2F37A

Crystal structure of the ankyrin repeat domain of human trpv2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
248
structure length
247
Chain Sequence
PNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQIDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGGTCFYFGELPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARLCPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title Crystal structure of the human TRPV2 channel ankyrin repeat domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 247
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2f37A00
4BETA 5CEAA 5EN5D 1TR4A 2A5EA 4HQDA 2RFMA 1IKND 5EIBE 1N11A 5AQAA 2NYJA 4HRMB 2J8SD 3AAAC 2V4HC 3EHRA 4HNAD 3TWQA 1MX6A 1S70B 3C5RA 4GPMA 4K5BA 5CEDB 2JABA 5ENQD 1IHBA 4QQIA 4HI8A 4HBDA 2F8XK 1SW6A 3DEOA 2L6BA 1UOHA 5EYLA 4U8VD 4O60A 2QC9A 3NBNB 1A5EA 5JMND 2XEEA 2MYOA 4J7WA 4U8YD 1MX2A 3B95A 1BD8A 5D66A 5EILA 1G3NB 3TWVA 4F1PA 1AP7A 3UI2A 3KEAA 4Z68A 3F6QA 3T9KA 4CZ2D 4UUCA 5AQBA 2XEHA 3ZU7B 2RFAA 5AQ7A 2F8YA 3NOGD 3UTMA 3W9GA 4JB8P 3J5QB 3V31A 2ETAA 2DZOA 3TWXA 4B93B 5CECB 5AN8A 5KBAA 2KBXA 3SO8A 5AAOA 1DCQA 4ZFHA 2DVWA 2DWZA 3TWTA 4BESA 1OT8A 3LJNA 2HE0A 2FO1E 2F37A 4YDYA 4BEPA 3V2OA 1DC2A 2DZNA 4HLLA 1N0QA 4HRLA 4N5QA 3JXIA 2BKGA 5AQ9A 4O1OA 1IXVA 2XENA 3UXGA 5ENPD 5CBNA 3V30A 2KXPC 3V2XA 5JA4D 2QYJA 4J8YA 2P2CP 4LNUD 5HKPA 4ATZD 5ENTD 3TWWA 4BSZB 4G8LA 4CYMD 1NFIE 5ITZF 4G8KA 3V79K 4OAUC 1D9SA 4GMRA 2XZDG 3W9FA 1YYHA 3B7BA 3D9HA 3T8KA 4TUMA 4HI9A 3JUEA 4DRXE 1WG0A 3JXJA 5KWDA 2BKKB 3TWRA 4LG6A 5BXOA 2Y1LE 4NIKA 3J5PA 1MJ0A 1MX4A 1K3ZD 2V5QC 3Q9NC 1N0RA 4OAVB 3HRAA 5ENOD 5KNHD 3TWUA 3EU9A 4DX6D 1AWCB 4ZHBA 3DEPA 4YDWA 3ZNGA 1BI7B 1K1BA 3EHQA 4DX5D 1K1AA 5CBOA 4RLYA 4DUIA 4DX2A 5HS0A 5BXUA 5HRYA 1BU9A 4U96D 1MYOA 2VGEA 5ENSD 2ZGDA 4DX1A 4HRNA 4HB5A 3ZUVB 1YMPA 3Q9UC 5ENRD 1SVXA 2ZGGA 4U95D 1BI8B 2B0OE 4F6RD 5AARA 3IXEA 4DX7D 2ETCA 1BLXB 5FIOA 3NOCD 4O1PA 4A63B 5EYPF 2PNNA 3TWSA 3HG0D 5CERB 2XZTG 4LSZE 4C48B 1QYMA 2AJAA 4K5CA 2Y0BG 5FINA 2ETBA 5KNGA 1OY3D 4K5AB 4BERA 1YCSB 1WDYA 3ZKJA 5EIDA 3AJIA 4QFVA
chains in the Genus database with same CATH superfamily
1TR4A 4DLQA 3ESKA 3AAAC 3QK0A 5ARGA 1OCOE 4G24A 3C5RA 2H6GA 5HI7A 3L17A 4IYPA 4HOTA 4E85A 1OCCE 1Z3YA 3FTSA 4CDRA 3FU6A 3UT4A 3AS5A 4J8EA 3ML9A 3FEXA 4B8AA 2VGXB 2Y4TA 2Y69E 2ETAA 3LVRE 1DNPA 2KBXA 4H7YA 4L2LA 3RRNB 2FO1E 4KXKB 2F37A 2WXPA 4K0RA 4XEIG 1OWOA 4CEMA 2WQ7A 4YVQC 4GA1A 3ZRHA 3JUEA 2L6JA 3Q9NC 3DWLG 4OAVB 4ATGA 1AWCB 3DEPA 3ENEA 2EILE 4JA7A 2EIKE 5G05C 1RZ4A 5BXUA 2PZIA 4FJZA 2L0TB 4GCOA 1SVXA 4U95D 5KJMA 3IKOB 2CG3A 4F3VA 2VTBA 2XS8A 4IULA 1KT1A 3RSEG 2XGOA 3CVUA 4XI9A 1X5BA 3K9IA 4JW1A 1N11A 3CVPA 4AJWA 2WXQA 4K5BA 3FHEA 2JABA 1IHBA 5KJLA 4HBDA 3DEOA 2L6BA 5EYLA 2L0IA 1UW4B 1MX2A 3UI2A 4KVOA 4UUCA 3ZU7B 2P9NG 2LAHA 4WWOA 2KCKA 3PE3A 1D8DA 2DVWA 3TWTA 3LY8A 3GZ1A 2DZNA 3B7UX 4BX9A 4FLHA 3ZYLA 4GU5A 5G2NA 2IF4A 5CBNA 4CYMD 2IONA 4TXQA 4GZ6A 4HOSA 4GYWA 4I43A 4U8HA 4AOFA 3CVLA 3NAWA 1PY1A 3SBSA 4AY6A 1LF8A 5AJDA 4WUYA 3TG4A 4ZHBA 4YDWA 1ELKA 2XHEA 4AP2A 4RLYA 4FC8A 1BU9A 4WWNA 4GTSA 4GMLA 3Q9UC 3I5PA 2ZGGA 4F6RD 2H6HA 3I3NA 4PDXA 5CMWA 2P9SG 4O1PA 2J4BA 3U3WA 5EYPF 3TWSA 2PQNA 3RO3A 1QYMA 3EUVA 2Y0BG 2ETBA 3Q15A 1H19A 1UN8A 1FVHA 3ZXPA 3EHRA 1HG2A 3CHRA 1RW2A 1IQUA 3KSQA 3DSWA 3NQPA 4I6EA 3PRZA 2OEVA 3CVNA 4O60A 3TWVA 3CSTA 4KT6B 5KJKA 5E76A 5CECB 5T3RA 1E96B 2JEKA 2VSYA 1H6PA 3AS8A 4I1MA 4LNGA 4BWRA 3SY2A 3LYAA 3PDNA 5JA4D 5LFAA 4FHJA 4G8LA 3CSFA 2IEJA 3CVVA 3RK6A 4BY6A 3EIJA 5KWDA 1U3CA 2DBAA 2ONDA 3I4GA 1N0RA 3D9JA 5ENOD 3EIQC 3L22A 1NA0A 1K8KG 3EHQA 4OVUA 3QDNA 2V4LA 5T8IA 3PS6A 4TXPA 4U96D 4DX1A 5CCMA 3ZUVB 5ENNA 3QWPA 4ACLA 4IRUA 4GAAA 4K5CA 1E90A 5KNGA 3PZ2A 1JCRA 2WQ6A 3QOUA 2P9IG 2NXPA 4PUCA 1OWLA 