3URZA

Crystal structure of a putative protein binding protein (bacova_03105) from bacteroides ovatus atcc 8483 at 2.19 a resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
201
Chain Sequence
SVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYKSPTKMQYARYRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACOVA_03105) from Bacteroides ovatus ATCC 8483 at 2.19 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Protein binding
total genus 70
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3urzA00
4NQ0A 3ULQA 2HR2A 1P5QA 4XI0A 2P58C 2C2LA 4CDRA 4GYYA 3CVLA 3KS2A 3QWPA 4WNFA 2Y4TA 4BWRA 3SF4A 3AS8A 1B89A 4UI9J 2MHKA 4J8EA 5EX0A 4G24A 3LYAA 1ELWA 5DIZA 3JYSA 3URZA 4ABNA 2L6JA 4JA9A 4AY5A 5FTPA 2OOEA 4G26A 3U3WA 4CGVA 1XNFA 1QQEA 2LNIA 5JJ7A 3FWVA 2UY1A 4HOTA 2VGYA 4YVOA 4U0ZA 1PC2A 5DBKA 3ZN3A 3MKRA 4N3CA 3RO2A 4U0SA 4APOA 4GA2A 3ZHEB 1NZNA 4U07A 3CKCA 4N5CA 3VTXA 2YQ8A 4B94A 3CK9A 3RJVA 2QFCA 4I2WA 4XIFA 5CCLA 5AYWD 5G04C 1W3BA 3CEQA 3RKVA 4HOUA 4IN3B 4WUYA 4KBQA 3E4BA 2UWJG 4EQFA 3UQ3A 4Y6WA 4YNDA 3AS4A 3TG4A 5G05J 5ARFA 3GW4A 4GZ3A 4KXKB 3SZ7A 3IEGA 3MV2B 4KYOB 4HOSA 3ZPJA 4BTBA 4N3BA 1FCHA 3LKUA 5EKQD 4JA7A 1WM5A 4O6FA 1KT1A 3CVQA 4U0UA 4U04A 3BEEA 3CVPA 2LSVA 3S7BA 1HXIA 4H7YA 1KLXA 5BT1A 3Q4AB 4I1AA 4UI9C 5FT9A 3OXGA 4N39A 3LCAA 1HZ4A 3KAEA 5CHEE 3CKBA 2WQHA 3RU0A 3TG5A 3GZ1A 4BT8A 4UQXA 4GYWA 2XCBA 2PZIA 5D0OD 1A17A 2IF4A 3Q15A 4H7XA 4AM9A 2UY1B 2PL2A 4N2SA 2KCVA 2FBNA 2XPIA 5BW8C 5A6CA 3QDNA 3UPVA 1ELRA 2XCCA 5M72A 2PQNA 2KATA 3ASFA 2VGXA 4G25A 2HYZA 2KCLA 3LY9A 4AY6A 3ASGA 2XGOA 3NF1A 3GZ2A 3ASHA 4YVQC 3R9AB 3N71A 3TGOA 4LEUA 4HOQA 5LCWJ 3S7DA 3QOUA 5BNWA 3LPZA 4I17A 4N2QA 4HORA 1YA0A 2GW1A 3PDNA 4I9CA 3HYMB 4GZ5A 3ZFWA 3QKYA 4I9EA 2AVPA 4RG6A 3UUXA 4WNGA 3OXFA 3O48A 3Q5MA 4NRHB 3GYZA 5G05C 4GPKA 3S7JA 2FEZA 2R5SA 3RIBA 2Q7FA 2HO1A 2C0LA 4ME2A 5A7DB 4RG9A 5FZQA 4I2ZA 3VTYA 1KT0A 4J8FA 3ASDA 4Y6CA 3LY8A 4UI9K 2KC7A 3U4TA 3Q47B 3MA5A 2FF4A 1HH8A 2C0MA 2VYIA 1QZ2A 4UQZA 2VSNA 2XGMA 3MEKA 2VQ2A 4BT9A 2BUGA 5KJLA 4GZ6A 5KJMA 5ARGA 5KJNA 2PQRA 4JHRA 2J9QA 2Y4UA 3FFLA 1NA3A 3CVNA 3PE4A 4GCNA 2DBAA 3AS5A 4GA1A 5KJKA 5FZRA 3CK7A 2XEVA 1E96B 4GA0A 4J0UA 2KCKA 2VGXB 2VSYA 4W9RA 3MV3B 3LY7A 4XI9A 1NA0A 1ZBPA 3CK8A 3FP3A 3EDTB 2JLBA 4G23A 5C1DA 4GCOA 3WXXA 4J8DA 2I6HA 5JJ6A 2FO7A 2WPVA 4A1SA 4G1TA 4WNDA 2FI7A 3CV0A 1WAO1 2YHCA 3TAXA 5EX3A 3QWVA 2LSUA 5LCWC 3ESKA 5HI7A 3S7FA 2ONDA 3ZHEA 5G04J 2E2EA 5D0QD 1TJCA 1IHGA 2XGSA 3QWWA 3ZGQA 3PE3A 5JJTA 3RO3A 2NC9A 5FJYA 4N3AA 4JL0A 4G2VA 4UQYA 5FZSA 2V5FA 1ZU2A 4F3VA 3KD7A 5HQ8A 3OXLA 1IYGA 1OUVA 4AIFA 4CGWA 3Q49B 4BTAA 1Y8MA 3K9IA 4GYOA 5CCMA 4WNEA 2IFUA
chains in the Genus database with same CATH superfamily
1TNYA 3ML9A 3SBSA 4DUIA 1Q2ZA 4TV3A 4BX8A 3FUMA 3JUEA 4WWNA 3FUHA 2P58C 3SFXA 3OTNA 3VLDA 2HM8A 4ANXA 4WNFA 1N94A 1B89A 4UWKA 3IKOB 4V3IA 5IY5E 3TXNA 5DIZA 2IO3C 3UT4A 3JYSA 3FULA 4TUMA 4E85A 4AY5A 1V54E 2WXQA 1OWLA 4CEMA 4IRUA 2H6IA 4DRXE 3ZVVA 3TXMA 3U3WA 4B8AA 2CFZA 4JXTA 2XRYA 2YHEA 3L13A 1QQEA 3Q9UC 4EZKA 2YINA 3C3OA 5J08A 3JCKC 2UY1A 3DSVA 3FEXA 5ANLA 2VGYA 1NFIE 3Q7AA 2BEDA 5DBKA 1UN8A 4KVMA 2J49A 4K5AB 4QQIA 4APOA 4B0ZA 5CEDB 2CFUA 3SQVA 3ZHEB 4UWFA 3ZXPA 3CKCA 4ILHB 3R7RA 3VTXA 3J5QB 2OV8A 5BV1A 2XEEA 4PDXA 4PS8A 2VJ8A 4HOUA 4IN3B 5EYLA 5G2NA 2CHWA 4LNUD 4O1PA 3JQ0A 4LG6A 4Y6WA 3HXDA 1KZPA 3TG4A 3D9HA 5KNHD 3FU3A 3GZSA 1INZA 1AP7A 2DVWA 3IEGA 1DCQA 4HOSA 4G11A 4JHJA 4BX9A 4XX5A 5EKQD 3CVQA 2F8YA 3AG1E 3UI2A 3G2WA 2J08A 1E7VA 2XHEA 3TWWA 4H7YA 2OEWA 3DSSA 3PEUB 2GGFA 3KAEA 3ZNGA 1SZAA 3B7BA 1HO8A 1UOHA 2X6IA 4F6RD 3RU0A 3TG5A 4Q94A 3GZ1A 3B7TA 4I6EA 3I4GA 3VLFA 2PZIA 1SZ9A 4PS7A 5J90A 2XS8A 1A17A 2I2OA 2IF4A 2XZDG 4AM9A 1U3DA 1H6OA 2KCVA 4WWOA 3D9PA 2VTBB 3TWVA 1D9SA 2PQNA 3ZKJA 3ASFA 3ULYA 4G25A 1LD8A 3PH0C 3FUDA 1O5MA 3Q75A 3U66A 3GZ2A 3T8MA 4HOQA 3FTZA 3D9IA 5H7PA 3APFA 4JZYA 3CHPA 3SNXA 2MYOA 4DX7D 3UIOC 2E0IA 2BKKB 5BXUA 4NURA 3FTVA 2RG8A 4RG6A 2MRIA 1HG2A 3IV0A 4B8CB 1L5JA 4NRHB 4GMJA 1ZB1A 3GYZA 2R03A 3SFYA 3IHYA 5AQBA 4ME2A 4RG9A 1K3ZD 2J09A 3VTYA 3FUFA 4J6IA 1H6KA 2WXPA 4GAAA 2R02A 4BEPA 1G3NB 4OVUA 3HIZA 3MA5A 1TJFA 2I9CA 2XPYA 3EIJA 3E30A 1QZ2A 3EIQC 3W9FA 1TNUA 3MEKA 4HBDA 1UJKA 5KJMA 2V5QC 5AQAA 2XRZA 5HS0A 4LRZA 5C2YA 3ABLE 5EDSA 4UWLA 4KMOA 3PE4A 4ZHBA 3TWTA 4FJYA 1VDYA 4ANUA 5FZRA 3SO8A 3NQPA 2GRLA 2QY7A 2VGXB 1N95A 2VSYA 4W9RA 1PAQA 4I1MA 3MV3B 3PZ3A 1KZOA 2F8XK 3Q7FA 1NA0A 2XQ0A 3CHQA 3J5PA 3FP3A 3EDTB 4G23A 1OY3D 4GCOA 5CEAA 4GTSA 3WXXA 5AARA 5JJ6A 3PZDA 3ABKE 4DX2A 1FVHA 3FUEA 4JVSA 1N0RA 3QARA 3CV0A 1WAO1 2RFAA 2EIKE 5EX3A 4DK5A 3ESKA 5E76A 4U7EB 2A5UA 1XGWA 1A5EA 3MYVA 5JMND 3PE3A 3Q79A 4I43A 5JJTA 2NC9A 2XPZA 4JL0A 2DCPA 4U95D 4G2VA 1LTXA 2ZGDA 2V5FA 1TNOA 1ZU2A 1MX4A 1N4SA 3KD7A 3ZYKA 3FH7A 4U8HA 3CVUA 1H2TC 2MOWA 1OUVA 4BESA 4CGWA 1QBQA 3TJPA 2H6GA 1BLXB 4U8YD 4WNEA 4F1SA 2ZGGA 3DPYA 3SI5A 4NQ0A 1HFAA 2ETAA 4MLPA 2HR2A 4BFRA 1P5QA 4XI0A 3LS8A 3CIAA 5CECB 5JA4D 3CHSA 1EDUA 3CVLA 2J07A 2KBXA 3CQGB 2EIJE 4XKBA 1U2VG 3D9OA 2R05A 2P9SG 1N52A 2MHKA 3BG0B 5EX0A 5ITZF 2BKGA 4G24A 3LYAA 1ELWA 3UXGA 1DC2A 2R2LA 4GMLA 1U3CA 3T9KA 4CCAA 2AXUA 3TL5A 3LDZA 4GU5A 2L6JA 2IQCA 1IHBA 2WXRA 4JA9A 1LF8A 1OWPA 1IXVA 5FTPA 5KNGA 2VGEA 4GTOA 2DWZA 4WWPA 1H2VC 4KT6B 3LJNA 4GTQA 4ILGA 4FHJA 4I6JA 2CG3A 1XNFA 4KZ0A 4CZ2D 3E33A 1H6PA 2LNIA 