5BXUA

Human tankyrase-2 in complex with macrocyclised extended peptide cp4n4m5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
GSGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Human Tankyrase-2 in Complex with Extended Stapled Peptide sp4n4m5
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 50
structure length 163
sequence length 163
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5bxuA00
2BKGA 4J7WA 3D9HA 3TWRA 1AWCB 3W9FA 4GMRA 4F6RD 3V2XA 4J8YA 2QYJA 2F8YA 5AQ7A 3TWUA 3EU9A 5CEDB 4N5QA 4UUCA 4G8LA 5FIOA 2ETAA 3J5PA 5HS0A 4BESA 4U96D 2VGEA 3LJNA 4HRNA 5AAOA 4U8VD 4HQDA 5CECB 4CZ2D 5BXUA 1IHBA 1NFIE 4HNAD 3TWWA 3EHQA 4K5BA 3AJIA 4LSZE 4F1PA 1G3NB 3V2OA 3ZNGA 5CEAA 4OAUC 4BERA 2V5QC 2XZTG 1OY3D 2J8SD 3KEAA 4QFVA 2ZGDA 5KNGA 2DZOA 1K3ZD 3Q9UC 1A5EA 4HRLA 2F37A 5EIBE 5EN5D 5JA4D 3IXEA 1YCSB 3B7BA 3HRAA 2RFMA 2Y0BG 2B0OE 4ATZD 1N11A 1IXVA 2V4HC 5AQBA 4O1PA 1YYHA 2MYOA 4O1OA 5FINA 5CBOA 4Z68A 2DWZA 3B95A 4C48B 1QYMA 3T9KA 1N0QA 4DX6D 1K1BA 4O60A 1MJ0A 3TWSA 5BXOA 4K5CA 5ENOD 1MYOA 5JMND 1D9SA 2XZDG 3V79K 3W9GA 1N0RA 1TR4A 2BKKB 4LNUD 3DEPA 2XEEA 5EILA 3V30A 2XEHA 4ZHBA 3V31A 4U95D 4A63B 5KNHD 3SO8A 5CERB 2Y1LE 1S70B 2ETBA 5AQ9A 1DC2A 3TWQA 1UOHA 4JB8P 3UTMA 3TWTA 4GPMA 4HB5A 3J5QB 2ZGGA 4LG6A 1BI8B 1MX6A 4YDWA 2PNNA 1K1AA 5D66A 3NOCD 5HRYA 4DX2A 5ITZF 1WG0A 3JXJA 5AARA 5HKPA 2DVWA 3Q9NC 5AQAA 2ETCA 1AP7A 4DUIA 3T8KA 1MX2A 4OAVB 1SW6A 2A5EA 1MX4A 2AJAA 3ZKJA 4BEPA 4TUMA 3NOGD 2KXPC 4HRMB 5AN8A 3UI2A 4CYMD 4DX5D 2NYJA 4G8KA 4HLLA 1IKND 1DCQA 2DZNA 4U8YD 3ZU7B 5ENTD 5ENQD 3AAAC 3C5RA 1BI7B 4BETA 4ZFHA 1BD8A 4NIKA 2RFAA 5KBAA 4YDYA 5EYPF 3TWXA 4DX1A 4QQIA 2QC9A 3DEOA 3F6QA 2JABA 3NBNB 1BLXB 1WDYA 4DX7D 5KWDA 2FO1E 5ENPD 3UXGA 5CBNA 3TWVA 3JXIA 1SVXA 4BSZB 3EHRA 5ENRD 5EYLA 2KBXA 4HBDA 3ZUVB 4B93B 5EIDA 2L6BA 4DRXE 2F8XK 2P2CP 1YMPA 3JUEA 1OT8A 4K5AB 2XENA 3HG0D 4HI8A 4RLYA 1BU9A 2HE0A 5ENSD 4HI9A
chains in the Genus database with same CATH superfamily
4ILHB 3V2XA 3ZW3A 2KM4A 4X8QA 4CT0A 1O1TA 2P9LG 4LSZE 3C3OA 3PZ2A 2HM8A 4L1BA 3FUIA 3LJ3A 4ACLA 2QZAA 5ENNA 3OXLA 4HORA 5T3RA 1MZCA 2VGXB 2XZDG 1W3BA 1IYGA 2BF0X 3ZN3A 3QAQA 4D10C 2V5FA 5AQ9A 2GRPB 1DC2A 2C2LA 3UTMA 3WXXA 4GA1A 4BT8A 1H2UA 1B89A 1HXIA 2Y3AA 4GTVA 1S64A 1X5BA 4GA2A 1WAO1 3MEKA 3CHQA 5B1BE 4APOA 4FP7A 4TUMA 3CKBA 3FY4A 3ZU7B 1HG5A 3VLEA 3MKRA 4RG9A 4G11A 4XX5A 4BTBA 2LAHA 3UXGA 3ZEFA 5IY5E 4J8FA 1FVFA 3JUEA 2GW1A 1EPUA 1OT8A 4EZKA 2J08A 4PH4B 3MKQB 3PUJA 4KYOB 4FJZA 1ELKA 2R2LA 2XCBA 1VDYA 2KCKA 4FLHA 1OWLA 4J8YA 3CVYA 3IHVA 4HOUA 5E76A 1ELWA 2Y4TA 3AS5A 3J5PA 3SGHA 3D3MA 5BNWA 5BXUA 1A17A 3B7SA 3L22A 4L2LA 5CEAA 3HIZA 2EIME 3IHYA 5KNGA 3MA5A 3EIJA 3QARA 2HYZA 1D8EA 4AM9A 4WUYA 2RFMA 4IULA 4O1PA 1NA0A 2LSUA 2VSXE 4C48B 4B8CB 3FTVA 1N9AA 4LUNU 1H2VC 3MGBA 3Q47B 4KT6B 4E6HA 3CK8A 4NACA 4JW1A 3TWTA 5A6CA 2BEDA 1INZA 2A4ZA 3I4RB 5D0QD 3S7DA 4ANVA 4A1GA 3DPDA 4UWFA 3MKQA 4BWRA 4EZJA 2P9NG 3R7RA 3VTYA 3PREA 5LCWJ 4Y6CA 2IFUA 4YDEA 3ULEG 1H0AA 4BEPA 4RVBA 4L7TA 3QB2A 3MV3B 2MRIA 3B7TA 4N39A 3NB2A 3PE4A 1KZPA 3CVQA 2FO1E 4UWGA 3CSFA 3R9MA 5BV0A 4B8AA 5LP0A 2QYUA 3ZYMA 1SZ9A 1NA3A 4HI9A 4APFA 3PDNA 2DCPA 1OCCE 4GAAA 3E33A 2C0MA 4G1TA 4UUCA 3C98A 4U0ZA 4N2SA 2M63A 3FUEA 3D9NA 4ME2A 3Q4AB 3ZFWA 4C0EA 3ONKA 1NFIE 1EYHA 3B13A 5T4YA 3ZNGA 2P9IG 1TNZA 4FLBA 2BUGA 4GTRA 4BERA 2AWIA 3EU5A 2L6JA 5JA4D 3HRAA 5E75A 2XGMA 4ATZD 4I43A 3UX4A 2WXFA 3NF1A 1O5MA 3CV0A 5KJNA 3LS8A 2GRQB 4KVOA 3SO8A 2Y1LE 4C9BB 3RO3A 4E85A 4MRUA 4AEZC 1SA4A 4B94A 3ASFA 4HLEA 4JVSA 3E4BA 4EPZA 3FP3A 3DSWA 1MHQA 4BSXA 4CDNA 4U8HA 3UM1A 2R05A 1SQMA 1H6OA 4JEHA 2I9CA 3L16A 3TWXA 4DX1A 1V55E 3ZGQA 5FZSA 5D0OD 2GGFA 4JA9A 4FC8A 2L6BA 2WXHA 2AXUA 4G26A 3BG1B 4GCNA 1E96B 2R5SA 2IEJA 2V8SE 1E8YA 3LYAA 