3TWRA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human 3bp2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
b'SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/peptide
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twrA00
2XEHA 2F37A 4DX7D 4F1PA 3T8KA 4U8YD 1IKND 3AJIA 3Q9UC 1N0QA 5KNHD 5EN5D 3HRAA 2B0OE 5CERB 4HI8A 4K5CA 2XZTG 2HE0A 4G8LA 4HB5A 3UTMA 4BERA 2F8XK 1BU9A 2JABA 2VGEA 4DX1A 2DWZA 2KXPC 5AN8A 2DZNA 2V5QC 2QYJA 2FO1E 5KWDA 4LNUD 3V79K 2BKGA 1MX4A 4K5BA 3TWQA 5EILA 3KEAA 4A63B 5BXOA 3HG0D 1IHBA 5CECB 3ZU7B 4DRXE 1S70B 5HKPA 1K1BA 5ENOD 4UUCA 3ZUVB 1MX6A 3EHRA 2AJAA 2QC9A 4BSZB 1A5EA 1MX2A 4J8YA 3EHQA 5EYLA 1MJ0A 3V30A 5FIOA 4RLYA 5ENTD 4O1OA 5HS0A 1NFIE 3IXEA 4QQIA 1D9SA 2NYJA 5KBAA 5CEAA 5ENRD 4TUMA 5ENPD 2V4HC 4HRMB 4N5QA 4U95D 3NOCD 2DZOA 3W9FA 2ETBA 4NIKA 3AAAC 1SVXA 1YCSB 4HQDA 2ZGGA 1BLXB 3D9HA 5AQBA 5ENSD 1DC2A 4LG6A 5CBNA 5EYPF 4BETA 5ENQD 4QFVA 1N0RA 4HLLA 4LSZE 1TR4A 3TWRA 3NBNB 3DEPA 5EIBE 1K1AA 1UOHA 3JUEA 3TWUA 4HNAD 3UXGA 5AAOA 5ITZF 1AP7A 2DVWA 4HBDA 1MYOA 2XENA 2Y0BG 3ZNGA 3T9KA 4Z68A 4DX5D 4YDWA 4HRLA 3TWTA 4ATZD 3Q9NC 2MYOA 4O1PA 2ETCA 1AWCB 5CBOA 2P2CP 3B7BA 3JXJA 4U8VD 1N11A 3F6QA 2ETAA 3J5PA 2BKKB 3C5RA 2J8SD 2XEEA 4O60A 2ZGDA 1IXVA 1DCQA 2A5EA 3JXIA 1BD8A 4YDYA 3NOGD 5EIDA 4K5AB 3W9GA 4DX2A 5JA4D 4G8KA 3LJNA 1K3ZD 2F8YA 4GPMA 4U96D 4DX6D 3EU9A 4OAVB 5JMND 3ZKJA 3UI2A 4B93B 2Y1LE 2RFAA 2L6BA 2XZDG 5AQAA 3V2XA 4BESA 4CZ2D 5BXUA 2KBXA 4GMRA 1SW6A 3SO8A 3TWXA 4ZFHA 1YYHA 3V31A 4F6RD 5D66A 4BEPA 3J5QB 3TWSA 5CEDB 4OAUC 4JB8P 1OT8A 5AARA 5HRYA 2PNNA 3V2OA 4HI9A 1WG0A 3B95A 1WDYA 4HRNA 1G3NB 3TWVA 1QYMA 5FINA 4DUIA 1BI7B 1OY3D 5AQ7A 3TWWA 4CYMD 2RFMA 4ZHBA 4C48B 5KNGA 4J7WA 1BI8B 3DEOA 1YMPA 5AQ9A
chains in the Genus database with same CATH superfamily
2XEHA 4X8QA 4MRUA 1IKND 1P5QA 3FTYA 3DXKG 2R03A 1YA0A 4TXQA 3ZW3A 3HVEA 2ILRA 3KD7A 4ANWA 2X6JA 5KWDA 3MJWA 4CDMA 1IHBA 5CECB 2IO2C 3D9LA 2V0PA 3BQOA 2QZAA 3UT4A 2CG3A 3IV0A 1MX6A 3EHRA 2EILE 4JHKA 3EHQA 3P1UA 4CDRA 3CHOA 3L82A 4AP2A 2MRIA 4UI9J 3IHVA 3U9WA 2R2LA 1HE8A 5CEAA 4TUMA 2V5FA 4APOA 3KEZA 1D8DA 5ENQD 4I9CA 4HLLA 1TR4A 3BU8A 1A17A 4DK5A 5C2YA 5FQ8A 4A1SA 5AYWD 4HRLA 2MYOA 3B13A 3CVYA 3JUIA 3E30A 5DIZA 1S63A 3OXGA 3W9GA 1B89A 3FTSA 1JWFA 2Y1LE 4XIFA 3FTZA 1FT1A 3AS8A 4JXTA 2LAHA 3R9AB 1FCHA 2V4LA 2H6HA 4BX9A 5T8IA 4GCNA 2VQ2A 3TWVA 2CG2A 3VTXA 3FTVA 3K9IA 2NC9A 3FUFA 5H7PA 3UIPC 4DX7D 1HFAA 4HI8A 2XZTG 4N2QA 2LNIA 5D2MC 5FZQA 3CHQA 1JCQA 2EQXA 1OWOA 4HS2A 3ZU7B 4DRXE 4GA1A 2ZU6B 4GMJA 5AJDA 2IF4A 3FHEA 5G05J 3SFXA 1TNYA 3FP3A 4JA9A 4QQIA 2NYJA 4Q69A 4NIKA 1SQMA 1HZ4A 4LG6A 3TWRA 3DBSA 2H6GA 1K1AA 5CMWA 3L16A 2Y0BG 5KJLA 4I2WA 3Q73A 2ONDA 3UM1A 1AWCB 2VJ8A 3D9MA 3SD5A 3S7DA 3DWLG 3LCAA 2XS8A 4B93B 2RFAA 5BXUA 3UQ3A 3HXFA 4ZFHA 4F53A 5BV1A 3C72A 1OWNA 2Y69E 4GU5A 4Q94A 5AARA 1N4SA 3PE4A 5AIJA 3OXFA 3ZFWA 5G04J 3DXMG 2J4DA 4E85A 4UWFA 4EZKA 4UWHA 4DI3A 3HRAA 3TAXA 5JJ7A 3GZ1A 2F8XK 3RRUA 2JABA 3DSWA 2KXPC 4N3BA 4JEHA 5AN8A 2QYJA 2X6FA 3ZHEA 3V79K 1MX4A 3TWQA 4WWOA 2A5UA 4K03A 4UQXA 3SFZA 5EKQD 3LDZA 1LD8A 4RG9A 1RZ4A 2J07A 1QNFA 2OV8A 3NB2A 4JZYA 5DBKA 2OEVA 4PUCA 1HU3A 1SZ9A 4I1AA 1Z3YA 4UQZA 4HQDA 4WUYA 1DC2A 1JUQA 1NA3A 2WVIA 2R05A 3T5XA 1KPSB 3EDTB 3PZ1A 5BW8C 4IULA 1FPPA 3RO2A 3CVNA 5ITZF 3E4BA 5BV0A 4N3AA 2ETCA 2I2OA 2GRNB 3JXJA 2AVPA 3U66A 3LJNA 5FQ6A 4GCOA 4BWRA 5T4YA 3FTUA 4NRHB 4FU3A 5BUZA 3MEKA 4ILGA 3MKQA 1WG0A 3ASOE 3RRNB 1QYMA 2AXVA 3SFYA 3FU3A 4GTRA 4CYMD 3U64A 1HH8A 2P9KG 2YQ8A 5AJLA 4GA2A 1YMPA 5B3SE 1U2VG 2GRPB 2BF0X 4UWLA 2DZNA 4AVXA 3C3RA 1HO8A 2LXMA 4U0ZA 5B1AE 3ASFA 3R9MA 3EIJA 2RKKA 5EYLA 3S7FA 1Y6IA 2X3MA 3CVWA 2IONA 5G55A 4BTAA 1O5MA 5ENSD 4DI4A 2OEWA 4C0MA 3UT7A 2KC7A 3ZYLA 