3IHVA 2WQ7A 4YVOA 2WM9A 4U0ZA 1PC2A 1RZ4A 2RFMA 5KBAA 3D9JA 3NOGD 2FULA 4DX1A 2LAIA 2CHZA 5T8IA 2RD0A 3B13A 3HG0D 1SQMA 4N5CA 1N54A 3PUJA 2QFCA 3SFZA 4GZCA 4OAVB 5ENSD 3DSUA 3CEQA 3G2TA 4DJAA 5CBNA 3L22A 4DI3A 3AAAC 4EBAA 3JUIA 1O1SA 3E4BA 3ZYQA 3C3QA 2L9BA 3UQ3A 3PREA 4YNDA 3ZYMA 4DX6D 5FINA 3GW4A 4WAFA 4GZ3A 2IEJA 3FTWA 4FLHA 3MV2B 1PY1A 2J4DA 1HX8A 3DWLG 4BTBA 4HRNA 1FCHA 1WM5A 4U0UA 1MHQA 3V31A 3RRNB 3Q78A 2GRQB 2OCCE 4M3OA 3CVPA 5EYPF 3DPDA 1HXIA 4XZ4A 2GROB 3PNTB 4KZCA 5BT1A 3S2AA 3Q4AB 4UI9C 4ILIA 1HZ4A 4TXRA 1S64A 3ASOE 4A3VA 3CKBA 2WXMA 3RAUA 5HKPA 3EHRA 4UQXA 4GYWA 1N9AA 1V55E 1TN6A 4FHKA 4CDNA 3QAQA 4QFVA 5AAOA 3Q15A 4H7XA 2UY1B 4RSYA 2PL2A 5B1BE 2ZIRA 4N2SA 4F53A 2FBNA 4GMRA 4A55A 2R17C 2XPIA 2ETCA 5AIJA 4GZDA 2XENA 3QDNA 1ELRA 3PZ1A 4HI9A 4ATZD 1JUQA 2KATA 2WQ6A 3HVEB 1TNZA 3LY9A 4AY6A 3ASGA 2WXKA 3EHMA 2V4HC 4APFA 3JQ1A 3UM1A 4JW1A 3HVEA 2XGOA 4C0MA 4UUCA 1MYOA 4FC8A 4YVQC 3PEVB 4LEUA 5LCWJ 3S7DA 4I17A 4ANWA 3B7RL 2B0OE 3ZU7B 4HORA 1YA0A 2NXPA 4I9CA 5JHAA 2QZAA 4GZ5A 4UWGA 3ZFWA 3CSFA 4I9EA 2AVPA 2P2CP 1MZCA 1E8ZA 3UUXA 3LVQE 3T5VA 3O48A 5G05C 3MCXA 4EZLA 2FEZA 3L54A 2R5SA 2HO1A 1OCCE 2C0LA 3NOCD 5ANRA 3MZLB 1OT8A 4XE0A 1Z3XA 4L9PA 4MKTA 4Y6CA 3LY8A 4UI9K 4JC8A 2KC7A 3UX4A 3Q47B 4FADA 2FF4A 1HH8A 4UQZA 2WB2A 3FTUA 2VQ2A 4M7CA 1E7UA 4BT9A 2BUGA 1S70B 5KJLA 2GRRB 5ARGA 2GRMA 4JHRA 1Z6TA 4GCNA 3CVWA 3G2SA 1HS6A 4X8QA 3B7UX 3R9MA 1FT1A 4GTRA 2XEVA 1DVPA 4OVVA 3HXEA 4GA0A 4HLEA 3CHOA 1OWOA 4BSXA 3FDHA 2R59A 3EUVA 4FU3A 3AG4E 3SGHA 3UT8A 3BG1B 1N0QA 3VLEA 1SVXA 2DZOA 4J8DA 2I6HA 4NIKA 4A1SA 4EPZA 4BY6A 4HI8A 3CVXA 4RVBA 4Z68A 1Z3YA 1JCRA 2WXNA 3MKQB 3FHEA 3HXCA 5AJLA 4P29A 1KPSB 3UMVA 5HI7A 3MKQA 1JCQA 3D9LA 3ZIMA 4YDYA 3ABME 2IOSA 2PM7A 2ZISA 2H6FA 5AN8A 3FUIA 4O60A 3PUKA 1FVFA 1YCSB 5FZSA 5ENRD 1WG0A 3IBEA 4E6HA 4ACKA 4F3VA 4BETA 5HQ8A 2X6JA 4R7LA 4AIFA 1Y8MA 3C3RA 3K9IA 2JEKA 3BUAA 4XEIG 4GYOA 5EIDA 5CCMA 4CT4A 2BTDA 2Y1LE 3APDA 2IFUA 3TWQA 4C48B 1HU3A 3ULQA 3EU5A 3UM3A 4AJWA 1H0AA 3TWRA 4OYSA 3KS2A 4JHKA 2Y4TA 5FWQA 2H6HA 1OCRE 2ZXWE 4J8EA 1GW6A 4I6GA 2PNNA 4A3TA 2DYRE 4CT0A 1E8WA 4HB5A 5ENNA 3QB2A 2M63A 3NZSA 2WXGA 2J8SD 4Q96A 3FUNA 2F0YA 5T3RA 1MX6A 4A1GA 4I1OB 1IQRA 4HXIA 3T5XA 1S63A 3TWUA 1NI1A 2Y0BG 5JJ7A 3D9NA 4CYMD 3MJWA 2OEVA 4HOTA 5FQ6A 2X3MA 3ZN3A 4N3CA 3RO2A 1DNPA 4J7WA 4U0SA 3PVLA 4AXHA 4GTMA 3P1UA 4FLBA 5BXOA 4BSZB 4U07A 4EZJA 2YQ8A 4B94A 3CK9A 4DI4A 3DSWA 5G04C 5G55A 3NBNB 1W3BA 1S0PA 1WY6A 2I1JA 2X38A 5KCMA 3RKVA 4WUYA 2IY0C 4HVBA 2IONA 2UWJG 3CLJA 1BI8B 3PS6A 3AS4A 2IU1A 1K8KG 3PZ4A 5ARFA 4KXKB 3SZ7A 2P9KG 2HE0A 3SY2A 3EU9A 3RRMB 3AG3E 5JHBA 1D8EA 4O6FA 4EBAG 3ASNE 4G8LA 1UJJA 2P9LG 4DLOA 3TWSA 1OWNA 3BEEA 3S7BA 4MBGA 2WXOA 3LVRE 1TN8A 4LCTA 1FT2A 1KLXA 3CGHA 2WXLA 3Q9NC 4N39A 4L1BA 3LCAA 2DYSE 2WQHA 4AV7A 3G2UA 1EYHA 2LAHA 4GTTA 1OCZE 1X5BA 2CG2A 1X81A 3ZUVB 3EHNA 3ONKA 3L82A 2A4ZA 2OVBA 3U9WA 2JABA 4GTPA 5BW8C 3V79K 3UPVA 4N5QA 3EJNA 5AJDA 2KCLA 4DLQA 1TR4A 5FQ8A 5ENPD 2NSZA 3NF1A 4JEUA 2X6HA 3PZ2A 3ENEA 3FH5A 4AOFA 1MJ0A 5BNWA 3UKUG 3LPZA 4U63A 3O4ZA 3AJIA 3BU8A 3PDNA 4G8KA 3LJ3A 4HFGA 1Z5SC 4B93B 4MRUA 2NYJA 4YDOA 2V8SE 4WNGA 4HS2A 3LEWA 3DSTA 1YYHA 3ESLA 1WDYA 4GPKA 4K0RA 3RIBA 4A63B 1E90A 1N4QA 3KSQA 2V4LA 5ENQD 2Y3AA 5A7DB 3FU6A 2CHXA 3APCA 5LOZA 1KT0A 3X2QE 3D9KA 3ASDA 3FH8A 1MQSA 5EIBE 3ZRHA 3QJZA 5D66A 2ETBA 4KVOA 4DX5D 5FIOA 4GZ6A 4U96D 3L16A 2PQRA 1NA3A 3FFLA 4FJZA 4Q69A 3AS5A 3PRZA 5CERB 5HRYA 2WXIA 2KCKA 3DXKG 3CQCB 5C1DA 3FTSA 1EPUA 1UN9A 2QYUA 3ML8A 4YDEA 4G1TA 4EECA 4L23A 5T4YA 2YHCA 4O1OA 3UINC 2EINE 3FTXA 3UM2A 5CMYA 3S7FA 2L6BA 3ZHEA 3FU5A 3QWWA 1IHGA 3ZGQA 5LX8A 4LNBA 3DBSA 2X6KA 5FJYA 4N3AA 5FQ4A 2J4BA 3D9MA 2V0PA 1TYQG 2EQXA 5KWDA 3ZXSA 4PS3A 3OXLA 3Q49B 3ONLA 3T8KA 4JB8P 2AXVA 1OWMA 4TRQA 4LUNU 1DCEA 4K5BA 4XKCA 4RQIA 2DIWA 4LERA 3L6AA 3KEAA 2C2LA 4CDRA 4GYYA 5A23A 4B89A 3QWPA 3RSEG 4AVXA 3E32A 3LXUX 4BWRA 3SF4A 3AS8A 3P2BA 4YDWA 3KSLA 4L2LA 4UI9J 2L0TB 3B95A 3C5RA 1E8YA 3URZA 3ZYLA 4U8VD 4ABNA 4FP7A 3JXJA 4OAUC 3L08A 4L2YA 2WMNA 5EN5D 2OOEA 5FQ7A 4G26A 4PUCA 3DXMG 2VSOE 4CGVA 5CRUA 2KXPC 2WMOA 5AQ9A 3HDXA 2BF0X 4GTVA 3FWVA 3E37A 2GRPB 3WG7E 1E8XA 3BQOA 2VTBA 3MKRA 1UW4B 2L0IA 4GA2A 2P9UG 3FUJA 1FPPA 4TXPA 1H2UA 2EILE 3CVVA 3HXFA 1NZNA 1QNFA 2AXZA 5E75A 5ENTD 1BU9A 1RW2A 3CSTA 1OXJA 3RJVA 3V2XA 2WXJA 4GB9A 4I2WA 2XS1A 4XIFA 5CCLA 5AYWD 5CMWA 3DEPA 4BERA 5B3SE 1TEZA 3ULEG 3UM0A 4AP2A 4KBQA 5LFAA 5BPPA 4EQFA 2QC9A 3D3MA 4LSZE 4CDMA 5BV0A 4HRLA 3UKRG 5G05J 3HRAA 2LUHA 3MX3A 3I5PA 3FY4A 1LD7A 4FA6A 3DEOA 4KYOB 1SA4A 3ZPJA 4PH4B 1D8DA 4N3BA 3LKUA 4JA7A 4C0EA 1KT1A 5CRVA 4U04A 3C98A 3IXEA 2VSXE 4C9BB 3UIPC 2LSVA 3CHMA 4IULA 3DSXA 1K1AA 4TXQA 3UTMA 3CR3A 3AU4A 5BUZA 2KM4A 4I1AA 1UG3A 3CHRA 5FT9A 3OXGA 2P9PG 2B6CA 5CHEE 3RRUA 2EIME 1BD8A 2WVIA 2FO1E 1BPOA 1O1RA 1IKND 3HHMA 4BT8A 3TWXA 3U64A 4F1PA 2RKKA 2XCBA 4ACLA 5D0OD 1HF8A 4JEHA 3I3NA 4MS6A 1YMPA 4HQDA 3R7QA 4ANVA 2IO2C 2P9NG 3QK0A 3QNKA 5A6CA 2XCCA 5M72A 1NP7A 2VGXA 4RLYA 2HYZA 4F7AA 3V2OA 1N4PA 4URKA 3SBTB 2LXLA 3L9TA 3PNLB 2WXHA 4HLLA 4ZFHA 4K5CA 4D10C 1JWGA 1IQUA 3ASHA 1Y6IA 2Y69E 3R9AB 3N71A 3CVYA 3TGOA 3I4RB 3QOUA 2LXMA 2AWIA 4UWHA 4N2QA 3JXIA 1O1TA 3ISMC 2GW1A 2GRNB 1N11A 3HYMB 3EHQA 3HXBA 3QKYA 3MGBA 1EF1C 3C72A 4HRMB 2XEHA 3OXFA 3Q5MA 2AW6A 2P9IG 3S7JA 2YNQA 4AEZC 4GPMA 2Q7FA 3QC1A 5FZQA 4I2ZA 2A5EA 1SA5A 1ELKA 1HG5A 4J8FA 3ZEFA 4TUUA 1AWCB 3Q73A 2IJGX 3U4TA 4CRWA 5LP0A 2C0MA 2VYIA 2QYJA 1QYMA 2VSNA 2XGMA 1TN7A 2I1KA 5KJNA 3DRAA 2J9QA 1N4RA 2Y4UA 2WXFA 3CVNA 2DBAA 2DZNA 3RK6A 3NZUA 4GA1A 3NAWA 1JWFA 5KJKA 3SD5A 3CK7A 5D2MC 2LO6A 1E96B 4ATGA 4DPRA 5B1AE 3FTYA 4J0UA 4HNAD 3F6QA 1BI7B 3LY7A 4XI9A 1ZBPA 2ILRA 2AJAA 3AG2E 3CK8A 4J8SA 2JLBA 1OCOE 2PM6A 2ZU6B 3NB2A 1H19A 1TNBA 3ZW3A 4K03A 4FULA 3V30A 2FO7A 2WPVA 1K1BA 1NL4A 2KZTB 3B7SA 4WNDA 2X6FA 2IOLA 2FI7A 4J8YA 2KZTA 4EHMA 3AU5A 4NACA 3TAXA 3QWVA 2LSUA 4IYPA 5LCWC 3L17A 2ONDA 2XZTG 4L7TA 5AQ7A 5EILA 5G04J 2E2EA 5D0QD 1TJCA 2XGSA 3KEZA 3RO3A 1JCSA 2OVFA 3FU0A 4UQYA 1JPLA 3SHFA 3OAWA 1MX2A 3E34A 5ENOD 4JD2G 3FUKA 1IYGA 3UT7A 3G2VA 4BTAA 5CBOA 3FEYA 1SW6A 1HE8A 2F37A 4JPSA 5AENA 3W9GA 4LNGA
