3TWRA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human 3bp2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twrA00
1N11A 4DX1A 4F1PA 4OAVB 2RFAA 5AARA 3V79K 2KXPC 1WG0A 2QYJA 4YDYA 4ZFHA 1K1BA 4G8LA 2XEHA 4LSZE 3C5RA 5EYPF 5ITZF 3EHQA 5CEDB 1SVXA 2Y1LE 1SW6A 4QQIA 1MX2A 1NFIE 2PNNA 5D66A 1OY3D 2AJAA 4LNUD 2ETCA 4TUMA 2KBXA 3NOGD 2DZOA 2P2CP 2A5EA 2BKGA 4O1OA 3TWQA 2XENA 1BLXB 2F37A 3T8KA 3ZNGA 2DVWA 5ENQD 4UUCA 4RLYA 3TWXA 4G8KA 3TWTA 2Y0BG 2NYJA 3AAAC 1N0QA 3D9HA 2BKKB 5FINA 1K3ZD 4J8YA 3ZKJA 4Z68A 1MYOA 3DEPA 5HS0A 2F8YA 4U8YD 4N5QA 4U95D 3V2OA 1G3NB 3B95A 4U96D 4DX7D 4ZHBA 3Q9NC 2JABA 3IXEA 1WDYA 1K1AA 3Q9UC 4O60A 5EYLA 1D9SA 2XZDG 1IXVA 1IHBA 2ETAA 4YDWA 5EN5D 1BD8A 4HLLA 1S70B 3V31A 5JA4D 4A63B 2HE0A 2MYOA 2V5QC 2ZGDA 2V4HC 1DCQA 3EU9A 5AQAA 5KBAA 5ENPD 4DUIA 2RFMA 4J7WA 3J5QB 5EILA 4DRXE 1YCSB 2ZGGA 3UXGA 5AQ9A 5AQBA 3TWVA 1UOHA 4GPMA 5EIDA 2DZNA 3J5PA 3JXJA 3JXIA 1QYMA 5FIOA 1YMPA 3UI2A 1BU9A 4O1PA 1MX4A 3SO8A 2DWZA 5AN8A 2FO1E 3KEAA 3NOCD 4C48B 1TR4A 1MX6A 3HG0D 4GMRA 4K5CA 2F8XK 1AWCB 4QFVA 3TWRA 4BSZB 4HRMB 3B7BA 5HRYA 3NBNB 1BI7B 3TWSA 2XEEA 3AJIA 4HI8A 4K5BA 3ZUVB 2J8SD 5CBOA 3W9GA 4BEPA 5KWDA 4LG6A 5ENSD 5ENRD 3ZU7B 4OAUC 5JMND 4B93B 2L6BA 2VGEA 5CECB 4HQDA 4K5AB 4F6RD 4HRLA 4HI9A 5ENTD 2QC9A 3UTMA 3TWUA 4DX6D 4U8VD 5ENOD 4HRNA 3EHRA 4HNAD 5CEAA 2B0OE 5AQ7A 4DX2A 3V2XA 5BXOA 5AAOA 4CYMD 1DC2A 5CERB 1MJ0A 4CZ2D 4BERA 3HRAA 2XZTG 3W9FA 4JB8P 3F6QA 4HB5A 3JUEA 4BESA 3DEOA 5CBNA 5EIBE 1YYHA 1IKND 5HKPA 4ATZD 1OT8A 4NIKA 5KNGA 3V30A 2ETBA 1N0RA 4HBDA 3TWWA 5BXUA 3T9KA 3LJNA 4BETA 1AP7A 1BI8B 5KNHD 4DX5D 1A5EA
chains in the Genus database with same CATH superfamily
4DX1A 5JHBA 4TXRA 1E7VA 2ILRA 2EIME 3NAWA 2ZISA 1NFIE 1OY3D 4GA1A 3DSWA 3GZ2A 3Q75A 4UQZA 4URKA 1S63A 5G04C 4A1GA 4UUCA 3OAWA 3NZSA 1OCCE 3RJVA 5FTPA 4XKCA 3Q73A 4J8YA 3PVLA 4U96D 1K1AA 3Q9UC 3JUIA 3RO3A 1S70B 3PE3A 2HE0A 2MYOA 3EU9A 3ASFA 4HFGA 2KCLA 5FIOA 1NA0A 2R2LA 3FULA 4ANXA 4MLPA 3VLDA 1ELWA 1DVPA 4WNEA 1LD7A 4YDEA 1FVHA 4A3VA 3G2VA 5ENOD 4JHKA 1S64A 4EQFA 3VTYA 3CVPA 4Y6CA 1PC2A 1XGWA 3CHRA 3ESLA 3IKOB 1UN9A 5EIBE 3FUKA 1OT8A 4XZ4A 2P58C 4UWLA 5BXUA 1AP7A 3CSTA 4IYPA 3PZ3A 3SHFA 1UJKA 3B7TA 3S7DA 3HYMB 3QK0A 4KZCA 4F1PA 3MV3B 4U0UA 3ZPJA 4F7AA 2HM8A 1K1BA 5ITZF 3C5RA 1A17A 3TG5A 3MV2B 4CCAA 1OCOE 2LO6A 3L54A 4UQYA 4FLBA 5ANRA 2I2OA 3DBSA 4BTAA 3FUIA 3NB2A 1KZOA 3G2UA 4BFRA 3DSUA 4W9RA 2HYZA 4AY6A 3DWLG 3B95A 3CQGB 5T3RA 2L0IA 2JABA 5BPPA 4JD2G 4FJZA 1BD8A 3FUNA 2B6CA 1N95A 3I3NA 4J7WA 4HLEA 5J90A 4N3CA 3VTXA 1QYMA 1JCSA 2XQ0A 3EJNA 4FLHA 5BV0A 2P9PG 4I43A 5B1AE 4I6EA 2XEEA 3TWSA 3FU6A 3KAEA 4ANWA 4G23A 3UTMA 4DX6D 4EBAG 2XCCA 3MEKA 3RAUA 5BXOA 3FUMA 3B7SA 5EX0A 2LXLA 4J8SA 3UMVA 1L5JA 3SD5A 3FUDA 3CVUA 3R9AB 2CHZA 5CMWA 4XI9A 1PAQA 2KATA 1ZB1A 4GCNA 1MX2A 4PDXA 4TUMA 1X5BA 2YINA 4YVQC 3AU4A 3RSEG 4XX5A 1OUVA 4X8QA 4O6FA 3HXBA 2GRRB 4LNGA 2VTBB 3ZYLA 3APDA 2I6HA 2AXUA 4N5QA 3Q49B 1G3NB 3LY9A 2IEJA 3KEZA 1WDYA 1HH8A 4APFA 1Z3XA 4YDWA 2V5QC 1NI1A 3L82A 4R7LA 3GZSA 3OTNA 2JLBA 1H2UA 3UI2A 4UI9J 3CVQA 2FO1E 2YHCA 2IFUA 4AM9A 5B3SE 3NBNB 3U9WA 3MA5A 4PUCA 4U8HA 5JMND 2HR2A 5FT9A 1D8DA 1INZA 5FZSA 4WUYA 2LAIA 2XGMA 1Z3YA 4UWGA 4OVVA 4UWKA 1N4QA 3SFZA 5AYWD 3UUXA 4HOUA 1HE8A 5ARFA 3MX3A 4ATZD 3D9OA 3UKUG 2CFUA 2IY0C 2YHEA 2XHEA 3WXXA 5FQ7A 5EX3A 2RFAA 3BU8A 5ENNA 2KXPC 3UIOC 5FQ4A 4MBGA 4ANUA 3FTSA 2MRIA 2PNNA 5B1BE 3FUFA 1O5MA 1IHGA 2OVFA 3DSVA 2BUGA 3IHVA 3UINC 5IY5E 3FH8A 1LTXA 4TUUA 2BF0X 1FVFA 1P5QA 4ILHB 2EILE 2LNIA 2VQ2A 1D9SA 1JCQA 4MKTA 3ISMC 4JHRA 5FJYA 2V4HC 3LJ3A 2WVIA 2X6IA 3LKUA 3CVLA 2GROB 2HO1A 3SO8A 3MKRA 4U63A 3L08A 3HG0D 1E8YA 3TWRA 3PH0C 3QKYA 4K5BA 4YNDA 1QQEA 4RVBA 4Y6WA 4APOA 2XGSA 5AQ7A 