3TWRA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human 3bp2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twrA00
1DCQA 1YMPA 2ETAA 4JB8P 3V79K 4YDYA 4U8YD 5AN8A 1G3NB 5FIOA 3TWUA 1OT8A 4U96D 4O60A 4U8VD 1K3ZD 2FO1E 5HKPA 5AQ7A 2A5EA 1SW6A 4F6RD 3NOCD 2KBXA 4O1PA 4QQIA 4OAVB 2HE0A 5EIDA 3TWTA 4K5CA 4HNAD 4A63B 4J7WA 2XEEA 4HRNA 1BD8A 3IXEA 3EHQA 3UXGA 1IXVA 3TWVA 4ZHBA 1SVXA 3HRAA 3ZNGA 5KBAA 4QFVA 4B93B 5CBOA 5CBNA 5ENTD 5AARA 4DX1A 2B0OE 4HLLA 5HRYA 2V5QC 5BXUA 3EHRA 4HQDA 4DX2A 4DX6D 4G8KA 1BI8B 2RFAA 2Y0BG 5JMND 4F1PA 1D9SA 1MYOA 3TWRA 3J5QB 5CEAA 3AJIA 5EIBE 5HS0A 1K1BA 4HRLA 2J8SD 3DEOA 3TWQA 3UI2A 5AAOA 1WDYA 3NOGD 2BKGA 5ITZF 1WG0A 5ENRD 1MX4A 2BKKB 5EYPF 3B95A 3T8KA 3T9KA 2NYJA 2ZGDA 4UUCA 1IHBA 1UOHA 2DVWA 1TR4A 4HI8A 3W9GA 3TWSA 3JUEA 4BERA 5CEDB 4DUIA 2ZGGA 4LG6A 4K5BA 2ETBA 2L6BA 4GMRA 4J8YA 3HG0D 5EYLA 5CERB 2QYJA 2Y1LE 3V30A 3C5RA 4DX7D 5ENSD 5JA4D 2RFMA 2DZOA 3Q9UC 3KEAA 4HB5A 4RLYA 5AQBA 4BSZB 3ZUVB 3J5PA 2KXPC 1DC2A 3DEPA 5KWDA 3W9FA 2PNNA 5ENPD 4DRXE 2P2CP 1YCSB 1BI7B 1OY3D 1YYHA 4GPMA 1IKND 3F6QA 4YDWA 3V2XA 4Z68A 1MX2A 4NIKA 5KNGA 3TWWA 1N0QA 4U95D 5ENQD 1AWCB 3D9HA 1S70B 4ATZD 4BEPA 3JXIA 2MYOA 4N5QA 3SO8A 4BETA 1N0RA 1MX6A 2ETCA 2XENA 2QC9A 5BXOA 3B7BA 1K1AA 4G8LA 2XEHA 4LSZE 2XZDG 2VGEA 2V4HC 5CECB 5FINA 4BESA 4DX5D 3TWXA 4HI9A 4LNUD 4HBDA 3JXJA 1BLXB 5EN5D 4TUMA 5KNHD 1NFIE 2AJAA 3UTMA 4CZ2D 1N11A 3AAAC 4C48B 1QYMA 5ENOD 1MJ0A 5D66A 1A5EA 3Q9NC 1AP7A 2F8YA 4OAUC 3V31A 2F37A 5AQAA 2F8XK 3ZU7B 4K5AB 2DZNA 5EILA 2DWZA 4HRMB 4O1OA 3V2OA 5AQ9A 3LJNA 2JABA 3EU9A 4CYMD 1BU9A 3NBNB 2XZTG 3ZKJA 4ZFHA
chains in the Genus database with same CATH superfamily
3FUDA 4N3BA 4AJWA 4U8YD 1WY6A 2WMNA 1OT8A 3QC1A 4XE0A 3PUJA 4KYOB 5LCWC 2HE0A 3PZ1A 4CGVA 1ELKA 2I2OA 5T8IA 3E34A 2Q7FA 2KC7A 4GZCA 2WQ7A 3O48A 4JXTA 4DX2A 5BPPA 4YDOA 1K1BA 1QQEA 1WDYA 4D10C 1UN9A 2YINA 1HXIA 1TNYA 4J6IA 4WNEA 3FTSA 2LSVA 2EINE 4EZJA 5BNWA 3ML8A 4GU5A 1KLXA 3TG5A 5LOZA 5JA4D 4E85A 1OCZE 4RVBA 2BEDA 3PVLA 1B89A 3D9MA 1HZ4A 4PS7A 1IKND 4UQZA 3PDNA 4ME2A 4ILIA 3E37A 2RG8A 2IQCA 4YVQC 2OVFA 4N5QA 1TEZA 4UI9K 4EHMA 3SNXA 3PH0C 1IQUA 5J08A 1BLXB 2R17C 3HYMB 4HOSA 5AYWD 3ZFWA 4AP2A 1O1RA 2V0PA 5EKQD 3V79K 3KSQA 3HVEB 2I6HA 4JVSA 4GZ6A 1U3DA 3UT7A 4U8VD 3RK6A 4JA7A 3UMVA 5FQ8A 2KBXA 4BX9A 1HX8A 1N9AA 3SFYA 2XEEA 3TXNA 3FTYA 3I4GA 4DI4A 4KZCA 2WXRA 4F7AA 1N54A 1OWLA 4DLQA 3RU0A 3OXGA 4G8KA 1HG2A 4IYPA 4AV7A 3AJIA 3EHMA 3ZVVA 3DEOA 3CVUA 1OUVA 5EDSA 3JYSA 3MV2B 1WG0A 1JWFA 2AWIA 3EJNA 1OWNA 2XHEA 2WXMA 2VSXE 4K5BA 1E96B 4LRZA 1Q2ZA 2DYRE 3SQVA 3C5RA 2P9PG 3Q9UC 2Y4UA 3JQ0A 2BUGA 2PNNA 3VLDA 2WXQA 3S7FA 5G04C 3HXBA 2DIWA 2IEJA 3Q7FA 5KNGA 1N0QA 3FUHA 2MRIA 3CV0A 2PM6A 4HXIA 4BETA 2PQRA 2IONA 1MHQA 3LY8A 1KPSB 5G55A 3Q49B 2J08A 5BV0A 3G2WA 1RZ4A 2F37A 3PEUB 3HXDA 3LJNA 3NBNB 4YDYA 3QAQA 3RRNB 4JEHA 5A7DB 4H7YA 3HXEA 3MEKA 3TGOA 3NAWA 4BWRA 3OXFA 1HF8A 5KJNA 4ILGA 2UY1A 2HR2A 3TWVA 1EYHA 5KJLA 5CBNA 1N94A 2B0OE 5HRYA 5HQ8A 2J9QA 3EUVA 2P9IG 2WQ6A 2QZAA 4IULA 3UI2A 2GRLA 2XRZA 5EYPF 3UQ3A 3B7TA 4U63A 5FJYA 4U04A 4RG6A 3IKOB 5CERB 3ENEA 3WG7E 2KXPC 1E8YA 2FBNA 5KWDA 3QKYA 1YCSB 3QARA 4G2VA 2EIKE 3CHOA 3RRUA 4FJYA 5FQ4A 4GAAA 3HXCA 1FVHA 1K1AA 2R2LA 4I2WA 3FU6A 2OVBA 3DRAA 4XKBA 3ASHA 1DVPA 3G2SA 5D66A 4OAUC 3R7RA 4HVBA 3VLFA 3QOUA 4EZLA 5LP0A 2L0TB 3UT8A 4GPKA 3MCXA 2KZTA 2FI7A 2HYZA 4W9RA 5B1AE 3FFLA 5B3SE 2H6IA 5HKPA 5KJKA 2IOLA 4FJZA 2KATA 4B0ZA 4RG9A 4F1SA 4ANXA 1TJCA 1H2VC 5JJTA 1OCCE 2QY7A 4A3TA 3DXKG 4U07A 5ENTD 2JLBA 1K8KG 1S63A 1S0PA 3SZ7A 3QDNA 1JCSA 1N4RA 2RFAA 5D0OD 5CEAA 1OWMA 3SI5A 1FVFA 2E0IA 3EHNA 3LKUA 4FHJA 2XPIA 2X6FA 1HO8A 5LFAA 3HG0D 2Y1LE 1A17A 4HORA 5ENSD 1H2TC 4HB5A 4I9EA 3MYVA 4L2LA 