3TWRA

Crystal structure of arc4 from human tankyrase 2 in complex with peptide from human 3bp2
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
SEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/peptide
molecule keywords Tankyrase-2
publication title Structural basis and sequence rules for substrate recognition by tankyrase explain the basis for cherubism disease.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2011-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3twrA00
1WDYA 1D9SA 1QYMA 5ENOD 4DX1A 5AQ7A 3T9KA 4HRNA 4U95D 5EYPF 2L6BA 4U96D 4CYMD 5KNGA 3IXEA 5KNHD 4QFVA 3HG0D 1BI7B 4RLYA 4YDWA 2BKGA 3JXIA 4DX6D 5FIOA 4Z68A 3V2OA 3TWVA 5EIBE 3C5RA 5KWDA 4C48B 3EU9A 4QQIA 1OT8A 2XEHA 5EIDA 3TWUA 3V2XA 5EYLA 2A5EA 4ATZD 5ENPD 3SO8A 4J8YA 4K5BA 1SW6A 5BXUA 4BERA 1BD8A 3J5QB 4HI9A 4O60A 4BEPA 4F1PA 4JB8P 5HKPA 4OAVB 4LNUD 2DZNA 1NFIE 2XEEA 1UOHA 4YDYA 5ENQD 4B93B 4UUCA 2DVWA 1K3ZD 2B0OE 2F37A 3NBNB 2HE0A 3ZUVB 4BESA 4TUMA 5ENSD 1N0QA 3NOGD 4HBDA 3B7BA 4HB5A 3T8KA 4K5CA 1TR4A 1K1BA 1BLXB 2J8SD 2NYJA 2QYJA 4HRLA 3ZKJA 3LJNA 2F8XK 1DCQA 4HLLA 4LSZE 2FO1E 4F6RD 5CERB 2JABA 4DX7D 3UI2A 3AJIA 4BETA 2ETBA 2KXPC 5AQBA 3W9GA 2QC9A 3V79K 2RFMA 2MYOA 2XZDG 5HS0A 3TWXA 1N0RA 4A63B 1K1AA 4G8KA 4HQDA 1AP7A 3ZNGA 3JUEA 2ETAA 4GMRA 4O1PA 1MX4A 2Y0BG 4HRMB 2DZOA 4U8YD 2DWZA 3F6QA 1IKND 5EILA 3EHQA 1MX2A 3Q9UC 5CBNA 5CEDB 1MYOA 2V4HC 4LG6A 4NIKA 1YCSB 3DEOA 3UXGA 1DC2A 3JXJA 5ENRD 3TWRA 5AAOA 5ITZF 1YMPA 3NOCD 5JMND 3J5PA 1BU9A 2ZGGA 5ENTD 1MX6A 2Y1LE 3DEPA 5CECB 4GPMA 3B95A 4K5AB 5FINA 1YYHA 4OAUC 3V30A 4N5QA 2P2CP 3KEAA 5CEAA 3AAAC 1SVXA 3TWSA 4HI8A 1A5EA 4DUIA 2ETCA 3V31A 2PNNA 5AQ9A 2XZTG 2AJAA 1S70B 5KBAA 1N11A 1IXVA 5EN5D 4ZFHA 3UTMA 3D9HA 2KBXA 5AN8A 1IHBA 4O1OA 5JA4D 5D66A 4DRXE 4DX5D 3HRAA 3EHRA 3TWWA 2BKKB 4BSZB 3TWTA 3Q9NC 3TWQA 1MJ0A 5AQAA 4U8VD 2V5QC 2RFAA 4HNAD 1G3NB 4ZHBA 1AWCB 1OY3D 5HRYA 4J7WA 3ZU7B 2ZGDA 2VGEA 2F8YA 4DX2A 1BI8B 3W9FA 4G8LA 4CZ2D 5BXOA 1WG0A 2XENA 5AARA 5CBOA
chains in the Genus database with same CATH superfamily
2A4ZA 3DSWA 5ENNA 4JXTA 5FTPA 3SFZA 1H6KA 3G2VA 4NACA 2WXKA 5ANLA 3PUKA 3ML8A 5KWDA 3MJWA 4WNDA 2XEHA 4JPSA 5LOZA 3CVWA 2VSNA 4LNUD 1K3ZD 4BTBA 2XHEA 2X38A 3PH0C 2XQ0A 4N3AA 3T8KA 1JCQA 4U0ZA 4CDRA 4UQZA 4UI9K 1HE8A 3ULQA 2ETBA 3D3MA 1X5BA 2M63A 3S2AA 1QQEA 1DCEA 5ENRD 3LCAA 3KS2A 5CEAA 4GTMA 3D9OA 3UPVA 4G23A 2KBXA 5D66A 1NA0A 4GMLA 4I9CA 4BX8A 3MX3A 3FUFA 4O6FA 1E8YA 1UJKA 5KJLA 4CZ2D 1S64A 4AVXA 3ABLE 2XEVA 4CDMA 2PZIA 2GRQB 2L6BA 2DYSE 3JXIA 2Y4TA 4QQIA 3SF4A 2UY1B 4GTPA 3B13A 1KT0A 1BD8A 4PUCA 3R7QA 3MGBA 2PM6A 1ZBPA 4UI9J 1EYHA 5ENSD 2P9LG 3C3QA 1OXJA 2GRLA 4CRWA 1DNPA 3I5PA 4PS7A 4XI9A 4F6RD 4NRHB 5AQBA 4YDEA 4RVBA 1N95A 4KBQA 3U66A 4TRQA 1Z3XA 3KSLA 1YCSB 1FVHA 3EIJA 3E32A 5D0OD 1IQUA 3HXCA 2R5SA 2IO2C 3L08A 4CCAA 3QB2A 1YYHA 1SQMA 4BWRA 3EJNA 4U7EB 4GZDA 2GRRB 2P9PG 2FULA 3RKVA 2YHEA 3ZN3A 1E90A 3LVRE 3T5XA 4BSZB 3QWVA 4G25A 4A55A 4BY6A 5AARA 5BT1A 3JCKC 1D9SA 5LCWC 3FU3A 4CYMD 2XPIA 2XRZA 4GZ6A 4AV7A 4Z68A 1TJCA 1TJFA 2I9CA 4JHRA 2KCLA 3FEXA 3V2XA 2WXRA 5ARGA 3FUIA 4F1PA 4LNGA 3R9MA 2DZNA 4KYOB 3Q79A 4WNEA 2DVWA 2RD0A 3ZGQA 2ILRA 3FTYA 3ASHA 4DK5A 4Y6CA 3CLJA 3FTXA 1BLXB 5JHBA 4LUNU 1EDUA 4DX7D 1KLXA 4ANVA 3LS8A 3UM1A 3P2BA 2XZDG 5D2MC 4HXIA 4FLHA 2ETAA 4HRMB 5IY5E 3DRAA 1S63A 2HR2A 4AM9A 3HHMA 5D0QD 3MKQB 3UXGA 2QYUA 3ML9A 1SZAA 2FEZA 4ILGA 3U64A 1V54E 5HQ8A 1SVXA 3LJ3A 4DUIA 1LD8A 3S7BA 2L6JA 5KBAA 3MV3B 1IXVA 4WAFA 1IHBA 3DSSA 4UQXA 5CHEE 2CG3A 3R9AB 3TWWA 4Q96A 3TWTA 3FTSA 3Q9NC 3OXGA 4GTTA 4JZYA 4J7WA 4G8LA 5J90A 4HRNA 4OYSA 5AQ7A 4L1BA 2LXMA 3C3OA 3HG0D 2LNIA 1TN8A 2BKGA 3NZUA 2KCVA 2OOEA 2QY7A 4I2WA 4GZCA 3GW4A 3FHEA 3Q75A 3RRNB 2WB2A 1SW6A 4I43A 5HKPA 1H0AA 1L5JA 1E8WA 2KCKA 