1KZOA 4WNDA 1OCRE 2B6CA 3TGOA 3TWUA 4Y6WA 1MQSA 3AU5A 3FUDA 1N4QA 1U3DA 1ELRA 3KS2A 3ESLA 2I2OA 2XGOA 5FQ4A 4CZ2D 1E7UA 3UIPC 4JPSA 4ABNA 3IKOB 5C1DA 1UG3A 3O4ZA 1IXVA 2LNIA 2XPZA 2MHKA 3FFLA 5H7PA 4I9CA 3PS6A 4J8EA 3UINC 1QQEA 3V30A 1OWMA 3V31A 2PZIA 5KNHD 1NI1A 3SNXA 2WQHA 5FT9A 1H6KA 3IEGA 5D66A 3GW4A 4DX2A 5G05C 1JWGA 4U7EB 4WWOA 1N95A 3ULYA 2PM6A 3SF4A 3ENEA 2A5EA 4OVUA 3JQ0A 3APCA 3BEEA 3Q7FA 2IQCA 5AENA 3CVNA 4UI9K 4CGWA 4CGVA 3NZUA 3PEVB 4HXIA 3MCXA 4CEMA 3G2UA 5ENRD 3AU4A 4HBDA 4K5AB 2XENA 4EZLA 1HFAA 1AWCB 3ONLA 2XS8A 2DIWA 3EU9A 5FQ6A 4MS6A 4JHJA 2LXMA 5EX0A 2WM9A 2X6HA 2XPYA 2P9PG 1JPLA 3Q49B 2J4DA 3T9KA 4DPRA 3UKUG 2VSYA 4RSYA 2IF4A 5C2YA 4A63B 3SBTB 4CT4A 3ABLE 5G04C 3FU0A 5LOZA 5BUZA 5AARA 5JJ6A 4GZDA 3UT7A 3UPVA 5FQ7A 1DCEA 3ASHA 1UN9A 3FH7A 1OXJA 2YNQA 5A23A 3X2QE 1BI7B 3OXGA 3F6QA 4DX7D 4CCAA 4I2ZA 3ASDA 3GYZA 2UWJG 4HS2A 1GW6A 2H6HA 4W9RA 4RLYA 4TUUA 3RU0A 3D9PA 4JL0A 2EIKE 4WWPA 1TNUA 3CGHA 1NZNA 1KLXA 3CQCB 5FZQA 3Q75A 3FU5A 3QOUA 5AAOA 2Y4UA 4AXHA 2L9BA 2WXIA 2V5QC 3FH5A 1TNYA 4XKBA 1E8XA 3DPYA 3RO2A 3LEWA 1OWPA 2OCCE 4GMLA 1HO8A 3Q78A 1YYHA 1OCOE 3QK0A 4MKTA 5DIZA 5CBOA 1LD7A 3B95A 3ULQA 4KVMA 4GZ5A 3V79K 3DXMG 4ATGA 1K8KG 2XEEA 5EILA 3N71A 1QZ2A 1UN8A 4U95D 3CHPA 4TXPA 3RSEG 2H6IA 2H6GA 1SA5A 3JXJA 2XGSA 3HXEA 3UM2A 3Q7AA 3ASNE 2EIJE 5HI7A 3AG1E 4TXRA 4WNFA 1N54A 4U0UA 4CYMD 1QBQA 5ENQD 4UWLA 4RQIA 5KBAA 5JJ7A 5AIJA 4WNGA 2ONDA 3APDA 3PH0C 5ENPD 2XPIA 2XEVA 2NC9A 5EYLA 1E90A 3ZUVB 4DI3A 2VTBB 4G24A 3CLJA 2FBNA 4LNGA 3KEZA 2HE0A 3ZHEB 5KJLA 5AJLA 4J7WA 4AVXA 4KZCA 4U0SA 1O1RA 1TN8A 4KXKB 3D9JA 1P5QA 5BV1A 1Z6TA 3FEYA 3S7FA 5T8IA 5J08A 4G23A 3DSTA 2ILRA 1IHBA 4HNAD 5KJMA 4UQXA 4XKCA 3TJPA 2LXLA 2XZTG 3OAWA 3EJNA 4JXTA 3U4TA 1N11A 3CSTA 4Z68A 5CCMA 1UJJA 2IOLA 2VJ8A 4DX6D 2EQXA 4LERA 5JMND 4GYYA 3DEPA 3Q79A 4ZHBA 2PL2A 2YQ8A 2AXZA 4L2YA 4A1SA 3LXUX 2H6FA 3RRNB 4MLPA 4K0RA 3AS4A 5HRYA 3UT4A 1ZB1A 2R59A 2KCVA 2VTBA 1Y6IA 4N3AA 5ARGA 4DUIA 3ZHEA 4JA7A 4A3TA 3GZSA 4ANXA 3U3WA 1KPSB 3DSXA 3ZKJA 1TNBA 4EECA 2L0IA 4G8KA 4AIFA 2DZNA 3E32A 3C5RA 4BETA 2QC9A 3U9WA 1WY6A 1N4RA 1SVXA 1YMPA 4F7AA 3UT8A 3CVWA 1Z3XA 3RRMB 5AJDA 2XRZA 4KZ0A 3D9OA 2BKGA 4HFGA 1DVPA 4GTQA 2IY0C 2WMOA 3PNTB 1FVHA 3SQVA 4K5BA 2KC7A 4N3CA 1E7VA 4QFVA 4Q69A 4GZCA 1A5EA 3PVLA 5BPPA 4IYPA 4LNBA 1UJKA 4PDXA 2CFZA 1LTXA 5EKQD 2RKKA 2CFUA 4FU3A 3CKCA 4LNUD 2ETBA 4J8SA 2WXJA 4WAFA 1UOHA 2VQ2A 4J8DA 4JEUA 4GTSA 4WNEA 2WB2A 1N94A 2E2EA 4BY6A 1NL4A 2QFCA 1XGWA 2ETCA 1TN7A 2OV8A 5FJYA 3RK6A 2ZU6B 3D9KA 2ZXWE 2X6JA 3FU3A 3LDZA 4DX5D 2OVFA 2FULA 4YDYA 3P2BA 4QQIA 2XS1A 1D8DA 1BLXB 5KWDA 3ASOE 3EHNA 4AY5A 4OVVA 4BSZB 4AP2A 2FF4A 3DSSA 3APFA 3I5PA 3HG0D 4HI8A 3FUFA 3CVXA 2HR2A 2FI7A 3W9FA 3ASGA 4TXQA 3SFZA 4G2VA 3G2TA 3PZ3A 5FIOA 4BESA 3PUKA 1FT1A 1UW4B 3LJNA 4BTAA 3T5VA 3RIBA 4C0MA 3FUKA 1HX8A 3PNLB 2R17C 2J8SD 3SFXA 2ZGDA 2GROB 2GRNB 1OWOA 3QWVA 5CMYA 3EDTB 4ANUA 2NXPA 3CR3A 3CVLA 3W9GA 3AG4E 2R03A 1N0RA 2WQ6A 3LY7A 4JHRA 3PZDA 2YINA 3QNKA 5JHAA 1Q2ZA 4HB5A 2ZGGA 1BI8B 1MX6A 2V4LA 4URKA 2WMNA 5J90A 3JYSA 3L54A 1PC2A 2CG2A 3DBSA 1L5JA 2RG8A 3G2VA 4U8YD 3E37A 5ENTD 1H2TC 1JWFA 1BD8A 5EYPF 4GYOA 4AV7A 3CHOA 1DNPA 1HS6A 1N52A 3FHEA 4Q94A 5M72A 1JCSA 3DSVA 3D9IA 2GRRB 4I6GA 2P2CP 3FWVA 5KJKA 3TXNA 2WQ7A 1WM5A 4Q96A 5ANLA 4GZ6A 3DWLG 3KSQA 2CHWA 1JCQA 4YNDA 4PUCA 3IBEA 3KD7A 3TAXA 5CECB 3ABME 4PS7A 5ANRA 3TWWA 2WXLA 1SZAA 4OAUC 2IJGX 2YHEA 2Q7FA 4HRLA 5D2MC 5FQ8A 2FEZA 2XQ0A 3B7BA 2Y0BG 4I1MA 5AQBA 3RAUA 4GTTA 2IONA 3HXCA 4GTPA 1QYMA 4LEUA 4U07A 3PZ1A 1JUQA 3HVEB 5CERB 3TWQA 3HXDA 1HU3A 4YDWA 3BUAA 4YVQC 3NZSA 4RG6A 5AQAA 4PS3A 4HOQA 4I9EA 1YA0A 2KZTB 2VSOE 3RJVA 4V3IA 3HDXA 2DYRE 3U66A 5KCMA 3SD5A 4CDMA 4R7LA 5CBNA 3TWVA 4EBAG 3LCAA 2KBXA 4B93B 3PE3A 5CHEE 