2F37A

Crystal structure of the ankyrin repeat domain of human trpv2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
248
structure length
247
Chain Sequence
PNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human TRPV2 channel ankyrin repeat domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Transient receptor potential cation channel subfamily V memb
total genus 77
structure length 247
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2f37A00
4G8LA 1MJ0A 1UOHA 5ITZF 5EN5D 5ENSD 4DX7D 4DRXE 4O1OA 4HNAD 1MX2A 1S70B 2RFMA 4C48B 3V2XA 5AARA 4J7WA 1MX4A 1N0QA 4BETA 1K1AA 3TWXA 1A5EA 3TWTA 2NYJA 4BESA 3NOGD 3HG0D 2B0OE 4N5QA 3JXJA 4BSZB 4HI9A 5EILA 2DWZA 4QFVA 5EIBE 5KWDA 3KEAA 3NBNB 2F8XK 5CEAA 1BI7B 3UI2A 5AQ9A 3T8KA 3EU9A 1NFIE 2BKKB 1BI8B 2XEEA 1SVXA 5KNGA 2F37A 3W9GA 2Y1LE 5CEDB 4K5BA 1WDYA 1BU9A 4U95D 3V79K 4DX2A 1G3NB 3TWSA 4ATZD 1OT8A 4OAUC 3TWUA 2KBXA 4DX6D 3J5PA 1K3ZD 3W9FA 3DEPA 4BEPA 2ETCA 5FINA 4HB5A 5JA4D 1OY3D 5AQ7A 3V30A 4ZFHA 5HRYA 3EHQA 5ENQD 4DUIA 2DVWA 2F8YA 2FO1E 3AAAC 3LJNA 4NIKA 4LSZE 4O60A 4JB8P 4YDWA 3DEOA 3TWVA 5BXOA 4F1PA 5KBAA 2A5EA 4DX1A 3Q9UC 2QYJA 1N0RA 5AQAA 4OAVB 5HKPA 3ZKJA 3T9KA 5AQBA 2ETBA 3AJIA 2L6BA 3ZNGA 5CECB 1DCQA 2MYOA 3D9HA 1MX6A 4O1PA 3V31A 1DC2A 2RFAA 2J8SD 4GMRA 4B93B 4HRNA 2XZTG 4HBDA 4A63B 3C5RA 4YDYA 1K1BA 4U8YD 2P2CP 5KNHD 1IXVA 4K5AB 2V4HC 3TWRA 1TR4A 5ENPD 2PNNA 1YMPA 3JUEA 5EYPF 1YCSB 2Y0BG 3HRAA 1MYOA 3ZUVB 1YYHA 3UTMA 5BXUA 4ZHBA 1N11A 2XENA 4GPMA 3ZU7B 1AP7A 5EIDA 1IKND 4U8VD 2DZOA 4RLYA 1SW6A 3UXGA 1D9SA 3IXEA 3TWWA 4CZ2D 5HS0A 4TUMA 5CBOA 5ENRD 3F6QA 3NOCD 2DZNA 5AN8A 4LNUD 4BERA 4J8YA 5EYLA 3EHRA 2HE0A 4F6RD 5CBNA 2ZGGA 3JXIA 4HRLA 4G8KA 4K5CA 3Q9NC 5FIOA 1BD8A 2ZGDA 2JABA 4UUCA 5JMND 4CYMD 2AJAA 3B7BA 5AAOA 4U96D 3TWQA 1AWCB 1WG0A 2XZDG 4HLLA 4LG6A 2VGEA 1BLXB 3V2OA 2V5QC 5ENTD 4DX5D 2KXPC 3J5QB 5CERB 5ENOD 1IHBA 4HRMB 2QC9A 2ETAA 3B95A 4HI8A 4QQIA 4HQDA 2XEHA 3SO8A 1QYMA 2BKGA 4Z68A 5D66A
chains in the Genus database with same CATH superfamily
4G1TA 1O5MA 4O6FA 3BG0B 2KCLA 3TWXA 3HG0D 4DJAA 4I1OB 5EILA 1N9AA 1OUVA 3RAUA 1YA0A 3EDTB 4GA2A 3T8KA 5LOZA 3TG5A 4EQFA 3FTSA 3CK8A 3PEUB 5B3SE 2X6JA 3E4BA 5ARFA 5J08A 4GA1A 3PE3A 3Q9UC 5HKPA 3L13A 1Y6IA 2QY7A 1EYHA 4R7LA 3S2AA 5CMWA 3L17A 4IYPA 2R02A 4B8AA 5KNHD 4K5AB 4PUCA 3KSQA 2X38A 3ONLA 5CRVA 5JHBA 4CDRA 2Y4UA 2WXPA 3CHOA 1E8XA 5BXUA 4ZHBA 2KC7A 4FU3A 3QJZA 3CVUA 5LCWC 2KCVA 2WXLA 3IKOB 2KM4A 2XGMA 3LKUA 3OXGA 4U96D 2R17C 4HLLA 5ENTD 3FUMA 3WG7E 1N0RA 5G05C 1TEZA 2CHZA 4L2LA 2RFMA 3CVLA 4HOTA 2WM9A 5FJYA 1WM5A 1SVXA 1OT8A 4GCOA 5ANRA 3ESKA 3PE4A 3LYAA 5HRYA 2E2EA 1ELWA 3FHEA 5BXOA 4LSZE 1Y8MA 2YHEA 4DX1A 4H7YA 3FEXA 4D10C 2GRQB 3UIOC 1MX6A 4GYOA 2RFAA 4CDNA 2XZTG 4JL0A 3U9WA 3CKCA 5AJDA 4MBGA 4JHJA 5ENPD 2VGXA 4MLPA 3HXDA 1KT1A 4XE0A 1IHGA 3NAWA 1OCOE 3HVEB 4CZ2D 4IN3B 5AN8A 4DI3A 4L1BA 3PH0C 2ZIRA 2JLBA 3FU0A 3MJWA 2JABA 1KZOA 3Q7AA 3CLJA 3B7RL 1O1SA 2WMNA 5AYWD 5ENSD 3HXEA 3ZIMA 2GROB 3X2QE 3Q4AB 4BETA 5AENA 3EHNA 1A5EA 2I1JA 3P1UA 4APOA 4N5QA 4BSZB 4JA9A 2P9SG 3FH5A 3MV2B 2WXGA 1NL4A 3FUIA 2I6HA 3CQCB 3SFXA 3TGOA 5CEDB 3GZ2A 1MQSA 4I6EA 3QOUA 2HR2A 2QZAA 4GMJA 1UN9A 4J8SA 4P29A 4FA6A 2VSXE 3D9HA 3V31A 4J0UA 4WNEA 4B93B 1HE8A 1D8EA 2LXLA 4EHMA 4JEHA 3NZUA 2X6FA 4FC8A 4CGWA 4I1AA 4XI9A 1MHQA 4JVSA 4UWHA 2E0IA 3LY8A 2H6GA 2WXJA 3O48A 1KLXA 1H6KA 3HIZA 4GTQA 4G23A 4A1SA 4K5CA 1UJJA 4EZKA 5JMND 2VSYA 2P58C 3CV0A 1WG0A 1NA0A 3J5QB 3QWPA 2P9NG 2ONDA 3ML9A 4HQDA 4Z68A 2DIWA 3GW4A 4U7EB 2B6CA 2WQ7A 4TRQA 2NYJA 3S7DA 3DBSA 2IEJA 2WQHA 2WXHA 4I1MA 4Q69A 4JPSA 2IJGX 3KEAA 4JHKA 3C72A 4KT6B 2XEEA 4GYWA 5B1AE 3TXMA 1IQUA 1MZCA 3RIBA 2LO6A 2P9LG 3RRNB 4U0UA 4GZ6A 2J09A 3EUVA 4JB8P 3RO3A 4DPRA 3FTYA 4BTBA 2QYJA 3UM0A 3ASGA 2QYUA 