1OUVA 4OVUA 2GGFA 5ENQD 4GZ5A 4DI4A 2ONDA 4PS7A 3ISMC 4I1MA 5FQ4A 3IEGA 2MYOA 1MX6A 4GYWA 4HLLA 3U64A 2NC9A 2P9KG 2RFAA 5E75A 1TNYA 2Q7FA 3LPZA 4JB8P 3L13A 3ZIMA 4HXIA 4M7CA 3X2QE 4DX1A 1IHGA 1E8YA 4G8KA 3C3QA 3LJ3A 3SFZA 3TWXA 5BXUA 4NQ0A 3OXFA 3D9PA 2DBAA 3Q75A 2E0IA 5EIDA 4DX5D 1H2UA 1LD8A 2WQHA 4FHJA 4C48B 2CFUA 4JA7A 5BXOA 2XZDG 1MZCA 2X6IA 4JL0A 3PZ3A 3Q78A 3E37A 4I2WA 4JA9A 3U9WA 2XHEA 3IXEA 5AJDA 3SFXA 3GZSA 5ENPD 1KZPA 5T4YA 1UG3A 2YHEA 1TNBA 3L22A 3SFYA 3D9LA 3V2XA 3W9FA 3C5RA 3L17A 3PEVB 4CDMA 4CYMD 2GRRB 3PZ2A 4L2YA 3RO2A 3PUKA 3AAAC 1O1SA 2XPIA 5FINA 4D10C 1UJKA 3DPYA 1SQMA 4LG6A 4B93B 2F8YA 1JCRA 3FH5A 3DEPA 2WPVA 4DI3A 4HI8A 4NACA 4RVBA 1UN9A 1HFAA 4AXHA 4UWGA 3E4BA 5AQAA 1FT2A 4N3AA 3MX3A 4YDOA 5C2YA 5FJYA 1X5BA 5IY5E 2QC9A 3B7RL 3UPVA 4YVQC 3FTZA 3FH8A 3QNKA 3ESLA 4NIKA 3FU6A 2H6FA 3ZW3A 3SY2A 1NZNA 3AU5A 3JQ0A 2Y4TA 3FUEA 4KZ0A 2MOWA 4N39A 4EHMA 2WVIA 5DIZA 4KXKB 2X6FA 4G23A 2WXLA 3QWVA 4LNUD 3P1UA 5FTPA 5AQ9A 3BU8A 5EN5D 3W9GA 1HG2A 3Q15A 3CVYA 2KZTB 3ASDA 3FUDA 4AOFA 2VQ2A 5A23A 3ZYLA 3CEQA 5JJTA 5HQ8A 4CDNA 2XZTG 2B0OE 4CRWA 2R05A 4NRHB 2IF4A 3CHSA 3N71A 4FC8A 3FTWA 2AWIA 5EX3A 4GYOA 1A5EA 1HXIA 1MJ0A 2QY7A 3VTXA 3FU3A 4EBAA 4EZKA 2IOLA 2OV8A 3B7TA 4DUIA 4IULA 2LNIA 3G2WA 2F37A 4YNDA 5LCWJ 3WXXA 3MYVA 4C0EA 2GRLA 4PDXA 5BUZA 4WNFA 4HOTA 3OTNA 1MYOA 2OVBA 3Q79A 3DSVA 3ABLE 2J07A 3CVNA 3ZXPA 3S7JA 2GRNB 2EINE 3KSLA 4E85A 4EZLA 2XGMA 3EHRA 1H0AA 3SI5A 2AXVA 4A3VA 3NZSA 1OWPA 3LCAA 3JQ1A 5LFAA 1IKND 5AQBA 4I9EA 3CVWA 4QQIA 2WXMA 4CEMA 3OAWA 4Q94A 3Q5MA 3BQOA 4GMLA 4ANWA 1D9SA 2AJAA 1MX2A 4L7TA 4U63A 4XIFA 2RKKA 1HO8A 1XNFA 4CDRA 3UIOC 4Y6CA 3KSQA 5HS0A 2HO1A 2LSUA 2YINA 3CK8A 2XS1A 4FP7A 3I5PA 3CSTA 1OWOA 3NF1A 1D8EA 3VTYA 1FPPA 1EDUA 3CVXA 1HX8A 3TG4A 2KZTA 3ZGQA 2CG2A 1SW6A 1Y8MA 4Y6WA 3Q9UC 3E33A 4G24A 1Z6TA 3GZ2A 5ARFA 4BEPA 3NQPA 1QBQA 3KEZA 3ZRHA 4E6HA 2XEVA 4U07A 1LTXA 2DWZA 1JUQA 3SHFA 4GCNA 3UX4A 3ZHEB 2ZXWE 4GZ6A 1DC2A 1OCRE 4G8LA 3SD5A 4EECA 3P2BA 1GW6A 1PY1A 2XPZA 3KEAA 2IU1A 3QB2A 5HRYA 3I4GA 4OAUC 4A3TA 3J5QB 4NURA 2IFUA 4TUMA 3HXDA 3S7BA 2CHXA 3U3WA 3L54A 4TXRA 4GPMA 2VTBA 4HBDA 3FUIA 3LYAA 1FCHA 4AVXA 3FWVA 4ANVA 1EYHA 1YYHA 4FADA 2J9QA 1UJJA 4B94A 5FZRA 4I2ZA 5CMWA 4JEUA 4XI9A 4GTMA 5LP0A 4GPKA 1E8WA 2YHCA 1P5QA 4GU5A 1NA0A 3ZEFA 2PM7A 2RD0A 1QYMA 3CHMA 2VGYA 4RSYA 3TXMA 3UINC 2DCPA 4JVSA 1AP7A 3HRAA 2XS8A 3GZ1A 1V54E 2V5FA 3NBNB 1LF8A 3F6QA 4TUUA 3HVEB 1DVPA 1OCCE 4LUNU 2FF4A 3BEEA 1RW2A 2FEZA 4ANXA 2LAIA 1W3BA 3E30A 3TWQA 2UWJG 3LS8A 3CIAA 2GRPB 1SA4A 2HR2A 4QFVA 4J8YA 3CK7A 3U4TA 3O48A 3ZVVA 5KCMA 3UM1A 4GTVA 4BT9A 3ZHEA 3DBSA 1K1AA 3UT4A 1JWGA 3TJPA 3LJNA 4U04A 2AVPA 1SA5A 3UT7A 2J08A 2Y4UA 4URKA 4GCOA 4HOQA 4B8CB 2P9UG 4GA2A 4YDEA 4GTTA 3Q49B 3Q4AB 