3URZA

Crystal structure of a putative protein binding protein (bacova_03105) from bacteroides ovatus atcc 8483 at 2.19 a resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
201
Chain Sequence
SVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYKSPTKMQYARYRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACOVA_03105) from Bacteroides ovatus ATCC 8483 at 2.19 A resolution
rcsb
source organism Bacteroides ovatus
total genus 70
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3urzA00
5D0OD 4GZ3A 1E96B 5ARGA 3ASDA 3S7JA 1WM5A 5HI7A 3CVQA 3LYAA 2Q7FA 4HOUA 3AS5A 3QDNA 3QWPA 2KC7A 5LCWJ 4JL0A 1NA3A 5FJYA 4HOQA 1WAO1 4GZ5A 2FO7A 2VQ2A 3PE4A 2VGYA 3MV2B 3ZGQA 4I17A 3CVNA 4I1AA 3ASFA 2Y4UA 4JA9A 5A7DB 5BW8C 3CVLA 2FBNA 1QZ2A 2VYIA 5KJKA 5CCLA 2KCVA 4N2SA 2PQNA 5JJ7A 1KT0A 2YQ8A 1OUVA 5FT9A 3IEGA 4BTAA 4U0ZA 2L6JA 3Q49B 4O6FA 4CGVA 3LPZA 4G24A 2VGXB 4GZ6A 5G05C 2IFUA 3GZ1A 3CK8A 3EDTB 5KJMA 1YA0A 3CK7A 3VTYA 3ESKA 5M72A 5D0QD 4GYOA 1Y8MA 1PC2A 3HYMB 3OXFA 1NZNA 5CHEE 4JA7A 4WNGA 4UI9K 3GYZA 2VGXA 4N5CA 5G05J 3ZHEB 5EX3A 4XIFA 4BT9A 3URZA 4IN3B 3SZ7A 2JLBA 2FI7A 2IF4A 4HORA 2XGSA 1HH8A 4GA0A 5KJNA 4YVQC 2DBAA 5FZSA 3CVPA 5FZRA 4WNFA 3KD7A 3O48A 3U3WA 4AY6A 3ZPJA 5BT1A 4GA2A 3ZHEA 4BTBA 4U0UA 3QWWA 4GCOA 2GW1A 2R5SA 3BEEA 2WPVA 4I9EA 4NRHB 1HZ4A 1P5QA 3MEKA 3ASGA 3U4TA 3KAEA 3TGOA 3RKVA 3ASHA 3R9AB 3QKYA 2XCCA 3JYSA 4F3VA 3LY9A 4I2ZA 1ELRA 2UWJG 4A1SA 1A17A 4EQFA 4GPKA 2P58C 3RU0A 3GZ2A 4N3BA 3TG5A 2HYZA 4G2VA 3ZN3A 2KCKA 1IYGA 1KT1A 3AS4A 4I9CA 4AY5A 3E4BA 2KCLA 2C0MA 5FZQA 4BT8A 4CDRA 3MV3B 4CGWA 4ABNA 4UI9J 3PDNA 4NQ0A 3LY8A 4GA1A 4AM9A 3PE3A 3FWVA 3CEQA 3WXXA 4G25A 4U04A 5DBKA 3UPVA 1HXIA 2NC9A 2PL2A 3OXLA 5EX0A 3OXGA 3TAXA 3RO2A 4J8FA 4G23A 1QQEA 3N71A 4H7YA 4J0UA 4U0SA 5ARFA 1NA0A 2OOEA 4LEUA 5CCMA 2XPIA 2PZIA 3UQ3A 2UY1B 3CKBA 4U07A 4XI0A 2AVPA 2C2LA 2ONDA 5G04C 2YHCA 4KXKB 5AYWD 5C1DA 2FF4A 3K9IA 3Q47B 2Y4TA 3QWVA 3RIBA 5KJLA 4N2QA 4B94A 1ZBPA 2C0LA 2BUGA 4XI9A 2QFCA 2WQHA 3GW4A 4HOTA 2UY1A 5BNWA 3Q5MA 5G04J 2XCBA 4GYWA 4WNDA 1ZU2A 4KBQA 3S7DA 4UQYA 2J9QA 4UQXA 2PQRA 2KATA 4UI9C 4H7XA 2LSVA 4N39A 3UUXA 1XNFA 4KYOB 4YNDA 3S7FA 2LSUA 4RG9A 4G1TA 4J8EA 4I2WA 3CKCA 4APOA 2XGOA 3MA5A 2VSYA 3S7BA 3Q15A 1IHGA 2LNIA 4N3CA 3LCAA 1W3BA 5JJTA 4BWRA 2XGMA 3RO3A 4Y6WA 3LY7A 5JJ6A 2I6HA 3CK9A 3TG4A 4G26A 4AIFA 4Y6CA 4RG6A 3RJVA 3FFLA 3NF1A 2MHKA 1KLXA 2FEZA 4JHRA 5A6CA 3MKRA 2VSNA 5HQ8A 4WUYA 3AS8A 4YVOA 4HOSA 4WNEA 4J8DA 3QOUA 5DIZA 1TJCA 3KS2A 3SF4A 4W9RA 2E2EA 2HO1A 2HR2A 1ELWA 4ME2A 5FTPA 1B89A 4N3AA 3ULQA 3CV0A 4UQZA 3FP3A 5LCWC 2XEVA 3LKUA 3ZFWA 3Q4AB 2V5FA 4GYYA 1FCHA 4GCNA 3VTXA 5EKQD
chains in the Genus database with same CATH superfamily
3J5PA 2P9SG 1E96B 2P9NG 3ASDA 1GW6A 3QARA 3W9FA 3VLDA 5HI7A 5CEAA 3PZ4A 3IBEA 5KNGA 3EHRA 4J6IA 1S70B 2XENA 3B7TA 2GRNB 4U8HA 5FJYA 1UN8A 2WQ7A 4GZ5A 2FO7A 2R17C 1ELKA 3ZNGA 2VQ2A 3PE4A 3PREA 4XKCA 3DSWA 4FHJA 1EDUA 4GMJA 3T5VA 1H2VC 4JA9A 2J09A 4DI4A 4U7EB 3CVLA 2FBNA 2NXPA 4TXQA 1OY3D 4EZKA 1LTXA 2J07A 2Y1LE 3CHOA 2L0TB 1TN6A 2WMNA 1HF8A 4F6RD 4N2SA 1MQSA 3UINC 3LVQE 3NOGD 2L6JA 5BXUA 5G2NA 5ENSD 2L9BA 4TUMA 3LPZA 4FC8A 4CYMD 3EIJA 3DEOA 5G05C 4PDXA 1V54E 3T8KA 3CHPA 4PS3A 5BUZA 4IYPA 2GGFA 2BTDA 3Q7FA 2B6CA 1EF1C 3SY2A 2RFMA 3HYMB 4GPMA 1OWMA 1IQUA 4WNGA 4UI9K 1S63A 5G05J 1DCQA 3URZA 3DPDA 4IN3B 3CQGB 5BXOA 2IO2C 3Q9UC 1SVXA 5LP0A 2FI7A 2IF4A 3IV0A 2XGSA 4CZ2D 3FU0A 3PUJA 4OVUA 3HHMA 4WNFA 3KD7A 3FH8A 2YNQA 3O48A 2P9UG 3CSFA 4AY6A 4HVBA 4A55A 2R5SA 3BEEA 1HZ4A 2X6JA 3FTYA 3HXCA 3NAWA 2H6FA 3ASHA 3ZIMA 4E85A 2XCCA 1E8ZA 3FY4A 3EUVA 3UM2A 3AG4E 1E8XA 4JW1A 3G2VA 3FUEA 3LY9A 3TWUA 1D8EA 1OXJA 5CBNA 3SNXA 1E8WA 4L2LA 1N95A 2R05A 1AP7A 2HE0A 3RU0A 3SO8A 3GZ2A 4N3BA 2XHEA 3CHSA 4UWHA 4GTOA 1TN8A 1UN9A 3TL5A 2X6FA 3FUDA 3AG1E 2J4DA 3IKOB 2C0MA 3R7QA 2PNNA 1S0PA 3HDXA 4BT8A 2Y3AA 3T8MA 2CHZA 1HU3A 3OAWA 3EU9A 3ISMC 4ABNA 3U66A 5T4YA 2P9KG 1K1BA 4AM9A 1BPOA 3PE3A 1SA5A 2GRMA 4G25A 2FO1E 3U64A 4B8AA 1HXIA 4V3IA 1A5EA 4EECA 3OXLA 4TRQA 4MKTA 2OCCE 3ESLA 1HFAA 1QBQA 4DI3A 1Y6IA 4H7YA 2ZGDA 3ZYLA 2XZTG 3SBTB 5EILA 2XEHA 3V2XA 2OOEA 2V5QC 5CCMA 4O1OA 3TWXA 3NQPA 1O1RA 3UMVA 1NL4A 2C2LA 2ONDA 2WXNA 5FQ4A 4O1PA 3VLFA 2H6HA 4GU5A 1SZAA 3Q47B 4PH4B 4ATZD 2IJGX 1D8DA 4PUCA 5EIDA 3RIBA 1SW6A 4HB5A 2XZDG 3B7SA 3FEXA 4B94A 3KEAA 2BUGA 4I6JA 3B13A 3GW4A 3B7UX 1QYMA 5HRYA 5BNWA 2RKKA 2XCBA 3BG0B 5FINA 4WNDA 2WQ6A 3CGHA 4R7LA 1Z3XA 2WVIA 4U96D 4UQYA 1L5JA 5AQ9A 4UI9C 2WXHA 4J8SA 4BERA 2LSVA 3CLJA 3UUXA 4G8LA 5ENQD 2R59A 3JQ1A 2LSUA 2LXMA 4JZYA 3FULA 3EHQA 4G1TA 3I5PA 2CG3A 2RG8A 3QJZA 4LG6A 3CKCA 2LUHA 4TUUA 2LAHA 3AU5A 2NYJA 4KVMA 1E8YA 5EN5D 2AJAA 4C0EA 4BESA 2VSYA 3S7BA 2B0OE 4EPZA 4GB9A 2F0YA 3LS8A 4GMLA 1TNYA 4GTPA 3AJIA 4N3CA 4AP2A 1DVPA 4DUIA 3FUIA 4DPRA 2E0IA 3L08A 2QYUA 2IEJA 2AXUA 1IHBA 4BY6A 3FUNA 4ILGA 3NF1A 1UOHA 1KLXA 1UW4B 1JPLA 2CHWA 3MKRA 5HQ8A 3NB2A 3PVLA 4WNEA 4J8DA 4DRXE 3U9WA 4A3VA 3KS2A 1QNFA 3QK0A 1FT2A 3PEVB 3ABLE 4OAUC 