chains in the Genus database with same CATH topology
4NQ0A 2DIWA 1HFAA 3ML9A 3SBSA 4TV3A 4LERA 1HU3A 4MLPA 4BX8A 3FUMA 3L6AA 3ULQA 2HR2A 4BFRA 1P5QA 4XI0A 4AJWA 4WWNA 1H0AA 2P58C 2C2LA 3FUHA 3LS8A 4CDRA 3CIAA 4GYYA 4OYSA 5A23A 3CHSA 4B89A 1EDUA 3CVLA 3KS2A 2J07A 2HM8A 3OTNA 3QWPA 4JHKA 3CQGB 4WNFA 4AVXA 4ANXA 3LXUX 4XKBA 2Y4TA 3D9OA 5FWQA 3AS8A 3P2BA 3SF4A 4BWRA 1B89A 4UI9J 4L2LA 4UWKA 1N52A 2MHKA 3IKOB 1GW6A 4J8EA 4V3IA 3BG0B 5EX0A 4I6GA 2L0TB 4G24A 3TXNA 3LYAA 1ELWA 5DIZA 3UT4A 4GMLA 4A3TA 3JYSA 4CT0A 3FULA 1E8WA 1U3CA 1E8YA 3URZA 3ZYLA 4CCAA 5ENNA 3QB2A 2AXUA 3TL5A 4ABNA 2M63A 3LDZA 4GU5A 2L6JA 3NZSA 2IQCA 2WXRA 4JA9A 1LF8A 1OWPA 4FP7A 4E85A 4AY5A 5FTPA 2WXGA 4WWPA 2WXQA 1H2VC 4KT6B 3L08A 1OWLA 4L2YA 2WMNA 4CEMA 4IRUA 4Q96A 3FUNA 4ILGA 4FHJA 3ZVVA 2OOEA 3TXMA 5T3RA 5FQ7A 4G26A 4A1GA 4B8AA 3U3WA 4PUCA 2CFZA 4I1OB 4I6JA 4JXTA 2CG3A 2VSOE 4CGVA 1IQRA 1XNFA 4HXIA 4KZ0A 3T5XA 2XRYA 2WMOA 2YHEA 3L13A 1QQEA 2LNIA 3IHVA 3D9NA 3HDXA 4EZKA 5JJ7A 2WQ7A 2YINA 2BF0X 3FWVA 3MJWA 5J08A 3JCKC 2UY1A 4HOTA 3FEXA 5ANLA 2VGYA 4YVOA 2WM9A 5FQ6A 1E8XA 4U0ZA 1PC2A 2X3MA 5DBKA 1UN8A 4KVMA 2VTBA 3ZN3A 3D9JA 3MKRA 1UW4B 2J49A 4N3CA 2L0IA 2FULA 3RO2A 1DNPA 4U0SA 4APOA 4GA2A 2LAIA 4B0ZA 2CHZA 3PVLA 2CFUA 3FUJA 1H2UA 4AXHA 5T8IA 3ZHEB 2RD0A 3B13A 3P1UA 4FLBA 3CVVA 1SQMA 4UWFA 1NZNA 1QNFA 2AXZA 4U07A 5E75A 3CKCA 4ILHB 3R7RA 4EZJA 4N5CA 3VTXA 1N54A 3CSTA 3PUJA 2YQ8A 4B94A 3CK9A 3RJVA 4DI4A 2QFCA 2WXJA 2OV8A 5BV1A 4GB9A 4I2WA 3SFZA 4GZCA 4XIFA 5CCLA 5AYWD 5G04C 5CMWA 5G55A 4PDXA 4PS8A 1W3BA 3CEQA 1S0PA 3G2TA 4DJAA 1WY6A 2I1JA 2VJ8A 2X38A 3L22A 4HOUA 4IN3B 5KCMA 3RKVA 4DI3A 4WUYA 1TEZA 5G2NA 2CHWA 4EBAA 4AP2A 4KBQA 3JUIA 4HVBA 3JQ0A 5LFAA 3E4BA 2IONA 2UWJG 2L9BA 3ZYQA 4EQFA 5BPPA 3UQ3A 3PREA 3CLJA 4Y6WA 4YNDA 3ZYMA 3PS6A 3D3MA 3AS4A 3TG4A 4CDMA 5BV0A 5G05J 2IU1A 5ARFA 3GW4A 3FU3A 3GZSA 1INZA 4WAFA 3MX3A 4GZ3A 4KXKB 3FTWA 3SZ7A 3I5PA 3IEGA 4FLHA 3FY4A 3MV2B 1PY1A 2J4DA 1HX8A 4FA6A 4KYOB 4HOSA 3RRMB 4G11A 3ZPJA 4JHJA 4PH4B 4BTBA 4BX9A 4N3BA 1FCHA 3LKUA 5JHBA 4XX5A 4JA7A 5EKQD 1WM5A 4O6FA 1KT1A 3CVQA 4C0EA 4U0UA 1MHQA 3RRNB 4EBAG 4U04A 3C98A 1UJJA 3G2WA 2J08A 4DLOA 4M3OA 1E7VA 2VSXE 4C9BB 1OWNA 3BEEA 2LSVA 3CVPA 3CHMA 2XHEA 3S7BA 4IULA 2WXOA 3DPDA 3LVRE 3CR3A 1HXIA 3AU4A 4H7YA 5BUZA 4LCTA 4XZ4A 3PNTB 4KZCA 3CGHA 1KLXA 5BT1A 2KM4A 3S2AA 3Q4AB 4I1AA 2WXLA 1UG3A 3CHRA 4UI9C 5FT9A 3OXGA 3PEUB 2GGFA 4N39A 4ILIA 4L1BA 3LCAA 1HZ4A 3KAEA 5CHEE 3RRUA 4A3VA 3CKBA 1SZAA 1HO8A 2X6IA 2WXMA 2WQHA 2WVIA 3RU0A 4AV7A 3TG5A 1BPOA 3G2UA 3GZ1A 1EYHA 3B7TA 4Q94A 3HHMA 2LAHA 4I6EA 4BT8A 3U64A 3I4GA 4UQXA 4GYWA 2XCBA 3VLFA 1X5BA 1SZ9A 2PZIA 5D0OD 4PS7A 1HF8A 4ACLA 5J90A 4JEHA 2CG2A 1A17A 3I3NA 4FHKA 4CDNA 2I2OA 3EHNA 4MS6A 3ONKA 3QAQA 4QFVA 2IF4A 3Q15A 2A4ZA 2OVBA 4H7XA 3U9WA 1U3DA 2UY1B 4AM9A 4RSYA 3R7QA 2PL2A 4N2SA 4ANVA 4F53A 2KCVA 2FBNA 3QK0A 4A55A 4WWOA 3D9PA 2VTBB 2R17C 2XPIA 3QNKA 5AIJA 4GZDA 5BW8C 5A6CA 3QDNA 3EJNA 3UPVA 1ELRA 2XCCA 5M72A 1JUQA 2PQNA 2KATA 3ASFA 1NP7A 2VGXA 4G25A 2HYZA 5AJDA 2KCLA 4DLQA 3HVEB 4F7AA 2WQ6A 3LY9A 3PH0C 5FQ8A 4AY6A 3ASGA 3FUDA 4URKA 2WXKA 3EHMA 3JQ1A 3SBTB 2NSZA 4JW1A 3PNLB 4APFA 3HVEA 3U66A 2XGOA 4C0MA 3NF1A 4JEUA 2X6HA 2WXHA 3ENEA 3GZ2A 3FH5A 4D10C 4FC8A 1JWGA 1IQUA 3ASHA 1Y6IA 4YVQC 3R9AB 3N71A 3PEVB 3CVYA 3TGOA 4LEUA 3I4RB 3T8MA 4HOQA 4AOFA 3FTZA 3D9IA 3S7DA 3QOUA 3VLDA 5LCWJ 3APFA 2AWIA 4JZYA 5BNWA 3LPZA 4UWHA 3CHPA 4I17A 4ANWA 4N2QA 3B7RL 3SNXA 4U63A 3O4ZA 4HORA 1YA0A 2GW1A 3PDNA 2NXPA 4I9CA 2E0IA 5JHAA 3LJ3A 4HFGA 3HYMB 4GZ5A 4NURA 4MRUA 4UWGA 3FTVA 3ZFWA 3CSFA 3QKYA 4I9EA 2AVPA 3MGBA 2RG8A 4RG6A 1EF1C 1E8ZA 2MRIA 3UUXA 3LVQE 2V8SE 1HG2A 4WNGA 3OXFA 3T5VA 3IV0A 3O48A 4B8CB 3Q5MA 4HS2A 1L5JA 3LEWA 4NRHB 4GMJA 2AW6A 3ESLA 3GYZA 5G05C 4K0RA 4GPKA 3S7JA 3IHYA 3MCXA 4EZLA 2YNQA 4AEZC 2FEZA 3L54A 2R5SA 3RIBA 2Q7FA 3QC1A 2HO1A 1E90A 2V4LA 2C0LA 2Y3AA 4ME2A 5A7DB 4RG9A 3FU6A 4I2ZA 5FZQA 2CHXA 5ANRA 2J09A 1ELKA 3APCA 3VTYA 3MZLB 1HG5A 3FUFA 4J6IA 5LOZA 1KT0A 4XE0A 4J8FA 1H6KA 1Z3XA 2WXPA 4MKTA 3ZEFA 4TUUA 3D9KA 3ASDA 4GAAA 4Y6CA 3LY8A 4UI9K 3FH8A 1MQSA 2IJGX 4JC8A 4OVUA 2KC7A 3U4TA 3HIZA 3ZRHA 4CRWA 3UX4A 5LP0A 3Q47B 3MA5A 1TJFA 2XPYA 2FF4A 2I9CA 1HH8A 2C0MA 2VYIA 3EIJA 3QJZA 4FADA 1QZ2A 4UQZA 2VSNA 2WB2A 2XGMA 4KVOA 3EIQC 3FTUA 3MEKA 1UJKA 2VQ2A 1E7UA 4BT9A 2BUGA 2I1KA 5KJLA 4GZ6A 5KJMA 5ARGA 5KJNA 3L16A 2GRMA 2XRZA 4LRZA 2PQRA 5C2YA 2J9QA 4JHRA 2Y4UA 1NA3A 1Z6TA 2WXFA 3FFLA 3CVNA 4KMOA 4UWLA 5EDSA 3PE4A 4GCNA 2DBAA 3CVWA 3G2SA 1HS6A 3RK6A 3NZUA 4FJZA 4FJYA 4Q69A 3AS5A 4GA1A 3B7UX 1JWFA 