2L9BA 1KLXA 4CYMD 4K03A 3RIBA 3LY8A 4P29A 4KYOB 1ZBPA 2AXZA 1IQUA 3DPYA 4OYSA 3QJZA 3V30A 3QARA 1U2VG 4JEHA 2OOEA 4M7CA 5LX8A 4HORA 1TN6A 2E2EA 2OVBA 3PS6A 4MS6A 4DI4A 5AJDA 4GTPA 3E37A 4FP7A 4I1MA 2WPVA 4AP2A 3E30A 4GYOA 2LUHA 3AS8A 3EIQC 3T8MA 1IYGA 5LCWC 4CDMA 4B94A 4GTRA 2XRYA 3V2OA 4DX7D 3IEGA 3IXEA 4EZJA 5C1DA 2XPZA 3CHQA 3PEUB 1DCQA 1TNBA 4U04A 3JCKC 4EZLA 3VLFA 4BWRA 4JL0A 2IONA 1SA4A 2ZGGA 3UXGA 1BU9A 4N3AA 4O1PA 3PZ1A 2EIJE 3Q79A 5FWQA 4HOQA 5ANLA 4L23A 4C0MA 1TEZA 2P9KG 3W9GA 3ASDA 4KVOA 3SBTB 1S0PA 3CVWA 2J4BA 2VYIA 2GGFA 3IHYA 5CHEE 2I9CA 1DC2A 1MJ0A 4KBQA 5BNWA 4PH4B 4AVXA 3F6QA 1UW4B 2FULA 3UT7A 3U3WA 1N4RA 2PM7A 3ZHEB 1Z5SC 2ZXWE 4LSZE 5G04J 3GZ1A 5EDSA 3L16A 5A7DB 2ETCA 5BT1A 3NOGD 1HG5A 4OVUA 3U64A 3SQVA 3ENEA 5FQ8A 4CT4A 3CLJA 3CIAA 3U66A 3T5VA 1H19A 4WWNA 1Z6TA 3URZA 5EKQD 2ZIRA 4AXHA 3Q9NC 4I2WA 2LAHA 2XZDG 5LCWJ 3APCA 4RG9A 3Q78A 3U4TA 2WXKA 3PREA 2RFMA 3KSQA 2PZIA 1UOHA 4GMLA 3D9LA 3AS4A 3SFXA 4G1TA 3R7RA 2CFZA 2YNQA 3ULQA 2AXVA 4HRMB 4JVSA 4GYYA 1ZU2A 4LG6A 5ENRD 3ZW3A 4DLQA 2KC7A 2XGOA 5H7PA 3DRAA 4V3IA 2UWJG 3UM3A 2XCBA 4DX2A 4EECA 5CERB 1FPPA 3D9MA 3UT4A 1FT1A 3FUHA 3JQ0A 4NACA 4C9BB 5KNHD 5J08A 5FZRA 5CMYA 3V79K 4N2QA 2MHKA 4ZFHA 2XEHA 5EYPF 1Q2ZA 5CCLA 1SW6A 2WM9A 4G25A 5LP0A 1E7UA 4Q94A 4WNGA 3E4BA 2DZOA 3C3RA 5ARGA 2GW1A 3LDZA 2WXJA 1PY1A 4AEZC 1X81A 1H6OA 2H6GA 4N39A 3RRNB 4ILIA 4GAAA 5G05J 3ZVVA 3CHSA 3TWXA 3TWTA 3LPZA 4CT0A 5JJTA 1N0QA 4GTMA 4Z68A 4ZHBA 3N71A 2WXHA 3UIPC 3V31A 3BQOA 1TN7A 3AU5A 5DBKA 2BEDA 1D8EA 4BETA 3L9TA 2NC9A 5G05C 3TAXA 3P1UA 3NOCD 3OXGA 5G55A 4XE0A 3C72A 4WWPA 1U3DA 1E90A 4J0UA 3BG0B 4HRLA 1UG3A 3QC1A 4WNFA 4CRWA 3HVEB 2OEVA 3MZLB 3S2AA 3HRAA 2XZTG 4JC8A 4NURA 3FTXA 3ESKA 3DEOA 1NL4A 4U0SA 1V55E 3FTYA 1A5EA 4A55A 4GTTA 2Q7FA 3R9MA 4EPZA 1QZ2A 5CRUA 2CHWA 2WXQA 1LF8A 5D66A 2OEWA 4HXIA 2EIKE 3JQ1A 1XNFA 3FY4A 3ASOE 2J08A 4BX9A 3RU0A 1Y6IA 4ACLA 3EIJA 3FUEA 4G8KA 4N2SA 3QDNA 3EHNA 2KM4A 1JWFA 1E8XA 3ULYA 4LRZA 4JXTA 5A23A 2FEZA 2XEVA 5JA4D 3L13A 3HXCA 3ONLA 1EF1C 3D9PA 3CV0A 4JA7A 1H2TC 1UN8A 5BV1A 3ZXSA 2IU1A 2GRLA 5CCMA 1RZ4A 2QZAA 4BTBA 3ZXPA 2P9IG 3JYSA 3CR3A 5ENSD 3DXMG 1TNZA 4RQIA 3FH5A 4TXPA 3V2XA 4Q96A 5AJLA 4XKBA 2V4LA 3LYAA 4GU5A 2XPIA 3LVQE 3T9KA 2GRNB 2H6HA 1NP7A 3UX4A 4DK5A 1N11A 3FTUA 4FHJA 1SQMA 5D0OD 2WMOA 4CGWA 3MCXA 2VSOE 5C2YA 2RD0A 2VGYA 3ZN3A 2KBXA 2P9NG 2R5SA 4GZ3A 2XENA 3CHMA 3ZNGA 2V8SE 2R17C 2P9LG 3RRUA 3UT8A 1QBQA 2CG3A 1FT2A 3LCAA 2VGXA 4U8YD 4U95D 2A5UA 1IXVA 5EN5D 3FEYA 3R7QA 2X6FA 1SZ9A 2WXOA 3CSFA 2Y69E 4U7EB 4HVBA 4E85A 5A6CA 3TL5A 4PS7A 3TXMA 4DRXE 2XS1A 1TNUA 2DZNA 4TV3A 4HOTA 2Y4TA 1K8KG 3FHEA 1AWCB 1B89A 5HRYA 4HS2A 3AJIA 1ELRA 1OWMA 3DSXA 3NF1A 2XS8A 1OXJA 3S7FA 2R03A 4FC8A 1MHQA 4J6IA 4B89A 1O1RA 5AAOA 2FF4A 1TNYA 2P9UG 3EU5A 4JB8P 3CVNA 4JA9A 2EQXA 3CVYA 5KJMA 3P2BA 2ETBA 3O4ZA 1BI8B 1EPUA 1H2VC 2WXNA 1TJCA 4CGVA 2I1JA 2VSNA 4I1AA 3QOUA 4I6JA 2FO7A 3SF4A 3B7RL 4GA2A 4UWFA 2NXPA 2R05A 4B0ZA 3HXFA 1BPOA 2P2CP 3LXUX 2WQ6A 5ENQD 4I2ZA 3LY7A 1JCRA 3DSSA 3MKQB 2PL2A 3G2SA 3PNLB 1MZCA 2JEKA 1K3ZD 3CVXA 1MYOA 1RW2A 2PQNA 3CK7A 2VTBA 2X3MA 5G2NA 1SA5A 3EHMA 4RG6A 2H6IA 2PM6A 3SI5A 1GW6A 3JXIA 4A3TA 4N3BA 1MX4A 4C48B 4GMRA 2F8XK 1KZPA 2XPYA 3ZGQA 2M63A 4GZ6A 1KPSB 4BEPA 5LFAA 4ILGA 2L6BA 2IQCA 5CECB 3IV0A 2OCCE 5ENTD 1OCZE 4UI9K 5CEAA 4AJWA 2WXPA 3B7UX 1E96B 3FP3A 4CZ2D 3E34A 1IKND 3O48A 3QNKA 3ABLE 5BW8C 2F0YA 3LJNA 4N5CA 4BT8A 4F1SA 3PUKA 4GB9A 5KJNA 2J4DA 3DSTA 3ZIMA 5AARA 2C0LA 4DPRA 4YVOA 2QYJA 1UJJA 1DCEA 3NQPA 3EHQA 2X6HA 2Y1LE 3CHOA 4QQIA 1N4SA 2BKGA 3UKRG 3PUJA 3AS5A 1KT1A 4GTVA 3ZYQA 4FJYA 3ML8A 3Q15A 4RLYA 3FUJA 4I9EA 3AAAC 2BKKB 1EYHA 1N94A 2UY1B 4BT9A 1NZNA 4NQ0A 3AG1E 3SGHA 4IRUA 4JEUA 4AY5A 