5BXUA

Human tankyrase-2 in complex with macrocyclised extended peptide cp4n4m5
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
163
structure length
163
Chain Sequence
GSGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tankyrase-2
publication title Human Tankyrase-2 in Complex with Extended Stapled Peptide sp4n4m5
rcsb
source organism Homo sapiens
total genus 50
structure length 163
sequence length 163
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2015-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
A PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5bxuA00
2XENA 3JXJA 4BEPA 2ZGDA 4BESA 3V79K 5EYPF 5D66A 5HRYA 5CBNA 3DEOA 1DC2A 5AAOA 1N11A 3AJIA 5ENSD 5EN5D 5ENOD 1N0QA 3EU9A 4J8YA 1DCQA 4K5CA 5CERB 4K5BA 1IKND 4O1PA 1OT8A 4QQIA 1SVXA 3TWVA 4F6RD 3HG0D 2JABA 4HB5A 3ZNGA 4DX1A 1YYHA 2ETAA 1QYMA 4DUIA 1BU9A 2F37A 1YMPA 2RFAA 4B93B 5AQAA 2MYOA 5AARA 3SO8A 4LSZE 5EILA 3NOGD 5ENPD 2Y0BG 3TWXA 4ATZD 5AN8A 1MJ0A 1K1AA 1NFIE 3C5RA 3F6QA 4O60A 5KWDA 5CEDB 3HRAA 1AWCB 4DX6D 3TWRA 5ENQD 3DEPA 2J8SD 1WDYA 3B7BA 3ZUVB 2BKGA 5KNHD 3EHRA 4A63B 2QYJA 1MX4A 3V2OA 1MX6A 2DVWA 3AAAC 5AQ7A 3ZKJA 4HRMB 3J5PA 2ETBA 5FIOA 3LJNA 4DX5D 2B0OE 3UTMA 5EIBE 1BD8A 1AP7A 5ITZF 4BERA 3V31A 4U96D 3TWWA 2XZDG 5ENTD 3T9KA 1S70B 5HS0A 2L6BA 1WG0A 3Q9UC 2A5EA 4U8YD 3TWUA 1BI7B 5CEAA 3NOCD 5HKPA 1IXVA 3B95A 3Q9NC 2DZOA 4HI8A 4N5QA 4NIKA 4BSZB 3EHQA 3ZU7B 4LNUD 4DRXE 1YCSB 4HBDA 2FO1E 4YDWA 5EYLA 2F8YA 3TWSA 4DX7D 2P2CP 4HQDA 5EIDA 3JUEA 3T8KA 3UXGA 5AQBA 2V4HC 4J7WA 5JMND 5JA4D 5CBOA 4HNAD 5KNGA 3TWQA 4F1PA 4O1OA 4UUCA 3IXEA 3UI2A 4HLLA 5FINA 2F8XK 4LG6A 4HRNA 2NYJA 2KBXA 2AJAA 4U8VD 4CYMD 5BXUA 4JB8P 2DZNA 3TWTA 3V2XA 4CZ2D 3NBNB 4BETA 3KEAA 1UOHA 4DX2A 2V5QC 2RFMA 4RLYA 3V30A 2XEHA 4HRLA 3D9HA 4YDYA 4G8KA 2PNNA 1G3NB 1K3ZD 1A5EA 4C48B 4GMRA 4G8LA 4U95D 5ENRD 5CECB 5AQ9A 2ZGGA 3JXIA 4OAVB 4K5AB 4ZFHA 1BI8B 4ZHBA 4QFVA 1SW6A 1BLXB 5KBAA 4Z68A 2KXPC 2ETCA 2VGEA 1OY3D 2BKKB 3J5QB 1K1BA 2XEEA 5BXOA 1IHBA 1TR4A 3W9FA 4HI9A 2XZTG 3W9GA 4GPMA 1MYOA 2HE0A 2DWZA 4OAUC 2Y1LE 1N0RA 4TUMA 1D9SA 1MX2A 2QC9A
chains in the Genus database with same CATH superfamily
3JXJA 4MKTA 2IF4A 1DC2A 1N11A 4DI3A 4N5CA 3UM2A 2Y3AA 3KSQA 4J8FA 2OOEA 3OAWA 5G04J 2KATA 4HOSA 3U3WA 5JHAA 5KCMA 1UG3A 3G2VA 3D9OA 4FLBA 1FCHA 1NZNA 3MGBA 2IQCA 1VDYA 4M3OA 5KNHD 5C2YA 1ELWA 3L22A 1HE8A 3X2QE 3T9KA 4CGVA 4G1TA 3Q9UC 2A5EA 2WXNA 1FVFA 1IXVA 3Q9NC 3KAEA 3I3NA 3PZ1A 1YCSB 2FO1E 4HQDA 4OYSA 3PZDA 2Q7FA 3QJZA 4WAFA 5KNGA 4E85A 3IXEA 4ILGA 4HRNA 2AJAA 2J9QA 4I17A 1OCOE 2XEHA 3D9HA 3FH5A 4CEMA 1P5QA 5CECB 1XNFA 4DI4A 3LY9A 2NC9A 5LX8A 3LXUX 3ABME 4LERA 4HXIA 3AU5A 3MKQA 1K1BA 4G23A 2NSZA 2I2OA 3W9GA 2J09A 3RAUA 3ONKA 1D9SA 2IFUA 4AM9A 4CT4A 3EIJA 2E2EA 3IHVA 4C9BB 3PUJA 3AS5A 1FT1A 4K5CA 1PAQA 1E8XA 3FUJA 4J6IA 1OCZE 4TUUA 1N4SA 2X3MA 2JABA 4HB5A 3D9PA 3HXBA 1Z5SC 3LVRE 4ILHB 4NACA 2GRPB 4J8EA 4L23A 1UN8A 1MX4A 3AAAC 5AQ7A 4LNBA 3FEYA 1TN7A 4DX5D 4FJZA 3E4BA 2OVBA 4I6GA 4U96D 4K03A 2XZDG 5D0OD 5HKPA 1KT0A 2DZOA 3ZU7B 2IY0C 3U64A 2P9SG 3T8KA 5AQBA 2WXQA 5CBOA 4BT9A 2HR2A 1LTXA 3HIZA 3UI2A 4EBAG 5CCLA 4APFA 3AG3E 5BW8C 2VSOE 2GRLA 4PH4B 4IN3B 4MRUA 3MA5A 4ZFHA 4QFVA 5KBAA 1SZAA 2V4LA 1IHGA 2PZIA 4FADA 2XZTG 2XPIA 3IBEA 3T5XA 4UQXA 2PM6A 4B8AA 4YVQC 5CBNA 4KVMA 2KCLA 4PS3A 4EZKA 3L82A 2L9BA 3L08A 1NA0A 4PS7A 3DWLG 5CMWA 1LD8A 4N2SA 3ISMC 2CFZA 3QB2A 3SFYA 3HXEA 3I4GA 4XKCA 3NOGD 3TG5A 2Y0BG 2GRQB 2ONDA 1JCSA 5ENQD 2DYRE 4Q69A 3OXGA 3FUEA 1TN6A 2R59A 4L2YA 5ITZF 2HO1A 3PREA 2IOLA 2NXPA 1HH8A 3GZSA 3ABKE 5EYLA 2LAIA 2P2CP 1V54E 3ZYMA 4J7WA 3RO3A 3ZRHA 2KBXA 2VJ8A 3NBNB 2V5QC 2RFMA 3O48A 4UI9J 4PDXA 4XIFA 2IU1A 3K9IA 2VGYA 1HO8A 4A3TA 3D9KA 4TRQA 1N54A 2VYIA 3CHRA 1SW6A 3D9JA 3AG4E 2EIKE 2BUGA 1Z3YA 3CK7A 