2NSZA 2JLBA 4CDRA 3QC1A 3CK9A 3T5XA 3SFYA 3WG7E 3D9HA 4F6RD 1Y8MA 3FTYA 3LVQE 3JUIA 4H7YA 1X81A 2OEVA 2X6FA 4ANWA 5CEDB 4N5QA 1TJCA 4N2QA 5HS0A 3HVEA 4U96D 1N4SA 3PEUB 4XI0A 3I4GA 3BU8A 5CMWA 2J9QA 1FT2A 1OY3D 1N4PA 3HXBA 1H19A 3K9IA 4PS8A 3PZ4A 3B7UX 3IXEA 3FTSA 1S63A 2B0OE 2LAIA 2V4HC 3FDHA 5BW8C 3CVUA 3ZIMA 3MZLB 3VTXA 3SHFA 1K1BA 4O60A 3TWSA 3ZVVA 2KZTA 1MYOA 4B0ZA 3PRZA 3RKVA 4DJAA 4I17A 4FULA 3FUMA 3ZPJA 3FULA 3KSLA 2IOSA 2V0PA 2VYIA 2IO2C 3ISMC 4GPKA 4U63A 2KATA 3Q9NC 2WXQA 4I1OB 4XIFA 3CVVA 2P9SG 2YHCA 4OAVB 3CHMA 4U04A 5CRUA 3CHRA 4JD2G 4GA0A 5B1AE 2P9UG 3UIOC 2JABA 4JZYA 3I3NA 3ZYKA 5G05J 3BQOA 1E8ZA 4M7CA 3FTZA 2J07A 4NQ0A 3LVRE 1PY1A 3CK7A 5FZRA 4UWKA 2XHEA 2X3MA 5AQ7A 2ETAA 2WXOA 3CEQA 4U8VD 2MOWA 3FTUA 1IHGA 3C3RA 3MJWA 4FHJA 3C3QA 5EX3A 3G2WA 1FCHA 2AVPA 2E0IA 4UQZA 2MYOA 1ZU2A 4FA6A 1IQUA 5B3SE 3FUNA 1EF1C 4IRUA 2UY1B 4JC8A 4L23A 3TG5A 4GYWA 4I2WA 5ITZF 5A7DB 5AYWD 1LF8A 1AP7A 3T8KA 2KCLA 2VSNA 4I6JA 1SW6A 3AS8A 4A55A 3UMVA 2WVIA 2WXMA 4NURA 2KXPC 3UI2A 1DCQA 4ILGA 3DSUA 3Q15A 2VGXA 1TEZA 1E8WA 3BG0B 3Q5MA 5G55A 3TXMA 3NBNB 5G04J 4AJWA 3JXIA 3CIAA 3QWWA 4DRXE 3D9MA 1HF8A 3RRUA 2LSVA 4UI9C 4YDOA 4J0UA 5ENSD 2CHXA 5JJTA 2XCCA 4BT9A 4GMRA 5BT1A 3B7RL 2AXVA 3TG4A 2LO6A 1FPPA 4HRNA 2UY1A 1JCRA 4AY6A 2DBAA 2P58C 3UM0A 2X38A 1K3ZD 3AG2E 3CHSA 3GZ2A 3MYVA 4GCOA 3DRAA 2QY7A 3FUJA 4DLQA 1MJ0A 1TYQG 3FH8A 2RD0A 5EDSA 1D9SA 4GZ3A 3SZ7A 4J6IA 4MBGA 1KT0A 4JB8P 2CG3A 1IQRA 1U2VG 3LY8A 3SI5A 3L82A 3EIQC 4N5CA 4BFRA 2DVWA 2AW6A 3MV2B 4B89A 3NAWA 3QKYA 1V54E 1MX4A 1BPOA 2JEKA 3S7BA 1HH8A 4N3BA 2HO1A 4HVBA 3FEXA 4NRHB 2I1JA 4AOFA 5EIDA 2F8XK 4GB9A 4ACKA 3HHMA 1HG2A 4DI4A 4LRZA 3UQ3A 3Q73A 4OYSA 5CCLA 4LCTA 4WWNA 2QYJA 1O1SA 3L9TA 1LD8A 2F8YA 4G8LA 2J09A 3S7JA 2CHZA 4HOTA 4HQDA 1U3CA 3EHQA 4KMOA 1G3NB 3FTWA 3E30A 3CVPA 1KT1A 2LUHA 2IO3C 3KEAA 3NQPA 2OOEA 4K03A 2F37A 2ZISA 5EN5D 1YCSB 3ZRHA 4O1OA 3TL5A 5DBKA 3LY9A 3KAEA 1N0QA 4DLOA 3URZA 5ENOD 5ARFA 2X6KA 3P1UA 4GTOA 2R02A 3UM3A 2ZIRA 4GPMA 4JHKA 4GU5A 4LG6A 4UWHA 3NOCD 2WXGA 2PQRA 3IV0A 1ZBPA 1Z3YA 1OWNA 3C72A 4F53A 2OVBA 3NOGD 4HRMB 2NYJA 4IN3B 3AAAC 3L17A 1Z5SC 2F0YA 3EUVA 2VGYA 3R9AB 3MX3A 1HZ4A 2J49A 3EHRA 4I1AA 1TN6A 4HOSA 2XRYA 2WXPA 2IU1A 3LKUA 1RW2A 4GMJA 4UI9J 4XZ4A 4F3VA 2L0TB 2P9KG 1XNFA 4L9PA 2VGEA 4GTMA 4F1SA 3S2AA 3L08A 3VLFA 4F1PA 3AJIA 3JCKC 3V2OA 2WXRA 3G2SA 3FU6A 4EBAA 3U64A 1OCZE 2DZOA 3Q9UC 3VLDA 3E34A 2GRMA 4TRQA 4G25A 2PQNA 3SY2A 4FHKA 1OUVA 5BXOA 4CRWA 4K5CA 1EDUA 5FWQA 3GZ1A 4A3VA 4UQYA 2BKKB 1PAQA 3L6AA 3JQ1A 4FJYA 2FO7A 3OTNA 5CRVA 4YVOA 5JHBA 2EILE 3J5QB 4M3OA 1K1AA 1QNFA 2GRLA 1TJFA 5HKPA 2Y69E 3QDNA 3QJZA 2I1KA 3OXFA 4HLLA 1IKND 4BX9A 5HQ8A 3DEOA 4XI9A 2PM7A 2BTDA 3ML9A 4TV3A 2OEWA 3L13A 3O48A 1TNOA 1BU9A 4EHMA 5FTPA 3TWRA 4P29A 3HXFA 2X6IA 4XEIG 4KBQA 2WPVA 1S0PA 2EINE 1HE8A 3R7QA 3SBSA 3QWPA 3CQGB 4O6FA 5EIBE 5LX8A 4I6EA 2A5UA 5FINA 3ZYLA 2DWZA 3EHMA 1H6PA 2WXNA 1TR4A 2XEHA 3ZXSA 3ZXPA 1S70B 1NP7A 3UUXA 4BX8A 3LPZA 3D9LA 2PNNA 1WG0A 3FUHA 3HYMB 4ILIA 1RZ4A 5LCWC 3AG3E 2DYSE 5LFAA 3ESKA 1MX2A 2C0LA 3ML8A 2J4BA 2AJAA 3FTXA 5AN8A 3UKRG 2I6HA 4EQFA 4ZFHA 4DK5A 4NIKA 2RFAA 1WDYA 4FADA 3ZYQA 4H7XA 4XE0A 3T8MA 3ABKE 3DXKG 5G2NA 2WXKA
chains in the Genus database with same CATH topology