1SZ9A 3HYMB 3NBNB 3UX4A 3E37A 3MKRA 4HLLA 5FT9A 1U3DA 4KT6B 4LCTA 5C2YA 3FFLA 4I2ZA 3SFYA 4CT0A 3HIZA 1FT1A 3Q9UC 1JPLA 3TWRA 3X2QE 1OWLA 3NQPA 3S7JA 1MX6A 4D10C 3KAEA 4HFGA 2P2CP 3PVLA 2J49A 2ETCA 3V31A 4BFRA 4G2VA 4NURA 4XKBA 1E96B 1LF8A 3TJPA 2IONA 2WQ6A 3MYVA 4XIFA 4FJYA 3RK6A 4J8FA 3TWQA 2HM8A 2KZTB 2L9BA 1OCRE 2RFAA 4HNAD 3LPZA 1OY3D 5AJLA 3D9KA 4DX2A 2VSYA 3C98A 5HI7A 1WG0A 2XENA 3BEEA 3AG3E 2P9SG 3G2UA 3CSTA 1PC2A 3UT7A 3CKCA 1GW6A 3CV0A 4PDXA 1OCZE 4MS6A 1OT8A 3IV0A 3SQVA 5AIJA 4AP2A 3HDXA 5KCMA 5JJ6A 2UWJG 3P1UA 2RG8A 2MRIA 3EIQC 3RSEG 3D9MA 5G04C 4ANXA 4HB5A 3TG5A 1OCOE 2QFCA 2FO1E 3CKBA 3CK8A 3DXMG 3CVXA 5BV1A 4M7CA 1LTXA 2WXQA 4U0UA 4FADA 3EUVA 4G8KA 1IYGA 3TXMA 4GA1A 4A1SA 3L17A 4U8YD 2BF0X 2J4BA 5CEDB 4NIKA 2I1JA 5CMYA 3DEOA 3PZDA 4A3VA 3CHPA 3PNLB 1YMPA 2RKKA 2ZIRA 2DIWA 3NOCD 2VSOE 2VGYA 4L7TA 5LCWJ 4L2YA 3VTYA 4BX9A 1JWGA 4C0EA 4LEUA 3CVUA 4MLPA 3LEWA 5BV0A 2UY1A 4JEHA 4CGVA 3QWPA 4ANUA 2VGEA 1TNBA 4UWGA 1PY1A 1UG3A 3IHVA 4UWLA 3OXLA 4EPZA 4BSXA 1LD7A 3OXFA 3IXEA 2X3MA 3NAWA 5T4YA 2XGSA 2XCBA 3CHSA 2J09A 3RJVA 4PH4B 3KSQA 1H6PA 3FUJA 5A23A 2R03A 4BERA 4J6IA 2H6GA 3IHYA 3PRZA 5BPPA 4TUMA 2GRNB 3AG4E 3T8MA 3ZHEB 1K1BA 3ZKJA 1IQRA 2F8XK 4U07A 4BTAA 5JJ7A 3MEKA 5LP0A 2JABA 1OUVA 3DSUA 2YNQA 3D9JA 3B7SA 5B1AE 2R05A 4X8QA 4APOA 4GMRA 2IOSA 2GGFA 2V4HC 2P9IG 1DC2A 4GTSA 4FULA 5AAOA 2V0PA 3OAWA 3DEPA 5FINA 2WXGA 2DYRE 4JHJA 2WMOA 4HI8A 3L82A 4APFA 2C0MA 2DCPA 5E76A 5KJKA 2WXMA 2Y3AA 4DRXE 4DX5D 1WY6A 5B1BE 4HOUA 1HX8A 3JQ0A 3QAQA 4ACLA 1TNOA 5FZQA 4HLEA 2AXUA 1OWMA 2IU1A 3CEQA 3PE4A 5G55A 4E6HA 2Y4UA 2PM7A 2ZXWE 3CVLA 3UIPC 1ELRA 3PZ4A 3FTUA 4ATZD 1HS6A 4ACKA 4K5BA 4OAVB 3CHMA 3LVQE 2OVFA 3FH8A 3MKQA 4DI3A 1TR4A 1QZ2A 5T3RA 4GA2A 3GYZA 3CK9A 3SD5A 3FUKA 3UI2A 4YDOA 1D8EA 3FEYA 3PZ3A 2H6IA 2AVPA 4PS8A 3TGOA 3E4BA 2LO6A 2LSUA 3O48A 3F6QA 5EILA 3FU6A 1MYOA 4GB9A 4FC8A 4MKTA 2KC7A 2Y1LE 4FU3A 2IFUA 3E34A 4XEIG 1KZPA 1UJJA 2HYZA 2J9QA 2WXIA 3ASFA 1E7VA 2XZTG 3PNTB 2IOLA 3PZ1A 2HO1A 3C3RA 3QKYA 3FUEA 3LXUX 3EU5A 4B0ZA 1U2VG 3RRUA 1TN7A 2L0TB 4NQ0A 5G04J 4KVMA 2E2EA 2V5FA 3PEUB 2R2LA 3APCA 2H6HA 4XZ4A 4HOQA 5EIBE 3GZ2A 3PZ2A 4C48B 3FH7A 4RQIA 4AY6A 4YVOA 3Q47B 3J5QB 4HI9A 2GRMA 5JJTA 2OCCE 1E7UA 2H6FA 2QYJA 2J4DA 1O1TA 4ILIA 3FUNA 4KVOA 2ZISA 1EPUA 2WXJA 3SBTB 2LAHA 3AS4A 3D9IA 4JHKA 4C0MA 2XGOA 2FF4A 5DIZA 2KZTA 4G11A 3LY8A 5H7PA 2IJGX 1N4QA 3VLFA 5CECB 4GPMA 4ATGA 3V30A 4N5QA 3U4TA 5AQ9A 3MV2B 4FHKA 2DBAA 3QNKA 2ONDA 3CIAA 1MJ0A 5AQAA 2C2LA 4F7AA 4ZHBA 1IHGA 3QWWA 3ZU7B 5CCLA 2NSZA 1JWFA 2F8YA 3JUIA 4KZCA 3FUDA 3CVYA 4CDNA 2GW1A 1E8ZA 4JEUA 4U96D 3UMVA 2WPVA 5KNGA 3PDNA 3FY4A 4QFVA 4HOTA 3UM0A 4GAAA 4DJAA 4RSYA 3EU9A 2P9NG 3TWUA 1HXIA 4ANWA 4H7YA 5BXUA 3CHQA 5FQ7A 4JA9A 2XEEA 3ONLA 2J07A 1HZ4A 3HXFA 1KZOA 3CVPA 3L6AA 3ENEA 4F1SA 2WM9A 4IRUA 4XE0A 1DCQA 3ZIMA 4N3BA 4TXRA 4I1MA 5FWQA 2QC9A 3I3NA 1WM5A 1N0RA 1K1AA 4DI4A 2KM4A 3RAUA 3E33A 4WWOA 5FZRA 5CBNA 4EHMA 2PQNA 2IO3C 2WXLA 4JL0A 1D8DA 5ITZF 2XPYA 5ARFA 5JMND 3J5PA 1BU9A 2WMNA 5ENTD 3R7RA 5FQ8A 3B95A 4GTQA 3QOUA 5EDSA 4B8AA 4DLOA 1H2UA 3KEZA 3SHFA 2JLBA 1W3BA 1HH8A 3LY7A 5EN5D 4DPRA 4O1OA 1OCCE 3ZVVA 4AOFA 2EIME 4TXPA 4BT9A 3ULYA 4GTOA 3URZA 1EF1C 4AEZC 1WDYA 4DX1A 1MQSA 3ZHEA 3BQOA 3BU8A 4GCNA 4C9BB 2GRPB 4XX5A 3V2OA 4K03A 3HXBA 3IBEA 4GCOA 3CHOA 3PREA 4IN3B 3SO8A 3KD7A 3HXEA 2AXZA 3APDA 4N5CA 4B93B 4YDYA 4UWFA 5CRVA 4HS2A 4BESA 3B7BA 3SNXA 3AG1E 4AY5A 4KXKB 4J8DA 2LSVA 3QC1A 5CERB 2A5UA 2MOWA 3AJIA 1SA5A 2OVBA 2RFMA 2Y69E 3D9NA 2LUHA 3ZYKA 2WVIA 2QZAA 3FUHA 4I1OB 1AP7A 1XGWA 3CVQA 2YQ8A 4BT8A 1VDYA 4JA7A 4AXHA 2DWZA 4TXQA 1HG5A 1MX2A 3EHQA 2Q7FA 2CHXA 1KT1A 2ZGGA 2VGXB 4OAUC 3L13A 3KEAA 3TWSA 2PNNA 3U9WA 2XGMA 2EIKE 3C72A 2VTBA 2GROB 1G3NB 2FI7A 4FA6A 4L9PA 5BXOA 5A6CA 2FBNA 