4DRXE 3ABLE 1P5QA 2GW1A 3FUIA 2GRPB 4BX8A 2VYIA 1O1TA 4ATZD 4HS2A 4ILHB 2XEHA 4CDRA 3TG4A 3TWXA 2DCPA 1ELWA 1NA3A 4HBDA 3IHYA 2ZU6B 3ESKA 2NXPA 5BT1A 2B6CA 2VSOE 2J4DA 4ANWA 2XZTG 3ZN3A 2BTDA 3L9TA 4G25A 5LCWJ 3CIAA 1K3ZD 4DI3A 3BQOA 4UQXA 4GCOA 2I1JA 1LD8A 5EIDA 3ULQA 4XKCA 4J7WA 3MA5A 4MLPA 4BSXA 5E75A 4C0EA 4PDXA 1LF8A 2V8SE 4AY5A 4N3AA 2OOEA 5AIJA 3L54A 2J09A 5KCMA 3FH7A 2BKGA 2AVPA 4YNDA 1U2VG 3T8KA 3CSTA 3D3MA 1NA0A 3Q7AA 2GRMA 5C2YA 2ETBA 3PREA 2QYUA 4GMRA 4PS3A 4L23A 4BY6A 2QYJA 4GTRA 2H6HA 3QWWA 1DC2A 1HFAA 1S64A 3PNLB 4LERA 2PL2A 3B7RL 3PEVB 4J8FA 4JD2G 4U0SA 1N95A 3DPYA 1TJFA 5BUZA 2AXUA 1DCEA 3DSTA 4EBAA 4XIFA 3PNTB 3FUMA 3FTWA 5FINA 3ISMC 4HI9A 3JXJA 3APDA 4TUMA 1NFIE 3OAWA 4ANVA 1OWOA 1QYMA 2LSUA 1MJ0A 1AP7A 2F8YA 1LD7A 5EILA 4GMLA 4URKA 4O60A 1UJJA 4RSYA 5AQ7A 2A5EA 1SW6A 3NOCD 3GZ2A 3CQGB 3NZSA 4JHKA 2WXFA 4CGWA 3UIOC 1IXVA 3KEZA 2J07A 3PRZA 4GYWA 4HQDA 3KS2A 4CT4A 4UWFA 4GA1A 3TJPA 4OVVA 4R7LA 4RQIA 1SZAA 4XX5A 1Y6IA 2CHXA 2Y69E 3PZ3A 2XPZA 1UOHA 2WXJA 2ZGGA 4LG6A 4WNGA 3ZIMA 4GMJA 2FF4A 2RFMA 1HE8A 2WXGA 4AM9A 2XPYA 4LEUA 4N3CA 3HVEA 4WUYA 3Q47B 3UM2A 5EX0A 3CHMA 2QFCA 5CCMA 4YDWA 1SA5A 3L22A 1SA4A 3FUJA 4FULA 3JXIA 1H6PA 1MX6A 4A3VA 5BXOA 2XZDG 2WM9A 4BESA 4YDEA 2GROB 4LNUD 2FEZA 2VGYA 1IQRA 1TN6A 5FZQA 1H19A 2XRYA 4DLOA 1HU3A 1TN7A 3UM0A 5T4YA 4BT9A 1E7UA 4JL0A 4K5AB 3EU9A 3Q78A 3TAXA 3BG1B 3FU3A 2C2LA 4MKTA 2C0MA 4XI9A 2V4LA 1X5BA 3TWUA 3ML9A 4WWNA 3MKQA 5D2MC 4CDMA 1H6KA 3OTNA 3CEQA 1Z3YA 4NQ0A 3NF1A 3RJVA 3ZNGA 4IN3B 4FHKA 2R5SA 3DXMG 3UINC 2WMOA 1E7VA 3DBSA 2OCCE 4CT0A 2XS1A 1PAQA 2UY1B 3UT4A 3NOGD 3ASNE 4JZYA 4KZ0A 2BKKB 3B95A 2CHWA 4G24A 2ILRA 4Q96A 1JCRA 4JA9A 4DJAA 5G04J 4KT6B 1QNFA 3V30A 3D9IA 4BTBA 2DZOA 3J5PA 3C3RA 3DSUA 3W9FA 2CG3A 2OV8A 4M7CA 3QJZA 4N5CA 4ABNA 5FQ7A 3URZA 1VDYA 2LAHA 4NRHB 3TWWA 1H2UA 3CHPA 3L08A 3Q79A 4UWLA 4MBGA 2KZTB 4X8QA 2ETCA 3CVPA 3OXLA 3ASGA 3IBEA 3L17A 2R03A 4GTVA 3AAAC 3FTZA 4Y6WA 5ENNA 1IHGA 3FY4A 3B7SA 3CKBA 4WWOA 2ZISA 3V31A 5AQAA 4JPSA 3SHFA 3CK7A 2WXNA 5CHEE 4JB8P 2XGSA 4GYOA 3PUKA 4GTQA 3HHMA 3EU5A 4WAFA 1SQMA 2X6IA 2VGXB 3ESLA 3D9OA 3EHQA 1D8DA 3QWPA 3MGBA 4PH4B 3KD7A 2MOWA 3LCAA 1RW2A 1X81A 3RIBA 2XGOA 3EHRA 3C72A 3FTVA 4DX6D 3SFXA 4A1SA 4F1PA 3T5XA 5HS0A 1E8WA 4HLEA 1E90A 3ABME 5FZSA 1OXJA 3AG1E 2DVWA 1TR4A 4HI8A 5CEDB 3NZUA 1EPUA 3AU5A 3HXFA 3ONKA 4E6HA 3ZEFA 4BSZB 3EDTB 3Q4AB 3N71A 1TYQG 3CLJA 1OY3D 3IEGA 1MX2A 4TXQA 1AWCB 3SO8A 3UUXA 2I9CA 3FHEA 1Z3XA 3B7BA 3LDZA 4KVOA 3FUFA 1YA0A 2CHZA 3QB2A 4C48B 1OWPA 2UWJG 2KM4A 3FTXA 1A5EA 4AIFA 3MKQB 2GRNB 5C1DA 2ZXWE 3VTXA 1Y8MA 3ZU7B 3LS8A 4EPZA 2A4ZA 3T5VA 3AG4E 4ZFHA 1KT0A 3AG3E 3BEEA 1ELRA 5D0QD 4AEZC 1GW6A 4A1GA 4U96D 3VLEA 2Y3AA 3I3NA 2CG2A 3GZ1A 2IO3C 3RO2A 4LCTA 3IXEA 1TN8A 4I9CA 3UXGA 1W3BA 3ULYA 1SVXA 2VSNA 4TXRA 4GTOA 3LVRE 3S7BA 2M63A 3J5QB 3LEWA 5H7PA 3RRMB 2H6GA 1N4PA 2VTBB 5ENRD 1EDUA 2YHCA 4UUCA 2WXKA 1FT2A 4CCAA 5EX3A 4GTTA 3JUEA 3KEAA 3PZDA 2PQNA 4GYYA 3D9PA 3CR3A 2NSZA 5ENPD 4OYSA 4DK5A 3ZW3A 3CVNA 3V2XA 3APFA 1FCHA 3P1UA 3LJ3A 5DBKA 4Y6CA 4L1BA 5J90A 5CRVA 4U8HA 4G8LA 1KZPA 5CECB 3CVLA 4L2YA 3IHVA 1NP7A 5T3RA 2AJAA 3D9JA 3UTMA 4EZKA 3CKCA 3G2TA 4DPRA 4HRMB 4PUCA 4XZ4A 2JABA 1UJKA 1JPLA 4I6GA 1BU9A 2IO2C 1FPPA 2L0IA 2P9LG 1MQSA 3LPZA 1TNUA 3UKRG 1NL4A 3U9WA 5DIZA 4F6RD 4HOQA 5FTPA 4QQIA 4C9BB 4K5CA 3WXXA 1BD8A 4GTSA 3RAUA 3ONLA 3R9MA 4QFVA 2WVIA 4U7EB 2LAIA 2A5UA 2X38A 3ZYKA 3CSFA 1MYOA 1LTXA 1BPOA 2YNQA 3FU0A 3TWRA 3EIJA 3D9LA 4WNDA 1Z5SC 5ITZF 2WB2A 3FEYA 1QBQA 3MJWA 2WXOA 3BUAA 4G23A 3ULEG 1NI1A 3E33A 4KVMA 3AS4A 3ZXSA 1MZCA 2X6JA 1Z6TA 1U3CA 2PZIA 4I6EA 2P2CP 4CEMA 2R05A 1BI7B 2WXIA 1JWGA 4NIKA 2R02A 4BEPA 1EF1C 1V54E 3APCA 4FA6A 1FT1A 3O4ZA 2CFUA 2XGMA 