5B3SE 2IOSA 3D9OA 5EIBE 2YNQA 3APFA 3O48A 1WY6A 3MYVA 1S70B 5CEDB 4WNFA 3ABKE 3S7DA 1UOHA 4BT9A 3URZA 3RRUA 5C1DA 4CRWA 1G3NB 2OVBA 4MBGA 3FDHA 3ZIMA 2XEHA 3OXLA 2J07A 3MEKA 5ANRA 3Q73A 1N9AA 4HOQA 2PQRA 4TXRA 2KM4A 4BFRA 2I9CA 3LJNA 3P1UA 4HLLA 1N0QA 3FY4A 4GTPA 3FP3A 3JXIA 4DLOA 2XEVA 3MV2B 3UIOC 2GRRB 4K03A 1NL4A 2XZDG 1YYHA 2CHXA 3PZ4A 3ASFA 4LG6A 1OWMA 5JJ7A 5BUZA 4UI9K 2KZTB 4GMJA 5KNHD 3RIBA 4J0UA 2FBNA 4HLEA 2WM9A 5HRYA 1JPLA 3IHVA 3AU5A 3AG4E 3CV0A 2FF4A 1UG3A 1TJCA 5CMYA 1U2VG 3ZN3A 4ANXA 4BTBA 4WNGA 2AXUA 1S64A 2WB2A 5FQ4A 4FJYA 3RKVA 3TAXA 3ZKJA 1JCSA 1JUQA 3PEUB 4HQDA 2CFUA 2J8SD 3UKRG 3UM2A 2X6JA 1O1TA 2IJGX 5EILA 3FUJA 3BU8A 2XRZA 1P5QA 4CZ2D 2F8YA 3O4ZA 2R2LA 1H6OA 3W9GA 4UWKA 4OYSA 1A17A 1ELRA 3ULEG 3ZHEA 3UXGA 1HO8A 4EBAA 3UINC 3UM3A 4I1OB 5C2YA 3D9HA 3NZUA 4UWHA 2WXJA 4H7XA 5DIZA 1NZNA 3JXJA 5FJYA 5EX3A 3GYZA 4NIKA 3AU4A 2WXLA 1Y6IA 2Y3AA 3ASOE 4PS8A 3JQ1A 1K1AA 1PC2A 5JJ6A 4DX2A 4GA2A 2VTBB 5H7PA 3PEVB 3CR3A 2ZGDA 1N54A 2H6FA 5LP0A 2PNNA 3HG0D 2HM8A 2OOEA 4D10C 3ZFWA 4XZ4A 3S2AA 1O1RA 4AV7A 2GGFA 2C0LA 2P9PG 1GW6A 3HVEA 2QZAA 2RFMA 4ABNA 2BTDA 4U0ZA 3FH5A 4KZCA 1N94A 5EDSA 2F8XK 5BNWA 1X81A 4JVSA 1A5EA 4JEHA 3FEYA 3CVWA 3FUHA 3WG7E 3UPVA 3E37A 2R59A 3KEAA 4BX8A 3MKRA 5IY5E 5CHEE 2GRMA 1H0AA 3SI5A 2LSUA 3L08A 5A6CA 2KCLA 2WPVA 4G1TA 4P29A 5FWQA 4B94A 2WXHA 3SO8A 1O5MA 2DWZA 3HYMB 3CKCA 4Y6CA 3RAUA 4BEPA 5M72A 3ASHA 4C9BB 3E34A 4HOUA 4OVVA 3UM0A 1SA5A 3T8KA 2WXMA 4EZLA 4U0UA 5LCWC 4U7EB 4M7CA 3D3MA 3Q5MA 3Q79A 4L2YA 2A5UA 4JHRA 3EHNA 2AXVA 2EIJE 2PM7A 3DXMG 4F7AA 4V3IA 3FU3A 1HFAA 3MA5A 2ETCA 3C3QA 4N2QA 5FT9A 1U3DA 4C48B 4GPKA 4GYOA 2XGSA 3TGOA 4KMOA 2WXNA 3GW4A 4CT0A 4G26A 4LERA 4DPRA 3MCXA 3Q47B 2XGMA 2NYJA 3JYSA 1MX6A 3PVLA 5ENQD 4I6GA 4HI8A 1TN8A 4UWFA 4JC8A 2IOLA 1HH8A 4GYYA 5ARFA 3NF1A 3F6QA 2M63A 3ZVVA 5B1BE 2ZIRA 3UTMA 3CHSA 5KBAA 3OXFA 3AG1E 4GTTA 1KZOA 5FZRA 4HORA 5ITZF 1NFIE 4FADA 2X3MA 4GMRA 3W9FA 4L1BA 3HXEA 3CQCB 3SZ7A 5D0QD 3PZ3A 3ABME 4L7TA 2CHZA 3MV3B 3ONKA 1OCRE 3DXKG 2KATA 4O6FA 4AVXA 3EU9A 3ZNGA 2XCBA 2R03A 4L23A 4BTAA 3DSSA 3FUEA 4FP7A 2I2OA 3QAQA 4CDMA 3BUAA 3CVYA 3OXGA 3UUXA 3UT8A 1MHQA 3SHFA 3PZDA 2R5SA 1IKND 4XE0A 4GPMA 2UY1A 3QKYA 4AIFA 3VLFA 3ZYQA 4FU3A 4Q94A 3CLJA 2X6IA 5D66A 1AP7A 2DYRE 5FQ7A 2GROB 2L9BA 2WXRA 2DZOA 4C0MA 4CGWA 4B8CB 2C0MA 2HE0A 1TJFA 4UI9C 2MRIA 2XPZA 2AVPA 4MKTA 4U63A 5LX8A 4ATZD 5E75A 1HZ4A 3CHQA 3KAEA 2LO6A 3ONLA 1ZB1A 5B1AE 1V55E 3TWRA 4WAFA 2I1JA 2ZXWE 3D9LA 3HXDA 2V5QC 1HE8A 3FTWA 5JHBA 3BEEA 3QWVA 1BI7B 4DX5D 5LOZA 1ZU2A 5HS0A 5ENSD 3FH8A 3TL5A 3IBEA 4KYOB 5JHAA 3SQVA 1QNFA 4JZYA 1QBQA 1UN9A 1NI1A 1TNBA 5CERB 1N4PA 4I17A 3EHMA 2BF0X 2OEWA 3LJ3A 3ESLA 2R02A 3ZYMA 4MLPA 1KT0A 3D9IA 4N3CA 2GRNB 2XQ0A 4EECA 4XIFA 3B95A 3N71A 4JL0A 4GTVA 3ASGA 5BT1A 5CRUA 1MQSA 5AJLA 2RFAA 3L54A 4YVOA 3DSVA 3ZHEB 5CCLA 5AN8A 2X6HA 2LUHA 3FUDA 1DC2A 4GZ3A 1OXJA 2KCVA 3DPDA 2WXFA 3FUIA 4LNBA 1H2VC 4C0EA 2KXPC 5ENTD 2VSXE 3V79K 3SFZA 1BPOA 2V8SE 4TUMA 2JLBA 3C98A 2PL2A 2Y1LE 1MJ0A 1E8XA 2LNIA 2IO3C 3TWUA 3WXXA 2AXZA 5CBOA 1DVPA 3RRMB 3MGBA 4A3VA 3B7TA 4AEZC 1YMPA 3ULQA 3CVQA 2J08A 3HVEB 2WQHA 4GTOA 3BG1B 5FINA 4E6HA 3SBTB 4QFVA 4HXIA 3SGHA 5AQAA 1EDUA 4X8QA 3TWQA 3ZW3A 4Q96A 3FTZA 1W3BA 2P9LG 1N52A 5BW8C 1JCQA 1E8YA 1Y8MA 3JCKC 4I2WA 1N4SA 4GCNA 4DJAA 3AS4A 3LY7A 4EQFA 3ZYKA 2DIWA 4FLBA 4R7LA 2NSZA 3BG0B 3QARA 5BV1A 4ZFHA 2B6CA 1OT8A 4JHKA 1SZAA 3NZSA 1H2TC 4XI0A 2AW6A 4RG6A 3Q49B 4J8YA 4ANWA 3E32A 1JWFA 3FUKA 4NRHB 4ACKA 3D9PA 1S63A 4HI9A 3FTYA 3S7BA 2VSOE 4CCAA 2H6IA 1Z5SC 3B7RL 3ABLE 2XRYA 1LD8A 3FULA 4KVMA 4GA0A 1N95A 5KCMA 2CFZA 1D8EA 4DUIA 1EF1C 3KS2A 2P58C 1TNUA 4AY5A 4URKA 1BI8B 5AARA 4DX7D 2WMOA 1LTXA 2WXIA 2RKKA 1E7VA 3LXUX 2AJAA 3QB2A 4FA6A 5DBKA 1E8WA 5G05J 3L9TA 1E8ZA 4LEUA 4KBQA 2CHWA 