5CBOA 4TUUA 4WUYA 3S7FA 4U95D 2FO7A 1DVPA 3DBSA 5FIOA 3SGHA 2WQHA 3EHNA 2NC9A 1E8XA 2B6CA 1FPPA 4BEPA 1BPOA 4JB8P 2PQRA 2E0IA 3ASNE 1UOHA 2R59A 3B7UX 3UUXA 4L2LA 2HE0A 3CK7A 3B7TA 4HBDA 4GZ3A 4I1AA 2P9UG 2J8SD 4F53A 2AWIA 1Z6TA 4GYOA 4J8SA 3NF1A 1UN9A 1N94A 4N2SA 5HS0A 4OVUA 3UQ3A 2P58C 1PAQA 1V55E 3ZYMA 4Y6WA 4I6GA 2L0IA 2VQ2A 5FQ6A 4M3OA 3VLDA 4AJWA 3HVEB 3I4GA 4K5AB 1XNFA 3SZ7A 1A5EA 1OWPA 2CHWA 3ZRHA 3UT4A 1NP7A 4GTVA 3AU5A 2V5QC 3Q7FA 4JVSA 4RG6A 3TAXA 4GZ5A 2ZGDA 3I4RB 1NI1A 1QYMA 3O4ZA 4U63A 3DPDA 3MA5A 3TXNA 1UW4B 3D9LA 3UM2A 4UWKA 3Q78A 3Q49B 3LKUA 3TWVA 1H19A 1H2VC 3ABME 1B89A 2MHKA 3TG4A 2CG2A 5AENA 5G05C 4O60A 5BNWA 4JW1A 3AG2E 1QNFA 4UUCA 3UINC 1MZCA 4Q94A 3VTXA 1A17A 2EQXA 2YHCA 5CCMA 1QBQA 3JYSA 2V8SE 3PUJA 4FHJA 3V79K 4WWPA 2VTBB 3EHMA 4J8EA 4GYWA 3TL5A 4B94A 4B89A 5C1DA 3S7DA 3D9PA 1Z5SC 1HFAA 4EBAA 1HG2A 4WNGA 3ABKE 4J0UA 3Q7AA 3APFA 3AS8A 1K8KG 2AXVA 3PEVB 1TNUA 4N39A 4KMOA 2CFUA 4EBAG 3G2WA 5JHAA 2AW6A 5LX8A 5EX0A 1WAO1 4ZFHA 3UTMA 5CMWA 1Z3YA 5AN8A 3MCXA 3WXXA 2X6KA 5A7DB 4V3IA 3B7RL 5KJMA 3U3WA 1RZ4A 4WWNA 1OWNA 2X6IA 3MZLB 5ENOD 2X6FA 5T8IA 3T9KA 5EYPF 2NXPA 2C0LA 1JUQA 3ESKA 4YDWA 2I1KA 5BW8C 3SFXA 2R17C 2OV8A 4W9RA 5EYLA 5ENPD 1HO8A 1NFIE 2B0OE 3ZUVB 1N4SA 5ANRA 1N0QA 3L54A 3G2TA 3CR3A 3PE3A 2X6HA 2I6HA 5EKQD 4URKA 4Q69A 3L9TA 3CHRA 1N4PA 3NZSA 2PL2A 2MYOA 3L22A 4UWHA 5FZSA 3TWXA 4N2QA 3PS6A 3AU4A 3DSVA 1N54A 4FLBA 1MX4A 1UN8A 1X81A 3VLEA 3FU5A 3K9IA 1ZB1A 1HF8A 3L16A 5M72A 3AAAC 1S70B 1N11A 4EQFA 3BUAA 3FP3A 2JEKA 3GZSA 4E85A 4IYPA 4MBGA 4MRUA 2KATA 1BI8B 3W9FA 3QARA 3FU0A 4EZKA 3FH5A 4CGWA 1ZU2A 3ASGA 3IEGA 3Q15A 4XI0A 4EZJA 5KNHD 4RLYA 1BI7B 3ASOE 3LDZA 2OEWA 3ZEFA 1Q2ZA 3C5RA 3IKOB 2LXLA 4OVVA 1O5MA 1ELWA 3BG0B 3E30A 2BTDA 1TNYA 5ENQD 1MHQA 2F37A 3UT8A 2IY0C 4LERA 4I17A 4HORA 4K5CA 4AIFA 3SY2A 1NL4A 5J08A 2VGXA 4GA0A 4LSZE 3DSXA 1FT2A 3W9GA 4K0RA 4A1GA 2XCCA 3G2SA 5G2NA 3ZNGA 1FVFA 3QJZA 4H7XA 3JUEA 4O1PA 2Y0BG 4HVBA 4U0SA 3HXDA 2WXOA 3CVNA 2VYIA 4GU5A 3BG1B 4JD2G 3CQCB 3LY9A 3AS5A 4KZ0A 2WXPA 3ZW3A 3Q5MA 3SBSA 3FWVA 1N52A 2EILE 4ABNA 2AJAA 2CHZA 3ONKA 3LYAA 2WXHA 3Q4AB 3UM3A 2LAIA 1N4RA 5G05J 1P5QA 3ZYQA 2I2OA 2WQ7A 5HRYA 4B8CB 3CGHA 3Q73A 2WXNA 4ME2A 3UIOC 3ZPJA 1AWCB 4I9EA 4DLQA 4I6EA 2F0YA 3WG7E 3CSFA 2VSXE 2OEVA 5AJDA 3CVVA 4XKCA 4U8HA 5EIDA 1INZA 3ASDA 2A5EA 4N3CA 3ZFWA 4P29A 3ULEG 3N71A 5AYWD 3DSTA 2X6JA 3ZXPA 2R02A 3HVEA 4GMJA 2NYJA 2VJ8A 3LJNA 4RG9A 3DWLG 4TV3A 4BETA 2KXPC 1TNZA 3GZ1A 4ILHB 4L23A 3T5VA 1HU3A 1Y8MA 2P9KG 5B3SE 4WNFA 2IF4A 4LG6A 2V4LA 3JXJA 4R7LA 3FDHA 4UI9C 3NB2A 3RU0A 5LFAA 1NZNA 4A3TA 1N9AA 1O1SA 5CRUA 3D9HA 2ZU6B 3FTZA 5JA4D 1RW2A 5KJNA 2BKKB 4U8VD 4G26A 5EX3A 4FP7A 3ZYLA 4LNBA 3FTWA 4U04A 2XRYA 3UKUG 4YNDA 3RO2A 4F3VA 4FJZA 2WXFA 2BEDA 2J08A 1S0PA 4DX6D 5E75A 1JCRA 4PS3A 3FTVA 1TYQG 4J8YA 3FUMA 2XS1A 3ISMC 1H6OA 3CQGB 3ESLA 4CT4A 4GYYA 1FCHA 5FJYA 2IEJA 3NOGD 4HOSA 2YINA 4CEMA 1KPSB 3JQ1A 1SA4A 3FULA 1H2TC 4HRLA 3RIBA 1U3CA 1OWOA 3QDNA 1Y6IA 4A63B 3QK0A 2XPZA 4HQDA 3OTNA 5BUZA 3ZXSA 2DZOA 1IKND 4G1TA 4EZLA 1NA3A 4UQYA 2BUGA 3DPYA 2EINE 3RRMB 2IQCA 2EIJE 1JCSA 4YVQC 3SI5A 1TN6A 4GPKA 3RO3A 4IULA 2CFZA 3EDTB 2XS8A 1ELKA 3DXKG 4G24A 4GTRA 3UKRG 4EECA 1TEZA 3HRAA 3EHRA 4I6JA 4JC8A 1YA0A 4LRZA 5DBKA 5FQ4A 1O1RA
chains in the Genus database with same CATH topology