2YINA 3G2TA 4JHJA 2HYZA 3QDNA 4LCTA 1MQSA 3RO2A 4UWLA 2OEVA 4F1SA 2XRYA 2GRRB 3ASFA 2PM7A 4I9EA 5EDSA 4L1BA 3QWWA 4Y6WA 4QQIA 2R05A 1QYMA 2H6HA 3VLEA 1K1AA 3C5RA 2P9IG 4ILIA 2YNQA 4BTBA 3EHRA 1HXIA 3L16A 2EINE 3FDHA 2LUHA 4BERA 2RG8A 3EHMA 1S70B 3HYMB 3Q78A 4NIKA 4I9CA 5LFAA 3MJWA 1RW2A 3TXMA 2CHZA 4YVOA 5EX0A 3MX3A 3CVPA 2KZTA 2X6HA 4TXRA 2WXOA 3ULEG 3HVEA 1H2UA 3E34A 3FU3A 1S63A 4GTQA 4F3VA 1JWGA 3LJ3A 1BI8B 2YQ8A 3UIOC 3JCKC 3FUMA 2BKKB 4GA1A 3PE3A 2A5UA 1IQRA 4XI9A 2KCKA 4EQFA 3L9TA 4WUYA 4AY6A 3LDZA 2AWIA 2YHCA 3TXNA 4BWRA 4WWPA 5ENOD 1OWNA 4ANVA 5CERB 3BUAA 3LYAA 2DBAA 4ANUA 1OCRE 4PUCA 3SBSA 4U8HA 5LOZA 5EILA 5LP0A 3ZIMA 4B8CB 5KWDA 1AWCB 2XEVA 3ULQA 4A63B 4CDRA 4FC8A 3AG1E 2WQ7A 3LJNA 2R17C 1N95A 5JHBA 1AP7A 3UM3A 3OTNA 3WG7E 4AP2A 4DJAA 3DBSA 5FZSA 2KM4A 4HOQA 3TJPA 4JL0A 4FA6A 3B7SA 5LCWC 4A1GA 2EIME 4DX7D 5AJDA 5BV1A 3R7QA 3FUFA 4R7LA 3E30A 2BF0X 3NF1A 4LG6A 3GZ1A 3TG4A 5G04C 2J49A 3HXFA 2H6IA 3ASGA 3Q49B 2PNNA 4AEZC 2WMNA 3IV0A 4FU3A 2C0LA 2GRNB 1DCEA 2ZGGA 2UY1A 5ARGA 4K5AB 2KZTB 2KXPC 3HVEB 4G11A 3SD5A 3DSUA 3UT4A 3CVUA 3KSLA 1ZU2A 2RKKA 5BV0A 3BG0B 1UW4B 1KZPA 1LD7A 4GPMA 3RRUA 3APDA 3CVQA 5T4YA 3NQPA 2JEKA 2QC9A 3RU0A 4BESA 5HRYA 2P9NG 2LSVA 1IQUA 3SBTB 4O1PA 3MEKA 1OT8A 1SVXA 1TJCA 3SGHA 3UQ3A 4EHMA 2EILE 2F37A 2P9UG 2MYOA 2PQRA 4LSZE 3FTXA 2XGSA 3ULYA 4B0ZA 2CHWA 5CEDB 1E8YA 3SZ7A 4I1MA 5EIBE 3Q7AA 3LS8A 4U8YD 2VGXB 1EPUA 3LEWA 3B7UX 4APOA 4LEUA 3I4RB 4O1OA 4WWOA 3C3RA 3SF4A 1IYGA 2L0IA 3GW4A 5FZQA 3FTSA 4GCOA 3T8MA 2PL2A 4G8LA 1ZB1A 1PC2A 3LY7A 5JJ6A 4A3VA 4I1OB 3C72A 3CVYA 4RSYA 2AW6A 1JCQA 4EZJA 2ETCA 2WXLA 3NZUA 4U04A 4B89A 4I6EA 2XPZA 4G2VA 5BUZA 3ZXSA 1IHBA 4MLPA 2DYSE 4UWKA 1S0PA 3U66A 5KJNA 2UY1B 4RG9A 1OXJA 4JVSA 1NP7A 4GAAA 1U3CA 4UWGA 1N4RA 4GZ3A 4F6RD 2CG3A 3C3OA 4H7YA 3QK0A 4XEIG 2FULA 4GTTA 4UQZA 1H6KA 1HZ4A 4U0SA 2ILRA 1N4PA 1Y6IA 4WNDA 2V8SE 3V2OA 3PEUB 4UWHA 2Y4UA 1HG5A 3LCAA 2IJGX 1BPOA 4TV3A 1TEZA 5A7DB 3B95A 5FQ8A 3ABLE 4LNUD 2Y4TA 3TWSA 4XE0A 3PZ4A 3EU5A 2ZISA 2OCCE 1EF1C 3TWQA 3FTZA 3FH8A 4ANXA 1QQEA 3Q73A 1ELKA 3UMVA 5G05J 4KVOA 5B1AE 3APCA 4NQ0A 2WXPA 1E7UA 3FEXA 4GCNA 4GTRA 2MOWA 3D9LA 4UWFA 3KD7A 3OXLA 4YDOA 2AXUA 2XS1A 2MRIA 3NAWA 3GZ2A 5AENA 3ZFWA 1X81A 4AVXA 3ASDA 5AAOA 4HFGA 2VSNA 5AYWD 1DCQA 2H6GA 2GW1A 4K5BA 5A6CA 3VLFA 3S7DA 4BTAA 4JW1A 1INZA 4JA7A 1H2VC 2VSXE 5M72A 5ENPD 5ANRA 4ATZD 5AN8A 4I43A 3SQVA 3D9NA 1N52A 3CV0A 1RZ4A 5KJKA 2GROB 3DEPA 3BU8A 4HORA 1OCCE 5A23A 3MKQB 3IEGA 4G25A 1ZBPA 3TWWA 4OVUA 4Q96A 4FHKA 4IYPA 3DXMG 3Q5MA 2WVIA 3KEZA 3ZXPA 4HI8A 2WXMA 3O4ZA 5EIDA 3FH7A 4HNAD 1MHQA 1OWPA 3QARA 3TWTA 4AIFA 4CZ2D 3EIQC 4C0EA 1TNOA 4P29A 2AXZA 4C48B 4CGWA 3R7RA 3E33A 3PZ3A 4JHRA 1OY3D 3SFZA 1HX8A 3CGHA 1W3BA 3DSXA 2WXRA 2WXHA 2XENA 4BEPA 1KPSB 1HS6A 3PNLB 3LKUA 2WB2A 4GPKA 4I2WA 2AVPA 3CKCA 5J90A 4HOUA 4AOFA 1YMPA 2FI7A 1WY6A 3RIBA 2X6JA 3CIAA 3N71A 2J8SD 3DRAA 4U0UA 4CCAA 3CVLA 4LUNU 4U0ZA 3ASOE 2OV8A 4N2QA 3CHQA 1H6OA 1BI7B 3MKRA 3NOCD 2PQNA 4N5QA 2EIJE 3E32A 4YDWA 3PRZA 2J08A 3FWVA 3ZVVA 2V4HC 5CMYA 3BQOA 1H19A 2C2LA 4Q94A 1H0AA 4A55A 4U8VD 4EZLA 3KEAA 1UOHA 4DX2A 4UQYA 3ZYLA 2R02A 4BY6A 3LVQE 4FLHA 4WNFA 5ENRD 3ML8A 2WQ6A 2P9KG 2I9CA 4BX9A 3CKBA 3TGOA 3RRNB 3PE4A 2J4DA 2XEEA 5BXOA 4U63A 2LSUA 1TJFA 3UT8A 1UN9A 1DVPA 4WNEA 3S7BA 4GA0A 4GZ5A 5D66A 2LNIA 5FT9A 3EU9A 4O6FA 2Y69E 2IOSA 3TWVA 4DX1A 1YYHA 3NB2A 3URZA 1O5MA 3UIPC 5E76A 3LY8A 2HM8A 3UT7A 5HQ8A 4YNDA 2I1KA 4DX6D 4CDMA 2WM9A 1E8ZA 2FEZA 3J5PA 2FF4A 2VTBA 2X6FA 3V31A 4OVVA 3ZHEA 1WG0A 3Q75A 3QAQA 4WWNA 5KJMA 1PY1A 4AJWA 3E37A 3ZN3A 1A17A 5AJLA 3JUEA 4HVBA 5B3SE 3CSFA 4FP7A 2KC7A 3CEQA 1NA3A 4GU5A 1O1SA 4NRHB 1KLXA 2VSYA 5BXUA 3V2XA 4IRUA 3AS4A 2I6HA 5FQ6A 3FHEA 2R03A 2DIWA 4KMOA 5FJYA 5IY5E 3CHOA 5T3RA 4U95D 4KXKB 2IO3C 4BX8A 3OXFA 