2BKGA 4J7WA 3D9HA 3TWRA 1AWCB 3W9FA 4GMRA 4F6RD 3V2XA 4J8YA 2QYJA 2F8YA 5AQ7A 3TWUA 3EU9A 5CEDB 4N5QA 4UUCA 4G8LA 5FIOA 2ETAA 3J5PA 5HS0A 4BESA 4U96D 2VGEA 3LJNA 4HRNA 5AAOA 4U8VD 4HQDA 5CECB 4CZ2D 5BXUA 1IHBA 1NFIE 4HNAD 3TWWA 3EHQA 4K5BA 3AJIA 4LSZE 4F1PA 1G3NB 3V2OA 3ZNGA 5CEAA 4OAUC 4BERA 2V5QC 2XZTG 1OY3D 2J8SD 3KEAA 4QFVA 2ZGDA 5KNGA 2DZOA 1K3ZD 3Q9UC 1A5EA 4HRLA 2F37A 5EIBE 5EN5D 5JA4D 3IXEA 1YCSB 3B7BA 3HRAA 2RFMA 2Y0BG 2B0OE 4ATZD 1N11A 1IXVA 2V4HC 5AQBA 4O1PA 1YYHA 2MYOA 4O1OA 5FINA 5CBOA 4Z68A 2DWZA 3B95A 4C48B 1QYMA 3T9KA 1N0QA 4DX6D 1K1BA 4O60A 1MJ0A 3TWSA 5BXOA 4K5CA 5ENOD 1MYOA 5JMND 1D9SA 2XZDG 3V79K 3W9GA 1N0RA 1TR4A 2BKKB 4LNUD 3DEPA 2XEEA 5EILA 3V30A 2XEHA 4ZHBA 3V31A 4U95D 4A63B 5KNHD 3SO8A 5CERB 2Y1LE 1S70B 2ETBA 5AQ9A 1DC2A 3TWQA 1UOHA 4JB8P 3UTMA 3TWTA 4GPMA 4HB5A 3J5QB 2ZGGA 4LG6A 1BI8B 1MX6A 4YDWA 2PNNA 1K1AA 5D66A 3NOCD 5HRYA 4DX2A 5ITZF 1WG0A 3JXJA 5AARA 5HKPA 2DVWA 3Q9NC 5AQAA 2ETCA 1AP7A 4DUIA 3T8KA 1MX2A 4OAVB 1SW6A 2A5EA 1MX4A 2AJAA 3ZKJA 4BEPA 4TUMA 3NOGD 2KXPC 4HRMB 5AN8A 3UI2A 4CYMD 4DX5D 2NYJA 4G8KA 4HLLA 1IKND 1DCQA 2DZNA 4U8YD 3ZU7B 5ENTD 5ENQD 3AAAC 3C5RA 1BI7B 4BETA 4ZFHA 1BD8A 4NIKA 2RFAA 5KBAA 4YDYA 5EYPF 3TWXA 4DX1A 4QQIA 2QC9A 3DEOA 3F6QA 2JABA 3NBNB 1BLXB 1WDYA 4DX7D 5KWDA 2FO1E 5ENPD 3UXGA 5CBNA 3TWVA 3JXIA 1SVXA 4BSZB 3EHRA 5ENRD 5EYLA 2KBXA 4HBDA 3ZUVB 4B93B 5EIDA 2L6BA 4DRXE 2F8XK 2P2CP 1YMPA 3JUEA 1OT8A 4K5AB 2XENA 3HG0D 4HI8A 4RLYA 1BU9A 2HE0A 5ENSD 4HI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKG A;  4J7W A;  3D9H A;  3TWR A;  1AWC B;  3W9F A;  4GMR A;  4F6R D;  3V2X A;  4J8Y A;  2QYJ A;  2F8Y A;  5AQ7 A;  3TWU A;  3EU9 A;  5CED B;  4N5Q A;  4UUC A;  4G8L A;  5FIO A;  2ETA A;  3J5P A;  5HS0 A;  4BES A;  4U96 D;  2VGE A;  3LJN A;  4HRN A;  5AAO A;  4U8V D;  4HQD A;  5CEC B;  4CZ2 D;  5BXU A;  1IHB A;  1NFI E;  4HNA D;  3TWW A;  3EHQ A;  4K5B A;  3AJI A;  4LSZ E;  4F1P A;  1G3N B;  3V2O A;  3ZNG A;  5CEA A;  4OAU C;  4BER A;  2V5Q C;  2XZT G;  1OY3 D;  2J8S D;  3KEA A;  4QFV A;  2ZGD A;  5KNG A;  2DZO A;  1K3Z D;  3Q9U C;  1A5E A;  4HRL A;  2F37 A;  5EIB E;  5EN5 D;  5JA4 D;  3IXE A;  1YCS B;  3B7B A;  3HRA A;  2RFM A;  2Y0B G;  2B0O E;  4ATZ D;  1N11 A;  1IXV A;  2V4H C;  5AQB A;  4O1P A;  1YYH A;  2MYO A;  4O1O A;  5FIN A;  5CBO A;  4Z68 A;  2DWZ A;  3B95 A;  4C48 B;  1QYM A;  3T9K A;  1N0Q A;  4DX6 D;  1K1B A;  4O60 A;  1MJ0 A;  3TWS A;  5BXO A;  4K5C A;  5ENO D;  1MYO A;  5JMN D;  1D9S A;  2XZD G;  3V79 K;  3W9G A;  1N0R A;  1TR4 A;  2BKK B;  4LNU D;  3DEP A;  2XEE A;  5EIL A;  3V30 A;  2XEH A;  4ZHB A;  3V31 A;  4U95 D;  4A63 B;  5KNH D;  3SO8 A;  5CER B;  2Y1L E;  1S70 B;  2ETB A;  5AQ9 A;  1DC2 A;  3TWQ A;  1UOH A;  4JB8 P;  3UTM A;  3TWT A;  4GPM A;  4HB5 A;  3J5Q B;  2ZGG A;  4LG6 A;  1BI8 B;  1MX6 A;  4YDW A;  2PNN A;  1K1A A;  5D66 A;  3NOC D;  5HRY A;  4DX2 A;  5ITZ F;  1WG0 A;  3JXJ A;  5AAR A;  5HKP A;  2DVW A;  3Q9N C;  5AQA A;  2ETC A;  1AP7 A;  4DUI A;  3T8K A;  1MX2 A;  4OAV B;  1SW6 A;  2A5E A;  1MX4 A;  2AJA A;  3ZKJ A;  4BEP A;  4TUM A;  3NOG D;  2KXP C;  4HRM B;  5AN8 A;  3UI2 A;  4CYM D;  4DX5 D;  2NYJ A;  4G8K A;  4HLL A;  1IKN D;  1DCQ A;  2DZN A;  4U8Y D;  3ZU7 B;  5ENT D;  5ENQ D;  3AAA C;  3C5R A;  1BI7 B;  4BET A;  4ZFH A;  1BD8 A;  4NIK A;  2RFA A;  5KBA A;  4YDY A;  5EYP F;  3TWX A;  4DX1 A;  4QQI A;  2QC9 A;  3DEO A;  3F6Q A;  2JAB A;  3NBN B;  1BLX B;  1WDY A;  4DX7 D;  5KWD A;  2FO1 E;  5ENP D;  3UXG A;  5CBN A;  3TWV A;  3JXI A;  1SVX A;  4BSZ B;  3EHR A;  5ENR D;  5EYL A;  2KBX A;  4HBD A;  3ZUV B;  4B93 B;  5EID A;  2L6B A;  4DRX E;  2F8X K;  2P2C P;  1YMP A;  3JUE A;  1OT8 A;  4K5A B;  2XEN A;  3HG0 D;  4HI8 A;  4RLY A;  1BU9 A;  2HE0 A;  5ENS D;  4HI9 A; 
#chains in the Genus database with same CATH topology