1WDYA 1D9SA 1QYMA 5ENOD 4DX1A 5AQ7A 3T9KA 4HRNA 4U95D 5EYPF 2L6BA 4U96D 4CYMD 5KNGA 3IXEA 5KNHD 4QFVA 3HG0D 1BI7B 4RLYA 4YDWA 2BKGA 3JXIA 4DX6D 5FIOA 4Z68A 3V2OA 3TWVA 5EIBE 3C5RA 5KWDA 4C48B 3EU9A 4QQIA 1OT8A 2XEHA 5EIDA 3TWUA 3V2XA 5EYLA 2A5EA 4ATZD 5ENPD 3SO8A 4J8YA 4K5BA 1SW6A 5BXUA 4BERA 1BD8A 3J5QB 4HI9A 4O60A 4BEPA 4F1PA 4JB8P 5HKPA 4OAVB 4LNUD 2DZNA 1NFIE 2XEEA 1UOHA 4YDYA 5ENQD 4B93B 4UUCA 2DVWA 1K3ZD 2B0OE 2F37A 3NBNB 2HE0A 3ZUVB 4BESA 4TUMA 5ENSD 1N0QA 3NOGD 4HBDA 3B7BA 4HB5A 3T8KA 4K5CA 1TR4A 1K1BA 1BLXB 2J8SD 2NYJA 2QYJA 4HRLA 3ZKJA 3LJNA 2F8XK 1DCQA 4HLLA 4LSZE 2FO1E 4F6RD 5CERB 2JABA 4DX7D 3UI2A 3AJIA 4BETA 2ETBA 2KXPC 5AQBA 3W9GA 2QC9A 3V79K 2RFMA 2MYOA 2XZDG 5HS0A 3TWXA 1N0RA 4A63B 1K1AA 4G8KA 4HQDA 1AP7A 3ZNGA 3JUEA 2ETAA 4GMRA 4O1PA 1MX4A 2Y0BG 4HRMB 2DZOA 4U8YD 2DWZA 3F6QA 1IKND 5EILA 3EHQA 1MX2A 3Q9UC 5CBNA 5CEDB 1MYOA 2V4HC 4LG6A 4NIKA 1YCSB 3DEOA 3UXGA 1DC2A 3JXJA 5ENRD 3TWRA 5AAOA 5ITZF 1YMPA 3NOCD 5JMND 3J5PA 1BU9A 2ZGGA 5ENTD 1MX6A 2Y1LE 3DEPA 5CECB 4GPMA 3B95A 4K5AB 5FINA 1YYHA 4OAUC 3V30A 4N5QA 2P2CP 3KEAA 5CEAA 3AAAC 1SVXA 3TWSA 4HI8A 1A5EA 4DUIA 2ETCA 3V31A 2PNNA 5AQ9A 2XZTG 2AJAA 1S70B 5KBAA 1N11A 1IXVA 5EN5D 4ZFHA 3UTMA 3D9HA 2KBXA 5AN8A 1IHBA 4O1OA 5JA4D 5D66A 4DRXE 4DX5D 3HRAA 3EHRA 3TWWA 2BKKB 4BSZB 3TWTA 3Q9NC 3TWQA 1MJ0A 5AQAA 4U8VD 2V5QC 2RFAA 4HNAD 1G3NB 4ZHBA 1AWCB 1OY3D 5HRYA 4J7WA 3ZU7B 2ZGDA 2VGEA 2F8YA 4DX2A 1BI8B 3W9FA 4G8LA 4CZ2D 5BXOA 1WG0A 2XENA 5AARA 5CBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WDY A;  1D9S A;  1QYM A;  5ENO D;  4DX1 A;  5AQ7 A;  3T9K A;  4HRN A;  4U95 D;  5EYP F;  2L6B A;  4U96 D;  4CYM D;  5KNG A;  3IXE A;  5KNH D;  4QFV A;  3HG0 D;  1BI7 B;  4RLY A;  4YDW A;  2BKG A;  3JXI A;  4DX6 D;  5FIO A;  4Z68 A;  3V2O A;  3TWV A;  5EIB E;  3C5R A;  5KWD A;  4C48 B;  3EU9 A;  4QQI A;  1OT8 A;  2XEH A;  5EID A;  3TWU A;  3V2X A;  5EYL A;  2A5E A;  4ATZ D;  5ENP D;  3SO8 A;  4J8Y A;  4K5B A;  1SW6 A;  5BXU A;  4BER A;  1BD8 A;  3J5Q B;  4HI9 A;  4O60 A;  4BEP A;  4F1P A;  4JB8 P;  5HKP A;  4OAV B;  4LNU D;  2DZN A;  1NFI E;  2XEE A;  1UOH A;  4YDY A;  5ENQ D;  4B93 B;  4UUC A;  2DVW A;  1K3Z D;  2B0O E;  2F37 A;  3NBN B;  2HE0 A;  3ZUV B;  4BES A;  4TUM A;  5ENS D;  1N0Q A;  3NOG D;  4HBD A;  3B7B A;  4HB5 A;  3T8K A;  4K5C A;  1TR4 A;  1K1B A;  1BLX B;  2J8S D;  2NYJ A;  2QYJ A;  4HRL A;  3ZKJ A;  3LJN A;  2F8X K;  1DCQ A;  4HLL A;  4LSZ E;  2FO1 E;  4F6R D;  5CER B;  2JAB A;  4DX7 D;  3UI2 A;  3AJI A;  4BET A;  2ETB A;  2KXP C;  5AQB A;  3W9G A;  2QC9 A;  3V79 K;  2RFM A;  2MYO A;  2XZD G;  5HS0 A;  3TWX A;  1N0R A;  4A63 B;  1K1A A;  4G8K A;  4HQD A;  1AP7 A;  3ZNG A;  3JUE A;  2ETA A;  4GMR A;  4O1P A;  1MX4 A;  2Y0B G;  4HRM B;  2DZO A;  4U8Y D;  2DWZ A;  3F6Q A;  1IKN D;  5EIL A;  3EHQ A;  1MX2 A;  3Q9U C;  5CBN A;  5CED B;  1MYO A;  2V4H C;  4LG6 A;  4NIK A;  1YCS B;  3DEO A;  3UXG A;  1DC2 A;  3JXJ A;  5ENR D;  3TWR A;  5AAO A;  5ITZ F;  1YMP A;  3NOC D;  5JMN D;  3J5P A;  1BU9 A;  2ZGG A;  5ENT D;  1MX6 A;  2Y1L E;  3DEP A;  5CEC B;  4GPM A;  3B95 A;  4K5A B;  5FIN A;  1YYH A;  4OAU C;  3V30 A;  4N5Q A;  2P2C P;  3KEA A;  5CEA A;  3AAA C;  1SVX A;  3TWS A;  4HI8 A;  1A5E A;  4DUI A;  2ETC A;  3V31 A;  2PNN A;  5AQ9 A;  2XZT G;  2AJA A;  1S70 B;  5KBA A;  1N11 A;  1IXV A;  5EN5 D;  4ZFH A;  3UTM A;  3D9H A;  2KBX A;  5AN8 A;  1IHB A;  4O1O A;  5JA4 D;  5D66 A;  4DRX E;  4DX5 D;  3HRA A;  3EHR A;  3TWW A;  2BKK B;  4BSZ B;  3TWT A;  3Q9N C;  3TWQ A;  1MJ0 A;  5AQA A;  4U8V D;  2V5Q C;  2RFA A;  4HNA D;  1G3N B;  4ZHB A;  1AWC B;  1OY3 D;  5HRY A;  4J7W A;  3ZU7 B;  2ZGD A;  2VGE A;  2F8Y A;  4DX2 A;  1BI8 B;  3W9F A;  4G8L A;  4CZ2 D;  5BXO A;  1WG0 A;  2XEN A;  5AAR A;  5CBO A; 
#chains in the Genus database with same CATH topology