2BEDA 2ZIRA 4JPSA 1MJ0A 2VTBB 1ELWA 1FVHA 4OVVA 4LSZE 3ML9A 1Z5SC 4N3AA 1TR4A 2H6GA 5D66A 3I4GA 3UT4A 2P2CP 3CVVA 3L16A 3CR3A 3ZFWA 4DX5D 1YCSB 4GYYA 5LX8A 1SQMA 3PRZA 5D0OD 3ZYKA 4GZ3A 3Q75A 2DYRE 3CHRA 5ARGA 3Q7AA 3HXBA 5HS0A 2VTBA 1H19A 3HXEA 3CVQA 2AW6A 4FU3A 4UWKA 4HOUA 3AS5A 3QWPA 1OT8A 4WAFA 2J4BA 5ITZF 5C2YA 3Q78A 4JL0A 3I4RB 3HRAA 4HOQA 1WAO1 2WM9A 4HI9A 4K5AB 3UM3A 3KEZA 1H2UA 2WXIA 1H2TC 3LEWA 2VGYA 2NSZA 3FUHA 3FHEA 4BFRA 3V79K 4I17A 3CVNA 3ASFA 1EYHA 3NOCD 1KPSB 2QZAA 4B93B 5BW8C 4KZ0A 2P9PG 1QZ2A 1BU9A 3E34A 5H7PA 2IO3C 2DIWA 1MYOA 2KCVA 4C0MA 5B1AE 5ENRD 2YQ8A 1OUVA 5FT9A 3NZUA 3IEGA 4BTAA 3TWVA 3D9OA 1OCCE 4GTSA 2H6IA 3G2TA 4CGVA 3IHVA 3IXEA 4C9BB 3APCA 1MX6A 1OCRE 2X6KA 5ANLA 5M72A 1TNBA 5D0QD 2EINE 1E7VA 5LOZA 1PC2A 2XEEA 3BUAA 3OXFA 1NZNA 4EHMA 5CHEE 4JA7A 3GYZA 3ZHEB 3W9GA 5EX3A 1X5BA 3D9KA 3OTNA 3QB2A 2WXFA 1JCQA 3SZ7A 3UKRG 5AAOA 2JLBA 4HORA 3G2UA 2V0PA 5KJNA 4N5QA 5FZSA 1N0RA 1INZA 3CVPA 2CFUA 4ANXA 1UJJA 3ZPJA 4GA2A 3ZHEA 1TNZA 3MKQB 3QWWA 2WPVA 2DZOA 4NRHB 3ABME 4XX5A 3U4TA 2V8SE 3TGOA 3R9AB 4IRUA 5BPPA 2J8SD 4BX8A 4GTRA 2YINA 3L17A 3HXDA 4JB8P 1ELRA 2OVFA 3MKQA 3DSSA 4GPKA 2P58C 4CRWA 3BQOA 2KCKA 5CMWA 5AJLA 5KBAA 3UTMA 4AY5A 3QAQA 2KCLA 4DX7D 4K0RA 3D9LA 3P2BA 3RRMB 4J7WA 3MV3B 3DBSA 1V55E 4CCAA 1LD7A 3PDNA 3C72A 2WXGA 3CEQA 4L9PA 2WXPA 5LFAA 3CVYA 3QNKA 1N52A 1ZB1A 2F8XK 3CVXA 4L2YA 2NC9A 4Q96A 4LRZA 1HG5A 4J8FA 4G23A 3L9TA 3EJNA 1QQEA 5CECB 3MCXA 4O60A 4U8YD 5ARFA 1AWCB 3KSQA 1NA0A 1MX4A 1FPPA 2PZIA 2UY1B 3KSLA 4DX1A 1HG2A 4XI0A 2YHCA 4KXKB 2Y0BG 5AYWD 3V2OA 4F7AA 3FTXA 2R03A 3QWVA 2F8YA 5KJLA 4N2QA 4FJYA 1ZBPA 2R2LA 2C0LA 3HVEB 2KBXA 1N11A 2J49A 2GRRB 2P9IG 3DEPA 2J08A 3RRNB 3FUKA 2UY1A 3APDA 4GYWA 2GRLA 4UWLA 1ZU2A 4K5CA 3I3NA 2XS8A 3E37A 3S7DA 2RFAA 2J9QA 4C48B 1N4RA 4KVOA 3HVEA 4MS6A 2QY7A 3LJ3A 4KYOB 3X2QE 4YNDA 4TXRA 4J8EA 4I2WA 3RK6A 4HS2A 4APOA 5ENNA 3DXMG 3L82A 2XS1A 2LNIA 3UIPC 4EBAA 1LF8A 3AAAC 3F6QA 3FEYA 5JJTA 3Q73A 4Y6WA 4L7TA 5JJ6A 4YDYA 3CK9A 3ONLA 4TV3A 4Y6CA 3TWRA 3LJNA 1YYHA 2DVWA 3TWSA 2IY0C 2WB2A 5A6CA 3SD5A 4WUYA 3AS8A 4CDMA 4F1PA 3SF4A 5KWDA 2IONA 4W9RA 3V30A 3D9JA 5AIJA 1U3DA 3ZXPA 2LO6A 3ASNE 4ME2A 5KNHD 5FTPA 4I1MA 4LNBA 5A23A 1NFIE 3CV0A 2WXMA 1H6KA 1N4PA 3FTSA 3Q4AB 4XZ4A 5HKPA 3VTXA 4ZFHA 3FUFA 1D9SA 2ETAA 5CRVA 2WXOA 3TXNA 2Q7FA 2XPZA 1TEZA 3QDNA 5ENTD 4HRLA 4FA6A 3DXKG 1TYQG 3DSVA 1OWPA 1H6PA 5D2MC 4GZCA 3L54A 4DK5A 1NA3A 3WG7E 1U2VG 1UJKA 2DCPA 2QYJA 3CQCB 4U8VD 3EHMA 2RD0A 4ANVA 1X81A 4I1AA 2Y4UA 3FH5A 2FULA 2BF0X 2VYIA 4I1OB 1SZ9A 3P1UA 1DCEA 3LXUX 4FADA 2YHEA 5KJKA 2EILE 5CCLA 1KT0A 3D9IA 3BG1B 3E33A 4U0ZA 3ULYA 1JUQA 4ILHB 3TJPA 1WG0A 5AENA 5KCMA 4GZ6A 3GZ1A 3CK8A 3ZW3A 5KJMA 3IHYA 1FT1A 2R02A 2XRYA 3VTYA 2I9CA 4G8KA 4HNAD 2IU1A 3SGHA 5E76A 4CEMA 4F53A 4NURA 2ZU6B 3SFXA 4QFVA 4XIFA 1MHQA 2A4ZA 3FTWA 4HBDA 4AXHA 3EIQC 3GZSA 2XRZA 3PNLB 1HH8A 4GA0A 3DSUA 2X3MA 4YDEA 2DBAA 2JABA 3PUKA 5EIBE 3C98A 5JA4D 2OV8A 4M7CA 3U3WA 5BT1A 3TXMA 4BTBA 4U0UA 3TWWA 5AQ7A 4GCOA 3CIAA 2GW1A 4I9EA 3JXJA 3ASGA 1OCZE 3RKVA 1SA4A 4ACLA 3L6AA 3R9MA 3JYSA 2AWIA 1OCOE 2BKKB 3ZUVB 3T9KA 2CFZA 4E6HA 4I2ZA 3O4ZA 3V31A 2VSOE 2LXLA 4A1SA 3JXIA 4EQFA 4GTQA 2V4LA 2X38A 4B89A 5JMND 4J8YA 2OEWA 4G2VA 4JC8A 4GTVA 4I9CA 3SBSA 3LVRE 4Z68A 5ENPD 3PNTB 1PY1A 2BKGA 5FZQA 3JCKC 2IQCA 2IOLA 1MZCA 4XKBA 3Q79A 3ZYQA 1OWOA 4I43A 4ANUA 2I2OA 1JWGA 4AEZC 4GA1A 3HIZA 4YDWA 3ZXSA 4U04A 5DBKA 3UT7A 3CVWA 4QQIA 3UPVA 2MRIA 3UIOC 3B95A 4DJAA 1HO8A 4ANWA 2PL2A 1BD8A 3FU5A 4U95D 5G55A 5EX0A 5CERB 3CHMA 3TAXA 4TXPA 2A5EA 2WXQA 3B7BA 4I6EA 4K03A 4MBGA 3ML8A 4UUCA 2ZGGA 3RRUA 2AXZA 5FQ8A 3VLEA 3JQ0A 4HRNA 3SFZA 4J0UA 1H6OA 4U0SA 4YDOA 5AJDA 3C3QA 4D10C 2PM7A 2IOSA 4P29A 4FULA 4LEUA 2EIJE 5EYPF 2VGEA 3UQ3A 3NZSA 3L13A 5G04C 2FF4A 3TWTA 4X8QA 3UX4A 1EPUA 4FLBA 1WDYA 3ONKA 3DWLG 2GRQB 1N94A 1KZOA 4WWNA 4HI8A 5AN8A 1OWNA 5BV1A 3PZ2A 4XI9A 3Q9NC 4ACKA 4HOTA 3Q5MA 5G04J 2WXJA 4IULA 3PZDA 2QC9A 5FIOA 5ENOD 4LUNU 4UQXA 3DSTA 2EIKE 2PQRA 2KATA 4GMRA 4H7XA 2DZNA 4N39A 3PZ3A 5EYLA 3ZKJA 1XNFA 3CVUA 4AVXA 5FQ7A 3S7FA 1PAQA 5CRUA 4EZJA 4KMOA 5CMYA 2ETBA 4JEHA 3LDZA 1XGWA 3Q15A 1IHGA 3UXGA 5T8IA 1JWFA 1W3BA 4HLLA 4PS8A 4BWRA 2XGMA 3PZ1A 4GTMA 4CT4A 4RQIA 3TG4A 4G26A 4KT6B 4RG6A 1FVFA 3MX3A 2ZXWE 3RJVA 1OWLA 2MHKA 5CEDB 4JHRA 2VSNA 3SI5A 1K1AA 2CHXA 4YVOA 4HOSA 4AOFA 2E2EA 5J08A 2HO1A 1N4QA 1IXVA 4RLYA 4Q94A 1DC2A 1B89A 4PS7A 5B3SE 1N54A 4UQZA 3FTVA 1YMPA 5LCWC 1N9AA 2V5FA 4GTTA 1Z6TA 3ZRHA 1NI1A 1FCHA 3CHQA 1BI7B 4URKA 5EKQD 3HG0D 2VJ8A 3S7JA 3S2AA 1WM5A 3LYAA 4HFGA 3ZU7B 3ASOE 1HX8A 2EIME 2KC7A 4L23A 5LCWJ 3JUIA 1IQRA 1HS6A 2PM6A 4WWPA 3D9MA 4RSYA 3QC1A 2OEVA 5JHAA 4HXIA 3FU3A 4DX6D 3MV2B 4DLOA 3BU8A 4I6GA 3ZGQA 1K3ZD 5A7DB 1RZ4A 4HQDA 5E75A 2P9LG 3JUEA 4DX2A 2A5UA 2ZISA 1TNOA 2GROB 3B7RL 2PQNA 2KXPC 5JJ7A 3MZLB 4OAVB 3Q49B 4O6FA 4A1GA 3RSEG 4G24A 2VGXB 3AU4A 4FP7A 3ENEA 1NP7A 5T3RA 2IFUA 3EDTB 2VSXE 4U63A 1YA0A 3CK7A 2WXRA 3FUMA 3NBNB 3ESKA 5BV0A 1RW2A 1LD8A 2LAIA 4GYOA 