5A6CA 3ZN3A 3RIBA 2R17C 1VDYA 5FZQA 3RAUA 1N4QA 4UI9J 5CHEE 5KBAA 3FY4A 4GMJA 4XKBA 3R7QA 2XRZA 4Q96A 1O1TA 2H6GA 1BPOA 4WNEA 2ILRA 3HYMB 1ELKA 2X38A 4BWRA 4F53A 2QZAA 4JC8A 2DZNA 4DLOA 1JPLA 1QQEA 2DYRE 1NFIE 3LXUX 1DCEA 4BY6A 3JUIA 4UUCA 3ENEA 5FWQA 3CK9A 4RG6A 1OWLA 3DXKG 3FU0A 3PZ4A 1N0QA 2JEKA 3B7UX 4ILGA 4U0ZA 4DPRA 2PQNA 1Z3YA 5EYPF 2WXOA 2WXFA 2R2LA 4J8DA 4K5BA 3EJNA 2P58C 3V2OA 3NB2A 5D66A 4LERA 3FHEA 2XENA 5D0QD 1OXJA 5KJNA 3NAWA 2L6BA 2WXRA 3FTXA 3FDHA 2WQ6A 2B6CA 4DX2A 1E8XA 1H2VC 5AN8A 3IHYA 1ELWA 1S64A 4I1AA 4AP2A 3QOUA 2P9PG 2I1JA 4LEUA 3BG0B 4J7WA 2WM9A 2R59A 4HFGA 4HI9A 3CQCB 3SO8A 4GTOA 2QYUA 4RLYA 3JXIA 2EIME 4N2SA 5LX8A 3CQGB 3CHOA 3DXMG 2PZIA 4N3CA 2X6JA 4OVVA 1TNOA 3D3MA 3FTVA 5ENRD 1E7VA 5LCWC 3D9IA 4KVMA 5CBNA 4G11A 2J8SD 5KJMA 2C0LA 4XZ4A 2JABA 1KLXA 1HS6A 5M72A 5KWDA 2XCCA 3G2UA 1NL4A 5C1DA 2BKKB 3UMVA 4EPZA 3LDZA 1N9AA 2J4DA 3PE3A 4AM9A 4PUCA 2P2CP 5A7DB 4DLQA 4LCTA 5BPPA 3FP3A 3MEKA 1BI7B 3HXBA 4F6RD 2LO6A 1MX4A 3APDA 3ABKE 2QFCA 3SZ7A 3UQ3A 4J8EA 2KCVA 4HLEA 4FHKA 2KATA 2L0TB 1K8KG 1H6KA 4DJAA 4AJWA 3CVLA 3C3OA 4JZYA 4JPSA 4GA1A 1E96B 3V79K 3FUJA 5D2MC 1Z3XA 1SZ9A 2I2OA 2V0PA 1H6PA 5ITZF 3Q7FA 2C2LA 3QC1A 4V3IA 3EHQA 4BT8A 2VSNA 3C72A 2IY0C 4O60A 2LUHA 5JMND 1G3NB 5B3SE 4BX8A 4GTRA 5DBKA 1JCQA 4PH4B 4A63B 3FTYA 3B95A 5KJKA 2Y69E 1YMPA 1E8ZA 3T5VA 3TWVA 3LY8A 3HXFA 1WAO1 5AJLA 5ENTD 4O1OA 2L9BA 3DSSA 2J49A 3RRNB 4MBGA 2XRYA 3SQVA 2Y3AA 4N3BA 2JLBA 4GTPA 2A5EA 4B89A 5HKPA 1PAQA 4KMOA 1NA3A 3CHQA 3MJWA 3ZNGA 3PEUB 4IN3B 4LSZE 1WG0A 4F3VA 2ZU6B 1ZB1A 2WXPA 5JHAA 3LVRE 2A5UA 2CFZA 1OWMA 4I9CA 2WB2A 3CGHA 3C98A 1RZ4A 3O4ZA 3PS6A 3TWWA 3HHMA 5J90A 2IONA 1HF8A 1HU3A 2XEEA 3ZPJA 3ZUVB 5FZSA 3IHVA 4UQYA 2FO7A 3MKQB 4LRZA 3ZU7B 3JYSA 1UOHA 1IQRA 3CKCA 3E32A 5CRUA 3OXGA 5BT1A 5CEAA 1E7UA 3FUKA 3TWRA 3I3NA 2VGEA 4UWHA 3FEXA 4WWNA 3NOGD 1TN6A 3PREA 4ANUA 3MCXA 1YCSB 3RJVA 4BX9A 3CR3A 5G2NA 3B7BA 3S7FA 3ZYQA 1BI8B 2V8SE 3D9KA 3LY9A 2VSOE 4ATZD 4HOUA 1NP7A 4AY5A 2IO2C 1INZA 3IBEA 3R9AB 5G04J 5KNGA 4WWOA 2WQ7A 2BTDA 5EX0A 2IQCA 4KYOB 1IHBA 4U7EB 4YDWA 3S7DA 3UM2A 4LNGA 5B1AE 2GROB 3AS4A 4HRMB 4KVOA 4GA0A 2KC7A 3CVQA 1KT0A 3V31A 3AG2E 4GZDA 4MRUA 4APFA 4WNDA 1YA0A 5JA4D 1HE8A 3AJIA 3HXEA 5FT9A 1TYQG 4AEZC 3D9NA 3T5XA 3AG1E 5AQ7A 2OVFA 3ASNE 4APOA 3VLDA 3B7SA 2J4BA 1MHQA 3RRMB 4YDYA 1TJCA 3UKUG 4UI9C 3DSUA 3ULYA 2GRQB 3D9OA 4FULA 3KAEA 2WXHA 4JHJA 2WXJA 1TEZA 2XQ0A 5CERB 5KNHD 4GYYA 4UWKA 2H6HA 3APCA 3FULA 4K5CA 2GW1A 2DIWA 4ACLA 3EUVA 1K1BA 2C0MA 3SBTB 4AY6A 2LXMA 1Q2ZA 4C0MA 2I6HA 2GRMA 2P9IG 2OCCE 2AW6A 4G1TA 4CGVA 3L08A 4CT4A 4Z68A 3UUXA 4HNAD 5BW8C 1EF1C 3RKVA 1H6OA 4BTAA 1OWNA 2WMNA 3RK6A 4U8YD 1HZ4A 1S0PA 3JUEA 3Q9NC 3APFA 3CSFA 5JHBA 1FVFA 3DPDA 5E76A 1HH8A 4MLPA 1X81A 1KZOA 