3TWRA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human 3bp2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twrA00
5KBAA 1TR4A 3TWRA 2KBXA 3V30A 2V4HC 3TWWA 3TWUA 1IXVA 5EYPF 5HS0A 4DRXE 5BXUA 1K3ZD 1QYMA 3V2XA 3V31A 1IKND 5ITZF 4DUIA 4DX6D 1UOHA 3JXIA 3UTMA 5D66A 4N5QA 5KWDA 4J8YA 3ZKJA 4YDWA 2AJAA 4CZ2D 2L6BA 4HLLA 3KEAA 4Z68A 3B7BA 1YCSB 4U8YD 2ETAA 4HNAD 4O1OA 1S70B 1YYHA 4HRMB 4TUMA 4DX7D 4LSZE 4ZFHA 2RFMA 4HRLA 5CBOA 2HE0A 2V5QC 2DWZA 2MYOA 3Q9UC 2ZGDA 4LNUD 5AQ9A 4GMRA 3TWVA 4HB5A 4DX5D 5JMND 2BKGA 3V79K 1MJ0A 5AQ7A 5EN5D 4BSZB 3TWTA 4K5CA 1MX2A 1BI7B 3NOCD 4JB8P 2DVWA 5ENSD 5HKPA 3UXGA 4ATZD 1BLXB 1N11A 4HQDA 3ZNGA 2XZDG 5CERB 3J5QB 2FO1E 2Y0BG 2F8YA 4ZHBA 4CYMD 2B0OE 5FIOA 5AQAA 5EIBE 5AARA 3V2OA 3W9FA 1K1AA 4U96D 4U95D 2JABA 5EILA 5EIDA 3SO8A 3W9GA 1MYOA 1N0RA 5CEDB 1K1BA 1D9SA 2A5EA 3DEOA 1SVXA 1WDYA 3EU9A 5ENQD 4OAVB 1DC2A 5AAOA 2XENA 4BERA 2RFAA 4F1PA 3IXEA 1MX6A 4BETA 4LG6A 5ENOD 4DX2A 1OT8A 2NYJA 3NOGD 5FINA 2XEHA 5ENTD 4UUCA 2XZTG 2QC9A 3EHRA 4O1PA 2QYJA 2F37A 3UI2A 4GPMA 1A5EA 1AP7A 4QFVA 3TWQA 4DX1A 4HI9A 4G8LA 5CEAA 1SW6A 3C5RA 1MX4A 4BESA 2XEEA 1YMPA 4U8VD 4HBDA 1BU9A 3DEPA 2ZGGA 5AQBA 2ETBA 5BXOA 1AWCB 3B95A 4HI8A 3T9KA 1BI8B 1IHBA 3HG0D 3AJIA 4QQIA 2KXPC 2J8SD 1G3NB 4HRNA 4OAUC 4C48B 3JXJA 5AN8A 3JUEA 4A63B 4K5AB 5CBNA 3D9HA 2PNNA 1WG0A 2ETCA 3T8KA 2DZNA 2P2CP 4BEPA 2VGEA 4F6RD 3AAAC 4O60A 3ZU7B 5ENPD 1NFIE 2DZOA 4G8KA 4J7WA 4YDYA 3TWSA 3HRAA 4B93B 1OY3D 2BKKB 4RLYA 3F6QA 2F8XK 5CECB 5HRYA 5JA4D 4NIKA 3LJNA 1N0QA 2Y1LE 4K5BA 5KNHD 3TWXA 3Q9NC 3ZUVB 1BD8A 3EHQA 5EYLA 1DCQA 5KNGA 3NBNB 5ENRD 3J5PA
chains in the Genus database with same CATH superfamily
3LY7A 3TWRA 4G24A 2X6KA 1LD8A 3CQGB 2IO3C 3EHNA 2XRYA 3JXIA 3T5VA 3ASGA 3SD5A 3EIQC 2PQNA 4Y6CA 4CZ2D 4WWOA 2MRIA 4E85A 2UWJG 4TXRA 1DVPA 1UW4B 4K0RA 1MHQA 4ZFHA 4UWKA 2J49A 3MA5A 5AQ9A 3RRNB 1LTXA 5ENSD 2WB2A 1ELRA 5A23A 2XRZA 3TAXA 4U7EB 2MHKA 3SF4A 3B7TA 4CT0A 3FEXA 3CVQA 5ANLA 2WMNA 4B94A 3UINC 3S7BA 1HO8A 3SQVA 4BERA 4U07A 5KCMA 3BG0B 2GRLA 4FJZA 5ENOD 2V0PA 2XS8A 2WQHA 3DXMG 2AWIA 4WNDA 5BNWA 3ABME 1DNPA 3AS4A 3FUEA 4UI9J 4CGWA 3C72A 4QQIA 3SZ7A 4W9RA 3D9PA 3JXJA 3SBSA 4XKCA 4UWLA 2NC9A 1EYHA 3HXBA 3PVLA 4G8KA 4B93B 2J4BA 4N3CA 5EKQD 3L13A 4ILHB 1TR4A 3QWPA 2DCPA 3TWUA 5KJLA 2R2LA 3HVEA 2CHZA 2P9NG 1S70B 4YNDA 3NAWA 1A17A 5FQ4A 3Q9UC 5KJMA 2OVBA 4HB5A 1IQRA 5JJ7A 2BKGA 3ZW3A 5G55A 2XCCA 2FEZA 4CRWA 1EPUA 1HX8A 2ZISA 2Y3AA 2J07A 3BU8A 2VYIA 4CGVA 1JUQA 4I6EA 1UN9A 3CHMA 2WXJA 3Q75A 3SBTB 4XKBA 4OVVA 4XI0A 3D9JA 3RRMB 4I6GA 4M3OA 4G26A 4K03A 4BSXA 1NI1A 4Y6WA 4ILGA 4AV7A 3BG1B 2FULA 4DLQA 3DEPA 2RG8A 5BXOA 3R9MA 1S0PA 3L08A 3ZIMA 5AYWD 3SNXA 4GCOA 4EZLA 4HRNA 4HXIA 2NSZA 4FHJA 2VQ2A 3JUEA 2MOWA 1Y6IA 3HRAA 4WNGA 5JA4D 1OXJA 3AS8A 2LXLA 3MZLB 3ML9A 3L16A 4I9EA 4KVOA 3FTSA 2GRPB 2KBXA 4UWHA 2R03A 4J0UA 4AVXA 3OTNA 3V31A 4L9PA 3E33A 2LNIA 3PZ2A 4WNFA 4U04A 5FJYA 2WMOA 3UT7A 2P9PG 5D2MC 4GZDA 4U0ZA 4M7CA 3V79K 3I3NA 1BI7B 1Z5SC 3LCAA 5A7DB 4CYMD 3ABKE 4I2WA 3LYAA 5EIBE 2VGXA 4GB9A 4U96D 5EIDA 3D9LA 4GU5A 2A5EA 4FU3A 2NXPA 1EF1C 1MX6A 2XQ0A 3RO2A 4AOFA 1UN8A 3KSLA 5BUZA 3FUMA 5ENTD 3Q47B 1FVFA 4QFVA 4HI9A 2HYZA 2IEJA 1HFAA 3D9MA 3BUAA 4GTQA 2CFUA 2KZTB 2V8SE 4I43A 2WXHA 5D0QD 2GRRB 4J7WA 5DBKA 5HI7A 1N0QA 3FTYA 3TWXA 5EYLA 1PC2A 1KLXA 3RO3A 3HXFA 2L9BA 1KT1A 3Q15A 4WWNA 4DRXE 4GPKA 3L6AA 3S7JA 3ZPJA 2J08A 2PZIA 4HLLA 2I1JA 4HNAD 4PS3A 1N94A 4LRZA 4DX7D 3KS2A 1JCQA 2RFMA 4J6IA 5C2YA 2ZGDA 3QB2A 3APDA 2LAHA 2DVWA 3AU5A 4FLBA 3FUDA 3AS5A 3ZYQA 2IONA 4OYSA 3E30A 3GZ1A 3C98A 3FP3A 1SZAA 4AY5A 2GRMA 1MYOA 1KPSB 5JJTA 3AU4A 3MGBA 3DSTA 2XEVA 4WUYA 3IXEA 3UIPC 4GZ3A 3GYZA 2VGYA 4XE0A 3EHRA 4FA6A 4CEMA 2F0YA 2OV8A 1YA0A 