3DSXA 1Y8MA 4L1BA 3D9NA 3C3OA 5J90A 4A63B 1E90A 1JCSA 2VGXA 4N5CA 4BT9A 3EU5A 3PH0C 2ILRA 4NACA 4JD2G 3UKUG 2X6IA 4YVQC 1Z3YA 1O5MA 5FZRA 2MYOA 4HLEA 4LCTA 2KZTB 3ZEFA 3FU6A 5FWQA 2EQXA 3J5QB 2M63A 4JHJA 1P5QA 3MEKA 3KAEA 1U3CA 4B0ZA 3QKYA 4HRMB 2DYSE 3D9HA 4F3VA 4DLQA 2KZTA 2UWJG 1K8KG 1TNUA 1A17A 4FJZA 4ZHBA 3EHNA 2WXLA 3TG5A 4RVBA 2HYZA 3ZN3A 4AV7A 4A3TA 4F1SA 2HM8A 3PEUB 1IYGA 1KT1A 3AS4A 3UM1A 4B8CB 1O1TA 3E4BA 3FDHA 4BX9A 4CDRA 5AARA 3UM0A 4KZCA 4CGWA 4UI9J 2L0IA 3FUJA 3HXFA 3CSTA 4NQ0A 3LY8A 1N4SA 5B1BE 3FWVA 3G2SA 4BSXA 3WXXA 4LNGA 3D9PA 4K5BA 2ETCA 4BETA 1BLXB 1Q2ZA 3R7RA 4EBAG 4XE0A 4JVSA 5AQBA 4JEUA 3OXGA 1IKND 3RO2A 2OVBA 3T5XA 4OYSA 5JHBA 5CBOA 5AQAA 5IY5E 3N71A 1TN7A 4CT0A 3APFA 4LERA 3TWQA 4CDNA 4LNUD 2XPIA 4UWGA 1KZPA 3CKBA 4U07A 2AVPA 2F37A 2X6HA 1O1SA 3DPYA 3ULEG 1H0AA 5C1DA 4APFA 4JXTA 3K9IA 1N0QA 2Y4TA 4ILIA 1E7UA 3AG3E 3FH7A 3D3MA 1HE8A 2I1JA 3MGBA 2QFCA 4BEPA 2WQHA 1UG3A 3E32A 3AG2E 4FLHA 2WXKA 2AXVA 4KBQA 2CG2A 3C5RA 2MOWA 4JHKA 5FQ6A 3SHFA 4XEIG 3SFYA 3ZYMA 3RAUA 1MX2A 4RG9A 1S64A 4GZDA 4WWOA 2XGOA 3MA5A 3E30A 3ZVVA 3L22A 2XQ0A 4Q69A 5ANRA 3ABKE 4UWFA 3LCAA 3DRAA 4ATGA 3UI2A 3RO3A 3LY7A 3UT8A 2I6HA 3FTUA 1VDYA 4MLPA 4AIFA 1DNPA 3MYVA 3PS6A 4M3OA 4AJWA 3FFLA 2GRPB 3C3RA 2FEZA 1G3NB 4GAAA 1WY6A 2KM4A 3QOUA 5DIZA 2XPYA 1TJCA 2V4HC 1BI8B 2HR2A 3FTZA 4BSZB 1TJFA 4FHKA 1JCRA 3MJWA 5EDSA 2I1KA 4G11A 2JEKA 3G2WA 4MRUA 2DWZA 3ULQA 3FP3A 2XEVA 3LKUA 3SQVA 2L6BA 4EZLA 2Y69E 4GCNA 2WMOA 4NIKA
chains in the Genus database with same CATH topology
3FUFA 5D0OD 3ZYKA 4GZ3A 1E96B 2VJ8A 3CHRA 5ARGA 3ASDA 1GW6A 3QARA 3VLDA 2VTBA 1H19A 3S7JA 3S2AA 1WM5A 5HI7A 2WXOA 3TXNA 3CVQA 3LYAA 4HFGA 2AW6A 2Q7FA 4FU3A 1HX8A 4UWKA 4HOUA 3AS5A 2XPZA 3IBEA 1TEZA 3QDNA 3QWPA 4FA6A 2KC7A 4L23A 2J4BA 4WAFA 4J6IA 1OWPA 3B7TA 5C2YA 3JUIA 5LCWJ 4GZCA 3L54A 4JL0A 4DK5A 4U8HA 1NA3A 3I4RB 5FJYA 4HOQA 1IQRA 1UN8A 1HS6A 1WAO1 2WQ7A 2WM9A 2PM6A 4WWPA 3D9MA 2FO7A 3QC1A 4GZ5A 2R17C 3KEZA 4RSYA 1ELKA 1H2UA 2VQ2A 2WXIA 1H2TC 5JHAA 3PE4A 1UJKA 2DCPA 3PREA 4HXIA 3FU3A 3LEWA 4XKCA 2VGYA 3CQCB 2NSZA 3FUHA 3EHMA 3MV2B 4DLOA 2RD0A 4FHJA 3FHEA 1EDUA 4BFRA 4I6GA 4GMJA 4ANVA 3ZGQA 4I17A 3T5VA 3CVNA 1H2VC 4I1AA 3ASFA 2Y4UA 3FH5A 1EYHA 2FULA 4JA9A 5A7DB 2J09A 4DI4A 5BW8C 3CVLA 5E75A 4KZ0A 2FBNA 2BF0X 2NXPA 4EZKA 1QZ2A 2A5UA 2VYIA 1SZ9A 4I1OB 2J07A 3P1UA 3CHOA 3LXUX 2L0TB 4FADA 2YHEA 5KJKA 2DIWA 2WMNA 5CCLA 1HF8A 3B7RL 2KCVA 4C0MA 4N2SA 2PQNA 5JJ7A 1KT0A 2YQ8A 3D9IA 1OUVA 5FT9A 1MQSA 3NZUA 3BG1B 3IEGA 4BTAA 4U0ZA 3MZLB 3D9OA 3LVQE 2L6JA 1JUQA 3Q49B 5G2NA 4O6FA 4ILHB 4A1GA 3TJPA 2L9BA 4CGVA 3G2TA 3LPZA 4FC8A 4G24A 2VGXB 3AU4A 4FP7A 5AENA 3ENEA 5KCMA 1NP7A 3IHVA 3EIJA 4GZ6A 5T3RA 5G05C 2IFUA 4C9BB 3GZ1A 3APCA 3CK8A 2VSXE 3EDTB 4PDXA 4U63A 3ZW3A 5KJMA 3IHYA 3CHPA 1YA0A 4PS3A 3CK7A 5BUZA 4IYPA 2X6KA 2GGFA 2WXRA 3FUMA 2BTDA 2XRYA 5ANLA 3ESKA 3VTYA 5M72A 5D0QD 5BV0A 1EF1C 2I9CA 2LAIA 4GYOA 1E7VA 1Y8MA 4L1BA 5LOZA 2IU1A 1PC2A 3D9NA 5E76A 3SGHA 4CEMA 4F53A 5J90A 3HYMB 1OWMA 3OXFA 1NZNA 4NURA 4JA7A 1IQUA 1E90A 4WNGA 5CHEE 4UI9K 3GYZA 2ZU6B 2VGXA 4N5CA 5G05J 3ZHEB 5EX3A 4QFVA 4XIFA 4BT9A 1MHQA 2A4ZA 3URZA 1X5BA 3D9KA 3OTNA 3QB2A 2WXFA 3FTWA 3PH0C 3DPDA 4IN3B 3CQGB 4AXHA 2ILRA 4NACA 3EIQC 3SZ7A 3GZSA 2XRZA 3PNLB 5LP0A 2JLBA 2FI7A 2X6IA 2IF4A 3IV0A 3G2UA 2XGSA 4HORA 2V0PA 1HH8A 4GA0A 5KJNA 2X3MA 3FU0A 4YVQC 2DBAA 1Z3YA 5FZSA 1INZA 3PUJA 3CVPA 3PUKA 5FZRA 3C98A 4OVUA 4HLEA 3HHMA 4LCTA 4WNFA 2CFUA 2OV8A 3KD7A 3FH8A 4ANXA 2YNQA 2KZTB 3O48A 3CSFA 3U3WA 4AY6A 4HVBA 1UJJA 3FU6A 4GA2A 3ZEFA 3ZHEA 3TXMA 3MKQB 3ZPJA 4A55A 5BT1A 5FWQA 4BTBA 4U0UA 3QWWA 4GCOA 3CIAA 2EQXA 3BEEA 2GW1A 2R5SA 2WPVA 2M63A 4I9EA 4JHJA 4NRHB 1HZ4A 1P5QA 2X6JA 3MEKA 3FTYA 4XX5A 3ASGA 3U4TA 2V8SE 3KAEA 1U3CA 3TGOA 3RKVA 4B0ZA 3ASHA 3R9AB 4ACLA 3ZIMA 4IRUA 5BPPA 4E85A 3L6AA 3QKYA 2XCCA 3JYSA 1E8ZA 4BX8A 2AWIA 3FY4A 2YINA 3L17A 4F3VA 2CFZA 1E8XA 4JW1A 4DLQA 2KZTA 3G2VA 4E6HA 3FUEA 3LY9A 4I2ZA 3O4ZA 1ELRA 2OVFA 3MKQA 2VSOE 2UWJG 4A1SA 1A17A 3SNXA 1E8WA 4FJZA 4L2LA 3EHNA 4EQFA 4GPKA 2V4LA 2P58C 2X38A 4B89A 2WXLA 3RU0A 3GZ2A 4N3BA 2XHEA 3TG5A 3CHSA 4RVBA 4CRWA 2HYZA 4G2VA 3ZN3A 4UWHA 4AV7A 4A3TA 2KCKA 2HM8A 4JC8A 4F1SA 1UN9A 3PEUB 5CMWA 3TL5A 1IYGA 5AJLA 1KT1A 2X6FA 3AS4A 3FUDA 4I9CA 3SBSA 3LVRE 4AY5A 3QAQA 2J4DA 4B8CB 3PNTB 1PY1A 3E4BA 3IKOB 2KCLA 2C0MA 3R7QA 3FDHA 1S0PA 5FZQA 3HDXA 4BX9A 4BT8A 4K0RA 3D9LA 3JCKC 4CDRA 2IQCA 2Y3AA 3T8MA 3P2BA 2CHZA 2IOLA 1HU3A 3OAWA 4XKBA 3RRMB 3ZYQA 1OWOA 3MV3B 4KZCA 3DBSA 4CGWA 4I43A 4ABNA 4CCAA 4UI9J 4ANUA 2L0IA 3U66A 3FUJA 2I2OA 1JWGA 5T4YA 3PDNA 3CSTA 4NQ0A 4AEZC 3LY8A 4GA1A 4AM9A 1BPOA 3PE3A 3FWVA 2WXGA 3CEQA 3G2SA 3HIZA 4BSXA 3ZXSA 2GRMA 3WXXA 4G25A 2WXPA 3D9PA 4U04A 5DBKA 3UT7A 5LFAA 3QNKA 3CVYA 3CVWA 1N52A 3UPVA 2MRIA 3U64A 4B8AA 1HXIA 4V3IA 4DJAA 3R7RA 3CVXA 4L2YA 2NC9A 1HO8A 4EBAG 4Q96A 2PL2A 4XE0A 4ANWA 3FU5A 3OXLA 4EECA 4JVSA 4TRQA 5G55A 5EX0A 4JEUA 3OXGA 3CHMA 4MKTA 4K03A 2WXQA 4I6EA 3RO2A 3ESLA 3TAXA 1HFAA 