2FULA 4U07A 3CK9A 3OAWA 1IHGA 2Y4UA 4HFGA 4FULA 1SQMA 3T8MA 4WWPA 3PUKA 3IEGA 5JMND 1BD8A 1B89A 4XKCA 3JUIA 2CG2A 3ML8A 4GZDA 4YNDA 2HR2A 3HIZA 3ASDA 4UQXA 3MKQA 2R05A 4I1AA 2RG8A 3P2BA 3L13A 5BV0A 5ENPD 3V2XA 2QYJA 3PH0C 1IYGA 2IO2C 2XPYA 1TN6A 1D9SA 4GTRA 5A23A 4YDEA 4NQ0A 4GTMA 4XKBA 2VQ2A 3FUNA 1OCZE 3PREA 2MHKA 1MYOA 2XPIA 1QQEA 4WNEA 1MZCA 3TJPA 3T5VA 2LSVA 1TNZA 2J09A 2WXOA 1XGWA 2XCCA 3IHYA 4LSZE 1FVFA 2HYZA 2VJ8A 3QNKA 3MZLB 1HX8A 1LD7A 3GZSA 3CQGB 2E0IA 4N2SA 2UY1B 4A55A 2BUGA 3Q4AB 3KSLA 3LVQE 3B13A 4DK5A 4I9EA 4B0ZA 1Q2ZA 3S7FA 3APCA 4QQIA 3E30A 2MOWA 2OCCE 3NBNB 2MYOA 3LS8A 3EDTB 4GB9A 4Z68A 3RO2A 1VDYA 5JJTA 4GZCA 3CK8A 4IN3B 5G04C 4JB8P 2AWIA 1DCQA 5FZSA 2FO7A 3FUFA 4UI9J 5A7DB 2ILRA 4O1OA 2LAIA 3CK7A 1NP7A 2P2CP 5HKPA 4A1SA 3DBSA 4ME2A 1NA3A 3B7BA 4N3BA 5EX0A 2IQCA 1YA0A 4ANUA 4DRXE 2QYUA 4RSYA 1QZ2A 2E2EA 3L6AA 3J5PA 2YINA 4B89A 2P9UG 4APFA 3U9WA 3LDZA 4LCTA 4JHJA 2VGEA 3R7QA 4I2ZA 4L9PA 4DI4A 1FCHA 5J08A 2WXGA 3NOCD 4CGVA 4FHKA 1L5JA 2X6FA 1TYQG 4K5AB 4BERA 3DPYA 3QWWA 5EN5D 3X2QE 2A5EA 1TNOA 1SZ9A 1HXIA 4U0SA 2EQXA 3PNLB 3MX3A 4NURA 4CDNA 3FU5A 2Q7FA 1SA4A 3FTXA 2I6HA 3PNTB 2QC9A 4Q69A 3CHPA 1TNYA 3Q7FA 3AG3E 3T9KA 2J49A 1WAO1 3FUMA 3RJVA 1V54E 3PUJA 5FQ8A 3R7RA 5AAOA 3C3OA 4BESA 1UJKA 1ZBPA 2YHCA 4J8FA 3Q75A 4U04A 4HRLA 2YHEA 4N5QA 5G55A 2VGXA 4DI3A 2QFCA 5CRVA 3V30A 1TN7A 1UJJA 3LY9A 4RG9A 2P9KG 3LCAA 1HG5A 1DCEA 2V0PA 1WG0A 5BXOA 3CKBA 1K3ZD 1JWGA 3DSUA 4CT4A 3HRAA 3ZEFA 3FWVA 1K1BA 3ASNE 4G23A 4JEUA 1Z3XA 2VSNA 5D2MC 2GW1A 1FT1A 3LPZA 1E7UA 3TG5A 4A63B 1TEZA 3LEWA 3KEZA 3AJIA 4BETA 5AIJA 4UWGA 4G25A 4Y6WA 4UWLA 4HRMB 3HDXA 2V4HC 5ANLA 1INZA 4EPZA 2IY0C 2UWJG 2PM6A 3UQ3A 1SW6A 3JQ0A 2EINE 3VTYA 4U8VD 4EHMA 2XEEA 4UQYA 3CHMA 1WM5A 3SNXA 4J6IA 4F1SA 3TXNA 4APOA 3V31A 4I6JA 1OWPA 3CVXA 5KJNA 4J8DA 1H2UA 4XX5A 4KZ0A 3B7SA 3QC1A 3GZ2A 3HHMA 3NB2A 5AQ9A 3PE4A 1N4QA 3CGHA 4LNUD 4G8KA 1HF8A 4OAUC 3U66A 2LXMA 1S0PA 3ISMC 2WXKA 3G2WA 2BKKB 4GZ5A 3C72A 2XS1A 1HS6A 4W9RA 4RVBA 4TUUA 3CHOA 4MRUA 2R17C 1OWNA 3VLEA 3DRAA 5ENRD 3APDA 4JXTA 5FZQA 2B0OE 2KC7A 5FIOA 5T4YA 2WVIA 1N4RA 3BQOA 3UT7A 4JA9A 5EKQD 4AM9A 2RD0A 2J4DA 3RU0A 2C2LA 2LXLA 1YCSB 2I1KA 3FU0A 3OTNA 5EIDA 4BT8A 3CIAA 3CEQA 3MJWA 3KD7A 2DCPA 2FEZA 3PZ1A 4TRQA 2DYSE 2F0YA 3I4RB 2OV8A 1O1SA 4J7WA 4G2VA 4U8YD 3MKQB 3FTUA 5AYWD 4AXHA 4G11A 3UX4A 1OUVA 5AQBA 3UM1A 5AQ7A 3ZXSA 5BPPA 4A3TA 1PAQA 3J5QB 2NC9A 3R9AB 5FQ6A 1KPSB 3TWXA 4EBAG 4F53A 1IQRA 4JPSA 3C3RA 5FTPA 3FH7A 3V2OA 2BKGA 4UQZA 2VGYA 4J8SA 2QY7A 4RQIA 4BSZB 1H6KA 3TWWA 4HVBA 4GTQA 5AENA 3T5XA 2V5FA 2A4ZA 2GRPB 4WNDA 1MX4A 2GRQB 4N5CA 3E4BA 3EJNA 1KZPA 3SD5A 3U4TA 3DSTA 4JD2G 2VYIA 4HRNA 4LRZA 3IXEA 1BLXB 3FFLA 5LCWJ 5J90A 4TV3A 3D9MA 2XZTG 3G2VA 3Q7AA 1HU3A 4MS6A 3G2SA 3SF4A 4I9CA 2GRLA 1WDYA 3G2TA 3SFXA 5CEAA 3AG2E 4NACA 4HNAD 3QJZA 4ILGA 2X6KA 2IFUA 3U64A 4N39A 4ANVA 4EZJA 3Q78A 2IU1A 1ELWA 4PS3A 4F1PA 3L16A 1Z6TA 4YDOA 5G04J 3D9KA 3SFYA 3ZPJA 3NOGD 1EYHA 3LKUA 4PS7A 3S7JA 4B93B 2EIME 3R9MA 4ILHB 2WMNA 4YDYA 4HS2A 2OVFA 1IXVA 2XENA 3HXFA 2X38A 3TXMA 3FTVA 3VLDA 1EPUA 4LUNU 4PH4B 2YQ8A 1FT2A 3UKUG 2ZU6B 3G2UA 4A1GA 4DX6D 2BEDA 2J9QA 1KLXA 2HO1A 3ZGQA 2KZTA 2FI7A 3HXBA 3IV0A 4HB5A 1FPPA 3DSXA 3EU5A 3HXCA 3UMVA 4N3AA 3VTXA 3L82A 5D0OD 4M3OA 4EZKA 3E33A 3D9NA 3ULYA 3UIPC 4BSXA 1OY3D 1XNFA 2ZISA 5HQ8A 4ILIA
chains in the Genus database with same CATH topology