3JXIA 3MYVA 3PVLA 1MZCA 2OVFA 3SI5A 3PUKA 5FQ7A 4L9PA 3T5VA 1SQMA 4OAUC 3ESLA 2BKGA 3Q4AB 3U4TA 1OWLA 1JWFA 1SA5A 4GTSA 2QYUA 5ENNA 2ETAA 1KZOA 3UM0A 3ASHA 4CT0A 5AARA 1L5JA 3ASNE 3FFLA 4U07A 2LO6A 3HRAA 4JZYA 3RSEG 4JEUA 3ZUVB 3FTVA 1LF8A 4PS8A 2WMOA 4BT8A 4ABNA 3UTMA 4ACKA 2ZIRA 5HS0A 1WM5A 4XZ4A 3QWPA 4GYWA 4BSZB 3DPYA 4GZ6A 4DRXE 3S2AA 4KBQA 3C98A 3QNKA 2ZXWE 2F0YA 4AV7A 4G26A 3SY2A 1QBQA 4G24A 3S7FA 5C1DA 3AG2E 3WXXA 4BETA 2P9LG 1Z6TA 5G2NA 4AY5A 5AQ9A 1D8EA 2XCBA 3RJVA 3CHMA 2UWJG 1O1RA 4ZHBA 3TL5A 3VTXA 3QOUA 3Q79A 4K0RA 4RVBA 2QZAA 4WNGA 2IEJA 3CSTA 1Z3XA 4I1AA 3MV2B 3CVVA 3Q7FA 3Q47B 4N3AA 3CK8A 4HI9A 3PH0C 1MYOA 2DWZA 4TUMA 2WXJA 3PEVB 4N3CA 3V79K 3ML9A 4RG6A 5ENSD 3D9IA 1N0QA 3FUNA 2I1JA 3JQ0A 1IKND 3P1UA 3UKRG 5CRUA 5G05C 2J07A 2RD0A 4XI0A 3D3MA 3FP3A 2FO7A 3F6QA 4C0MA 2WQHA 5EX3A 5E75A 3FULA 5HI7A 1WAO1 2LAHA 3DSWA 4A1SA 1NI1A 5ARFA 3QWVA 2VQ2A 3EDTB 1N4QA 3CVNA 4GMJA 4HBDA 2L6JA 1H2TC 2WXIA 3JUIA 3G2UA 4HLLA 5FINA 1UJKA 3DXKG 3BEEA 2DZNA 5DBKA 4JXTA 1B89A 4RLYA 2QY7A 1OUVA 3RKVA 4I6JA 5CCMA 1NL4A 3NZSA 2XCCA 3VTYA 3C3QA 4Z68A 1N9AA 3SFXA 4GTVA 2XGOA 3AS8A 3CK9A 2X6KA 3L13A 2MHKA 4V3IA 4JD2G 5AIJA 2KCVA 2WPVA 3L17A 1E90A 2IONA 4KT6B 1HG2A 3CQCB 1ELRA 3I5PA 1SA4A 4GB9A 3FUDA 4DUIA 4B93B 2OEWA 5AQAA 1TNYA 3MZLB 3FUHA 3EUVA 4AXHA 4EECA 1JPLA 2L0TB 2DCPA 3B7BA 3PNTB 3HXDA 5FZRA 3UINC 3FU5A 4EPZA 3TAXA 3ENEA 2L6BA 2B6CA 5CEAA 4UI9C 4TXQA 2P58C 3G2SA 3CR3A 3B13A 2M63A 3CVXA 4L2LA 4LRZA 3L54A 4MS6A 2V5FA 3SNXA 5ANLA 4GMLA 2F8XK 4X8QA 3L6AA 2NYJA 2CFUA 3PDNA 1JCRA 1HF8A 3V30A 4NURA 5T8IA 1HFAA 1G3NB 4KYOB 1HU3A 3MCXA 4GYYA 3UX4A 3IKOB 4CRWA 1EDUA 3DSSA 1OWMA 3ZYQA 3RRMB 5JJTA 4BFRA 1TR4A 4XKBA 2HE0A 4UI9K 2QFCA 4FHJA 3P2BA 1QNFA 3U9WA 1TYQG 2FBNA 1YA0A 4DPRA 3HG0D 1BU9A 3ZW3A 1XGWA 1DNPA 4J0UA 3DSTA 4F7AA 4E6HA 3TWRA 1V55E 1FVHA 4ME2A 1WDYA 1N94A 1SZ9A 3MV3B 1MX6A 4EBAA 5FIOA 3AU4A 5D2MC 3B7RL 2IO2C 4BSXA 2C0MA 1FT2A 3UUXA 3TWUA 1JUQA 4JPSA 2X6IA 4W9RA 4TXPA 4HLEA 2F8YA 4Y6CA 5JMND 4N3BA 4F1PA 3VLDA 1Q2ZA 3CVWA 3RK6A 1GW6A 4GTOA 4JB8P 2WXGA 2XPYA 5KJLA 1E8WA 3FY4A 3JQ1A 4YDYA 4HOTA 1TNZA 2ZU6B 1K3ZD 5EKQD 3CHSA 1Y8MA 5BPPA 5FQ4A 4D10C 3R9MA 4M7CA 2CG2A 3UPVA 1BLXB 3CHPA 3PS6A 2VGEA 1O1TA 2R5SA 5H7PA 5G55A 1E96B 2Y1LE 1N0RA 2XRZA 3J5QB 2ZGDA 4JC8A 3DEOA 4YDEA 3AJIA 4JA9A 3LPZA 5EN5D 4DLQA 3EJNA 4J8YA 1U2VG 5JJ7A 1UJJA 3S7JA 1H6PA 3ZNGA 5CRVA 2EQXA 3PZ2A 4DK5A 3SO8A 4GTPA 1NFIE 3G2WA 2QYJA 3ZKJA 4HRMB 1TNBA 2B0OE 1BD8A 5ENTD 1FPPA 2E0IA 3DSVA 5D0QD 5J08A 2XS8A 1TN8A 1X5BA 3FUKA 4JHKA 2A4ZA 1TNUA 3IHYA 4URKA 5JA4D 4XX5A 3FTUA 1U3DA 2WXKA 4J8SA 4GYOA 2JLBA 1QZ2A 2XGMA 4MBGA 4HRLA 3APFA 4ACLA 3FU6A 1A5EA 4B94A 4GMRA 5FTPA 4RQIA 4GZCA 3ESKA 4L7TA 2BEDA 4J8DA 4N39A 4F53A 4HS2A 4DLOA 3ZEFA 3CQGB 4IULA 2LXMA 3FTYA 3W9FA 4LNGA 4GA2A 5BNWA 1KT1A 2AXVA 2XQ0A 2BTDA 5EYPF 5B1BE 2VGXA 3ZGQA 3D9MA 3R9AB 1E7VA 3JYSA 3KS2A 2P9PG 2J4BA 3EHNA 5FWQA 3ONLA 3ZPJA 2RFAA 2YHEA 2V0PA 3TWXA 3HXCA 2XHEA 1MJ0A 4O60A 3BG1B 4I2ZA 1D8DA 2DVWA 3GYZA 3UM1A 3B7TA 2ETBA 4JEHA 2LXLA 3FUIA 3SHFA 4FJYA 3HDXA 4H7XA 3EHQA 5CHEE 3CLJA 2GGFA 1EYHA 3UXGA 5DIZA 2H6FA 4UUCA 3FTWA 4U7EB 5BT1A 4CYMD 2R2LA 3DPDA 4ATGA 4G8KA 3UKUG 2GRMA 2X38A 4FULA 4KZ0A 4KZCA 3ZYKA 4OAVB 2CHXA 3QC1A 3Q15A 4GZDA 2VTBB 4ANWA 1K8KG 3HHMA 1S64A 3ZHEB 4CDNA 1OWOA 3QKYA 3FU0A 4GTMA 1MX2A 5LCWJ 2WXFA
chains in the Genus database with same CATH topology