1TNOA 2WXHA 1WAO1 2XEVA 3ASDA 4GA0A 3QNKA 4N39A 3SBSA 2DWZA 4O1OA 3V2OA 2VTBA 5AN8A 2IF4A 3BG0B 3QWVA 2GGFA 2I1KA 2P9KG 4O1PA 4B89A 4GTPA 5FZRA 2EIJE 1HS6A 4A63B 1H0AA 4AVXA 2OEWA 4KBQA 4MS6A 4UI9C 3GYZA 5BXUA 1UG3A 2PM7A 2Y0BG 3DPDA 3CK8A 3CVVA 3IV0A 4ACKA 3ZHEA 1MX4A 2ZGDA 2F0YA 4J8DA 2L6JA 4DUIA 2VSYA 2L6BA 1V55E 1D8EA 2FULA 4APOA 5JHAA 3F6QA 3Q15A 3DSXA 4U95D 2DYSE 3SGHA 3D9HA 2EILE 5G05C 2MYOA 4EBAG 1N4QA 4LNBA 3EIQC 5A6CA 4DX5D 4FLBA 3TXMA 4EQFA 3UIPC 4HOUA 4G26A 5ENOD 2IY0C 3DSVA 5FT9A 3R9AB 3E30A 5AQ9A 3KSLA 4G1TA 5JJ7A 1N52A 3ZKJA 2J49A 1G3NB 3ZYLA 1INZA 4TV3A 3I5PA 4J8SA 3AS5A 4JHRA 4M3OA 2V5FA 4B8AA 3ASFA 3SY2A 4HRNA 4Q94A 3K9IA 3UX4A 3CVXA 3B7UX 3U66A 4ZHBA 2NC9A 4B93B 5AARA 2P9UG 2X6KA 2CFZA 2J8SD 2ONDA 3L6AA 4A55A 4BT8A 3MV3B 2E2EA 3UPVA 1ZB1A 3FULA 1UN8A 3TL5A 3R7QA 3BU8A 4TRQA 2LNIA 4JEUA 4B94A 2GRQB 5AQBA 4FADA 3AG2E 3HDXA 3FP3A 3ZYQA 4NACA 4I2ZA 1N4SA 3ABKE 1IYGA 3JQ1A 4AY6A 5AJDA 3JUIA 3PZ4A 3U3WA 5KNHD 3CVWA 3SFZA 2JEKA 3C3QA 2EQXA 2DZNA 3CK9A 1DCQA 3FUEA 2ETAA 4NURA 5FIOA 2WXLA 2XS8A 4WWPA 4OAVB 3L16A 3CHRA 3C3OA 1E8XA 4JW1A 3DSWA 3DSSA 4GA2A 1PC2A 2VQ2A 5BW8C 2AW6A 3SF4A 3LY7A 1D9SA 4HRLA 3CVYA 2GRRB 1JUQA 5JJ6A 4P29A 3D9NA 4K03A 4GCNA 3PE4A 3W9GA 2HO1A 5AJLA 3CQCB 4J8YA 3SBTB 2BF0X 3UM1A 3Q5MA 3ZXPA 2RKKA 3DWLG 3PZ2A 3ZUVB 5CMWA 3MZLB 3PE3A 5ARFA 2R59A 4GPMA 2Y4TA 4LUNU 5FQ6A 5AENA 3GZSA 2WXPA 3VTYA 2QC9A 2YHEA 5B1BE 2WQHA 4O6FA 3C98A 4G11A 4I1OB 4CRWA 2X3MA 4OVUA 4L7TA 1H6OA 3I4RB 4FLHA 2FO7A 1YMPA 4GZ3A 3KAEA 3CHSA 4ANUA 1ZU2A 2EIME 2LO6A 2FO1E 3FH8A 4GZDA 1HG5A 3UKUG 4I6JA 3ASOE 3LY9A 4V3IA 4GZ5A 5A23A 4GTMA 3HRAA 1NZNA 4UQYA 4AOFA 4DX1A 2V5QC 5ANRA 2L9BA 1L5JA 4K0RA 1BI8B 5JMND 5IY5E 4EECA 2H6FA 4I17A 5EIBE 3CHQA 4ATGA 3T9KA 2NYJA 4C0MA 3TWSA 4J8EA 4U0UA 1HH8A 2KCLA 1KT1A 5G05J 2AXZA 5ANLA 4I1AA 3GW4A 3JCKC 3L82A 4WNFA 3U64A 3AS8A 2VJ8A 4YVOA 5LX8A 1TNZA 2XCBA 3RKVA 4AXHA 3FWVA 4LSZE 2VGEA 5EN5D 4PS8A 1N11A 4UI9J 3E32A 1DNPA 3Q9NC 4B8CB 4ACLA 4XEIG 1QZ2A 3ZRHA 3FU5A 3MKRA 3FEXA 4KMOA 4FC8A 4LNGA 4APFA 2IU1A 4GB9A 2J4BA 4F3VA 3TWTA 4CDNA 2WPVA 3ZHEB 4XI0A 4TUUA 3L13A 4HFGA 5G2NA 1SZ9A 4KXKB 3S7DA 2LXLA 2X6HA 5KBAA 5CBOA 4HLLA 3X2QE 2KCVA 4J0UA 2XCCA 3D9KA 3SD5A 4I1MA 5JHBA 2HM8A 1KZOA 3TWQA 5AAOA 4I43A 3B13A 2KCKA 4TXPA 3UM3A 4U0ZA 3CGHA 3G2UA 4BTAA 5M72A 1PY1A 4RLYA 4UWKA 3ZGQA 3U4TA 2YQ8A 1YYHA 4H7XA 4Z68A 3FTUA 2IFUA 5CCLA 1N0RA 3FDHA 3RO3A 3HIZA 2V4HC 3Q75A 4CZ2D 1O5MA 2RD0A 3ZYMA 3FUNA 4Q69A 4L9PA 2P9NG 3E4BA 2F8XK 1XGWA 3FUKA 1O1SA 1ZBPA 2IJGX 4BFRA 3ZPJA 2AXVA 1JCQA 3S2AA 4HNAD 1WM5A 5BV1A 2LUHA 3P2BA 4F53A 5FWQA 5KJMA 3LVQE 4N2SA 1XNFA 2XQ0A 3LYAA 4FU3A 1IHBA 4BERA 2DBAA 4JHJA 5E76A 1E8ZA 4FP7A 5EYLA 4DX7D 2IOSA 3G2VA 2VGXA 4UWHA 3DEPA 3CVQA 3RSEG 4MRUA 2P58C 2OEVA 3NB2A 3LXUX 3T8MA 1TNBA 4N2QA 2MHKA 5ENQD 3PS6A 1S70B 1OCOE 2XENA 5CMYA 3MX3A 1OCRE 3NQPA 1UW4B 2C0LA 2ZIRA 3Q73A 3QK0A 3S7JA 4HOTA 4UWGA 4IRUA 3AU4A 5ARGA 4JC8A 5CRUA 2LXMA 3FH5A 4CYMD 2P9SG 5HI7A
chains in the Genus database with same CATH topology
1DCQA 1YMPA 2ETAA 4JB8P 3V79K 4YDYA 4U8YD 5AN8A 1G3NB 5FIOA 3TWUA 1OT8A 4U96D 4O60A 4U8VD 1K3ZD 2FO1E 5HKPA 5AQ7A 2A5EA 1SW6A 4F6RD 3NOCD 2KBXA 4O1PA 4QQIA 4OAVB 2HE0A 5EIDA 3TWTA 4K5CA 4HNAD 4A63B 4J7WA 2XEEA 4HRNA 1BD8A 3IXEA 3EHQA 3UXGA 1IXVA 3TWVA 4ZHBA 1SVXA 3HRAA 3ZNGA 5KBAA 4QFVA 4B93B 5CBOA 5CBNA 5ENTD 5AARA 4DX1A 2B0OE 4HLLA 5HRYA 2V5QC 5BXUA 3EHRA 4HQDA 4DX2A 4DX6D 4G8KA 1BI8B 2RFAA 2Y0BG 5JMND 4F1PA 1D9SA 1MYOA 3TWRA 3J5QB 5CEAA 3AJIA 5EIBE 5HS0A 1K1BA 4HRLA 2J8SD 3DEOA 3TWQA 3UI2A 5AAOA 1WDYA 3NOGD 2BKGA 5ITZF 1WG0A 5ENRD 1MX4A 2BKKB 5EYPF 3B95A 3T8KA 3T9KA 2NYJA 2ZGDA 4UUCA 1IHBA 1UOHA 2DVWA 1TR4A 4HI8A 3W9GA 3TWSA 3JUEA 4BERA 5CEDB 4DUIA 