4BETA 5CEAA 5EN5D 1TR4A 2A5EA 4HQDA 2RFMA 1IKND 5EIBE 1N11A 5AQAA 2NYJA 4HRMB 2J8SD 3AAAC 2V4HC 3EHRA 4HNAD 3TWQA 1MX6A 1S70B 3C5RA 4GPMA 4K5BA 5CEDB 2JABA 5ENQD 1IHBA 4QQIA 4HI8A 4HBDA 2F8XK 1SW6A 3DEOA 2L6BA 1UOHA 5EYLA 4U8VD 4O60A 2QC9A 3NBNB 1A5EA 5JMND 2XEEA 2MYOA 4J7WA 4U8YD 1MX2A 3B95A 1BD8A 5D66A 5EILA 1G3NB 3TWVA 4F1PA 1AP7A 3UI2A 3KEAA 4Z68A 3F6QA 3T9KA 4CZ2D 4UUCA 5AQBA 2XEHA 3ZU7B 2RFAA 5AQ7A 2F8YA 3NOGD 3UTMA 3W9GA 4JB8P 3J5QB 3V31A 2ETAA 2DZOA 3TWXA 4B93B 5CECB 5AN8A 5KBAA 2KBXA 3SO8A 5AAOA 1DCQA 4ZFHA 2DVWA 2DWZA 3TWTA 4BESA 1OT8A 3LJNA 2HE0A 2FO1E 2F37A 4YDYA 4BEPA 3V2OA 1DC2A 2DZNA 4HLLA 1N0QA 4HRLA 4N5QA 3JXIA 2BKGA 5AQ9A 4O1OA 1IXVA 2XENA 3UXGA 5ENPD 5CBNA 3V30A 2KXPC 3V2XA 5JA4D 2QYJA 4J8YA 2P2CP 4LNUD 5HKPA 4ATZD 5ENTD 3TWWA 4BSZB 4G8LA 4CYMD 1NFIE 5ITZF 4G8KA 3V79K 4OAUC 1D9SA 4GMRA 2XZDG 3W9FA 1YYHA 3B7BA 3D9HA 3T8KA 4TUMA 4HI9A 3JUEA 4DRXE 1WG0A 3JXJA 5KWDA 2BKKB 3TWRA 4LG6A 5BXOA 2Y1LE 4NIKA 3J5PA 1MJ0A 1MX4A 1K3ZD 2V5QC 3Q9NC 1N0RA 4OAVB 3HRAA 5ENOD 5KNHD 3TWUA 3EU9A 4DX6D 1AWCB 4ZHBA 3DEPA 4YDWA 3ZNGA 1BI7B 1K1BA 3EHQA 4DX5D 1K1AA 5CBOA 4RLYA 4DUIA 4DX2A 5HS0A 5BXUA 5HRYA 1BU9A 4U96D 1MYOA 2VGEA 5ENSD 2ZGDA 4DX1A 4HRNA 4HB5A 3ZUVB 1YMPA 3Q9UC 5ENRD 1SVXA 2ZGGA 4U95D 1BI8B 2B0OE 4F6RD 5AARA 3IXEA 4DX7D 2ETCA 1BLXB 5FIOA 3NOCD 4O1PA 4A63B 5EYPF 2PNNA 3TWSA 3HG0D 5CERB 2XZTG 4LSZE 4C48B 1QYMA 2AJAA 4K5CA 2Y0BG 5FINA 2ETBA 5KNGA 1OY3D 4K5AB 4BERA 1YCSB 1WDYA 3ZKJA 5EIDA 3AJIA 4QFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BET A;  5CEA A;  5EN5 D;  1TR4 A;  2A5E A;  4HQD A;  2RFM A;  1IKN D;  5EIB E;  1N11 A;  5AQA A;  2NYJ A;  4HRM B;  2J8S D;  3AAA C;  2V4H C;  3EHR A;  4HNA D;  3TWQ A;  1MX6 A;  1S70 B;  3C5R A;  4GPM A;  4K5B A;  5CED B;  2JAB A;  5ENQ D;  1IHB A;  4QQI A;  4HI8 A;  4HBD A;  2F8X K;  1SW6 A;  3DEO A;  2L6B A;  1UOH A;  5EYL A;  4U8V D;  4O60 A;  2QC9 A;  3NBN B;  1A5E A;  5JMN D;  2XEE A;  2MYO A;  4J7W A;  4U8Y D;  1MX2 A;  3B95 A;  1BD8 A;  5D66 A;  5EIL A;  1G3N B;  3TWV A;  4F1P A;  1AP7 A;  3UI2 A;  3KEA A;  4Z68 A;  3F6Q A;  3T9K A;  4CZ2 D;  4UUC A;  5AQB A;  2XEH A;  3ZU7 B;  2RFA A;  5AQ7 A;  2F8Y A;  3NOG D;  3UTM A;  3W9G A;  4JB8 P;  3J5Q B;  3V31 A;  2ETA A;  2DZO A;  3TWX A;  4B93 B;  5CEC B;  5AN8 A;  5KBA A;  2KBX A;  3SO8 A;  5AAO A;  1DCQ A;  4ZFH A;  2DVW A;  2DWZ A;  3TWT A;  4BES A;  1OT8 A;  3LJN A;  2HE0 A;  2FO1 E;  2F37 A;  4YDY A;  4BEP A;  3V2O A;  1DC2 A;  2DZN A;  4HLL A;  1N0Q A;  4HRL A;  4N5Q A;  3JXI A;  2BKG A;  5AQ9 A;  4O1O A;  1IXV A;  2XEN A;  3UXG A;  5ENP D;  5CBN A;  3V30 A;  2KXP C;  3V2X A;  5JA4 D;  2QYJ A;  4J8Y A;  2P2C P;  4LNU D;  5HKP A;  4ATZ D;  5ENT D;  3TWW A;  4BSZ B;  4G8L A;  4CYM D;  1NFI E;  5ITZ F;  4G8K A;  3V79 K;  4OAU C;  1D9S A;  4GMR A;  2XZD G;  3W9F A;  1YYH A;  3B7B A;  3D9H A;  3T8K A;  4TUM A;  4HI9 A;  3JUE A;  4DRX E;  1WG0 A;  3JXJ A;  5KWD A;  2BKK B;  3TWR A;  4LG6 A;  5BXO A;  2Y1L E;  4NIK A;  3J5P A;  1MJ0 A;  1MX4 A;  1K3Z D;  2V5Q C;  3Q9N C;  1N0R A;  4OAV B;  3HRA A;  5ENO D;  5KNH D;  3TWU A;  3EU9 A;  4DX6 D;  1AWC B;  4ZHB A;  3DEP A;  4YDW A;  3ZNG A;  1BI7 B;  1K1B A;  3EHQ A;  4DX5 D;  1K1A A;  5CBO A;  4RLY A;  4DUI A;  4DX2 A;  5HS0 A;  5BXU A;  5HRY A;  1BU9 A;  4U96 D;  1MYO A;  2VGE A;  5ENS D;  2ZGD A;  4DX1 A;  4HRN A;  4HB5 A;  3ZUV B;  1YMP A;  3Q9U C;  5ENR D;  1SVX A;  2ZGG A;  4U95 D;  1BI8 B;  2B0O E;  4F6R D;  5AAR A;  3IXE A;  4DX7 D;  2ETC A;  1BLX B;  5FIO A;  3NOC D;  4O1P A;  4A63 B;  5EYP F;  2PNN A;  3TWS A;  3HG0 D;  5CER B;  2XZT G;  4LSZ E;  4C48 B;  1QYM A;  2AJA A;  4K5C A;  2Y0B G;  5FIN A;  2ETB A;  5KNG A;  1OY3 D;  4K5A B;  4BER A;  1YCS B;  1WDY A;  3ZKJ A;  5EID A;  3AJI A;  4QFV A; 
#chains in the Genus database with same CATH topology