3CVLA 3B7UX 3LS8A 1TNBA 2PM7A 4YDWA 2PM6A 3TWTA 1DCEA 4O60A 2XGMA 3PVLA 4AJWA 3CQGB 2WPVA 3ESLA 1WM5A 1HG5A 4UWGA 3ASGA 3T5VA 4AY5A 4WWPA 2VGXB 2NSZA 2GRRB 1H2UA 3SBTB 4XKCA 3QK0A 4DUIA 5AQ7A 3CVUA 3I4GA 3DEOA 4KBQA 4Y6WA 1E8YA 4KXKB 3Q9UC 1N0QA 4CRWA 4FADA 1HX8A 4HB5A 5A23A 5HI7A 4DLQA 1JCSA 1E7UA 4Y6CA 5BPPA 2VSOE 5HKPA 2CHWA 2EIJE 3TGOA 1W3BA 4ME2A 2I1KA 3SF4A 4G11A 4DJAA 1TNUA 1NFIE 1N4QA 3C98A 3I5PA 3FH7A 5ENRD 4ILHB 4PS7A 4FULA 2V4HC 2DIWA 4GA0A 3APFA 3HVEB 5BT1A 3DSVA 3Q15A 3HXDA 3JUEA 3QWVA 3U3WA 1D8EA 3D9JA 4N5CA 2L0TB 3B7BA 4B8AA 5KJMA 5T3RA 3I3NA 3N71A 1MQSA 2A5EA 4GZ6A 3OAWA 3PEUB 1U3DA 4EECA 3PNTB 3AG2E 3B7RL 5JMND 3PUJA 4JHJA 1SW6A 5LP0A 2HYZA 4HVBA 4HXIA 1X81A 4CDNA 3TXMA 4IYPA 3D9OA 2WXOA 3E34A 2J4BA 4HRNA 4XE0A 1OY3D 2WB2A 2DBAA 2L9BA 1IYGA 1BI8B 4U0SA 4I1OB 3ABME 1N95A 3RO3A 3ML8A 3E33A 3CVPA 1LF8A 4WNDA 1OWMA 4N3CA 3QOUA 3RIBA 3O48A 3GZSA 4FLHA 1VDYA 2WXJA 3SI5A 3CEQA 2VYIA 2HO1A 2XCCA 1EYHA 2IQCA 3DSUA 3AU5A 2IOSA 4EPZA 5CRUA 1YCSB 5AQBA 3HDXA 4ATGA 3ML9A 3PDNA 2UY1A 3CHSA 2FF4A 2P9SG 4B89A 1OXJA 4YVQC 4R7LA 2XENA 3QKYA 3RK6A 3WXXA 3LY8A 1INZA 3FULA 3ULYA 1FT2A 3AG3E 4GB9A 3Q4AB 5JHAA 1K3ZD 3U4TA 3MKRA 1S64A 3BUAA 3ZEFA 3NAWA 3FU5A 4ANVA 3V31A 5D66A 5CEDB 2WXNA 1ELRA 4ILIA 3KSQA 5FINA 4HOSA 3FH5A 4AM9A 3AJIA 3PRZA 2I1JA 4DX1A 1E96B 4XI9A 2V5QC 4K5BA 1Y8MA 1TNZA 4FLBA 4XX5A 3FUEA 4UUCA 1QQEA 5D0OD 5ANRA 1K8KG 3TG5A 4PDXA 1OCOE 5IY5E 4JC8A 3PZ2A 2XEVA 3LYAA 4I9EA 2DZOA 3AG4E 1H6KA 4NURA 4L7TA 5EYPF 3ZHEB 2AWIA 4I2ZA 4U07A 3ZNGA 2J09A 4A1GA 4DX5D 3ZXPA 3SY2A 4TXRA 4U8VD 3URZA 3CK9A 5ARGA 2J8SD 1IXVA 4TUUA 3ULQA 4DX6D 4OAVB 3UI2A 5AQAA 3MA5A 3FUNA 4B94A 3L54A 1PC2A 3P2BA 1QZ2A 2KM4A 4HLEA 3LY7A 2IJGX 2C0LA 5KCMA 3HIZA 1KZOA 5FZRA 4PH4B 2VSNA 2R59A 5EX3A 2GGFA 3FH8A 2R5SA 2B0OE 2VSXE 3SQVA 1JWGA 2WXQA 3CVVA 2VGEA 3FEXA 1Z6TA 1NP7A 4G24A 3QDNA 3CR3A 2WXRA 2IOLA 3ISMC 4RVBA 1TEZA 4HOUA 2JEKA 4RLYA 4I1MA 2J08A 2CFZA 3G2SA 3QARA 1BLXB 2Y4UA 4BTBA 3APDA 4QFVA 4UWKA 3LVRE 3DEPA 2WQ6A 3UKRG 2BEDA 1O1TA 3DSXA 3NZSA 3NQPA 2ZISA 3PUKA 2EIME 1S0PA 2KCLA 2P2CP 1E90A 2X6HA 4PS8A 3FY4A 3PE3A 3NOGD 3PREA 1GW6A 3ULEG 2E2EA 5LFAA 1NA0A 1FVFA 2KCKA 1N94A 4H7XA 4GMLA 4KVMA 4KZ0A 4YDOA 3Q5MA 4DLOA 3OXLA 2J49A 1BI7B 2WMNA 4C48B 5KNGA 5FQ4A 3FUJA 3ABLE 3IBEA 3SHFA 3UT8A 1ZBPA 4KMOA 1MHQA 1KT0A 5EILA 2LUHA 3S7BA 3PZ4A 2BUGA 1ELKA 4AV7A 2QC9A 3B7TA 3C3QA 4LERA 4LRZA 2CHXA 1JPLA 3GYZA 3MV3B 2WXGA 4AIFA 2ZXWE 3JCKC 5M72A 2WXFA 1HS6A 1ELWA 1UOHA 5FQ7A 3MGBA 4EQFA 4CGWA 3HXBA 4GAAA 4O1PA 3Q79A 4KYOB 2YHEA 3C5RA 2XEEA 4WNEA 3G2WA 3JXIA 5FT9A 3GW4A 4C9BB 2VGYA 3MX3A 4EHMA 3V2XA 3PS6A 3RAUA 2KBXA 3QAQA 4XI0A 4GTMA 4GPKA 4HFGA 2IFUA 4BEPA 2OOEA 3TWSA 2X38A 5HRYA 4JL0A 3OTNA 3HXEA 3QNKA 3TWWA 3DSTA 3HYMB 1H6OA 1NZNA 4MKTA 4L1BA 3ASDA 2XPIA 4WWNA 5CMYA 3NZUA 5C1DA 2IEJA 2H6IA 4O6FA 3UTMA 4BERA 3Q47B 1BU9A 2WQHA 4W9RA 4FHKA 1OCRE 5AENA 5KJNA 4ANXA 4MBGA 4A3VA 3VLEA 3EIQC 1U3CA 4AOFA 4J0UA 2HR2A 4AEZC 3CK8A 1FVHA 4EBAA 4HRMB 4U95D 3W9FA 3KS2A 2DYRE 1IQRA 1SVXA 3L13A 1E8WA 3MYVA 5EIBE 2CHZA 1OWPA 4JEUA 5CHEE 4FP7A 5B1BE 3R7QA 5JJTA 2VTBA 4L9PA 3F6QA 4GYWA 2ZGDA 1DCQA 4YDYA 4A55A 4Q96A 2LAIA 1UN9A 3ZYQA 1Q2ZA 3ZXSA 2L6BA 4TV3A 3LEWA 1E7VA 3UMVA 2EIKE 4E6HA 4FA6A 3BG0B 3CKBA 4LUNU 4MLPA 3JQ0A 3L6AA 3RU0A 2X6IA 1HXIA 3T8MA 2ZIRA 5AQ9A 2XQ0A 2Q7FA 4U8YD 2YINA 2DYSE 2WMOA 3IKOB 2P9LG 2WXIA 5CCMA 1H2VC 3D9PA 2YNQA 4OYSA 3Q49B 1UW4B 3HG0D 3QWPA 3SGHA 3S2AA 4CT4A 3PZDA 2LSUA 2XRZA 4CT0A 2XPZA 1A5EA 4ABNA 1KZPA 2R02A 5ARFA 4HOTA 3PZ3A 2I6HA 1TN8A 4GTTA 2GROB 3CHPA 3D9HA 3KSLA 4BETA 3FUDA 1E8ZA 4FHJA 3LY9A 5BNWA 4HBDA 2E0IA 3T9KA 2R17C 4FJZA 4Z68A 1E8XA 2XPYA 2EINE 3APCA 4I6EA 3O4ZA 2WXLA 3EUVA 4DX2A 4G8KA 1WAO1 3QJZA 4K0RA 3R7RA 2C0MA 