2XENA 3JXJA 4BEPA 2ZGDA 4BESA 3V79K 5EYPF 5D66A 5HRYA 5CBNA 3DEOA 1DC2A 5AAOA 1N11A 3AJIA 5ENSD 5EN5D 5ENOD 1N0QA 3EU9A 4J8YA 1DCQA 4K5CA 5CERB 4K5BA 1IKND 4O1PA 1OT8A 4QQIA 1SVXA 3TWVA 4F6RD 3HG0D 2JABA 4HB5A 3ZNGA 4DX1A 1YYHA 2ETAA 1QYMA 4DUIA 1BU9A 2F37A 1YMPA 2RFAA 4B93B 5AQAA 2MYOA 5AARA 3SO8A 4LSZE 5EILA 3NOGD 5ENPD 2Y0BG 3TWXA 4ATZD 5AN8A 1MJ0A 1K1AA 1NFIE 3C5RA 3F6QA 4O60A 5KWDA 5CEDB 3HRAA 1AWCB 4DX6D 3TWRA 5ENQD 3DEPA 2J8SD 1WDYA 3B7BA 3ZUVB 2BKGA 5KNHD 3EHRA 4A63B 2QYJA 1MX4A 3V2OA 1MX6A 2DVWA 3AAAC 5AQ7A 3ZKJA 4HRMB 3J5PA 2ETBA 5FIOA 3LJNA 4DX5D 2B0OE 3UTMA 5EIBE 1BD8A 1AP7A 5ITZF 4BERA 3V31A 4U96D 3TWWA 2XZDG 5ENTD 3T9KA 1S70B 5HS0A 2L6BA 1WG0A 3Q9UC 2A5EA 4U8YD 3TWUA 1BI7B 5CEAA 3NOCD 5HKPA 1IXVA 3B95A 3Q9NC 2DZOA 4HI8A 4N5QA 4NIKA 4BSZB 3EHQA 3ZU7B 4LNUD 4DRXE 1YCSB 4HBDA 2FO1E 4YDWA 5EYLA 2F8YA 3TWSA 4DX7D 2P2CP 4HQDA 5EIDA 3JUEA 3T8KA 3UXGA 5AQBA 2V4HC 4J7WA 5JMND 5JA4D 5CBOA 4HNAD 5KNGA 3TWQA 4F1PA 4O1OA 4UUCA 3IXEA 3UI2A 4HLLA 5FINA 2F8XK 4LG6A 4HRNA 2NYJA 2KBXA 2AJAA 4U8VD 4CYMD 5BXUA 4JB8P 2DZNA 3TWTA 3V2XA 4CZ2D 3NBNB 4BETA 3KEAA 1UOHA 4DX2A 2V5QC 2RFMA 4RLYA 3V30A 2XEHA 4HRLA 3D9HA 4YDYA 4G8KA 2PNNA 1G3NB 1K3ZD 1A5EA 4C48B 4GMRA 4G8LA 4U95D 5ENRD 5CECB 5AQ9A 2ZGGA 3JXIA 4OAVB 4K5AB 4ZFHA 1BI8B 4ZHBA 4QFVA 1SW6A 1BLXB 5KBAA 4Z68A 2KXPC 2ETCA 2VGEA 1OY3D 2BKKB 3J5QB 1K1BA 2XEEA 5BXOA 1IHBA 1TR4A 3W9FA 4HI9A 2XZTG 3W9GA 4GPMA 1MYOA 2HE0A 2DWZA 4OAUC 2Y1LE 1N0RA 4TUMA 1D9SA 1MX2A 2QC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEN A;  3JXJ A;  4BEP A;  2ZGD A;  4BES A;  3V79 K;  5EYP F;  5D66 A;  5HRY A;  5CBN A;  3DEO A;  1DC2 A;  5AAO A;  1N11 A;  3AJI A;  5ENS D;  5EN5 D;  5ENO D;  1N0Q A;  3EU9 A;  4J8Y A;  1DCQ A;  4K5C A;  5CER B;  4K5B A;  1IKN D;  4O1P A;  1OT8 A;  4QQI A;  1SVX A;  3TWV A;  4F6R D;  3HG0 D;  2JAB A;  4HB5 A;  3ZNG A;  4DX1 A;  1YYH A;  2ETA A;  1QYM A;  4DUI A;  1BU9 A;  2F37 A;  1YMP A;  2RFA A;  4B93 B;  5AQA A;  2MYO A;  5AAR A;  3SO8 A;  4LSZ E;  5EIL A;  3NOG D;  5ENP D;  2Y0B G;  3TWX A;  4ATZ D;  5AN8 A;  1MJ0 A;  1K1A A;  1NFI E;  3C5R A;  3F6Q A;  4O60 A;  5KWD A;  5CED B;  3HRA A;  1AWC B;  4DX6 D;  3TWR A;  5ENQ D;  3DEP A;  2J8S D;  1WDY A;  3B7B A;  3ZUV B;  2BKG A;  5KNH D;  3EHR A;  4A63 B;  2QYJ A;  1MX4 A;  3V2O A;  1MX6 A;  2DVW A;  3AAA C;  5AQ7 A;  3ZKJ A;  4HRM B;  3J5P A;  2ETB A;  5FIO A;  3LJN A;  4DX5 D;  2B0O E;  3UTM A;  5EIB E;  1BD8 A;  1AP7 A;  5ITZ F;  4BER A;  3V31 A;  4U96 D;  3TWW A;  2XZD G;  5ENT D;  3T9K A;  1S70 B;  5HS0 A;  2L6B A;  1WG0 A;  3Q9U C;  2A5E A;  4U8Y D;  3TWU A;  1BI7 B;  5CEA A;  3NOC D;  5HKP A;  1IXV A;  3B95 A;  3Q9N C;  2DZO A;  4HI8 A;  4N5Q A;  4NIK A;  4BSZ B;  3EHQ A;  3ZU7 B;  4LNU D;  4DRX E;  1YCS B;  4HBD A;  2FO1 E;  4YDW A;  5EYL A;  2F8Y A;  3TWS A;  4DX7 D;  2P2C P;  4HQD A;  5EID A;  3JUE A;  3T8K A;  3UXG A;  5AQB A;  2V4H C;  4J7W A;  5JMN D;  5JA4 D;  5CBO A;  4HNA D;  5KNG A;  3TWQ A;  4F1P A;  4O1O A;  4UUC A;  3IXE A;  3UI2 A;  4HLL A;  5FIN A;  2F8X K;  4LG6 A;  4HRN A;  2NYJ A;  2KBX A;  2AJA A;  4U8V D;  4CYM D;  5BXU A;  4JB8 P;  2DZN A;  3TWT A;  3V2X A;  4CZ2 D;  3NBN B;  4BET A;  3KEA A;  1UOH A;  4DX2 A;  2V5Q C;  2RFM A;  4RLY A;  3V30 A;  2XEH A;  4HRL A;  3D9H A;  4YDY A;  4G8K A;  2PNN A;  1G3N B;  1K3Z D;  1A5E A;  4C48 B;  4GMR A;  4G8L A;  4U95 D;  5ENR D;  5CEC B;  5AQ9 A;  2ZGG A;  3JXI A;  4OAV B;  4K5A B;  4ZFH A;  1BI8 B;  4ZHB A;  4QFV A;  1SW6 A;  1BLX B;  5KBA A;  4Z68 A;  2KXP C;  2ETC A;  2VGE A;  1OY3 D;  2BKK B;  3J5Q B;  1K1B A;  2XEE A;  5BXO A;  1IHB A;  1TR4 A;  3W9F A;  4HI9 A;  2XZT G;  3W9G A;  4GPM A;  1MYO A;  2HE0 A;  2DWZ A;  4OAU C;  2Y1L E;  1N0R A;  4TUM A;  1D9S A;  1MX2 A;  2QC9 A; 
#chains in the Genus database with same CATH topology