3CEQA 4JZYA 4U8VD 3OXFA 4PDXA 3SY2A 3CVNA 4BTBA 1O1RA 3FUNA 3ASDA 4GTSA 1HE8A 2VTBB 3G2VA 2RKKA 4UQXA 3TWSA 2X38A 3ZYKA 2GW1A 5ENRD 3J5PA 5KBAA 4GZCA 5LX8A 2VSNA 3V2XA 3Q49B 2P9UG 4XX5A 3VTYA 4ANXA 4J8YA 3FUKA 3ZKJA 3E4BA 3MKQA 3D9KA 4B89A 2E2EA 4JXTA 2XHEA 3ZVVA 1K8KG 3FTUA 3PE4A 4LNUD 2DYRE 3EDTB 2H6GA 1V55E 4RQIA 2XGSA 1U3CA 4ZHBA 3ASNE 3FY4A 2A4ZA 5AQAA 2WM9A 1K1AA 4U95D 2XPIA 1N95A 5CEDB 4WAFA 4C9BB 4UI9K 3ENEA 2IFUA 4OVUA 3OXGA 5M72A 3LKUA 4XEIG 4UUCA 5LCWJ 1A5EA 1W3BA 1SA5A 3LVQE 1TN7A 4HVBA 3QKYA 1OWMA 1MZCA 2FBNA 1AWCB 4BX9A 3PNLB 2Y4TA 1P5QA 3BQOA 1N52A 4GCNA 3NZUA 2P2CP 1QBQA 5G2NA 5BT1A 1X5BA 1Z3YA 2IQCA 1D8EA 4K5BA 3QOUA 5AJLA 2X6JA 4FHKA 5LFAA 2J09A 2V4HC 3TWWA 4NACA 2Q7FA 3PNTB 4BT9A 3TJPA 1HG2A 2IF4A 3QAQA 1UOHA 3UTMA 4DI4A 2R17C 4EBAA 4GA1A 2DBAA 4APFA 3SI5A 4I1AA 2OOEA 3RAUA 1H2TC 1Z6TA 3TXMA 2ONDA 1E8YA 2MYOA 3QNKA 4GAAA 2X6IA 2DYSE 3I5PA 4BT8A 1N11A 4HQDA 3ULEG 1QQEA 2OCCE 2JABA 4JEUA 3SO8A 4N3BA 1K1BA 3DSSA 3JQ1A 4WNEA 5AJDA 3VTXA 3HVEB 3FU5A 2QFCA 4KXKB 1UJKA 4F53A 1WAO1 4WWPA 3C3QA 4A3VA 2PL2A 5CRVA 2YQ8A 1ELWA 3L54A 2J9QA 3FU6A 5AQBA 2J4DA 4I1OB 3B95A 4TUUA 1BI8B 2KXPC 4KMOA 1RZ4A 4OAUC 1E7VA 2BF0X 2CHWA 3NQPA 4HFGA 1OCCE 3PS6A 4NIKA 2IU1A 2YINA 5KNHD 3Q9NC 3ZUVB 1HF8A 1O1TA 3HDXA 3ONKA 2KM4A 2WPVA 4O6FA 4N5QA 2R5SA 4GYYA 4U63A 1ELKA 4V3IA 2R05A 2XGOA 4LSZE 4KZCA 2WXMA 3TWVA 2ZU6B 4N5CA 5EN5D 4ATZD 1RW2A 2JEKA 4HOUA 4UQZA 3UM0A 3CVPA 2GRNB 5CRUA 5BW8C 4DJAA 2EQXA 5IY5E 1HG5A 1Q2ZA 2YNQA 4ANWA 5ENNA 4F1PA 1FT1A 3CIAA 3S7FA 2C2LA 3IV0A 3CKBA 3JYSA 4EBAG 2KCLA 2WXRA 3C5RA 5G05C 1DCEA 4C0MA 3CVVA 4JVSA 4G1TA 2HM8A 3CQCB 2JLBA 3B7SA 3AJIA 1IHGA 2J8SD 3DBSA 2VGXB 4L23A 3T8KA 2LSVA 3RIBA 1KZPA 3AAAC 4ILIA 4XZ4A 3DPYA 3CSTA 4KT6B 2F8XK 4BX8A 3ZXPA 5HRYA 2EINE 4AXHA 1S64A 3VLDA 3EHQA 2B6CA 3LVRE 4D10C 4KBQA 2I9CA 3ZYLA 4H7XA 5CCMA 1JWGA 4ABNA 5CMYA 4FADA 2L6BA 4U8HA 4U8YD 1ZU2A 3MEKA 4TXPA 1TNOA 4HRMB 3BEEA 3D3MA 4FP7A 5JMND 2P58C 3CVWA 3ZNGA 4EZJA 1OCRE 2HR2A 3DXKG 4PS8A 2B0OE 3W9GA 5G04C 3HXCA 4YVQC 4CDRA 4AP2A 4O1PA 3UM2A 3SFZA 4DX1A 1SW6A 2FO7A 4HLEA 4HBDA 4AJWA 3T9KA 3HG0D 3KEZA 3U9WA 5B1AE 3ZN3A 2L0IA 3FFLA 2Y4UA 3WG7E 2VGEA 3DSXA 2YHEA 4A1SA 4N3AA 2LSUA 4RG6A 1H6PA 4N39A 3FUFA 3PUJA 3ESKA 4EZKA 5T8IA 2KATA 3IHVA 3HXDA 2R02A 4RSYA 3PZDA 3UKUG 1YCSB 5CCLA 2IO2C 4C0EA 3CLJA 3NB2A 3TL5A 4H7YA 1TNBA 3MX3A 3TWTA 3Q5MA 5ARFA 3ZHEA 2H6FA 2P9KG 1OWNA 3I4GA 4J8EA 3UPVA 1N4QA 2RD0A 4XI9A 3S2AA 2I2OA 3DEOA 3MYVA 4DLOA 1HU3A 3CR3A 3MKQB 2IOSA 4BETA 2CG3A 3NOGD 4MS6A 1UJJA 2IJGX 1N54A 4N2SA 4GPMA 4HORA 3DSWA 4BESA 1YMPA 1ZB1A 4ME2A 1TNUA 3MJWA 3FTZA 4J8SA 4C48B 3L82A 4RG9A 1WG0A 2DZNA 2KC7A 4NRHB 3EIJA 4HS2A 2A5UA 3UX4A 5AENA 3NZSA 3LDZA 2BEDA 1BD8A 2XPYA 5KNGA 4GYWA 5FWQA 1QYMA 1IKND 5JHBA 2AW6A 2XCBA 3L9TA 1VDYA 3RRUA 1E96B 2LUHA 4XIFA 3UQ3A 1WM5A 3B7BA 1YYHA 4APOA 2KZTA 1BPOA 3T5XA 4HRLA 1U3DA 4IN3B 2X3MA 3P1UA 4IULA 1MJ0A 3DSVA 3NOCD 4JB8P 3UXGA 2C0LA 2AXZA 4MBGA 3TXNA 4JD2G 4ANUA 2BTDA 1ZBPA 1KZOA 3QDNA 5E76A 4CT4A 1Y8MA 3GZSA 1N4PA 2PM7A 4JA7A 4PH4B 3FU3A 1B89A 4MLPA 1N4RA 2NYJA 3APCA 4KYOB 1U2VG 4AEZC 3TGOA 1BU9A 2UY1A 4Q94A 1IHBA 2BUGA 2VSYA 2WQ6A 1E8WA 2OVFA 3UT8A 3FH5A 5EX0A 4B8AA 3CHRA 4I1MA 3OXLA 4B0ZA 4A1GA 1H2UA 1NFIE 4YDYA 2GROB 4J8FA 4RLYA 4PUCA 3HIZA 2Y1LE 3FULA 2P9SG 2PQRA 4IRUA 1IXVA 5HS0A 3E32A 4YDOA 3ABLE 3Q73A 5J90A 2ETAA 2EIKE 1TNYA 4RVBA 3RJVA 3K9IA 4MRUA 3EUVA 2E0IA 3PZ1A 5LCWC 1GW6A 4I9CA 1LF8A 5C1DA 5FT9A 4ATGA 1BLXB 4BY6A 4GA2A 2OEVA 2WXFA 3CK8A 4FC8A 4G11A 1TNZA 3W9FA 1TN8A 1TEZA 2PM6A 4R7LA 1IYGA 1OWPA 5JHAA 3EU9A 3PREA 4OAVB 5AAOA 2XENA 2WXIA 2RFAA 3APFA 2WXKA 2I1KA 1OCOE 1WY6A 3P2BA 4G2VA 1V54E 3FUHA 2XZTG 4A3TA 3EHMA 3MCXA 3G2WA 2WXOA 2M63A 5FZSA 