 1TR4 A;  4DLQ A;  3ESK A;  3AAA C;  3QK0 A;  5ARG A;  1OCO E;  4G24 A;  3C5R A;  2H6G A;  5HI7 A;  3L17 A;  4IYP A;  4HOT A;  4E85 A;  1OCC E;  1Z3Y A;  3FTS A;  4CDR A;  3FU6 A;  3UT4 A;  3AS5 A;  4J8E A;  3ML9 A;  3FEX A;  4B8A A;  2VGX B;  2Y4T A;  2Y69 E;  2ETA A;  3LVR E;  1DNP A;  2KBX A;  4H7Y A;  4L2L A;  3RRN B;  2FO1 E;  4KXK B;  2F37 A;  2WXP A;  4K0R A;  4XEI G;  1OWO A;  4CEM A;  2WQ7 A;  4YVQ C;  4GA1 A;  3ZRH A;  3JUE A;  2L6J A;  3Q9N C;  3DWL G;  4OAV B;  4ATG A;  1AWC B;  3DEP A;  3ENE A;  2EIL E;  4JA7 A;  2EIK E;  5G05 C;  1RZ4 A;  5BXU A;  2PZI A;  4FJZ A;  2L0T B;  4GCO A;  1SVX A;  4U95 D;  5KJM A;  3IKO B;  2CG3 A;  4F3V A;  2VTB A;  2XS8 A;  4IUL A;  1KT1 A;  3RSE G;  2XGO A;  3CVU A;  4XI9 A;  1X5B A;  3K9I A;  4JW1 A;  1N11 A;  3CVP A;  4AJW A;  2WXQ A;  4K5B A;  3FHE A;  2JAB A;  1IHB A;  5KJL A;  4HBD A;  3DEO A;  2L6B A;  5EYL A;  2L0I A;  1UW4 B;  1MX2 A;  3UI2 A;  4KVO A;  4UUC A;  3ZU7 B;  2P9N G;  2LAH A;  4WWO A;  2KCK A;  3PE3 A;  1D8D A;  2DVW A;  3TWT A;  3LY8 A;  3GZ1 A;  2DZN A;  3B7U X;  4BX9 A;  4FLH A;  3ZYL A;  4GU5 A;  5G2N A;  2IF4 A;  5CBN A;  4CYM D;  2ION A;  4TXQ A;  4GZ6 A;  4HOS A;  4GYW A;  4I43 A;  4U8H A;  4AOF A;  3CVL A;  3NAW A;  1PY1 A;  3SBS A;  4AY6 A;  1LF8 A;  5AJD A;  4WUY A;  3TG4 A;  4ZHB A;  4YDW A;  1ELK A;  2XHE A;  4AP2 A;  4RLY A;  4FC8 A;  1BU9 A;  4WWN A;  4GTS A;  4GML A;  3Q9U C;  3I5P A;  2ZGG A;  4F6R D;  2H6H A;  3I3N A;  4PDX A;  5CMW A;  2P9S G;  4O1P A;  2J4B A;  3U3W A;  5EYP F;  3TWS A;  2PQN A;  3RO3 A;  1QYM A;  3EUV A;  2Y0B G;  2ETB A;  3Q15 A;  1H19 A;  1UN8 A;  1FVH A;  3ZXP A;  3EHR A;  1HG2 A;  3CHR A;  1RW2 A;  1IQU A;  3KSQ A;  3DSW A;  3NQP A;  4I6E A;  3PRZ A;  2OEV A;  3CVN A;  4O60 A;  3TWV A;  3CST A;  4KT6 B;  5KJK A;  5E76 A;  5CEC B;  5T3R A;  1E96 B;  2JEK A;  2VSY A;  1H6P A;  3AS8 A;  4I1M A;  4LNG A;  4BWR A;  3SY2 A;  3LYA A;  3PDN A;  5JA4 D;  5LFA A;  4FHJ A;  4G8L A;  3CSF A;  2IEJ A;  3CVV A;  3RK6 A;  4BY6 A;  3EIJ A;  5KWD A;  1U3C A;  2DBA A;  2OND A;  3I4G A;  1N0R A;  3D9J A;  5ENO D;  3EIQ C;  3L22 A;  1NA0 A;  1K8K G;  3EHQ A;  4OVU A;  3QDN A;  2V4L A;  5T8I A;  3PS6 A;  4TXP A;  4U96 D;  4DX1 A;  5CCM A;  3ZUV B;  5ENN A;  3QWP A;  4ACL A;  4IRU A;  4GAA A;  4K5C A;  1E90 A;  5KNG A;  3PZ2 A;  1JCR A;  2WQ6 A;  3QOU A;  2P9I G;  2NXP A;  4PUC A;  1OWL A;  5B3S E;  2IOS A;  3D9O A;  5EIB E;  2YNQ A;  3APF A;  3O48 A;  1WY6 A;  3MYV A;  1S70 B;  5CED B;  4WNF A;  3ABK E;  3S7D A;  1UOH A;  4BT9 A;  3URZ A;  3RRU A;  5C1D A;  4CRW A;  1G3N B;  2OVB A;  4MBG A;  3FDH A;  3ZIM A;  2XEH A;  3OXL A;  2J07 A;  3MEK A;  5ANR A;  3Q73 A;  1N9A A;  4HOQ A;  2PQR A;  4TXR A;  2KM4 A;  4BFR A;  2I9C A;  3LJN A;  3P1U A;  4HLL A;  1N0Q A;  3FY4 A;  4GTP A;  3FP3 A;  3JXI A;  4DLO A;  2XEV A;  3MV2 B;  3UIO C;  2GRR B;  4K03 A;  1NL4 A;  2XZD G;  1YYH A;  2CHX A;  3PZ4 A;  3ASF A;  4LG6 A;  1OWM A;  5JJ7 A;  5BUZ A;  4UI9 K;  2KZT B;  4GMJ A;  5KNH D;  3RIB A;  4J0U A;  2FBN A;  4HLE A;  2WM9 A;  5HRY A;  1JPL A;  3IHV A;  3AU5 A;  3AG4 E;  3CV0 A;  2FF4 A;  1UG3 A;  1TJC A;  5CMY A;  1U2V G;  3ZN3 A;  4ANX A;  4BTB A;  4WNG A;  2AXU A;  1S64 A;  2WB2 A;  5FQ4 A;  4FJY A;  3RKV A;  3TAX A;  3ZKJ A;  1JCS A;  1JUQ A;  3PEU B;  4HQD A;  2CFU A;  2J8S D;  3UKR G;  3UM2 A;  2X6J A;  1O1T A;  2IJG X;  5EIL A;  3FUJ A;  3BU8 A;  2XRZ A;  1P5Q A;  4CZ2 D;  2F8Y A;  3O4Z A;  2R2L A;  1H6O A;  3W9G A;  4UWK A;  4OYS A;  1A17 A;  1ELR A;  3ULE G;  3ZHE A;  3UXG A;  1HO8 A;  4EBA A;  3UIN C;  3UM3 A;  4I1O B;  5C2Y A;  3D9H A;  3NZU A;  4UWH A;  2WXJ A;  4H7X A;  5DIZ A;  1NZN A;  3JXJ A;  5FJY A;  5EX3 A;  3GYZ A;  4NIK A;  3AU4 A;  2WXL A;  1Y6I A;  2Y3A A;  3ASO E;  4PS8 A;  3JQ1 A;  1K1A A;  1PC2 A;  5JJ6 A;  4DX2 A;  4GA2 A;  2VTB B;  5H7P A;  3PEV B;  3CR3 A;  2ZGD A;  1N54 A;  2H6F A;  5LP0 A;  2PNN A;  3HG0 D;  2HM8 A;  2OOE A;  4D10 C;  3ZFW A;  4XZ4 A;  3S2A A;  1O1R A;  4AV7 A;  2GGF A;  2C0L A;  2P9P G;  1GW6 A;  3HVE A;  2QZA A;  2RFM A;  4ABN A;  