3C3OA 4GCOA 3SZ7A 4YDOA 4G24A 3J5QB 1OWLA 3AG4E 4M3OA 3I4GA 1YMPA 5AN8A 2R02A 4GMJA 1N9AA 3SY2A 1MX6A 4BSZB 4CDNA 2X6KA 1YA0A 3S7BA 3FEXA 3ZUVB 5CBOA 3E32A 2J8SD 3MJWA 3ZU7B 5D0QD 3PE4A 2DBAA 2CG2A 4FADA 3LEWA 5T8IA 5FZQA 4PS3A 3AG2E 3D9IA 4NIKA 5KNGA 3TWWA 5HI7A 5CRVA 4DI3A 3CHPA 3ASNE 3PZDA 2FI7A 3EUVA 3CVVA 2PQRA 3CK9A 4G8LA 3Q7AA 4CDRA 1TJFA 2QYUA 3QB2A 3HIZA 3ZEFA 4H7YA 2A5EA 4B8CB 4J8FA 4TXQA 3TWQA 4KXKB 1HU3A 4XEIG 3ZYMA 3MKQA 3B13A 4G26A 4XI0A 2KZTA 2CHXA 2WMNA 2WXLA 3FU3A 2VJ8A 3DEPA 2AWIA 2WQ7A 3FU5A 2C2LA 3UM1A 2X6JA 1N4PA 2XRZA 2LXMA 4HLLA 5AENA 5JJ6A 4L2LA 1N54A 2VGXB 3ZYKA 3ML9A 4JHJA 4ME2A 3OXFA 1OWOA 3RO2A 1YCSB 2RKKA 1TN8A 4EZKA 5AQBA 3CQCB 3UM0A 4UQXA 2WQHA 5E76A 3ASHA 1NA3A 5FQ6A 1BI7B 3PEVB 4TRQA 4U0ZA 3OXLA 5KWDA 3CEQA 4ANVA 4B93B 4K5AB 2KCKA 3T5XA 1TYQG 3TWUA 4UWHA 2A4ZA 2R59A 4JZYA 3GYZA 3SBSA 1HX8A 4XIFA 3ABKE 3W9FA 4AOFA 5DIZA 5M72A 5CBNA 4BESA 3RRMB 3HVEA 4DX5D 3UPVA 4J8EA 1N52A 4K0RA 1OWNA 1WG0A 1WY6A 3FTVA 2EINE 3DPDA 1MQSA 5CEDB 1SVXA 2ZU6B 2WB2A 1WAO1 3PNTB 4PS8A 4L1BA 4GPKA 2Y0BG 4FHKA 3VLEA 3EDTB 2IOSA 4JPSA 3QAQA 5FINA 3ULEG 2J07A 5HS0A 4KVMA 5KJKA 4O60A 5EYLA 2J9QA 3TGOA 2ETAA 4B8AA 3D9KA 2DIWA 2ZGDA 3DXKG 2P9SG 1H6KA 5AQ9A 3TWVA 4I6GA 4GZCA 1H6PA 4I1OB 4QFVA 2WXGA 4FULA 3TXNA 3SFYA 1W3BA 4LUNU 2L0TB 4UI9C 3CKCA 2V0PA 2GRPB 2VGEA 2WXFA 5T4YA 4F6RD 2QC9A 3PDNA 5E75A 4DLOA 4GA0A 1EDUA 4HB5A 4BSXA 2L6JA 5HKPA 4FA6A 4ACKA 3CGHA 4OAVB 4FU3A 3ONKA 3PZ4A 4YDYA 3CKBA 2J09A 2LSUA 4LNUD 1QNFA 3PZ2A 1IQRA 1V54E 3I4RB 3L6AA 2J49A 3E33A 2F37A 4I9CA 1HZ4A 2DVWA 5JJ7A 2H6FA 3UM2A 3MYVA 3D9HA 1DNPA 3FTWA 4LNBA 3TJPA 4BY6A 2DYRE 1IHBA 4G11A 3G2TA 4ATGA 4L7TA 5D2MC 4A63B 5AQAA 5ENPD 4KT6B 3Q5MA 4BX8A 1U3CA 3UQ3A 4KMOA 3PRZA 5LOZA 4IULA 2V5FA 3KEAA 4H7XA 1Y8MA 2KCVA 3ABME 3FDHA 1SZAA 2VSXE 3FU0A 3WG7E 3KSLA 3BG1B 4HNAD 2B0OE 3QWPA 2FBNA 4BERA 4EBAA 4C0EA 2UY1A 3JUEA 2GRMA 1YYHA 3APFA 3C3QA 1N0RA 4HBDA 3CK8A 2QFCA 1VDYA 5BUZA 2ONDA 4GTSA 2E0IA 2GRQB 2AJAA 3S7JA 1E8WA 3FWVA 2IO2C 3I5PA 3BEEA 4O1OA 2OV8A 5KJLA 2AW6A 4L9PA 1BLXB 2VSYA 4DJAA 2RG8A 3C98A 2KZTB 1H0AA 2BTDA 2MOWA 2Y4UA 3HHMA 2F8YA 3ZHEA 4LCTA 2AVPA 5JHAA 4GYWA 4WWOA 4GZDA 4WNDA 2WXIA 2IOLA 3LVRE 4GTQA 3L17A 3AG3E 1O1TA 5EILA 3BUAA 4KZ0A 3X2QE 5EIDA 3J5PA 5HQ8A 2DWZA 4IN3B 1HG2A 2IJGX 2X38A 3D3MA 4K5CA 2LSVA 4JW1A 3B7BA 1HXIA 4L2YA 3FFLA 3Q7FA 4AIFA 1KT0A 4HI9A 4U8VD 4E6HA 3KS2A 3FH7A 4MRUA 4NRHB 2WXMA 3QWVA 4EHMA 4Q69A 2YQ8A 3D9NA 3MGBA 5KCMA 1JUQA 3HXDA 1JWGA 4RSYA 2Y3AA 1JPLA 2DCPA 4ABNA 3Q47B 1HFAA 1OWPA 2DYSE 2IF4A 3SNXA 4D10C 4I17A 3ASGA 4U07A 3KD7A 4LERA 4J8DA 3G2WA 3ZFWA 2NSZA 4WAFA 4F53A 4AV7A 1E8ZA 5AIJA 3T8KA 3RKVA 3TG4A 2NYJA 1LD8A 4GZ5A 3GW4A 2QY7A 3Q4AB 3ZRHA 3ZKJA 2WXRA 3D9JA 2I1KA 4GTOA 4HOSA 1ELKA 2IO3C 5KBAA 4DUIA 3K9IA 4GPMA 3JXJA 2C0MA 3RK6A 3LS8A 4LEUA 1TR4A 1HS6A 3IBEA 1OCRE 3QWWA 4F3VA 3HDXA 4HI8A 3HXEA 3L22A 4CEMA 4OAUC 4HQDA 3FTZA 1HO8A 4A1SA 1TNOA 1HF8A 3NZUA 4HRNA 3EHRA 1O1SA 1WM5A 4G2VA 1FCHA
chains in the Genus database with same CATH topology
1N11A 4DX1A 4F1PA 4OAVB 2RFAA 5AARA 3V79K 2KXPC 1WG0A 2QYJA 4YDYA 4ZFHA 1K1BA 4G8LA 2XEHA 4LSZE 3C5RA 5EYPF 5ITZF 3EHQA 5CEDB 1SVXA 2Y1LE 1SW6A 4QQIA 1MX2A 1NFIE 2PNNA 5D66A 1OY3D 2AJAA 4LNUD 2ETCA 4TUMA 2KBXA 3NOGD 2DZOA 2P2CP 2A5EA 2BKGA 4O1OA 3TWQA 2XENA 1BLXB 2F37A 3T8KA 3ZNGA 2DVWA 5ENQD 4UUCA 4RLYA 3TWXA 4G8KA 3TWTA 2Y0BG 2NYJA 3AAAC 1N0QA 3D9HA 2BKKB 5FINA 1K3ZD 4J8YA 3ZKJA 4Z68A 1MYOA 3DEPA 5HS0A 2F8YA 4U8YD 4N5QA 4U95D 3V2OA 1G3NB 3B95A 4U96D 4DX7D 4ZHBA 3Q9NC 2JABA 3IXEA 1WDYA 1K1AA 3Q9UC 4O60A 5EYLA 1D9SA 2XZDG 1IXVA 1IHBA 2ETAA 4YDWA 5EN5D 1BD8A 4HLLA 1S70B 3V31A 5JA4D 4A63B 2HE0A 2MYOA 2V5QC 2ZGDA 2V4HC 1DCQA 3EU9A 5AQAA 5KBAA 5ENPD 4DUIA 