1O5MA 4EHMA 4L2YA 4A63B 3PEVB 4DPRA 2ETCA 2AXVA 4BEPA 2EIJE 1NA3A 1OY3D 4FLHA 5CECB 1INZA 5B1BE 3G2UA 3NBNB 3RSEG 4I2ZA 1HS6A 5BXUA 3CGHA 5ITZF 3CSFA 4DUIA 2IY0C 2KCKA 5KWDA 3Q78A 3KEAA 3SGHA 3HHMA 2EIME 1NA0A 1PY1A 3CVYA 2HO1A 2HE0A 4HOTA 3U4TA 2ZIRA 4DX5D 2L6JA 5T4YA 4CCAA 5AQ7A 1FT2A 3E37A 2L0TB 2Y0BG 2F8YA 1TN6A 5FIOA 4UWFA 3PRZA 4EPZA 4GMLA 1WDYA 4B8CB 4BTAA 1H2VC 3FU0A 3ZXSA 3T8MA 5FINA 2XEHA 3CVLA 3C3OA 2EILE 4UI9C 3IBEA 4TRQA 5FTPA 4G8LA 3O4ZA 3LY8A 4I17A 3CHPA 4KZ0A 3PZ4A 1TJFA 4IYPA 4JEHA 5G05J 5BV0A 3FWVA 3GZ2A 3KD7A 4G25A 3D9HA 1TJCA 3LJ3A 2WXGA 4O60A 2P9IG 4AIFA 3JCKC 3DPDA 4JHKA 2CFZA 3LY9A 3CHOA 2C0MA 2LXMA 3LJNA 5DIZA 4GZ6A 3VLFA 1FCHA 2FF4A 2IOLA 1DCQA 1N4SA 3R7QA 3CVXA 3V30A 3PH0C 1KT0A 4GTMA 1SA4A 3O48A 3UUXA 5EDSA 3RK6A 4GYOA 3UT4A 1H19A 4TXQA 2H6HA 2WVIA 4L7TA 3ESLA 1FPPA 2XZDG 3GW4A 3KAEA 3Q7FA 4G23A 4LNGA 3RU0A 1XGWA 1D9SA 1JWFA 1LD7A 5ENQD 4YVOA 3CV0A 3LXUX 2LO6A 4NQ0A 5G04J 2OEWA 2GRQB 3SFYA 3U3WA 5ANRA 2DIWA 4GTPA 3QC1A 3B7UX 2F37A 3UI2A 1AP7A 2CHXA 4JW1A 1MX4A 4P29A 2ZGGA 3MKRA 4ACLA 3ZHEB 3ASFA 5E75A 5BPPA 4Q96A 2CG2A 3RKVA 2ZXWE 3FH7A 5AN8A 2WXNA 3LS8A 2WXLA 5FZQA 3UKRG 1XNFA 3U64A 1D8DA 2VSXE 2BKKB 4JC8A 3SHFA 2AXUA 3CK9A 4FULA 4JPSA 5BV1A 3DRAA 4GTRA 3D9OA 4YDEA 1PAQA 1QNFA 3TG5A 2WQ7A 4YDWA 4EQFA 4Z68A 4JA9A 4N2QA 1FVHA 3PEUB 1OWLA 3HYMB 2V5QC 3AG2E 4A55A 4JHJA 3E34A 2ILRA 1MX2A 4KVMA 3MV3B 5CERB 3J5QB 2P9LG 3IHYA 3QWVA 4UQYA 3R7RA 3I4RB 1E90A 3SFXA 2X6HA 1Z3XA 5EILA 1SZ9A 5KJKA 2GGFA 1N0RA 5ARGA 3URZA 3CK7A 3DWLG 3QARA 1QZ2A 4LG6A 5LOZA 1OCZE 1NZNA 4EECA 3IKOB 3JQ0A 2QYJA 4LUNU 3Q7AA 3TWQA 3FH8A 3ULQA 2WXPA 4MKTA 3TG4A 2ETBA 3AG4E 3DSUA 3ZRHA 5B3SE 5FQ8A 1G3NB 4I6JA 3PZ3A 5T3RA 2XGMA 5CBNA 3C3RA 3WXXA 2WXQA 4URKA 5FZRA 2AVPA 3G2SA 3ZU7B 3ZGQA 1E7UA 2DZOA 4DK5A 4LERA 4JL0A 1SQMA 3FTVA 4LNBA 1HH8A 3IEGA 2XPZA 5EYPF 4E6HA 1JCSA 4ACKA 2QYUA 4DX6D 2UY1B 1E8ZA 4GMJA 1E8XA 2AJAA 5FQ6A 4O1OA 2V5FA 5AIJA 5CBOA 5J08A 4BWRA 3ML8A 5KJNA 4GMRA 4BFRA 4BSZB 1NP7A 4F3VA 3ZYMA 2FI7A 1JPLA 1OUVA 5H7PA 3ONLA 1IQUA 4LCTA 2QY7A 5FQ7A 4F7AA 4HOQA 2QZAA 4DX2A 1OT8A 2VJ8A 2LAIA 4AM9A 4CDMA 1OWOA 4U0SA 2QC9A 2YHCA 3B13A 3UM3A 3UIOC 3FDHA 1S63A 1L5JA 4UWGA 5CEAA 1H0AA 1H6OA 2XEEA 3FHEA 3N71A 4ANVA 3PDNA 4AY6A 3QK0A 4DI3A 1HZ4A 4TV3A 4GA0A 3QWWA 2PNNA 5HQ8A 3PE3A 2X6FA 5CHEE 4F6RD 3CKCA 4GZ5A 5CMWA 4GTVA 4U0UA 3LEWA 3FUIA 4X8QA 5A6CA 4Q69A 3X2QE 1EDUA 1K3ZD 3EU5A 4GTOA 3B7RL 5D66A 2VSOE 3EJNA 3L22A 4J8DA 1UG3A 3OAWA 4HOSA 3HXEA 1NL4A 3Q79A 2KCVA 3FUJA 4TUMA 3PUKA 5EX3A 3ISMC 2DWZA 1MQSA 3FTWA 4NURA 5D0OD 3CHQA 3VLEA 4K5CA 5HKPA 4LEUA 3ZEFA 2FO1E 3UM1A 3S7DA 3FEYA 4CDNA 3Q4AB 3FTXA 5AARA 3V2OA 3D9NA 4JHRA 2VTBA 3CHSA 3G2TA 3QJZA 3JUIA 1SVXA 2Y69E 3ASOE 4L2LA 4GTTA 4FJYA 3U66A 2V4LA 3UMVA 3AG3E 1H6KA 3D9IA 3LPZA 1JCRA 2R59A 3NF1A 3R9AB 4HI8A 3ULYA 2I6HA 3MV2B 4K5AB 3KSQA 1X81A 2H6IA 5JJ6A 2XS1A 1N9AA 5ENPD 1O1SA 3F6QA 4PS7A 1TYQG 5LP0A 4L1BA 3CVUA 1HXIA 3ASHA 3ZFWA 3L17A 4F1SA 3AG1E 1DC2A
chains in the Genus database with same CATH topology
5KBAA 1TR4A 3TWRA 2KBXA 3V30A 2V4HC 3TWWA 3TWUA 1IXVA 5EYPF 5HS0A 4DRXE 5BXUA 1K3ZD 1QYMA 3V2XA 3V31A 1IKND 5ITZF 4DUIA 4DX6D 1UOHA 3JXIA 3UTMA 5D66A 4N5QA 5KWDA 4J8YA 3ZKJA 4YDWA 2AJAA 4CZ2D 2L6BA 4HLLA 3KEAA 4Z68A 3B7BA 1YCSB 4U8YD 2ETAA 4HNAD 4O1OA 1S70B 1YYHA 4HRMB 4TUMA 4DX7D 4LSZE 4ZFHA 2RFMA 4HRLA 5CBOA 2HE0A 2V5QC 2DWZA 2MYOA 3Q9UC 2ZGDA 4LNUD 5AQ9A 4GMRA 3TWVA 4HB5A 4DX5D 5JMND 2BKGA 3V79K 1MJ0A 5AQ7A 5EN5D 4BSZB 3TWTA 4K5CA 1MX2A 1BI7B 3NOCD 4JB8P 2DVWA 5ENSD 5HKPA 3UXGA 4ATZD 1BLXB 1N11A 4HQDA 3ZNGA 2XZDG 5CERB 3J5QB 2FO1E 2Y0BG 2F8YA 4ZHBA 4CYMD 2B0OE 5FIOA 5AQAA 5EIBE 5AARA 3V2OA 3W9FA 1K1AA 4U96D 4U95D 2JABA 5EILA 5EIDA 3SO8A 3W9GA 1MYOA 