 2A4Z A;  3DSW A;  5ENN A;  4JXT A;  5FTP A;  3SFZ A;  1H6K A;  3G2V A;  4NAC A;  2WXK A;  5ANL A;  3PUK A;  3ML8 A;  5KWD A;  3MJW A;  4WND A;  2XEH A;  4JPS A;  5LOZ A;  3CVW A;  2VSN A;  4LNU D;  1K3Z D;  4BTB A;  2XHE A;  2X38 A;  3PH0 C;  2XQ0 A;  4N3A A;  3T8K A;  1JCQ A;  4U0Z A;  4CDR A;  4UQZ A;  4UI9 K;  1HE8 A;  3ULQ A;  2ETB A;  3D3M A;  1X5B A;  2M63 A;  3S2A A;  1QQE A;  1DCE A;  5ENR D;  3LCA A;  3KS2 A;  5CEA A;  4GTM A;  3D9O A;  3UPV A;  4G23 A;  2KBX A;  5D66 A;  1NA0 A;  4GML A;  4I9C A;  4BX8 A;  3MX3 A;  3FUF A;  4O6F A;  1E8Y A;  1UJK A;  5KJL A;  4CZ2 D;  1S64 A;  4AVX A;  3ABL E;  2XEV A;  4CDM A;  2PZI A;  2GRQ B;  2L6B A;  2DYS E;  3JXI A;  2Y4T A;  4QQI A;  3SF4 A;  2UY1 B;  4GTP A;  3B13 A;  1KT0 A;  1BD8 A;  4PUC A;  3R7Q A;  3MGB A;  2PM6 A;  1ZBP A;  4UI9 J;  1EYH A;  5ENS D;  2P9L G;  3C3Q A;  1OXJ A;  2GRL A;  4CRW A;  1DNP A;  3I5P A;  4PS7 A;  4XI9 A;  4F6R D;  4NRH B;  5AQB A;  4YDE A;  4RVB A;  1N95 A;  4KBQ A;  3U66 A;  4TRQ A;  1Z3X A;  3KSL A;  1YCS B;  1FVH A;  3EIJ A;  3E32 A;  5D0O D;  1IQU A;  3HXC A;  2R5S A;  2IO2 C;  3L08 A;  4CCA A;  3QB2 A;  1YYH A;  1SQM A;  4BWR A;  3EJN A;  4U7E B;  4GZD A;  2GRR B;  2P9P G;  2FUL A;  3RKV A;  2YHE A;  3ZN3 A;  1E90 A;  3LVR E;  3T5X A;  4BSZ B;  3QWV A;  4G25 A;  4A55 A;  4BY6 A;  5AAR A;  5BT1 A;  3JCK C;  1D9S A;  5LCW C;  3FU3 A;  4CYM D;  2XPI A;  2XRZ A;  4GZ6 A;  4AV7 A;  4Z68 A;  1TJC A;  1TJF A;  2I9C A;  4JHR A;  2KCL A;  3FEX A;  3V2X A;  2WXR A;  5ARG A;  3FUI A;  4F1P A;  4LNG A;  3R9M A;  2DZN A;  4KYO B;  3Q79 A;  4WNE A;  2DVW A;  2RD0 A;  3ZGQ A;  2ILR A;  3FTY A;  3ASH A;  4DK5 A;  4Y6C A;  3CLJ A;  3FTX A;  1BLX B;  5JHB A;  4LUN U;  1EDU A;  4DX7 D;  1KLX A;  4ANV A;  3LS8 A;  3UM1 A;  3P2B A;  2XZD G;  5D2M C;  4HXI A;  4FLH A;  2ETA A;  4HRM B;  5IY5 E;  3DRA A;  1S63 A;  2HR2 A;  4AM9 A;  3HHM A;  5D0Q D;  3MKQ B;  3UXG A;  2QYU A;  3ML9 A;  1SZA A;  2FEZ A;  4ILG A;  3U64 A;  1V54 E;  5HQ8 A;  1SVX A;  3LJ3 A;  4DUI A;  1LD8 A;  3S7B A;  2L6J A;  5KBA A;  3MV3 B;  1IXV A;  4WAF A;  1IHB A;  3DSS A;  4UQX A;  5CHE E;  2CG3 A;  3R9A B;  3TWW A;  4Q96 A;  3TWT A;  3FTS A;  3Q9N C;  3OXG A;  4GTT A;  4JZY A;  4J7W A;  4G8L A;  5J90 A;  4HRN A;  4OYS A;  5AQ7 A;  4L1B A;  2LXM A;  3C3O A;  3HG0 D;  2LNI A;  1TN8 A;  2BKG A;  3NZU A;  2KCV A;  2OOE A;  2QY7 A;  4I2W A;  4GZC A;  3GW4 A;  3FHE A;  3Q75 A;  3RRN B;  2WB2 A;  1SW6 A;  4I43 A;  5HKP A;  1H0A A;  1L5J A;  1E8W A;  2KCK A;  1SZ9 A;  3HYM B;  3NBN B;  3UX4 A;  3E37 A;  3MKR A;  4HLL A;  5FT9 A;  1U3D A;  4KT6 B;  4LCT A;  5C2Y A;  3FFL A;  4I2Z A;  3SFY A;  4CT0 A;  3HIZ A;  1FT1 A;  3Q9U C;  1JPL A;  3TWR A;  3X2Q E;  1OWL A;  3NQP A;  3S7J A;  1MX6 A;  4D10 C;  3KAE A;  4HFG A;  2P2C P;  3PVL A;  2J49 A;  2ETC A;  3V31 A;  4BFR A;  4G2V A;  4NUR A;  4XKB A;  1E96 B;  1LF8 A;  3TJP A;  2ION A;  2WQ6 A;  3MYV A;  4XIF A;  4FJY A;  3RK6 A;  4J8F A;  3TWQ A;  2HM8 A;  2KZT B;  2L9B A;  1OCR E;  2RFA A;  4HNA D;  3LPZ A;  1OY3 D;  5AJL A;  3D9K A;  4DX2 A;  2VSY A;  3C98 A;  5HI7 A;  1WG0 A;  2XEN A;  3BEE A;  3AG3 E;  2P9S G;  3G2U A;  3CST A;  1PC2 A;  3UT7 A;  3CKC A;  1GW6 A;  3CV0 A;  4PDX A;  1OCZ E;  4MS6 A;  1OT8 A;  3IV0 A;  3SQV A;  5AIJ A;  4AP2 A;  3HDX A;  5KCM A;  5JJ6 A;  2UWJ G;  3P1U A;  2RG8 A;  2MRI A;  3EIQ C;  3RSE G;  3D9M A;  5G04 C;  4ANX A;  4HB5 A;  3TG5 A;  1OCO E;  2QFC A;  2FO1 E;  3CKB A;  3CK8 A;  3DXM G;  3CVX A;  5BV1 A;  4M7C A;  1LTX A;  2WXQ A;  4U0U A;  4FAD A;  3EUV A;  4G8K A;  1IYG A;  3TXM A;  4GA1 A;  4A1S A;  3L17 A;  4U8Y D;  2BF0 X;  2J4B A;  5CED B;  4NIK A;  2I1J A;  5CMY A;  3DEO A;  3PZD A;  4A3V A;  3CHP A;  3PNL B;  1YMP A;  2RKK A;  2ZIR A;  2DIW A;  3NOC D;  2VSO E;  2VGY A;  4L7T A;  5LCW J;  4L2Y A;  3VTY A;  4BX9 A;  1JWG A;  4C0E A;  4LEU A;  3CVU A;  4MLP A;  3LEW A;  5BV0 A;  2UY1 A;  4JEH A;  4CGV A;  3QWP A;  4ANU A;  2VGE A;  1TNB A;  4UWG A;  1PY1 A;  1UG3 A;  3IHV A;  4UWL A;  3OXL A;  4EPZ A;  4BSX A;  1LD7 A;  3OXF A;  3IXE A;  2X3M A;  3NAW A;  5T4Y A;  2XGS