2RFMA 4J7WA 3J5QB 5EILA 4DRXE 1YCSB 2ZGGA 3UXGA 5AQ9A 5AQBA 3TWVA 1UOHA 4GPMA 5EIDA 2DZNA 3J5PA 3JXJA 3JXIA 1QYMA 5FIOA 1YMPA 3UI2A 1BU9A 4O1PA 1MX4A 3SO8A 2DWZA 5AN8A 2FO1E 3KEAA 3NOCD 4C48B 1TR4A 1MX6A 3HG0D 4GMRA 4K5CA 2F8XK 1AWCB 4QFVA 3TWRA 4BSZB 4HRMB 3B7BA 5HRYA 3NBNB 1BI7B 3TWSA 2XEEA 3AJIA 4HI8A 4K5BA 3ZUVB 2J8SD 5CBOA 3W9GA 4BEPA 5KWDA 4LG6A 5ENSD 5ENRD 3ZU7B 4OAUC 5JMND 4B93B 2L6BA 2VGEA 5CECB 4HQDA 4K5AB 4F6RD 4HRLA 4HI9A 5ENTD 2QC9A 3UTMA 3TWUA 4DX6D 4U8VD 5ENOD 4HRNA 3EHRA 4HNAD 5CEAA 2B0OE 5AQ7A 4DX2A 3V2XA 5BXOA 5AAOA 4CYMD 1DC2A 5CERB 1MJ0A 4CZ2D 4BERA 3HRAA 2XZTG 3W9FA 4JB8P 3F6QA 4HB5A 3JUEA 4BESA 3DEOA 5CBNA 5EIBE 1YYHA 1IKND 5HKPA 4ATZD 1OT8A 4NIKA 5KNGA 3V30A 2ETBA 1N0RA 4HBDA 3TWWA 5BXUA 3T9KA 3LJNA 4BETA 1AP7A 1BI8B 5KNHD 4DX5D 1A5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N11 A;  4DX1 A;  4F1P A;  4OAV B;  2RFA A;  5AAR A;  3V79 K;  2KXP C;  1WG0 A;  2QYJ A;  4YDY A;  4ZFH A;  1K1B A;  4G8L A;  2XEH A;  4LSZ E;  3C5R A;  5EYP F;  5ITZ F;  3EHQ A;  5CED B;  1SVX A;  2Y1L E;  1SW6 A;  4QQI A;  1MX2 A;  1NFI E;  2PNN A;  5D66 A;  1OY3 D;  2AJA A;  4LNU D;  2ETC A;  4TUM A;  2KBX A;  3NOG D;  2DZO A;  2P2C P;  2A5E A;  2BKG A;  4O1O A;  3TWQ A;  2XEN A;  1BLX B;  2F37 A;  3T8K A;  3ZNG A;  2DVW A;  5ENQ D;  4UUC A;  4RLY A;  3TWX A;  4G8K A;  3TWT A;  2Y0B G;  2NYJ A;  3AAA C;  1N0Q A;  3D9H A;  2BKK B;  5FIN A;  1K3Z D;  4J8Y A;  3ZKJ A;  4Z68 A;  1MYO A;  3DEP A;  5HS0 A;  2F8Y A;  4U8Y D;  4N5Q A;  4U95 D;  3V2O A;  1G3N B;  3B95 A;  4U96 D;  4DX7 D;  4ZHB A;  3Q9N C;  2JAB A;  3IXE A;  1WDY A;  1K1A A;  3Q9U C;  4O60 A;  5EYL A;  1D9S A;  2XZD G;  1IXV A;  1IHB A;  2ETA A;  4YDW A;  5EN5 D;  1BD8 A;  4HLL A;  1S70 B;  3V31 A;  5JA4 D;  4A63 B;  2HE0 A;  2MYO A;  2V5Q C;  2ZGD A;  2V4H C;  1DCQ A;  3EU9 A;  5AQA A;  5KBA A;  5ENP D;  4DUI A;  2RFM A;  4J7W A;  3J5Q B;  5EIL A;  4DRX E;  1YCS B;  2ZGG A;  3UXG A;  5AQ9 A;  5AQB A;  3TWV A;  1UOH A;  4GPM A;  5EID A;  2DZN A;  3J5P A;  3JXJ A;  3JXI A;  1QYM A;  5FIO A;  1YMP A;  3UI2 A;  1BU9 A;  4O1P A;  1MX4 A;  3SO8 A;  2DWZ A;  5AN8 A;  2FO1 E;  3KEA A;  3NOC D;  4C48 B;  1TR4 A;  1MX6 A;  3HG0 D;  4GMR A;  4K5C A;  2F8X K;  1AWC B;  4QFV A;  3TWR A;  4BSZ B;  4HRM B;  3B7B A;  5HRY A;  3NBN B;  1BI7 B;  3TWS A;  2XEE A;  3AJI A;  4HI8 A;  4K5B A;  3ZUV B;  2J8S D;  5CBO A;  3W9G A;  4BEP A;  5KWD A;  4LG6 A;  5ENS D;  5ENR D;  3ZU7 B;  4OAU C;  5JMN D;  4B93 B;  2L6B A;  2VGE A;  5CEC B;  4HQD A;  4K5A B;  4F6R D;  4HRL A;  4HI9 A;  5ENT D;  2QC9 A;  3UTM A;  3TWU A;  4DX6 D;  4U8V D;  5ENO D;  4HRN A;  3EHR A;  4HNA D;  5CEA A;  2B0O E;  5AQ7 A;  4DX2 A;  3V2X A;  5BXO A;  5AAO A;  4CYM D;  1DC2 A;  5CER B;  1MJ0 A;  4CZ2 D;  4BER A;  3HRA A;  2XZT G;  3W9F A;  4JB8 P;  3F6Q A;  4HB5 A;  3JUE A;  4BES A;  3DEO A;  5CBN A;  5EIB E;  1YYH A;  1IKN D;  5HKP A;  4ATZ D;  1OT8 A;  4NIK A;  5KNG A;  3V30 A;  2ETB A;  1N0R A;  4HBD A;  3TWW A;  5BXU A;  3T9K A;  3LJN A;  4BET A;  1AP7 A;  1BI8 B;  5KNH D;  4DX5 D;  1A5E A; 
#chains in the Genus database with same CATH topology
 4DX1 A;  5JHB A;  4TXR A;  1E7V A;  2ILR A;  2EIM E;  3NAW A;  2ZIS A;  1NFI E;  1OY3 D;  4GA1 A;  3DSW A;  3GZ2 A;  3Q75 A;  4UQZ A;  4URK A;  1S63 A;  5G04 C;  4A1G A;  4UUC A;  3OAW A;  3NZS A;  1OCC E;  3RJV A;  5FTP A;  4XKC A;  3Q73 A;  4J8Y A;  3PVL A;  4U96 D;  1K1A A;  3Q9U C;  3JUI A;  3RO3 A;  1S70 B;  3PE3 A;  2HE0 A;  2MYO A;  3EU9 A;  3ASF A;  4HFG A;  2KCL A;  5FIO A;  1NA0 A;  2R2L A;  3FUL A;  4ANX A;  4MLP A;  3VLD A;  1ELW A;  1DVP A;  4WNE A;  1LD7 A;  4YDE A;  1FVH A;  4A3V A;  3G2V A;  5ENO D;  4JHK A;  1S64 A;  