 3JXJ A;  4MKT A;  2IF4 A;  1DC2 A;  1N11 A;  4DI3 A;  4N5C A;  3UM2 A;  2Y3A A;  3KSQ A;  4J8F A;  2OOE A;  3OAW A;  5G04 J;  2KAT A;  4HOS A;  3U3W A;  5JHA A;  5KCM A;  1UG3 A;  3G2V A;  3D9O A;  4FLB A;  1FCH A;  1NZN A;  3MGB A;  2IQC A;  1VDY A;  4M3O A;  5KNH D;  5C2Y A;  1ELW A;  3L22 A;  1HE8 A;  3X2Q E;  3T9K A;  4CGV A;  4G1T A;  3Q9U C;  2A5E A;  2WXN A;  1FVF A;  1IXV A;  3Q9N C;  3KAE A;  3I3N A;  3PZ1 A;  1YCS B;  2FO1 E;  4HQD A;  4OYS A;  3PZD A;  2Q7F A;  3QJZ A;  4WAF A;  5KNG A;  4E85 A;  3IXE A;  4ILG A;  4HRN A;  2AJA A;  2J9Q A;  4I17 A;  1OCO E;  2XEH A;  3D9H A;  3FH5 A;  4CEM A;  1P5Q A;  5CEC B;  1XNF A;  4DI4 A;  3LY9 A;  2NC9 A;  5LX8 A;  3LXU X;  3ABM E;  4LER A;  4HXI A;  3AU5 A;  3MKQ A;  1K1B A;  4G23 A;  2NSZ A;  2I2O A;  3W9G A;  2J09 A;  3RAU A;  3ONK A;  1D9S A;  2IFU A;  4AM9 A;  4CT4 A;  3EIJ A;  2E2E A;  3IHV A;  4C9B B;  3PUJ A;  3AS5 A;  1FT1 A;  4K5C A;  1PAQ A;  1E8X A;  3FUJ A;  4J6I A;  1OCZ E;  4TUU A;  1N4S A;  2X3M A;  2JAB A;  4HB5 A;  3D9P A;  3HXB A;  1Z5S C;  3LVR E;  4ILH B;  4NAC A;  2GRP B;  4J8E A;  4L23 A;  1UN8 A;  1MX4 A;  3AAA C;  5AQ7 A;  4LNB A;  3FEY A;  1TN7 A;  4DX5 D;  4FJZ A;  3E4B A;  2OVB A;  4I6G A;  4U96 D;  4K03 A;  2XZD G;  5D0O D;  5HKP A;  1KT0 A;  2DZO A;  3ZU7 B;  2IY0 C;  3U64 A;  2P9S G;  3T8K A;  5AQB A;  2WXQ A;  5CBO A;  4BT9 A;  2HR2 A;  1LTX A;  3HIZ A;  3UI2 A;  4EBA G;  5CCL A;  4APF A;  3AG3 E;  5BW8 C;  2VSO E;  2GRL A;  4PH4 B;  4IN3 B;  4MRU A;  3MA5 A;  4ZFH A;  4QFV A;  5KBA A;  1SZA A;  2V4L A;  1IHG A;  2PZI A;  4FAD A;  2XZT G;  2XPI A;  3IBE A;  3T5X A;  4UQX A;  2PM6 A;  4B8A A;  4YVQ C;  5CBN A;  4KVM A;  2KCL A;  4PS3 A;  4EZK A;  3L82 A;  2L9B A;  3L08 A;  1NA0 A;  4PS7 A;  3DWL G;  5CMW A;  1LD8 A;  4N2S A;  3ISM C;  2CFZ A;  3QB2 A;  3SFY A;  3HXE A;  3I4G A;  4XKC A;  3NOG D;  3TG5 A;  2Y0B G;  2GRQ B;  2OND A;  1JCS A;  5ENQ D;  2DYR E;  4Q69 A;  3OXG A;  3FUE A;  1TN6 A;  2R59 A;  4L2Y A;  5ITZ F;  2HO1 A;  3PRE A;  2IOL A;  2NXP A;  1HH8 A;  3GZS A;  3ABK E;  5EYL A;  2LAI A;  2P2C P;  1V54 E;  3ZYM A;  4J7W A;  3RO3 A;  3ZRH A;  2KBX A;  2VJ8 A;  3NBN B;  2V5Q C;  2RFM A;  3O48 A;  4UI9 J;  4PDX A;  4XIF A;  2IU1 A;  3K9I A;  2VGY A;  1HO8 A;  4A3T A;  3D9K A;  4TRQ A;  1N54 A;  2VYI A;  3CHR A;  1SW6 A;  3D9J A;  3AG4 E;  2EIK E;  2BUG A;  1Z3Y A;  3CK7 A;  2YIN A;  3G2T A;  4JHJ A;  2HYZ A;  3QDN A;  4LCT A;  1MQS A;  3RO2 A;  4UWL A;  2OEV A;  4F1S A;  2XRY A;  2GRR B;  3ASF A;  2PM7 A;  4I9E A;  5EDS A;  4L1B A;  3QWW A;  4Y6W A;  4QQI A;  2R05 A;  1QYM A;  2H6H A;  3VLE A;  1K1A A;  3C5R A;  2P9I G;  4ILI A;  2YNQ A;  4BTB A;  3EHR A;  1HXI A;  3L16 A;  2EIN E;  3FDH A;  2LUH A;  4BER A;  2RG8 A;  3EHM A;  1S70 B;  3HYM B;  3Q78 A;  4NIK A;  4I9C A;  5LFA A;  3MJW A;  1RW2 A;  3TXM A;  2CHZ A;  4YVO A;  5EX0 A;  3MX3 A;  3CVP A;  2KZT A;  2X6H A;  4TXR A;  2WXO A;  3ULE G;  3HVE A;  1H2U A;  3E34 A;  3FU3 A;  1S63 A;  4GTQ A;  4F3V A;  1JWG A;  3LJ3 A;  1BI8 B;  2YQ8 A;  3UIO C;  3JCK C;  3FUM A;  2BKK B;  4GA1 A;  3PE3 A;  2A5U A;  1IQR A;  4XI9 A;  2KCK A;  4EQF A;  3L9T A;  4WUY A;  4AY6 A;  3LDZ A;  2AWI A;  2YHC A;  3TXN A;  4BWR A;  4WWP A;  5ENO D;  1OWN A;  4ANV A;  5CER B;  3BUA A;  3LYA A;  2DBA A;  4ANU A;  1OCR E;  4PUC A;  3SBS A;  4U8H A;  5LOZ A;  5EIL A;  5LP0 A;  3ZIM A;  4B8C B;  5KWD A;  1AWC B;  2XEV A;  3ULQ A;  4A63 B;  4CDR A;  4FC8 A;  3AG1 E;  2WQ7 A;  3LJN A;  2R17 C;  1N95 A;  5JHB A;  1AP7 A;  3UM3 A;  3OTN A;  3WG7 E;  4AP2 A;  4DJA A;  3DBS A;  5FZS A;  2KM4 A;  4HOQ A;  3TJP A;  4JL0 A;  4FA6 A;  3B7S A;  5LCW C;  4A1G A;  2EIM E;  4DX7 D;  5AJD A;  5BV1 A;  3R7Q A;  3FUF A;  4R7L A;  3E30 A;  2BF0 X;  3NF1 A;  4LG6 A;  3GZ1 A;  3TG4 A;  5G04 C;  2J49 A;  3HXF A;  2H6I A;  3ASG A;  3Q49 B;  2PNN A;  4AEZ C;  2WMN A;  3IV0 A;  4FU3 A;  2C0L A;  2GRN B;  1DCE A;  2ZGG A;  2UY1 A;  5ARG A;  4K5A B;  2KZT B;  2KXP C;  3HVE B;  4G11 A;  3SD5 A;  3DSU A;  3UT4 A;  3CVU A;  3KSL A;  1ZU2 A;  2RKK A;  5BV0 A;  3BG0 