3D9MA 1K1BA 4I9EA 2C0LA 1HS6A 1TNZA 3TAXA 5CHEE 3NQPA 4PDXA 5D0OD 3MX3A 5BV0A 3UTMA 2L9BA 2P9KG 3MZLB 3RKVA 5DBKA 3SD5A 4CT0A 4UI9C 3UM2A 2H6HA 2AW6A 4GCNA 3Q9NC 4APFA 5ANLA 4CYMD 3B7BA 3UT8A 2NC9A 1EDUA 4JEUA 3R7RA 2VGEA 1WAO1 5A6CA 2OV8A 4GMLA 3TL5A 5ENOD 2FEZA 4FULA 3PNLB 4A55A 1QYMA 1HF8A 5D66A 2X6HA 2J08A 2GRRB 1N94A 3ZRHA 3U4TA 4BESA 4LNBA 3URZA 3I3NA 2PL2A 4F1SA 2Y69E 4XIFA 4JZYA 3ZHEA 4CGVA 5HQ8A 4ANUA 3AG2E 5FTPA 1JUQA 2Y1LE 3L6AA 4AM9A 4NURA 1G3NB 4KMOA 4BEPA 1TNBA 1E8WA 2CFZA 2CFUA 2FO1E 1IQRA 3FU5A 2WPVA 1LTXA 3UT7A 2VSOE 2Y4TA 1H6OA 2OEWA 4M7CA 3JQ0A 2XRZA 3AS5A 4GTSA 1UN8A 5G55A 3UINC 3CVYA 3QK0A 2HO1A 1OWLA 4KYOB 2PNNA 2C2LA 4AVXA 3KEZA 2XENA 4U8VD 2DZOA 4RLYA 5KJNA 1SW6A 1GW6A 3L08A 3C3RA 4YNDA 3I4GA 1QQEA 1QNFA 2YNQA 3PNTB 3TWQA 4RG6A 1BLXB 3LXUX 3B95A 1P5QA 3PZDA 1MJ0A 4GTVA 4HOUA 4OVVA 1MX2A 5BNWA 1UG3A 1FT2A 3CIAA 3CK9A 3VTYA 5JJ6A 4I6JA 2F8XK 2MOWA 4CDMA 4PH4B 3QB2A 3ML8A 4ANWA 2WQ6A 3RO2A 5AJLA 3ZXSA 3DPDA 3TWUA 3CEQA 4DX6D 3R9AB 5FINA 3LY7A 2UY1B 5G2NA 3D9PA 5EKQD 4WUYA 4C0MA 4EBAG 3E32A 1HH8A 3V79K 3Q15A 1HG2A 2GRPB 3Q78A 3AJIA 4GB9A 4ANVA 3FU3A 1SZ9A 4FHKA 1JCQA 3MKQA 3FTVA 4LUNU 3ABME 3CVXA 2CHWA 1PC2A 4I43A 1E8ZA 3HDXA 3PZ2A 2WXQA 3QWVA 2KATA 3Q47B 2DCPA 3Q5MA 1B89A 5EYLA 5CCLA 1N54A 3CVVA 2IO3C 1DCEA 4HRLA 4WWOA 1TNYA 5EX0A 3SFZA 4X8QA 4HI8A 3ZGQA 1TN7A 5D0QD 1ZU2A 4G8LA 4LRZA 4I2WA 4LNGA 3V2XA 2XEVA 3B7UX 4W9RA 3GZSA 2V0PA 2NSZA 4F53A 4FADA 3IV0A 3UI2A 3SBTB 1U3CA 3QAQA 3OXFA 4UWGA 2AVPA 4OAUC 4FJZA 3W9FA 3DEPA 5T3RA 3Q49B 4B8CB 2FI7A 1BPOA 2GGFA 2J07A 1N4QA 3NF1A 2F8YA 4NIKA 1OCRE 2A5EA 3T9KA 2XCCA 4PS3A 1JCSA 3IHYA 4KVOA 1TYQG 3ZHEB 2MYOA 4ACKA 2A4ZA 4O1PA 1HO8A 3ZPJA 1E8YA 1E7VA 3TWRA 4GZ3A 4Y6WA 2KZTA 4BT9A 3D9NA 3DSUA 3LS8A 2OVBA 3IBEA 1KZPA 3ZU7B 4F3VA 1AP7A 3SNXA 4A3VA 3IXEA 3F6QA 4U0SA 4C0EA 3JXIA 4ILHB 1AWCB 3SHFA 3FULA 1SA4A 4DX5D 3ZVVA 3S7JA 3ZEFA 4QQIA 3SO8A 4OVUA 2BKGA 3ZYMA 2RD0A 3PUKA 5ITZF 4DX7D 1N0QA 1RZ4A 3L82A 3S7BA 3QKYA 5FZSA 3U3WA 3JXJA 2WXMA 4HI9A 4L2YA 4WNGA 5M72A 3PS6A 5AQ9A 3EU9A 1IYGA 1TN6A 1NI1A 3GYZA 3PEVB 4U95D 4FHJA 1OWOA 5AQ7A 3SZ7A 5LX8A 2DVWA 2FULA 4EBAA 3FUKA 4GTOA 3FTWA 4RSYA 2IOLA 2LUHA 1V54E 1OWMA 4GU5A 5FQ7A 4GMRA 3LPZA 2YINA 2BF0X 2CHXA 3JYSA 3FUHA 4NQ0A 4N5CA 3KS2A 1NA3A 4ABNA 2XPIA 1YMPA 5D2MC 1YCSB 2HM8A 4G26A 3WXXA 4JC8A 4UWFA 3LEWA 3AG4E 5T8IA 3T8MA 4GTTA 1D9SA 4TXPA 4HS2A 5CBOA 3FH7A 3U66A 3NOCD 4AEZC 3B7SA 2XPYA 4KZCA 3CHQA 2XQ0A 2F0YA 4NACA 2IY0C 4J8DA 4YVQC 2IF4A 3APFA 3DRAA 3OAWA 3FY4A 3AS4A 1S63A 2QC9A 4I9CA 4BT8A 5LP0A 2XEHA 3AS8A 4CEMA 4O1OA 1HG5A 4E85A 1K1AA 3ABLE 1HZ4A 1OCZE 2VTBA 2LSVA 4AY5A 1H19A 2X6KA 3BU8A 4L7TA 3KSLA 1NFIE 2BKKB 1TNOA 3O4ZA 2F37A 2P9PG 3MEKA 4K5BA 1WDYA 4KXKB 2KBXA 3GZ1A 3QC1A 1K3ZD 4XKBA 1NZNA 4GZDA 1OY3D 2H6IA 3V30A 3ESLA 3EHQA 3LVRE 4URKA 1H0AA 5CRUA 3UX4A 4B89A 3L54A 3T5XA 4YDOA 4ATGA 5A7DB 4IULA 4HBDA 3SGHA 5FWQA 5DIZA 2V4HC 3VLFA 3QWWA 1SZAA 5EIDA 1HXIA 3ISMC 2P9IG 1U2VG 2VSNA 4V3IA 4GPKA 2AXVA 3EHRA 2XRYA 1QZ2A 3TG4A 2GRNB 4PS8A 3AG1E 3I4RB 4GA0A 2KXPC 2VJ8A 4MS6A 5G04J 3UMVA 1XNFA 5KJKA 2H6FA 5EN5D 4KBQA 2I9CA 3QARA 2A5UA 4U0ZA 4C48B 3DSXA 3HXBA 2OCCE 3OXLA 4GTPA 3B7TA 5FT9A 1FT1A 1TJCA 4PS7A 4N2SA 4BTAA 3C3OA 5FQ6A 5G04C 3J5PA 3FUJA 3RJVA 3N71A 1O1RA 1Z3YA 2J49A 4DUIA 3L16A 3LJNA 4WAFA 1K8KG 1JWGA 4J8FA 4G25A 3DSVA 5FQ8A 2WB2A 4WWPA 2J8SD 4AJWA 3CQGB 4HRNA 4G11A 4EECA 2X3MA 3MKQB 4AP2A 2LSUA 3CHSA 2OEVA 3D9JA 4N3BA 2VQ2A 1E90A 2I2OA 4WNDA 2WXIA 3LJ3A 5CMYA 4UI9J 3SY2A 2Y3AA 4GPMA 1IKND 2WXNA 4UQYA 3VLDA 3BEEA 5J90A 3FUFA 3TWWA 2BUGA 5HS0A 3HXCA 3CKBA 2EIKE 3G2UA 4F6RD 3L9TA 4J8YA 3S7FA 3CSTA 3TXNA 4G2VA 2AJAA 3BG1B 1TNUA 2IQCA 3PVLA 1X81A 3ZYKA 3P2BA 2ILRA 3UPVA 3G2SA 5E76A 4N3AA 4BX8A 2CG2A 3CGHA 2EILE 5HI7A 2YHCA 