4EQF A;  3VTY A;  3CVP A;  4Y6C A;  1PC2 A;  1XGW A;  3CHR A;  3ESL A;  3IKO B;  1UN9 A;  5EIB E;  3FUK A;  1OT8 A;  4XZ4 A;  2P58 C;  4UWL A;  5BXU A;  1AP7 A;  3CST A;  4IYP A;  3PZ3 A;  3SHF A;  1UJK A;  3B7T A;  3S7D A;  3HYM B;  3QK0 A;  4KZC A;  4F1P A;  3MV3 B;  4U0U A;  3ZPJ A;  4F7A A;  2HM8 A;  1K1B A;  5ITZ F;  3C5R A;  1A17 A;  3TG5 A;  3MV2 B;  4CCA A;  1OCO E;  2LO6 A;  3L54 A;  4UQY A;  4FLB A;  5ANR A;  2I2O A;  3DBS A;  4BTA A;  3FUI A;  3NB2 A;  1KZO A;  3G2U A;  4BFR A;  3DSU A;  4W9R A;  2HYZ A;  4AY6 A;  3DWL G;  3B95 A;  3CQG B;  5T3R A;  2L0I A;  2JAB A;  5BPP A;  4JD2 G;  4FJZ A;  1BD8 A;  3FUN A;  2B6C A;  1N95 A;  3I3N A;  4J7W A;  4HLE A;  5J90 A;  4N3C A;  3VTX A;  1QYM A;  1JCS A;  2XQ0 A;  3EJN A;  4FLH A;  5BV0 A;  2P9P G;  4I43 A;  5B1A E;  4I6E A;  2XEE A;  3TWS A;  3FU6 A;  3KAE A;  4ANW A;  4G23 A;  3UTM A;  4DX6 D;  4EBA G;  2XCC A;  3MEK A;  3RAU A;  5BXO A;  3FUM A;  3B7S A;  5EX0 A;  2LXL A;  4J8S A;  3UMV A;  1L5J A;  3SD5 A;  3FUD A;  3CVU A;  3R9A B;  2CHZ A;  5CMW A;  4XI9 A;  1PAQ A;  2KAT A;  1ZB1 A;  4GCN A;  1MX2 A;  4PDX A;  4TUM A;  1X5B A;  2YIN A;  4YVQ C;  3AU4 A;  3RSE G;  4XX5 A;  1OUV A;  4X8Q A;  4O6F A;  3HXB A;  2GRR B;  4LNG A;  2VTB B;  3ZYL A;  3APD A;  2I6H A;  2AXU A;  4N5Q A;  3Q49 B;  1G3N B;  3LY9 A;  2IEJ A;  3KEZ A;  1WDY A;  1HH8 A;  4APF A;  1Z3X A;  4YDW A;  2V5Q C;  1NI1 A;  3L82 A;  4R7L A;  3GZS A;  3OTN A;  2JLB A;  1H2U A;  3UI2 A;  4UI9 J;  3CVQ A;  2FO1 E;  2YHC A;  2IFU A;  4AM9 A;  5B3S E;  3NBN B;  3U9W A;  3MA5 A;  4PUC A;  4U8H A;  5JMN D;  2HR2 A;  5FT9 A;  1D8D A;  1INZ A;  5FZS A;  4WUY A;  2LAI A;  2XGM A;  1Z3Y A;  4UWG A;  4OVV A;  4UWK A;  1N4Q A;  3SFZ A;  5AYW D;  3UUX A;  4HOU A;  1HE8 A;  5ARF A;  3MX3 A;  4ATZ D;  3D9O A;  3UKU G;  2CFU A;  2IY0 C;  2YHE A;  2XHE A;  3WXX A;  5FQ7 A;  5EX3 A;  2RFA A;  3BU8 A;  5ENN A;  2KXP C;  3UIO C;  5FQ4 A;  4MBG A;  4ANU A;  3FTS A;  2MRI A;  2PNN A;  5B1B E;  3FUF A;  1O5M A;  1IHG A;  2OVF A;  3DSV A;  2BUG A;  3IHV A;  3UIN C;  5IY5 E;  3FH8 A;  1LTX A;  4TUU A;  2BF0 X;  1FVF A;  1P5Q A;  4ILH B;  2EIL E;  2LNI A;  2VQ2 A;  1D9S A;  1JCQ A;  4MKT A;  3ISM C;  4JHR A;  5FJY A;  2V4H C;  3LJ3 A;  2WVI A;  2X6I A;  3LKU A;  3CVL A;  2GRO B;  2HO1 A;  3SO8 A;  3MKR A;  4U63 A;  3L08 A;  3HG0 D;  1E8Y A;  3TWR A;  3PH0 C;  3QKY A;  4K5B A;  4YND A;  1QQE A;  4RVB A;  4Y6W A;  4APO A;  2XGS A;  5AQ7 A;  2L9B A;  1KLX A;  4CYM D;  4K03 A;  3RIB A;  3LY8 A;  4P29 A;  4KYO B;  1ZBP A;  2AXZ A;  1IQU A;  3DPY A;  4OYS A;  3QJZ A;  3V30 A;  3QAR A;  1U2V G;  4JEH A;  2OOE A;  4M7C A;  5LX8 A;  4HOR A;  1TN6 A;  2E2E A;  2OVB A;  3PS6 A;  4MS6 A;  4DI4 A;  5AJD A;  4GTP A;  3E37 A;  4FP7 A;  4I1M A;  2WPV A;  4AP2 A;  3E30 A;  4GYO A;  2LUH A;  3AS8 A;  3EIQ C;  3T8M A;  1IYG A;  5LCW C;  4CDM A;  4B94 A;  4GTR A;  2XRY A;  3V2O A;  4DX7 D;  3IEG A;  3IXE A;  4EZJ A;  5C1D A;  2XPZ A;  3CHQ A;  3PEU B;  1DCQ A;  1TNB A;  4U04 A;  3JCK C;  4EZL A;  3VLF A;  4BWR A;  4JL0 A;  2ION A;  1SA4 A;  2ZGG A;  3UXG A;  1BU9 A;  4N3A A;  4O1P A;  3PZ1 A;  2EIJ E;  3Q79 A;  5FWQ A;  4HOQ A;  5ANL A;  4L23 A;  4C0M A;  1TEZ A;  2P9K G;  3W9G A;  3ASD A;  4KVO A;  3SBT B;  1S0P A;  3CVW A;  2J4B A;  2VYI A;  2GGF A;  3IHY A;  5CHE E;  2I9C A;  1DC2 A;  1MJ0 A;  4KBQ A;  5BNW A;  4PH4 B;  4AVX A;  3F6Q A;  1UW4 B;  2FUL A;  3UT7 A;  3U3W A;  1N4R A;  2PM7 A;  3ZHE B;  1Z5S C;  2ZXW E;  4LSZ E;  5G04 J;  3GZ1 A;  5EDS A;  3L16 A;  5A7D B;  2ETC A;  5BT1 A;  3NOG D;  1HG5 A;  4OVU A;  3U64 A;  3SQV A;  3ENE A;  5FQ8 A;  4CT4 A;  3CLJ A;  3CIA A;  3U66 A;  3T5V A;  1H19 A;  4WWN A;  