B;  1UW4 B;  1KZP A;  1LD7 A;  4GPM A;  3RRU A;  3APD A;  3CVQ A;  5T4Y A;  3NQP A;  2JEK A;  2QC9 A;  3RU0 A;  4BES A;  5HRY A;  2P9N G;  2LSV A;  1IQU A;  3SBT B;  4O1P A;  3MEK A;  1OT8 A;  1SVX A;  1TJC A;  3SGH A;  3UQ3 A;  4EHM A;  2EIL E;  2F37 A;  2P9U G;  2MYO A;  2PQR A;  4LSZ E;  3FTX A;  2XGS A;  3ULY A;  4B0Z A;  2CHW A;  5CED B;  1E8Y A;  3SZ7 A;  4I1M A;  5EIB E;  3Q7A A;  3LS8 A;  4U8Y D;  2VGX B;  1EPU A;  3LEW A;  3B7U X;  4APO A;  4LEU A;  3I4R B;  4O1O A;  4WWO A;  3C3R A;  3SF4 A;  1IYG A;  2L0I A;  3GW4 A;  5FZQ A;  3FTS A;  4GCO A;  3T8M A;  2PL2 A;  4G8L A;  1ZB1 A;  1PC2 A;  3LY7 A;  5JJ6 A;  4A3V A;  4I1O B;  3C72 A;  3CVY A;  4RSY A;  2AW6 A;  1JCQ A;  4EZJ A;  2ETC A;  2WXL A;  3NZU A;  4U04 A;  4B89 A;  4I6E A;  2XPZ A;  4G2V A;  5BUZ A;  3ZXS A;  1IHB A;  4MLP A;  2DYS E;  4UWK A;  1S0P A;  3U66 A;  5KJN A;  2UY1 B;  4RG9 A;  1OXJ A;  4JVS A;  1NP7 A;  4GAA A;  1U3C A;  4UWG A;  1N4R A;  4GZ3 A;  4F6R D;  2CG3 A;  3C3O A;  4H7Y A;  3QK0 A;  4XEI G;  2FUL A;  4GTT A;  4UQZ A;  1H6K A;  1HZ4 A;  4U0S A;  2ILR A;  1N4P A;  1Y6I A;  4WND A;  2V8S E;  3V2O A;  3PEU B;  4UWH A;  2Y4U A;  1HG5 A;  3LCA A;  2IJG X;  1BPO A;  4TV3 A;  1TEZ A;  5A7D B;  3B95 A;  5FQ8 A;  3ABL E;  4LNU D;  2Y4T A;  3TWS A;  4XE0 A;  3PZ4 A;  3EU5 A;  2ZIS A;  2OCC E;  1EF1 C;  3TWQ A;  3FTZ A;  3FH8 A;  4ANX A;  1QQE A;  3Q73 A;  1ELK A;  3UMV A;  5G05 J;  4KVO A;  5B1A E;  3APC A;  4NQ0 A;  2WXP A;  1E7U A;  3FEX A;  4GCN A;  4GTR A;  2MOW A;  3D9L A;  4UWF A;  3KD7 A;  3OXL A;  4YDO A;  2AXU A;  2XS1 A;  2MRI A;  3NAW A;  3GZ2 A;  5AEN A;  3ZFW A;  1X81 A;  4AVX A;  3ASD A;  5AAO A;  4HFG A;  2VSN A;  5AYW D;  1DCQ A;  2H6G A;  2GW1 A;  4K5B A;  5A6C A;  3VLF A;  3S7D A;  4BTA A;  4JW1 A;  1INZ A;  4JA7 A;  1H2V C;  2VSX E;  5M72 A;  5ENP D;  5ANR A;  4ATZ D;  5AN8 A;  4I43 A;  3SQV A;  3D9N A;  1N52 A;  3CV0 A;  1RZ4 A;  5KJK A;  2GRO B;  3DEP A;  3BU8 A;  4HOR A;  1OCC E;  5A23 A;  3MKQ B;  3IEG A;  4G25 A;  1ZBP A;  3TWW A;  4OVU A;  4Q96 A;  4FHK A;  4IYP A;  3DXM G;  3Q5M A;  2WVI A;  3KEZ A;  3ZXP A;  4HI8 A;  2WXM A;  3O4Z A;  5EID A;  3FH7 A;  4HNA D;  1MHQ A;  1OWP A;  3QAR A;  3TWT A;  4AIF A;  4CZ2 D;  3EIQ C;  4C0E A;  1TNO A;  4P29 A;  2AXZ A;  4C48 B;  4CGW A;  3R7R A;  3E33 A;  3PZ3 A;  4JHR A;  1OY3 D;  3SFZ A;  1HX8 A;  3CGH A;  1W3B A;  3DSX A;  2WXR A;  2WXH A;  2XEN A;  4BEP A;  1KPS B;  1HS6 A;  3PNL B;  3LKU A;  2WB2 A;  4GPK A;  4I2W A;  2AVP A;  3CKC A;  5J90 A;  4HOU A;  4AOF A;  1YMP A;  2FI7 A;  1WY6 A;  3RIB A;  2X6J A;  3CIA A;  3N71 A;  2J8S D;  3DRA A;  4U0U A;  4CCA A;  3CVL A;  4LUN U;  4U0Z A;  3ASO E;  2OV8 A;  4N2Q A;  3CHQ A;  1H6O A;  1BI7 B;  3MKR A;  3NOC D;  2PQN A;  4N5Q A;  2EIJ E;  3E32 A;  4YDW A;  3PRZ A;  2J08 A;  3FWV A;  3ZVV A;  2V4H C;  5CMY A;  3BQO A;  1H19 A;  2C2L A;  4Q94 A;  1H0A A;  4A55 A;  4U8V D;  4EZL A;  3KEA A;  1UOH A;  4DX2 A;  4UQY A;  3ZYL A;  2R02 A;  4BY6 A;  3LVQ E;  4FLH A;  4WNF A;  5ENR D;  3ML8 A;  2WQ6 A;  2P9K G;  2I9C A;  4BX9 A;  3CKB A;  3TGO A;  3RRN B;  3PE4 A;  2J4D A;  2XEE A;  5BXO A;  4U63 A;  2LSU A;  1TJF A;  3UT8 A;  1UN9 A;  1DVP A;  4WNE A;  3S7B A;  4GA0 A;  4GZ5 A;  5D66 A;  2LNI A;  5FT9 A;  3EU9 A;  4O6F A;  2Y69 E;  2IOS A;  3TWV A;  4DX1 A;  1YYH A;  3NB2 A;  3URZ A;  1O5M A;  3UIP C;  5E76 A;  3LY8 A;  2HM8 A;  3UT7 A;  5HQ8 A;  4YND A;  2I1K A;  4DX6 D;  4CDM A;  2WM9 A;  1E8Z A;  2FEZ A;  3J5P A;  2FF4 A;  2VTB A;  2X6F A;  3V31 A;  4OVV A;  3ZHE A;  1WG0 A;  3Q75 A;  3QAQ A;  4WWN A;  5KJM A;  1PY1 A;  4AJW A;  3E37 A;  3ZN3 A;  1A17 A;  5AJL A;  3JUE A;  4HVB A;  5B3S E;  3CSF A;  4FP7 A;  2KC7 A;  3CEQ A;  1NA3 A;  4GU5 A;  1O1S A;  4NRH B;  