2BTD A;  4U0Z A;  3FH5 A;  4KZC A;  1N94 A;  5EDS A;  2F8X K;  5BNW A;  1X81 A;  4JVS A;  1A5E A;  4JEH A;  3FEY A;  3CVW A;  3FUH A;  3WG7 E;  3UPV A;  3E37 A;  2R59 A;  3KEA A;  4BX8 A;  3MKR A;  5IY5 E;  5CHE E;  2GRM A;  1H0A A;  3SI5 A;  2LSU A;  3L08 A;  5A6C A;  2KCL A;  2WPV A;  4G1T A;  4P29 A;  5FWQ A;  4B94 A;  2WXH A;  3SO8 A;  1O5M A;  2DWZ A;  3HYM B;  3CKC A;  4Y6C A;  3RAU A;  4BEP A;  5M72 A;  3ASH A;  4C9B B;  3E34 A;  4HOU A;  4OVV A;  3UM0 A;  1SA5 A;  3T8K A;  2WXM A;  4EZL A;  4U0U A;  5LCW C;  4U7E B;  4M7C A;  3D3M A;  3Q5M A;  3Q79 A;  4L2Y A;  2A5U A;  4JHR A;  3EHN A;  2AXV A;  2EIJ E;  2PM7 A;  3DXM G;  4F7A A;  4V3I A;  3FU3 A;  1HFA A;  3MA5 A;  2ETC A;  3C3Q A;  4N2Q A;  5FT9 A;  1U3D A;  4C48 B;  4GPK A;  4GYO A;  2XGS A;  3TGO A;  4KMO A;  2WXN A;  3GW4 A;  4CT0 A;  4G26 A;  4LER A;  4DPR A;  3MCX A;  3Q47 B;  2XGM A;  2NYJ A;  3JYS A;  1MX6 A;  3PVL A;  5ENQ D;  4I6G A;  4HI8 A;  1TN8 A;  4UWF A;  4JC8 A;  2IOL A;  1HH8 A;  4GYY A;  5ARF A;  3NF1 A;  3F6Q A;  2M63 A;  3ZVV A;  5B1B E;  2ZIR A;  3UTM A;  3CHS A;  5KBA A;  3OXF A;  3AG1 E;  4GTT A;  1KZO A;  5FZR A;  4HOR A;  5ITZ F;  1NFI E;  4FAD A;  2X3M A;  4GMR A;  3W9F A;  4L1B A;  3HXE A;  3CQC B;  3SZ7 A;  5D0Q D;  3PZ3 A;  3ABM E;  4L7T A;  2CHZ A;  3MV3 B;  3ONK A;  1OCR E;  3DXK G;  2KAT A;  4O6F A;  4AVX A;  3EU9 A;  3ZNG A;  2XCB A;  2R03 A;  4L23 A;  4BTA A;  3DSS A;  3FUE A;  4FP7 A;  2I2O A;  3QAQ A;  4CDM A;  3BUA A;  3CVY A;  3OXG A;  3UUX A;  3UT8 A;  1MHQ A;  3SHF A;  3PZD A;  2R5S A;  1IKN D;  4XE0 A;  4GPM A;  2UY1 A;  3QKY A;  4AIF A;  3VLF A;  3ZYQ A;  4FU3 A;  4Q94 A;  3CLJ A;  2X6I A;  5D66 A;  1AP7 A;  2DYR E;  5FQ7 A;  2GRO B;  2L9B A;  2WXR A;  2DZO A;  4C0M A;  4CGW A;  4B8C B;  2C0M A;  2HE0 A;  1TJF A;  4UI9 C;  2MRI A;  2XPZ A;  2AVP A;  4MKT A;  4U63 A;  5LX8 A;  4ATZ D;  5E75 A;  1HZ4 A;  3CHQ A;  3KAE A;  2LO6 A;  3ONL A;  1ZB1 A;  5B1A E;  1V55 E;  3TWR A;  4WAF A;  2I1J A;  2ZXW E;  3D9L A;  3HXD A;  2V5Q C;  1HE8 A;  3FTW A;  5JHB A;  3BEE A;  3QWV A;  1BI7 B;  4DX5 D;  5LOZ A;  1ZU2 A;  5HS0 A;  5ENS D;  3FH8 A;  3TL5 A;  3IBE A;  4KYO B;  5JHA A;  3SQV A;  1QNF A;  4JZY A;  1QBQ A;  1UN9 A;  1NI1 A;  1TNB A;  5CER B;  1N4P A;  4I17 A;  3EHM A;  2BF0 X;  2OEW A;  3LJ3 A;  3ESL A;  2R02 A;  3ZYM A;  4MLP A;  1KT0 A;  3D9I A;  4N3C A;  2GRN B;  2XQ0 A;  4EEC A;  4XIF A;  3B95 A;  3N71 A;  4JL0 A;  4GTV A;  3ASG A;  5BT1 A;  5CRU A;  1MQS A;  5AJL A;  2RFA A;  3L54 A;  4YVO A;  3DSV A;  3ZHE B;  5CCL A;  5AN8 A;  2X6H A;  2LUH A;  3FUD A;  1DC2 A;  4GZ3 A;  1OXJ A;  2KCV A;  3DPD A;  2WXF A;  3FUI A;  4LNB A;  1H2V C;  4C0E A;  2KXP C;  5ENT D;  2VSX E;  3V79 K;  3SFZ A;  1BPO A;  2V8S E;  4TUM A;  2JLB A;  3C98 A;  2PL2 A;  2Y1L E;  1MJ0 A;  1E8X A;  2LNI A;  2IO3 C;  3TWU A;  3WXX A;  2AXZ A;  5CBO A;  1DVP A;  3RRM B;  3MGB A;  4A3V A;  3B7T A;  4AEZ C;  1YMP A;  3ULQ A;  3CVQ A;  2J08 A;  3HVE B;  2WQH A;  4GTO A;  3BG1 B;  5FIN A;  4E6H A;  3SBT B;  4QFV A;  4HXI A;  3SGH A;  5AQA A;  1EDU A;  4X8Q A;  3TWQ A;  3ZW3 A;  4Q96 A;  3FTZ A;  1W3B A;  2P9L G;  1N52 A;  5BW8 C;  1JCQ A;  1E8Y A;  1Y8M A;  3JCK C;  4I2W A;  1N4S A;  4GCN A;  4DJA A;  3AS4 A;  3LY7 A;  4EQF A;  3ZYK A;  2DIW A;  4FLB A;  4R7L A;  2NSZ A;  3BG0 B;  3QAR A;  5BV1 A;  4ZFH A;  2B6C A;  1OT8 A;  4JHK A;  1SZA A;  3NZS A;  1H2T C;  4XI0 A;  2AW6 A;  4RG6 A;  3Q49 B;  4J8Y A;  4ANW A;  3E32 A;  1JWF A;  3FUK A;  4NRH B;  4ACK A;  3D9P A;  1S63 A;  4HI9 A;  3FTY A;  3S7B A;  2VSO E;  4CCA A;  2H6I A;  1Z5S C;  3B7R L;  3ABL E;  2XRY A;  1LD8 A;  3FUL A;  4KVM A;  4GA0 A;  1N95 A;  5KCM A;  2CFZ A;  1D8E A;  4DUI A;  1EF1 C;  3KS2 A;  2P58 C;  1TNU A;  