1Z6T A;  3URZ A;  5EKQ D;  2ZIR A;  4AXH A;  3Q9N C;  4I2W A;  2LAH A;  2XZD G;  5LCW J;  3APC A;  4RG9 A;  3Q78 A;  3U4T A;  2WXK A;  3PRE A;  2RFM A;  3KSQ A;  2PZI A;  1UOH A;  4GML A;  3D9L A;  3AS4 A;  3SFX A;  4G1T A;  3R7R A;  2CFZ A;  2YNQ A;  3ULQ A;  2AXV A;  4HRM B;  4JVS A;  4GYY A;  1ZU2 A;  4LG6 A;  5ENR D;  3ZW3 A;  4DLQ A;  2KC7 A;  2XGO A;  5H7P A;  3DRA A;  4V3I A;  2UWJ G;  3UM3 A;  2XCB A;  4DX2 A;  4EEC A;  5CER B;  1FPP A;  3D9M A;  3UT4 A;  1FT1 A;  3FUH A;  3JQ0 A;  4NAC A;  4C9B B;  5KNH D;  5J08 A;  5FZR A;  5CMY A;  3V79 K;  4N2Q A;  2MHK A;  4ZFH A;  2XEH A;  5EYP F;  1Q2Z A;  5CCL A;  1SW6 A;  2WM9 A;  4G25 A;  5LP0 A;  1E7U A;  4Q94 A;  4WNG A;  3E4B A;  2DZO A;  3C3R A;  5ARG A;  2GW1 A;  3LDZ A;  2WXJ A;  1PY1 A;  4AEZ C;  1X81 A;  1H6O A;  2H6G A;  4N39 A;  3RRN B;  4ILI A;  4GAA A;  5G05 J;  3ZVV A;  3CHS A;  3TWX A;  3TWT A;  3LPZ A;  4CT0 A;  5JJT A;  1N0Q A;  4GTM A;  4Z68 A;  4ZHB A;  3N71 A;  2WXH A;  3UIP C;  3V31 A;  3BQO A;  1TN7 A;  3AU5 A;  5DBK A;  2BED A;  1D8E A;  4BET A;  3L9T A;  2NC9 A;  5G05 C;  3TAX A;  3P1U A;  3NOC D;  3OXG A;  5G55 A;  4XE0 A;  3C72 A;  4WWP A;  1U3D A;  1E90 A;  4J0U A;  3BG0 B;  4HRL A;  1UG3 A;  3QC1 A;  4WNF A;  4CRW A;  3HVE B;  2OEV A;  3MZL B;  3S2A A;  3HRA A;  2XZT G;  4JC8 A;  4NUR A;  3FTX A;  3ESK A;  3DEO A;  1NL4 A;  4U0S A;  1V55 E;  3FTY A;  1A5E A;  4A55 A;  4GTT A;  2Q7F A;  3R9M A;  4EPZ A;  1QZ2 A;  5CRU A;  2CHW A;  2WXQ A;  1LF8 A;  5D66 A;  2OEW A;  4HXI A;  2EIK E;  3JQ1 A;  1XNF A;  3FY4 A;  3ASO E;  2J08 A;  4BX9 A;  3RU0 A;  1Y6I A;  4ACL A;  3EIJ A;  3FUE A;  4G8K A;  4N2S A;  3QDN A;  3EHN A;  2KM4 A;  1JWF A;  1E8X A;  3ULY A;  4LRZ A;  4JXT A;  5A23 A;  2FEZ A;  2XEV A;  5JA4 D;  3L13 A;  3HXC A;  3ONL A;  1EF1 C;  3D9P A;  3CV0 A;  4JA7 A;  1H2T C;  1UN8 A;  5BV1 A;  3ZXS A;  2IU1 A;  2GRL A;  5CCM A;  1RZ4 A;  2QZA A;  4BTB A;  3ZXP A;  2P9I G;  3JYS A;  3CR3 A;  5ENS D;  3DXM G;  1TNZ A;  4RQI A;  3FH5 A;  4TXP A;  3V2X A;  4Q96 A;  5AJL A;  4XKB A;  2V4L A;  3LYA A;  4GU5 A;  2XPI A;  3LVQ E;  3T9K A;  2GRN B;  2H6H A;  1NP7 A;  3UX4 A;  4DK5 A;  1N11 A;  3FTU A;  4FHJ A;  1SQM A;  5D0O D;  2WMO A;  4CGW A;  3MCX A;  2VSO E;  5C2Y A;  2RD0 A;  2VGY A;  3ZN3 A;  2KBX A;  2P9N G;  2R5S A;  4GZ3 A;  2XEN A;  3CHM A;  3ZNG A;  2V8S E;  2R17 C;  2P9L G;  3RRU A;  3UT8 A;  1QBQ A;  2CG3 A;  1FT2 A;  3LCA A;  2VGX A;  4U8Y D;  4U95 D;  2A5U A;  1IXV A;  5EN5 D;  3FEY A;  3R7Q A;  2X6F A;  1SZ9 A;  2WXO A;  3CSF A;  2Y69 E;  4U7E B;  4HVB A;  4E85 A;  5A6C A;  3TL5 A;  4PS7 A;  3TXM A;  4DRX E;  2XS1 A;  1TNU A;  2DZN A;  4TV3 A;  4HOT A;  2Y4T A;  1K8K G;  3FHE A;  1AWC B;  1B89 A;  5HRY A;  4HS2 A;  3AJI A;  1ELR A;  1OWM A;  3DSX A;  3NF1 A;  2XS8 A;  1OXJ A;  3S7F A;  2R03 A;  4FC8 A;  1MHQ A;  4J6I A;  4B89 A;  1O1R A;  5AAO A;  2FF4 A;  1TNY A;  2P9U G;  3EU5 A;  4JB8 P;  3CVN A;  4JA9 A;  2EQX A;  3CVY A;  5KJM A;  3P2B A;  2ETB A;  3O4Z A;  1BI8 B;  1EPU A;  1H2V C;  2WXN A;  1TJC A;  4CGV A;  2I1J A;  2VSN A;  4I1A A;  3QOU A;  4I6J A;  2FO7 A;  3SF4 A;  3B7R L;  4GA2 A;  4UWF A;  2NXP A;  2R05 A;  4B0Z A;  3HXF A;  1BPO A;  2P2C P;  3LXU X;  2WQ6 A;  5ENQ D;  4I2Z A;  3LY7 A;  1JCR A;  3DSS A;  3MKQ B;  2PL2 A;  3G2S A;  3PNL B;  1MZC A;  2JEK A;  1K3Z D;  3CVX A;  1MYO A;  1RW2 A;  2PQN A;  3CK7 A;  2VTB A;  2X3M A;  5G2N A;  1SA5 A;  3EHM A;  4RG6 A;  2H6I A;  2PM6 A;  3SI5 A;  1GW6 A;  3JXI A;  4A3T A;  4N3B A;  1MX4 A;  4C48 B;  4GMR A;  2F8X K;  1KZP A;  2XPY A;  3ZGQ A;  2M63 A;  4GZ6 A;  1KPS B;  4BEP A;  5LFA A;  4ILG A;  2L6B A;  2IQC A;  5CEC B;  3IV0 A;  2OCC E;  5ENT