3RRUA 3ASHA 4M3OA 5FIOA 4DX6D 2P9LG 4BESA 2BKGA 3FUNA 2DYSE 4X8QA 2KBXA 2WXGA 3MZLB 5KJLA 2EILE 4U0SA 1WDYA 1UW4B 4CZ2D 3PE4A 4FU3A 1N11A 2Y0BG 3HXCA 4KT6B 2NYJA 3VLFA 4BTBA 1IQUA 3RO3A 3V30A 2DVWA 2MHKA 3L6AA 2EQXA 4DRXE 3ASFA 4HS2A 2CG3A 4G2VA 3QK0A 5H7PA 3TWUA 1HG5A 4IYPA 1D8DA 4J8SA 3HVEA 3PNLB 1N52A 1FT1A 2IEJA 3PRZA 3QWWA 2RG8A 3DEOA 3BG1B 2ETBA 2EIKE 4DK5A 2R03A 4UWLA 3CVUA 3EIJA 2R5SA 4U8VD 4ACKA 3ULEG 2ZGGA 3CVVA 3LKUA 2F8XK 5AYWD 5G05J 4F1PA 3C3RA 3FUHA 3RU0A 5BV0A 3J5PA 4Q69A 5ANRA 4JHRA 1QNFA 2OOEA 2WMOA 2FBNA 4OAVB 4B0ZA 4H7YA 1BLXB 3IKOB 4L23A 1U3CA 3FUFA 2RFMA 1KT1A 4AV7A 3U66A 3GW4A 2VSXE 2QYJA 1IYGA 5EYLA 2OEVA 4I1OB 3FTUA 3ML9A 3UIPC 3L9TA 1XGWA 3WG7E 4A1SA 1N4RA 3UT8A 3UM3A 3GYZA 2ZISA 3CKBA 3G2TA 5AIJA 3S2AA 1N54A 3MV3B 4L9PA 4IRUA 4GZ3A 4JW1A 5FQ7A 1N95A 3TG5A 5CCMA 2UY1B 2HYZA 4OYSA 3HDXA 3CHRA 1TR4A 4MS6A 4CGWA 5CECB 3SGHA 2XEHA 5ANLA 1BU9A 4I43A 3EIQC 3ESKA 3UKRG 2ETAA 3MGBA 4JEHA 1IXVA 2PL2A 3CV0A 3ONKA 3EU9A 3FUMA 4MKTA 2H6IA 4N2QA 5B1BE 2I1KA 1KPSB 4LNBA 4GZCA 1WY6A 3QKYA 2PNNA 4I6JA 2A4ZA 3ULQA 3AS5A 4HB5A 2M63A 4C9BB 4EZJA 3NZUA 2YNQA 3ASOE 1N0RA 3HG0D 2BF0X 4CT0A 1H19A 3PZ1A 5BNWA 3I4RB 1O5MA 4ILIA 4EQFA 5FQ8A 4BERA 1OCZE 3BUAA 2XGOA 1TN7A 4TV3A 3NOCD 4HOSA 4XKCA 5EIBE 5AARA 4EBAG 4UQXA 4K0RA 3T9KA 1Z5SC 1DNPA 1K3ZD 5D0OD 4L2LA 4L1BA 5CEDB 2CHWA 4A1GA 1BD8A 2ZGDA 1N4SA 4RQIA 2FO1E 2E2EA 1NI1A 3R9MA 3AG3E 2WXNA 1LD7A 2L0IA 3SBSA 5T8IA 3G2SA 4BSXA 1OY3D 3L16A 3PUJA 4I6EA 5ARGA 5ENSD 4J8FA 1FVHA 2KCLA 2UY1A 5FQ6A 4JD2G 3EHNA 4UQZA 4UWFA 2HM8A 5G04C 1Y6IA 1JCSA 3FH7A 1TNZA 2ZIRA 1AWCB 5JJ7A 2VTBB 5HI7A 3MA5A 4JXTA 3T8KA 1DCQA 5LOZA 4XI0A 5EILA 3UM0A 1SVXA 3QAQA 4FA6A 3UTMA 1U2VG 3QWPA 3QJZA 3EDTB 3FTSA 4XX5A 5T3RA 3FU5A 5CRVA 1B89A 3FEYA 1OT8A 2KCKA 3HIZA 5AAOA 3JXJA 1O1RA 2VJ8A 1PC2A 4GTQA 1N4PA 2J09A 3QDNA 4FJZA 4GTSA 2P9NG 4AIFA 2KXPC 4CCAA 5AENA 3ZYMA 4P29A 4FJYA 2ETCA 4J6IA 2IO3C 2VGXB 5ENOD 4TXPA 2BEDA 2KM4A 5EKQD 2AXUA 2F0YA 4BETA 4HRNA 1JWFA 2WXQA 3QARA 1SZAA 3KD7A 5JJ6A 2WXKA 2I9CA 2L6JA 2LAHA 1ZU2A 4YVOA 3UXGA 4ATGA 3ASGA 2XGSA 2YQ8A 4ABNA 3TL5A 1MQSA 1OCOE 3KS2A 4ME2A 4HORA 2LXLA 3OXLA 3K9IA 4FLBA 4KZCA 2BUGA 3L82A 1UN8A 4WUYA 4BSZB 1H2TC 3MV2B 3PH0C 4HQDA 4K03A 1S70B 3DRAA 3D9JA 3DSXA 4HVBA 2VYIA 3B13A 1TNUA 3AG4E 2CHZA 3AU4A 3PZDA 4RG9A 4HRLA 5CBOA 5EDSA 4F7AA 2NXPA 2FULA 3AS8A 3TWTA 4W9RA 2DZOA 3FFLA 3PDNA 2PM6A 4N5CA 2R02A 3D9MA 5ENNA 2AXZA 3SNXA 4ZHBA 3LVQE 2X6KA 2V4LA 3DWLG 2IOSA 4B8AA 3CLJA 2Y1LE 2WXIA 3ZKJA 4O6FA 4UI9K 2V5QC 4H7XA 1WM5A 3CVPA 4I6GA 3MKQA 3EHMA 4J0UA 2XPYA 3URZA 1EPUA 3EU5A 5G55A 1U3DA
chains in the Genus database with same CATH topology