1KLX A;  2VSY A;  5BXU A;  3V2X A;  4IRU A;  3AS4 A;  2I6H A;  5FQ6 A;  3FHE A;  2R03 A;  2DIW A;  4KMO A;  5FJY A;  5IY5 E;  3CHO A;  5T3R A;  4U95 D;  4KXK B;  2IO3 C;  4BX8 A;  3OXF A;  3JXI A;  3MYV A;  3PVL A;  1MZC A;  2OVF A;  3SI5 A;  3PUK A;  5FQ7 A;  4L9P A;  3T5V A;  1SQM A;  4OAU C;  3ESL A;  2BKG A;  3Q4A B;  3U4T A;  1OWL A;  1JWF A;  1SA5 A;  4GTS A;  2QYU A;  5ENN A;  2ETA A;  1KZO A;  3UM0 A;  3ASH A;  4CT0 A;  5AAR A;  1L5J A;  3ASN E;  3FFL A;  4U07 A;  2LO6 A;  3HRA A;  4JZY A;  3RSE G;  4JEU A;  3ZUV B;  3FTV A;  1LF8 A;  4PS8 A;  2WMO A;  4BT8 A;  4ABN A;  3UTM A;  4ACK A;  2ZIR A;  5HS0 A;  1WM5 A;  4XZ4 A;  3QWP A;  4GYW A;  4BSZ B;  3DPY A;  4GZ6 A;  4DRX E;  3S2A A;  4KBQ A;  3C98 A;  3QNK A;  2ZXW E;  2F0Y A;  4AV7 A;  4G26 A;  3SY2 A;  1QBQ A;  4G24 A;  3S7F A;  5C1D A;  3AG2 E;  3WXX A;  4BET A;  2P9L G;  1Z6T A;  5G2N A;  4AY5 A;  5AQ9 A;  1D8E A;  2XCB A;  3RJV A;  3CHM A;  2UWJ G;  1O1R A;  4ZHB A;  3TL5 A;  3VTX A;  3QOU A;  3Q79 A;  4K0R A;  4RVB A;  2QZA A;  4WNG A;  2IEJ A;  3CST A;  1Z3X A;  4I1A A;  3MV2 B;  3CVV A;  3Q7F A;  3Q47 B;  4N3A A;  3CK8 A;  4HI9 A;  3PH0 C;  1MYO A;  2DWZ A;  4TUM A;  2WXJ A;  3PEV B;  4N3C A;  3V79 K;  3ML9 A;  4RG6 A;  5ENS D;  3D9I A;  1N0Q A;  3FUN A;  2I1J A;  3JQ0 A;  1IKN D;  3P1U A;  3UKR G;  5CRU A;  5G05 C;  2J07 A;  2RD0 A;  4XI0 A;  3D3M A;  3FP3 A;  2FO7 A;  3F6Q A;  4C0M A;  2WQH A;  5EX3 A;  5E75 A;  3FUL A;  5HI7 A;  1WAO 1;  2LAH A;  3DSW A;  4A1S A;  1NI1 A;  5ARF A;  3QWV A;  2VQ2 A;  3EDT B;  1N4Q A;  3CVN A;  4GMJ A;  4HBD A;  2L6J A;  1H2T C;  2WXI A;  3JUI A;  3G2U A;  4HLL A;  5FIN A;  1UJK A;  3DXK G;  3BEE A;  2DZN A;  5DBK A;  4JXT A;  1B89 A;  4RLY A;  2QY7 A;  1OUV A;  3RKV A;  4I6J A;  5CCM A;  1NL4 A;  3NZS A;  2XCC A;  3VTY A;  3C3Q A;  4Z68 A;  1N9A A;  3SFX A;  4GTV A;  2XGO A;  3AS8 A;  3CK9 A;  2X6K A;  3L13 A;  2MHK A;  4V3I A;  4JD2 G;  5AIJ A;  2KCV A;  2WPV A;  3L17 A;  1E90 A;  2ION A;  4KT6 B;  1HG2 A;  3CQC B;  1ELR A;  3I5P A;  1SA4 A;  4GB9 A;  3FUD A;  4DUI A;  4B93 B;  2OEW A;  5AQA A;  1TNY A;  3MZL B;  3FUH A;  3EUV A;  4AXH A;  4EEC A;  1JPL A;  2L0T B;  2DCP A;  3B7B A;  3PNT B;  3HXD A;  5FZR A;  3UIN C;  3FU5 A;  4EPZ A;  3TAX A;  3ENE A;  2L6B A;  2B6C A;  5CEA A;  4UI9 C;  4TXQ A;  2P58 C;  3G2S A;  3CR3 A;  3B13 A;  2M63 A;  3CVX A;  4L2L A;  4LRZ A;  3L54 A;  4MS6 A;  2V5F A;  3SNX A;  5ANL A;  4GML A;  2F8X K;  4X8Q A;  3L6A A;  2NYJ A;  2CFU A;  3PDN A;  1JCR A;  1HF8 A;  3V30 A;  4NUR A;  5T8I A;  1HFA A;  1G3N B;  4KYO B;  1HU3 A;  3MCX A;  4GYY A;  3UX4 A;  3IKO B;  4CRW A;  1EDU A;  3DSS A;  1OWM A;  3ZYQ A;  3RRM B;  5JJT A;  4BFR A;  1TR4 A;  4XKB A;  2HE0 A;  4UI9 K;  2QFC A;  4FHJ A;  3P2B A;  1QNF A;  3U9W A;  1TYQ G;  2FBN A;  1YA0 A;  4DPR A;  3HG0 D;  1BU9 A;  3ZW3 A;  1XGW A;  1DNP A;  4J0U A;  3DST A;  4F7A A;  4E6H A;  3TWR A;  1V55 E;  1FVH A;  4ME2 A;  1WDY A;  1N94 A;  1SZ9 A;  3MV3 B;  1MX6 A;  4EBA A;  5FIO A;  3AU4 A;  5D2M C;  3B7R L;  2IO2 C;  4BSX A;  2C0M A;  1FT2 A;  3UUX A;  3TWU A;  1JUQ A;  4JPS A;  2X6I A;  4W9R A;  4TXP A;  4HLE A;  2F8Y A;  4Y6C A;  5JMN D;  4N3B A;  4F1P A;  3VLD A;  1Q2Z A;  3CVW A;  3RK6 A;  1GW6 A;  4GTO A;  4JB8 P;  2WXG A;  2XPY A;  5KJL A;  1E8W A;  3FY4 A;  3JQ1 A;  4YDY A;  4HOT A;  1TNZ A;  2ZU6 B;  1K3Z D;  5EKQ D;  3CHS A;  1Y8M A;  5BPP A;  5FQ4 A;  4D10 C;  3R9M A;  4M7C A;  2CG2 A;  3UPV A;  1BLX B;  3CHP A;  3PS6 A;  2VGE A;  1O1T A;  2R5S A;  5H7P A;  5G55 A;  1E96 B;  2Y1L E;  1N0R A;  2XRZ A;  3J5Q B;  2ZGD A;  4JC8 A;  3DEO A;  4YDE A;  3AJI A;  4JA9 A;  3LPZ A;  5EN5 D;  4DLQ A;  3EJN A;  4J8Y A;  1U2V G;  5JJ7 A;  1UJJ A;  3S7J A;  1H6P A;  3ZNG A;  