1KPSB 2V4LA 5LFAA 3NOGD 2WVIA 3D9KA 4RQIA 3SFYA 3FTXA 1INZA 1S64A 2IONA 3SI5A 1BU9A 2WXFA 1NP7A 3ASNE 3EU5A 3CSFA 4ILIA 4K0RA 3EHMA 2YQ8A 4HB5A 4IRUA 1HU3A 2XPZA 4K03A 2EINE 2UY1A 3ASDA 3K9IA 3PZ4A 5KBAA 2L0TB 4XEIG 1E96B 4XI0A 3ZNGA 4J8EA 3RK6A 1SQMA 3D9LA 3AU4A 2L0IA 3PUJA 1TR4A 5EYPF 3JUEA 1LD8A 3Q73A 3BUAA 3ASOE 1N11A 5H7PA 3DSTA 1OXJA 1TJFA 2CG3A 1RW2A 5KCMA 3BQOA 4AV7A 2LXMA 4UQXA 2DZNA 4LNUD 4BERA 2OVFA 3L22A 4ANXA 1BD8A 2GW1A 5AAOA 1VDYA 4HRMB 1V55E 5IY5E 1Z5SC 1H2TC 4I2ZA 5JJTA 4YVOA 4DRXE 2M63A 4HNAD 5BT1A 3G2TA 3UUXA 3UKUG 2P9UG 3TWTA 3UKRG 4HOSA 3CHMA 4GAAA 3UM3A 3CHRA 3EIQC 3CVNA 1FCHA 2XS8A 5CEAA 3VTXA 1ZBPA 3R7QA 4AIFA 1OWPA 3E33A 4TUUA 1OWNA 1WY6A 4HLEA 1XGWA 5EX3A 5E75A 3QNKA 4GTMA 4H7XA 4ACLA 3HHMA 5AQBA 3FUEA 1PAQA 3E34A 2BTDA 4N3CA 3D9IA 2AWIA 5C1DA 2VTBB 4U8YD 3AG3E 5T4YA 3Q79A 4WWNA 2KCKA 3ZUVB 3ENEA 3APCA 3KD7A 1FVFA 1KT0A 3E30A 2V5FA 1ELRA 4JW1A 5CBNA 5FZRA 2PZIA 1H2VC 5FIOA 4AXHA 2DBAA 3ASHA 2FBNA 2WXOA 2FO7A 3TWSA 5BPPA 1UOHA 2XGOA 1H2UA 2VGXB 4FJYA 3CR3A 4Q96A 4J7WA 1MX4A 3D9OA 2AXUA 3MKRA 3FDHA 1BI7B 4UWLA 3MGBA 3NZSA 5KNGA 3U64A 3FUDA 4BFRA 4DX2A 4ATZD 3ZW3A 2R59A 3UT4A 1TN8A 2ETCA 1N4SA 3DSSA 5ENQD 1LD7A 3G2VA 2VYIA 4CRWA 3RSEG 1N4PA 3DEOA 2VGYA 2J4DA 1H6PA 5AQAA 3KAEA 1DCQA 1QBQA 4BSXA 4LEUA 4A63B 5ARGA 4NRHB 1ELKA 3E37A 3VLEA 4UQZA 3RRMB 3MCXA 3HRAA 4WNFA 3LDZA 4DLQA 2MHKA 3CVPA 5ENRD 4M3OA 2ZGGA 3HYMB 3ULQA 3RRUA 4GYYA 4AY6A 4MKTA 3I5PA 4E6HA 3B13A 3G2WA 1N52A 2JEKA 2J9QA 2KZTB 4FLBA 1A17A 2BEDA 2IU1A 4Q94A 2I1KA 5AARA 3UQ3A 4FP7A 1D8DA 2LAIA 3JCKC 3JUIA 1HFAA 2DWZA 4QFVA 5EIBE 2RKKA 3FTUA 4A1GA 3AU5A 3C3QA 2DYRE 4I6GA 2WMOA 2XCBA 2XS1A 1OCCE 1O1TA 4UI9K 3Q75A 3ULEG 4C9BB 5BV1A 3EJNA 5JHAA 3SQVA 4HOQA 4OYSA 3JQ1A 5JA4D 2J4BA 4KVMA 2GRMA 4O60A 4F1PA 3ZKJA 4EZLA 2LNIA 4AOFA 3DPYA 2IO2C 2ZU6B 3UM1A 5FQ4A 3ZFWA 3APDA 4B0ZA 4I17A 2IOSA 3LY9A 1W3BA 4TV3A 5G05J 5B1BE 5ENNA 1L5JA 4JXTA 2LAHA 5KJLA 4U07A 2UWJG 3UXGA 3IHVA 4ME2A 2HE0A 3ULYA 3PDNA 5LCWJ 3NB2A 3FWVA 2ZGDA 3R9MA 4L9PA 3PZ3A 4UUCA 2V5QC 3SBSA 4DI4A 4A3TA 4HXIA 2XGSA 4HORA 5BUZA 1EPUA 4HVBA 3PRZA 2OOEA 2XHEA 4DLOA 4CT4A 1JWFA 3T5VA 2B0OE 2AXZA 5KWDA 2C0MA 3NBNB 3FH8A 4GZ5A 4GZCA 1BI8B 5FZQA 4HFGA 3W9GA 3DXKG 3SF4A 1ZB1A 3LVQE 1JCRA 1EF1C 4JHRA 3RU0A 4ZFHA 2GRLA 4N2QA 3FP3A 3HVEA 3AAAC 2R03A 2L6JA 2Q7FA 3DXMG 2PQRA 4F7AA 1DVPA 4XKCA 2FF4A 4DK5A 2R5SA 1DC2A 3ZYLA 4BY6A 2NXPA 4B94A 3ABKE 2IFUA 3C5RA 4YDYA 3IEGA 4U63A 2P2CP 1IXVA 5C2YA 3FUNA 2WXRA 3FTZA 5A23A 2QFCA 3ZXPA 4U04A 4LCTA 4EZJA 1E7UA 5EDSA 5JJ7A 3FEYA 3PZ1A 4TXRA 4GTRA 4J6IA 4XZ4A 3CK7A 3QDNA 4G8KA 1SA5A 4FLHA 1HX8A 2HYZA 2RG8A 3ZYQA 2R05A 3ZN3A 3DWLG 1JPLA 4LG6A 5AIJA 3V2OA 1UW4B 4CCAA 3CVQA 4UWKA 5CERB 3D3MA 2ETAA 4BX9A 3HXFA 3FFLA 4N39A 1N4RA 3LCAA 1S70B 3ASFA 3MYVA 2V8SE 1N95A 2ZXWE 2MRIA 4YDEA 3ONKA 3TJPA 2EIME 3UIPC 1Q2ZA 2R2LA 2DYSE 2PM6A 2EIJE 4BWRA 3FU6A 1U3DA 4JA7A 4G24A 4L23A 3TWVA 4YDWA 4Y6CA 2EQXA 3MA5A 4OAVB 4XX5A 3EIJA 2ETBA 4RVBA 2L6BA 3OTNA 5CECB 3MV3B 4TXQA 4EPZA 4RG9A 1FPPA 4JD2G 1FVHA 4KZ0A 1UJKA 1PY1A 4MRUA 3CVWA 3C98A 2PM7A 2Y0BG 1X5BA 1DNPA 1MYOA 3DSWA 1YYHA 1Z6TA 3CHPA 2PQNA 2X6IA 4TUMA 1Z3XA 2WXKA 4ILGA 1S0PA 3Q7FA 5KJMA 4LERA 4U8HA 2XZDG 1IHBA 1LF8A 5CCMA 2ZISA 5BW8C 3PREA
chains in the Genus database with same CATH topology