D;  1OCZ E;  4UI9 K;  5CEA A;  4AJW A;  2WXP A;  3B7U X;  1E96 B;  3FP3 A;  4CZ2 D;  3E34 A;  1IKN D;  3O48 A;  3QNK A;  3ABL E;  5BW8 C;  2F0Y A;  3LJN A;  4N5C A;  4BT8 A;  4F1S A;  3PUK A;  4GB9 A;  5KJN A;  2J4D A;  3DST A;  3ZIM A;  5AAR A;  2C0L A;  4DPR A;  4YVO A;  2QYJ A;  1UJJ A;  1DCE A;  3NQP A;  3EHQ A;  2X6H A;  2Y1L E;  3CHO A;  4QQI A;  1N4S A;  2BKG A;  3UKR G;  3PUJ A;  3AS5 A;  1KT1 A;  4GTV A;  3ZYQ A;  4FJY A;  3ML8 A;  3Q15 A;  4RLY A;  3FUJ A;  4I9E A;  3AAA C;  2BKK B;  1EYH A;  1N94 A;  2UY1 B;  4BT9 A;  1NZN A;  4NQ0 A;  3AG1 E;  3SGH A;  4IRU A;  4JEU A;  4AY5 A;  3C3O A;  4GCO A;  3SZ7 A;  4YDO A;  4G24 A;  3J5Q B;  1OWL A;  3AG4 E;  4M3O A;  3I4G A;  1YMP A;  5AN8 A;  2R02 A;  4GMJ A;  1N9A A;  3SY2 A;  1MX6 A;  4BSZ B;  4CDN A;  2X6K A;  1YA0 A;  3S7B A;  3FEX A;  3ZUV B;  5CBO A;  3E32 A;  2J8S D;  3MJW A;  3ZU7 B;  5D0Q D;  3PE4 A;  2DBA A;  2CG2 A;  4FAD A;  3LEW A;  5T8I A;  5FZQ A;  4PS3 A;  3AG2 E;  3D9I A;  4NIK A;  5KNG A;  3TWW A;  5HI7 A;  5CRV A;  4DI3 A;  3CHP A;  3ASN E;  3PZD A;  2FI7 A;  3EUV A;  3CVV A;  2PQR A;  3CK9 A;  4G8L A;  3Q7A A;  4CDR A;  1TJF A;  2QYU A;  3QB2 A;  3HIZ A;  3ZEF A;  4H7Y A;  2A5E A;  4B8C B;  4J8F A;  4TXQ A;  3TWQ A;  4KXK B;  1HU3 A;  4XEI G;  3ZYM A;  3MKQ A;  3B13 A;  4G26 A;  4XI0 A;  2KZT A;  2CHX A;  2WMN A;  2WXL A;  3FU3 A;  2VJ8 A;  3DEP A;  2AWI A;  2WQ7 A;  3FU5 A;  2C2L A;  3UM1 A;  2X6J A;  1N4P A;  2XRZ A;  2LXM A;  4HLL A;  5AEN A;  5JJ6 A;  4L2L A;  1N54 A;  2VGX B;  3ZYK A;  3ML9 A;  4JHJ A;  4ME2 A;  3OXF A;  1OWO A;  3RO2 A;  1YCS B;  2RKK A;  1TN8 A;  4EZK A;  5AQB A;  3CQC B;  3UM0 A;  4UQX A;  2WQH A;  5E76 A;  3ASH A;  1NA3 A;  5FQ6 A;  1BI7 B;  3PEV B;  4TRQ A;  4U0Z A;  3OXL A;  5KWD A;  3CEQ A;  4ANV A;  4B93 B;  4K5A B;  2KCK A;  3T5X A;  1TYQ G;  3TWU A;  4UWH A;  2A4Z A;  2R59 A;  4JZY A;  3GYZ A;  3SBS A;  1HX8 A;  4XIF A;  3ABK E;  3W9F A;  4AOF A;  5DIZ A;  5M72 A;  5CBN A;  4BES A;  3RRM B;  3HVE A;  4DX5 D;  3UPV A;  4J8E A;  1N52 A;  4K0R A;  1OWN A;  1WG0 A;  1WY6 A;  3FTV A;  2EIN E;  3DPD A;  1MQS A;  5CED B;  1SVX A;  2ZU6 B;  2WB2 A;  1WAO 1;  3PNT B;  4PS8 A;  4L1B A;  4GPK A;  2Y0B G;  4FHK A;  3VLE A;  3EDT B;  2IOS A;  4JPS A;  3QAQ A;  5FIN A;  3ULE G;  2J07 A;  5HS0 A;  4KVM A;  5KJK A;  4O60 A;  5EYL A;  2J9Q A;  3TGO A;  2ETA A;  4B8A A;  3D9K A;  2DIW A;  2ZGD A;  3DXK G;  2P9S G;  1H6K A;  5AQ9 A;  3TWV A;  4I6G A;  4GZC A;  1H6P A;  4I1O B;  4QFV A;  2WXG A;  4FUL A;  3TXN A;  3SFY A;  1W3B A;  4LUN U;  2L0T B;  4UI9 C;  3CKC A;  2V0P A;  2GRP B;  2VGE A;  2WXF A;  5T4Y A;  4F6R D;  2QC9 A;  3PDN A;  5E75 A;  4DLO A;  4GA0 A;  1EDU A;  4HB5 A;  4BSX A;  2L6J A;  5HKP A;  4FA6 A;  4ACK A;  3CGH A;  4OAV B;  4FU3 A;  3ONK A;  3PZ4 A;  4YDY A;  3CKB A;  2J09 A;  2LSU A;  4LNU D;  1QNF A;  3PZ2 A;  1IQR A;  1V54 E;  3I4R B;  3L6A A;  2J49 A;  3E33 A;  2F37 A;  4I9C A;  1HZ4 A;  2DVW A;  5JJ7 A;  2H6F A;  3UM2 A;  3MYV A;  3D9H A;  1DNP A;  3FTW A;  4LNB A;  3TJP A;  4BY6 A;  2DYR E;  1IHB A;  4G11 A;  3G2T A;  4ATG A;  4L7T A;  5D2M C;  4A63 B;  5AQA A;  5ENP D;  4KT6 B;  3Q5M A;  4BX8 A;  1U3C A;  3UQ3 A;  4KMO A;  3PRZ A;  5LOZ A;  4IUL A;  2V5F A;  3KEA A;  4H7X A;  1Y8M A;  2KCV A;  3ABM E;  3FDH A;  1SZA A;  2VSX E;  3FU0 A;  3WG7 E;  3KSL A;  3BG1 B;  4HNA D;  2B0O E;  3QWP A;  2FBN A;  4BER A;  4EBA A;  4C0E A;  2UY1 A;  3JUE A;  2GRM A;  1YYH A;  3APF A;  3C3Q A;  1N0R A;  4HBD A;  3CK8 A;  2QFC A;  1VDY A;  5BUZ A;  2OND A;  4GTS A;  2E0I A;  2GRQ B;  2AJA A;  3S7J A;  1E8W A;  3FWV A;  2IO2 C;  3I5P A;  3BEE A;  4O1O A;  2OV8 A;  5KJL A;  2AW6 A;  4L9P A;  1BLX