 4ILH B;  3V2X A;  3ZW3 A;  2KM4 A;  4X8Q A;  4CT0 A;  1O1T A;  2P9L G;  4LSZ E;  3C3O A;  3PZ2 A;  2HM8 A;  4L1B A;  3FUI A;  3LJ3 A;  4ACL A;  2QZA A;  5ENN A;  3OXL A;  4HOR A;  5T3R A;  1MZC A;  2VGX B;  2XZD G;  1W3B A;  1IYG A;  2BF0 X;  3ZN3 A;  3QAQ A;  4D10 C;  2V5F A;  5AQ9 A;  2GRP B;  1DC2 A;  2C2L A;  3UTM A;  3WXX A;  4GA1 A;  4BT8 A;  1H2U A;  1B89 A;  1HXI A;  2Y3A A;  4GTV A;  1S64 A;  1X5B A;  4GA2 A;  1WAO 1;  3MEK A;  3CHQ A;  5B1B E;  4APO A;  4FP7 A;  4TUM A;  3CKB A;  3FY4 A;  3ZU7 B;  1HG5 A;  3VLE A;  3MKR A;  4RG9 A;  4G11 A;  4XX5 A;  4BTB A;  2LAH A;  3UXG A;  3ZEF A;  5IY5 E;  4J8F A;  1FVF A;  3JUE A;  2GW1 A;  1EPU A;  1OT8 A;  4EZK A;  2J08 A;  4PH4 B;  3MKQ B;  3PUJ A;  4KYO B;  4FJZ A;  1ELK A;  2R2L A;  2XCB A;  1VDY A;  2KCK A;  4FLH A;  1OWL A;  4J8Y A;  3CVY A;  3IHV A;  4HOU A;  5E76 A;  1ELW A;  2Y4T A;  3AS5 A;  3J5P A;  3SGH A;  3D3M A;  5BNW A;  5BXU A;  1A17 A;  3B7S A;  3L22 A;  4L2L A;  5CEA A;  3HIZ A;  2EIM E;  3IHY A;  5KNG A;  3MA5 A;  3EIJ A;  3QAR A;  2HYZ A;  1D8E A;  4AM9 A;  4WUY A;  2RFM A;  4IUL A;  4O1P A;  1NA0 A;  2LSU A;  2VSX E;  4C48 B;  4B8C B;  3FTV A;  1N9A A;  4LUN U;  1H2V C;  3MGB A;  3Q47 B;  4KT6 B;  4E6H A;  3CK8 A;  4NAC A;  4JW1 A;  3TWT A;  5A6C A;  2BED A;  1INZ A;  2A4Z A;  3I4R B;  5D0Q D;  3S7D A;  4ANV A;  4A1G A;  3DPD A;  4UWF A;  3MKQ A;  4BWR A;  4EZJ A;  2P9N G;  3R7R A;  3VTY A;  3PRE A;  5LCW J;  4Y6C A;  2IFU A;  4YDE A;  3ULE G;  1H0A A;  4BEP A;  4RVB A;  4L7T A;  3QB2 A;  3MV3 B;  2MRI A;  3B7T A;  4N39 A;  3NB2 A;  3PE4 A;  1KZP A;  3CVQ A;  2FO1 E;  4UWG A;  3CSF A;  3R9M A;  5BV0 A;  4B8A A;  5LP0 A;  2QYU A;  3ZYM A;  1SZ9 A;  1NA3 A;  4HI9 A;  4APF A;  3PDN A;  2DCP A;  1OCC E;  4GAA A;  3E33 A;  2C0M A;  4G1T A;  4UUC A;  3C98 A;  4U0Z A;  4N2S A;  2M63 A;  3FUE A;  3D9N A;  4ME2 A;  3Q4A B;  3ZFW A;  4C0E A;  3ONK A;  1NFI E;  1EYH A;  3B13 A;  5T4Y A;  3ZNG A;  2P9I G;  1TNZ A;  4FLB A;  2BUG A;  4GTR A;  4BER A;  2AWI A;  3EU5 A;  2L6J A;  5JA4 D;  3HRA A;  5E75 A;  2XGM A;  4ATZ D;  4I43 A;  3UX4 A;  2WXF A;  3NF1 A;  1O5M A;  3CV0 A;  5KJN A;  3LS8 A;  2GRQ B;  4KVO A;  3SO8 A;  2Y1L E;  4C9B B;  3RO3 A;  4E85 A;  4MRU A;  4AEZ C;  1SA4 A;  4B94 A;  3ASF A;  4HLE A;  4JVS A;  3E4B A;  4EPZ A;  3FP3 A;  3DSW A;  1MHQ A;  4BSX A;  4CDN A;  4U8H A;  3UM1 A;  2R05 A;  1SQM A;  1H6O A;  4JEH A;  2I9C A;  3L16 A;  3TWX A;  4DX1 A;  1V55 E;  3ZGQ A;  5FZS A;  5D0O D;  2GGF A;  4JA9 A;  4FC8 A;  2L6B A;  2WXH A;  2AXU A;  4G26 A;  3BG1 B;  4GCN A;  1E96 B;  2R5S A;  2IEJ A;  2V8S E;  1E8Y A;  3LYA A;  1KZO A;  4WND A;  1OCR E;  2B6C A;  3TGO A;  3TWU A;  4Y6W A;  1MQS A;  3AU5 A;  3FUD A;  1N4Q A;  1U3D A;  1ELR A;  3KS2 A;  3ESL A;  2I2O A;  2XGO A;  5FQ4 A;  4CZ2 D;  1E7U A;  3UIP C;  4JPS A;  4ABN A;  3IKO B;  5C1D A;  1UG3 A;  3O4Z A;  1IXV A;  2LNI A;  2XPZ A;  2MHK A;  3FFL A;  5H7P A;  4I9C A;  3PS6 A;  4J8E A;  3UIN C;  1QQE A;  3V30 A;  1OWM A;  3V31 A;  2PZI A;  5KNH D;  1NI1 A;  3SNX A;  2WQH A;  5FT9 A;  1H6K A;  3IEG A;  5D66 A;  3GW4 A;  4DX2 A;  5G05 C;  1JWG A;  4U7E B;  4WWO A;  1N95 A;  3ULY A;  2PM6 A;  3SF4 A;  3ENE A;  2A5E A;  4OVU A;  3JQ0 A;  3APC A;  3BEE A;  3Q7F A;  2IQC A;  5AEN A;  3CVN A;  4UI9 K;  4CGW A;  4CGV A;  3NZU A;  3PEV B;  4HXI A;  3MCX A;  4CEM A;  3G2U A;  5ENR D;  3AU4 A;  4HBD A;  4K5A B;  2XEN A;  4EZL A;  1HFA A;  1AWC B;  3ONL A;  2XS8 A;  2DIW A;  3EU9 A;  5FQ6 A;  4MS6 A;  4JHJ A;  2LXM A;  5EX0 A;  2WM9 A;  2X6H A;  2XPY A;  2P9P G;  1JPL A;  3Q49 B;  2J4D A;  3T9K A;  4DPR A;  3UKU G;  2VSY A;  4RSY A;  2IF4 A;  5C2Y A;  4A63 B;  3SBT B;  4CT4 A;  3ABL E;  5G04 C;  3FU0 A;  5LOZ A;  5BUZ A;  5AAR A;  5JJ6 A;  4GZD A;  3UT7 A;  3UPV A;  5FQ7 A;  1DCE A;  3ASH A;  1UN9 A;  3FH7 A;  1OXJ A;  2YNQ A;  5A23 A;  3X2Q E;  1BI7 B;  3OXG A;  3F6Q A;  4DX7 D;  4CCA A;  4I2Z A;  3ASD A;  3GYZ A;  2UWJ G;  4HS2 A;  1GW6 A;  2H6H A;  4W9R A;  4RLY A;  4TUU A;  3RU0 A;  3D9P A;  4JL0 A;  2EIK E;  4WWP A;  1TNU A;  3CGH A;  1NZN A;  1KLX A;  3CQC B;  5FZQ A;  3Q75 A;  3FU5 A;  3QOU A;  