4G8LA 1MJ0A 1UOHA 5ITZF 5EN5D 5ENSD 4DX7D 4DRXE 4O1OA 4HNAD 1MX2A 1S70B 2RFMA 4C48B 3V2XA 5AARA 4J7WA 1MX4A 1N0QA 4BETA 1K1AA 3TWXA 1A5EA 3TWTA 2NYJA 4BESA 3NOGD 3HG0D 2B0OE 4N5QA 3JXJA 4BSZB 4HI9A 5EILA 2DWZA 4QFVA 5EIBE 5KWDA 3KEAA 3NBNB 2F8XK 5CEAA 1BI7B 3UI2A 5AQ9A 3T8KA 3EU9A 1NFIE 2BKKB 1BI8B 2XEEA 1SVXA 5KNGA 2F37A 3W9GA 2Y1LE 5CEDB 4K5BA 1WDYA 1BU9A 4U95D 3V79K 4DX2A 1G3NB 3TWSA 4ATZD 1OT8A 4OAUC 3TWUA 2KBXA 4DX6D 3J5PA 1K3ZD 3W9FA 3DEPA 4BEPA 2ETCA 5FINA 4HB5A 5JA4D 1OY3D 5AQ7A 3V30A 4ZFHA 5HRYA 3EHQA 5ENQD 4DUIA 2DVWA 2F8YA 2FO1E 3AAAC 3LJNA 4NIKA 4LSZE 4O60A 4JB8P 4YDWA 3DEOA 3TWVA 5BXOA 4F1PA 5KBAA 2A5EA 4DX1A 3Q9UC 2QYJA 1N0RA 5AQAA 4OAVB 5HKPA 3ZKJA 3T9KA 5AQBA 2ETBA 3AJIA 2L6BA 3ZNGA 5CECB 1DCQA 2MYOA 3D9HA 1MX6A 4O1PA 3V31A 1DC2A 2RFAA 2J8SD 4GMRA 4B93B 4HRNA 2XZTG 4HBDA 4A63B 3C5RA 4YDYA 1K1BA 4U8YD 2P2CP 5KNHD 1IXVA 4K5AB 2V4HC 3TWRA 1TR4A 5ENPD 2PNNA 1YMPA 3JUEA 5EYPF 1YCSB 2Y0BG 3HRAA 1MYOA 3ZUVB 1YYHA 3UTMA 5BXUA 4ZHBA 1N11A 2XENA 4GPMA 3ZU7B 1AP7A 5EIDA 1IKND 4U8VD 2DZOA 4RLYA 1SW6A 3UXGA 1D9SA 3IXEA 3TWWA 4CZ2D 5HS0A 4TUMA 5CBOA 5ENRD 3F6QA 3NOCD 2DZNA 5AN8A 4LNUD 4BERA 4J8YA 5EYLA 3EHRA 2HE0A 4F6RD 5CBNA 2ZGGA 3JXIA 4HRLA 4G8KA 4K5CA 3Q9NC 5FIOA 1BD8A 2ZGDA 2JABA 4UUCA 5JMND 4CYMD 2AJAA 3B7BA 5AAOA 4U96D 3TWQA 1AWCB 1WG0A 2XZDG 4HLLA 4LG6A 2VGEA 1BLXB 3V2OA 2V5QC 5ENTD 4DX5D 2KXPC 3J5QB 5CERB 5ENOD 1IHBA 4HRMB 2QC9A 2ETAA 3B95A 4HI8A 4QQIA 4HQDA 2XEHA 3SO8A 1QYMA 2BKGA 4Z68A 5D66A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G8L A;  1MJ0 A;  1UOH A;  5ITZ F;  5EN5 D;  5ENS D;  4DX7 D;  4DRX E;  4O1O A;  4HNA D;  1MX2 A;  1S70 B;  2RFM A;  4C48 B;  3V2X A;  5AAR A;  4J7W A;  1MX4 A;  1N0Q A;  4BET A;  1K1A A;  3TWX A;  1A5E A;  3TWT A;  2NYJ A;  4BES A;  3NOG D;  3HG0 D;  2B0O E;  4N5Q A;  3JXJ A;  4BSZ B;  4HI9 A;  5EIL A;  2DWZ A;  4QFV A;  5EIB E;  5KWD A;  3KEA A;  3NBN B;  2F8X K;  5CEA A;  1BI7 B;  3UI2 A;  5AQ9 A;  3T8K A;  3EU9 A;  1NFI E;  2BKK B;  1BI8 B;  2XEE A;  1SVX A;  5KNG A;  2F37 A;  3W9G A;  2Y1L E;  5CED B;  4K5B A;  1WDY A;  1BU9 A;  4U95 D;  3V79 K;  4DX2 A;  1G3N B;  3TWS A;  4ATZ D;  1OT8 A;  4OAU C;  3TWU A;  2KBX A;  4DX6 D;  3J5P A;  1K3Z D;  3W9F A;  3DEP A;  4BEP A;  2ETC A;  5FIN A;  4HB5 A;  5JA4 D;  1OY3 D;  5AQ7 A;  3V30 A;  4ZFH A;  5HRY A;  3EHQ A;  5ENQ D;  4DUI A;  2DVW A;  2F8Y A;  2FO1 E;  3AAA C;  3LJN A;  4NIK A;  4LSZ E;  4O60 A;  4JB8 P;  4YDW A;  3DEO A;  3TWV A;  5BXO A;  4F1P A;  5KBA A;  2A5E A;  4DX1 A;  3Q9U C;  2QYJ A;  1N0R A;  5AQA A;  4OAV B;  5HKP A;  3ZKJ A;  3T9K A;  5AQB A;  2ETB A;  3AJI A;  2L6B A;  3ZNG A;  5CEC B;  1DCQ A;  2MYO A;  3D9H A;  1MX6 A;  4O1P A;  3V31 A;  1DC2 A;  2RFA A;  2J8S D;  4GMR A;  4B93 B;  4HRN A;  2XZT G;  4HBD A;  4A63 B;  3C5R A;  4YDY A;  1K1B A;  4U8Y D;  2P2C P;  5KNH D;  1IXV A;  4K5A B;  2V4H C;  3TWR A;  1TR4 A;  5ENP D;  2PNN A;  1YMP A;  3JUE A;  5EYP F;  1YCS B;  2Y0B G;  3HRA A;  1MYO A;  3ZUV B;  1YYH A;  3UTM A;  5BXU A;  4ZHB A;  1N11 A;  2XEN A;  4GPM A;  3ZU7 B;  1AP7 A;  5EID A;  1IKN D;  4U8V D;  2DZO A;  4RLY A;  1SW6 A;  3UXG A;  1D9S A;  3IXE A;  3TWW A;  4CZ2 D;  5HS0 A;  4TUM A;  5CBO A;  5ENR D;  3F6Q A;  3NOC D;  2DZN A;  5AN8 A;  4LNU D;  4BER A;  4J8Y A;  5EYL A;  3EHR A;  2HE0 A;  4F6R D;  5CBN A;  2ZGG A;  3JXI A;  4HRL A;  4G8K A;  4K5C A;  3Q9N C;  5FIO A;  1BD8 A;  2ZGD A;  2JAB A;  4UUC A;  5JMN D;  4CYM D;  2AJA A;  3B7B A;  5AAO A;  4U96 D;  3TWQ A;  1AWC B;  1WG0 A;  2XZD G;  4HLL A;  4LG6 A;  2VGE A;  1BLX B;  3V2O A;  2V5Q C;  5ENT D;  4DX5 D;  2KXP C;  3J5Q B;  5CER B;  5ENO D;  1IHB A;  4HRM B;  2QC9 A;  2ETA A;  3B95 A;  4HI8 A;  4QQI A;  4HQD A;  2XEH A;  3SO8 A;  1QYM A;  2BKG A;  4Z68 A;  5D66 A; 
#chains in the Genus database with same CATH topology