4AY5 A;  4URK A;  1BI8 B;  5AAR A;  4DX7 D;  2WMO A;  1LTX A;  2WXI A;  2RKK A;  1E7V A;  3LXU X;  2AJA A;  3QB2 A;  4FA6 A;  5DBK A;  1E8W A;  5G05 J;  3L9T A;  1E8Z A;  4LEU A;  4KBQ A;  2CHW A;  2FUL A;  4U07 A;  3CK9 A;  3OAW A;  1IHG A;  2Y4U A;  4HFG A;  4FUL A;  1SQM A;  3T8M A;  4WWP A;  3PUK A;  3IEG A;  5JMN D;  1BD8 A;  1B89 A;  4XKC A;  3JUI A;  2CG2 A;  3ML8 A;  4GZD A;  4YND A;  2HR2 A;  3HIZ A;  3ASD A;  4UQX A;  3MKQ A;  2R05 A;  4I1A A;  2RG8 A;  3P2B A;  3L13 A;  5BV0 A;  5ENP D;  3V2X A;  2QYJ A;  3PH0 C;  1IYG A;  2IO2 C;  2XPY A;  1TN6 A;  1D9S A;  4GTR A;  5A23 A;  4YDE A;  4NQ0 A;  4GTM A;  4XKB A;  2VQ2 A;  3FUN A;  1OCZ E;  3PRE A;  2MHK A;  1MYO A;  2XPI A;  1QQE A;  4WNE A;  1MZC A;  3TJP A;  3T5V A;  2LSV A;  1TNZ A;  2J09 A;  2WXO A;  1XGW A;  2XCC A;  3IHY A;  4LSZ E;  1FVF A;  2HYZ A;  2VJ8 A;  3QNK A;  3MZL B;  1HX8 A;  1LD7 A;  3GZS A;  3CQG B;  2E0I A;  4N2S A;  2UY1 B;  4A55 A;  2BUG A;  3Q4A B;  3KSL A;  3LVQ E;  3B13 A;  4DK5 A;  4I9E A;  4B0Z A;  1Q2Z A;  3S7F A;  3APC A;  4QQI A;  3E30 A;  2MOW A;  2OCC E;  3NBN B;  2MYO A;  3LS8 A;  3EDT B;  4GB9 A;  4Z68 A;  3RO2 A;  1VDY A;  5JJT A;  4GZC A;  3CK8 A;  4IN3 B;  5G04 C;  4JB8 P;  2AWI A;  1DCQ A;  5FZS A;  2FO7 A;  3FUF A;  4UI9 J;  5A7D B;  2ILR A;  4O1O A;  2LAI A;  3CK7 A;  1NP7 A;  2P2C P;  5HKP A;  4A1S A;  3DBS A;  4ME2 A;  1NA3 A;  3B7B A;  4N3B A;  5EX0 A;  2IQC A;  1YA0 A;  4ANU A;  4DRX E;  2QYU A;  4RSY A;  1QZ2 A;  2E2E A;  3L6A A;  3J5P A;  2YIN A;  4B89 A;  2P9U G;  4APF A;  3U9W A;  3LDZ A;  4LCT A;  4JHJ A;  2VGE A;  3R7Q A;  4I2Z A;  4L9P A;  4DI4 A;  1FCH A;  5J08 A;  2WXG A;  3NOC D;  4CGV A;  4FHK A;  1L5J A;  2X6F A;  1TYQ G;  4K5A B;  4BER A;  3DPY A;  3QWW A;  5EN5 D;  3X2Q E;  2A5E A;  1TNO A;  1SZ9 A;  1HXI A;  4U0S A;  2EQX A;  3PNL B;  3MX3 A;  4NUR A;  4CDN A;  3FU5 A;  2Q7F A;  1SA4 A;  3FTX A;  2I6H A;  3PNT B;  2QC9 A;  4Q69 A;  3CHP A;  1TNY A;  3Q7F A;  3AG3 E;  3T9K A;  2J49 A;  1WAO 1;  3FUM A;  3RJV A;  1V54 E;  3PUJ A;  5FQ8 A;  3R7R A;  5AAO A;  3C3O A;  4BES A;  1UJK A;  1ZBP A;  2YHC A;  4J8F A;  3Q75 A;  4U04 A;  4HRL A;  2YHE A;  4N5Q A;  5G55 A;  2VGX A;  4DI3 A;  2QFC A;  5CRV A;  3V30 A;  1TN7 A;  1UJJ A;  3LY9 A;  4RG9 A;  2P9K G;  3LCA A;  1HG5 A;  1DCE A;  2V0P A;  1WG0 A;  5BXO A;  3CKB A;  1K3Z D;  1JWG A;  3DSU A;  4CT4 A;  3HRA A;  3ZEF A;  3FWV A;  1K1B A;  3ASN E;  4G23 A;  4JEU A;  1Z3X A;  2VSN A;  5D2M C;  2GW1 A;  1FT1 A;  3LPZ A;  1E7U A;  3TG5 A;  4A63 B;  1TEZ A;  3LEW A;  3KEZ A;  3AJI A;  4BET A;  5AIJ A;  4UWG A;  4G25 A;  4Y6W A;  4UWL A;  4HRM B;  3HDX A;  2V4H C;  5ANL A;  1INZ A;  4EPZ A;  2IY0 C;  2UWJ G;  2PM6 A;  3UQ3 A;  1SW6 A;  3JQ0 A;  2EIN E;  3VTY A;  4U8V D;  4EHM A;  2XEE A;  4UQY A;  3CHM A;  1WM5 A;  3SNX A;  4J6I A;  4F1S A;  3TXN A;  4APO A;  3V31 A;  4I6J A;  1OWP A;  3CVX A;  5KJN A;  4J8D A;  1H2U A;  4XX5 A;  4KZ0 A;  3B7S A;  3QC1 A;  3GZ2 A;  3HHM A;  3NB2 A;  5AQ9 A;  3PE4 A;  1N4Q A;  3CGH A;  4LNU D;  4G8K A;  1HF8 A;  4OAU C;  3U66 A;  2LXM A;  1S0P A;  3ISM C;  2WXK A;  3G2W A;  2BKK B;  4GZ5 A;  3C72 A;  2XS1 A;  1HS6 A;  4W9R A;  4RVB A;  4TUU A;  3CHO A;  4MRU A;  2R17 C;  1OWN A;  3VLE A;  3DRA A;  5ENR D;  3APD A;  4JXT A;  5FZQ A;  2B0O E;  2KC7 A;  5FIO A;  5T4Y A;  2WVI A;  1N4R A;  3BQO A;  3UT7 A;  4JA9 A;  5EKQ D;  4AM9 A;  2RD0 A;  2J4D A;  3RU0 A;  2C2L A;  2LXL A;  1YCS B;  2I1K A;  3FU0 A;  3OTN A;  5EID A;  4BT8 A;  3CIA A;  3CEQ A;  3MJW A;  3KD7 A;  2DCP A;  2FEZ A;  3PZ1 A;  4TRQ A;  2DYS E;  2F0Y A;  3I4R B;  2OV8 A;  1O1S A;  4J7W A;  4G2V A;  4U8Y D;  3MKQ B;  3FTU A;  5AYW D;  4AXH A;  4G11 A;  3UX4 A;  1OUV A;  5AQB A;  3UM1 A;  5AQ7 A;  3ZXS