5CRVA 2XS1A 3ULYA 2R05A 3C3OA 2R03A 2OEXA 3UM0A 1ZB1A 3UM2A 3C3QA 2OEVA 3ZXPA 3RAUA 2XS8A 2R02A 3UM1A 2OJQA 4JIOA 3C3RA 3UM3A 5CRUA 2OEWA 3R9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CRV A;  2XS1 A;  3ULY A;  2R05 A;  3C3O A;  2R03 A;  3UM0 A;  1ZB1 A;  3UM2 A;  3C3Q A;  2OEV A;  3ZXP A;  3RAU A;  2XS8 A;  2R02 A;  3UM1 A;  3C3R A;  3UM3 A;  5CRU A;  2OEW A;  3R9M A; 
#chains in the Genus database with same CATH topology
 3D9H A;  3RSE G;  2VGX A;  3PVL A;  4F1S A;  1N94 A;  3LY7 A;  4KBQ A;  3DSW A;  3ONL A;  4WAF A;  3PNT B;  4TXQ A;  4ZFH A;  1ZBP A;  3SF4 A;  3LEW A;  4BFR A;  4XEI G;  2HE0 A;  1TN8 A;  2EIJ E;  3E34 A;  4DX7 D;  3CHP A;  4WNG A;  2X3M A;  4U0U A;  2FI7 A;  5J08 A;  3TAX A;  2V4H C;  3IV0 A;  4N5Q A;  4A55 A;  2XCB A;  1S63 A;  4FLH A;  4GMR A;  1A17 A;  4G25 A;  5G05 C;  2OEW A;  4U8H A;  3R7R A;  2NSZ A;  1QZ2 A;  3G2V A;  3MKR A;  4JHK A;  2MRI A;  4PS3 A;  4U96 D;  3TXN A;  2VSY A;  2P9S G;  2IJG X;  1ELR A;  4PS8 A;  5CCL A;  5CMY A;  3ZXS A;  3TWS A;  3ABM E;  4R7L A;  3TGO A;  1V55 E;  3DST A;  3T8M A;  3Q47 B;  3JCK C;  4WWP A;  4GAA A;  4ILH B;  4GB9 A;  2LSV A;  3ZFW A;  1L5J A;  2X6H A;  3UI2 A;  4O1P A;  5BV1 A;  4U95 D;  3VLE A;  2PQR A;  4I17 A;  3Q73 A;  4XE0 A;  1E90 A;  4K5A B;  3ZYK A;  4G26 A;  4TRQ A;  1TJF A;  3ML8 A;  3Q7A A;  1OUV A;  4OVU A;  2GGF A;  5ENQ D;  4GZ5 A;  4DI4 A;  2OND A;  4PS7 A;  3ISM C;  4I1M A;  5FQ4 A;  3IEG A;  2MYO A;  1MX6 A;  4GYW A;  4HLL A;  3U64 A;  2NC9 A;  2P9K G;  2RFA A;  5E75 A;  1TNY A;  2Q7F A;  3LPZ A;  4JB8 P;  3L13 A;  3ZIM A;  4HXI A;  4M7C A;  3X2Q E;  4DX1 A;  1IHG A;  1E8Y A;  4G8K A;  3C3Q A;  3LJ3 A;  3SFZ A;  3TWX A;  5BXU A;  4NQ0 A;  3OXF A;  3D9P A;  2DBA A;  3Q75 A;  2E0I A;  5EID A;  4DX5 D;  1H2U A;  1LD8 A;  2WQH A;  4FHJ A;  4C48 B;  2CFU A;  4JA7 A;  5BXO A;  2XZD G;  1MZC A;  2X6I A;  4JL0 A;  3PZ3 A;  3Q78 A;  3E37 A;  4I2W A;  4JA9 A;  3U9W A;  2XHE A;  3IXE A;  5AJD A;  3SFX A;  3GZS A;  5ENP D;  1KZP A;  5T4Y A;  1UG3 A;  2YHE A;  1TNB A;  3L22 A;  3SFY A;  3D9L A;  3V2X A;  3W9F A;  3C5R A;  3L17 A;  3PEV B;  4CDM A;  4CYM D;  2GRR B;  3PZ2 A;  4L2Y A;  3RO2 A;  3PUK A;  3AAA C;  1O1S A;  2XPI A;  5FIN A;  4D10 C;  1UJK A;  3DPY A;  1SQM A;  4LG6 A;  4B93 B;  2F8Y A;  1JCR A;  3FH5 A;  3DEP A;  2WPV A;  4DI3 A;  4HI8 A;  4NAC A;  4RVB A;  1UN9 A;  1HFA A;  4AXH A;  4UWG A;  3E4B A;  5AQA A;  1FT2 A;  4N3A A;  3MX3 A;  4YDO A;  5C2Y A;  5FJY A;  1X5B A;  5IY5 E;  2QC9 A;  3B7R L;  3UPV A;  4YVQ C;  3FTZ A;  3FH8 A;  3QNK A;  3ESL A;  4NIK A;  3FU6 A;  2H6F A;  3ZW3 A;  3SY2 A;  1NZN A;  3AU5 A;  3JQ0 A;  2Y4T A;  3FUE A;  4KZ0 A;  2MOW A;  4N39 A;  4EHM A;  2WVI A;  5DIZ A;  4KXK B;  2X6F A;  4G23 A;  2WXL A;  3QWV A;  4LNU D;  3P1U A;  5FTP A;  5AQ9 A;  3BU8 A;  