1VDYA 5KJKA 3SD5A 4ANUA 3PRZA 5FZRA 3CK7A 2XEVA 1DVPA 2LO6A 1E96B 4OVVA 4ATGA 4DPRA 3FTYA 3NQPA 4GA0A 4HLEA 4J0UA 2GRLA 2WXIA 3CHOA 2KCKA 1OWOA 2QY7A 2VGXB 2VSYA 4BSXA 4W9RA 1PAQA 3FDHA 4I1MA 2R59A 3MV3B 3LY7A 4FU3A 4XI9A 1NA0A 2XQ0A 1ZBPA 2ILRA 3SGHA 3CQCB 3CHQA 3UT8A 3CK8A 3BG1B 4J8SA 3FP3A 3EDTB 2JLBA 4G23A 3VLEA 5C1DA 4GCOA 2PM6A 2ZU6B 1H19A 3FTSA 3WXXA 1EPUA 1UN9A 3ZW3A 4K03A 4FULA 3ML8A 4J8DA 2I6HA 5JJ6A 2FO7A 2WPVA 4A1SA 3PZDA 4EPZA 3B7SA 2KZTB 4G1TA 4WNDA 2X6FA 4BY6A 1FVHA 2IOLA 3FUEA 4EECA 2FI7A 4JVSA 3CVXA 4L23A 4RVBA 2KZTA 5T4YA 1Z3YA 3QARA 3CV0A 1WAO1 2WXNA 2YHCA 3AU5A 3MKQB 4NACA 3FHEA 5AJLA 3TAXA 5EX3A 3QWVA 2LSUA 4IYPA 4DK5A 3FTXA 4P29A 5CMYA 3UMVA 3ESKA 5HI7A 5LCWC 3L17A 5E76A 3MKQA 3S7FA 2ONDA 4L7TA 3D9LA 3ZHEA 3ZIMA 5G04J 2A5UA 3FU5A 2E2EA 1XGWA 5D0QD 1TJCA 1IHGA 2XGSA 3QWWA 2IOSA 3KEZA 3MYVA 3ZGQA 3PE3A 4I43A 5JJTA 5LX8A 3DBSA 3RO3A 2NC9A 2X6KA 2XPZA 2PM7A 4N3AA 5FJYA 5FQ4A 2J4BA 2OVFA 3FU0A 3FUIA 2DCPA 4JL0A 3PUKA 4G2VA 4UQYA 3D9MA 1FVFA 2V0PA 5FZSA 1JPLA 2V5FA 1ZU2A 3IBEA 3SHFA 2EQXA 4E6HA 3OAWA 4ACKA 3ZXSA 4F3VA 3KD7A 4PS3A 3ZYKA 3FH7A 4U8HA 3CVUA 5HQ8A 1H2TC 2MOWA 3OXLA 2X6JA 3FUKA 3UT7A 1IYGA 1OUVA 3G2VA 4R7LA 4AIFA 4CGWA 3Q49B 4BTAA 1Y8MA 3ONLA 3K9IA 2JEKA 3TJPA 4GYOA 2AXVA 3FEYA 5CCMA 1OWMA 2BTDA 4CT4A 1HE8A 4TRQA 4LUNU 3APDA 4JPSA 4WNEA 4F1SA 5AENA 4XKCA 2IFUA 3SI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQ0 A;  3ULQ A;  2HR2 A;  1P5Q A;  4XI0 A;  2P58 C;  2C2L A;  4CDR A;  4GYY A;  3CVL A;  3KS2 A;  3QWP A;  4WNF A;  2Y4T A;  4BWR A;  3SF4 A;  3AS8 A;  1B89 A;  4UI9 J;  2MHK A;  4J8E A;  5EX0 A;  4G24 A;  3LYA A;  1ELW A;  5DIZ A;  3JYS A;  3URZ A;  4ABN A;  2L6J A;  4JA9 A;  4AY5 A;  5FTP A;  2OOE A;  4G26 A;  3U3W A;  4CGV A;  1XNF A;  1QQE A;  2LNI A;  5JJ7 A;  3FWV A;  2UY1 A;  4HOT A;  2VGY A;  4YVO A;  4U0Z A;  1PC2 A;  5DBK A;  3ZN3 A;  3MKR A;  4N3C A;  3RO2 A;  4U0S A;  4APO A;  4GA2 A;  3ZHE B;  1NZN A;  4U07 A;  3CKC A;  4N5C A;  3VTX A;  2YQ8 A;  4B94 A;  3CK9 A;  3RJV A;  2QFC A;  4I2W A;  4XIF A;  5CCL A;  5AYW D;  5G04 C;  1W3B A;  3CEQ A;  3RKV A;  4HOU A;  4IN3 B;  4WUY A;  4KBQ A;  3E4B A;  2UWJ G;  4EQF A;  3UQ3 A;  4Y6W A;  4YND A;  3AS4 A;  3TG4 A;  5G05 J;  5ARF A;  3GW4 A;  4GZ3 A;  4KXK B;  3SZ7 A;  3IEG A;  3MV2 B;  4KYO B;  4HOS A;  3ZPJ A;  4BTB A;  4N3B A;  1FCH A;  3LKU A;  5EKQ D;  4JA7 A;  1WM5 A;  4O6F A;  1KT1 A;  3CVQ A;  4U0U A;  4U04 A;  3BEE A;  3CVP A;  2LSV A;  3S7B A;  1HXI A;  4H7Y A;  1KLX A;  5BT1 A;  3Q4A B;  4I1A A;  4UI9 C;  5FT9 A;  3OXG A;  4N39 A;  3LCA A;  1HZ4 A;  3KAE A;  5CHE E;  3CKB A;  2WQH A;  3RU0 A;  3TG5 A;  3GZ1 A;  4BT8 A;  4UQX A;  4GYW A;  2XCB A;  2PZI A;  5D0O D;  1A17 A;  2IF4 A;  3Q15 A;  4H7X A;  4AM9 A;  2UY1 B;  2PL2 A;  4N2S A;  2KCV A;  2FBN A;  2XPI A;  5BW8 C;  5A6C A;  3QDN A;  3UPV A;  1ELR A;  2XCC A;  5M72 A;  2PQN A;  2KAT A;  3ASF A;  2VGX A;  4G25 A;  2HYZ A;  2KCL A;  3LY9 A;  4AY6 A;  3ASG A;  2XGO A;  3NF1 A;  3GZ2 A;  3ASH A;  4YVQ C;  3R9A B;  3N71 A;  3TGO A;  4LEU A;  4HOQ A;  5LCW J;  3S7D A;  3QOU A;  5BNW A;  3LPZ A;  4I17 A;  4N2Q A;  4HOR A;  1YA0 A;  2GW1 A;  3PDN A;  4I9C A;  3HYM B;  4GZ5 A;  3ZFW A;  3QKY A;  4I9E A;  2AVP A;  4RG6 A;  3UUX A;  4WNG A;  3OXF A;  3O48 A;  3Q5M A;  4NRH B;  3GYZ A;  5G05 C;  4GPK A;  3S7J A;  2FEZ A;  2R5S A;  3RIB A;  2Q7F A;  2HO1 A;  2C0L A;  4ME2 A;  5A7D B;  4RG9 A;  5FZQ A;  4I2Z A;  3VTY A;  1KT0 A;  4J8F A;  3ASD A;  4Y6C A;  3LY8 A;  4UI9 K;  2KC7 A;  3U4T A;  3Q47 B;  3MA5 A;  2FF4 A;  1HH8 A;  2C0M A;  2VYI A;  1QZ2 A;  4UQZ A;  2VSN A;  2XGM A;  3MEK A;  2VQ2 A;  4BT9 A;  2BUG A;  5KJL A;  4GZ6 A;  5KJM A;  5ARG A;  5KJN A;  2PQR A;  4JHR A;  2J9Q A;  2Y4U A;  3FFL A;  1NA3 A;  3CVN A;  3PE4 A;  4GCN A;  2DBA A;  3AS5 A;  4GA1 A;  5KJK A;  5FZR A;  3CK7 A;  2XEV A;  1E96 B;  4GA0 A;  4J0U A;  2KCK A;  2VGX B;  2VSY A;  4W9R A;  3MV3 B;  3LY7 A;  4XI9 A;  1NA0 A;  1ZBP A;  3CK8 A;  3FP3 A;  3EDT B;  2JLB A;  4G23 A;  5C1D A;  4GCO A;  3WXX A;  4J8D A;  2I6H A;  5JJ6 A;  2FO7 A;  2WPV A;  4A1S A;  4G1T A;  4WND A;  2FI7 A;  3CV0 A;  1WAO 1;  2YHC A;  3TAX A;  5EX3 A;  3QWV A;  2LSU A;  5LCW C;  3ESK A;  5HI7 A;  3S7F A;  2OND A;  3ZHE A;  5G04 J;  2E2E A;  5D0Q D;  1TJC A;  1IHG A;  2XGS A;  3QWW A;  3ZGQ A;  3PE3 A;  5JJT A;  3RO3 A;  2NC9 A;  5FJY A;  4N3A A;  4JL0 A;  4G2V A;  4UQY A;  5FZS A;  2V5F A;  1ZU2 A;  4F3V A;  3KD7 A;  5HQ8 A;  3OXL A;  1IYG A;  1OUV A;  4AIF A;  4CGW A;  3Q49 B;  4BTA A;  1Y8M A;  3K9I A;  4GYO A;  5CCM A;  4WNE A;  2IFU A; 
#chains in the Genus database with same CATH topology