1SA4A 3ZKJA 4BSXA 4IN3B 4XEIG 1H2TC 3IEGA 4WAFA 4OVUA 5G05C 4MS6A 4GYYA 3FWVA 2VSYA 4GZ3A 4HI9A 2LSVA 4JPSA 4BY6A 1G3NB 2F0YA 3ENEA 3ZGQA 4OVVA 4N2SA 4L23A 2FEZA 4M7CA 5FZSA 3RJVA 4F1PA 1N4PA 3E37A 4GZ5A 1TNOA 1DNPA 1NL4A 2PZIA 4LNUD 3UPVA 5BXOA 2FULA 1TJCA 2AW6A 2XHEA 2HM8A 3AS4A 2A4ZA 5ENOD 3MZLB 4BSZB 3L22A 3EHNA 3D9NA 5ENTD 3ZIMA 1OCZE 3IXEA 5ENPD 1N9AA 5J90A 2WXKA 1TJFA 2KZTA 4V3IA 2XS1A 4LSZE 4B8CB 2PQNA 4AY6A 4L2LA 3FUIA 5G04C 2DVWA 3IHYA 4BFRA 4NACA 4ATZD 3DPDA 5A7DB 1EDUA 1TN6A 4BT8A 4LCTA 4WNFA 5LX8A 2ETAA 2LXLA 3ONKA 1WY6A 5EIDA 1XGWA 3CGHA 4U96D 5EDSA 3FUHA 4J6IA 4XZ4A 4F6RD 3FEYA 4JB8P 3L17A 4RSYA 2PNNA 3DSSA 3EHMA 4UQYA 1JCRA 1LTXA 3VLDA 5FWQA 3E32A 2QY7A 3CK7A 5ENNA 1H6PA 5CERB 4H7YA 4G8LA 1IHGA 4L2YA 2OVBA 2Y3AA 4RG6A 2RG8A 3TL5A 4J8FA 5D0QD 3KEAA 3RSEG 1S70B 1SZAA 4FJYA 1KLXA 4GZCA 3VLFA 3TG4A 1MX2A 3FTXA 1MJ0A 2GRQB 4U8HA 1XNFA 3ASHA 4YNDA 3FU0A 4BT9A 2AXUA 5KBAA 3MCXA 4IRUA 2ETBA 2P9UG 3CSTA 3QB2A 3C3OA 4RQIA 3ZYKA 3MKQB 2P9NG 3UXGA 4UI9K 2X6KA 4GTSA 4JW1A 4G26A 3LJ3A 3LXUX 3CVXA 1OWLA 3L08A 2OVFA 4I6JA 3B7SA 1Z5SC 4GTOA 4B0ZA 2P58C 4GMRA 1PY1A 2DCPA 2J9QA 3SBSA 1DVPA 3V2OA 5FTPA 3ZYMA 4I6GA 1EF1C 3UINC 5E76A 5E75A 5KJKA 2QFCA 2RFMA 3UM3A 4CEMA 2F37A 2WXPA 3TXNA 2L6JA 1EPUA 1MZCA 4APFA 2P9IG 4K5CA 3D9IA 2HE0A 3AS5A 5JHBA 5LCWC 2DWZA 3QC1A 4I43A 3JQ1A 3CIAA 2BKGA 1QBQA 3BG1B 1HF8A 4LNGA 3TJPA 4EBAG 3FDHA 2P9PG 4J8DA 1N52A 5EX0A 3MV2B 4F7AA 4KT6B 4NQ0A 4AXHA 4J8YA 1UN8A 3V30A 4N39A 5FIOA 4G23A 1UJJA 4U63A 3ONLA 4G25A 3NOCD 3D9KA 3AAAC 2ZGGA 2XGOA 1IQUA 1L5JA 4U04A 1N0RA 4PS3A 1V54E 3Q7AA 2FI7A 2WXHA 2PQRA 2JLBA 5AAOA 1AP7A 4G2VA 3CLJA 5CRVA 1SA5A 3UX4A 4GYOA 4ACKA 5CBOA 2AXZA 1N11A 3KAEA 2KCVA 5JJ6A 2BKKB 1BD8A 4K5AB 4KVOA 3EU5A 4GTPA 2QYUA 2XRYA 4JVSA 4EZLA 2XZDG 4CZ2D 3ZPJA 1YYHA 1O1SA 3FU6A 4OAUC 2LO6A 1OT8A 4URKA 2B6CA 3AG1E 4LNBA 2VTBB 3L9TA 3Q75A 1OCCE 3EJNA 3CHRA 4ZHBA 4YDEA 4J7WA 3G2TA 2MOWA 4YVOA 3WG7E 3UM0A 4WNGA 1TN7A 5KNHD 5EN5D 4U7EB 3PEVB 4KZCA 4FC8A 5A6CA 4GTVA 3CSFA 3GZ2A 4A63B 1ZU2A 1HG2A 1PAQA 5FJYA 2XCBA 3G2UA 4JHRA 3PH0C 4F3VA 3ZUVB 1TYQG 2AJAA 1KT1A 1Z3XA 1O1RA 5LCWJ 4M3OA 3ABKE 4D10C 2RD0A 2IU1A 3FUKA 1NI1A 2WM9A 2FO7A 5CBNA 3DRAA 2BTDA 2GW1A 3RKVA 3CVQA 4LEUA 3Q7FA 4HNAD 3ZN3A 3HHMA 3FTWA 2H6FA 3HXCA 3Q9NC 4BX8A 3X2QE 4CCAA 3SNXA 3CQCB 3J5PA 3Q78A 4U0UA 2CFUA 4TRQA 4JD2G 2PL2A 4TXPA 4BESA 2C2LA 2FBNA 2V8SE 3ZVVA 5G2NA 3J5QB 3CV0A 3ASNE 4J8EA 4HORA 5LOZA 3CKCA 2M63A 3NF1A 2XGSA 3UM2A 2MHKA 4J8SA 2I9CA 3T8KA 5HQ8A 4ACLA 2UY1B 5CCLA 4GZDA 2WXMA 4UI9C 1OUVA 3S7JA 4DPRA 3FFLA 2FO1E 2KATA 4A3TA 1H0AA 3AU4A 4HOQA 2Y4TA 1K1BA 3UUXA 3QWWA 3LKUA 1X5BA 4O1OA 5J08A 5HS0A 4EZJA 1ZB1A 2YHCA 1D9SA 3I4RB 3LPZA 4N5QA 4I17A 1UG3A 1LD7A 4XKBA 3SZ7A 3NBNB 3TWUA 1N54A 3LVQE 1V55E 4C0EA 1UJKA 1MYOA 2VGXA 4P29A 1RW2A 3CHMA 3UKUG 1H19A 1N4RA 2OCCE 3JYSA 5ANLA 3PNLB 2WQ7A 4GTQA 4ANUA 5JA4D 3UIOC 2F8YA 3FUMA 4GPMA 2GRLA 1BPOA 3EU9A 4JA7A 3ESKA 2KZTB 3SO8A 3TWXA 3VTYA 3D3MA 2NXPA 4G1TA 3RRMB 2IO3C 2GRMA 3DPYA 3G2VA 2IY0C 3B95A 3BEEA 1WDYA 2UWJG 4F1SA 4CGVA 2L0IA 3ZRHA
chains in the Genus database with same CATH topology
2XEHA 2F37A 4DX7D 4F1PA 3T8KA 4U8YD 1IKND 3AJIA 3Q9UC 1N0QA 5KNHD 5EN5D 3HRAA 2B0OE 5CERB 4HI8A 4K5CA 2XZTG 2HE0A 4G8LA 4HB5A 3UTMA 4BERA 2F8XK 1BU9A 2JABA 2VGEA 4DX1A 2DWZA 2KXPC 5AN8A 2DZNA 2V5QC 2QYJA 2FO1E 5KWDA 4LNUD 3V79K 2BKGA 1MX4A 4K5BA 3TWQA 5EILA 3KEAA 4A63B 5BXOA 3HG0D 1IHBA 5CECB 3ZU7B 4DRXE 1S70B 5HKPA 1K1BA 5ENOD 4UUCA 3ZUVB 1MX6A 3EHRA 2AJAA 2QC9A 4BSZB 1A5EA 1MX2A 4J8YA 3EHQA 5EYLA 1MJ0A 3V30A 5FIOA 4RLYA 5ENTD 4O1OA 5HS0A 1NFIE 3IXEA 4QQIA 1D9SA 2NYJA 5KBAA 5CEAA 5ENRD 4TUMA 5ENPD 2V4HC 4HRMB 4N5QA 4U95D 3NOCD 2DZOA 3W9FA 2ETBA 4NIKA 3AAAC 1SVXA 1YCSB 4HQDA 