1N0RA 5CEDB 1K1BA 1D9SA 2A5EA 3DEOA 1SVXA 1WDYA 3EU9A 5ENQD 4OAVB 1DC2A 5AAOA 2XENA 4BERA 2RFAA 4F1PA 3IXEA 1MX6A 4BETA 4LG6A 5ENOD 4DX2A 1OT8A 2NYJA 3NOGD 5FINA 2XEHA 5ENTD 4UUCA 2XZTG 2QC9A 3EHRA 4O1PA 2QYJA 2F37A 3UI2A 4GPMA 1A5EA 1AP7A 4QFVA 3TWQA 4DX1A 4HI9A 4G8LA 5CEAA 1SW6A 3C5RA 1MX4A 4BESA 2XEEA 1YMPA 4U8VD 4HBDA 1BU9A 3DEPA 2ZGGA 5AQBA 2ETBA 5BXOA 1AWCB 3B95A 4HI8A 3T9KA 1BI8B 1IHBA 3HG0D 3AJIA 4QQIA 2KXPC 2J8SD 1G3NB 4HRNA 4OAUC 4C48B 3JXJA 5AN8A 3JUEA 4A63B 4K5AB 5CBNA 3D9HA 2PNNA 1WG0A 2ETCA 3T8KA 2DZNA 2P2CP 4BEPA 2VGEA 4F6RD 3AAAC 4O60A 3ZU7B 5ENPD 1NFIE 2DZOA 4G8KA 4J7WA 4YDYA 3TWSA 3HRAA 4B93B 1OY3D 2BKKB 4RLYA 3F6QA 2F8XK 5CECB 5HRYA 5JA4D 4NIKA 3LJNA 1N0QA 2Y1LE 4K5BA 5KNHD 3TWXA 3Q9NC 3ZUVB 1BD8A 3EHQA 5EYLA 1DCQA 5KNGA 3NBNB 5ENRD 3J5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KBA A;  1TR4 A;  3TWR A;  2KBX A;  3V30 A;  2V4H C;  3TWW A;  3TWU A;  1IXV A;  5EYP F;  5HS0 A;  4DRX E;  5BXU A;  1K3Z D;  1QYM A;  3V2X A;  3V31 A;  1IKN D;  5ITZ F;  4DUI A;  4DX6 D;  1UOH A;  3JXI A;  3UTM A;  5D66 A;  4N5Q A;  5KWD A;  4J8Y A;  3ZKJ A;  4YDW A;  2AJA A;  4CZ2 D;  2L6B A;  4HLL A;  3KEA A;  4Z68 A;  3B7B A;  1YCS B;  4U8Y D;  2ETA A;  4HNA D;  4O1O A;  1S70 B;  1YYH A;  4HRM B;  4TUM A;  4DX7 D;  4LSZ E;  4ZFH A;  2RFM A;  4HRL A;  5CBO A;  2HE0 A;  2V5Q C;  2DWZ A;  2MYO A;  3Q9U C;  2ZGD A;  4LNU D;  5AQ9 A;  4GMR A;  3TWV A;  4HB5 A;  4DX5 D;  5JMN D;  2BKG A;  3V79 K;  1MJ0 A;  5AQ7 A;  5EN5 D;  4BSZ B;  3TWT A;  4K5C A;  1MX2 A;  1BI7 B;  3NOC D;  4JB8 P;  2DVW A;  5ENS D;  5HKP A;  3UXG A;  4ATZ D;  1BLX B;  1N11 A;  4HQD A;  3ZNG A;  2XZD G;  5CER B;  3J5Q B;  2FO1 E;  2Y0B G;  2F8Y A;  4ZHB A;  4CYM D;  2B0O E;  5FIO A;  5AQA A;  5EIB E;  5AAR A;  3V2O A;  3W9F A;  1K1A A;  4U96 D;  4U95 D;  2JAB A;  5EIL A;  5EID A;  3SO8 A;  3W9G A;  1MYO A;  1N0R A;  5CED B;  1K1B A;  1D9S A;  2A5E A;  3DEO A;  1SVX A;  1WDY A;  3EU9 A;  5ENQ D;  4OAV B;  1DC2 A;  5AAO A;  2XEN A;  4BER A;  2RFA A;  4F1P A;  3IXE A;  1MX6 A;  4BET A;  4LG6 A;  5ENO D;  4DX2 A;  1OT8 A;  2NYJ A;  3NOG D;  5FIN A;  2XEH A;  5ENT D;  4UUC A;  2XZT G;  2QC9 A;  3EHR A;  4O1P A;  2QYJ A;  2F37 A;  3UI2 A;  4GPM A;  1A5E A;  1AP7 A;  4QFV A;  3TWQ A;  4DX1 A;  4HI9 A;  4G8L A;  5CEA A;  1SW6 A;  3C5R A;  1MX4 A;  4BES A;  2XEE A;  1YMP A;  4U8V D;  4HBD A;  1BU9 A;  3DEP A;  2ZGG A;  5AQB A;  2ETB A;  5BXO A;  1AWC B;  3B95 A;  4HI8 A;  3T9K A;  1BI8 B;  1IHB A;  3HG0 D;  3AJI A;  4QQI A;  2KXP C;  2J8S D;  1G3N B;  4HRN A;  4OAU C;  4C48 B;  3JXJ A;  5AN8 A;  3JUE A;  4A63 B;  4K5A B;  5CBN A;  3D9H A;  2PNN A;  1WG0 A;  2ETC A;  3T8K A;  2DZN A;  2P2C P;  4BEP A;  2VGE A;  4F6R D;  3AAA C;  4O60 A;  3ZU7 B;  5ENP D;  1NFI E;  2DZO A;  4G8K A;  4J7W A;  4YDY A;  3TWS A;  3HRA A;  4B93 B;  1OY3 D;  2BKK B;  4RLY A;  3F6Q A;  2F8X K;  5CEC B;  5HRY A;  5JA4 D;  4NIK A;  3LJN A;  1N0Q A;  2Y1L E;  4K5B A;  5KNH D;  3TWX A;  3Q9N C;  3ZUV B;  1BD8 A;  3EHQ A;  5EYL A;  1DCQ A;  5KNG A;  3NBN B;  5ENR D;  3J5P A; 
#chains in the Genus database with same CATH topology
 3LY7 A;  3TWR A;  4G24 A;  2X6K A;  1LD8 A;  3CQG B;  2IO3 C;  3EHN A;  2XRY A;  3JXI A;  3T5V A;  3ASG A;  3SD5 A;  3EIQ C;  2PQN A;  4Y6C A;  4CZ2 D;  4WWO A;  2MRI A;  4E85 A;  2UWJ G;  4TXR A;  1DVP A;  1UW4 B;  4K0R A;  1MHQ A;  4ZFH A;  4UWK A;  2J49 A;  3MA5 A;  5AQ9 A;  3RRN B;  1LTX A;  5ENS D;  2WB2 A;  1ELR A;  5A23 A;  2XRZ A;  3TAX A;  4U7E B;  2MHK A;  3SF4 A;  3B7T A;  4CT0 A;  3FEX A;  3CVQ A;  5ANL A;  2WMN A;  4B94 A;  3UIN C;  3S7B A;  1HO8 A;  3SQV A;  4BER A;  4U07 A;  5KCM A;  3BG0 B;  2GRL A;  4FJZ A;  5ENO D;  