2ZGGA 4LG6A 4K5BA 2ETBA 2L6BA 4GMRA 4J8YA 3HG0D 5EYLA 5CERB 2QYJA 2Y1LE 3V30A 3C5RA 4DX7D 5ENSD 5JA4D 2RFMA 2DZOA 3Q9UC 3KEAA 4HB5A 4RLYA 5AQBA 4BSZB 3ZUVB 3J5PA 2KXPC 1DC2A 3DEPA 5KWDA 3W9FA 2PNNA 5ENPD 4DRXE 2P2CP 1YCSB 1BI7B 1OY3D 1YYHA 4GPMA 1IKND 3F6QA 4YDWA 3V2XA 4Z68A 1MX2A 4NIKA 5KNGA 3TWWA 1N0QA 4U95D 5ENQD 1AWCB 3D9HA 1S70B 4ATZD 4BEPA 3JXIA 2MYOA 4N5QA 3SO8A 4BETA 1N0RA 1MX6A 2ETCA 2XENA 2QC9A 5BXOA 3B7BA 1K1AA 4G8LA 2XEHA 4LSZE 2XZDG 2VGEA 2V4HC 5CECB 5FINA 4BESA 4DX5D 3TWXA 4HI9A 4LNUD 4HBDA 3JXJA 1BLXB 5EN5D 4TUMA 5KNHD 1NFIE 2AJAA 3UTMA 4CZ2D 1N11A 3AAAC 4C48B 1QYMA 5ENOD 1MJ0A 5D66A 1A5EA 3Q9NC 1AP7A 2F8YA 4OAUC 3V31A 2F37A 5AQAA 2F8XK 3ZU7B 4K5AB 2DZNA 5EILA 2DWZA 4HRMB 4O1OA 3V2OA 5AQ9A 3LJNA 2JABA 3EU9A 4CYMD 1BU9A 3NBNB 2XZTG 3ZKJA 4ZFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCQ A;  1YMP A;  2ETA A;  4JB8 P;  3V79 K;  4YDY A;  4U8Y D;  5AN8 A;  1G3N B;  5FIO A;  3TWU A;  1OT8 A;  4U96 D;  4O60 A;  4U8V D;  1K3Z D;  2FO1 E;  5HKP A;  5AQ7 A;  2A5E A;  1SW6 A;  4F6R D;  3NOC D;  2KBX A;  4O1P A;  4QQI A;  4OAV B;  2HE0 A;  5EID A;  3TWT A;  4K5C A;  4HNA D;  4A63 B;  4J7W A;  2XEE A;  4HRN A;  1BD8 A;  3IXE A;  3EHQ A;  3UXG A;  1IXV A;  3TWV A;  4ZHB A;  1SVX A;  3HRA A;  3ZNG A;  5KBA A;  4QFV A;  4B93 B;  5CBO A;  5CBN A;  5ENT D;  5AAR A;  4DX1 A;  2B0O E;  4HLL A;  5HRY A;  2V5Q C;  5BXU A;  3EHR A;  4HQD A;  4DX2 A;  4DX6 D;  4G8K A;  1BI8 B;  2RFA A;  2Y0B G;  5JMN D;  4F1P A;  1D9S A;  1MYO A;  3TWR A;  3J5Q B;  5CEA A;  3AJI A;  5EIB E;  5HS0 A;  1K1B A;  4HRL A;  2J8S D;  3DEO A;  3TWQ A;  3UI2 A;  5AAO A;  1WDY A;  3NOG D;  2BKG A;  5ITZ F;  1WG0 A;  5ENR D;  1MX4 A;  2BKK B;  5EYP F;  3B95 A;  3T8K A;  3T9K A;  2NYJ A;  2ZGD A;  4UUC A;  1IHB A;  1UOH A;  2DVW A;  1TR4 A;  4HI8 A;  3W9G A;  3TWS A;  3JUE A;  4BER A;  5CED B;  4DUI A;  2ZGG A;  4LG6 A;  4K5B A;  2ETB A;  2L6B A;  4GMR A;  4J8Y A;  3HG0 D;  5EYL A;  5CER B;  2QYJ A;  2Y1L E;  3V30 A;  3C5R A;  4DX7 D;  5ENS D;  5JA4 D;  2RFM A;  2DZO A;  3Q9U C;  3KEA A;  4HB5 A;  4RLY A;  5AQB A;  4BSZ B;  3ZUV B;  3J5P A;  2KXP C;  1DC2 A;  3DEP A;  5KWD A;  3W9F A;  2PNN A;  5ENP D;  4DRX E;  2P2C P;  1YCS B;  1BI7 B;  1OY3 D;  1YYH A;  4GPM A;  1IKN D;  3F6Q A;  4YDW A;  3V2X A;  4Z68 A;  1MX2 A;  4NIK A;  5KNG A;  3TWW A;  1N0Q A;  4U95 D;  5ENQ D;  1AWC B;  3D9H A;  1S70 B;  4ATZ D;  4BEP A;  3JXI A;  2MYO A;  4N5Q A;  3SO8 A;  4BET A;  1N0R A;  1MX6 A;  2ETC A;  2XEN A;  2QC9 A;  5BXO A;  3B7B A;  1K1A A;  4G8L A;  2XEH A;  4LSZ E;  2XZD G;  2VGE A;  2V4H C;  5CEC B;  5FIN A;  4BES A;  4DX5 D;  3TWX A;  4HI9 A;  4LNU D;  4HBD A;  3JXJ A;  1BLX B;  5EN5 D;  4TUM A;  5KNH D;  1NFI E;  2AJA A;  3UTM A;  4CZ2 D;  1N11 A;  3AAA C;  4C48 B;  1QYM A;  5ENO D;  1MJ0 A;  5D66 A;  1A5E A;  3Q9N C;  1AP7 A;  2F8Y A;  4OAU C;  3V31 A;  2F37 A;  5AQA A;  2F8X K;  3ZU7 B;  4K5A B;  2DZN A;  5EIL A;  2DWZ A;  4HRM B;  4O1O A;  3V2O A;  5AQ9 A;  3LJN A;  2JAB A;  3EU9 A;  4CYM D;  1BU9 A;  3NBN B;  2XZT G;  3ZKJ A;  4ZFH A; 
#chains in the Genus database with same CATH topology
 3FUD A;  4N3B A;  4AJW A;  4U8Y D;  1WY6 A;  2WMN A;  1OT8 A;  3QC1 A;  4XE0 A;  3PUJ A;  4KYO B;  5LCW C;  2HE0 A;  3PZ1 A;  4CGV A;  1ELK A;  2I2O A;  5T8I A;  3E34 A;  2Q7F A;  2KC7 A;  4GZC A;  2WQ7 A;  3O48 A;  4JXT A;  4DX2 A;  5BPP A;  4YDO A;  1K1B A;  1QQE A;  1WDY A;  4D10 C;  1UN9 A;  2YIN A;  1HXI A;  1TNY A;  4J6I A;  4WNE A;  3FTS A;  2LSV A;  2EIN E;  4EZJ A;  5BNW A;  3ML8 A;  4GU5 A;  1KLX A;  3TG5 A;  5LOZ A;  5JA4 D;  4E85 A;  1OCZ E;  4RVB A;  2BED A;  3PVL A;  1B89 A;  3D9M A;  1HZ4 A;  4PS7 A;  1IKN D;  4UQZ A;  