5EN5 D;  3W9G A;  1HG2 A;  3Q15 A;  3CVY A;  2KZT B;  3ASD A;  3FUD A;  4AOF A;  2VQ2 A;  5A23 A;  3ZYL A;  3CEQ A;  5JJT A;  5HQ8 A;  4CDN A;  2XZT G;  2B0O E;  4CRW A;  2R05 A;  4NRH B;  2IF4 A;  3CHS A;  3N71 A;  4FC8 A;  3FTW A;  2AWI A;  5EX3 A;  4GYO A;  1A5E A;  1HXI A;  1MJ0 A;  2QY7 A;  3VTX A;  3FU3 A;  4EBA A;  4EZK A;  2IOL A;  2OV8 A;  3B7T A;  4DUI A;  4IUL A;  2LNI A;  3G2W A;  2F37 A;  4YND A;  5LCW J;  3WXX A;  3MYV A;  4C0E A;  2GRL A;  4PDX A;  5BUZ A;  4WNF A;  4HOT A;  3OTN A;  1MYO A;  2OVB A;  3Q79 A;  3DSV A;  3ABL E;  2J07 A;  3CVN A;  3ZXP A;  3S7J A;  2GRN B;  2EIN E;  3KSL A;  4E85 A;  4EZL A;  2XGM A;  3EHR A;  1H0A A;  3SI5 A;  2AXV A;  4A3V A;  3NZS A;  1OWP A;  3LCA A;  3JQ1 A;  5LFA A;  1IKN D;  5AQB A;  4I9E A;  3CVW A;  4QQI A;  2WXM A;  4CEM A;  3OAW A;  4Q94 A;  3Q5M A;  3BQO A;  4GML A;  4ANW A;  1D9S A;  2AJA A;  1MX2 A;  4L7T A;  4U63 A;  4XIF A;  2RKK A;  1HO8 A;  1XNF A;  4CDR A;  3UIO C;  4Y6C A;  3KSQ A;  5HS0 A;  2HO1 A;  2LSU A;  2YIN A;  3CK8 A;  2XS1 A;  4FP7 A;  3I5P A;  3CST A;  1OWO A;  3NF1 A;  1D8E A;  3VTY A;  1FPP A;  1EDU A;  3CVX A;  1HX8 A;  3TG4 A;  2KZT A;  3ZGQ A;  2CG2 A;  1SW6 A;  1Y8M A;  4Y6W A;  3Q9U C;  3E33 A;  4G24 A;  1Z6T A;  3GZ2 A;  5ARF A;  4BEP A;  3NQP A;  1QBQ A;  3KEZ A;  3ZRH A;  4E6H A;  2XEV A;  4U07 A;  1LTX A;  2DWZ A;  1JUQ A;  3SHF A;  4GCN A;  3UX4 A;  3ZHE B;  2ZXW E;  4GZ6 A;  1DC2 A;  1OCR E;  4G8L A;  3SD5 A;  4EEC A;  3P2B A;  1GW6 A;  1PY1 A;  2XPZ A;  3KEA A;  2IU1 A;  3QB2 A;  5HRY A;  3I4G A;  4OAU C;  4A3T A;  3J5Q B;  4NUR A;  2IFU A;  4TUM A;  3HXD A;  3S7B A;  2CHX A;  3U3W A;  3L54 A;  4TXR A;  4GPM A;  2VTB A;  4HBD A;  3FUI A;  3LYA A;  1FCH A;  4AVX A;  3FWV A;  4ANV A;  1EYH A;  1YYH A;  4FAD A;  2J9Q A;  1UJJ A;  4B94 A;  5FZR A;  4I2Z A;  5CMW A;  4JEU A;  4XI9 A;  4GTM A;  5LP0 A;  4GPK A;  1E8W A;  2YHC A;  1P5Q A;  4GU5 A;  1NA0 A;  3ZEF A;  2PM7 A;  2RD0 A;  1QYM A;  3CHM A;  2VGY A;  4RSY A;  3TXM A;  3UIN C;  2DCP A;  4JVS A;  1AP7 A;  3HRA A;  2XS8 A;  3GZ1 A;  1V54 E;  2V5F A;  3NBN B;  1LF8 A;  3F6Q A;  4TUU A;  3HVE B;  1DVP A;  1OCC E;  4LUN U;  2FF4 A;  3BEE A;  1RW2 A;  2FEZ A;  4ANX A;  2LAI A;  1W3B A;  3E30 A;  3TWQ A;  2UWJ G;  3LS8 A;  3CIA A;  2GRP B;  1SA4 A;  2HR2 A;  4QFV A;  4J8Y A;  3CK7 A;  3U4T A;  3O48 A;  3ZVV A;  5KCM A;  3UM1 A;  4GTV A;  4BT9 A;  3ZHE A;  3DBS A;  1K1A A;  3UT4 A;  1JWG A;  3TJP A;  3LJN A;  4U04 A;  2AVP A;  1SA5 A;  3UT7 A;  2J08 A;  2Y4U A;  4URK A;  4GCO A;  4HOQ A;  4B8C B;  2P9U G;  4GA2 A;  4YDE A;  4GTT A;  3Q49 B;  3Q4A B;  5A6C A;  3ZN3 A;  3RIB A;  2R17 C;  1VDY A;  5FZQ A;  3RAU A;  1N4Q A;  4UI9 J;  5CHE E;  5KBA A;  3FY4 A;  