2ZGGA 1BLXB 3D9HA 5AQBA 5ENSD 1DC2A 4LG6A 5CBNA 5EYPF 4BETA 5ENQD 4QFVA 1N0RA 4HLLA 4LSZE 1TR4A 3TWRA 3NBNB 3DEPA 5EIBE 1K1AA 1UOHA 3JUEA 3TWUA 4HNAD 3UXGA 5AAOA 5ITZF 1AP7A 2DVWA 4HBDA 1MYOA 2XENA 2Y0BG 3ZNGA 3T9KA 4Z68A 4DX5D 4YDWA 4HRLA 3TWTA 4ATZD 3Q9NC 2MYOA 4O1PA 2ETCA 1AWCB 5CBOA 2P2CP 3B7BA 3JXJA 4U8VD 1N11A 3F6QA 2ETAA 3J5PA 2BKKB 3C5RA 2J8SD 2XEEA 4O60A 2ZGDA 1IXVA 1DCQA 2A5EA 3JXIA 1BD8A 4YDYA 3NOGD 5EIDA 4K5AB 3W9GA 4DX2A 5JA4D 4G8KA 3LJNA 1K3ZD 2F8YA 4GPMA 4U96D 4DX6D 3EU9A 4OAVB 5JMND 3ZKJA 3UI2A 4B93B 2Y1LE 2RFAA 2L6BA 2XZDG 5AQAA 3V2XA 4BESA 4CZ2D 5BXUA 2KBXA 4GMRA 1SW6A 3SO8A 3TWXA 4ZFHA 1YYHA 3V31A 4F6RD 5D66A 4BEPA 3J5QB 3TWSA 5CEDB 4OAUC 4JB8P 1OT8A 5AARA 5HRYA 2PNNA 3V2OA 4HI9A 1WG0A 3B95A 1WDYA 4HRNA 1G3NB 3TWVA 1QYMA 5FINA 4DUIA 1BI7B 1OY3D 5AQ7A 3TWWA 4CYMD 2RFMA 4ZHBA 4C48B 5KNGA 4J7WA 1BI8B 3DEOA 1YMPA 5AQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEH A;  2F37 A;  4DX7 D;  4F1P A;  3T8K A;  4U8Y D;  1IKN D;  3AJI A;  3Q9U C;  1N0Q A;  5KNH D;  5EN5 D;  3HRA A;  2B0O E;  5CER B;  4HI8 A;  4K5C A;  2XZT G;  2HE0 A;  4G8L A;  4HB5 A;  3UTM A;  4BER A;  2F8X K;  1BU9 A;  2JAB A;  2VGE A;  4DX1 A;  2DWZ A;  2KXP C;  5AN8 A;  2DZN A;  2V5Q C;  2QYJ A;  2FO1 E;  5KWD A;  4LNU D;  3V79 K;  2BKG A;  1MX4 A;  4K5B A;  3TWQ A;  5EIL A;  3KEA A;  4A63 B;  5BXO A;  3HG0 D;  1IHB A;  5CEC B;  3ZU7 B;  4DRX E;  1S70 B;  5HKP A;  1K1B A;  5ENO D;  4UUC A;  3ZUV B;  1MX6 A;  3EHR A;  2AJA A;  2QC9 A;  4BSZ B;  1A5E A;  1MX2 A;  4J8Y A;  3EHQ A;  5EYL A;  1MJ0 A;  3V30 A;  5FIO A;  4RLY A;  5ENT D;  4O1O A;  5HS0 A;  1NFI E;  3IXE A;  4QQI A;  1D9S A;  2NYJ A;  5KBA A;  5CEA A;  5ENR D;  4TUM A;  5ENP D;  2V4H C;  4HRM B;  4N5Q A;  4U95 D;  3NOC D;  2DZO A;  3W9F A;  2ETB A;  4NIK A;  3AAA C;  1SVX A;  1YCS B;  4HQD A;  2ZGG A;  1BLX B;  3D9H A;  5AQB A;  5ENS D;  1DC2 A;  4LG6 A;  5CBN A;  5EYP F;  4BET A;  5ENQ D;  4QFV A;  1N0R A;  4HLL A;  4LSZ E;  1TR4 A;  3TWR A;  3NBN B;  3DEP A;  5EIB E;  1K1A A;  1UOH A;  3JUE A;  3TWU A;  4HNA D;  3UXG A;  5AAO A;  5ITZ F;  1AP7 A;  2DVW A;  4HBD A;  1MYO A;  2XEN A;  2Y0B G;  3ZNG A;  3T9K A;  4Z68 A;  4DX5 D;  4YDW A;  4HRL A;  3TWT A;  4ATZ D;  3Q9N C;  2MYO A;  4O1P A;  2ETC A;  1AWC B;  5CBO A;  2P2C P;  3B7B A;  3JXJ A;  4U8V D;  1N11 A;  3F6Q A;  2ETA A;  3J5P A;  2BKK B;  3C5R A;  2J8S D;  2XEE A;  4O60 A;  2ZGD A;  1IXV A;  1DCQ A;  2A5E A;  3JXI A;  1BD8 A;  4YDY A;  3NOG D;  5EID A;  4K5A B;  3W9G A;  4DX2 A;  5JA4 D;  4G8K A;  3LJN A;  1K3Z D;  2F8Y A;  4GPM A;  4U96 D;  4DX6 D;  3EU9 A;  4OAV B;  5JMN D;  3ZKJ A;  3UI2 A;  4B93 B;  2Y1L E;  2RFA A;  2L6B A;  2XZD G;  5AQA A;  3V2X A;  4BES A;  4CZ2 D;  5BXU A;  2KBX A;  4GMR A;  1SW6 A;  3SO8 A;  3TWX A;  4ZFH A;  1YYH A;  3V31 A;  4F6R D;  5D66 A;  4BEP A;  3J5Q B;  3TWS A;  5CED B;  4OAU C;  4JB8 P;  1OT8 A;  5AAR A;  5HRY A;  2PNN A;  3V2O A;  4HI9 A;  1WG0 A;  3B95 A;  1WDY A;  4HRN A;  1G3N B;  3TWV A;  1QYM A;  5FIN A;  4DUI A;  1BI7 B;  1OY3 D;  5AQ7 A;  3TWW A;  4CYM D;  2RFM A;  4ZHB A;  4C48 B;  5KNG A;  4J7W A;  1BI8 B;  3DEO A;  1YMP A;  5AQ9 A; 
#chains in the Genus database with same CATH topology