2V0P A;  2XS8 A;  2WQH A;  3DXM G;  2AWI A;  4WND A;  5BNW A;  3ABM E;  1DNP A;  3AS4 A;  3FUE A;  4UI9 J;  4CGW A;  3C72 A;  4QQI A;  3SZ7 A;  4W9R A;  3D9P A;  3JXJ A;  3SBS A;  4XKC A;  4UWL A;  2NC9 A;  1EYH A;  3HXB A;  3PVL A;  4G8K A;  4B93 B;  2J4B A;  4N3C A;  5EKQ D;  3L13 A;  4ILH B;  1TR4 A;  3QWP A;  2DCP A;  3TWU A;  5KJL A;  2R2L A;  3HVE A;  2CHZ A;  2P9N G;  1S70 B;  4YND A;  3NAW A;  1A17 A;  5FQ4 A;  3Q9U C;  5KJM A;  2OVB A;  4HB5 A;  1IQR A;  5JJ7 A;  2BKG A;  3ZW3 A;  5G55 A;  2XCC A;  2FEZ A;  4CRW A;  1EPU A;  1HX8 A;  2ZIS A;  2Y3A A;  2J07 A;  3BU8 A;  2VYI A;  4CGV A;  1JUQ A;  4I6E A;  1UN9 A;  3CHM A;  2WXJ A;  3Q75 A;  3SBT B;  4XKB A;  4OVV A;  4XI0 A;  3D9J A;  3RRM B;  4I6G A;  4M3O A;  4G26 A;  4K03 A;  4BSX A;  1NI1 A;  4Y6W A;  4ILG A;  4AV7 A;  3BG1 B;  2FUL A;  4DLQ A;  3DEP A;  2RG8 A;  5BXO A;  3R9M A;  1S0P A;  3L08 A;  3ZIM A;  5AYW D;  3SNX A;  4GCO A;  4EZL A;  4HRN A;  4HXI A;  2NSZ A;  4FHJ A;  2VQ2 A;  3JUE A;  2MOW A;  1Y6I A;  3HRA A;  4WNG A;  5JA4 D;  1OXJ A;  3AS8 A;  2LXL A;  3MZL B;  3ML9 A;  3L16 A;  4I9E A;  4KVO A;  3FTS A;  2GRP B;  2KBX A;  4UWH A;  2R03 A;  4J0U A;  4AVX A;  3OTN A;  3V31 A;  4L9P A;  3E33 A;  2LNI A;  3PZ2 A;  4WNF A;  4U04 A;  5FJY A;  2WMO A;  3UT7 A;  2P9P G;  5D2M C;  4GZD A;  4U0Z A;  4M7C A;  3V79 K;  3I3N A;  1BI7 B;  1Z5S C;  3LCA A;  5A7D B;  4CYM D;  3ABK E;  4I2W A;  3LYA A;  5EIB E;  2VGX A;  4GB9 A;  4U96 D;  5EID A;  3D9L A;  4GU5 A;  2A5E A;  4FU3 A;  2NXP A;  1EF1 C;  1MX6 A;  2XQ0 A;  3RO2 A;  4AOF A;  1UN8 A;  3KSL A;  5BUZ A;  3FUM A;  5ENT D;  3Q47 B;  1FVF A;  4QFV A;  4HI9 A;  2HYZ A;  2IEJ A;  1HFA A;  3D9M A;  3BUA A;  4GTQ A;  2CFU A;  2KZT B;  2V8S E;  4I43 A;  2WXH A;  5D0Q D;  2GRR B;  4J7W A;  5DBK A;  5HI7 A;  1N0Q A;  3FTY A;  3TWX A;  5EYL A;  1PC2 A;  1KLX A;  3RO3 A;  3HXF A;  2L9B A;  1KT1 A;  3Q15 A;  4WWN A;  4DRX E;  4GPK A;  3L6A A;  3S7J A;  3ZPJ A;  2J08 A;  2PZI A;  4HLL A;  2I1J A;  4HNA D;  4PS3 A;  1N94 A;  4LRZ A;  4DX7 D;  3KS2 A;  1JCQ A;  2RFM A;  4J6I A;  5C2Y A;  2ZGD A;  3QB2 A;  3APD A;  2LAH A;  2DVW A;  3AU5 A;  4FLB A;  3FUD A;  3AS5 A;  3ZYQ A;  2ION A;  4OYS A;  3E30 A;  3GZ1 A;  3C98 A;  3FP3 A;  1SZA A;  4AY5 A;  2GRM A;  1MYO A;  1KPS B;  5JJT A;  3AU4 A;  3MGB A;  3DST A;  2XEV A;  4WUY A;  3IXE A;  3UIP C;  4GZ3 A;  3GYZ A;  2VGY A;  4XE0 A;  3EHR A;  4FA6 A;  4CEM A;  2F0Y A;  2OV8 A;  1YA0 A;  3CEQ A;  4JZY A;  4U8V D;  3OXF A;  4PDX A;  3SY2 A;  3CVN A;  4BTB A;  1O1R A;  3FUN A;  3ASD A;  4GTS A;  1HE8 A;  2VTB B;  3G2V A;  2RKK A;  4UQX A;  3TWS A;  2X38 A;  3ZYK A;  2GW1 A;  5ENR D;  3J5P A;  5KBA A;  4GZC A;  5LX8 A;  2VSN A;  3V2X A;  3Q49 B;  2P9U G;  4XX5 A;  3VTY A;  4ANX A;  4J8Y A;  3FUK A;  3ZKJ A;  3E4B A;  3MKQ A;  3D9K A;  4B89 A;  2E2E A;  4JXT A;  2XHE A;  3ZVV A;  1K8K G;  3FTU A;  3PE4 A;  4LNU D;  2DYR E;  3EDT B;  2H6G A;  1V55 E;  4RQI A;  2XGS A;  1U3C A;  4ZHB A;  3ASN E;  3FY4 A;  2A4Z A;  5AQA A;  2WM9 A;  1K1A A;  4U95 D;  2XPI A;  1N95 A;  5CED B;  4WAF A;  4C9B B;  4UI9 K;  3ENE A;  2IFU A;  4OVU A;  3OXG A;  5M72 A;  3LKU A;  4XEI G;  4UUC A;  5LCW J;  1A5E A;  1W3B A;  1SA5 A;  3LVQ E;  1TN7 A;  4HVB A;  3QKY A;  1OWM A;  1MZC A;  2FBN A;  1AWC B;  4BX9 A;  3PNL B;  2Y4T A;  1P5Q A;  3BQO A;  1N52 A;  4GCN A;  3NZU A;  2P2C P;  1QBQ A;  5G2N A;  5BT1 A;  1X5B A;  1Z3Y A;  2IQC A;  1D8E A;  4K5B A;  3QOU A;  5AJL A;  2X6J A;  4FHK A;  5LFA A;  2J09 A;  2V4H C;  3TWW A;  4NAC A;  2Q7F A;  3PNT B;  4BT9 A;  3TJP A;  1HG2 A;  2IF4 A;  3QAQ A;  1UOH A;  3UTM A;  4DI4 A;  2R17 C;  4EBA A;  4GA1 A;  2DBA A;  4APF A;  3SI5 A;  