2OVBA 3T5XA 3ML8A 4LRZA 4OYSA 3RRUA 1HG5A 5JHBA 2AXZA 4J8FA 5FQ8A 4G23A 4DI3A 3VLEA 3EJNA 1QQEA 3JQ0A 5EKQD 3N71A 1Y6IA 3MCXA 4H7YA 4J0UA 3SFZA 4CT0A 3APFA 4U0SA 3ZYLA 5AJDA 5ARFA 3SBTB 4LERA 4D10C 4CDNA 2PM7A 1NA0A 2IOSA 4P29A 2OOEA 4FULA 4LEUA 5CCMA 2XPIA 4UWGA 2PZIA 3UQ3A 2UY1B 3NQPA 3UMVA 3CKBA 3NZSA 1HG2A 4U07A 2AVPA 4XI0A 2C2LA 2ONDA 3L13A 2WXNA 5G04C 2X6HA 2YHCA 4KXKB 5AYWD 1H0AA 5FQ4A 3VLFA 5C1DA 2FF4A 4F7AA 3FTXA 4APFA 4JXTA 3K9IA 4GU5A 1SZAA 3Q47B 2Y4TA 3QWVA 4PH4B 4ILIA 1E7UA 2IJGX 1EPUA 4FLBA 4PUCA 3RIBA 3UX4A 5KJLA 4N2QA 3ONKA 4FJYA 3B7SA 3FEXA 4B94A 4WWNA 3FH7A 1ZBPA 3D3MA 1HE8A 1OWNA 2C0LA 3HVEB 2I1JA 5BV1A 2BUGA 4XI9A 4I6JA 2J49A 3MGBA 2QFCA 3B13A 2WQHA 3GW4A 4ACKA 2J08A 3RRNB 3FUKA 4HOTA 3B7UX 2UY1A 5BNWA 3APDA 3Q5MA 5G04J 2XCBA 1UG3A 2WXJA 4IULA 3BG0B 4GYWA 2GRLA 4UWLA 4WNDA 2WQ6A 3CGHA 4R7LA 1ZU2A 3PZDA 1Z3XA 4FLHA 2WXKA 3I3NA 2AXVA 4KBQA 3S7DA 2WVIA 4UQYA 1L5JA 2J9QA 2CG2A 4LUNU 4UQXA 4KVOA 2MOWA 3HVEA 2PQRA 2KATA 4UI9C 2WXHA 4H7XA 4J8SA 2LSVA 4JHKA 4N39A 4MS6A 5FQ6A 2QY7A 3CLJA 3SHFA 3UUXA 3ZYMA 1XNFA 3LJ3A 4KYOB 3CVUA 4YNDA 4AVXA 2R59A 3JQ1A 5FQ7A 3S7FA 2LSUA 4JZYA 4RG9A 3FULA 4G1TA 3I5PA 2CG3A 1PAQA 4GZDA 4J8EA 4I2WA 4WWOA 2RG8A 3QJZA 4KMOA 5CMYA 3CKCA 3RK6A 4EZJA 4HS2A 4TUUA 2LAHA 4APOA 2XGOA 3AU5A 3MA5A 3ZVVA 4JEHA 4KVMA 1E8YA 3L22A 5ENNA 4C0EA 2VSYA 3S7BA 3LDZA 1XGWA 2XQ0A 4EPZA 3Q15A 1IHGA 2LNIA 4GB9A 4EBAA 4Q69A 3LS8A 5ANRA 1LF8A 4GMLA 5T8IA 4UWFA 4N3CA 3FEYA 3LCAA 1JWFA 4AP2A 1W3BA 5JJTA 1DVPA 4ATGA 3FUIA 4BWRA 4PS8A 4DPRA 2E0IA 2XGMA 3RO3A 4Y6WA 3L08A 4L7TA 3LY7A 5JJ6A 3UT8A 2I6HA 3FTUA 4CT4A 3CK9A 3TG4A 4G26A 2AXUA 4BY6A 3FUNA 3ONLA 1VDYA 4MLPA 4TV3A 4Y6CA 1DNPA 3MYVA 4ILGA 4AIFA 3PS6A 4KT6B 4M3OA 4RG6A 4AJWA 1FVFA 3MX3A 3RJVA 3FFLA 1OWLA 3NF1A 2MHKA 1UW4B 1KLXA 2FEZA 4JHRA 1JPLA 2CHWA 5A6CA 2WB2A 3MKRA 2VSNA 3SD5A 4WUYA 3SI5A 5HQ8A 3AS8A 4CDMA 2CHXA 4YVOA 4GAAA 4HOSA 3PVLA 1WY6A 2KM4A 4WNEA 4J8DA 4AOFA 3QOUA 5DIZA 3U9WA 2XPYA 4A3VA 1TJCA 3KS2A 1QNFA 3SF4A 3QK0A 2IONA 4W9RA 3D9JA 2E2EA 3PEVB 5AIJA 5J08A 2HO1A 2HR2A 3FTZA 1U3DA 2LO6A 1TJFA 4JPSA 4FHKA 2VTBB 1ELWA 1FVHA 3MJWA 4ME2A 5EDSA 4OVVA 2I1KA 4G11A 4Q94A 2JEKA 5FTPA 4I1MA 1B89A 3ML9A 4PS7A 5A23A 3G2WA 4MRUA 1N54A 4N3AA 3ULQA 3CV0A 3FTVA 4UQZA 3I4GA 3FP3A 2WXMA 3UT4A 1H6KA 5LCWC 2XEVA 3CVVA 3FTSA 3L16A 3CR3A 3LKUA 3ZFWA 3Q4AB 4XZ4A 2V5FA 3ZRHA 1Z6TA 4EZLA 4GYYA 5LX8A 1SQMA 1FCHA 3CHQA 4GCNA 4URKA 3VTXA 2WMOA 3PRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D0O D;  4GZ3 A;  1E96 B;  5ARG A;  3ASD A;  3S7J A;  1WM5 A;  5HI7 A;  3CVQ A;  3LYA A;  2Q7F A;  4HOU A;  3AS5 A;  3QDN A;  3QWP A;  2KC7 A;  5LCW J;  4JL0 A;  1NA3 A;  5FJY A;  4HOQ A;  1WAO 1;  4GZ5 A;  2FO7 A;  2VQ2 A;  3PE4 A;  2VGY A;  3MV2 B;  3ZGQ A;  4I17 A;  3CVN A;  4I1A A;  3ASF A;  2Y4U A;  4JA9 A;  5A7D B;  5BW8 C;  3CVL A;  2FBN A;  1QZ2 A;  2VYI A;  5KJK A;  5CCL A;  2KCV A;  4N2S A;  2PQN A;  5JJ7 A;  1KT0 A;  2YQ8 A;  1OUV A;  5FT9 A;  3IEG A;  4BTA A;  4U0Z A;  2L6J A;  3Q49 B;  4O6F A;  4CGV A;  3LPZ A;  4G24 A;  2VGX B;  4GZ6 A;  5G05 C;  2IFU A;  3GZ1 A;  3CK8 A;  3EDT B;  5KJM A;  1YA0 A;  3CK7 A;  3VTY A;  3ESK A;  5M72 A;  5D0Q D;  4GYO A;  1Y8M A;  1PC2 A;  3HYM B;  3OXF A;  1NZN A;  5CHE E;  4JA7 A;  4WNG A;  4UI9 K;  3GYZ A;  2VGX A;  4N5C A;  5G05 J;  3ZHE B;  5EX3 A;  4XIF A;  4BT9 A;  3URZ A;  4IN3 B;  3SZ7 A;  2JLB A;  2FI7 A;  2IF4 A;  4HOR A;  2XGS A;  1HH8 A;  4GA0 A;  5KJN A;  4YVQ C;  2DBA A;  5FZS A;  3CVP A;  5FZR A;  4WNF A;  3KD7 A;  3O48 A;  3U3W A;  4AY6 A;  3ZPJ A;  5BT1 A;  4GA2 A;  3ZHE A;  4BTB A;  4U0U A;  3QWW A;  4GCO A;  2GW1 A;  2R5S A;  3BEE A;  2WPV A;  4I9E A;  4NRH B;  1HZ4 A;  1P5Q A;  3MEK A;  3ASG A;  3U4T A;  3KAE A;  3TGO A;  3RKV A;  3ASH A;  3R9A B;  3QKY A;  2XCC A;  3JYS A;  4F3V A;  3LY9 A;  4I2Z A;  1ELR A;  2UWJ G;  4A1S A;  1A17 A;  4EQF A;  4GPK A;  2P58 C;  3RU0 A;  3GZ2 A;  4N3B A;  3TG5 A;  2HYZ A;  4G2V A;  3ZN3 A;  2KCK A;  1IYG A;  1KT1 A;  3AS4 A;  4I9C A;  4AY5 A;  3E4B A;  2KCL A;  2C0M A;  5FZQ A;  4BT8 A;  4CDR A;  3MV3 B;  4CGW A;  4ABN A;  4UI9 J;  3PDN A;  4NQ0 A;  3LY8 A;  4GA1 A;  4AM9 A;  3PE3 A;  3FWV A;  3CEQ A;  3WXX A;  4G25 A;  4U04 A;  5DBK A;  3UPV A;  1HXI A;  2NC9 A;  2PL2 A;  3OXL A;  5EX0 A;  3OXG A;  3TAX A;  3RO2 A;  4J8F A;  4G23 A;  1QQE A;  3N71 A;  4H7Y A;  4J0U A;  4U0S A;  5ARF A;  1NA0 A;  2OOE A;  4LEU A;  5CCM A;  2XPI A;  2PZI A;  3UQ3 A;  2UY1 B;  3CKB A;  4U07 A;  4XI0 A;  2AVP A;  2C2L A;  2OND A;  5G04 C;  2YHC A;  4KXK B;  5AYW D;  5C1D A;  2FF4 A;  3K9I A;  3Q47 B;  2Y4T A;  3QWV A;  3RIB A;  5KJL A;  4N2Q A;  4B94 A;  1ZBP A;  2C0L A;  2BUG A;  4XI9 A;  2QFC A;  2WQH A;  3GW4 A;  4HOT A;  2UY1 A;  5BNW A;  3Q5M A;  5G04 J;  2XCB A;  4GYW A;  4WND A;  1ZU2 A;  4KBQ A;  3S7D A;  4UQY A;  2J9Q A;  4UQX A;  2PQR A;  2KAT A;  4UI9 C;  4H7X A;  2LSV A;  4N39 A;  3UUX A;  1XNF A;  4KYO B;  4YND A;  3S7F A;  2LSU A;  4RG9 A;  4G1T A;  4J8E A;  4I2W A;  3CKC A;  4APO A;  2XGO A;  3MA5 A;  2VSY A;  3S7B A;  3Q15 A;  1IHG A;  2LNI A;  4N3C A;  3LCA A;  1W3B A;  5JJT A;  4BWR A;  2XGM A;  3RO3 A;  4Y6W A;  3LY7 A;  5JJ6 A;  2I6H A;  3CK9 A;  3TG4 A;  4G26 A;  4AIF A;  4Y6C A;  4RG6 A;  3RJV A;  3FFL A;  3NF1 A;  2MHK A;  1KLX A;  2FEZ A;  4JHR A;  5A6C A;  3MKR A;  2VSN A;  5HQ8 A;  4WUY A;  3AS8 A;  4YVO A;  4HOS A;  4WNE A;  4J8D A;  3QOU A;  5DIZ A;  1TJC A;  3KS2 A;  3SF4 A;  4W9R A;  2E2E A;  2HO1 A;  2HR2 A;  1ELW A;  4ME2 A;  5FTP A;  1B89 A;  4N3A A;  3ULQ A;  3CV0 A;  4UQZ A;  3FP3 A;  5LCW C;  2XEV A;  3LKU A;  3ZFW A;  3Q4A B;  2V5F A;  4GYY A;  1FCH A;  4GCN A;  3VTX A;  5EKQ D; 