A;  2XCB A;  3CHS A;  2J09 A;  3RJV A;  4PH4 B;  3KSQ A;  1H6P A;  3FUJ A;  5A23 A;  2R03 A;  4BER A;  4J6I A;  2H6G A;  3IHY A;  3PRZ A;  5BPP A;  4TUM A;  2GRN B;  3AG4 E;  3T8M A;  3ZHE B;  1K1B A;  3ZKJ A;  1IQR A;  2F8X K;  4U07 A;  4BTA A;  5JJ7 A;  3MEK A;  5LP0 A;  2JAB A;  1OUV A;  3DSU A;  2YNQ A;  3D9J A;  3B7S A;  5B1A E;  2R05 A;  4X8Q A;  4APO A;  4GMR A;  2IOS A;  2GGF A;  2V4H C;  2P9I G;  1DC2 A;  4GTS A;  4FUL A;  5AAO A;  2V0P A;  3OAW A;  3DEP A;  5FIN A;  2WXG A;  2DYR E;  4JHJ A;  2WMO A;  4HI8 A;  3L82 A;  4APF A;  2C0M A;  2DCP A;  5E76 A;  5KJK A;  2WXM A;  2Y3A A;  4DRX E;  4DX5 D;  1WY6 A;  5B1B E;  4HOU A;  1HX8 A;  3JQ0 A;  3QAQ A;  4ACL A;  1TNO A;  5FZQ A;  4HLE A;  2AXU A;  1OWM A;  2IU1 A;  3CEQ A;  3PE4 A;  5G55 A;  4E6H A;  2Y4U A;  2PM7 A;  2ZXW E;  3CVL A;  3UIP C;  1ELR A;  3PZ4 A;  3FTU A;  4ATZ D;  1HS6 A;  4ACK A;  4K5B A;  4OAV B;  3CHM A;  3LVQ E;  2OVF A;  3FH8 A;  3MKQ A;  4DI3 A;  1TR4 A;  1QZ2 A;  5T3R A;  4GA2 A;  3GYZ A;  3CK9 A;  3SD5 A;  3FUK A;  3UI2 A;  4YDO A;  1D8E A;  3FEY A;  3PZ3 A;  2H6I A;  2AVP A;  4PS8 A;  3TGO A;  3E4B A;  2LO6 A;  2LSU A;  3O48 A;  3F6Q A;  5EIL A;  3FU6 A;  1MYO A;  4GB9 A;  4FC8 A;  4MKT A;  2KC7 A;  2Y1L E;  4FU3 A;  2IFU A;  3E34 A;  4XEI G;  1KZP A;  1UJJ A;  2HYZ A;  2J9Q A;  2WXI A;  3ASF A;  1E7V A;  2XZT G;  3PNT B;  2IOL A;  3PZ1 A;  2HO1 A;  3C3R A;  3QKY A;  3FUE A;  3LXU X;  3EU5 A;  4B0Z A;  1U2V G;  3RRU A;  1TN7 A;  2L0T B;  4NQ0 A;  5G04 J;  4KVM A;  2E2E A;  2V5F A;  3PEU B;  2R2L A;  3APC A;  2H6H A;  4XZ4 A;  4HOQ A;  5EIB E;  3GZ2 A;  3PZ2 A;  4C48 B;  3FH7 A;  4RQI A;  4AY6 A;  4YVO A;  3Q47 B;  3J5Q B;  4HI9 A;  2GRM A;  5JJT A;  2OCC E;  1E7U A;  2H6F A;  2QYJ A;  2J4D A;  1O1T A;  4ILI A;  3FUN A;  4KVO A;  2ZIS A;  1EPU A;  2WXJ A;  3SBT B;  2LAH A;  3AS4 A;  3D9I A;  4JHK A;  4C0M A;  2XGO A;  2FF4 A;  5DIZ A;  2KZT A;  4G11 A;  3LY8 A;  5H7P A;  2IJG X;  1N4Q A;  3VLF A;  5CEC B;  4GPM A;  4ATG A;  3V30 A;  4N5Q A;  3U4T A;  5AQ9 A;  3MV2 B;  4FHK A;  2DBA A;  3QNK A;  2OND A;  3CIA A;  1MJ0 A;  5AQA A;  2C2L A;  4F7A A;  4ZHB A;  1IHG A;  3QWW A;  3ZU7 B;  5CCL A;  2NSZ A;  1JWF A;  2F8Y A;  3JUI A;  4KZC A;  3FUD A;  3CVY A;  4CDN A;  2GW1 A;  1E8Z A;  4JEU A;  4U96 D;  3UMV A;  2WPV A;  5KNG A;  3PDN A;  3FY4 A;  4QFV A;  4HOT A;  3UM0 A;  4GAA A;  4DJA A;  4RSY A;  3EU9 A;  2P9N G;  3TWU A;  1HXI A;  4ANW A;  4H7Y A;  5BXU A;  3CHQ A;  5FQ7 A;  4JA9 A;  2XEE A;  3ONL A;  2J07 A;  1HZ4 A;  3HXF A;  1KZO A;  3CVP A;  3L6A A;  3ENE A;  4F1S A;  2WM9 A;  4IRU A;  4XE0 A;  1DCQ A;  3ZIM A;  4N3B A;  4TXR A;  4I1M A;  5FWQ A;  2QC9 A;  3I3N A;  1WM5 A;  1N0R A;  1K1A A;  4DI4 A;  2KM4 A;  3RAU A;  3E33 A;  4WWO A;  5FZR A;  5CBN A;  4EHM A;  2PQN A;  2IO3 C;  2WXL A;  4JL0 A;  1D8D A;  5ITZ F;  2XPY A;  5ARF A;  5JMN D;  3J5P A;  1BU9 A;  2WMN A;  5ENT D;  3R7R A;  5FQ8 A;  3B95 A;  4GTQ A;  3QOU A;  5EDS A;  4B8A A;  4DLO A;  1H2U A;  3KEZ A;  3SHF A;  2JLB A;  1W3B A;  1HH8 A;  3LY7 A;  5EN5 D;  4DPR A;  4O1O A;  1OCC E;  3ZVV A;  4AOF A;  2EIM E;  4TXP A;  4BT9 A;  3ULY A;  4GTO A;  3URZ A;  1EF1 C;  4AEZ C;  1WDY A;  4DX1 A;  1MQS A;  3ZHE A;  3BQO A;  3BU8 A;  4GCN A;  4C9B B;  2GRP B;  4XX5 A;  3V2O A;  4K03 A;  3HXB A;  3IBE A;  4GCO A;  3CHO A;  3PRE A;  4IN3 B;  3SO8 A;  3KD7 A;  3HXE A;  2AXZ A;  3APD A;  4N5C A;  4B93 B;  4YDY A;  4UWF A;  5CRV A;  4HS2 A;  4BES A;  3B7B A;  3SNX A;  3AG1 E;  4AY5 A;  4KXK B;  4J8D A;  2LSV A;  3QC1 A;  5CER B;  2A5U A;  2MOW A;  3AJI A;  1SA5 A;  2OVB A;  2RFM A;  2Y69 E;  3D9N A;  2LUH A;  3ZYK A;  2WVI A;  2QZA A;  3FUH A;  4I1O B;  1AP7 A;  1XGW A;  3CVQ A;  2YQ8 A;  4BT8 A;  1VDY