4I1A A;  2OOE A;  3RAU A;  1H2T C;  1Z6T A;  3TXM A;  2OND A;  1E8Y A;  2MYO A;  3QNK A;  4GAA A;  2X6I A;  2DYS E;  3I5P A;  4BT8 A;  1N11 A;  4HQD A;  3ULE G;  1QQE A;  2OCC E;  2JAB A;  4JEU A;  3SO8 A;  4N3B A;  1K1B A;  3DSS A;  3JQ1 A;  4WNE A;  5AJD A;  3VTX A;  3HVE B;  3FU5 A;  2QFC A;  4KXK B;  1UJK A;  4F53 A;  1WAO 1;  4WWP A;  3C3Q A;  4A3V A;  2PL2 A;  5CRV A;  2YQ8 A;  1ELW A;  3L54 A;  2J9Q A;  3FU6 A;  5AQB A;  2J4D A;  4I1O B;  3B95 A;  4TUU A;  1BI8 B;  2KXP C;  4KMO A;  1RZ4 A;  4OAU C;  1E7V A;  2BF0 X;  2CHW A;  3NQP A;  4HFG A;  1OCC E;  3PS6 A;  4NIK A;  2IU1 A;  2YIN A;  5KNH D;  3Q9N C;  3ZUV B;  1HF8 A;  1O1T A;  3HDX A;  3ONK A;  2KM4 A;  2WPV A;  4O6F A;  4N5Q A;  2R5S A;  4GYY A;  4U63 A;  1ELK A;  4V3I A;  2R05 A;  2XGO A;  4LSZ E;  4KZC A;  2WXM A;  3TWV A;  2ZU6 B;  4N5C A;  5EN5 D;  4ATZ D;  1RW2 A;  2JEK A;  4HOU A;  4UQZ A;  3UM0 A;  3CVP A;  2GRN B;  5CRU A;  5BW8 C;  4DJA A;  2EQX A;  5IY5 E;  1HG5 A;  1Q2Z A;  2YNQ A;  4ANW A;  5ENN A;  4F1P A;  1FT1 A;  3CIA A;  3S7F A;  2C2L A;  3IV0 A;  3CKB A;  3JYS A;  4EBA G;  2KCL A;  2WXR A;  3C5R A;  5G05 C;  1DCE A;  4C0M A;  3CVV A;  4JVS A;  4G1T A;  2HM8 A;  3CQC B;  2JLB A;  3B7S A;  3AJI A;  1IHG A;  2J8S D;  3DBS A;  2VGX B;  4L23 A;  3T8K A;  2LSV A;  3RIB A;  1KZP A;  3AAA C;  4ILI A;  4XZ4 A;  3DPY A;  3CST A;  4KT6 B;  2F8X K;  4BX8 A;  3ZXP A;  5HRY A;  2EIN E;  4AXH A;  1S64 A;  3VLD A;  3EHQ A;  2B6C A;  3LVR E;  4D10 C;  4KBQ A;  2I9C A;  3ZYL A;  4H7X A;  5CCM A;  1JWG A;  4ABN A;  5CMY A;  4FAD A;  2L6B A;  4U8H A;  4U8Y D;  1ZU2 A;  3MEK A;  4TXP A;  1TNO A;  4HRM B;  3BEE A;  3D3M A;  4FP7 A;  5JMN D;  2P58 C;  3CVW A;  3ZNG A;  4EZJ A;  1OCR E;  2HR2 A;  3DXK G;  4PS8 A;  2B0O E;  3W9G A;  5G04 C;  3HXC A;  4YVQ C;  4CDR A;  4AP2 A;  4O1P A;  3UM2 A;  3SFZ A;  4DX1 A;  1SW6 A;  2FO7 A;  4HLE A;  4HBD A;  4AJW A;  3T9K A;  3HG0 D;  3KEZ A;  3U9W A;  5B1A E;  3ZN3 A;  2L0I A;  3FFL A;  2Y4U A;  3WG7 E;  2VGE A;  3DSX A;  2YHE A;  4A1S A;  4N3A A;  2LSU A;  4RG6 A;  1H6P A;  4N39 A;  3FUF A;  3PUJ A;  3ESK A;  4EZK A;  5T8I A;  2KAT A;  3IHV A;  3HXD A;  2R02 A;  4RSY A;  3PZD A;  3UKU G;  1YCS B;  5CCL A;  2IO2 C;  4C0E A;  3CLJ A;  3NB2 A;  3TL5 A;  4H7Y A;  1TNB A;  3MX3 A;  3TWT A;  3Q5M A;  5ARF A;  3ZHE A;  2H6F A;  2P9K G;  1OWN A;  3I4G A;  4J8E A;  3UPV A;  1N4Q A;  2RD0 A;  4XI9 A;  3S2A A;  2I2O A;  3DEO A;  3MYV A;  4DLO A;  1HU3 A;  3CR3 A;  3MKQ B;  2IOS A;  4BET A;  2CG3 A;  3NOG D;  4MS6 A;  1UJJ A;  2IJG X;  1N54 A;  4N2S A;  4GPM A;  4HOR A;  3DSW A;  4BES A;  1YMP A;  1ZB1 A;  4ME2 A;  1TNU A;  3MJW A;  3FTZ A;  4J8S A;  4C48 B;  3L82 A;  4RG9 A;  1WG0 A;  2DZN A;  2KC7 A;  4NRH B;  3EIJ A;  4HS2 A;  2A5U A;  3UX4 A;  5AEN A;  3NZS A;  3LDZ A;  2BED A;  1BD8 A;  2XPY A;  5KNG A;  4GYW A;  5FWQ A;  1QYM A;  1IKN D;  5JHB A;  2AW6 A;  2XCB A;  3L9T A;  1VDY A;  3RRU A;  1E96 B;  2LUH A;  4XIF A;  3UQ3 A;  1WM5 A;  3B7B A;  1YYH A;  4APO A;  2KZT A;  1BPO A;  3T5X A;  4HRL A;  1U3D A;  4IN3 B;  2X3M A;  3P1U A;  4IUL A;  1MJ0 A;  3DSV A;  3NOC D;  4JB8 P;  3UXG A;  2C0L A;  2AXZ A;  4MBG A;  3TXN A;  4JD2 G;  4ANU A;  2BTD A;  1ZBP A;  1KZO A;  3QDN A;  5E76 A;  4CT4 A;  1Y8M A;  3GZS A;  1N4P A;  2PM7 A;  4JA7 A;  4PH4 B;  3FU3 A;  1B89 A;  4MLP A;  1N4R A;  2NYJ A;  3APC A;  4KYO B;  1U2V G;  4AEZ C;  3TGO A;  1BU9 A;  2UY1 A;  4Q94 A;  1IHB A;  2BUG A;  2VSY A;  2WQ6 A;  1E8W A;  2OVF A;  3UT8 A;  3FH5 A;  5EX0 A;  4B8A A;  3CHR A;  4I1M A;  3OXL A;  4B0Z A;  4A1G A;  1H2U A;  1NFI E;  4YDY A;  2GRO B;  4J8F A;  4RLY A;  4PUC A;  3HIZ A;  2Y1L E;  3FUL A;  2P9S G;  2PQR