#chains in the Genus database with same CATH topology
 3J5P A;  2P9S G;  1E96 B;  2P9N G;  3ASD A;  1GW6 A;  3QAR A;  3W9F A;  3VLD A;  5HI7 A;  5CEA A;  3PZ4 A;  3IBE A;  5KNG A;  3EHR A;  4J6I A;  1S70 B;  2XEN A;  3B7T A;  2GRN B;  4U8H A;  5FJY A;  1UN8 A;  2WQ7 A;  4GZ5 A;  2FO7 A;  2R17 C;  1ELK A;  3ZNG A;  2VQ2 A;  3PE4 A;  3PRE A;  4XKC A;  3DSW A;  4FHJ A;  1EDU A;  4GMJ A;  3T5V A;  1H2V C;  4JA9 A;  2J09 A;  4DI4 A;  4U7E B;  3CVL A;  2FBN A;  2NXP A;  4TXQ A;  1OY3 D;  4EZK A;  1LTX A;  2J07 A;  2Y1L E;  3CHO A;  2L0T B;  1TN6 A;  2WMN A;  1HF8 A;  4F6R D;  4N2S A;  1MQS A;  3UIN C;  3LVQ E;  3NOG D;  2L6J A;  5BXU A;  5G2N A;  5ENS D;  2L9B A;  4TUM A;  3LPZ A;  4FC8 A;  4CYM D;  3EIJ A;  3DEO A;  5G05 C;  4PDX A;  1V54 E;  3T8K A;  3CHP A;  4PS3 A;  5BUZ A;  4IYP A;  2GGF A;  2BTD A;  3Q7F A;  2B6C A;  1EF1 C;  3SY2 A;  2RFM A;  3HYM B;  4GPM A;  1OWM A;  1IQU A;  4WNG A;  4UI9 K;  1S63 A;  5G05 J;  1DCQ A;  3URZ A;  3DPD A;  4IN3 B;  3CQG B;  5BXO A;  2IO2 C;  3Q9U C;  1SVX A;  5LP0 A;  2FI7 A;  2IF4 A;  3IV0 A;  2XGS A;  4CZ2 D;  3FU0 A;  3PUJ A;  4OVU A;  3HHM A;  4WNF A;  3KD7 A;  3FH8 A;  2YNQ A;  3O48 A;  2P9U G;  3CSF A;  4AY6 A;  4HVB A;  4A55 A;  2R5S A;  3BEE A;  1HZ4 A;  2X6J A;  3FTY A;  3HXC A;  3NAW A;  2H6F A;  3ASH A;  3ZIM A;  4E85 A;  2XCC A;  1E8Z A;  3FY4 A;  3EUV A;  3UM2 A;  3AG4 E;  1E8X A;  4JW1 A;  3G2V A;  3FUE A;  3LY9 A;  3TWU A;  1D8E A;  1OXJ A;  5CBN A;  3SNX A;  1E8W A;  4L2L A;  1N95 A;  2R05 A;  1AP7 A;  2HE0 A;  3RU0 A;  3SO8 A;  3GZ2 A;  4N3B A;  2XHE A;  3CHS A;  4UWH A;  4GTO A;  1TN8 A;  1UN9 A;  3TL5 A;  2X6F A;  3FUD A;  3AG1 E;  2J4D A;  3IKO B;  2C0M A;  3R7Q A;  2PNN A;  1S0P A;  3HDX A;  4BT8 A;  2Y3A A;  3T8M A;  2CHZ A;  1HU3 A;  3OAW A;  3EU9 A;  3ISM C;  4ABN A;  3U66 A;  5T4Y A;  2P9K G;  1K1B A;  4AM9 A;  1BPO A;  3PE3 A;  1SA5 A;  2GRM A;  4G25 A;  2FO1 E;  3U64 A;  4B8A A;  1HXI A;  4V3I A;  1A5E A;  4EEC A;  3OXL A;  4TRQ A;  4MKT A;  2OCC E;  3ESL A;  1HFA A;  1QBQ A;  4DI3 A;  1Y6I A;  4H7Y A;  2ZGD A;  3ZYL A;  2XZT G;  3SBT B;  5EIL A;  2XEH A;  3V2X A;  2OOE A;  2V5Q C;  5CCM A;  4O1O A;  3TWX A;  3NQP A;  1O1R A;  3UMV A;  1NL4 A;  2C2L A;  2OND A;  2WXN A;  5FQ4 A;  4O1P A;  3VLF A;  2H6H A;  4GU5 A;  1SZA A;  3Q47 B;  4PH4 B;  4ATZ D;  2IJG X;  1D8D A;  4PUC A;  5EID A;  3RIB A;  1SW6 A;  4HB5 A;  2XZD G;  3B7S A;  3FEX A;  4B94 A;  3KEA A;  2BUG A;  4I6J A;  3B13 A;  3GW4 A;  3B7U X;  1QYM A;  5HRY A;  5BNW A;  2RKK A;  2XCB A;  3BG0 B;  5FIN A;  4WND A;  2WQ6 A;  3CGH A;  4R7L A;  1Z3X A;  2WVI A;  4U96 D;  4UQY A;  1L5J A;  5AQ9 A;  4UI9 C;  2WXH A;  4J8S A;  4BER A;  2LSV A;  3CLJ A;  3UUX A;  4G8L A;  5ENQ D;  2R59 A;  3JQ1 A;  2LSU A;  2LXM A;  4JZY A;  3FUL A;  3EHQ A;  4G1T A;  3I5P A;  2CG3 A;  2RG8 A;  3QJZ A;  4LG6 A;  3CKC A;  2LUH A;  4TUU A;  2LAH A;  3AU5 A;  2NYJ A;  4KVM A;  1E8Y A;  5EN5 D;  2AJA A;  4C0E A;  4BES A;  2VSY A;  3S7B A;  2B0O E;  4EPZ A;  4GB9 A;  2F0Y A;  3LS8 A;  4GML A;  1TNY A;  4GTP A;  3AJI A;  4N3C A;  4AP2 A;  1DVP A;  4DUI A;  3FUI A;  4DPR A;  2E0I A;  3L08 A;  2QYU A;  2IEJ A;  2AXU A;  1IHB A;  4BY6 A;  3FUN A;  4ILG A;  3NF1 A;  1UOH A;  1KLX A;  1UW4 B;  1JPL A;  2CHW A;  3MKR A;  5HQ8 A;  3NB2 A;  3PVL A;  4WNE A;  4J8D A;  4DRX E;  3U9W A;  4A3V A;  3KS2 A;  1QNF A;  3QK0 A;  1FT2 A;  3PEV B;  3ABL E;  4OAU C;  2BED A;  2ZIR A;  4JPS A;  1MJ0 A;  2VTB B;  1ELW A;  1FVH A;  4OVV A;  4LSZ E;  3ML9 A;  1Z5S C;  4N3A A;  1TR4 A;  2H6G A;  5D66 A;  3I4G A;  3UT4 A;  2P2C P;  3CVV A;  3L16 A;  3CR3 A;  3ZFW A;  4DX5 D;  1YCS B;  4GYY A;  5LX8 A;  1SQM A;  3PRZ A;  5D0O D;  3ZYK A;  4GZ3 A;  3Q75 A;  2DYR E;  3CHR A;  5ARG A;  3Q7A A;  3HXB A;  5HS0 A;  2VTB A;  1H19 A;  3HXE A;  3CVQ A;  2AW6 A;  4FU3 A;  4UWK A;  4HOU A;  3AS5 A;  3QWP A;  1OT8 A;  4WAF A;  2J4B A;  5ITZ F;  5C2Y A;  3Q78 A;  4JL0 A;  3I4R B;  3HRA A;  4HOQ A;  1WAO 1;  2WM9 A;  4HI9 A;  4K5A B;  3UM3 A;  3KEZ A;  1H2U A;  2WXI A;  1H2T C;  3LEW A;  2VGY A;  2NSZ A;  3FUH A;  3FHE A;  4BFR A;  3V79 K;  4I17 A;  3CVN A;  3ASF A;  1EYH A;  3NOC D;  1KPS B;  2QZA A;  4B93 B;  5BW8 C;  4KZ0 A;  2P9P G;  