A;  5BPP A;  4A3T A;  1PAQ A;  3J5Q B;  2NC9 A;  3R9A B;  5FQ6 A;  1KPS B;  3TWX A;  4EBA G;  4F53 A;  1IQR A;  4JPS A;  3C3R A;  5FTP A;  3FH7 A;  3V2O A;  2BKG A;  4UQZ A;  2VGY A;  4J8S A;  2QY7 A;  4RQI A;  4BSZ B;  1H6K A;  3TWW A;  4HVB A;  4GTQ A;  5AEN A;  3T5X A;  2V5F A;  2A4Z A;  2GRP B;  4WND A;  1MX4 A;  2GRQ B;  4N5C A;  3E4B A;  3EJN A;  1KZP A;  3SD5 A;  3U4T A;  3DST A;  4JD2 G;  2VYI A;  4HRN A;  4LRZ A;  3IXE A;  1BLX B;  3FFL A;  5LCW J;  5J90 A;  4TV3 A;  3D9M A;  2XZT G;  3G2V A;  3Q7A A;  1HU3 A;  4MS6 A;  3G2S A;  3SF4 A;  4I9C A;  2GRL A;  1WDY A;  3G2T A;  3SFX A;  5CEA A;  3AG2 E;  4NAC A;  4HNA D;  3QJZ A;  4ILG A;  2X6K A;  2IFU A;  3U64 A;  4N39 A;  4ANV A;  4EZJ A;  3Q78 A;  2IU1 A;  1ELW A;  4PS3 A;  4F1P A;  3L16 A;  1Z6T A;  4YDO A;  5G04 J;  3D9K A;  3SFY A;  3ZPJ A;  3NOG D;  1EYH A;  3LKU A;  4PS7 A;  3S7J A;  4B93 B;  2EIM E;  3R9M A;  4ILH B;  2WMN A;  4YDY A;  4HS2 A;  2OVF A;  1IXV A;  2XEN A;  3HXF A;  2X38 A;  3TXM A;  3FTV A;  3VLD A;  1EPU A;  4LUN U;  4PH4 B;  2YQ8 A;  1FT2 A;  3UKU G;  2ZU6 B;  3G2U A;  4A1G A;  4DX6 D;  2BED A;  2J9Q A;  1KLX A;  2HO1 A;  3ZGQ A;  2KZT A;  2FI7 A;  3HXB A;  3IV0 A;  4HB5 A;  1FPP A;  3DSX A;  3EU5 A;  3HXC A;  3UMV A;  4N3A A;  3VTX A;  3L82 A;  5D0O D;  4M3O A;  4EZK A;  3E33 A;  3D9N A;  3ULY A;  3UIP C;  4BSX A;  1OY3 D;  1XNF A;  2ZIS A;  5HQ8 A;  4ILI A; 
#chains in the Genus database with same CATH homology
 4BET A;  5CEA A;  5EN5 D;  1TR4 A;  2A5E A;  4HQD A;  2RFM A;  1IKN D;  5EIB E;  1N11 A;  5AQA A;  2NYJ A;  4HRM B;  2J8S D;  3AAA C;  2V4H C;  3EHR A;  4HNA D;  3TWQ A;  1MX6 A;  1S70 B;  3C5R A;  4GPM A;  4K5B A;  5CED B;  2JAB A;  5ENQ D;  1IHB A;  4QQI A;  4HI8 A;  4HBD A;  2F8X K;  1SW6 A;  3DEO A;  2L6B A;  1UOH A;  5EYL A;  4U8V D;  4O60 A;  2QC9 A;  3NBN B;  1A5E A;  5JMN D;  2XEE A;  2MYO A;  4J7W A;  4U8Y D;  1MX2 A;  3B95 A;  1BD8 A;  5D66 A;  5EIL A;  1G3N B;  3TWV A;  4F1P A;  1AP7 A;  3UI2 A;  3KEA A;  4Z68 A;  3F6Q A;  3T9K A;  4CZ2 D;  4UUC A;  5AQB A;  2XEH A;  3ZU7 B;  2RFA A;  5AQ7 A;  2F8Y A;  3NOG D;  3UTM A;  3W9G A;  4JB8 P;  3J5Q B;  3V31 A;  2ETA A;  2DZO A;  3TWX A;  4B93 B;  5CEC B;  5AN8 A;  5KBA A;  2KBX A;  3SO8 A;  5AAO A;  1DCQ A;  4ZFH A;  2DVW A;  2DWZ A;  3TWT A;  4BES A;  1OT8 A;  3LJN A;  2HE0 A;  2FO1 E;  2F37 A;  4YDY A;  4BEP A;  3V2O A;  1DC2 A;  2DZN A;  4HLL A;  1N0Q A;  4HRL A;  4N5Q A;  3JXI A;  2BKG A;  5AQ9 A;  4O1O A;  1IXV A;  2XEN A;  3UXG A;  5ENP D;  5CBN A;  3V30 A;  2KXP C;  3V2X A;  5JA4 D;  2QYJ A;  4J8Y A;  2P2C P;  4LNU D;  5HKP A;  4ATZ D;  5ENT D;  3TWW A;  4BSZ B;  4G8L A;  4CYM D;  1NFI E;  5ITZ F;  4G8K A;  3V79 K;  4OAU C;  1D9S A;  4GMR A;  2XZD G;  3W9F A;  1YYH A;  3B7B A;  3D9H A;  3T8K A;  4TUM A;  4HI9 A;  3JUE A;  4DRX E;  1WG0 A;  3JXJ A;  5KWD A;  2BKK B;  3TWR A;  4LG6 A;  5BXO A;  2Y1L E;  4NIK A;  3J5P A;  1MJ0 A;  1MX4 A;  1K3Z D;  2V5Q C;  3Q9N C;  1N0R A;  4OAV B;  3HRA A;  5ENO D;  5KNH D;  3TWU A;  3EU9 A;  4DX6 D;  1AWC B;  4ZHB A;  3DEP A;  4YDW A;  3ZNG A;  1BI7 B;  1K1B A;  3EHQ A;  4DX5 D;  1K1A A;  5CBO A;  4RLY A;  4DUI A;  4DX2 A;  5HS0 A;  5BXU A;  5HRY A;  1BU9 A;  4U96 D;  1MYO A;  2VGE A;  5ENS D;  2ZGD A;  4DX1 A;  4HRN A;  4HB5 A;  3ZUV B;  1YMP A;  3Q9U C;  5ENR D;  1SVX A;  2ZGG A;  4U95 D;  1BI8 B;  2B0O E;  4F6R D;  5AAR A;  3IXE A;  4DX7 D;  2ETC A;  1BLX B;  5FIO A;  3NOC D;  4O1P A;  4A63 B;  5EYP F;  2PNN A;  3TWS A;  3HG0 D;  5CER B;  2XZT G;  4LSZ E;  4C48 B;  1QYM A;  2AJA A;  4K5C A;  2Y0B G;  5FIN A;  2ETB A;  5KNG A;  1OY3 D;  4K5A B;  4BER A;  1YCS B;  1WDY A;  3ZKJ A;  5EID A;  3AJI A;  4QFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...