3PDN A;  4ME2 A;  4ILI A;  3E37 A;  2RG8 A;  2IQC A;  4YVQ C;  2OVF A;  4N5Q A;  1TEZ A;  4UI9 K;  4EHM A;  3SNX A;  3PH0 C;  1IQU A;  5J08 A;  1BLX B;  2R17 C;  3HYM B;  4HOS A;  5AYW D;  3ZFW A;  4AP2 A;  1O1R A;  2V0P A;  5EKQ D;  3V79 K;  3KSQ A;  3HVE B;  2I6H A;  4JVS A;  4GZ6 A;  1U3D A;  3UT7 A;  4U8V D;  3RK6 A;  4JA7 A;  3UMV A;  5FQ8 A;  2KBX A;  4BX9 A;  1HX8 A;  1N9A A;  3SFY A;  2XEE A;  3TXN A;  3FTY A;  3I4G A;  4DI4 A;  4KZC A;  2WXR A;  4F7A A;  1N54 A;  1OWL A;  4DLQ A;  3RU0 A;  3OXG A;  4G8K A;  1HG2 A;  4IYP A;  4AV7 A;  3AJI A;  3EHM A;  3ZVV A;  3DEO A;  3CVU A;  1OUV A;  5EDS A;  3JYS A;  3MV2 B;  1WG0 A;  1JWF A;  2AWI A;  3EJN A;  1OWN A;  2XHE A;  2WXM A;  2VSX E;  4K5B A;  1E96 B;  4LRZ A;  1Q2Z A;  2DYR E;  3SQV A;  3C5R A;  2P9P G;  3Q9U C;  2Y4U A;  3JQ0 A;  2BUG A;  2PNN A;  3VLD A;  2WXQ A;  3S7F A;  5G04 C;  3HXB A;  2DIW A;  2IEJ A;  3Q7F A;  5KNG A;  1N0Q A;  3FUH A;  2MRI A;  3CV0 A;  2PM6 A;  4HXI A;  4BET A;  2PQR A;  2ION A;  1MHQ A;  3LY8 A;  1KPS B;  5G55 A;  3Q49 B;  2J08 A;  5BV0 A;  3G2W A;  1RZ4 A;  2F37 A;  3PEU B;  3HXD A;  3LJN A;  3NBN B;  4YDY A;  3QAQ A;  3RRN B;  4JEH A;  5A7D B;  4H7Y A;  3HXE A;  3MEK A;  3TGO A;  3NAW A;  4BWR A;  3OXF A;  1HF8 A;  5KJN A;  4ILG A;  2UY1 A;  2HR2 A;  3TWV A;  1EYH A;  5KJL A;  5CBN A;  1N94 A;  2B0O E;  5HRY A;  5HQ8 A;  2J9Q A;  3EUV A;  2P9I G;  2WQ6 A;  2QZA A;  4IUL A;  3UI2 A;  2GRL A;  2XRZ A;  5EYP F;  3UQ3 A;  3B7T A;  4U63 A;  5FJY A;  4U04 A;  4RG6 A;  3IKO B;  5CER B;  3ENE A;  3WG7 E;  2KXP C;  1E8Y A;  2FBN A;  5KWD A;  3QKY A;  1YCS B;  3QAR A;  4G2V A;  2EIK E;  3CHO A;  3RRU A;  4FJY A;  5FQ4 A;  4GAA A;  3HXC A;  1FVH A;  1K1A A;  2R2L A;  4I2W A;  3FU6 A;  2OVB A;  3DRA A;  4XKB A;  3ASH A;  1DVP A;  3G2S A;  5D66 A;  4OAU C;  3R7R A;  4HVB A;  3VLF A;  3QOU A;  4EZL A;  5LP0 A;  2L0T B;  3UT8 A;  4GPK A;  3MCX A;  2KZT A;  2FI7 A;  2HYZ A;  4W9R A;  5B1A E;  3FFL A;  5B3S E;  2H6I A;  5HKP A;  5KJK A;  2IOL A;  4FJZ A;  2KAT A;  4B0Z A;  4RG9 A;  4F1S A;  4ANX A;  1TJC A;  1H2V C;  5JJT A;  1OCC E;  2QY7 A;  4A3T A;  3DXK G;  4U07 A;  5ENT D;  2JLB A;  1K8K G;  1S63 A;  1S0P A;  3SZ7 A;  3QDN A;  1JCS A;  1N4R A;  2RFA A;  5D0O D;  5CEA A;  1OWM A;  3SI5 A;  1FVF A;  2E0I A;  3EHN A;  3LKU A;  4FHJ A;  2XPI A;  2X6F A;  1HO8 A;  5LFA A;  3HG0 D;  2Y1L E;  1A17 A;  4HOR A;  5ENS D;  1H2T C;  4HB5 A;  4I9E A;  3MYV A;  4L2L A;  4DRX E;  3ABL E;  1P5Q A;  2GW1 A;  3FUI A;  2GRP B;  4BX8 A;  2VYI A;  1O1T A;  4ATZ D;  4HS2 A;  4ILH B;  2XEH A;  4CDR A;  3TG4 A;  3TWX A;  2DCP A;  1ELW A;  1NA3 A;  4HBD A;  3IHY A;  2ZU6 B;  3ESK A;  2NXP A;  5BT1 A;  2B6C A;  2VSO E;  2J4D A;  4ANW A;  2XZT G;  3ZN3 A;  2BTD A;  3L9T A;  4G25 A;  5LCW J;  3CIA A;  1K3Z D;  4DI3 A;  3BQO A;  4UQX A;  4GCO A;  2I1J A;  1LD8 A;  5EID A;  3ULQ A;  4XKC A;  4J7W A;  3MA5 A;  4MLP A;  4BSX A;  5E75 A;  4C0E A;  4PDX A;  1LF8 A;  2V8S E;  4AY5 A;  4N3A A;  2OOE A;  5AIJ A;  3L54 A;  2J09 A;  5KCM A;  3FH7 A;  2BKG A;  2AVP A;  4YND A;  1U2V G;  3T8K A;  3CST A;  3D3M A;  1NA0 A;  3Q7A A;  2GRM A;  5C2Y A;  2ETB A;  3PRE A;  2QYU A;  4GMR A;  4PS3 A;  4L23 A;  4BY6 A;  2QYJ A;  4GTR A;  2H6H A;  3QWW A;  1DC2 A;  1HFA A;  1S64 A;  3PNL B;  4LER A;  2PL2 A;  3B7R L;  3PEV B;  4J8F A;  4JD2 G;  4U0S A;  1N95 A;  3DPY A;  1TJF A;  5BUZ A;  2AXU A;  1DCE A;  3DST A;  4EBA A;  4XIF A;  3PNT B;  3FUM A;  3FTW A;  5FIN A;  3ISM C;  4HI9 A;  3JXJ A;  3APD A;  4TUM A;  1NFI E;  3OAW A;  4ANV A;  1OWO A;  1QYM A;  2LSU A;  1MJ0 A;  1AP7 A;  2F8Y A;  1LD7 A;  5EIL A;  4GML A;  4URK A;  4O60 A;  1UJJ A;  4RSY A;  5AQ7 A;  