A;  4IRU A;  1IXV A;  5HS0 A;  3E32 A;  4YDO A;  3ABL E;  3Q73 A;  5J90 A;  2ETA A;  2EIK E;  1TNY A;  4RVB A;  3RJV A;  3K9I A;  4MRU A;  3EUV A;  2E0I A;  3PZ1 A;  5LCW C;  1GW6 A;  4I9C A;  1LF8 A;  5C1D A;  5FT9 A;  4ATG A;  1BLX B;  4BY6 A;  4GA2 A;  2OEV A;  2WXF A;  3CK8 A;  4FC8 A;  4G11 A;  1TNZ A;  3W9F A;  1TN8 A;  1TEZ A;  2PM6 A;  4R7L A;  1IYG A;  1OWP A;  5JHA A;  3EU9 A;  3PRE A;  4OAV B;  5AAO A;  2XEN A;  2WXI A;  2RFA A;  3APF A;  2WXK A;  2I1K A;  1OCO E;  1WY6 A;  3P2B A;  4G2V A;  1V54 E;  3FUH A;  2XZT G;  4A3T A;  3EHM A;  3MCX A;  3G2W A;  2WXO A;  2M63 A;  5FZS A;  1O5M A;  4EHM A;  4L2Y A;  4A63 B;  3PEV B;  4DPR A;  2ETC A;  2AXV A;  4BEP A;  2EIJ E;  1NA3 A;  1OY3 D;  4FLH A;  5CEC B;  1INZ A;  5B1B E;  3G2U A;  3NBN B;  3RSE G;  4I2Z A;  1HS6 A;  5BXU A;  3CGH A;  5ITZ F;  3CSF A;  4DUI A;  2IY0 C;  2KCK A;  5KWD A;  3Q78 A;  3KEA A;  3SGH A;  3HHM A;  2EIM E;  1NA0 A;  1PY1 A;  3CVY A;  2HO1 A;  2HE0 A;  4HOT A;  3U4T A;  2ZIR A;  4DX5 D;  2L6J A;  5T4Y A;  4CCA A;  5AQ7 A;  1FT2 A;  3E37 A;  2L0T B;  2Y0B G;  2F8Y A;  1TN6 A;  5FIO A;  4UWF A;  3PRZ A;  4EPZ A;  4GML A;  1WDY A;  4B8C B;  4BTA A;  1H2V C;  3FU0 A;  3ZXS A;  3T8M A;  5FIN A;  2XEH A;  3CVL A;  3C3O A;  2EIL E;  4UI9 C;  3IBE A;  4TRQ A;  5FTP A;  4G8L A;  3O4Z A;  3LY8 A;  4I17 A;  3CHP A;  4KZ0 A;  3PZ4 A;  1TJF A;  4IYP A;  4JEH A;  5G05 J;  5BV0 A;  3FWV A;  3GZ2 A;  3KD7 A;  4G25 A;  3D9H A;  1TJC A;  3LJ3 A;  2WXG A;  4O60 A;  2P9I G;  4AIF A;  3JCK C;  3DPD A;  4JHK A;  2CFZ A;  3LY9 A;  3CHO A;  2C0M A;  2LXM A;  3LJN A;  5DIZ A;  4GZ6 A;  3VLF A;  1FCH A;  2FF4 A;  2IOL A;  1DCQ A;  1N4S A;  3R7Q A;  3CVX A;  3V30 A;  3PH0 C;  1KT0 A;  4GTM A;  1SA4 A;  3O48 A;  3UUX A;  5EDS A;  3RK6 A;  4GYO A;  3UT4 A;  1H19 A;  4TXQ A;  2H6H A;  2WVI A;  4L7T A;  3ESL A;  1FPP A;  2XZD G;  3GW4 A;  3KAE A;  3Q7F A;  4G23 A;  4LNG A;  3RU0 A;  1XGW A;  1D9S A;  1JWF A;  1LD7 A;  5ENQ D;  4YVO A;  3CV0 A;  3LXU X;  2LO6 A;  4NQ0 A;  5G04 J;  2OEW A;  2GRQ B;  3SFY A;  3U3W A;  5ANR A;  2DIW A;  4GTP A;  3QC1 A;  3B7U X;  2F37 A;  3UI2 A;  1AP7 A;  2CHX A;  4JW1 A;  1MX4 A;  4P29 A;  2ZGG A;  3MKR A;  4ACL A;  3ZHE B;  3ASF A;  5E75 A;  5BPP A;  4Q96 A;  2CG2 A;  3RKV A;  2ZXW E;  3FH7 A;  5AN8 A;  2WXN A;  3LS8 A;  2WXL A;  5FZQ A;  3UKR G;  1XNF A;  3U64 A;  1D8D A;  2VSX E;  2BKK B;  4JC8 A;  3SHF A;  2AXU A;  3CK9 A;  4FUL A;  4JPS A;  5BV1 A;  3DRA A;  4GTR A;  3D9O A;  4YDE A;  1PAQ A;  1QNF A;  3TG5 A;  2WQ7 A;  4YDW A;  4EQF A;  4Z68 A;  4JA9 A;  4N2Q A;  1FVH A;  3PEU B;  1OWL A;  3HYM B;  2V5Q C;  3AG2 E;  4A55 A;  4JHJ A;  3E34 A;  2ILR A;  1MX2 A;  4KVM A;  3MV3 B;  5CER B;  3J5Q B;  2P9L G;  3IHY A;  3QWV A;  4UQY A;  3R7R A;  3I4R B;  1E90 A;  3SFX A;  2X6H A;  1Z3X A;  5EIL A;  1SZ9 A;  5KJK A;  2GGF A;  1N0R A;  5ARG A;  3URZ A;  3CK7 A;  3DWL G;  3QAR A;  1QZ2 A;  4LG6 A;  5LOZ A;  1OCZ E;  1NZN A;  4EEC A;  3IKO B;  3JQ0 A;  2QYJ A;  4LUN U;  3Q7A A;  3TWQ A;  3FH8 A;  3ULQ A;  2WXP A;  4MKT A;  3TG4 A;  2ETB A;  3AG4 E;  3DSU A;  3ZRH A;  5B3S E;  5FQ8 A;  1G3N B;  4I6J A;  3PZ3 A;  5T3R A;  2XGM A;  5CBN A;  3C3R A;  3WXX A;  2WXQ A;  4URK A;  5FZR A;  2AVP A;  3G2S A;  3ZU7 B;  3ZGQ A;  1E7U A;  2DZO A;  4DK5 A;  4LER A;  4JL0 A;  1SQM A;  3FTV A;  4LNB A;  1HH8 A;  3IEG A;  2XPZ A;  5EYP F;  4E6H A;  1JCS A;  4ACK A;  2QYU A;  4DX6 D;  2UY1 B;  1E8Z A;  4GMJ A;  1E8X A;  2AJA A;  5FQ6 A;  4O1O A;  2V5F A;  5AIJ A;  5CBO A;  5J08 A;  4BWR A;  3ML8 A;  5KJN A;  4GMR A;  4BFR A;  4BSZ B;  1NP7 A;  4F3V A;  3ZYM A;  2FI7 A;  1JPL A;  1OUV A;  5H7P A;  3ONL A;  1IQU A;  4LCT A;  2QY7 