 4G1T A;  1O5M A;  4O6F A;  3BG0 B;  2KCL A;  3TWX A;  3HG0 D;  4DJA A;  4I1O B;  5EIL A;  1N9A A;  1OUV A;  3RAU A;  1YA0 A;  3EDT B;  4GA2 A;  3T8K A;  5LOZ A;  3TG5 A;  4EQF A;  3FTS A;  3CK8 A;  3PEU B;  5B3S E;  2X6J A;  3E4B A;  5ARF A;  5J08 A;  4GA1 A;  3PE3 A;  3Q9U C;  5HKP A;  3L13 A;  1Y6I A;  2QY7 A;  1EYH A;  4R7L A;  3S2A A;  5CMW A;  3L17 A;  4IYP A;  2R02 A;  4B8A A;  5KNH D;  4K5A B;  4PUC A;  3KSQ A;  2X38 A;  3ONL A;  5CRV A;  5JHB A;  4CDR A;  2Y4U A;  2WXP A;  3CHO A;  1E8X A;  5BXU A;  4ZHB A;  2KC7 A;  4FU3 A;  3QJZ A;  3CVU A;  5LCW C;  2KCV A;  2WXL A;  3IKO B;  2KM4 A;  2XGM A;  3LKU A;  3OXG A;  4U96 D;  2R17 C;  4HLL A;  5ENT D;  3FUM A;  3WG7 E;  1N0R A;  5G05 C;  1TEZ A;  2CHZ A;  4L2L A;  2RFM A;  3CVL A;  4HOT A;  2WM9 A;  5FJY A;  1WM5 A;  1SVX A;  1OT8 A;  4GCO A;  5ANR A;  3ESK A;  3PE4 A;  3LYA A;  5HRY A;  2E2E A;  1ELW A;  3FHE A;  5BXO A;  4LSZ E;  1Y8M A;  2YHE A;  4DX1 A;  4H7Y A;  3FEX A;  4D10 C;  2GRQ B;  3UIO C;  1MX6 A;  4GYO A;  2RFA A;  4CDN A;  2XZT G;  4JL0 A;  3U9W A;  3CKC A;  5AJD A;  4MBG A;  4JHJ A;  5ENP D;  2VGX A;  4MLP A;  3HXD A;  1KT1 A;  4XE0 A;  1IHG A;  3NAW A;  1OCO E;  3HVE B;  4CZ2 D;  4IN3 B;  5AN8 A;  4DI3 A;  4L1B A;  3PH0 C;  2ZIR A;  2JLB A;  3FU0 A;  3MJW A;  2JAB A;  1KZO A;  3Q7A A;  3CLJ A;  3B7R L;  1O1S A;  2WMN A;  5AYW D;  5ENS D;  3HXE A;  3ZIM A;  2GRO B;  3X2Q E;  3Q4A B;  4BET A;  5AEN A;  3EHN A;  1A5E A;  2I1J A;  3P1U A;  4APO A;  4N5Q A;  4BSZ B;  4JA9 A;  2P9S G;  3FH5 A;  3MV2 B;  2WXG A;  1NL4 A;  3FUI A;  2I6H A;  3CQC B;  3SFX A;  3TGO A;  5CED B;  3GZ2 A;  1MQS A;  4I6E A;  3QOU A;  2HR2 A;  2QZA A;  4GMJ A;  1UN9 A;  4J8S A;  4P29 A;  4FA6 A;  2VSX E;  3D9H A;  3V31 A;  4J0U A;  4WNE A;  4B93 B;  1HE8 A;  1D8E A;  2LXL A;  4EHM A;  4JEH A;  3NZU A;  2X6F A;  4FC8 A;  4CGW A;  4I1A A;  4XI9 A;  1MHQ A;  4JVS A;  4UWH A;  2E0I A;  3LY8 A;  2H6G A;  2WXJ A;  3O48 A;  1KLX A;  1H6K A;  3HIZ A;  4GTQ A;  4G23 A;  4A1S A;  4K5C A;  1UJJ A;  4EZK A;  5JMN D;  2VSY A;  2P58 C;  3CV0 A;  1WG0 A;  1NA0 A;  3J5Q B;  3QWP A;  2P9N G;  2OND A;  3ML9 A;  4HQD A;  4Z68 A;  2DIW A;  3GW4 A;  4U7E B;  2B6C A;  2WQ7 A;  4TRQ A;  2NYJ A;  3S7D A;  3DBS A;  2IEJ A;  2WQH A;  2WXH A;  4I1M A;  4Q69 A;  4JPS A;  2IJG X;  3KEA A;  4JHK A;  3C72 A;  4KT6 B;  2XEE A;  4GYW A;  5B1A E;  3TXM A;  1IQU A;  1MZC A;  3RIB A;  2LO6 A;  2P9L G;  3RRN B;  4U0U A;  4GZ6 A;  2J09 A;  3EUV A;  4JB8 P;  3RO3 A;  4DPR A;  3FTY A;  4BTB A;  2QYJ A;  3UM0 A;  3ASG A;  2QYU A;  3D9M A;  1K1B A;  4I9E A;  2C0L A;  1HS6 A;  1TNZ A;  3TAX A;  5CHE E;  3NQP A;  4PDX A;  5D0O D;  3MX3 A;  5BV0 A;  3UTM A;  2L9B A;  2P9K G;  3MZL B;  3RKV A;  5DBK A;  3SD5 A;  4CT0 A;  4UI9 C;  3UM2 A;  2H6H A;  2AW6 A;  4GCN A;  3Q9N C;  4APF A;  5ANL A;  4CYM D;  3B7B A;  3UT8 A;  2NC9 A;  1EDU A;  4JEU A;  3R7R A;  2VGE A;  1WAO 1;  5A6C A;  2OV8 A;  4GML A;  3TL5 A;  5ENO D;  2FEZ A;  4FUL A;  3PNL B;  4A55 A;  1QYM A;  1HF8 A;  5D66 A;  2X6H A;  2J08 A;  2GRR B;  1N94 A;  3ZRH A;  3U4T A;  4BES A;  4LNB A;  3URZ A;  3I3N A;  2PL2 A;  4F1S A;  2Y69 E;  4XIF A;  4JZY A;  3ZHE A;  4CGV A;  5HQ8 A;  4ANU A;  3AG2 E;  5FTP A;  1JUQ A;  2Y1L E;  3L6A A;  4AM9 A;  4NUR A;  1G3N B;  4KMO A;  4BEP A;  1TNB A;  1E8W A;  2CFZ A;  2CFU A;  2FO1 E;  1IQR A;  3FU5 A;  2WPV A;  1LTX A;  3UT7 A;  2VSO E;  2Y4T A;  1H6O A;  2OEW A;  4M7C A;  3JQ0 A;  2XRZ A;  3AS5 A;  4GTS A;  1UN8 A;  5G55 A;  3UIN C;  3CVY A;  3QK0 A;  2HO1 A;  1OWL A;  4KYO B;  2PNN A;  2C2L A;  4AVX A;  3KEZ A;  2XEN A;  4U8V D;  2DZO A;  4RLY A;  5KJN A;  1SW6 A;  1GW6 A;  3L08 A;  3C3R A;  4YND A;  3I4G A;  1QQE A;  1QNF A;  2YNQ A;  3PNT B;  3TWQ A;  4RG6 A;  1BLX B;  3LXU X;  3B95 A;  1P5Q A;  3PZD A;  1MJ0 A;  4GTV A;  4HOU A;  4OVV A;  1MX2 A;  5BNW A;  1UG3 A;  1FT2 A;  3CIA A;  3CK9 A;  3VTY A;  5JJ6 A;  4I6J A;  2F8X K;  2MOW A;  4CDM A;  4PH4 B;  3QB2 A;  3ML8 A;  4ANW A;  2WQ6 A;  3RO2 A;  5AJL A;  3ZXS A;  3DPD A;  3TWU A;  3CEQ A;  4DX6 D;  3R9A B;  5FIN A;  3LY7 A;  2UY1 B;  5G2N A;  3D9P A;  