4GMJ A;  4XKB A;  3R7Q A;  2XRZ A;  4Q96 A;  1O1T A;  2H6G A;  1BPO A;  4WNE A;  2ILR A;  3HYM B;  1ELK A;  2X38 A;  4BWR A;  4F53 A;  2QZA A;  4JC8 A;  2DZN A;  4DLO A;  1JPL A;  1QQE A;  2DYR E;  1NFI E;  3LXU X;  1DCE A;  4BY6 A;  3JUI A;  4UUC A;  3ENE A;  5FWQ A;  3CK9 A;  4RG6 A;  1OWL A;  3DXK G;  3FU0 A;  3PZ4 A;  1N0Q A;  2JEK A;  3B7U X;  4ILG A;  4U0Z A;  4DPR A;  2PQN A;  1Z3Y A;  5EYP F;  2WXO A;  2WXF A;  2R2L A;  4J8D A;  4K5B A;  3EJN A;  2P58 C;  3V2O A;  3NB2 A;  5D66 A;  4LER A;  3FHE A;  2XEN A;  5D0Q D;  1OXJ A;  5KJN A;  3NAW A;  2L6B A;  2WXR A;  3FTX A;  3FDH A;  2WQ6 A;  2B6C A;  4DX2 A;  1E8X A;  1H2V C;  5AN8 A;  3IHY A;  1ELW A;  1S64 A;  4I1A A;  4AP2 A;  3QOU A;  2P9P G;  2I1J A;  4LEU A;  3BG0 B;  4J7W A;  2WM9 A;  2R59 A;  4HFG A;  4HI9 A;  3CQC B;  3SO8 A;  4GTO A;  2QYU A;  4RLY A;  3JXI A;  2EIM E;  4N2S A;  5LX8 A;  3CQG B;  3CHO A;  3DXM G;  2PZI A;  4N3C A;  2X6J A;  4OVV A;  1TNO A;  3D3M A;  3FTV A;  5ENR D;  1E7V A;  5LCW C;  3D9I A;  4KVM A;  5CBN A;  4G11 A;  2J8S D;  5KJM A;  2C0L A;  4XZ4 A;  2JAB A;  1KLX A;  1HS6 A;  5M72 A;  5KWD A;  2XCC A;  3G2U A;  1NL4 A;  5C1D A;  2BKK B;  3UMV A;  4EPZ A;  3LDZ A;  1N9A A;  2J4D A;  3PE3 A;  4AM9 A;  4PUC A;  2P2C P;  5A7D B;  4DLQ A;  4LCT A;  5BPP A;  3FP3 A;  3MEK A;  1BI7 B;  3HXB A;  4F6R D;  2LO6 A;  1MX4 A;  3APD A;  3ABK E;  2QFC A;  3SZ7 A;  3UQ3 A;  4J8E A;  2KCV A;  4HLE A;  4FHK A;  2KAT A;  2L0T B;  1K8K G;  1H6K A;  4DJA A;  4AJW A;  3CVL A;  3C3O A;  4JZY A;  4JPS A;  4GA1 A;  1E96 B;  3V79 K;  3FUJ A;  5D2M C;  1Z3X A;  1SZ9 A;  2I2O A;  2V0P A;  1H6P A;  5ITZ F;  3Q7F A;  2C2L A;  3QC1 A;  4V3I A;  3EHQ A;  4BT8 A;  2VSN A;  3C72 A;  2IY0 C;  4O60 A;  2LUH A;  5JMN D;  1G3N B;  5B3S E;  4BX8 A;  4GTR A;  5DBK A;  1JCQ A;  4PH4 B;  4A63 B;  3FTY A;  3B95 A;  5KJK A;  2Y69 E;  1YMP A;  1E8Z A;  3T5V A;  3TWV A;  3LY8 A;  3HXF A;  1WAO 1;  5AJL A;  5ENT D;  4O1O A;  2L9B A;  3DSS A;  2J49 A;  3RRN B;  4MBG A;  2XRY A;  3SQV A;  2Y3A A;  4N3B A;  2JLB A;  4GTP A;  2A5E A;  4B89 A;  5HKP A;  1PAQ A;  4KMO A;  1NA3 A;  3CHQ A;  3MJW A;  3ZNG A;  3PEU B;  4IN3 B;  4LSZ E;  1WG0 A;  4F3V A;  2ZU6 B;  1ZB1 A;  2WXP A;  5JHA A;  3LVR E;  2A5U A;  2CFZ A;  1OWM A;  4I9C A;  2WB2 A;  3CGH A;  3C98 A;  1RZ4 A;  3O4Z A;  3PS6 A;  3TWW A;  3HHM A;  5J90 A;  2ION A;  1HF8 A;  1HU3 A;  2XEE A;  3ZPJ A;  3ZUV B;  5FZS A;  3IHV A;  4UQY A;  2FO7 A;  3MKQ B;  4LRZ A;  3ZU7 B;  3JYS A;  1UOH A;  1IQR A;  3CKC A;  3E32 A;  5CRU A;  3OXG A;  5BT1 A;  5CEA A;  1E7U A;  3FUK A;  3TWR A;  3I3N A;  2VGE A;  4UWH A;  3FEX A;  4WWN A;  3NOG D;  1TN6 A;  3PRE A;  4ANU A;  3MCX A;  1YCS B;  3RJV A;  4BX9 A;  3CR3 A;  