1QZ2 A;  1BU9 A;  3E34 A;  5H7P A;  2IO3 C;  2DIW A;  1MYO A;  2KCV A;  4C0M A;  5B1A E;  5ENR D;  2YQ8 A;  1OUV A;  5FT9 A;  3NZU A;  3IEG A;  4BTA A;  3TWV A;  3D9O A;  1OCC E;  4GTS A;  2H6I A;  3G2T A;  4CGV A;  3IHV A;  3IXE A;  4C9B B;  3APC A;  1MX6 A;  1OCR E;  2X6K A;  5ANL A;  5M72 A;  1TNB A;  5D0Q D;  2EIN E;  1E7V A;  5LOZ A;  1PC2 A;  2XEE A;  3BUA A;  3OXF A;  1NZN A;  4EHM A;  5CHE E;  4JA7 A;  3GYZ A;  3ZHE B;  3W9G A;  5EX3 A;  1X5B A;  3D9K A;  3OTN A;  3QB2 A;  2WXF A;  1JCQ A;  3SZ7 A;  3UKR G;  5AAO A;  2JLB A;  4HOR A;  3G2U A;  2V0P A;  5KJN A;  4N5Q A;  5FZS A;  1N0R A;  1INZ A;  3CVP A;  2CFU A;  4ANX A;  1UJJ A;  3ZPJ A;  4GA2 A;  3ZHE A;  1TNZ A;  3MKQ B;  3QWW A;  2WPV A;  2DZO A;  4NRH B;  3ABM E;  4XX5 A;  3U4T A;  2V8S E;  3TGO A;  3R9A B;  4IRU A;  5BPP A;  2J8S D;  4BX8 A;  4GTR A;  2YIN A;  3L17 A;  3HXD A;  4JB8 P;  1ELR A;  2OVF A;  3MKQ A;  3DSS A;  4GPK A;  2P58 C;  4CRW A;  3BQO A;  2KCK A;  5CMW A;  5AJL A;  5KBA A;  3UTM A;  4AY5 A;  3QAQ A;  2KCL A;  4DX7 D;  4K0R A;  3D9L A;  3P2B A;  3RRM B;  4J7W A;  3MV3 B;  3DBS A;  1V55 E;  4CCA A;  1LD7 A;  3PDN A;  3C72 A;  2WXG A;  3CEQ A;  4L9P A;  2WXP A;  5LFA A;  3CVY A;  3QNK A;  1N52 A;  1ZB1 A;  2F8X K;  3CVX A;  4L2Y A;  2NC9 A;  4Q96 A;  4LRZ A;  1HG5 A;  4J8F A;  4G23 A;  3L9T A;  3EJN A;  1QQE A;  5CEC B;  3MCX A;  4O60 A;  4U8Y D;  5ARF A;  1AWC B;  3KSQ A;  1NA0 A;  1MX4 A;  1FPP A;  2PZI A;  2UY1 B;  3KSL A;  4DX1 A;  1HG2 A;  4XI0 A;  2YHC A;  4KXK B;  2Y0B G;  5AYW D;  3V2O A;  4F7A A;  3FTX A;  2R03 A;  3QWV A;  2F8Y A;  5KJL A;  4N2Q A;  4FJY A;  1ZBP A;  2R2L A;  2C0L A;  3HVE B;  2KBX A;  1N11 A;  2J49 A;  2GRR B;  2P9I G;  3DEP A;  2J08 A;  3RRN B;  3FUK A;  2UY1 A;  3APD A;  4GYW A;  2GRL A;  4UWL A;  1ZU2 A;  4K5C A;  3I3N A;  2XS8 A;  3E37 A;  3S7D A;  2RFA A;  2J9Q A;  4C48 B;  1N4R A;  4KVO A;  3HVE A;  4MS6 A;  2QY7 A;  3LJ3 A;  4KYO B;  3X2Q E;  4YND A;  4TXR A;  4J8E A;  4I2W A;  3RK6 A;  4HS2 A;  4APO A;  5ENN A;  3DXM G;  3L82 A;  2XS1 A;  2LNI A;  3UIP C;  4EBA A;  1LF8 A;  3AAA C;  3F6Q A;  3FEY A;  5JJT A;  3Q73 A;  4Y6W A;  4L7T A;  5JJ6 A;  4YDY A;  3CK9 A;  3ONL A;  4TV3 A;  4Y6C A;  3TWR A;  3LJN A;  1YYH A;  2DVW A;  3TWS A;  2IY0 C;  2WB2 A;  5A6C A;  3SD5 A;  4WUY A;  3AS8 A;  4CDM A;  4F1P A;  3SF4 A;  5KWD A;  2ION A;  4W9R A;  3V30 A;  3D9J A;  5AIJ A;  1U3D A;  3ZXP A;  2LO6 A;  3ASN E;  4ME2 A;  5KNH D;  5FTP A;  4I1M A;  4LNB A;  5A23 A;  1NFI E;  3CV0 A;  2WXM A;  1H6K A;  1N4P A;  3FTS A;  3Q4A B;  4XZ4 A;  5HKP A;  3VTX A;  4ZFH A;  3FUF A;  1D9S A;  2ETA A;  5CRV A;  2WXO A;  3TXN A;  2Q7F A;  2XPZ A;  1TEZ A;  3QDN A;  5ENT D;  4HRL A;  4FA6 A;  3DXK G;  1TYQ G;  3DSV A;  1OWP A;  1H6P A;  5D2M C;  4GZC A;  3L54 A;  4DK5 A;  1NA3 A;  3WG7 E;  1U2V G;  1UJK A;  2DCP A;  2QYJ A;  3CQC B;  4U8V D;  3EHM A;  2RD0 A;  4ANV A;  1X81 A;  4I1A A;  2Y4U A;  3FH5 A;  2FUL A;  2BF0 X;  2VYI A;  4I1O B;  1SZ9 A;  3P1U A;  1DCE A;  3LXU X;  4FAD A;  2YHE A;  5KJK A;  2EIL E;  5CCL A;  1KT0 A;  3D9I A;  3BG1 B;  3E33 A;  4U0Z A;  3ULY A;  1JUQ A;  4ILH B;  3TJP A;  1WG0 A;  5AEN A;  5KCM A;  4GZ6 A;  3GZ1 A;  3CK8 A;  3ZW3 A;  5KJM A;  3IHY A;  1FT1 A;  2R02 A;  2XRY A;  3VTY A;  2I9C A;  4G8K A;  4HNA D;  2IU1 A;  3SGH A;  5E76 A;  4CEM A;  4F53 A;  4NUR A;  2ZU6 B;  3SFX A;  4QFV A;  4XIF A;  1MHQ A;  2A4Z A;  3FTW A;  4HBD A;  4AXH A;  3EIQ C;  3GZS A;  2XRZ A;  3PNL B;  1HH8 A;  4GA0 A;  3DSU A;  2X3M A;  4YDE A;  2DBA A;  2JAB A;  3PUK A;  5EIB E;  3C98 A;  5JA4 D;  2OV8 A;  4M7C A;  3U3W A;  5BT1 A;  3TXM A;  4BTB A;  4U0U A;  3TWW A;  5AQ7 A;  4GCO A;  3CIA A;  2GW1 A;  4I9E A;  3JXJ A;  3ASG A;  1OCZ E;  3RKV A;  1SA4 A;  4ACL A;  3L6A A;  3R9M A;  3JYS A;  2AWI A;  1OCO E;  2BKK B;  3ZUV B;  3T9K A;  2CFZ A;  4E6H A;  4I2Z A;  3O4Z A;  3V31 A;  2VSO E;  2LXL A;  4A1S A;  3JXI A;  4EQF A;  4GTQ A;  2V4L A;  2X38 A;  4B89 A;  5JMN D;  4J8Y A;  2OEW A;  4G2V A;  4JC8 A;  4GTV A;  4I9C A;  3SBS A;  3LVR E;  4Z68 A;  5ENP D;  3PNT B;  1PY1 A;  2BKG A;  5FZQ A;  3JCK C;  2IQC A;  2IOL A;  1MZC A;  4XKB A;  3Q79 A;  3ZYQ A;  1OWO A;  4I43 A;  4ANU A;  2I2O A;  1JWG A;  4AEZ C;  4GA1 A;  3HIZ A;  4YDW A;  3ZXS A;  4U04 A;  5DBK A;  3UT7 A;  3CVW A;  4QQI A;  3UPV A;  2MRI A;  3UIO C;  3B95 A;  4DJA A;  1HO8 A;  4ANW A;  2PL2 A;  1BD8 A;  3FU5 A;  4U95 D;  5G55 A;  5EX0 A;  5CER B;  3CHM A;  3TAX A;  4TXP A;  2A5E A;  2WXQ A;  3B7B A;  4I6E A;  4K03 A;  4MBG A;  3ML8 A;  4UUC A;  2ZGG A;  3RRU A;  2AXZ A;  5FQ8 A;  3VLE A;  3JQ0 A;  4HRN A;  3SFZ A;  4J0U A;  1H6O A;  4U0S A;  4YDO A;  5AJD A;  3C3Q A;  4D10 C;  2PM7 A;  2IOS A;  4P29 A;  4FUL A;  4LEU A;  2EIJ E;  5EYP F;  2VGE A;  3UQ3 A;  3NZS A;  3L13 A;  5G04 C;  2FF4 A;  3TWT A;  4X8Q A;  3UX4 A;  1EPU A;  4FLB A;  1WDY A;  3ONK A;  3DWL G;  2GRQ B;  1N94 A;  1KZO A;  4WWN A;  4HI8 A;  