 2XEH A;  4X8Q A;  4MRU A;  1IKN D;  1P5Q A;  3FTY A;  3DXK G;  2R03 A;  1YA0 A;  4TXQ A;  3ZW3 A;  3HVE A;  2ILR A;  3KD7 A;  4ANW A;  2X6J A;  5KWD A;  3MJW A;  4CDM A;  1IHB A;  5CEC B;  2IO2 C;  3D9L A;  2V0P A;  3BQO A;  2QZA A;  3UT4 A;  2CG3 A;  3IV0 A;  1MX6 A;  3EHR A;  2EIL E;  4JHK A;  3EHQ A;  3P1U A;  4CDR A;  3CHO A;  3L82 A;  4AP2 A;  2MRI A;  4UI9 J;  3IHV A;  3U9W A;  2R2L A;  1HE8 A;  5CEA A;  4TUM A;  2V5F A;  4APO A;  3KEZ A;  1D8D A;  5ENQ D;  4I9C A;  4HLL A;  1TR4 A;  3BU8 A;  1A17 A;  4DK5 A;  5C2Y A;  5FQ8 A;  4A1S A;  5AYW D;  4HRL A;  2MYO A;  3B13 A;  3CVY A;  3JUI A;  3E30 A;  5DIZ A;  1S63 A;  3OXG A;  3W9G A;  1B89 A;  3FTS A;  1JWF A;  2Y1L E;  4XIF A;  3FTZ A;  1FT1 A;  3AS8 A;  4JXT A;  2LAH A;  3R9A B;  1FCH A;  2V4L A;  2H6H A;  4BX9 A;  5T8I A;  4GCN A;  2VQ2 A;  3TWV A;  2CG2 A;  3VTX A;  3FTV A;  3K9I A;  2NC9 A;  3FUF A;  5H7P A;  3UIP C;  4DX7 D;  1HFA A;  4HI8 A;  2XZT G;  4N2Q A;  2LNI A;  5D2M C;  5FZQ A;  3CHQ A;  1JCQ A;  2EQX A;  1OWO A;  4HS2 A;  3ZU7 B;  4DRX E;  4GA1 A;  2ZU6 B;  4GMJ A;  5AJD A;  2IF4 A;  3FHE A;  5G05 J;  3SFX A;  1TNY A;  3FP3 A;  4JA9 A;  4QQI A;  2NYJ A;  4Q69 A;  4NIK A;  1SQM A;  1HZ4 A;  4LG6 A;  3TWR A;  3DBS A;  2H6G A;  1K1A A;  5CMW A;  3L16 A;  2Y0B G;  5KJL A;  4I2W A;  3Q73 A;  2OND A;  3UM1 A;  1AWC B;  2VJ8 A;  3D9M A;  3SD5 A;  3S7D A;  3DWL G;  3LCA A;  2XS8 A;  4B93 B;  2RFA A;  5BXU A;  3UQ3 A;  3HXF A;  4ZFH A;  4F53 A;  5BV1 A;  3C72 A;  1OWN A;  2Y69 E;  4GU5 A;  4Q94 A;  5AAR A;  1N4S A;  3PE4 A;  5AIJ A;  3OXF A;  3ZFW A;  5G04 J;  3DXM G;  2J4D A;  4E85 A;  4UWF A;  4EZK A;  4UWH A;  4DI3 A;  3HRA A;  3TAX A;  5JJ7 A;  3GZ1 A;  2F8X K;  3RRU A;  2JAB A;  3DSW A;  2KXP C;  4N3B A;  4JEH A;  5AN8 A;  2QYJ A;  2X6F A;  3ZHE A;  3V79 K;  1MX4 A;  3TWQ A;  4WWO A;  2A5U A;  4K03 A;  4UQX A;  3SFZ A;  5EKQ D;  3LDZ A;  1LD8 A;  4RG9 A;  1RZ4 A;  2J07 A;  1QNF A;  2OV8 A;  3NB2 A;  4JZY A;  5DBK A;  2OEV A;  4PUC A;  1HU3 A;  1SZ9 A;  4I1A A;  1Z3Y A;  4UQZ A;  4HQD A;  4WUY A;  1DC2 A;  1JUQ A;  1NA3 A;  2WVI A;  2R05 A;  3T5X A;  1KPS B;  3EDT B;  3PZ1 A;  5BW8 C;  4IUL A;  1FPP A;  3RO2 A;  3CVN A;  5ITZ F;  3E4B A;  5BV0 A;  4N3A A;  2ETC A;  2I2O A;  2GRN B;  3JXJ A;  2AVP A;  3U66 A;  3LJN A;  5FQ6 A;  4GCO A;  4BWR A;  5T4Y A;  3FTU A;  4NRH B;  4FU3 A;  5BUZ A;  3MEK A;  4ILG A;  3MKQ A;  1WG0 A;  3ASO E;  3RRN B;  1QYM A;  2AXV A;  3SFY A;  3FU3 A;  4GTR A;  4CYM D;  3U64 A;  1HH8 A;  2P9K G;  2YQ8 A;  5AJL A;  4GA2 A;  1YMP A;  5B3S E;  1U2V G;  2GRP B;  2BF0 X;  4UWL A;  2DZN A;  4AVX A;  3C3R A;  1HO8 A;  2LXM A;  4U0Z A;  5B1A E;  3ASF A;  3R9M A;  3EIJ A;  2RKK A;  5EYL A;  3S7F A;  1Y6I A;  2X3M A;  3CVW A;  2ION A;  5G55 A;  4BTA A;  1O5M A;  5ENS D;  4DI4 A;  2OEW A;  4C0M A;  3UT7 A;  2KC7 A;  3ZYL A;  3CVL A;  3B7U X;  3LS8 A;  1TNB A;  2PM7 A;  4YDW A;  2PM6 A;  3TWT A;  1DCE A;  4O60 A;  2XGM A;  3PVL A;  4AJW A;  3CQG B;  2WPV A;  3ESL A;  1WM5 A;  1HG5 A;  4UWG A;  3ASG A;  3T5V A;  4AY5 A;  4WWP A;  2VGX B;  2NSZ A;  2GRR B;  1H2U A;  3SBT B;  4XKC A;  3QK0 A;  4DUI A;  5AQ7 A;  3CVU A;  3I4G A;  3DEO A;  4KBQ A;  4Y6W A;  1E8Y A;  4KXK B;  3Q9U C;  1N0Q A;  4CRW A;  4FAD A;  1HX8 A;  4HB5 A;  5A23 A;  5HI7 A;  4DLQ A;  1JCS A;  1E7U A;  4Y6C A;  5BPP A;  2VSO E;  5HKP A;  2CHW A;  2EIJ E;  3TGO A;  1W3B A;  4ME2 A;  2I1K A;  3SF4 A;  4G11 A;  4DJA A;  1TNU A;  1NFI E;  1N4Q A;  3C98 A;  3I5P A;  3FH7 A;  5ENR D;  4ILH B;  4PS7 A;  4FUL A;  2V4H C;  2DIW A;  4GA0 A;  3APF A;  3HVE B;  5BT1 A;  3DSV A;  3Q15 A;  3HXD A;  3JUE A;  3QWV A;  3U3W A;  1D8E A;  3D9J A;  4N5C A;  2L0T B;  3B7B A;  4B8A A;  5KJM A;  5T3R A;  3I3N A;  3N71 A;  1MQS A;  2A5E A;  4GZ6 A;  3OAW A;  3PEU B;  1U3D A;  4EEC A;  3PNT B;  3AG2 E;  3B7R L;  5JMN D;  3PUJ A;  4JHJ A;  1SW6 A;  5LP0 A;  2HYZ A;  4HVB A;  4HXI A;  1X81 A;  4CDN A;  3TXM A;  4IYP A;  3D9O A;  2WXO A;  3E34 A;  2J4B A;  4HRN A;  4XE0 A;  1OY3 D;  2WB2 A;  2DBA A;  2L9B A;  1IYG A;  1BI8 B;  4U0S A;  4I1O B;  3ABM E;  1N95 A;  3RO3 A;  3ML8 A;  3E33 A;  3CVP A;  1LF8 A;  4WND A;  1OWM A;  4N3C A;  3QOU A;  3RIB A;  3O48 A;  