 1TNY A;  3ML9 A;  3SBS A;  4DUI A;  1Q2Z A;  4TV3 A;  4BX8 A;  3FUM A;  3JUE A;  4WWN A;  3FUH A;  2P58 C;  3SFX A;  3OTN A;  3VLD A;  2HM8 A;  4ANX A;  4WNF A;  1N94 A;  1B89 A;  4UWK A;  3IKO B;  4V3I A;  5IY5 E;  3TXN A;  5DIZ A;  2IO3 C;  3UT4 A;  3JYS A;  3FUL A;  4TUM A;  4E85 A;  4AY5 A;  1V54 E;  2WXQ A;  1OWL A;  4CEM A;  4IRU A;  2H6I A;  4DRX E;  3ZVV A;  3TXM A;  3U3W A;  4B8A A;  2CFZ A;  4JXT A;  2XRY A;  2YHE A;  3L13 A;  1QQE A;  3Q9U C;  4EZK A;  2YIN A;  3C3O A;  5J08 A;  3JCK C;  2UY1 A;  3DSV A;  3FEX A;  5ANL A;  2VGY A;  1NFI E;  3Q7A A;  2BED A;  5DBK A;  1UN8 A;  4KVM A;  2J49 A;  4K5A B;  4QQI A;  4APO A;  4B0Z A;  5CED B;  2CFU A;  3SQV A;  3ZHE B;  4UWF A;  3ZXP A;  3CKC A;  4ILH B;  3R7R A;  3VTX A;  3J5Q B;  2OV8 A;  5BV1 A;  2XEE A;  4PDX A;  4PS8 A;  2VJ8 A;  4HOU A;  4IN3 B;  5EYL A;  5G2N A;  2CHW A;  4LNU D;  4O1P A;  3JQ0 A;  4LG6 A;  4Y6W A;  3HXD A;  1KZP A;  3TG4 A;  3D9H A;  5KNH D;  3FU3 A;  3GZS A;  1INZ A;  1AP7 A;  2DVW A;  3IEG A;  1DCQ A;  4HOS A;  4G11 A;  4JHJ A;  4BX9 A;  4XX5 A;  5EKQ D;  3CVQ A;  2F8Y A;  3AG1 E;  3UI2 A;  3G2W A;  2J08 A;  1E7V A;  2XHE A;  3TWW A;  4H7Y A;  2OEW A;  3DSS A;  3PEU B;  2GGF A;  3KAE A;  3ZNG A;  1SZA A;  3B7B A;  1HO8 A;  1UOH A;  2X6I A;  4F6R D;  3RU0 A;  3TG5 A;  4Q94 A;  3GZ1 A;  3B7T A;  4I6E A;  3I4G A;  3VLF A;  2PZI A;  1SZ9 A;  4PS7 A;  5J90 A;  2XS8 A;  1A17 A;  2I2O A;  2IF4 A;  2XZD G;  4AM9 A;  1U3D A;  1H6O A;  2KCV A;  4WWO A;  3D9P A;  2VTB B;  3TWV A;  1D9S A;  2PQN A;  3ZKJ A;  3ASF A;  3ULY A;  4G25 A;  1LD8 A;  3PH0 C;  3FUD A;  1O5M A;  3Q75 A;  3U66 A;  3GZ2 A;  3T8M A;  4HOQ A;  3FTZ A;  3D9I A;  5H7P A;  3APF A;  4JZY A;  3CHP A;  3SNX A;  2MYO A;  4DX7 D;  3UIO C;  2E0I A;  2BKK B;  5BXU A;  4NUR A;  3FTV A;  2RG8 A;  4RG6 A;  2MRI A;  1HG2 A;  3IV0 A;  4B8C B;  1L5J A;  4NRH B;  4GMJ A;  1ZB1 A;  3GYZ A;  2R03 A;  3SFY A;  3IHY A;  5AQB A;  4ME2 A;  4RG9 A;  1K3Z D;  2J09 A;  3VTY A;  3FUF A;  4J6I A;  1H6K A;  2WXP A;  4GAA A;  2R02 A;  4BEP A;  1G3N B;  4OVU A;  3HIZ A;  3MA5 A;  1TJF A;  2I9C A;  2XPY A;  3EIJ A;  3E30 A;  1QZ2 A;  3EIQ C;  3W9F A;  1TNU A;  3MEK A;  4HBD A;  1UJK A;  5KJM A;  2V5Q C;  5AQA A;  2XRZ A;  5HS0 A;  4LRZ A;  5C2Y A;  3ABL E;  5EDS A;  4UWL A;  4KMO A;  3PE4 A;  4ZHB A;  3TWT A;  4FJY A;  1VDY A;  4ANU A;  5FZR A;  3SO8 A;  3NQP A;  2GRL A;  2QY7 A;  2VGX B;  1N95 A;  2VSY A;  4W9R A;  1PAQ A;  4I1M A;  3MV3 B;  3PZ3 A;  1KZO A;  2F8X K;  3Q7F A;  1NA0 A;  2XQ0 A;  3CHQ A;  3J5P A;  3FP3 A;  3EDT B;  4G23 A;  1OY3 D;  4GCO A;  5CEA A;  4GTS A;  3WXX A;  5AAR A;  5JJ6 A;  3PZD A;  3ABK E;  4DX2 A;  1FVH A;  3FUE A;  4JVS A;  1N0R A;  3QAR A;  3CV0 A;  1WAO 1;  2RFA A;  2EIK E;  5EX3 A;  4DK5 A;  3ESK A;  5E76 A;  4U7E B;  2A5U A;  1XGW A;  1A5E A;  3MYV A;  5JMN D;  3PE3 A;  3Q79 A;  4I43 A;  5JJT A;  2NC9 A;  2XPZ A;  4JL0 A;  2DCP A;  4U95 D;  4G2V A;  1LTX A;  2ZGD A;  2V5F A;  1TNO A;  1ZU2 A;  1MX4 A;  1N4S A;  3KD7 A;  3ZYK A;  3FH7 A;  4U8H A;  3CVU A;  1H2T C;  2MOW A;  1OUV A;  4BES A;  4CGW A;  1QBQ A;  3TJP A;  2H6G A;  1BLX B;  4U8Y D;  4WNE A;  4F1S A;  2ZGG A;  3DPY A;  3SI5 A;  4NQ0 A;  1HFA A;  2ETA A;  4MLP A;  2HR2 A;  4BFR A;  1P5Q A;  4XI0 A;  3LS8 A;  3CIA A;  5CEC B;  5JA4 D;  3CHS A;  1EDU A;  3CVL A;  2J07 A;  2KBX A;  3CQG B;  2EIJ E;  4XKB A;  1U2V G;  3D9O A;  2R05 A;  2P9S G;  1N52 A;  2MHK A;  3BG0 B;  5EX0 A;  5ITZ F;  2BKG A;  4G24 A;  3LYA A;  1ELW A;  3UXG A;  1DC2 A;  2R2L A;  4GML A;  1U3C A;  3T9K A;  4CCA A;  2AXU A;  3TL5 A;  3LDZ A;  4GU5 A;  2L6J A;  2IQC A;  1IHB A;  2WXR A;  4JA9 A;  1LF8 A;  1OWP A;  1IXV A;  5FTP A;  5KNG A;  2VGE A;  4GTO A;  2DWZ A;  4WWP A;  1H2V C;  4KT6 B;  3LJN A;  4GTQ A;  4ILG A;  4FHJ A;  4I6J A;  2CG3 A;  1XNF A;  4KZ0 A;  4CZ2 D;  3E33 A;  1H6P A;  2LNI A;  3IHV A;  2WQ7 A;  4YVO A;  2WM9 A;  4U0Z A;  1PC2 A;  1RZ4 A;  2RFM A;  5KBA A;  3D9J A;  3NOG D;  2FUL A;  4DX1 A;  2LAI A;  2CHZ A;  5T8I A;  2RD0 A;  3B13 A;  3HG0 D;  1SQM A;  4N5C A;  1N54 A;  3PUJ A;  2QFC A;  3SFZ A;  4GZC A;  4OAV B;  5ENS D;  3DSU A;  3CEQ A;  3G2T A;  4DJA A;  5CBN A;  3L22 A;  4DI3 A;  3AAA C;  4EBA A;  3JUI A;  1O1S A;  3E4B A;  3ZYQ A;  3C3Q A;  2L9B A;  3UQ3 A;  3PRE A;  4YND A;  3ZYM A;  4DX6 D;  5FIN A;  3GW4 A;  4WAF A;  4GZ3 A;  2IEJ A;  3FTW A;  4FLH A;  3MV2 B;  1PY1 A;  2J4D A;  1HX8 A;  3DWL G;  4BTB A;  4HRN A;  1FCH A;  1WM5 A;  4U0U A;  1MHQ A;  3V31 A;  3RRN B;  3Q78 A;  2GRQ B;  2OCC E;  4M3O A;  3CVP A;  5EYP F;  3DPD A;  1HXI A;  4XZ4 A;  2GRO B;  3PNT B;  4KZC A;  5BT1 A;  3S2A A;  3Q4A B;  4UI9 C;  4ILI A;  1HZ4 A;  4TXR A;  1S64 A;  3ASO E;  4A3V A;  3CKB A;  2WXM A;  3RAU A;  5HKP A;  3EHR A;  4UQX A;  4GYW A;  1N9A A;  1V55 E;  1TN6 A;  4FHK A;  4CDN A;  3QAQ A;  4QFV A;  5AAO A;  3Q15 A;  4H7X A;  2UY1 B;  4RSY A;  2PL2 A;  5B1B E;  2ZIR A;  4N2S A;  4F53 A;  2FBN A;  4GMR A;  4A55 A;  2R17 C;  2XPI A;  2ETC A;  5AIJ A;  4GZD A;  2XEN A;  3QDN A;  1ELR A;  3PZ1 A;  4HI9 A;  4ATZ D;  1JUQ A;  2KAT A;  2WQ6 A;  3HVE B;  1TNZ A;  3LY9 A;  4AY6 A;  3ASG A;  2WXK A;  3EHM A;  2V4H C;  4APF A;  3JQ1 A;  3UM1 A;  4JW1 A;  3HVE A;  2XGO A;  4C0M A;  4UUC A;  1MYO A;  4FC8 A;  4YVQ C;  3PEV B;  4LEU A;  5LCW J;  3S7D A;  4I17 A;  4ANW A;  3B7R L;  2B0O E;  3ZU7 B;  4HOR A;  1YA0 A;  2NXP A;  4I9C A;  5JHA A;  2QZA A;  4GZ5 A;  4UWG A;  3ZFW A;  3CSF A;  4I9E A;  2AVP A;  2P2C P;  1MZC A;  1E8Z A;  3UUX A;  3LVQ E;  3T5V A;  3O48 A;  5G05 C;  3MCX A;  4EZL A;  2FEZ A;  3L54 A;  2R5S A;  2HO1 A;  1OCC E;  2C0L A;  3NOC D;  5ANR A;  3MZL B;  1OT8 A;  4XE0 A;  1Z3X A;  4L9P A;  4MKT A;  4Y6C A;  3LY8 A;  4UI9 K;  4JC8 A;  2KC7 A;  3UX4 A;  3Q47 B;  4FAD A;  2FF4 A;  1HH8 A;  4UQZ A;  2WB2 A;  3FTU A;  2VQ2 A;  4M7C A;  1E7U A;  4BT9 A;  2BUG A;  1S70 B;  5KJL A;  2GRR B;  5ARG A;  2GRM A;  4JHR A;  1Z6T A;  4GCN A;  3CVW A;  