5EKQ D;  4WUY A;  4C0M A;  4EBA G;  3E32 A;  1HH8 A;  3V79 K;  3Q15 A;  1HG2 A;  2GRP B;  3Q78 A;  3AJI A;  4GB9 A;  4ANV A;  3FU3 A;  1SZ9 A;  4FHK A;  1JCQ A;  3MKQ A;  3FTV A;  4LUN U;  3ABM E;  3CVX A;  2CHW A;  1PC2 A;  4I43 A;  1E8Z A;  3HDX A;  3PZ2 A;  2WXQ A;  3QWV A;  2KAT A;  3Q47 B;  2DCP A;  3Q5M A;  1B89 A;  5EYL A;  5CCL A;  1N54 A;  3CVV A;  2IO3 C;  1DCE A;  4HRL A;  4WWO A;  1TNY A;  5EX0 A;  3SFZ A;  4X8Q A;  4HI8 A;  3ZGQ A;  1TN7 A;  5D0Q D;  1ZU2 A;  4G8L A;  4LRZ A;  4I2W A;  4LNG A;  3V2X A;  2XEV A;  3B7U X;  4W9R A;  3GZS A;  2V0P A;  2NSZ A;  4F53 A;  4FAD A;  3IV0 A;  3UI2 A;  3SBT B;  1U3C A;  3QAQ A;  3OXF A;  4UWG A;  2AVP A;  4OAU C;  4FJZ A;  3W9F A;  3DEP A;  5T3R A;  3Q49 B;  4B8C B;  2FI7 A;  1BPO A;  2GGF A;  2J07 A;  1N4Q A;  3NF1 A;  2F8Y A;  4NIK A;  1OCR E;  2A5E A;  3T9K A;  2XCC A;  4PS3 A;  1JCS A;  3IHY A;  4KVO A;  1TYQ G;  3ZHE B;  2MYO A;  4ACK A;  2A4Z A;  4O1P A;  1HO8 A;  3ZPJ A;  1E8Y A;  1E7V A;  3TWR A;  4GZ3 A;  4Y6W A;  2KZT A;  4BT9 A;  3D9N A;  3DSU A;  3LS8 A;  2OVB A;  3IBE A;  1KZP A;  3ZU7 B;  4F3V A;  1AP7 A;  3SNX A;  4A3V A;  3IXE A;  3F6Q A;  4U0S A;  4C0E A;  3JXI A;  4ILH B;  1AWC B;  3SHF A;  3FUL A;  1SA4 A;  4DX5 D;  3ZVV A;  3S7J A;  3ZEF A;  4QQI A;  3SO8 A;  4OVU A;  2BKG A;  3ZYM A;  2RD0 A;  3PUK A;  5ITZ F;  4DX7 D;  1N0Q A;  1RZ4 A;  3L82 A;  3S7B A;  3QKY A;  5FZS A;  3U3W A;  3JXJ A;  2WXM A;  4HI9 A;  4L2Y A;  4WNG A;  5M72 A;  3PS6 A;  5AQ9 A;  3EU9 A;  1IYG A;  1TN6 A;  1NI1 A;  3GYZ A;  3PEV B;  4U95 D;  4FHJ A;  1OWO A;  5AQ7 A;  3SZ7 A;  5LX8 A;  2DVW A;  2FUL A;  4EBA A;  3FUK A;  4GTO A;  3FTW A;  4RSY A;  2IOL A;  2LUH A;  1V54 E;  1OWM A;  4GU5 A;  5FQ7 A;  4GMR A;  3LPZ A;  2YIN A;  2BF0 X;  2CHX A;  3JYS A;  3FUH A;  4NQ0 A;  4N5C A;  3KS2 A;  1NA3 A;  4ABN A;  2XPI A;  1YMP A;  5D2M C;  1YCS B;  2HM8 A;  4G26 A;  3WXX A;  4JC8 A;  4UWF A;  3LEW A;  3AG4 E;  5T8I A;  3T8M A;  4GTT A;  1D9S A;  4TXP A;  4HS2 A;  5CBO A;  3FH7 A;  3U66 A;  3NOC D;  4AEZ C;  3B7S A;  2XPY A;  4KZC A;  3CHQ A;  2XQ0 A;  2F0Y A;  4NAC A;  2IY0 C;  4J8D A;  4YVQ C;  2IF4 A;  3APF A;  3DRA A;  3OAW A;  3FY4 A;  3AS4 A;  1S63 A;  2QC9 A;  4I9C A;  4BT8 A;  5LP0 A;  2XEH A;  3AS8 A;  4CEM A;  4O1O A;  1HG5 A;  4E85 A;  1K1A A;  3ABL E;  1HZ4 A;  1OCZ E;  2VTB A;  2LSV A;  4AY5 A;  1H19 A;  2X6K A;  3BU8 A;  4L7T A;  3KSL A;  1NFI E;  2BKK B;  1TNO A;  3O4Z A;  2F37 A;  2P9P G;  3MEK A;  4K5B A;  1WDY A;  4KXK B;  2KBX A;  3GZ1 A;  3QC1 A;  1K3Z D;  4XKB A;  1NZN A;  4GZD A;  1OY3 D;  2H6I A;  3V30 A;  3ESL A;  3EHQ A;  3LVR E;  4URK A;  1H0A A;  5CRU A;  3UX4 A;  4B89 A;  3L54 A;  3T5X A;  4YDO A;  4ATG A;  5A7D B;  4IUL A;  4HBD A;  3SGH A;  5FWQ A;  5DIZ A;  2V4H C;  3VLF A;  3QWW A;  1SZA A;  5EID A;  1HXI A;  3ISM C;  2P9I G;  1U2V G;  2VSN A;  4V3I A;  4GPK A;  2AXV A;  3EHR A;  2XRY A;  1QZ2 A;  3TG4 A;  2GRN B;  4PS8 A;  3AG1 E;  3I4R B;  4GA0 A;  2KXP C;  2VJ8 A;  4MS6 A;  5G04 J;  3UMV A;  1XNF A;  5KJK A;  2H6F A;  5EN5 D;  4KBQ A;  2I9C A;  3QAR A;  2A5U A;  4U0Z A;  4C48 B;  3DSX A;  3HXB A;  2OCC E;  3OXL A;  4GTP A;  3B7T A;  5FT9 A;  1FT1 A;  1TJC A;  4PS7 A;  4N2S A;  4BTA A;  3C3O A;  5FQ6 A;  5G04 C;  3J5P A;  3FUJ A;  3RJV A;  3N71 A;  1O1R A;  1Z3Y A;  2J49 A;  4DUI A;  3L16 A;  3LJN A;  4WAF A;  1K8K G;  1JWG A;  4J8F A;  4G25 A;  3DSV A;  5FQ8 A;  2WB2 A;  4WWP A;  2J8S D;  4AJW A;  3CQG B;  4HRN A;  4G11 A;  4EEC A;  2X3M A;  3MKQ B;  4AP2 A;  2LSU A;  3CHS A;  2OEV A;  3D9J A;  4N3B A;  2VQ2 A;  1E90 A;  2I2O A;  4WND A;  2WXI A;  3LJ3 A;  5CMY A;  4UI9 J;  3SY2 A;  2Y3A A;  4GPM A;  1IKN D;  2WXN A;  4UQY A;  3VLD A;  3BEE A;  5J90 A;  3FUF A;  3TWW A;  2BUG A;  5HS0 A;  3HXC A;  3CKB A;  2EIK E;  3G2U A;  4F6R D;  3L9T A;  4J8Y A;  3S7F A;  3CST A;  3TXN A;  4G2V A;  2AJA A;  3BG1 B;  1TNU A;  2IQC A;  3PVL A;  1X81 A;  3ZYK A;  3P2B A;  2ILR A;  3UPV A;  3G2S A;  5E76 A;  4N3A A;  4BX8 A;  2CG2 A;  3CGH A;  2EIL E;  5HI7 A;  2YHC A;  1KPS B;  2V4L A;  5LFA A;  3NOG D;  2WVI A;  3D9K A;  4RQI A;  3SFY A;  3FTX A;  1INZ A;  1S64 A;  2ION A;  3SI5 A;  1BU9 A;  2WXF A;  1NP7 A;  3ASN E;  3EU5 A;  3CSF A;  4ILI A;  4K0R A;  3EHM A;  2YQ8 A;  4HB5 A;  4IRU A;  1HU3 A;  2XPZ A;  4K03 A;  2EIN E;  2UY1 A;  3ASD A;  3K9I A;  3PZ4 A;  5KBA A;  2L0T B;  4XEI G;  1E96 B;  4XI0 A;  3ZNG A;  4J8E A;  3RK6 A;  1SQM A;  3D9L A;  3AU4 A;  2L0I A;  3PUJ A;  1TR4 A;  5EYP F;  3JUE A;  1LD8 A;  3Q73 A;  3BUA A;  3ASO E;  1N11 A;  5H7P A;  3DST A;  1OXJ A;  1TJF A;  2CG3 A;  1RW2 A;  5KCM A;  3BQO A;  4AV7 A;  2LXM A;  4UQX A;  2DZN A;  4LNU D;  4BER A;  2OVF A;  3L22 A;  4ANX A;  1BD8 A;  2GW1 A;  5AAO A;  1VDY A;  4HRM B;  1V55 E;  5IY5 E;  1Z5S C;  1H2T C;  4I2Z A;  5JJT A;  4YVO A;  4DRX E;  2M63 A;  4HNA D;  5BT1 A;  3G2T A;  3UUX A;  3UKU G;  2P9U G;  3TWT A;  3UKR G;  4HOS A;  3CHM A;  4GAA A;  3UM3 A;  3CHR A;  3EIQ C;  3CVN A;  1FCH A;  2XS8 A;  5CEA A;  3VTX A;  1ZBP A;  3R7Q A;  4AIF A;  1OWP A;  3E33 A;  4TUU A;  1OWN A;  1WY6 A;  4HLE A;  1XGW A;  5EX3 A;  5E75 A;  3QNK A;  4GTM A;  4H7X A;  4ACL A;  3HHM A;  5AQB A;  3FUE A;  1PAQ A;  3E34 A;  2BTD A;  4N3C A;  3D9I A;  2AWI A;  5C1D A;  2VTB B;  4U8Y D;  3AG3 E;  5T4Y A;  3Q79 A;  4WWN A;  2KCK A;  3ZUV B;  3ENE A;  3APC A;  3KD7 A;  1FVF A;  1KT0 A;  3E30 A;  2V5F A;  1ELR A;  4JW1 A;  5CBN A;  5FZR A;  2PZI A;  1H2V C;  5FIO A;  4AXH A;  2DBA A;  3ASH A;  2FBN A;  2WXO A;  2FO7 A;  3TWS A;  5BPP A;  1UOH A;  2XGO A;  1H2U A;  2VGX B;  4FJY A;  3CR3 A;  4Q96 A;  4J7W A;  1MX4 A;  3D9O A;  2AXU A;  3MKR A;  3FDH A;  1BI7 B;  4UWL A;  3MGB A;  3NZS A;  5KNG A;  3U64 A;  3FUD A;  4BFR A;  4DX2 A;  4ATZ D;  3ZW3 A;  2R59 A;  3UT4 A;  1TN8 A;  2ETC A;  1N4S A;  3DSS A;  5ENQ D;  1LD7 A;  3G2V A;  2VYI A;  4CRW A;  3RSE G;  1N4P A;  3DEO A;  2VGY A;  2J4D A;  1H6P A;  5AQA A;  3KAE A;  1DCQ A;  1QBQ A;  4BSX A;  4LEU A;  4A63 B;  5ARG A;  4NRH B;  1ELK A;  3E37 A;  3VLE A;  4UQZ A;  3RRM B;  3MCX A;  3HRA A;  4WNF A;  3LDZ A;  4DLQ A;  2MHK A;  3CVP A;  5ENR D;  4M3O A;  2ZGG A;  3HYM B;  3ULQ A;  3RRU A;  4GYY A;  4AY6 A;  4MKT A;  3I5P A;  4E6H A;  3B13 A;  3G2W A;  1N52 A;  2JEK A;  2J9Q A;  2KZT B;  4FLB A;  1A17 A;  2BED A;  2IU1 A;  4Q94 A;  2I1K A;  5AAR A;  3UQ3 A;  4FP7 A;  1D8D A;  2LAI A;  3JCK C;  3JUI A;  1HFA A;  2DWZ A;  4QFV A;  5EIB E;  2RKK A;  3FTU A;  4A1G A;  3AU5 A;  3C3Q A;  2DYR E;  4I6G A;  2WMO A;  2XCB A;  2XS1 A;  1OCC E;  1O1T A;  4UI9 K;  3Q75 A;  3ULE G;  4C9B B;  5BV1 A;  3EJN A;  5JHA A;  3SQV A;  4HOQ A;  4OYS A;  3JQ1 A;  5JA4 D;  2J4B A;  4KVM A;  2GRM A;  4O60 A;  4F1P A;  3ZKJ A;  4EZL A;  2LNI A;  4AOF A;  3DPY A;  2IO2 C;  2ZU6 B;  3UM1 A;  5FQ4 A;  3ZFW A;  3APD A;  4B0Z A;  4I17 A;  2IOS A;  3LY9 A;  1W3B A;  4TV3 A;  5G05 J;  5B1B E;  5ENN A;  1L5J A;  4JXT A;  2LAH A;  5KJL A;  4U07 A;  2UWJ G;  3UXG A;  3IHV A;  4ME2 A;  2HE0 A;  3ULY A;  3PDN A;  5LCW J;  3NB2 A;  3FWV A;  2ZGD A;  3R9M A;  4L9P A;  3PZ3 A;  4UUC A;  2V5Q C;  3SBS A;  4DI4 A;  4A3T A;  4HXI A;  2XGS A;  4HOR A;  5BUZ A;  1EPU A;  4HVB A;  3PRZ A;  2OOE A;  2XHE A;  4DLO A;  4CT4 A;  1JWF A;  3T5V A;  2B0O E;  2AXZ A;  5KWD A;  2C0M A;  3NBN B;  3FH8 A;  4GZ5 A;  4GZC A;  1BI8 B;  5FZQ A;  4HFG A;  3W9G A;  3DXK G;  3SF4 A;  1ZB1 A;  3LVQ E;  1JCR A;  1EF1 C;  4JHR A;  3RU0 A;  4ZFH A;  2GRL A;  4N2Q A;  3FP3 A;  