A;  5FQ7 A;  4F7A A;  4HOQ A;  2QZA A;  4DX2 A;  1OT8 A;  2VJ8 A;  2LAI A;  4AM9 A;  4CDM A;  1OWO A;  4U0S A;  2QC9 A;  2YHC A;  3B13 A;  3UM3 A;  3UIO C;  3FDH A;  1S63 A;  1L5J A;  4UWG A;  5CEA A;  1H0A A;  1H6O A;  2XEE A;  3FHE A;  3N71 A;  4ANV A;  3PDN A;  4AY6 A;  3QK0 A;  4DI3 A;  1HZ4 A;  4TV3 A;  4GA0 A;  3QWW A;  2PNN A;  5HQ8 A;  3PE3 A;  2X6F A;  5CHE E;  4F6R D;  3CKC A;  4GZ5 A;  5CMW A;  4GTV A;  4U0U A;  3LEW A;  3FUI A;  4X8Q A;  5A6C A;  4Q69 A;  3X2Q E;  1EDU A;  1K3Z D;  3EU5 A;  4GTO A;  3B7R L;  5D66 A;  2VSO E;  3EJN A;  3L22 A;  4J8D A;  1UG3 A;  3OAW A;  4HOS A;  3HXE A;  1NL4 A;  3Q79 A;  2KCV A;  3FUJ A;  4TUM A;  3PUK A;  5EX3 A;  3ISM C;  2DWZ A;  1MQS A;  3FTW A;  4NUR A;  5D0O D;  3CHQ A;  3VLE A;  4K5C A;  5HKP A;  4LEU A;  3ZEF A;  2FO1 E;  3UM1 A;  3S7D A;  3FEY A;  4CDN A;  3Q4A B;  3FTX A;  5AAR A;  3V2O A;  3D9N A;  4JHR A;  2VTB A;  3CHS A;  3G2T A;  3QJZ A;  3JUI A;  1SVX A;  2Y69 E;  3ASO E;  4L2L A;  4GTT A;  4FJY A;  3U66 A;  2V4L A;  3UMV A;  3AG3 E;  1H6K A;  3D9I A;  3LPZ A;  1JCR A;  2R59 A;  3NF1 A;  3R9A B;  4HI8 A;  3ULY A;  2I6H A;  3MV2 B;  4K5A B;  3KSQ A;  1X81 A;  2H6I A;  5JJ6 A;  2XS1 A;  1N9A A;  5ENP D;  1O1S A;  3F6Q A;  4PS7 A;  1TYQ G;  5LP0 A;  4L1B A;  3CVU A;  1HXI A;  3ASH A;  3ZFW A;  3L17 A;  4F1S A;  3AG1 E;  1DC2 A; 
#chains in the Genus database with same CATH homology
 5KBA A;  1TR4 A;  3TWR A;  2KBX A;  3V30 A;  2V4H C;  3TWW A;  3TWU A;  1IXV A;  5EYP F;  5HS0 A;  4DRX E;  5BXU A;  1K3Z D;  1QYM A;  3V2X A;  3V31 A;  1IKN D;  5ITZ F;  4DUI A;  4DX6 D;  1UOH A;  3JXI A;  3UTM A;  5D66 A;  4N5Q A;  5KWD A;  4J8Y A;  3ZKJ A;  4YDW A;  2AJA A;  4CZ2 D;  2L6B A;  4HLL A;  3KEA A;  4Z68 A;  3B7B A;  1YCS B;  4U8Y D;  2ETA A;  4HNA D;  4O1O A;  1S70 B;  1YYH A;  4HRM B;  4TUM A;  4DX7 D;  4LSZ E;  4ZFH A;  2RFM A;  4HRL A;  5CBO A;  2HE0 A;  2V5Q C;  2DWZ A;  2MYO A;  3Q9U C;  2ZGD A;  4LNU D;  5AQ9 A;  4GMR A;  3TWV A;  4HB5 A;  4DX5 D;  5JMN D;  2BKG A;  3V79 K;  1MJ0 A;  5AQ7 A;  5EN5 D;  4BSZ B;  3TWT A;  4K5C A;  1MX2 A;  1BI7 B;  3NOC D;  4JB8 P;  2DVW A;  5ENS D;  5HKP A;  3UXG A;  4ATZ D;  1BLX B;  1N11 A;  4HQD A;  3ZNG A;  2XZD G;  5CER B;  3J5Q B;  2FO1 E;  2Y0B G;  2F8Y A;  4ZHB A;  4CYM D;  2B0O E;  5FIO A;  5AQA A;  5EIB E;  5AAR A;  3V2O A;  3W9F A;  1K1A A;  4U96 D;  4U95 D;  2JAB A;  5EIL A;  5EID A;  3SO8 A;  3W9G A;  1MYO A;  1N0R A;  5CED B;  1K1B A;  1D9S A;  2A5E A;  3DEO A;  1SVX A;  1WDY A;  3EU9 A;  5ENQ D;  4OAV B;  1DC2 A;  5AAO A;  2XEN A;  4BER A;  2RFA A;  4F1P A;  3IXE A;  1MX6 A;  4BET A;  4LG6 A;  5ENO D;  4DX2 A;  1OT8 A;  2NYJ A;  3NOG D;  5FIN A;  2XEH A;  5ENT D;  4UUC A;  2XZT G;  2QC9 A;  3EHR A;  4O1P A;  2QYJ A;  2F37 A;  3UI2 A;  4GPM A;  1A5E A;  1AP7 A;  4QFV A;  3TWQ A;  4DX1 A;  4HI9 A;  4G8L A;  5CEA A;  1SW6 A;  3C5R A;  1MX4 A;  4BES A;  2XEE A;  1YMP A;  4U8V D;  4HBD A;  1BU9 A;  3DEP A;  2ZGG A;  5AQB A;  2ETB A;  5BXO A;  1AWC B;  3B95 A;  4HI8 A;  3T9K A;  1BI8 B;  1IHB A;  3HG0 D;  3AJI A;  4QQI A;  2KXP C;  2J8S D;  1G3N B;  4HRN A;  4OAU C;  4C48 B;  3JXJ A;  5AN8 A;  3JUE A;  4A63 B;  4K5A B;  5CBN A;  3D9H A;  2PNN A;  1WG0 A;  2ETC A;  3T8K A;  2DZN A;  2P2C P;  4BEP A;  2VGE A;  4F6R D;  3AAA C;  4O60 A;  3ZU7 B;  5ENP D;  1NFI E;  2DZO A;  4G8K A;  4J7W A;  4YDY A;  3TWS A;  3HRA A;  4B93 B;  1OY3 D;  2BKK B;  4RLY A;  3F6Q A;  2F8X K;  5CEC B;  5HRY A;  5JA4 D;  4NIK A;  3LJN A;  1N0Q A;  2Y1L E;  4K5B A;  5KNH D;  3TWX A;  3Q9N C;  3ZUV B;  1BD8 A;  3EHQ A;  5EYL A;  1DCQ A;  5KNG A;  3NBN B;  5ENR D;  3J5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...