3G2S A;  1HS6 A;  4X8Q A;  3B7U X;  3R9M A;  1FT1 A;  4GTR A;  2XEV A;  1DVP A;  4OVV A;  3HXE A;  4GA0 A;  4HLE A;  3CHO A;  1OWO A;  4BSX A;  3FDH A;  2R59 A;  3EUV A;  4FU3 A;  3AG4 E;  3SGH A;  3UT8 A;  3BG1 B;  1N0Q A;  3VLE A;  1SVX A;  2DZO A;  4J8D A;  2I6H A;  4NIK A;  4A1S A;  4EPZ A;  4BY6 A;  4HI8 A;  3CVX A;  4RVB A;  4Z68 A;  1Z3Y A;  1JCR A;  2WXN A;  3MKQ B;  3FHE A;  3HXC A;  5AJL A;  4P29 A;  1KPS B;  3UMV A;  5HI7 A;  3MKQ A;  1JCQ A;  3D9L A;  3ZIM A;  4YDY A;  3ABM E;  2IOS A;  2PM7 A;  2ZIS A;  2H6F A;  5AN8 A;  3FUI A;  4O60 A;  3PUK A;  1FVF A;  1YCS B;  5FZS A;  5ENR D;  1WG0 A;  3IBE A;  4E6H A;  4ACK A;  4F3V A;  4BET A;  5HQ8 A;  2X6J A;  4R7L A;  4AIF A;  1Y8M A;  3C3R A;  3K9I A;  2JEK A;  3BUA A;  4XEI G;  4GYO A;  5EID A;  5CCM A;  4CT4 A;  2BTD A;  2Y1L E;  3APD A;  2IFU A;  3TWQ A;  4C48 B;  1HU3 A;  3ULQ A;  3EU5 A;  3UM3 A;  4AJW A;  1H0A A;  3TWR A;  4OYS A;  3KS2 A;  4JHK A;  2Y4T A;  5FWQ A;  2H6H A;  1OCR E;  2ZXW E;  4J8E A;  1GW6 A;  4I6G A;  2PNN A;  4A3T A;  2DYR E;  4CT0 A;  1E8W A;  4HB5 A;  5ENN A;  3QB2 A;  2M63 A;  3NZS A;  2WXG A;  2J8S D;  4Q96 A;  3FUN A;  2F0Y A;  5T3R A;  1MX6 A;  4A1G A;  4I1O B;  1IQR A;  4HXI A;  3T5X A;  1S63 A;  3TWU A;  1NI1 A;  2Y0B G;  5JJ7 A;  3D9N A;  4CYM D;  3MJW A;  2OEV A;  4HOT A;  5FQ6 A;  2X3M A;  3ZN3 A;  4N3C A;  3RO2 A;  1DNP A;  4J7W A;  4U0S A;  3PVL A;  4AXH A;  4GTM A;  3P1U A;  4FLB A;  5BXO A;  4BSZ B;  4U07 A;  4EZJ A;  2YQ8 A;  4B94 A;  3CK9 A;  4DI4 A;  3DSW A;  5G04 C;  5G55 A;  3NBN B;  1W3B A;  1S0P A;  1WY6 A;  2I1J A;  2X38 A;  5KCM A;  3RKV A;  4WUY A;  2IY0 C;  4HVB A;  2ION A;  2UWJ G;  3CLJ A;  1BI8 B;  3PS6 A;  3AS4 A;  2IU1 A;  1K8K G;  3PZ4 A;  5ARF A;  4KXK B;  3SZ7 A;  2P9K G;  2HE0 A;  3SY2 A;  3EU9 A;  3RRM B;  3AG3 E;  5JHB A;  1D8E A;  4O6F A;  4EBA G;  3ASN E;  4G8L A;  1UJJ A;  2P9L G;  4DLO A;  3TWS A;  1OWN A;  3BEE A;  3S7B A;  4MBG A;  2WXO A;  3LVR E;  1TN8 A;  4LCT A;  1FT2 A;  1KLX A;  3CGH A;  2WXL A;  3Q9N C;  4N39 A;  4L1B A;  3LCA A;  2DYS E;  2WQH A;  4AV7 A;  3G2U A;  1EYH A;  2LAH A;  4GTT A;  1OCZ E;  1X5B A;  2CG2 A;  1X81 A;  3ZUV B;  3EHN A;  3ONK A;  3L82 A;  2A4Z A;  2OVB A;  3U9W A;  2JAB A;  4GTP A;  5BW8 C;  3V79 K;  3UPV A;  4N5Q A;  3EJN A;  5AJD A;  2KCL A;  4DLQ A;  1TR4 A;  5FQ8 A;  5ENP D;  2NSZ A;  3NF1 A;  4JEU A;  2X6H A;  3PZ2 A;  3ENE A;  3FH5 A;  4AOF A;  1MJ0 A;  5BNW A;  3UKU G;  3LPZ A;  4U63 A;  3O4Z A;  3AJI A;  3BU8 A;  3PDN A;  4G8K A;  3LJ3 A;  4HFG A;  1Z5S C;  4B93 B;  4MRU A;  2NYJ A;  4YDO A;  2V8S E;  4WNG A;  4HS2 A;  3LEW A;  3DST A;  1YYH A;  3ESL A;  1WDY A;  4GPK A;  4K0R A;  3RIB A;  4A63 B;  1E90 A;  1N4Q A;  3KSQ A;  2V4L A;  5ENQ D;  2Y3A A;  5A7D B;  3FU6 A;  2CHX A;  3APC A;  5LOZ A;  1KT0 A;  3X2Q E;  3D9K A;  3ASD A;  3FH8 A;  1MQS A;  5EIB E;  3ZRH A;  3QJZ A;  5D66 A;  2ETB A;  4KVO A;  4DX5 D;  5FIO A;  4GZ6 A;  4U96 D;  3L16 A;  2PQR A;  1NA3 A;  3FFL A;  4FJZ A;  4Q69 A;  3AS5 A;  3PRZ A;  5CER B;  5HRY A;  2WXI A;  2KCK A;  3DXK G;  3CQC B;  5C1D A;  3FTS A;  1EPU A;  1UN9 A;  2QYU A;  3ML8 A;  4YDE A;  4G1T A;  4EEC A;  4L23 A;  5T4Y A;  2YHC A;  4O1O A;  3UIN C;  2EIN E;  3FTX A;  3UM2 A;  5CMY A;  3S7F A;  2L6B A;  3ZHE A;  3FU5 A;  3QWW A;  1IHG A;  3ZGQ A;  5LX8 A;  4LNB A;  3DBS A;  2X6K A;  5FJY A;  4N3A A;  5FQ4 A;  2J4B A;  3D9M A;  2V0P A;  1TYQ G;  2EQX A;  5KWD A;  3ZXS A;  4PS3 A;  3OXL A;  3Q49 B;  3ONL A;  3T8K A;  4JB8 P;  2AXV A;  1OWM A;  4TRQ A;  4LUN U;  1DCE A;  4K5B A;  4XKC A;  4RQI A;  2DIW A;  4LER A;  3L6A A;  3KEA A;  2C2L A;  4CDR A;  4GYY A;  5A23 A;  4B89 A;  3QWP A;  3RSE G;  4AVX A;  3E32 A;  3LXU X;  4BWR A;  3SF4 A;  3AS8 A;  3P2B A;  4YDW A;  3KSL A;  4L2L A;  4UI9 J;  2L0T B;  3B95 A;  3C5R A;  1E8Y A;  3URZ A;  3ZYL A;  4U8V D;  4ABN A;  4FP7 A;  3JXJ A;  4OAU C;  3L08 A;  4L2Y A;  2WMN A;  5EN5 D;  2OOE A;  5FQ7 A;  4G26 A;  4PUC A;  3DXM G;  2VSO E;  4CGV A;  5CRU A;  2KXP C;  2WMO A;  5AQ9 A;  3HDX A;  2BF0 X;  4GTV A;  3FWV A;  3E37 A;  2GRP B;  3WG7 E;  1E8X A;  3BQO A;  2VTB A;  3MKR A;  1UW4 B;  2L0I A;  4GA2 A;  2P9U G;  3FUJ A;  1FPP A;  4TXP A;  1H2U A;  2EIL E;  3CVV A;  3HXF A;  1NZN A;  1QNF A;  2AXZ A;  5E75 A;  5ENT D;  1BU9 A;  1RW2 A;  3CST A;  1OXJ A;  3RJV A;  3V2X A;  2WXJ A;  4GB9 A;  4I2W A;  2XS1 A;  4XIF A;  5CCL A;  5AYW D;  5CMW A;  3DEP A;  4BER A;  5B3S E;  1TEZ A;  3ULE G;  3UM0 A;  4AP2 A;  4KBQ A;  5LFA A;  5BPP A;  4EQF A;  2QC9 A;  3D3M A;  4LSZ E;  4CDM A;  5BV0 A;  4HRL A;  3UKR G;  5G05 J;  3HRA A;  2LUH A;  3MX3 A;  3I5P A;  3FY4 A;  1LD7 A;  4FA6 A;  3DEO A;  4KYO B;  1SA4 A;  3ZPJ A;  4PH4 B;  1D8D A;  4N3B A;  3LKU A;  4JA7 A;  4C0E A;  1KT1 A;  5CRV A;  4U04 A;  3C98 A;  3IXE A;  2VSX E;  4C9B B;  3UIP C;  2LSV A;  3CHM A;  4IUL A;  3DSX A;  1K1A A;  4TXQ A;  3UTM A;  3CR3 A;  3AU4 A;  5BUZ A;  2KM4 A;  4I1A A;  1UG3 A;  3CHR A;  5FT9 A;  3OXG A;  2P9P G;  2B6C A;  5CHE E;  3RRU A;  2EIM E;  1BD8 A;  2WVI A;  2FO1 E;  1BPO A;  1O1R A;  1IKN D;  3HHM A;  4BT8 A;  3TWX A;  3U64 A;  4F1P A;  2RKK A;  2XCB A;  4ACL A;  5D0O D;  1HF8 A;  4JEH A;  3I3N A;  4MS6 A;  1YMP A;  4HQD A;  3R7Q A;  4ANV A;  2IO2 C;  2P9N G;  3QK0 A;  3QNK A;  5A6C A;  2XCC A;  5M72 A;  1NP7 A;  2VGX A;  4RLY A;  2HYZ A;  4F7A A;  3V2O A;  1N4P A;  4URK A;  3SBT B;  2LXL A;  3L9T A;  3PNL B;  2WXH A;  4HLL A;  4ZFH A;  4K5C A;  4D10 C;  1JWG A;  1IQU A;  3ASH A;  1Y6I A;  2Y69 E;  3R9A B;  3N71 A;  3CVY A;  3TGO A;  3I4R B;  3QOU A;  2LXM A;  2AWI A;  4UWH A;  4N2Q A;  3JXI A;  1O1T A;  3ISM C;  2GW1 A;  2GRN B;  1N11 A;  3HYM B;  3EHQ A;  3HXB A;  3QKY A;  3MGB A;  1EF1 C;  3C72 A;  4HRM B;  2XEH A;  3OXF A;  3Q5M A;  2AW6 A;  2P9I G;  3S7J A;  2YNQ A;  4AEZ C;  4GPM A;  2Q7F A;  3QC1 A;  5FZQ A;  4I2Z A;  2A5E A;  1SA5 A;  1ELK A;  1HG5 A;  4J8F A;  3ZEF A;  4TUU A;  1AWC B;  3Q73 A;  2IJG X;  3U4T A;  4CRW A;  5LP0 A;  2C0M A;  2VYI A;  2QYJ A;  1QYM A;  2VSN A;  2XGM A;  1TN7 A;  2I1K A;  5KJN A;  3DRA A;  2J9Q A;  1N4R A;  2Y4U A;  2WXF A;  3CVN A;  2DBA A;  2DZN A;  3RK6 A;  3NZU A;  4GA1 A;  3NAW A;  1JWF A;  5KJK A;  3SD5 A;  3CK7 A;  5D2M C;  2LO6 A;  1E96 B;  4ATG A;  4DPR A;  5B1A E;  3FTY A;  4J0U A;  4HNA D;  3F6Q A;  1BI7 B;  3LY7 A;  4XI9 A;  1ZBP A;  2ILR A;  2AJA A;  3AG2 E;  3CK8 A;  4J8S A;  2JLB A;  1OCO E;  2PM6 A;  2ZU6 B;  3NB2 A;  1H19 A;  1TNB A;  3ZW3 A;  4K03 A;  4FUL A;  3V30 A;  2FO7 A;  2WPV A;  1K1B A;  1NL4 A;  2KZT B;  3B7S A;  4WND A;  2X6F A;  2IOL A;  2FI7 A;  4J8Y A;  2KZT A;  4EHM A;  3AU5 A;  4NAC A;  3TAX A;  3QWV A;  2LSU A;  4IYP A;  5LCW C;  3L17 A;  2OND A;  2XZT G;  4L7T A;  5AQ7 A;  5EIL A;  5G04 J;  2E2E A;  5D0Q D;  1TJC A;  2XGS A;  3KEZ A;  3RO3 A;  1JCS A;  2OVF A;  3FU0 A;  4UQY A;  1JPL A;  3SHF A;  3OAW A;  1MX2 A;  3E34 A;  5ENO D;  4JD2 G;  3FUK A;  1IYG A;  3UT7 A;  3G2V A;  4BTA A;  5CBO A;  3FEY A;  1SW6 A;  1HE8 A;  2F37 A;  4JPS A;  5AEN A;  3W9G A;  4LNG A; 
#chains in the Genus database with same CATH homology
 4NQ0 A;  2DIW A;  1HFA A;  3ML9 A;  3SBS A;  4TV3 A;  4LER A;  1HU3 A;  4MLP A;  4BX8 A;  3FUM A;  3L6A A;  3ULQ A;  2HR2 A;  4BFR A;  1P5Q A;  4XI0 A;  4AJW A;  4WWN A;  1H0A A;  2P58 C;  2C2L A;  3FUH A;  3LS8 A;  4CDR A;  3CIA A;  4GYY A;  4OYS A;  5A23 A;  3CHS A;  4B89 A;  1EDU A;  3CVL A;  3KS2 A;  2J07 A;  2HM8 A;  3OTN A;  3QWP A;  4JHK A;  3CQG B;  4WNF A;  4AVX A;  4ANX A;  3LXU X;  4XKB A;  2Y4T A;  3D9O A;  5FWQ A;  3AS8 A;  3P2B A;  3SF4 A;  4BWR A;  1B89 A;  4UI9 J;  4L2L A;  4UWK A;  1N52 A;  2MHK A;  3IKO B;  1GW6 A;  4J8E A;  4V3I A;  3BG0 B;  5EX0 A;  4I6G A;  2L0T B;  4G24 A;  3TXN A;  3LYA A;  1ELW A;  5DIZ A;  3UT4 A;  4GML A;  4A3T A;  3JYS A;  4CT0 A;  3FUL A;  1E8W A;  1U3C A;  1E8Y A;  3URZ A;  3ZYL A;  4CCA A;  5ENN A;  3QB2 A;  2AXU A;  3TL5 A;  4ABN A;  2M63 A;  3LDZ A;  4GU5 A;  2L6J A;  3NZS A;  2IQC A;  2WXR A;  4JA9 A;  1LF8 A;  1OWP A;  4FP7 A;  4E85 A;  4AY5 A;  5FTP A;  2WXG A;  4WWP A;  2WXQ A;  1H2V C;  4KT6 B;  3L08 A;  1OWL A;  4L2Y A;  2WMN A;  4CEM A;  4IRU A;  4Q96 A;  3FUN A;  4ILG A;  4FHJ A;  3ZVV A;  2OOE A;  3TXM A;  5T3R A;  5FQ7 A;  4G26 A;  4A1G A;  4B8A A;  3U3W A;  4PUC A;  2CFZ A;  4I1O B;  4I6J A;  4JXT A;  2CG3 A;  2VSO E;  4CGV A;  1IQR A;  1XNF A;  4HXI A;  4KZ0 A;  3T5X A;  2XRY A;  2WMO A;  2YHE A;  3L13 A;  1QQE A;  2LNI A;  3IHV A;  3D9N A;  3HDX A;  4EZK A;  5JJ7 A;  2WQ7 A;  2YIN A;  2BF0 X;  3FWV A;  3MJW A;  5J08 A;  3JCK C;  2UY1 A;  4HOT A;  3FEX A;  5ANL A;  2VGY A;  4YVO A;  2WM9 A;  5FQ6 A;  1E8X A;  4U0Z A;  1PC2 A;  2X3M A;  5DBK A;  1UN8 A;  4KVM A;  2VTB A;  3ZN3 A;  3D9J A;  3MKR A;  1UW4 B;  2J49 A;  4N3C A;  2L0I A;  2FUL A;  3RO2 A;  1DNP A;  4U0S A;  4APO A;  4GA2 A;  2LAI A;  4B0Z A;  2CHZ A;  3PVL A;  2CFU A;  3FUJ A;  1H2U A;  4AXH A;  5T8I A;  3ZHE B;  2RD0 A;  3B13 A;  3P1U A;  4FLB A;  3CVV A;  1SQM A;  4UWF A;  1NZN A;  1QNF A;  2AXZ A;  4U07 A;  5E75 A;  3CKC A;  4ILH B;  3R7R A;  4EZJ A;  4N5C A;  3VTX A;  1N54 A;  3CST A;  3PUJ A;  2YQ8 A;  4B94 A;  3CK9 A;  3RJV A;  4DI4 A;  2QFC A;  2WXJ A;  2OV8 A;  5BV1 A;  4GB9 A;  4I2W A;  3SFZ A;  4GZC A;  4XIF A;  5CCL A;  5AYW D;  5G04 C;  5CMW A;  5G55 A;  4PDX A;  4PS8 A;  1W3B A;  3CEQ A;  1S0P A;  3G2T A;  4DJA A;  1WY6 A;  2I1J A;  2VJ8 A;  2X38 A;  3L22 A;  4HOU A;  4IN3 B;  5KCM A;  3RKV A;  4DI3 A;  4WUY A;  1TEZ A;  5G2N A;  2CHW A;  4EBA A;  4AP2 A;  4KBQ A;  3JUI A;  4HVB A;  3JQ0 A;  5LFA A;  3E4B A;  2ION A;  2UWJ G;  2L9B A;  3ZYQ A;  4EQF A;  5BPP A;  3UQ3 A;  3PRE A;  3CLJ A;  4Y6W A;  4YND A;  3ZYM A;  3PS6 A;  3D3M A;  3AS4 A;  3TG4 A;  4CDM A;  5BV0 A;  5G05 J;  2IU1 A;  5ARF A;  3GW4 A;  3FU3 A;  3GZS A;  1INZ A;  4WAF A;  3MX3 A;  4GZ3 A;  4KXK B;  3FTW A;  3SZ7 A;  3I5P A;  3IEG A;  4FLH A;  3FY4 A;  3MV2 B;  1PY1 A;  2J4D A;  1HX8 A;  4FA6 A;  4KYO B;  4HOS A;  3RRM B;  4G11 A;  3ZPJ A;  4JHJ A;  4PH4 B;  4BTB A;  4BX9 A;  4N3B A;  1FCH A;  3LKU A;  5JHB A;  4XX5 A;  4JA7 A;  5EKQ D;  1WM5 A;  4O6F A;  1KT1 A;  3CVQ A;  4C0E A;  4U0U A;  1MHQ A;  3RRN B;  4EBA G;  4U04 A;  3C98 A;  1UJJ A;  3G2W A;  2J08 A;  4DLO A;  4M3O A;  1E7V A;  2VSX E;  4C9B B;  1OWN A;  3BEE A;  2LSV A;  3CVP A;  3CHM A;  2XHE A;  3S7B A;  4IUL A;  2WXO A;  3DPD A;  3LVR E;  3CR3 A;  1HXI A;  3AU4 A;  4H7Y A;  5BUZ A;  4LCT A;  4XZ4 A;  3PNT B;  4KZC A;  3CGH A;  1KLX A;  5BT1 A;  2KM4 A;  3S2A A;  3Q4A B;  4I1A A;  2WXL A;  1UG3 A;  3CHR A;  4UI9 C;  5FT9 A;  3OXG A;  3PEU B;  