2A5E A;  1SW6 A;  3NOC D;  3GZ2 A;  3CQG B;  3NZS A;  4JHK A;  2WXF A;  4CGW A;  3UIO C;  1IXV A;  3KEZ A;  2J07 A;  3PRZ A;  4GYW A;  4HQD A;  3KS2 A;  4CT4 A;  4UWF A;  4GA1 A;  3TJP A;  4OVV A;  4R7L A;  4RQI A;  1SZA A;  4XX5 A;  1Y6I A;  2CHX A;  2Y69 E;  3PZ3 A;  2XPZ A;  1UOH A;  2WXJ A;  2ZGG A;  4LG6 A;  4WNG A;  3ZIM A;  4GMJ A;  2FF4 A;  2RFM A;  1HE8 A;  2WXG A;  4AM9 A;  2XPY A;  4LEU A;  4N3C A;  3HVE A;  4WUY A;  3Q47 B;  3UM2 A;  5EX0 A;  3CHM A;  2QFC A;  5CCM A;  4YDW A;  1SA5 A;  3L22 A;  1SA4 A;  3FUJ A;  4FUL A;  3JXI A;  1H6P A;  1MX6 A;  4A3V A;  5BXO A;  2XZD G;  2WM9 A;  4BES A;  4YDE A;  2GRO B;  4LNU D;  2FEZ A;  2VGY A;  1IQR A;  1TN6 A;  5FZQ A;  1H19 A;  2XRY A;  4DLO A;  1HU3 A;  1TN7 A;  3UM0 A;  5T4Y A;  4BT9 A;  1E7U A;  4JL0 A;  4K5A B;  3EU9 A;  3Q78 A;  3TAX A;  3BG1 B;  3FU3 A;  2C2L A;  4MKT A;  2C0M A;  4XI9 A;  2V4L A;  1X5B A;  3TWU A;  3ML9 A;  4WWN A;  3MKQ A;  5D2M C;  4CDM A;  1H6K A;  3OTN A;  3CEQ A;  1Z3Y A;  4NQ0 A;  3NF1 A;  3RJV A;  3ZNG A;  4IN3 B;  4FHK A;  2R5S A;  3DXM G;  3UIN C;  2WMO A;  1E7V A;  3DBS A;  2OCC E;  4CT0 A;  2XS1 A;  1PAQ A;  2UY1 B;  3UT4 A;  3NOG D;  3ASN E;  4JZY A;  4KZ0 A;  2BKK B;  3B95 A;  2CHW A;  4G24 A;  2ILR A;  4Q96 A;  1JCR A;  4JA9 A;  4DJA A;  5G04 J;  4KT6 B;  1QNF A;  3V30 A;  3D9I A;  4BTB A;  2DZO A;  3J5P A;  3C3R A;  3DSU A;  3W9F A;  2CG3 A;  2OV8 A;  4M7C A;  3QJZ A;  4N5C A;  4ABN A;  5FQ7 A;  3URZ A;  1VDY A;  2LAH A;  4NRH B;  3TWW A;  1H2U A;  3CHP A;  3L08 A;  3Q79 A;  4UWL A;  4MBG A;  2KZT B;  4X8Q A;  2ETC A;  3CVP A;  3OXL A;  3ASG A;  3IBE A;  3L17 A;  2R03 A;  4GTV A;  3AAA C;  3FTZ A;  4Y6W A;  5ENN A;  1IHG A;  3FY4 A;  3B7S A;  3CKB A;  4WWO A;  2ZIS A;  3V31 A;  5AQA A;  4JPS A;  3SHF A;  3CK7 A;  2WXN A;  5CHE E;  4JB8 P;  2XGS A;  4GYO A;  3PUK A;  4GTQ A;  3HHM A;  3EU5 A;  4WAF A;  1SQM A;  2X6I A;  2VGX B;  3ESL A;  3D9O A;  3EHQ A;  1D8D A;  3QWP A;  3MGB A;  4PH4 B;  3KD7 A;  2MOW A;  3LCA A;  1RW2 A;  1X81 A;  3RIB A;  2XGO A;  3EHR A;  3C72 A;  3FTV A;  4DX6 D;  3SFX A;  4A1S A;  4F1P A;  3T5X A;  5HS0 A;  1E8W A;  4HLE A;  1E90 A;  3ABM E;  5FZS A;  1OXJ A;  3AG1 E;  2DVW A;  1TR4 A;  4HI8 A;  5CED B;  3NZU A;  1EPU A;  3AU5 A;  3HXF A;  3ONK A;  4E6H A;  3ZEF A;  4BSZ B;  3EDT B;  3Q4A B;  3N71 A;  1TYQ G;  3CLJ A;  1OY3 D;  3IEG A;  1MX2 A;  4TXQ A;  1AWC B;  3SO8 A;  3UUX A;  2I9C A;  3FHE A;  1Z3X A;  3B7B A;  3LDZ A;  4KVO A;  3FUF A;  1YA0 A;  2CHZ A;  3QB2 A;  4C48 B;  1OWP A;  2UWJ G;  2KM4 A;  3FTX A;  1A5E A;  4AIF A;  3MKQ B;  2GRN B;  5C1D A;  2ZXW E;  3VTX A;  1Y8M A;  3ZU7 B;  3LS8 A;  4EPZ A;  2A4Z A;  3T5V A;  3AG4 E;  4ZFH A;  1KT0 A;  3AG3 E;  3BEE A;  1ELR A;  5D0Q D;  4AEZ C;  1GW6 A;  4A1G A;  4U96 D;  3VLE A;  2Y3A A;  3I3N A;  2CG2 A;  3GZ1 A;  2IO3 C;  3RO2 A;  4LCT A;  3IXE A;  1TN8 A;  4I9C A;  3UXG A;  1W3B A;  3ULY A;  1SVX A;  2VSN A;  4TXR A;  4GTO A;  3LVR E;  3S7B A;  2M63 A;  3J5Q B;  3LEW A;  5H7P A;  3RRM B;  2H6G A;  1N4P A;  2VTB B;  5ENR D;  1EDU A;  2YHC A;  4UUC A;  2WXK A;  1FT2 A;  4CCA A;  5EX3 A;  4GTT A;  3JUE A;  3KEA A;  3PZD A;  2PQN A;  4GYY A;  3D9P A;  3CR3 A;  2NSZ A;  5ENP D;  4OYS A;  4DK5 A;  3ZW3 A;  3CVN A;  3V2X A;  3APF A;  1FCH A;  3P1U A;  3LJ3 A;  5DBK A;  4Y6C A;  4L1B A;  5J90 A;  5CRV A;  4U8H A;  4G8L A;  1KZP A;  5CEC B;  3CVL A;  4L2Y A;  3IHV A;  1NP7 A;  5T3R A;  2AJA A;  3D9J A;  3UTM A;  4EZK A;  3CKC A;  3G2T A;  4DPR A;  4HRM B;  4PUC A;  4XZ4 A;  2JAB A;  1UJK A;  1JPL A;  4I6G A;  1BU9 A;  2IO2 C;  1FPP A;  2L0I A;  2P9L G;  1MQS A;  3LPZ A;  1TNU A;  3UKR G;  1NL4 A;  3U9W A;  5DIZ A;  4F6R D;  