5AAO A;  2Y4U A;  4AXH A;  2L9B A;  2WXI A;  2V5Q C;  3FH5 A;  1TNY A;  4XKB A;  1E8X A;  3DPY A;  3RO2 A;  3LEW A;  1OWP A;  2OCC E;  4GML A;  1HO8 A;  3Q78 A;  1YYH A;  1OCO E;  3QK0 A;  4MKT A;  5DIZ A;  5CBO A;  1LD7 A;  3B95 A;  3ULQ A;  4KVM A;  4GZ5 A;  3V79 K;  3DXM G;  4ATG A;  1K8K G;  2XEE A;  5EIL A;  3N71 A;  1QZ2 A;  1UN8 A;  4U95 D;  3CHP A;  4TXP A;  3RSE G;  2H6I A;  2H6G A;  1SA5 A;  3JXJ A;  2XGS A;  3HXE A;  3UM2 A;  3Q7A A;  3ASN E;  2EIJ E;  5HI7 A;  3AG1 E;  4TXR A;  4WNF A;  1N54 A;  4U0U A;  4CYM D;  1QBQ A;  5ENQ D;  4UWL A;  4RQI A;  5KBA A;  5JJ7 A;  5AIJ A;  4WNG A;  2OND A;  3APD A;  3PH0 C;  5ENP D;  2XPI A;  2XEV A;  2NC9 A;  5EYL A;  1E90 A;  3ZUV B;  4DI3 A;  2VTB B;  4G24 A;  3CLJ A;  2FBN A;  4LNG A;  3KEZ A;  2HE0 A;  3ZHE B;  5KJL A;  5AJL A;  4J7W A;  4AVX A;  4KZC A;  4U0S A;  1O1R A;  1TN8 A;  4KXK B;  3D9J A;  1P5Q A;  5BV1 A;  1Z6T A;  3FEY A;  3S7F A;  5T8I A;  5J08 A;  4G23 A;  3DST A;  2ILR A;  1IHB A;  4HNA D;  5KJM A;  4UQX A;  4XKC A;  3TJP A;  2LXL A;  2XZT G;  3OAW A;  3EJN A;  4JXT A;  3U4T A;  1N11 A;  3CST A;  4Z68 A;  5CCM A;  1UJJ A;  2IOL A;  2VJ8 A;  4DX6 D;  2EQX A;  4LER A;  5JMN D;  4GYY A;  3DEP A;  3Q79 A;  4ZHB A;  2PL2 A;  2YQ8 A;  2AXZ A;  4L2Y A;  4A1S A;  3LXU X;  2H6F A;  3RRN B;  4MLP A;  4K0R A;  3AS4 A;  5HRY A;  3UT4 A;  1ZB1 A;  2R59 A;  2KCV A;  2VTB A;  1Y6I A;  4N3A A;  5ARG A;  4DUI A;  3ZHE A;  4JA7 A;  4A3T A;  3GZS A;  4ANX A;  3U3W A;  1KPS B;  3DSX A;  3ZKJ A;  1TNB A;  4EEC A;  2L0I A;  4G8K A;  4AIF A;  2DZN A;  3E32 A;  3C5R A;  4BET A;  2QC9 A;  3U9W A;  1WY6 A;  1N4R A;  1SVX A;  1YMP A;  4F7A A;  3UT8 A;  3CVW A;  1Z3X A;  3RRM B;  5AJD A;  2XRZ A;  4KZ0 A;  3D9O A;  2BKG A;  4HFG A;  1DVP A;  4GTQ A;  2IY0 C;  2WMO A;  3PNT B;  1FVH A;  3SQV A;  4K5B A;  2KC7 A;  4N3C A;  1E7V A;  4QFV A;  4Q69 A;  4GZC A;  1A5E A;  3PVL A;  5BPP A;  4IYP A;  4LNB A;  1UJK A;  4PDX A;  2CFZ A;  1LTX A;  5EKQ D;  2RKK A;  2CFU A;  4FU3 A;  3CKC A;  4LNU D;  2ETB A;  4J8S A;  2WXJ A;  4WAF A;  1UOH A;  2VQ2 A;  4J8D A;  4JEU A;  4GTS A;  4WNE A;  2WB2 A;  1N94 A;  2E2E A;  4BY6 A;  1NL4 A;  2QFC A;  1XGW A;  2ETC A;  1TN7 A;  2OV8 A;  5FJY A;  3RK6 A;  2ZU6 B;  3D9K A;  2ZXW E;  2X6J A;  3FU3 A;  3LDZ A;  4DX5 D;  2OVF A;  2FUL A;  4YDY A;  3P2B A;  4QQI A;  2XS1 A;  1D8D A;  1BLX B;  5KWD A;  3ASO E;  3EHN A;  4AY5 A;  4OVV A;  4BSZ B;  4AP2 A;  2FF4 A;  3DSS A;  3APF A;  3I5P A;  3HG0 D;  4HI8 A;  3FUF A;  3CVX A;  2HR2 A;  2FI7 A;  3W9F A;  3ASG A;  4TXQ A;  3SFZ A;  4G2V A;  3G2T A;  3PZ3 A;  5FIO A;  4BES A;  3PUK A;  1FT1 A;  1UW4 B;  3LJN A;  4BTA A;  3T5V A;  3RIB A;  4C0M A;  3FUK A;  1HX8 A;  3PNL B;  2R17 C;  2J8S D;  3SFX A;  2ZGD A;  2GRO B;  2GRN B;  1OWO A;  3QWV A;  5CMY A;  3EDT B;  4ANU A;  2NXP A;  3CR3 A;  3CVL A;  3W9G A;  3AG4 E;  2R03 A;  1N0R A;  2WQ6 A;  3LY7 A;  4JHR A;  3PZD A;  2YIN A;  3QNK A;  5JHA A;  1Q2Z A;  4HB5 A;  2ZGG A;  1BI8 B;  1MX6 A;  2V4L A;  4URK A;  2WMN A;  5J90 A;  3JYS A;  3L54 A;  1PC2 A;  2CG2 A;  3DBS A;  1L5J A;  2RG8 A;  3G2V A;  4U8Y D;  3E37 A;  5ENT D;  1H2T C;  1JWF A;  1BD8 A;  5EYP F;  4GYO A;  4AV7 A;  3CHO A;  1DNP A;  1HS6 A;  1N52 A;  3FHE A;  4Q94 A;  5M72 A;  1JCS A;  3DSV A;  3D9I A;  2GRR B;  4I6G A;  2P2C P;  3FWV A;  5KJK A;  3TXN A;  2WQ7 A;  1WM5 A;  4Q96 A;  5ANL A;  4GZ6 A;  3DWL G;  3KSQ A;  2CHW A;  1JCQ A;  4YND A;  4PUC A;  3IBE A;  3KD7 A;  3TAX A;  5CEC B;  3ABM E;  4PS7 A;  5ANR A;  3TWW A;  2WXL A;  1SZA A;  4OAU C;  2IJG X;  2YHE A;  2Q7F A;  4HRL A;  5D2M C;  5FQ8 A;  2FEZ A;  2XQ0 A;  3B7B A;  2Y0B G;  4I1M A;  5AQB A;  3RAU A;  4GTT A;  2ION A;  3HXC A;  4GTP A;  1QYM A;  