5G2N A;  3B7B A;  3S7F A;  3ZYQ A;  1BI8 B;  2V8S E;  3D9K A;  3LY9 A;  2VSO E;  4ATZ D;  4HOU A;  1NP7 A;  4AY5 A;  2IO2 C;  1INZ A;  3IBE A;  3R9A B;  5G04 J;  5KNG A;  4WWO A;  2WQ7 A;  2BTD A;  5EX0 A;  2IQC A;  4KYO B;  1IHB A;  4U7E B;  4YDW A;  3S7D A;  3UM2 A;  4LNG A;  5B1A E;  2GRO B;  3AS4 A;  4HRM B;  4KVO A;  4GA0 A;  2KC7 A;  3CVQ A;  1KT0 A;  3V31 A;  3AG2 E;  4GZD A;  4MRU A;  4APF A;  4WND A;  1YA0 A;  5JA4 D;  1HE8 A;  3AJI A;  3HXE A;  5FT9 A;  1TYQ G;  4AEZ C;  3D9N A;  3T5X A;  3AG1 E;  5AQ7 A;  2OVF A;  3ASN E;  4APO A;  3VLD A;  3B7S A;  2J4B A;  1MHQ A;  3RRM B;  4YDY A;  1TJC A;  3UKU G;  4UI9 C;  3DSU A;  3ULY A;  2GRQ B;  3D9O A;  4FUL A;  3KAE A;  2WXH A;  4JHJ A;  2WXJ A;  1TEZ A;  2XQ0 A;  5CER B;  5KNH D;  4GYY A;  4UWK A;  2H6H A;  3APC A;  3FUL A;  4K5C A;  2GW1 A;  2DIW A;  4ACL A;  3EUV A;  1K1B A;  2C0M A;  3SBT B;  4AY6 A;  2LXM A;  1Q2Z A;  4C0M A;  2I6H A;  2GRM A;  2P9I G;  2OCC E;  2AW6 A;  4G1T A;  4CGV A;  3L08 A;  4CT4 A;  4Z68 A;  3UUX A;  4HNA D;  5BW8 C;  1EF1 C;  3RKV A;  1H6O A;  4BTA A;  1OWN A;  2WMN A;  3RK6 A;  4U8Y D;  1HZ4 A;  1S0P A;  3JUE A;  3Q9N C;  3APF A;  3CSF A;  5JHB A;  1FVF A;  3DPD A;  5E76 A;  1HH8 A;  4MLP A;  1X81 A;  1KZO A;  3RRU A;  3ASH A;  4M3O A;  5FIO A;  4DX6 D;  2P9L G;  4BES A;  2BKG A;  3FUN A;  2DYS E;  4X8Q A;  2KBX A;  2WXG A;  3MZL B;  5KJL A;  2EIL E;  4U0S A;  1WDY A;  1UW4 B;  4CZ2 D;  3PE4 A;  4FU3 A;  1N11 A;  2Y0B G;  3HXC A;  4KT6 B;  2NYJ A;  3VLF A;  4BTB A;  1IQU A;  3RO3 A;  3V30 A;  2DVW A;  2MHK A;  3L6A A;  2EQX A;  4DRX E;  3ASF A;  4HS2 A;  2CG3 A;  4G2V A;  3QK0 A;  5H7P A;  3TWU A;  1HG5 A;  4IYP A;  1D8D A;  4J8S A;  3HVE A;  3PNL B;  1N52 A;  1FT1 A;  2IEJ A;  3PRZ A;  3QWW A;  2RG8 A;  3DEO A;  3BG1 B;  2ETB A;  2EIK E;  4DK5 A;  2R03 A;  4UWL A;  3CVU A;  3EIJ A;  2R5S A;  4U8V D;  4ACK A;  3ULE G;  2ZGG A;  3CVV A;  3LKU A;  2F8X K;  5AYW D;  5G05 J;  4F1P A;  3C3R A;  3FUH A;  3RU0 A;  5BV0 A;  3J5P A;  4Q69 A;  5ANR A;  4JHR A;  1QNF A;  2OOE A;  2WMO A;  2FBN A;  4OAV B;  4B0Z A;  4H7Y A;  1BLX B;  3IKO B;  4L23 A;  1U3C A;  3FUF A;  2RFM A;  1KT1 A;  4AV7 A;  3U66 A;  3GW4 A;  2VSX E;  2QYJ A;  1IYG A;  5EYL A;  2OEV A;  4I1O B;  3FTU A;  3ML9 A;  3UIP C;  3L9T A;  1XGW A;  3WG7 E;  4A1S A;  1N4R A;  3UT8 A;  3UM3 A;  3GYZ A;  2ZIS A;  3CKB A;  3G2T A;  5AIJ A;  3S2A A;  1N54 A;  3MV3 B;  4L9P A;  4IRU A;  4GZ3 A;  4JW1 A;  5FQ7 A;  1N95 A;  3TG5 A;  5CCM A;  2UY1 B;  2HYZ A;  4OYS A;  3HDX A;  3CHR A;  1TR4 A;  4MS6 A;  4CGW A;  5CEC B;  3SGH A;  2XEH A;  5ANL A;  1BU9 A;  4I43 A;  3EIQ C;  3ESK A;  3UKR G;  2ETA A;  3MGB A;  4JEH A;  1IXV A;  2PL2 A;  3CV0 A;  3ONK A;  3EU9 A;  