4HOQ A;  5FTP A;  4QQI A;  4C9B B;  4K5C A;  3WXX A;  1BD8 A;  4GTS A;  3RAU A;  3ONL A;  3R9M A;  4QFV A;  2WVI A;  4U7E B;  2LAI A;  2A5U A;  2X38 A;  3ZYK A;  3CSF A;  1MYO A;  1LTX A;  1BPO A;  2YNQ A;  3FU0 A;  3TWR A;  3EIJ A;  3D9L A;  4WND A;  1Z5S C;  5ITZ F;  2WB2 A;  3FEY A;  1QBQ A;  3MJW A;  2WXO A;  3BUA A;  4G23 A;  3ULE G;  1NI1 A;  3E33 A;  4KVM A;  3AS4 A;  3ZXS A;  1MZC A;  2X6J A;  1Z6T A;  1U3C A;  2PZI A;  4I6E A;  2P2C P;  4CEM A;  2R05 A;  1BI7 B;  2WXI A;  1JWG A;  4NIK A;  2R02 A;  4BEP A;  1EF1 C;  1V54 E;  3APC A;  4FA6 A;  1FT1 A;  3O4Z A;  2CFU A;  2XGM A;  1TNO A;  2WXH A;  1WAO 1;  2XEV A;  3ASD A;  4GA0 A;  3QNK A;  4N39 A;  3SBS A;  2DWZ A;  4O1O A;  3V2O A;  2VTB A;  5AN8 A;  2IF4 A;  3BG0 B;  3QWV A;  2GGF A;  2I1K A;  2P9K G;  4O1P A;  4B89 A;  4GTP A;  5FZR A;  2EIJ E;  1HS6 A;  4A63 B;  1H0A A;  4AVX A;  2OEW A;  4KBQ A;  4MS6 A;  4UI9 C;  3GYZ A;  5BXU A;  1UG3 A;  2PM7 A;  2Y0B G;  3DPD A;  3CK8 A;  3CVV A;  3IV0 A;  4ACK A;  3ZHE A;  1MX4 A;  2ZGD A;  2F0Y A;  4J8D A;  2L6J A;  4DUI A;  2VSY A;  2L6B A;  1V55 E;  1D8E A;  2FUL A;  4APO A;  5JHA A;  3F6Q A;  3Q15 A;  3DSX A;  4U95 D;  2DYS E;  3SGH A;  3D9H A;  2EIL E;  5G05 C;  2MYO A;  4EBA G;  1N4Q A;  4LNB A;  3EIQ C;  5A6C A;  4DX5 D;  4FLB A;  3TXM A;  4EQF A;  3UIP C;  4HOU A;  4G26 A;  5ENO D;  2IY0 C;  3DSV A;  5FT9 A;  3R9A B;  3E30 A;  5AQ9 A;  3KSL A;  4G1T A;  5JJ7 A;  1N52 A;  3ZKJ A;  2J49 A;  1G3N B;  3ZYL A;  1INZ A;  4TV3 A;  3I5P A;  4J8S A;  3AS5 A;  4JHR A;  4M3O A;  2V5F A;  4B8A A;  3ASF A;  3SY2 A;  4HRN A;  4Q94 A;  3K9I A;  3UX4 A;  3CVX A;  3B7U X;  3U66 A;  4ZHB A;  2NC9 A;  4B93 B;  5AAR A;  2P9U G;  2X6K A;  2CFZ A;  2J8S D;  2OND A;  3L6A A;  4A55 A;  4BT8 A;  3MV3 B;  2E2E A;  3UPV A;  1ZB1 A;  3FUL A;  1UN8 A;  3TL5 A;  3R7Q A;  3BU8 A;  4TRQ A;  2LNI A;  4JEU A;  4B94 A;  2GRQ B;  5AQB A;  4FAD A;  3AG2 E;  3HDX A;  3FP3 A;  3ZYQ A;  4NAC A;  4I2Z A;  1N4S A;  3ABK E;  1IYG A;  3JQ1 A;  4AY6 A;  5AJD A;  3JUI A;  3PZ4 A;  3U3W A;  5KNH D;  3CVW A;  3SFZ A;  2JEK A;  3C3Q A;  2EQX A;  2DZN A;  3CK9 A;  1DCQ A;  3FUE A;  2ETA A;  4NUR A;  5FIO A;  2WXL A;  2XS8 A;  4WWP A;  4OAV B;  3L16 A;  3CHR A;  3C3O A;  1E8X A;  4JW1 A;  3DSW A;  3DSS A;  4GA2 A;  1PC2 A;  2VQ2 A;  5BW8 C;  2AW6 A;  3SF4 A;  3LY7 A;  1D9S A;  4HRL A;  3CVY A;  2GRR B;  1JUQ A;  5JJ6 A;  4P29 A;  3D9N A;  4K03 A;  4GCN A;  3PE4 A;  3W9G A;  2HO1 A;  5AJL A;  3CQC B;  4J8Y A;  3SBT B;  2BF0 X;  3UM1 A;  3Q5M A;  3ZXP A;  2RKK A;  3DWL G;  3PZ2 A;  3ZUV B;  5CMW A;  3MZL B;  3PE3 A;  5ARF A;  2R59 A;  4GPM A;  2Y4T A;  4LUN U;  5FQ6 A;  5AEN A;  3GZS A;  2WXP A;  3VTY A;  2QC9 A;  2YHE A;  5B1B E;  2WQH A;  4O6F A;  3C98 A;  4G11 A;  4I1O B;  4CRW A;  2X3M A;  4OVU A;  4L7T A;  1H6O A;  3I4R B;  4FLH A;  2FO7 A;  1YMP A;  4GZ3 A;  3KAE A;  3CHS A;  4ANU A;  1ZU2 A;  2EIM E;  2LO6 A;  2FO1 E;  3FH8 A;  4GZD A;  1HG5 A;  3UKU G;  4I6J A;  3ASO E;  3LY9 A;  4V3I A;  4GZ5 A;  5A23 A;  4GTM A;  3HRA A;  1NZN A;  4UQY A;  4AOF A;  4DX1 A;  2V5Q C;  5ANR A;  2L9B A;  1L5J A;  4K0R A;  1BI8 B;  5JMN D;  5IY5 E;  4EEC A;  2H6F A;  4I17 A;  5EIB E;  3CHQ A;  4ATG A;  3T9K A;  2NYJ A;  4C0M A;  3TWS A;  4J8E A;  4U0U A;  1HH8 A;  2KCL A;  1KT1 A;  5G05 J;  2AXZ A;  5ANL A;  4I1A A;  3GW4 A;  3JCK C;  3L82 A;  4WNF A;  3U64 A;  3AS8 A;  2VJ8 A;  4YVO A;  5LX8 A;  1TNZ A;  2XCB A;  3RKV A;  4AXH A;  3FWV A;  4LSZ E;  2VGE A;  5EN5 D;  4PS8 A;  1N11 A;  4UI9 J;  3E32 A;  1DNP A;  3Q9N C;  4B8C B;  4ACL A;  4XEI G;  1QZ2 A;  3ZRH A;  3FU5 A;  3MKR A;  3FEX A;  4KMO A;  4FC8 A;  4LNG A;  4APF A;  2IU1 A;  4GB9 