B;  2VSY A;  4DJA A;  2RG8 A;  3C98 A;  2KZT B;  1H0A A;  2BTD A;  2MOW A;  2Y4U A;  3HHM A;  2F8Y A;  3ZHE A;  4LCT A;  2AVP A;  5JHA A;  4GYW A;  4WWO A;  4GZD A;  4WND A;  2WXI A;  2IOL A;  3LVR E;  4GTQ A;  3L17 A;  3AG3 E;  1O1T A;  5EIL A;  3BUA A;  4KZ0 A;  3X2Q E;  5EID A;  3J5P A;  5HQ8 A;  2DWZ A;  4IN3 B;  1HG2 A;  2IJG X;  2X38 A;  3D3M A;  4K5C A;  2LSV A;  4JW1 A;  3B7B A;  1HXI A;  4L2Y A;  3FFL A;  3Q7F A;  4AIF A;  1KT0 A;  4HI9 A;  4U8V D;  4E6H A;  3KS2 A;  3FH7 A;  4MRU A;  4NRH B;  2WXM A;  3QWV A;  4EHM A;  4Q69 A;  2YQ8 A;  3D9N A;  3MGB A;  5KCM A;  1JUQ A;  3HXD A;  1JWG A;  4RSY A;  2Y3A A;  1JPL A;  2DCP A;  4ABN A;  3Q47 B;  1HFA A;  1OWP A;  2DYS E;  2IF4 A;  3SNX A;  4D10 C;  4I17 A;  3ASG A;  4U07 A;  3KD7 A;  4LER A;  4J8D A;  3G2W A;  3ZFW A;  2NSZ A;  4WAF A;  4F53 A;  4AV7 A;  1E8Z A;  5AIJ A;  3T8K A;  3RKV A;  3TG4 A;  2NYJ A;  1LD8 A;  4GZ5 A;  3GW4 A;  2QY7 A;  3Q4A B;  3ZRH A;  3ZKJ A;  2WXR A;  3D9J A;  2I1K A;  4GTO A;  4HOS A;  1ELK A;  2IO3 C;  5KBA A;  4DUI A;  3K9I A;  4GPM A;  3JXJ A;  2C0M A;  3RK6 A;  3LS8 A;  4LEU A;  1TR4 A;  1HS6 A;  3IBE A;  1OCR E;  3QWW A;  4F3V A;  3HDX A;  4HI8 A;  3HXE A;  3L22 A;  4CEM A;  4OAU C;  4HQD A;  3FTZ A;  1HO8 A;  4A1S A;  1TNO A;  1HF8 A;  3NZU A;  4HRN A;  3EHR A;  1O1S A;  1WM5 A;  4G2V A;  1FCH A; 
#chains in the Genus database with same CATH homology
 1N11 A;  4DX1 A;  4F1P A;  4OAV B;  2RFA A;  5AAR A;  3V79 K;  2KXP C;  1WG0 A;  2QYJ A;  4YDY A;  4ZFH A;  1K1B A;  4G8L A;  2XEH A;  4LSZ E;  3C5R A;  5EYP F;  5ITZ F;  3EHQ A;  5CED B;  1SVX A;  2Y1L E;  1SW6 A;  4QQI A;  1MX2 A;  1NFI E;  2PNN A;  5D66 A;  1OY3 D;  2AJA A;  4LNU D;  2ETC A;  4TUM A;  2KBX A;  3NOG D;  2DZO A;  2P2C P;  2A5E A;  2BKG A;  4O1O A;  3TWQ A;  2XEN A;  1BLX B;  2F37 A;  3T8K A;  3ZNG A;  2DVW A;  5ENQ D;  4UUC A;  4RLY A;  3TWX A;  4G8K A;  3TWT A;  2Y0B G;  2NYJ A;  3AAA C;  1N0Q A;  3D9H A;  2BKK B;  5FIN A;  1K3Z D;  4J8Y A;  3ZKJ A;  4Z68 A;  1MYO A;  3DEP A;  5HS0 A;  2F8Y A;  4U8Y D;  4N5Q A;  4U95 D;  3V2O A;  1G3N B;  3B95 A;  4U96 D;  4DX7 D;  4ZHB A;  3Q9N C;  2JAB A;  3IXE A;  1WDY A;  1K1A A;  3Q9U C;  4O60 A;  5EYL A;  1D9S A;  2XZD G;  1IXV A;  1IHB A;  2ETA A;  4YDW A;  5EN5 D;  1BD8 A;  4HLL A;  1S70 B;  3V31 A;  5JA4 D;  4A63 B;  2HE0 A;  2MYO A;  2V5Q C;  2ZGD A;  2V4H C;  1DCQ A;  3EU9 A;  5AQA A;  5KBA A;  5ENP D;  4DUI A;  2RFM A;  4J7W A;  3J5Q B;  5EIL A;  4DRX E;  1YCS B;  2ZGG A;  3UXG A;  5AQ9 A;  5AQB A;  3TWV A;  1UOH A;  4GPM A;  5EID A;  2DZN A;  3J5P A;  3JXJ A;  3JXI A;  1QYM A;  5FIO A;  1YMP A;  3UI2 A;  1BU9 A;  4O1P A;  1MX4 A;  3SO8 A;  2DWZ A;  5AN8 A;  2FO1 E;  3KEA A;  3NOC D;  4C48 B;  1TR4 A;  1MX6 A;  3HG0 D;  4GMR A;  4K5C A;  2F8X K;  1AWC B;  4QFV A;  3TWR A;  4BSZ B;  4HRM B;  3B7B A;  5HRY A;  3NBN B;  1BI7 B;  3TWS A;  2XEE A;  3AJI A;  4HI8 A;  4K5B A;  3ZUV B;  2J8S D;  5CBO A;  3W9G A;  4BEP A;  5KWD A;  4LG6 A;  5ENS D;  5ENR D;  3ZU7 B;  4OAU C;  5JMN D;  4B93 B;  2L6B A;  2VGE A;  5CEC B;  4HQD A;  4K5A B;  4F6R D;  4HRL A;  4HI9 A;  5ENT D;  2QC9 A;  3UTM A;  3TWU A;  4DX6 D;  4U8V D;  5ENO D;  4HRN A;  3EHR A;  4HNA D;  5CEA A;  2B0O E;  5AQ7 A;  4DX2 A;  3V2X A;  5BXO A;  5AAO A;  4CYM D;  1DC2 A;  5CER B;  1MJ0 A;  4CZ2 D;  4BER A;  3HRA A;  2XZT G;  3W9F A;  4JB8 P;  3F6Q A;  4HB5 A;  3JUE A;  4BES A;  3DEO A;  5CBN A;  5EIB E;  1YYH A;  1IKN D;  5HKP A;  4ATZ D;  1OT8 A;  4NIK A;  5KNG A;  3V30 A;  2ETB A;  1N0R A;  4HBD A;  3TWW A;  5BXU A;  3T9K A;  3LJN A;  4BET A;  1AP7 A;  1BI8 B;  5KNH D;  4DX5 D;  1A5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...