3GZS A;  4FLH A;  1VDY A;  2WXJ A;  3SI5 A;  3CEQ A;  2VYI A;  2HO1 A;  2XCC A;  1EYH A;  2IQC A;  3DSU A;  3AU5 A;  2IOS A;  4EPZ A;  5CRU A;  1YCS B;  5AQB A;  3HDX A;  4ATG A;  3ML9 A;  3PDN A;  2UY1 A;  3CHS A;  2FF4 A;  2P9S G;  4B89 A;  1OXJ A;  4YVQ C;  4R7L A;  2XEN A;  3QKY A;  3RK6 A;  3WXX A;  3LY8 A;  1INZ A;  3FUL A;  3ULY A;  1FT2 A;  3AG3 E;  4GB9 A;  3Q4A B;  5JHA A;  1K3Z D;  3U4T A;  3MKR A;  1S64 A;  3BUA A;  3ZEF A;  3NAW A;  3FU5 A;  4ANV A;  3V31 A;  5D66 A;  5CED B;  2WXN A;  1ELR A;  4ILI A;  3KSQ A;  5FIN A;  4HOS A;  3FH5 A;  4AM9 A;  3AJI A;  3PRZ A;  2I1J A;  4DX1 A;  1E96 B;  4XI9 A;  2V5Q C;  4K5B A;  1Y8M A;  1TNZ A;  4FLB A;  4XX5 A;  3FUE A;  4UUC A;  1QQE A;  5D0O D;  5ANR A;  1K8K G;  3TG5 A;  4PDX A;  1OCO E;  5IY5 E;  4JC8 A;  3PZ2 A;  2XEV A;  3LYA A;  4I9E A;  2DZO A;  3AG4 E;  1H6K A;  4NUR A;  4L7T A;  5EYP F;  3ZHE B;  2AWI A;  4I2Z A;  4U07 A;  3ZNG A;  2J09 A;  4A1G A;  4DX5 D;  3ZXP A;  3SY2 A;  4TXR A;  4U8V D;  3URZ A;  3CK9 A;  5ARG A;  2J8S D;  1IXV A;  4TUU A;  3ULQ A;  4DX6 D;  4OAV B;  3UI2 A;  5AQA A;  3MA5 A;  3FUN A;  4B94 A;  3L54 A;  1PC2 A;  3P2B A;  1QZ2 A;  2KM4 A;  4HLE A;  3LY7 A;  2IJG X;  2C0L A;  5KCM A;  3HIZ A;  1KZO A;  5FZR A;  4PH4 B;  2VSN A;  2R59 A;  5EX3 A;  2GGF A;  3FH8 A;  2R5S A;  2B0O E;  2VSX E;  3SQV A;  1JWG A;  2WXQ A;  3CVV A;  2VGE A;  3FEX A;  1Z6T A;  1NP7 A;  4G24 A;  3QDN A;  3CR3 A;  2WXR A;  2IOL A;  3ISM C;  4RVB A;  1TEZ A;  4HOU A;  2JEK A;  4RLY A;  4I1M A;  2J08 A;  2CFZ A;  3G2S A;  3QAR A;  1BLX B;  2Y4U A;  4BTB A;  3APD A;  4QFV A;  4UWK A;  3LVR E;  3DEP A;  2WQ6 A;  3UKR G;  2BED A;  1O1T A;  3DSX A;  3NZS A;  3NQP A;  2ZIS A;  3PUK A;  2EIM E;  1S0P A;  2KCL A;  2P2C P;  1E90 A;  2X6H A;  4PS8 A;  3FY4 A;  3PE3 A;  3NOG D;  3PRE A;  1GW6 A;  3ULE G;  2E2E A;  5LFA A;  1NA0 A;  1FVF A;  2KCK A;  1N94 A;  4H7X A;  4GML A;  4KVM A;  4KZ0 A;  4YDO A;  3Q5M A;  4DLO A;  3OXL A;  2J49 A;  1BI7 B;  2WMN A;  4C48 B;  5KNG A;  5FQ4 A;  3FUJ A;  3ABL E;  3IBE A;  3SHF A;  3UT8 A;  1ZBP A;  4KMO A;  1MHQ A;  1KT0 A;  5EIL A;  2LUH A;  3S7B A;  3PZ4 A;  2BUG A;  1ELK A;  4AV7 A;  2QC9 A;  3B7T A;  3C3Q A;  4LER A;  4LRZ A;  2CHX A;  1JPL A;  3GYZ A;  3MV3 B;  2WXG A;  4AIF A;  2ZXW E;  3JCK C;  5M72 A;  2WXF A;  1HS6 A;  1ELW A;  1UOH A;  5FQ7 A;  3MGB A;  4EQF A;  4CGW A;  3HXB A;  4GAA A;  4O1P A;  3Q79 A;  4KYO B;  2YHE A;  3C5R A;  2XEE A;  4WNE A;  3G2W A;  3JXI A;  5FT9 A;  3GW4 A;  4C9B B;  2VGY A;  3MX3 A;  4EHM A;  3V2X A;  3PS6 A;  3RAU A;  2KBX A;  3QAQ A;  4XI0 A;  4GTM A;  4GPK A;  4HFG A;  2IFU A;  4BEP A;  2OOE A;  3TWS A;  2X38 A;  5HRY A;  4JL0 A;  3OTN A;  3HXE A;  3QNK A;  3TWW A;  3DST A;  3HYM B;  1H6O A;  1NZN A;  4MKT A;  4L1B A;  3ASD A;  2XPI A;  4WWN A;  5CMY A;  3NZU A;  5C1D A;  2IEJ A;  2H6I A;  4O6F A;  3UTM A;  4BER A;  3Q47 B;  1BU9 A;  2WQH A;  4W9R A;  4FHK A;  1OCR E;  5AEN A;  5KJN A;  4ANX A;  4MBG A;  4A3V A;  3VLE A;  3EIQ C;  1U3C A;  4AOF A;  4J0U A;  2HR2 A;  4AEZ C;  3CK8 A;  1FVH A;  4EBA A;  4HRM B;  4U95 D;  3W9F A;  3KS2 A;  2DYR E;  1IQR A;  1SVX A;  3L13 A;  1E8W A;  3MYV A;  5EIB E;  2CHZ A;  1OWP A;  4JEU A;  5CHE E;  4FP7 A;  5B1B E;  3R7Q A;  5JJT A;  2VTB A;  4L9P A;  3F6Q A;  4GYW A;  2ZGD A;  1DCQ A;  4YDY A;  4A55 A;  4Q96 A;  2LAI A;  1UN9 A;  3ZYQ A;  1Q2Z A;  3ZXS A;  2L6B A;  4TV3 A;  3LEW A;  1E7V A;  3UMV A;  2EIK E;  4E6H A;  4FA6 A;  3BG0 B;  3CKB A;  4LUN U;  4MLP A;  3JQ0 A;  3L6A A;  3RU0 A;  2X6I A;  1HXI A;  3T8M A;  2ZIR A;  5AQ9 A;  2XQ0 A;  2Q7F A;  4U8Y D;  2YIN A;  2DYS E;  2WMO A;  3IKO B;  2P9L G;  2WXI A;  5CCM A;  1H2V C;  3D9P A;  2YNQ A;  4OYS A;  3Q49 B;  1UW4 B;  3HG0 D;  3QWP A;  3SGH A;  3S2A A;  4CT4 A;  3PZD A;  2LSU A;  2XRZ A;  4CT0 A;  2XPZ A;  1A5E A;  4ABN A;  1KZP A;  2R02 A;  5ARF A;  4HOT A;  3PZ3 A;  2I6H A;  1TN8 A;  4GTT A;  2GRO B;  3CHP A;  3D9H A;  3KSL A;  4BET A;  3FUD A;  1E8Z A;  4FHJ A;  3LY9 A;  5BNW A;  4HBD A;  2E0I A;  3T9K A;  2R17 C;  4FJZ A;  4Z68 A;  1E8X A;  2XPY A;  2EIN E;  3APC A;  4I6E A;  3O4Z A;  2WXL A;  3EUV A;  4DX2 A;  4G8K A;  1WAO 1;  3QJZ A;  4K0R A;  3R7R A;  2C0M A;  1SA4 A;  3ZKJ A;  4BSX A;  4IN3 B;  4XEI G;  1H2T C;  3IEG A;  4WAF A;  4OVU A;  5G05 C;  4MS6 A;  4GYY A;  3FWV A;  2VSY A;  4GZ3 A;  4HI9 A;  2LSV A;  4JPS A;  4BY6 A;  1G3N B;  2F0Y A;  3ENE A;  3ZGQ A;  4OVV A;  4N2S A;  4L23 A;  2FEZ A;  4M7C A;  5FZS A;  3RJV A;  4F1P A;  1N4P A;  3E37 A;  4GZ5 A;  1TNO A;  1DNP A;  1NL4 A;  2PZI A;  4LNU D;  3UPV A;  5BXO A;  2FUL A;  1TJC A;  2AW6 A;  2XHE A;  2HM8 A;  3AS4 A;  2A4Z A;  5ENO D;  3MZL B;  4BSZ B;  3L22 A;  3EHN A;  3D9N A;  5ENT D;  3ZIM A;  1OCZ E;  3IXE A;  5ENP D;  1N9A A;  5J90 A;  2WXK A;  1TJF A;  2KZT A;  4V3I A;  2XS1 A;  4LSZ E;  4B8C B;  2PQN A;  4AY6 A;  4L2L A;  3FUI A;  5G04 C;  2DVW A;  3IHY A;  4BFR A;  4NAC A;  4ATZ D;  3DPD A;  5A7D B;  1EDU A;  1TN6 A;  4BT8 A;  4LCT A;  4WNF A;  5LX8 A;  2ETA A;  2LXL A;  3ONK A;  1WY6 A;  5EID A;  1XGW A;  3CGH A;  4U96 D;  5EDS A;  3FUH A;  4J6I A;  4XZ4 A;  4F6R D;  3FEY A;  4JB8 P;  3L17 A;  4RSY A;  2PNN A;  3DSS A;  3EHM A;  4UQY A;  1JCR A;  1LTX A;  3VLD A;  5FWQ A;  3E32 A;  2QY7 A;  3CK7 A;  5ENN A;  1H6P A;  5CER B;  4H7Y A;  4G8L A;  1IHG A;  4L2Y A;  2OVB A;  2Y3A A;  4RG6 A;  2RG8 A;  3TL5 A;  4J8F A;  5D0Q D;  3KEA A;  3RSE G;  1S70 B;  1SZA A;  4FJY A;  1KLX A;  4GZC A;  3VLF A;  3TG4 A;  1MX2 A;  3FTX A;  1MJ0 A;  2GRQ B;  4U8H A;  1XNF A;  3ASH A;  4YND A;  3FU0 A;  4BT9 A;  2AXU A;  5KBA A;  3MCX A;  4IRU A;  2ETB A;  2P9U G;  3CST A;  3QB2 A;  3C3O A;  4RQI A;  3ZYK A;  3MKQ B;  2P9N G;  3UXG A;  4UI9 K;  2X6K A;  4GTS A;  4JW1 A;  4G26 A;  3LJ3 A;  3LXU X;  3CVX A;  1OWL A;  3L08 A;  2OVF A;  4I6J A;  3B7S A;  1Z5S C;  4GTO A;  4B0Z A;  2P58 C;  4GMR A;  1PY1 A;  2DCP A;  2J9Q A;  3SBS A;  1DVP A;  3V2O A;  5FTP A;  3ZYM A;  4I6G A;  1EF1 C;  3UIN C;  5E76 A;  5E75 A;  5KJK A;  2QFC A;  2RFM A;  3UM3 A;  4CEM A;  2F37 A;  2WXP A;  3TXN A;  2L6J A;  1EPU A;  1MZC A;  4APF A;  2P9I G;  4K5C A;  3D9I A;  2HE0 A;  3AS5 A;  5JHB A;  5LCW C;  2DWZ A;  3QC1 A;  4I43 A;  3JQ1 A;  3CIA A;  2BKG A;  1QBQ A;  3BG1 B;  1HF8 A;  4LNG A;  3TJP A;  4EBA G;  3FDH A;  2P9P G;  4J8D A;  1N52 A;  5EX0 A;  3MV2 B;  4F7A A;  4KT6 B;  4NQ0 A;  4AXH A;  4J8Y A;  1UN8 A;  3V30 A;  4N39 A;  5FIO A;  4G23 A;  1UJJ A;  4U63 A;  3ONL A;  4G25 A;  3NOC D;  3D9K A;  3AAA C;  2ZGG A;  2XGO A;  1IQU A;  1L5J A;  4U04 A;  1N0R A;  4PS3 A;  1V54 E;  3Q7A A;  2FI7 A;  2WXH A;  2PQR A;  2JLB A;  5AAO A;  1AP7 A;  4G2V A;  3CLJ A;  5CRV A;  1SA5 A;  3UX4 A;  4GYO A;  4ACK A;  5CBO A;  2AXZ A;  1N11 A;  3KAE A;  2KCV A;  5JJ6 A;  2BKK B;  1BD8 A;  4K5A B;  4KVO A;  3EU5 A;  4GTP A;  2QYU A;  2XRY A;  4JVS A;  4EZL A;  2XZD G;  4CZ2 D;  3ZPJ A;  1YYH A;  1O1S A;  3FU6 A;  4OAU C;  2LO6 A;  1OT8 A;  4URK A;  2B6C A;  3AG1 E;  4LNB A;  2VTB B;  3L9T A;  3Q75 A;  1OCC E;  3EJN A;  3CHR A;  4ZHB A;  4YDE A;  4J7W A;  3G2T A;  2MOW A;  4YVO A;  3WG7 E;  3UM0 A;  4WNG A;  1TN7 A;  5KNH D;  5EN5 D;  4U7E B;  3PEV B;  4KZC A;  4FC8 A;  5A6C A;  4GTV A;  3CSF A;  3GZ2 A;  4A63 B;  1ZU2 A;  1HG2 A;  1PAQ A;  5FJY A;  2XCB A;  3G2U A;  4JHR A;  3PH0 C;  4F3V A;  3ZUV B;  1TYQ G;  2AJA A;  1KT1 A;  1Z3X A;  1O1R A;  5LCW J;  4M3O A;  3ABK E;  