3FUM A;  4MKT A;  2H6I A;  4N2Q A;  5B1B E;  2I1K A;  1KPS B;  4LNB A;  4GZC A;  1WY6 A;  3QKY A;  2PNN A;  4I6J A;  2A4Z A;  3ULQ A;  3AS5 A;  4HB5 A;  2M63 A;  4C9B B;  4EZJ A;  3NZU A;  2YNQ A;  3ASO E;  1N0R A;  3HG0 D;  2BF0 X;  4CT0 A;  1H19 A;  3PZ1 A;  5BNW A;  3I4R B;  1O5M A;  4ILI A;  4EQF A;  5FQ8 A;  4BER A;  1OCZ E;  3BUA A;  2XGO A;  1TN7 A;  4TV3 A;  3NOC D;  4HOS A;  4XKC A;  5EIB E;  5AAR A;  4EBA G;  4UQX A;  4K0R A;  3T9K A;  1Z5S C;  1DNP A;  1K3Z D;  5D0O D;  4L2L A;  4L1B A;  5CED B;  2CHW A;  4A1G A;  1BD8 A;  2ZGD A;  1N4S A;  4RQI A;  2FO1 E;  2E2E A;  1NI1 A;  3R9M A;  3AG3 E;  2WXN A;  1LD7 A;  2L0I A;  3SBS A;  5T8I A;  3G2S A;  4BSX A;  1OY3 D;  3L16 A;  3PUJ A;  4I6E A;  5ARG A;  5ENS D;  4J8F A;  1FVH A;  2KCL A;  2UY1 A;  5FQ6 A;  4JD2 G;  3EHN A;  4UQZ A;  4UWF A;  2HM8 A;  5G04 C;  1Y6I A;  1JCS A;  3FH7 A;  1TNZ A;  2ZIR A;  1AWC B;  5JJ7 A;  2VTB B;  5HI7 A;  3MA5 A;  4JXT A;  3T8K A;  1DCQ A;  5LOZ A;  4XI0 A;  5EIL A;  3UM0 A;  1SVX A;  3QAQ A;  4FA6 A;  3UTM A;  1U2V G;  3QWP A;  3QJZ A;  3EDT B;  3FTS A;  4XX5 A;  5T3R A;  3FU5 A;  5CRV A;  1B89 A;  3FEY A;  1OT8 A;  2KCK A;  3HIZ A;  5AAO A;  3JXJ A;  1O1R A;  2VJ8 A;  1PC2 A;  4GTQ A;  1N4P A;  2J09 A;  3QDN A;  4FJZ A;  4GTS A;  2P9N G;  4AIF A;  2KXP C;  4CCA A;  5AEN A;  3ZYM A;  4P29 A;  4FJY A;  2ETC A;  4J6I A;  2IO3 C;  2VGX B;  5ENO D;  4TXP A;  2BED A;  2KM4 A;  5EKQ D;  2AXU A;  2F0Y A;  4BET A;  4HRN A;  1JWF A;  2WXQ A;  3QAR A;  1SZA A;  3KD7 A;  5JJ6 A;  2WXK A;  2I9C A;  2L6J A;  2LAH A;  1ZU2 A;  4YVO A;  3UXG A;  4ATG A;  3ASG A;  2XGS A;  2YQ8 A;  4ABN A;  3TL5 A;  1MQS A;  1OCO E;  3KS2 A;  4ME2 A;  4HOR A;  2LXL A;  3OXL A;  3K9I A;  4FLB A;  4KZC A;  2BUG A;  3L82 A;  1UN8 A;  4WUY A;  4BSZ B;  1H2T C;  3MV2 B;  3PH0 C;  4HQD A;  4K03 A;  1S70 B;  3DRA A;  3D9J A;  3DSX A;  4HVB A;  2VYI A;  3B13 A;  1TNU A;  3AG4 E;  2CHZ A;  3AU4 A;  3PZD A;  4RG9 A;  4HRL A;  5CBO A;  5EDS A;  4F7A A;  2NXP A;  2FUL A;  3AS8 A;  3TWT A;  4W9R A;  2DZO A;  3FFL A;  3PDN A;  2PM6 A;  4N5C A;  2R02 A;  3D9M A;  5ENN A;  2AXZ A;  3SNX A;  4ZHB A;  3LVQ E;  2X6K A;  2V4L A;  3DWL G;  2IOS A;  4B8A A;  3CLJ A;  2Y1L E;  2WXI A;  3ZKJ A;  4O6F A;  4UI9 K;  2V5Q C;  4H7X A;  1WM5 A;  3CVP A;  4I6G A;  3MKQ A;  3EHM A;  4J0U A;  2XPY A;  3URZ A;  1EPU A;  3EU5 A;  5G55 A;  1U3D A; 
#chains in the Genus database with same CATH homology
 5CRV A;  2XS1 A;  3ULY A;  2R05 A;  3C3O A;  2R03 A;  2OEX A;  3UM0 A;  1ZB1 A;  3UM2 A;  3C3Q A;  2OEV A;  3ZXP A;  3RAU A;  2XS8 A;  2R02 A;  3UM1 A;  2OJQ A;  4JIO A;  3C3R A;  3UM3 A;  5CRU A;  2OEW A;  3R9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...