4LEU A;  4U07 A;  3PZ1 A;  1JUQ A;  3HVE B;  5CER B;  3TWQ A;  3HXD A;  1HU3 A;  4YDW A;  3BUA A;  4YVQ C;  3NZS A;  4RG6 A;  5AQA A;  4PS3 A;  4HOQ A;  4I9E A;  1YA0 A;  2KZT B;  2VSO E;  3RJV A;  4V3I A;  3HDX A;  2DYR E;  3U66 A;  5KCM A;  3SD5 A;  4CDM A;  4R7L A;  5CBN A;  3TWV A;  4EBA G;  3LCA A;  2KBX A;  4B93 B;  3PE3 A;  5CHE E;  2NSZ A;  2JLB A;  4CDR A;  3QC1 A;  3CK9 A;  3T5X A;  3SFY A;  3WG7 E;  3D9H A;  4F6R D;  1Y8M A;  3FTY A;  3LVQ E;  3JUI A;  4H7Y A;  1X81 A;  2OEV A;  2X6F A;  4ANW A;  5CED B;  4N5Q A;  1TJC A;  4N2Q A;  5HS0 A;  3HVE A;  4U96 D;  1N4S A;  3PEU B;  4XI0 A;  3I4G A;  3BU8 A;  5CMW A;  2J9Q A;  1FT2 A;  1OY3 D;  1N4P A;  3HXB A;  1H19 A;  3K9I A;  4PS8 A;  3PZ4 A;  3B7U X;  3IXE A;  3FTS A;  1S63 A;  2B0O E;  2LAI A;  2V4H C;  3FDH A;  5BW8 C;  3CVU A;  3ZIM A;  3MZL B;  3VTX A;  3SHF A;  1K1B A;  4O60 A;  3TWS A;  3ZVV A;  2KZT A;  1MYO A;  4B0Z A;  3PRZ A;  3RKV A;  4DJA A;  4I17 A;  4FUL A;  3FUM A;  3ZPJ A;  3FUL A;  3KSL A;  2IOS A;  2V0P A;  2VYI A;  2IO2 C;  3ISM C;  4GPK A;  4U63 A;  2KAT A;  3Q9N C;  2WXQ A;  4I1O B;  4XIF A;  3CVV A;  2P9S G;  2YHC A;  4OAV B;  3CHM A;  4U04 A;  5CRU A;  3CHR A;  4JD2 G;  4GA0 A;  5B1A E;  2P9U G;  3UIO C;  2JAB A;  4JZY A;  3I3N A;  3ZYK A;  5G05 J;  3BQO A;  1E8Z A;  4M7C A;  3FTZ A;  2J07 A;  4NQ0 A;  3LVR E;  1PY1 A;  3CK7 A;  5FZR A;  4UWK A;  2XHE A;  2X3M A;  5AQ7 A;  2ETA A;  2WXO A;  3CEQ A;  4U8V D;  2MOW A;  3FTU A;  1IHG A;  3C3R A;  3MJW A;  4FHJ A;  3C3Q A;  5EX3 A;  3G2W A;  1FCH A;  2AVP A;  2E0I A;  4UQZ A;  2MYO A;  1ZU2 A;  4FA6 A;  1IQU A;  5B3S E;  3FUN A;  1EF1 C;  4IRU A;  2UY1 B;  4JC8 A;  4L23 A;  3TG5 A;  4GYW A;  4I2W A;  5ITZ F;  5A7D B;  5AYW D;  1LF8 A;  1AP7 A;  3T8K A;  2KCL A;  2VSN A;  4I6J A;  1SW6 A;  3AS8 A;  4A55 A;  3UMV A;  2WVI A;  2WXM A;  4NUR A;  2KXP C;  3UI2 A;  1DCQ A;  4ILG A;  3DSU A;  3Q15 A;  2VGX A;  1TEZ A;  1E8W A;  3BG0 B;  3Q5M A;  5G55 A;  3TXM A;  3NBN B;  5G04 J;  4AJW A;  3JXI A;  3CIA A;  3QWW A;  4DRX E;  3D9M A;  1HF8 A;  3RRU A;  2LSV A;  4UI9 C;  4YDO A;  4J0U A;  5ENS D;  2CHX A;  5JJT A;  2XCC A;  4BT9 A;  4GMR A;  5BT1 A;  3B7R L;  2AXV A;  3TG4 A;  2LO6 A;  1FPP A;  4HRN A;  2UY1 A;  1JCR A;  4AY6 A;  2DBA A;  2P58 C;  3UM0 A;  2X38 A;  1K3Z D;  3AG2 E;  3CHS A;  3GZ2 A;  3MYV A;  4GCO A;  3DRA A;  2QY7 A;  3FUJ A;  4DLQ A;  1MJ0 A;  1TYQ G;  3FH8 A;  2RD0 A;  5EDS A;  1D9S A;  4GZ3 A;  3SZ7 A;  4J6I A;  4MBG A;  1KT0 A;  4JB8 P;  2CG3 A;  1IQR A;  1U2V G;  3LY8 A;  3SI5 A;  3L82 A;  3EIQ C;  4N5C A;  4BFR A;  2DVW A;  2AW6 A;  3MV2 B;  4B89 A;  3NAW A;  3QKY A;  1V54 E;  1MX4 A;  1BPO A;  2JEK A;  3S7B A;  1HH8 A;  4N3B A;  2HO1 A;  4HVB A;  3FEX A;  4NRH B;  2I1J A;  4AOF A;  5EID A;  2F8X K;  4GB9 A;  4ACK A;  3HHM A;  1HG2 A;  4DI4 A;  4LRZ A;  3UQ3 A;  3Q73 A;  4OYS A;  5CCL A;  4LCT A;  4WWN A;  2QYJ A;  1O1S A;  3L9T A;  1LD8 A;  2F8Y A;  4G8L A;  2J09 A;  3S7J A;  2CHZ A;  4HOT A;  4HQD A;  1U3C A;  3EHQ A;  4KMO A;  1G3N B;  3FTW A;  3E30 A;  3CVP A;  1KT1 A;  2LUH A;  2IO3 C;  3KEA A;  3NQP A;  2OOE A;  4K03 A;  2F37 A;  2ZIS A;  5EN5 D;  1YCS B;  3ZRH A;  4O1O A;  3TL5 A;  5DBK A;  3LY9 A;  3KAE A;  1N0Q A;  4DLO A;  3URZ A;  5ENO D;  5ARF A;  2X6K A;  3P1U A;  4GTO A;  2R02 A;  3UM3 A;  2ZIR A;  4GPM A;  4JHK A;  4GU5 A;  4LG6 A;  4UWH A;  3NOC D;  2WXG A;  2PQR A;  3IV0 A;  1ZBP A;  1Z3Y A;  1OWN A;  3C72 A;  4F53 A;  2OVB A;  3NOG D;  4HRM B;  2NYJ A;  4IN3 B;  3AAA C;  3L17 A;  1Z5S C;  2F0Y A;  3EUV A;  2VGY A;  3R9A B;  3MX3 A;  1HZ4 A;  2J49 A;  3EHR A;  4I1A A;  1TN6 A;  4HOS A;  2XRY A;  2WXP A;  2IU1 A;  3LKU A;  1RW2 A;  4GMJ A;  4UI9 J;  4XZ4 A;  4F3V