A;  4JA7 A;  4AXH A;  2DWZ A;  4TXQ A;  1HG5 A;  1MX2 A;  3EHQ A;  2Q7F A;  2CHX A;  1KT1 A;  2ZGG A;  2VGX B;  4OAU C;  3L13 A;  3KEA A;  3TWS A;  2PNN A;  3U9W A;  2XGM A;  2EIK E;  3C72 A;  2VTB A;  2GRO B;  1G3N B;  2FI7 A;  4FA6 A;  4L9P A;  5BXO A;  5A6C A;  2FBN A;  5CBO A;  4TUU A;  4WUY A;  3S7F A;  4U95 D;  2FO7 A;  1DVP A;  3DBS A;  5FIO A;  3SGH A;  2WQH A;  3EHN A;  2NC9 A;  1E8X A;  2B6C A;  1FPP A;  4BEP A;  1BPO A;  4JB8 P;  2PQR A;  2E0I A;  3ASN E;  1UOH A;  2R59 A;  3B7U X;  3UUX A;  4L2L A;  2HE0 A;  3CK7 A;  3B7T A;  4HBD A;  4GZ3 A;  4I1A A;  2P9U G;  2J8S D;  4F53 A;  2AWI A;  1Z6T A;  4GYO A;  4J8S A;  3NF1 A;  1UN9 A;  1N94 A;  4N2S A;  5HS0 A;  4OVU A;  3UQ3 A;  2P58 C;  1PAQ A;  1V55 E;  3ZYM A;  4Y6W A;  4I6G A;  2L0I A;  2VQ2 A;  5FQ6 A;  4M3O A;  3VLD A;  4AJW A;  3HVE B;  3I4G A;  4K5A B;  1XNF A;  3SZ7 A;  1A5E A;  1OWP A;  2CHW A;  3ZRH A;  3UT4 A;  1NP7 A;  4GTV A;  3AU5 A;  2V5Q C;  3Q7F A;  4JVS A;  4RG6 A;  3TAX A;  4GZ5 A;  2ZGD A;  3I4R B;  1NI1 A;  1QYM A;  3O4Z A;  4U63 A;  3DPD A;  3MA5 A;  3TXN A;  1UW4 B;  3D9L A;  3UM2 A;  4UWK A;  3Q78 A;  3Q49 B;  3LKU A;  3TWV A;  1H19 A;  1H2V C;  3ABM E;  1B89 A;  2MHK A;  3TG4 A;  2CG2 A;  5AEN A;  5G05 C;  4O60 A;  5BNW A;  4JW1 A;  3AG2 E;  1QNF A;  4UUC A;  3UIN C;  1MZC A;  4Q94 A;  3VTX A;  1A17 A;  2EQX A;  2YHC A;  5CCM A;  1QBQ A;  3JYS A;  2V8S E;  3PUJ A;  4FHJ A;  3V79 K;  4WWP A;  2VTB B;  3EHM A;  4J8E A;  4GYW A;  3TL5 A;  4B94 A;  4B89 A;  5C1D A;  3S7D A;  3D9P A;  1Z5S C;  1HFA A;  4EBA A;  1HG2 A;  4WNG A;  3ABK E;  4J0U A;  3Q7A A;  3APF A;  3AS8 A;  1K8K G;  2AXV A;  3PEV B;  1TNU A;  4N39 A;  4KMO A;  2CFU A;  4EBA G;  3G2W A;  5JHA A;  2AW6 A;  5LX8 A;  5EX0 A;  1WAO 1;  4ZFH A;  3UTM A;  5CMW A;  1Z3Y A;  5AN8 A;  3MCX A;  3WXX A;  2X6K A;  5A7D B;  4V3I A;  3B7R L;  5KJM A;  3U3W A;  1RZ4 A;  4WWN A;  1OWN A;  2X6I A;  3MZL B;  5ENO D;  2X6F A;  5T8I A;  3T9K A;  5EYP F;  2NXP A;  2C0L A;  1JUQ A;  3ESK A;  4YDW A;  2I1K A;  5BW8 C;  3SFX A;  2R17 C;  2OV8 A;  4W9R A;  5EYL A;  5ENP D;  1HO8 A;  1NFI E;  2B0O E;  3ZUV B;  1N4S A;  5ANR A;  1N0Q A;  3L54 A;  3G2T A;  3CR3 A;  3PE3 A;  2X6H A;  2I6H A;  5EKQ D;  4URK A;  4Q69 A;  3L9T A;  3CHR A;  1N4P A;  3NZS A;  2PL2 A;  2MYO A;  3L22 A;  4UWH A;  5FZS A;  3TWX A;  4N2Q A;  3PS6 A;  3AU4 A;  3DSV A;  1N54 A;  4FLB A;  1MX4 A;  1UN8 A;  1X81 A;  3VLE A;  3FU5 A;  3K9I A;  1ZB1 A;  1HF8 A;  3L16 A;  5M72 A;  3AAA C;  1S70 B;  1N11 A;  4EQF A;  3BUA A;  3FP3 A;  2JEK A;  3GZS A;  4E85 A;  4IYP A;  4MBG A;  4MRU A;  2KAT A;  1BI8 B;  3W9F A;  3QAR A;  3FU0 A;  4EZK A;  3FH5 A;  4CGW A;  1ZU2 A;  3ASG A;  3IEG A;  3Q15 A;  4XI0 A;  4EZJ A;  5KNH D;  4RLY A;  1BI7 B;  3ASO E;  3LDZ A;  2OEW A;  3ZEF A;  1Q2Z A;  3C5R A;  3IKO B;  2LXL A;  4OVV A;  1O5M A;  1ELW A;  3BG0 B;  3E30 A;  2BTD A;  1TNY A;  5ENQ D;  1MHQ A;  2F37 A;  3UT8 A;  2IY0 C;  4LER A;  4I17 A;  4HOR A;  4K5C A;  4AIF A;  3SY2 A;  1NL4 A;  5J08 A;  2VGX A;  4GA0 A;  4LSZ E;  3DSX A;  1FT2 A;  3W9G A;  4K0R A;  4A1G A;  2XCC A;  3G2S A;  5G2N A;  3ZNG A;  1FVF A;  3QJZ A;  4H7X A;  3JUE A;  4O1P A;  2Y0B G;  4HVB A;  4U0S A;  3HXD A;  2WXO A;  3CVN A;  2VYI A;  4GU5 A;  3BG1 B;  4JD2 G;  3CQC B;  3LY9 A;  3AS5 A;  4KZ0 A;  2WXP A;  3ZW3 A;  3Q5M A;  3SBS A;  3FWV A;  1N52 A;  2EIL E;  4ABN A;  2AJA A;  2CHZ A;  3ONK A;  3LYA A;  2WXH A;  3Q4A B;  3UM3 A;  2LAI A;  1N4R A;  5G05 J;  1P5Q A;  3ZYQ A;  2I2O A;  2WQ7 A;  5HRY A;  4B8C B;  3CGH A;  3Q73 A;  2WXN A;  4ME2 A;  3UIO C;  3ZPJ A;  1AWC B;  4I9E A;  4DLQ A;  4I6E A;  2F0Y A;  3WG7 E;  3CSF A;  2VSX E;  2OEV A;  5AJD A;  3CVV A;  4XKC A;  4U8H A;  5EID A;  1INZ A;  3ASD A;  2A5E A;  4N3C A;  3ZFW A;  4P29 A;  3ULE G;  3N71 A;  5AYW D;  3DST A;  2X6J A;  3ZXP A;  2R02 A;  3HVE A;  4GMJ A;  2NYJ A;  2VJ8 A;  3LJN A;  4RG9 A;  3DWL G;  4TV3 A;  4BET A;  2KXP C;  1TNZ A;  3GZ1 A;  4ILH B;  4L23 A;  3T5V A;  1HU3 A;  1Y8M A;  2P9K G;  5B3S E;  4WNF A;  2IF4 A;  4LG6 A;  2V4L A;  3JXJ A;  4R7L A;  3FDH A;  4UI9 C;  3NB2 A;  3RU0 A;  5LFA A;  1NZN A;  4A3T A;  1N9A A;  1O1S A;  5CRU A;  3D9H A;  2ZU6 B;  3FTZ A;  5JA4 D;  1RW2 A;  5KJN A;  2BKK B;  4U8V D;  4G26 A;  5EX3 A;  4FP7 A;  3ZYL A;  4LNB A;  3FTW A;  4U04 A;  2XRY A;  3UKU G;  4YND A;  3RO2 A;  4F3V A;  4FJZ A;  2WXF A;  2BED A;  2J08 A;  1S0P A;  4DX6 D;  5E75 A;  1JCR A;  4PS3 A;  3FTV A;  1TYQ G;  4J8Y A;  3FUM A;  2XS1 A;  3ISM C;  1H6O A;  3CQG B;  3ESL A;  4CT4 A;  4GYY A;  1FCH A;  5FJY A;  2IEJ A;  3NOG D;  4HOS A;  2YIN A;  4CEM A;  1KPS B;  3JQ1 A;  1SA4 A;  3FUL A;  1H2T C;  4HRL A;  3RIB A;  1U3C A;  1OWO A;  3QDN A;  1Y6I A;  4A63 B;  3QK0 A;  2XPZ A;  4HQD A;  3OTN A;  5BUZ A;  3ZXS A;  2DZO A;  1IKN D;  4G1T A;  4EZL A;  1NA3 A;  4UQY A;  2BUG A;  3DPY A;  2EIN E;  3RRM B;  2IQC A;  2EIJ E;  1JCS A;  4YVQ C;  3SI5 A;  1TN6 A;  4GPK A;  3RO3 A;  4IUL A;  2CFZ A;  3EDT B;  2XS8 A;  1ELK A;  3DXK G;  4G24 A;  4GTR A;  3UKR G;  4EEC A;  1TEZ A;  3HRA A;  3EHR A;  4I6J A;  4JC8 A;  1YA0 A;  4LRZ A;  5DBK A;  5FQ4 A;  1O1R A; 
#chains in the Genus database with same CATH homology
 1WDY A;  1D9S A;  1QYM A;  5ENO D;  4DX1 A;  5AQ7 A;  3T9K A;  4HRN A;  4U95 D;  5EYP F;  2L6B A;  4U96 D;  4CYM D;  5KNG A;  3IXE A;  5KNH D;  4QFV A;  3HG0 D;  1BI7 B;  4RLY A;  4YDW A;  2BKG A;  3JXI A;  4DX6 D;  5FIO A;  4Z68 A;  3V2O A;  3TWV A;  5EIB E;  3C5R A;  5KWD A;  4C48 B;  3EU9 A;  4QQI A;  1OT8 A;  2XEH A;  5EID A;  3TWU A;  3V2X A;  5EYL A;  2A5E A;  4ATZ D;  5ENP D;  3SO8 A;  4J8Y A;  4K5B A;  1SW6 A;  5BXU A;  4BER A;  1BD8 A;  3J5Q B;  4HI9 A;  4O60 A;  4BEP A;  4F1P A;  4JB8 P;  5HKP A;  4OAV B;  4LNU D;  2DZN A;  1NFI E;  2XEE A;  1UOH A;  4YDY A;  5ENQ D;  4B93 B;  4UUC A;  2DVW A;  1K3Z D;  2B0O E;  2F37 A;  3NBN B;  2HE0 A;  3ZUV B;  4BES A;  4TUM A;  5ENS D;  1N0Q A;  3NOG D;  4HBD A;  3B7B A;  4HB5 A;  3T8K A;  4K5C A;  1TR4 A;  1K1B A;  1BLX B;  2J8S D;  2NYJ A;  2QYJ A;  4HRL A;  3ZKJ A;  3LJN A;  2F8X K;  1DCQ A;  4HLL A;  4LSZ E;  2FO1 E;  4F6R D;  5CER B;  2JAB A;  4DX7 D;  3UI2 A;  3AJI A;  4BET A;  2ETB A;  2KXP C;  5AQB A;  3W9G A;  2QC9 A;  3V79 K;  2RFM A;  2MYO A;  2XZD G;  5HS0 A;  3TWX A;  1N0R A;  4A63 B;  1K1A A;  4G8K A;  4HQD A;  1AP7 A;  3ZNG A;  3JUE A;  2ETA A;  4GMR A;  4O1P A;  1MX4 A;  2Y0B G;  4HRM B;  2DZO A;  4U8Y D;  2DWZ A;  3F6Q A;  1IKN D;  5EIL A;  3EHQ A;  1MX2 A;  3Q9U C;  5CBN A;  5CED B;  1MYO A;  2V4H C;  4LG6 A;  4NIK A;  1YCS B;  3DEO A;  3UXG A;  1DC2 A;  3JXJ A;  5ENR D;  3TWR A;  5AAO A;  5ITZ F;  1YMP A;  3NOC D;  5JMN D;  3J5P A;  1BU9 A;  2ZGG A;  5ENT D;  1MX6 A;  2Y1L E;  3DEP A;  5CEC B;  4GPM A;  3B95 A;  4K5A B;  5FIN A;  1YYH A;  4OAU C;  3V30 A;  4N5Q A;  2P2C P;  3KEA A;  5CEA A;  3AAA C;  1SVX A;  3TWS A;  4HI8 A;  1A5E A;  4DUI A;  2ETC A;  3V31 A;  2PNN A;  5AQ9 A;  2XZT G;  2AJA A;  1S70 B;  5KBA A;  1N11 A;  1IXV A;  5EN5 D;  4ZFH A;  3UTM A;  3D9H A;  2KBX A;  5AN8 A;  1IHB A;  4O1O A;  5JA4 D;  5D66 A;  4DRX E;  4DX5 D;  3HRA A;  3EHR A;  3TWW A;  2BKK B;  4BSZ B;  3TWT A;  3Q9N C;  3TWQ A;  1MJ0 A;  5AQA A;  4U8V D;  2V5Q C;  2RFA A;  4HNA D;  1G3N B;  4ZHB A;  1AWC B;  1OY3 D;  5HRY A;  4J7W A;  3ZU7 B;  2ZGD A;  2VGE A;  2F8Y A;  4DX2 A;  1BI8 B;  3W9F A;  4G8L A;  4CZ2 D;  5BXO A;  1WG0 A;  2XEN A;  5AAR A;  5CBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...