5AN8 A;  1OWN A;  5BV1 A;  3PZ2 A;  4XI9 A;  3Q9N C;  4ACK A;  4HOT A;  3Q5M A;  5G04 J;  2WXJ A;  4IUL A;  3PZD A;  2QC9 A;  5FIO A;  5ENO D;  4LUN U;  4UQX A;  3DST A;  2EIK E;  2PQR A;  2KAT A;  4GMR A;  4H7X A;  2DZN A;  4N39 A;  3PZ3 A;  5EYL A;  3ZKJ A;  1XNF A;  3CVU A;  4AVX A;  5FQ7 A;  3S7F A;  1PAQ A;  5CRU A;  4EZJ A;  4KMO A;  5CMY A;  2ETB A;  4JEH A;  3LDZ A;  1XGW A;  3Q15 A;  1IHG A;  3UXG A;  5T8I A;  1JWF A;  1W3B A;  4HLL A;  4PS8 A;  4BWR A;  2XGM A;  3PZ1 A;  4GTM A;  4CT4 A;  4RQI A;  3TG4 A;  4G26 A;  4KT6 B;  4RG6 A;  1FVF A;  3MX3 A;  2ZXW E;  3RJV A;  1OWL A;  2MHK A;  5CED B;  4JHR A;  2VSN A;  3SI5 A;  1K1A A;  2CHX A;  4YVO A;  4HOS A;  4AOF A;  2E2E A;  5J08 A;  2HO1 A;  1N4Q A;  1IXV A;  4RLY A;  4Q94 A;  1DC2 A;  1B89 A;  4PS7 A;  5B3S E;  1N54 A;  4UQZ A;  3FTV A;  1YMP A;  5LCW C;  1N9A A;  2V5F A;  4GTT A;  1Z6T A;  3ZRH A;  1NI1 A;  1FCH A;  3CHQ A;  1BI7 B;  4URK A;  5EKQ D;  3HG0 D;  2VJ8 A;  3S7J A;  3S2A A;  1WM5 A;  3LYA A;  4HFG A;  3ZU7 B;  3ASO E;  1HX8 A;  2EIM E;  2KC7 A;  4L23 A;  5LCW J;  3JUI A;  1IQR A;  1HS6 A;  2PM6 A;  4WWP A;  3D9M A;  4RSY A;  3QC1 A;  2OEV A;  5JHA A;  4HXI A;  3FU3 A;  4DX6 D;  3MV2 B;  4DLO A;  3BU8 A;  4I6G A;  3ZGQ A;  1K3Z D;  5A7D B;  1RZ4 A;  4HQD A;  5E75 A;  2P9L G;  3JUE A;  4DX2 A;  2A5U A;  2ZIS A;  1TNO A;  2GRO B;  3B7R L;  2PQN A;  2KXP C;  5JJ7 A;  3MZL B;  4OAV B;  3Q49 B;  4O6F A;  4A1G A;  3RSE G;  4G24 A;  2VGX B;  3AU4 A;  4FP7 A;  3ENE A;  1NP7 A;  5T3R A;  2IFU A;  3EDT B;  2VSX E;  4U63 A;  1YA0 A;  3CK7 A;  2WXR A;  3FUM A;  3NBN B;  3ESK A;  5BV0 A;  1RW2 A;  1LD8 A;  2LAI A;  4GYO A;  3DSX A;  1Y8M A;  4L1B A;  3D9N A;  3C3O A;  5J90 A;  4A63 B;  1E90 A;  1JCS A;  2VGX A;  4N5C A;  4BT9 A;  3EU5 A;  3PH0 C;  2ILR A;  4NAC A;  4JD2 G;  3UKU G;  2X6I A;  4YVQ C;  1Z3Y A;  1O5M A;  5FZR A;  2MYO A;  4HLE A;  4LCT A;  2KZT B;  3ZEF A;  3FU6 A;  5FWQ A;  2EQX A;  3J5Q B;  2M63 A;  4JHJ A;  1P5Q A;  3MEK A;  3KAE A;  1U3C A;  4B0Z A;  3QKY A;  4HRM B;  2DYS E;  3D9H A;  4F3V A;  4DLQ A;  2KZT A;  2UWJ G;  1K8K G;  1TNU A;  1A17 A;  4FJZ A;  4ZHB A;  3EHN A;  2WXL A;  3TG5 A;  4RVB A;  2HYZ A;  3ZN3 A;  4AV7 A;  4A3T A;  4F1S A;  2HM8 A;  3PEU B;  1IYG A;  1KT1 A;  3AS4 A;  3UM1 A;  4B8C B;  1O1T A;  3E4B A;  3FDH A;  4BX9 A;  4CDR A;  5AAR A;  3UM0 A;  4KZC A;  4CGW A;  4UI9 J;  2L0I A;  3FUJ A;  3HXF A;  3CST A;  4NQ0 A;  3LY8 A;  1N4S A;  5B1B E;  3FWV A;  3G2S A;  4BSX A;  3WXX A;  4LNG A;  3D9P A;  4K5B A;  2ETC A;  4BET A;  1BLX B;  1Q2Z A;  3R7R A;  4EBA G;  4XE0 A;  4JVS A;  5AQB A;  4JEU A;  3OXG A;  1IKN D;  3RO2 A;  2OVB A;  3T5X A;  4OYS A;  5JHB A;  5CBO A;  5AQA A;  5IY5 E;  3N71 A;  1TN7 A;  4CT0 A;  3APF A;  4LER A;  3TWQ A;  4CDN A;  4LNU D;  2XPI A;  4UWG A;  1KZP A;  3CKB A;  4U07 A;  2AVP A;  2F37 A;  2X6H A;  1O1S A;  3DPY A;  3ULE G;  1H0A A;  5C1D A;  4APF A;  4JXT A;  3K9I A;  1N0Q A;  2Y4T A;  4ILI A;  1E7U A;  3AG3 E;  3FH7 A;  3D3M A;  1HE8 A;  2I1J A;  3MGB A;  2QFC A;  4BEP A;  2WQH A;  1UG3 A;  3E32 A;  3AG2 E;  4FLH A;  2WXK A;  2AXV A;  4KBQ A;  2CG2 A;  3C5R A;  2MOW A;  4JHK A;  5FQ6 A;  3SHF A;  4XEI G;  3SFY A;  3ZYM A;  3RAU A;  1MX2 A;  4RG9 A;  1S64 A;  4GZD A;  4WWO A;  2XGO A;  3MA5 A;  3E30 A;  3ZVV A;  3L22 A;  2XQ0 A;  4Q69 A;  5ANR A;  3ABK E;  4UWF A;  3LCA A;  3DRA A;  4ATG A;  3UI2 A;  3RO3 A;  3LY7 A;  3UT8 A;  2I6H A;  3FTU A;  1VDY A;  4MLP A;  4AIF A;  1DNP A;  3MYV A;  3PS6 A;  4M3O A;  4AJW A;  3FFL A;  2GRP B;  3C3R A;  2FEZ A;  1G3N B;  4GAA A;  1WY6 A;  2KM4 A;  3QOU A;  5DIZ A;  2XPY A;  1TJC A;  2V4H C;  1BI8 B;  2HR2 A;  3FTZ A;  4BSZ B;  1TJF A;  4FHK A;  1JCR A;  3MJW A;  5EDS A;  2I1K A;  4G11 A;  2JEK A;  3G2W A;  4MRU A;  2DWZ A;  3ULQ A;  3FP3 A;  2XEV A;  3LKU A;  3SQV A;  2L6B A;  4EZL A;  2Y69 E;  4GCN A;  2WMO A;  4NIK A; 
#chains in the Genus database with same CATH homology
 3FUF A;  5D0O D;  3ZYK A;  4GZ3 A;  1E96 B;  2VJ8 A;  3CHR A;  5ARG A;  3ASD A;  1GW6 A;  3QAR A;  3VLD A;  2VTB A;  1H19 A;  3S7J A;  3S2A A;  1WM5 A;  5HI7 A;  2WXO A;  3TXN A;  3CVQ A;  3LYA A;  4HFG A;  2AW6 A;  2Q7F A;  4FU3 A;  1HX8 A;  4UWK A;  4HOU A;  3AS5 A;  2XPZ A;  3IBE A;  1TEZ A;  3QDN A;  3QWP A;  4FA6 A;  2KC7 A;  4L23 A;  2J4B A;  4WAF A;  4J6I A;  1OWP A;  3B7T A;  5C2Y A;  3JUI A;  5LCW J;  4GZC A;  3L54 A;  4JL0 A;  4DK5 A;  4U8H A;  1NA3 A;  3I4R B;  5FJY A;  4HOQ A;  1IQR A;  1UN8 A;  1HS6 A;  1WAO 1;  2WQ7 A;  2WM9 A;  2PM6 A;  4WWP A;  3D9M A;  2FO7 A;  3QC1 A;  4GZ5 A;  2R17 C;  3KEZ A;  4RSY A;  1ELK A;  1H2U A;  2VQ2 A;  2WXI A;  1H2T C;  5JHA A;  3PE4 A;  1UJK A;  2DCP A;  3PRE A;  4HXI A;  3FU3 A;  3LEW A;  4XKC A;  2VGY A;  3CQC B;  2NSZ A;  3FUH A;  3EHM A;  3MV2 B;  4DLO A;  2RD0 A;  4FHJ A;  3FHE A;  1EDU A;  4BFR A;  4I6G A;  4GMJ A;  4ANV A;  3ZGQ A;  4I17 A;  3T5V A;  3CVN A;  1H2V C;  4I1A A;  