A;  2L0T B;  2P9K G;  1XNF A;  4L9P A;  2VGE A;  4GTM A;  4F1S A;  3S2A A;  3L08 A;  3VLF A;  4F1P A;  3AJI A;  3JCK C;  3V2O A;  2WXR A;  3G2S A;  3FU6 A;  4EBA A;  3U64 A;  1OCZ E;  2DZO A;  3Q9U C;  3VLD A;  3E34 A;  2GRM A;  4TRQ A;  4G25 A;  2PQN A;  3SY2 A;  4FHK A;  1OUV A;  5BXO A;  4CRW A;  4K5C A;  1EDU A;  5FWQ A;  3GZ1 A;  4A3V A;  4UQY A;  2BKK B;  1PAQ A;  3L6A A;  3JQ1 A;  4FJY A;  2FO7 A;  3OTN A;  5CRV A;  4YVO A;  5JHB A;  2EIL E;  3J5Q B;  4M3O A;  1K1A A;  1QNF A;  2GRL A;  1TJF A;  5HKP A;  2Y69 E;  3QDN A;  3QJZ A;  2I1K A;  3OXF A;  4HLL A;  1IKN D;  4BX9 A;  5HQ8 A;  3DEO A;  4XI9 A;  2PM7 A;  2BTD A;  3ML9 A;  4TV3 A;  2OEW A;  3L13 A;  3O48 A;  1TNO A;  1BU9 A;  4EHM A;  5FTP A;  3TWR A;  4P29 A;  3HXF A;  2X6I A;  4XEI G;  4KBQ A;  2WPV A;  1S0P A;  2EIN E;  1HE8 A;  3R7Q A;  3SBS A;  3QWP A;  3CQG B;  4O6F A;  5EIB E;  5LX8 A;  4I6E A;  2A5U A;  5FIN A;  3ZYL A;  2DWZ A;  3EHM A;  1H6P A;  2WXN A;  1TR4 A;  2XEH A;  3ZXS A;  3ZXP A;  1S70 B;  1NP7 A;  3UUX A;  4BX8 A;  3LPZ A;  3D9L A;  2PNN A;  1WG0 A;  3FUH A;  3HYM B;  4ILI A;  1RZ4 A;  5LCW C;  3AG3 E;  2DYS E;  5LFA A;  3ESK A;  1MX2 A;  2C0L A;  3ML8 A;  2J4B A;  2AJA A;  3FTX A;  5AN8 A;  3UKR G;  2I6H A;  4EQF A;  4ZFH A;  4DK5 A;  4NIK A;  2RFA A;  1WDY A;  4FAD A;  3ZYQ A;  4H7X A;  4XE0 A;  3T8M A;  3ABK E;  3DXK G;  5G2N A;  2WXK A; 
#chains in the Genus database with same CATH homology
 2BKG A;  4J7W A;  3D9H A;  3TWR A;  1AWC B;  3W9F A;  4GMR A;  4F6R D;  3V2X A;  4J8Y A;  2QYJ A;  2F8Y A;  5AQ7 A;  3TWU A;  3EU9 A;  5CED B;  4N5Q A;  4UUC A;  4G8L A;  5FIO A;  2ETA A;  3J5P A;  5HS0 A;  4BES A;  4U96 D;  2VGE A;  3LJN A;  4HRN A;  5AAO A;  4U8V D;  4HQD A;  5CEC B;  4CZ2 D;  5BXU A;  1IHB A;  1NFI E;  4HNA D;  3TWW A;  3EHQ A;  4K5B A;  3AJI A;  4LSZ E;  4F1P A;  1G3N B;  3V2O A;  3ZNG A;  5CEA A;  4OAU C;  4BER A;  2V5Q C;  2XZT G;  1OY3 D;  2J8S D;  3KEA A;  4QFV A;  2ZGD A;  5KNG A;  2DZO A;  1K3Z D;  3Q9U C;  1A5E A;  4HRL A;  2F37 A;  5EIB E;  5EN5 D;  5JA4 D;  3IXE A;  1YCS B;  3B7B A;  3HRA A;  2RFM A;  2Y0B G;  2B0O E;  4ATZ D;  1N11 A;  1IXV A;  2V4H C;  5AQB A;  4O1P A;  1YYH A;  2MYO A;  4O1O A;  5FIN A;  5CBO A;  4Z68 A;  2DWZ A;  3B95 A;  4C48 B;  1QYM A;  3T9K A;  1N0Q A;  4DX6 D;  1K1B A;  4O60 A;  1MJ0 A;  3TWS A;  5BXO A;  4K5C A;  5ENO D;  1MYO A;  5JMN D;  1D9S A;  2XZD G;  3V79 K;  3W9G A;  1N0R A;  1TR4 A;  2BKK B;  4LNU D;  3DEP A;  2XEE A;  5EIL A;  3V30 A;  2XEH A;  4ZHB A;  3V31 A;  4U95 D;  4A63 B;  5KNH D;  3SO8 A;  5CER B;  2Y1L E;  1S70 B;  2ETB A;  5AQ9 A;  1DC2 A;  3TWQ A;  1UOH A;  4JB8 P;  3UTM A;  3TWT A;  4GPM A;  4HB5 A;  3J5Q B;  2ZGG A;  4LG6 A;  1BI8 B;  1MX6 A;  4YDW A;  2PNN A;  1K1A A;  5D66 A;  3NOC D;  5HRY A;  4DX2 A;  5ITZ F;  1WG0 A;  3JXJ A;  5AAR A;  5HKP A;  2DVW A;  3Q9N C;  5AQA A;  2ETC A;  1AP7 A;  4DUI A;  3T8K A;  1MX2 A;  4OAV B;  1SW6 A;  2A5E A;  1MX4 A;  2AJA A;  3ZKJ A;  4BEP A;  4TUM A;  3NOG D;  2KXP C;  4HRM B;  5AN8 A;  3UI2 A;  4CYM D;  4DX5 D;  2NYJ A;  4G8K A;  4HLL A;  1IKN D;  1DCQ A;  2DZN A;  4U8Y D;  3ZU7 B;  5ENT D;  5ENQ D;  3AAA C;  3C5R A;  1BI7 B;  4BET A;  4ZFH A;  1BD8 A;  4NIK A;  2RFA A;  5KBA A;  4YDY A;  5EYP F;  3TWX A;  4DX1 A;  4QQI A;  2QC9 A;  3DEO A;  3F6Q A;  2JAB A;  3NBN B;  1BLX B;  1WDY A;  4DX7 D;  5KWD A;  2FO1 E;  5ENP D;  3UXG A;  5CBN A;  3TWV A;  3JXI A;  1SVX A;  4BSZ B;  3EHR A;  5ENR D;  5EYL A;  2KBX A;  4HBD A;  3ZUV B;  4B93 B;  5EID A;  2L6B A;  4DRX E;  2F8X K;  2P2C P;  1YMP A;  3JUE A;  1OT8 A;  4K5A B;  2XEN A;  3HG0 D;  4HI8 A;  4RLY A;  1BU9 A;  2HE0 A;  5ENS D;  4HI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...