2GGF A;  4N39 A;  4ILI A;  4L1B A;  3LCA A;  1HZ4 A;  3KAE A;  5CHE E;  3RRU A;  4A3V A;  3CKB A;  1SZA A;  1HO8 A;  2X6I A;  2WXM A;  2WQH A;  2WVI A;  3RU0 A;  4AV7 A;  3TG5 A;  1BPO A;  3G2U A;  3GZ1 A;  1EYH A;  3B7T A;  4Q94 A;  3HHM A;  2LAH A;  4I6E A;  4BT8 A;  3U64 A;  3I4G A;  4UQX A;  4GYW A;  2XCB A;  3VLF A;  1X5B A;  1SZ9 A;  2PZI A;  5D0O D;  4PS7 A;  1HF8 A;  4ACL A;  5J90 A;  4JEH A;  2CG2 A;  1A17 A;  3I3N A;  4FHK A;  4CDN A;  2I2O A;  3EHN A;  4MS6 A;  3ONK A;  3QAQ A;  4QFV A;  2IF4 A;  3Q15 A;  2A4Z A;  2OVB A;  4H7X A;  3U9W A;  1U3D A;  2UY1 B;  4AM9 A;  4RSY A;  3R7Q A;  2PL2 A;  4N2S A;  4ANV A;  4F53 A;  2KCV A;  2FBN A;  3QK0 A;  4A55 A;  4WWO A;  3D9P A;  2VTB B;  2R17 C;  2XPI A;  3QNK A;  5AIJ A;  4GZD A;  5BW8 C;  5A6C A;  3QDN A;  3EJN A;  3UPV A;  1ELR A;  2XCC A;  5M72 A;  1JUQ A;  2PQN A;  2KAT A;  3ASF A;  1NP7 A;  2VGX A;  4G25 A;  2HYZ A;  5AJD A;  2KCL A;  4DLQ A;  3HVE B;  4F7A A;  2WQ6 A;  3LY9 A;  3PH0 C;  5FQ8 A;  4AY6 A;  3ASG A;  3FUD A;  4URK A;  2WXK A;  3EHM A;  3JQ1 A;  3SBT B;  2NSZ A;  4JW1 A;  3PNL B;  4APF A;  3HVE A;  3U66 A;  2XGO A;  4C0M A;  3NF1 A;  4JEU A;  2X6H A;  2WXH A;  3ENE A;  3GZ2 A;  3FH5 A;  4D10 C;  4FC8 A;  1JWG A;  1IQU A;  3ASH A;  1Y6I A;  4YVQ C;  3R9A B;  3N71 A;  3PEV B;  3CVY A;  3TGO A;  4LEU A;  3I4R B;  3T8M A;  4HOQ A;  4AOF A;  3FTZ A;  3D9I A;  3S7D A;  3QOU A;  3VLD A;  5LCW J;  3APF A;  2AWI A;  4JZY A;  5BNW A;  3LPZ A;  4UWH A;  3CHP A;  4I17 A;  4ANW A;  4N2Q A;  3B7R L;  3SNX A;  4U63 A;  3O4Z A;  4HOR A;  1YA0 A;  2GW1 A;  3PDN A;  2NXP A;  4I9C A;  2E0I A;  5JHA A;  3LJ3 A;  4HFG A;  3HYM B;  4GZ5 A;  4NUR A;  4MRU A;  4UWG A;  3FTV A;  3ZFW A;  3CSF A;  3QKY A;  4I9E A;  2AVP A;  3MGB A;  2RG8 A;  4RG6 A;  1EF1 C;  1E8Z A;  2MRI A;  3UUX A;  3LVQ E;  2V8S E;  1HG2 A;  4WNG A;  3OXF A;  3T5V A;  3IV0 A;  3O48 A;  4B8C B;  3Q5M A;  4HS2 A;  1L5J A;  3LEW A;  4NRH B;  4GMJ A;  2AW6 A;  3ESL A;  3GYZ A;  5G05 C;  4K0R A;  4GPK A;  3S7J A;  3IHY A;  3MCX A;  4EZL A;  2YNQ A;  4AEZ C;  2FEZ A;  3L54 A;  2R5S A;  3RIB A;  2Q7F A;  3QC1 A;  2HO1 A;  1E90 A;  2V4L A;  2C0L A;  2Y3A A;  4ME2 A;  5A7D B;  4RG9 A;  3FU6 A;  4I2Z A;  5FZQ A;  2CHX A;  5ANR A;  2J09 A;  1ELK A;  3APC A;  3VTY A;  3MZL B;  1HG5 A;  3FUF A;  4J6I A;  5LOZ A;  1KT0 A;  4XE0 A;  4J8F A;  1H6K A;  1Z3X A;  2WXP A;  4MKT A;  3ZEF A;  4TUU A;  3D9K A;  3ASD A;  4GAA A;  4Y6C A;  3LY8 A;  4UI9 K;  3FH8 A;  1MQS A;  2IJG X;  4JC8 A;  4OVU A;  2KC7 A;  3U4T A;  3HIZ A;  3ZRH A;  4CRW A;  3UX4 A;  5LP0 A;  3Q47 B;  3MA5 A;  1TJF A;  2XPY A;  2FF4 A;  2I9C A;  1HH8 A;  2C0M A;  2VYI A;  3EIJ A;  3QJZ A;  4FAD A;  1QZ2 A;  4UQZ A;  2VSN A;  2WB2 A;  2XGM A;  4KVO A;  3EIQ C;  3FTU A;  3MEK A;  1UJK A;  2VQ2 A;  1E7U A;  4BT9 A;  2BUG A;  2I1K A;  5KJL A;  4GZ6 A;  5KJM A;  5ARG A;  5KJN A;  3L16 A;  2GRM A;  2XRZ A;  4LRZ A;  2PQR A;  5C2Y A;  2J9Q A;  4JHR A;  2Y4U A;  1NA3 A;  1Z6T A;  2WXF A;  3FFL A;  3CVN A;  4KMO A;  4UWL A;  5EDS A;  3PE4 A;  4GCN A;  2DBA A;  3CVW A;  3G2S A;  1HS6 A;  3RK6 A;  3NZU A;  4FJZ A;  4FJY A;  4Q69 A;  3AS5 A;  4GA1 A;  3B7U X;  1JWF A;  1VDY A;  5KJK A;  3SD5 A;  4ANU A;  3PRZ A;  5FZR A;  3CK7 A;  2XEV A;  1DVP A;  2LO6 A;  1E96 B;  4OVV A;  4ATG A;  4DPR A;  3FTY A;  3NQP A;  4GA0 A;  4HLE A;  4J0U A;  2GRL A;  2WXI A;  3CHO A;  2KCK A;  1OWO A;  2QY7 A;  2VGX B;  2VSY A;  4BSX A;  4W9R A;  1PAQ A;  3FDH A;  4I1M A;  2R59 A;  3MV3 B;  3LY7 A;  4FU3 A;  4XI9 A;  1NA0 A;  2XQ0 A;  1ZBP A;  2ILR A;  3SGH A;  3CQC B;  3CHQ A;  3UT8 A;  3CK8 A;  3BG1 B;  4J8S A;  3FP3 A;  3EDT B;  2JLB A;  4G23 A;  3VLE A;  5C1D A;  4GCO A;  2PM6 A;  2ZU6 B;  1H19 A;  3FTS A;  3WXX A;  1EPU A;  1UN9 A;  3ZW3 A;  4K03 A;  4FUL A;  3ML8 A;  4J8D A;  2I6H A;  5JJ6 A;  2FO7 A;  2WPV A;  4A1S A;  3PZD A;  4EPZ A;  3B7S A;  2KZT B;  4G1T A;  4WND A;  2X6F A;  4BY6 A;  1FVH A;  2IOL A;  3FUE A;  4EEC A;  2FI7 A;  4JVS A;  3CVX A;  4L23 A;  4RVB A;  2KZT A;  5T4Y A;  1Z3Y A;  3QAR A;  3CV0 A;  1WAO 1;  2WXN A;  2YHC A;  3AU5 A;  3MKQ B;  4NAC A;  3FHE A;  5AJL A;  3TAX A;  5EX3 A;  3QWV A;  2LSU A;  4IYP A;  4DK5 A;  3FTX A;  4P29 A;  5CMY A;  3UMV A;  3ESK A;  5HI7 A;  5LCW C;  3L17 A;  5E76 A;  3MKQ A;  3S7F A;  2OND A;  4L7T A;  3D9L A;  3ZHE A;  3ZIM A;  5G04 J;  2A5U A;  3FU5 A;  2E2E A;  1XGW A;  5D0Q D;  1TJC A;  1IHG A;  2XGS A;  3QWW A;  2IOS A;  3KEZ A;  3MYV A;  3ZGQ A;  3PE3 A;  4I43 A;  5JJT A;  5LX8 A;  3DBS A;  3RO3 A;  2NC9 A;  2X6K A;  2XPZ A;  2PM7 A;  4N3A A;  5FJY A;  5FQ4 A;  2J4B A;  2OVF A;  3FU0 A;  3FUI A;  2DCP A;  4JL0 A;  3PUK A;  4G2V A;  4UQY A;  3D9M A;  1FVF A;  2V0P A;  5FZS A;  1JPL A;  2V5F A;  1ZU2 A;  3IBE A;  3SHF A;  2EQX A;  4E6H A;  3OAW A;  4ACK A;  3ZXS A;  4F3V A;  3KD7 A;  4PS3 A;  3ZYK A;  3FH7 A;  4U8H A;  3CVU A;  5HQ8 A;  1H2T C;  2MOW A;  3OXL A;  2X6J A;  3FUK A;  3UT7 A;  1IYG A;  1OUV A;  3G2V A;  4R7L A;  4AIF A;  4CGW A;  3Q49 B;  4BTA A;  1Y8M A;  3ONL A;  3K9I A;  2JEK A;  3TJP A;  4GYO A;  2AXV A;  3FEY A;  5CCM A;  1OWM A;  2BTD A;  4CT4 A;  1HE8 A;  4TRQ A;  4LUN U;  3APD A;  4JPS A;  4WNE A;  4F1S A;  5AEN A;  4XKC A;  2IFU A;  3SI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...