5CRV A;  2EQX A;  3PZ2 A;  4DK5 A;  3SO8 A;  4GTP A;  1NFI E;  3G2W A;  2QYJ A;  3ZKJ A;  4HRM B;  1TNB A;  2B0O E;  1BD8 A;  5ENT D;  1FPP A;  2E0I A;  3DSV A;  5D0Q D;  5J08 A;  2XS8 A;  1TN8 A;  1X5B A;  3FUK A;  4JHK A;  2A4Z A;  1TNU A;  3IHY A;  4URK A;  5JA4 D;  4XX5 A;  3FTU A;  1U3D A;  2WXK A;  4J8S A;  4GYO A;  2JLB A;  1QZ2 A;  2XGM A;  4MBG A;  4HRL A;  3APF A;  4ACL A;  3FU6 A;  1A5E A;  4B94 A;  4GMR A;  5FTP A;  4RQI A;  4GZC A;  3ESK A;  4L7T A;  2BED A;  4J8D A;  4N39 A;  4F53 A;  4HS2 A;  4DLO A;  3ZEF A;  3CQG B;  4IUL A;  2LXM A;  3FTY A;  3W9F A;  4LNG A;  4GA2 A;  5BNW A;  1KT1 A;  2AXV A;  2XQ0 A;  2BTD A;  5EYP F;  5B1B E;  2VGX A;  3ZGQ A;  3D9M A;  3R9A B;  1E7V A;  3JYS A;  3KS2 A;  2P9P G;  2J4B A;  3EHN A;  5FWQ A;  3ONL A;  3ZPJ A;  2RFA A;  2YHE A;  2V0P A;  3TWX A;  3HXC A;  2XHE A;  1MJ0 A;  4O60 A;  3BG1 B;  4I2Z A;  1D8D A;  2DVW A;  3GYZ A;  3UM1 A;  3B7T A;  2ETB A;  4JEH A;  2LXL A;  3FUI A;  3SHF A;  4FJY A;  3HDX A;  4H7X A;  3EHQ A;  5CHE E;  3CLJ A;  2GGF A;  1EYH A;  3UXG A;  5DIZ A;  2H6F A;  4UUC A;  3FTW A;  4U7E B;  5BT1 A;  4CYM D;  2R2L A;  3DPD A;  4ATG A;  4G8K A;  3UKU G;  2GRM A;  2X38 A;  4FUL A;  4KZ0 A;  4KZC A;  3ZYK A;  4OAV B;  2CHX A;  3QC1 A;  3Q15 A;  4GZD A;  2VTB B;  4ANW A;  1K8K G;  3HHM A;  1S64 A;  3ZHE B;  4CDN A;  1OWO A;  3QKY A;  3FU0 A;  4GTM A;  1MX2 A;  5LCW J;  2WXF A; 
#chains in the Genus database with same CATH homology
 2XEN A;  3JXJ A;  4BEP A;  2ZGD A;  4BES A;  3V79 K;  5EYP F;  5D66 A;  5HRY A;  5CBN A;  3DEO A;  1DC2 A;  5AAO A;  1N11 A;  3AJI A;  5ENS D;  5EN5 D;  5ENO D;  1N0Q A;  3EU9 A;  4J8Y A;  1DCQ A;  4K5C A;  5CER B;  4K5B A;  1IKN D;  4O1P A;  1OT8 A;  4QQI A;  1SVX A;  3TWV A;  4F6R D;  3HG0 D;  2JAB A;  4HB5 A;  3ZNG A;  4DX1 A;  1YYH A;  2ETA A;  1QYM A;  4DUI A;  1BU9 A;  2F37 A;  1YMP A;  2RFA A;  4B93 B;  5AQA A;  2MYO A;  5AAR A;  3SO8 A;  4LSZ E;  5EIL A;  3NOG D;  5ENP D;  2Y0B G;  3TWX A;  4ATZ D;  5AN8 A;  1MJ0 A;  1K1A A;  1NFI E;  3C5R A;  3F6Q A;  4O60 A;  5KWD A;  5CED B;  3HRA A;  1AWC B;  4DX6 D;  3TWR A;  5ENQ D;  3DEP A;  2J8S D;  1WDY A;  3B7B A;  3ZUV B;  2BKG A;  5KNH D;  3EHR A;  4A63 B;  2QYJ A;  1MX4 A;  3V2O A;  1MX6 A;  2DVW A;  3AAA C;  5AQ7 A;  3ZKJ A;  4HRM B;  3J5P A;  2ETB A;  5FIO A;  3LJN A;  4DX5 D;  2B0O E;  3UTM A;  5EIB E;  1BD8 A;  1AP7 A;  5ITZ F;  4BER A;  3V31 A;  4U96 D;  3TWW A;  2XZD G;  5ENT D;  3T9K A;  1S70 B;  5HS0 A;  2L6B A;  1WG0 A;  3Q9U C;  2A5E A;  4U8Y D;  3TWU A;  1BI7 B;  5CEA A;  3NOC D;  5HKP A;  1IXV A;  3B95 A;  3Q9N C;  2DZO A;  4HI8 A;  4N5Q A;  4NIK A;  4BSZ B;  3EHQ A;  3ZU7 B;  4LNU D;  4DRX E;  1YCS B;  4HBD A;  2FO1 E;  4YDW A;  5EYL A;  2F8Y A;  3TWS A;  4DX7 D;  2P2C P;  4HQD A;  5EID A;  3JUE A;  3T8K A;  3UXG A;  5AQB A;  2V4H C;  4J7W A;  5JMN D;  5JA4 D;  5CBO A;  4HNA D;  5KNG A;  3TWQ A;  4F1P A;  4O1O A;  4UUC A;  3IXE A;  3UI2 A;  4HLL A;  5FIN A;  2F8X K;  4LG6 A;  4HRN A;  2NYJ A;  2KBX A;  2AJA A;  4U8V D;  4CYM D;  5BXU A;  4JB8 P;  2DZN A;  3TWT A;  3V2X A;  4CZ2 D;  3NBN B;  4BET A;  3KEA A;  1UOH A;  4DX2 A;  2V5Q C;  2RFM A;  4RLY A;  3V30 A;  2XEH A;  4HRL A;  3D9H A;  4YDY A;  4G8K A;  2PNN A;  1G3N B;  1K3Z D;  1A5E A;  4C48 B;  4GMR A;  4G8L A;  4U95 D;  5ENR D;  5CEC B;  5AQ9 A;  2ZGG A;  3JXI A;  4OAV B;  4K5A B;  4ZFH A;  1BI8 B;  4ZHB A;  4QFV A;  1SW6 A;  1BLX B;  5KBA A;  4Z68 A;  2KXP C;  2ETC A;  2VGE A;  1OY3 D;  2BKK B;  3J5Q B;  1K1B A;  2XEE A;  5BXO A;  1IHB A;  1TR4 A;  3W9F A;  4HI9 A;  2XZT G;  3W9G A;  4GPM A;  1MYO A;  2HE0 A;  2DWZ A;  4OAU C;  2Y1L E;  1N0R A;  4TUM A;  1D9S A;  1MX2 A;  2QC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...