4D10 C;  2RD0 A;  2IU1 A;  3FUK A;  1NI1 A;  2WM9 A;  2FO7 A;  5CBN A;  3DRA A;  2BTD A;  2GW1 A;  3RKV A;  3CVQ A;  4LEU A;  3Q7F A;  4HNA D;  3ZN3 A;  3HHM A;  3FTW A;  2H6F A;  3HXC A;  3Q9N C;  4BX8 A;  3X2Q E;  4CCA A;  3SNX A;  3CQC B;  3J5P A;  3Q78 A;  4U0U A;  2CFU A;  4TRQ A;  4JD2 G;  2PL2 A;  4TXP A;  4BES A;  2C2L A;  2FBN A;  2V8S E;  3ZVV A;  5G2N A;  3J5Q B;  3CV0 A;  3ASN E;  4J8E A;  4HOR A;  5LOZ A;  3CKC A;  2M63 A;  3NF1 A;  2XGS A;  3UM2 A;  2MHK A;  4J8S A;  2I9C A;  3T8K A;  5HQ8 A;  4ACL A;  2UY1 B;  5CCL A;  4GZD A;  2WXM A;  4UI9 C;  1OUV A;  3S7J A;  4DPR A;  3FFL A;  2FO1 E;  2KAT A;  4A3T A;  1H0A A;  3AU4 A;  4HOQ A;  2Y4T A;  1K1B A;  3UUX A;  3QWW A;  3LKU A;  1X5B A;  4O1O A;  5J08 A;  5HS0 A;  4EZJ A;  1ZB1 A;  2YHC A;  1D9S A;  3I4R B;  3LPZ A;  4N5Q A;  4I17 A;  1UG3 A;  1LD7 A;  4XKB A;  3SZ7 A;  3NBN B;  3TWU A;  1N54 A;  3LVQ E;  1V55 E;  4C0E A;  1UJK A;  1MYO A;  2VGX A;  4P29 A;  1RW2 A;  3CHM A;  3UKU G;  1H19 A;  1N4R A;  2OCC E;  3JYS A;  5ANL A;  3PNL B;  2WQ7 A;  4GTQ A;  4ANU A;  5JA4 D;  3UIO C;  2F8Y A;  3FUM A;  4GPM A;  2GRL A;  1BPO A;  3EU9 A;  4JA7 A;  3ESK A;  2KZT B;  3SO8 A;  3TWX A;  3VTY A;  3D3M A;  2NXP A;  4G1T A;  3RRM B;  2IO3 C;  2GRM A;  3DPY A;  3G2V A;  2IY0 C;  3B95 A;  3BEE A;  1WDY A;  2UWJ G;  4F1S A;  4CGV A;  2L0I A;  3ZRH A; 
#chains in the Genus database with same CATH homology
 2XEH A;  2F37 A;  4DX7 D;  4F1P A;  3T8K A;  4U8Y D;  1IKN D;  3AJI A;  3Q9U C;  1N0Q A;  5KNH D;  5EN5 D;  3HRA A;  2B0O E;  5CER B;  4HI8 A;  4K5C A;  2XZT G;  2HE0 A;  4G8L A;  4HB5 A;  3UTM A;  4BER A;  2F8X K;  1BU9 A;  2JAB A;  2VGE A;  4DX1 A;  2DWZ A;  2KXP C;  5AN8 A;  2DZN A;  2V5Q C;  2QYJ A;  2FO1 E;  5KWD A;  4LNU D;  3V79 K;  2BKG A;  1MX4 A;  4K5B A;  3TWQ A;  5EIL A;  3KEA A;  4A63 B;  5BXO A;  3HG0 D;  1IHB A;  5CEC B;  3ZU7 B;  4DRX E;  1S70 B;  5HKP A;  1K1B A;  5ENO D;  4UUC A;  3ZUV B;  1MX6 A;  3EHR A;  2AJA A;  2QC9 A;  4BSZ B;  1A5E A;  1MX2 A;  4J8Y A;  3EHQ A;  5EYL A;  1MJ0 A;  3V30 A;  5FIO A;  4RLY A;  5ENT D;  4O1O A;  5HS0 A;  1NFI E;  3IXE A;  4QQI A;  1D9S A;  2NYJ A;  5KBA A;  5CEA A;  5ENR D;  4TUM A;  5ENP D;  2V4H C;  4HRM B;  4N5Q A;  4U95 D;  3NOC D;  2DZO A;  3W9F A;  2ETB A;  4NIK A;  3AAA C;  1SVX A;  1YCS B;  4HQD A;  2ZGG A;  1BLX B;  3D9H A;  5AQB A;  5ENS D;  1DC2 A;  4LG6 A;  5CBN A;  5EYP F;  4BET A;  5ENQ D;  4QFV A;  1N0R A;  4HLL A;  4LSZ E;  1TR4 A;  3TWR A;  3NBN B;  3DEP A;  5EIB E;  1K1A A;  1UOH A;  3JUE A;  3TWU A;  4HNA D;  3UXG A;  5AAO A;  5ITZ F;  1AP7 A;  2DVW A;  4HBD A;  1MYO A;  2XEN A;  2Y0B G;  3ZNG A;  3T9K A;  4Z68 A;  4DX5 D;  4YDW A;  4HRL A;  3TWT A;  4ATZ D;  3Q9N C;  2MYO A;  4O1P A;  2ETC A;  1AWC B;  5CBO A;  2P2C P;  3B7B A;  3JXJ A;  4U8V D;  1N11 A;  3F6Q A;  2ETA A;  3J5P A;  2BKK B;  3C5R A;  2J8S D;  2XEE A;  4O60 A;  2ZGD A;  1IXV A;  1DCQ A;  2A5E A;  3JXI A;  1BD8 A;  4YDY A;  3NOG D;  5EID A;  4K5A B;  3W9G A;  4DX2 A;  5JA4 D;  4G8K A;  3LJN A;  1K3Z D;  2F8Y A;  4GPM A;  4U96 D;  4DX6 D;  3EU9 A;  4OAV B;  5JMN D;  3ZKJ A;  3UI2 A;  4B93 B;  2Y1L E;  2RFA A;  2L6B A;  2XZD G;  5AQA A;  3V2X A;  4BES A;  4CZ2 D;  5BXU A;  2KBX A;  4GMR A;  1SW6 A;  3SO8 A;  3TWX A;  4ZFH A;  1YYH A;  3V31 A;  4F6R D;  5D66 A;  4BEP A;  3J5Q B;  3TWS A;  5CED B;  4OAU C;  4JB8 P;  1OT8 A;  5AAR A;  5HRY A;  2PNN A;  3V2O A;  4HI9 A;  1WG0 A;  3B95 A;  1WDY A;  4HRN A;  1G3N B;  3TWV A;  1QYM A;  5FIN A;  4DUI A;  1BI7 B;  1OY3 D;  5AQ7 A;  3TWW A;  4CYM D;  2RFM A;  4ZHB A;  4C48 B;  5KNG A;  4J7W A;  1BI8 B;  3DEO A;  1YMP A;  5AQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...