3HVE A;  3AAA C;  2R03 A;  2L6J A;  2Q7F A;  3DXM G;  2PQR A;  4F7A A;  1DVP A;  4XKC A;  2FF4 A;  4DK5 A;  2R5S A;  1DC2 A;  3ZYL A;  4BY6 A;  2NXP A;  4B94 A;  3ABK E;  2IFU A;  3C5R A;  4YDY A;  3IEG A;  4U63 A;  2P2C P;  1IXV A;  5C2Y A;  3FUN A;  2WXR A;  3FTZ A;  5A23 A;  2QFC A;  3ZXP A;  4U04 A;  4LCT A;  4EZJ A;  1E7U A;  5EDS A;  5JJ7 A;  3FEY A;  3PZ1 A;  4TXR A;  4GTR A;  4J6I A;  4XZ4 A;  3CK7 A;  3QDN A;  4G8K A;  1SA5 A;  4FLH A;  1HX8 A;  2HYZ A;  2RG8 A;  3ZYQ A;  2R05 A;  3ZN3 A;  3DWL G;  1JPL A;  4LG6 A;  5AIJ A;  3V2O A;  1UW4 B;  4CCA A;  3CVQ A;  4UWK A;  5CER B;  3D3M A;  2ETA A;  4BX9 A;  3HXF A;  3FFL A;  4N39 A;  1N4R A;  3LCA A;  1S70 B;  3ASF A;  3MYV A;  2V8S E;  1N95 A;  2ZXW E;  2MRI A;  4YDE A;  3ONK A;  3TJP A;  2EIM E;  3UIP C;  1Q2Z A;  2R2L A;  2DYS E;  2PM6 A;  2EIJ E;  4BWR A;  3FU6 A;  1U3D A;  4JA7 A;  4G24 A;  4L23 A;  3TWV A;  4YDW A;  4Y6C A;  2EQX A;  3MA5 A;  4OAV B;  4XX5 A;  3EIJ A;  2ETB A;  4RVB A;  2L6B A;  3OTN A;  5CEC B;  3MV3 B;  4TXQ A;  4EPZ A;  4RG9 A;  1FPP A;  4JD2 G;  1FVH A;  4KZ0 A;  1UJK A;  1PY1 A;  4MRU A;  3CVW A;  3C98 A;  2PM7 A;  2Y0B G;  1X5B A;  1DNP A;  1MYO A;  3DSW A;  1YYH A;  1Z6T A;  3CHP A;  2PQN A;  2X6I A;  4TUM A;  1Z3X A;  2WXK A;  4ILG A;  1S0P A;  3Q7F A;  5KJM A;  4LER A;  4U8H A;  2XZD G;  1IHB A;  1LF8 A;  5CCM A;  2ZIS A;  5BW8 C;  3PRE A; 
#chains in the Genus database with same CATH homology
 4G8L A;  1MJ0 A;  1UOH A;  5ITZ F;  5EN5 D;  5ENS D;  4DX7 D;  4DRX E;  4O1O A;  4HNA D;  1MX2 A;  1S70 B;  2RFM A;  4C48 B;  3V2X A;  5AAR A;  4J7W A;  1MX4 A;  1N0Q A;  4BET A;  1K1A A;  3TWX A;  1A5E A;  3TWT A;  2NYJ A;  4BES A;  3NOG D;  3HG0 D;  2B0O E;  4N5Q A;  3JXJ A;  4BSZ B;  4HI9 A;  5EIL A;  2DWZ A;  4QFV A;  5EIB E;  5KWD A;  3KEA A;  3NBN B;  2F8X K;  5CEA A;  1BI7 B;  3UI2 A;  5AQ9 A;  3T8K A;  3EU9 A;  1NFI E;  2BKK B;  1BI8 B;  2XEE A;  1SVX A;  5KNG A;  2F37 A;  3W9G A;  2Y1L E;  5CED B;  4K5B A;  1WDY A;  1BU9 A;  4U95 D;  3V79 K;  4DX2 A;  1G3N B;  3TWS A;  4ATZ D;  1OT8 A;  4OAU C;  3TWU A;  2KBX A;  4DX6 D;  3J5P A;  1K3Z D;  3W9F A;  3DEP A;  4BEP A;  2ETC A;  5FIN A;  4HB5 A;  5JA4 D;  1OY3 D;  5AQ7 A;  3V30 A;  4ZFH A;  5HRY A;  3EHQ A;  5ENQ D;  4DUI A;  2DVW A;  2F8Y A;  2FO1 E;  3AAA C;  3LJN A;  4NIK A;  4LSZ E;  4O60 A;  4JB8 P;  4YDW A;  3DEO A;  3TWV A;  5BXO A;  4F1P A;  5KBA A;  2A5E A;  4DX1 A;  3Q9U C;  2QYJ A;  1N0R A;  5AQA A;  4OAV B;  5HKP A;  3ZKJ A;  3T9K A;  5AQB A;  2ETB A;  3AJI A;  2L6B A;  3ZNG A;  5CEC B;  1DCQ A;  2MYO A;  3D9H A;  1MX6 A;  4O1P A;  3V31 A;  1DC2 A;  2RFA A;  2J8S D;  4GMR A;  4B93 B;  4HRN A;  2XZT G;  4HBD A;  4A63 B;  3C5R A;  4YDY A;  1K1B A;  4U8Y D;  2P2C P;  5KNH D;  1IXV A;  4K5A B;  2V4H C;  3TWR A;  1TR4 A;  5ENP D;  2PNN A;  1YMP A;  3JUE A;  5EYP F;  1YCS B;  2Y0B G;  3HRA A;  1MYO A;  3ZUV B;  1YYH A;  3UTM A;  5BXU A;  4ZHB A;  1N11 A;  2XEN A;  4GPM A;  3ZU7 B;  1AP7 A;  5EID A;  1IKN D;  4U8V D;  2DZO A;  4RLY A;  1SW6 A;  3UXG A;  1D9S A;  3IXE A;  3TWW A;  4CZ2 D;  5HS0 A;  4TUM A;  5CBO A;  5ENR D;  3F6Q A;  3NOC D;  2DZN A;  5AN8 A;  4LNU D;  4BER A;  4J8Y A;  5EYL A;  3EHR A;  2HE0 A;  4F6R D;  5CBN A;  2ZGG A;  3JXI A;  4HRL A;  4G8K A;  4K5C A;  3Q9N C;  5FIO A;  1BD8 A;  2ZGD A;  2JAB A;  4UUC A;  5JMN D;  4CYM D;  2AJA A;  3B7B A;  5AAO A;  4U96 D;  3TWQ A;  1AWC B;  1WG0 A;  2XZD G;  4HLL A;  4LG6 A;  2VGE A;  1BLX B;  3V2O A;  2V5Q C;  5ENT D;  4DX5 D;  2KXP C;  3J5Q B;  5CER B;  5ENO D;  1IHB A;  4HRM B;  2QC9 A;  2ETA A;  3B95 A;  4HI8 A;  4QQI A;  4HQD A;  2XEH A;  3SO8 A;  1QYM A;  2BKG A;  4Z68 A;  5D66 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...