A;  2J4B A;  4F3V A;  3TWT A;  4CDN A;  2WPV A;  3ZHE B;  4XI0 A;  4TUU A;  3L13 A;  4HFG A;  5G2N A;  1SZ9 A;  4KXK B;  3S7D A;  2LXL A;  2X6H A;  5KBA A;  5CBO A;  4HLL A;  3X2Q E;  2KCV A;  4J0U A;  2XCC A;  3D9K A;  3SD5 A;  4I1M A;  5JHB A;  2HM8 A;  1KZO A;  3TWQ A;  5AAO A;  4I43 A;  3B13 A;  2KCK A;  4TXP A;  3UM3 A;  4U0Z A;  3CGH A;  3G2U A;  4BTA A;  5M72 A;  1PY1 A;  4RLY A;  4UWK A;  3ZGQ A;  3U4T A;  2YQ8 A;  1YYH A;  4H7X A;  4Z68 A;  3FTU A;  2IFU A;  5CCL A;  1N0R A;  3FDH A;  3RO3 A;  3HIZ A;  2V4H C;  3Q75 A;  4CZ2 D;  1O5M A;  2RD0 A;  3ZYM A;  3FUN A;  4Q69 A;  4L9P A;  2P9N G;  3E4B A;  2F8X K;  1XGW A;  3FUK A;  1O1S A;  1ZBP A;  2IJG X;  4BFR A;  3ZPJ A;  2AXV A;  1JCQ A;  3S2A A;  4HNA D;  1WM5 A;  5BV1 A;  2LUH A;  3P2B A;  4F53 A;  5FWQ A;  5KJM A;  3LVQ E;  4N2S A;  1XNF A;  2XQ0 A;  3LYA A;  4FU3 A;  1IHB A;  4BER A;  2DBA A;  4JHJ A;  5E76 A;  1E8Z A;  4FP7 A;  5EYL A;  4DX7 D;  2IOS A;  3G2V A;  2VGX A;  4UWH A;  3DEP A;  3CVQ A;  3RSE G;  4MRU A;  2P58 C;  2OEV A;  3NB2 A;  3LXU X;  3T8M A;  1TNB A;  4N2Q A;  2MHK A;  5ENQ D;  3PS6 A;  1S70 B;  1OCO E;  2XEN A;  5CMY A;  3MX3 A;  1OCR E;  3NQP A;  1UW4 B;  2C0L A;  2ZIR A;  3Q73 A;  3QK0 A;  3S7J A;  4HOT A;  4UWG A;  4IRU A;  3AU4 A;  5ARG A;  4JC8 A;  5CRU A;  2LXM A;  3FH5 A;  4CYM D;  2P9S G;  5HI7 A; 
#chains in the Genus database with same CATH homology
 1DCQ A;  1YMP A;  2ETA A;  4JB8 P;  3V79 K;  4YDY A;  4U8Y D;  5AN8 A;  1G3N B;  5FIO A;  3TWU A;  1OT8 A;  4U96 D;  4O60 A;  4U8V D;  1K3Z D;  2FO1 E;  5HKP A;  5AQ7 A;  2A5E A;  1SW6 A;  4F6R D;  3NOC D;  2KBX A;  4O1P A;  4QQI A;  4OAV B;  2HE0 A;  5EID A;  3TWT A;  4K5C A;  4HNA D;  4A63 B;  4J7W A;  2XEE A;  4HRN A;  1BD8 A;  3IXE A;  3EHQ A;  3UXG A;  1IXV A;  3TWV A;  4ZHB A;  1SVX A;  3HRA A;  3ZNG A;  5KBA A;  4QFV A;  4B93 B;  5CBO A;  5CBN A;  5ENT D;  5AAR A;  4DX1 A;  2B0O E;  4HLL A;  5HRY A;  2V5Q C;  5BXU A;  3EHR A;  4HQD A;  4DX2 A;  4DX6 D;  4G8K A;  1BI8 B;  2RFA A;  2Y0B G;  5JMN D;  4F1P A;  1D9S A;  1MYO A;  3TWR A;  3J5Q B;  5CEA A;  3AJI A;  5EIB E;  5HS0 A;  1K1B A;  4HRL A;  2J8S D;  3DEO A;  3TWQ A;  3UI2 A;  5AAO A;  1WDY A;  3NOG D;  2BKG A;  5ITZ F;  1WG0 A;  5ENR D;  1MX4 A;  2BKK B;  5EYP F;  3B95 A;  3T8K A;  3T9K A;  2NYJ A;  2ZGD A;  4UUC A;  1IHB A;  1UOH A;  2DVW A;  1TR4 A;  4HI8 A;  3W9G A;  3TWS A;  3JUE A;  4BER A;  5CED B;  4DUI A;  2ZGG A;  4LG6 A;  4K5B A;  2ETB A;  2L6B A;  4GMR A;  4J8Y A;  3HG0 D;  5EYL A;  5CER B;  2QYJ A;  2Y1L E;  3V30 A;  3C5R A;  4DX7 D;  5ENS D;  5JA4 D;  2RFM A;  2DZO A;  3Q9U C;  3KEA A;  4HB5 A;  4RLY A;  5AQB A;  4BSZ B;  3ZUV B;  3J5P A;  2KXP C;  1DC2 A;  3DEP A;  5KWD A;  3W9F A;  2PNN A;  5ENP D;  4DRX E;  2P2C P;  1YCS B;  1BI7 B;  1OY3 D;  1YYH A;  4GPM A;  1IKN D;  3F6Q A;  4YDW A;  3V2X A;  4Z68 A;  1MX2 A;  4NIK A;  5KNG A;  3TWW A;  1N0Q A;  4U95 D;  5ENQ D;  1AWC B;  3D9H A;  1S70 B;  4ATZ D;  4BEP A;  3JXI A;  2MYO A;  4N5Q A;  3SO8 A;  4BET A;  1N0R A;  1MX6 A;  2ETC A;  2XEN A;  2QC9 A;  5BXO A;  3B7B A;  1K1A A;  4G8L A;  2XEH A;  4LSZ E;  2XZD G;  2VGE A;  2V4H C;  5CEC B;  5FIN A;  4BES A;  4DX5 D;  3TWX A;  4HI9 A;  4LNU D;  4HBD A;  3JXJ A;  1BLX B;  5EN5 D;  4TUM A;  5KNH D;  1NFI E;  2AJA A;  3UTM A;  4CZ2 D;  1N11 A;  3AAA C;  4C48 B;  1QYM A;  5ENO D;  1MJ0 A;  5D66 A;  1A5E A;  3Q9N C;  1AP7 A;  2F8Y A;  4OAU C;  3V31 A;  2F37 A;  5AQA A;  2F8X K;  3ZU7 B;  4K5A B;  2DZN A;  5EIL A;  2DWZ A;  4HRM B;  4O1O A;  3V2O A;  5AQ9 A;  3LJN A;  2JAB A;  3EU9 A;  4CYM D;  1BU9 A;  3NBN B;  2XZT G;  3ZKJ A;  4ZFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...