3ASF A;  2Y4U A;  3FH5 A;  1EYH A;  2FUL A;  4JA9 A;  5A7D B;  2J09 A;  4DI4 A;  5BW8 C;  3CVL A;  5E75 A;  4KZ0 A;  2FBN A;  2BF0 X;  2NXP A;  4EZK A;  1QZ2 A;  2A5U A;  2VYI A;  1SZ9 A;  4I1O B;  2J07 A;  3P1U A;  3CHO A;  3LXU X;  2L0T B;  4FAD A;  2YHE A;  5KJK A;  2DIW A;  2WMN A;  5CCL A;  1HF8 A;  3B7R L;  2KCV A;  4C0M A;  4N2S A;  2PQN A;  5JJ7 A;  1KT0 A;  2YQ8 A;  3D9I A;  1OUV A;  5FT9 A;  1MQS A;  3NZU A;  3BG1 B;  3IEG A;  4BTA A;  4U0Z A;  3MZL B;  3D9O A;  3LVQ E;  2L6J A;  1JUQ A;  3Q49 B;  5G2N A;  4O6F A;  4ILH B;  4A1G A;  3TJP A;  2L9B A;  4CGV A;  3G2T A;  3LPZ A;  4FC8 A;  4G24 A;  2VGX B;  3AU4 A;  4FP7 A;  5AEN A;  3ENE A;  5KCM A;  1NP7 A;  3IHV A;  3EIJ A;  4GZ6 A;  5T3R A;  5G05 C;  2IFU A;  4C9B B;  3GZ1 A;  3APC A;  3CK8 A;  2VSX E;  3EDT B;  4PDX A;  4U63 A;  3ZW3 A;  5KJM A;  3IHY A;  3CHP A;  1YA0 A;  4PS3 A;  3CK7 A;  5BUZ A;  4IYP A;  2X6K A;  2GGF A;  2WXR A;  3FUM A;  2BTD A;  2XRY A;  5ANL A;  3ESK A;  3VTY A;  5M72 A;  5D0Q D;  5BV0 A;  1EF1 C;  2I9C A;  2LAI A;  4GYO A;  1E7V A;  1Y8M A;  4L1B A;  5LOZ A;  2IU1 A;  1PC2 A;  3D9N A;  5E76 A;  3SGH A;  4CEM A;  4F53 A;  5J90 A;  3HYM B;  1OWM A;  3OXF A;  1NZN A;  4NUR A;  4JA7 A;  1IQU A;  1E90 A;  4WNG A;  5CHE E;  4UI9 K;  3GYZ A;  2ZU6 B;  2VGX A;  4N5C A;  5G05 J;  3ZHE B;  5EX3 A;  4QFV A;  4XIF A;  4BT9 A;  1MHQ A;  2A4Z A;  3URZ A;  1X5B A;  3D9K A;  3OTN A;  3QB2 A;  2WXF A;  3FTW A;  3PH0 C;  3DPD A;  4IN3 B;  3CQG B;  4AXH A;  2ILR A;  4NAC A;  3EIQ C;  3SZ7 A;  3GZS A;  2XRZ A;  3PNL B;  5LP0 A;  2JLB A;  2FI7 A;  2X6I A;  2IF4 A;  3IV0 A;  3G2U A;  2XGS A;  4HOR A;  2V0P A;  1HH8 A;  4GA0 A;  5KJN A;  2X3M A;  3FU0 A;  4YVQ C;  2DBA A;  1Z3Y A;  5FZS A;  1INZ A;  3PUJ A;  3CVP A;  3PUK A;  5FZR A;  3C98 A;  4OVU A;  4HLE A;  3HHM A;  4LCT A;  4WNF A;  2CFU A;  2OV8 A;  3KD7 A;  3FH8 A;  4ANX A;  2YNQ A;  2KZT B;  3O48 A;  3CSF A;  3U3W A;  4AY6 A;  4HVB A;  1UJJ A;  3FU6 A;  4GA2 A;  3ZEF A;  3ZHE A;  3TXM A;  3MKQ B;  3ZPJ A;  4A55 A;  5BT1 A;  5FWQ A;  4BTB A;  4U0U A;  3QWW A;  4GCO A;  3CIA A;  2EQX A;  3BEE A;  2GW1 A;  2R5S A;  2WPV A;  2M63 A;  4I9E A;  4JHJ A;  4NRH B;  1HZ4 A;  1P5Q A;  2X6J A;  3MEK A;  3FTY A;  4XX5 A;  3ASG A;  3U4T A;  2V8S E;  3KAE A;  1U3C A;  3TGO A;  3RKV A;  4B0Z A;  3ASH A;  3R9A B;  4ACL A;  3ZIM A;  4IRU A;  5BPP A;  4E85 A;  3L6A A;  3QKY A;  2XCC A;  3JYS A;  1E8Z A;  4BX8 A;  2AWI A;  3FY4 A;  2YIN A;  3L17 A;  4F3V A;  2CFZ A;  1E8X A;  4JW1 A;  4DLQ A;  2KZT A;  3G2V A;  4E6H A;  3FUE A;  3LY9 A;  4I2Z A;  3O4Z A;  1ELR A;  2OVF A;  3MKQ A;  2VSO E;  2UWJ G;  4A1S A;  1A17 A;  3SNX A;  1E8W A;  4FJZ A;  4L2L A;  3EHN A;  4EQF A;  4GPK A;  2V4L A;  2P58 C;  2X38 A;  4B89 A;  2WXL A;  3RU0 A;  3GZ2 A;  4N3B A;  2XHE A;  3TG5 A;  3CHS A;  4RVB A;  4CRW A;  2HYZ A;  4G2V A;  3ZN3 A;  4UWH A;  4AV7 A;  4A3T A;  2KCK A;  2HM8 A;  4JC8 A;  4F1S A;  1UN9 A;  3PEU B;  5CMW A;  3TL5 A;  1IYG A;  5AJL A;  1KT1 A;  2X6F A;  3AS4 A;  3FUD A;  4I9C A;  3SBS A;  3LVR E;  4AY5 A;  3QAQ A;  2J4D A;  4B8C B;  3PNT B;  1PY1 A;  3E4B A;  3IKO B;  2KCL A;  2C0M A;  3R7Q A;  3FDH A;  1S0P A;  5FZQ A;  3HDX A;  4BX9 A;  4BT8 A;  4K0R A;  3D9L A;  3JCK C;  4CDR A;  2IQC A;  2Y3A A;  3T8M A;  3P2B A;  2CHZ A;  2IOL A;  1HU3 A;  3OAW A;  4XKB A;  3RRM B;  3ZYQ A;  1OWO A;  3MV3 B;  4KZC A;  3DBS A;  4CGW A;  4I43 A;  4ABN A;  4CCA A;  4UI9 J;  4ANU A;  2L0I A;  3U66 A;  3FUJ A;  2I2O A;  1JWG A;  5T4Y A;  3PDN A;  3CST A;  4NQ0 A;  4AEZ C;  3LY8 A;  4GA1 A;  4AM9 A;  1BPO A;  3PE3 A;  3FWV A;  2WXG A;  3CEQ A;  3G2S A;  3HIZ A;  4BSX A;  3ZXS A;  2GRM A;  3WXX A;  4G25 A;  2WXP A;  3D9P A;  4U04 A;  5DBK A;  3UT7 A;  5LFA A;  3QNK A;  3CVY A;  3CVW A;  1N52 A;  3UPV A;  2MRI A;  3U64 A;  4B8A A;  1HXI A;  4V3I A;  4DJA A;  3R7R A;  3CVX A;  4L2Y A;  2NC9 A;  1HO8 A;  4EBA G;  4Q96 A;  2PL2 A;  4XE0 A;  4ANW A;  3FU5 A;  3OXL A;  4EEC A;  4JVS A;  4TRQ A;  5G55 A;  5EX0 A;  4JEU A;  3OXG A;  3CHM A;  4MKT A;  4K03 A;  2WXQ A;  4I6E A;  3RO2 A;  3ESL A;  3TAX A;  1HFA A;  2OVB A;  3T5X A;  3ML8 A;  4LRZ A;  4OYS A;  3RRU A;  1HG5 A;  5JHB A;  2AXZ A;  4J8F A;  5FQ8 A;  4G23 A;  4DI3 A;  3VLE A;  3EJN A;  1QQE A;  3JQ0 A;  5EKQ D;  3N71 A;  1Y6I A;  3MCX A;  4H7Y A;  4J0U A;  3SFZ A;  4CT0 A;  3APF A;  4U0S A;  3ZYL A;  5AJD A;  5ARF A;  3SBT B;  4LER A;  4D10 C;  4CDN A;  2PM7 A;  1NA0 A;  2IOS A;  4P29 A;  2OOE A;  4FUL A;  4LEU A;  5CCM A;  2XPI A;  4UWG A;  2PZI A;  3UQ3 A;  2UY1 B;  3NQP A;  3UMV A;  3CKB A;  3NZS A;  1HG2 A;  4U07 A;  2AVP A;  4XI0 A;  2C2L A;  2OND A;  3L13 A;  2WXN A;  5G04 C;  2X6H A;  2YHC A;  4KXK B;  5AYW D;  1H0A A;  5FQ4 A;  3VLF A;  5C1D A;  2FF4 A;  4F7A A;  3FTX A;  4APF A;  4JXT A;  3K9I A;  4GU5 A;  1SZA A;  3Q47 B;  2Y4T A;  3QWV A;  4PH4 B;  4ILI A;  1E7U A;  2IJG X;  1EPU A;  4FLB A;  4PUC A;  3RIB A;  3UX4 A;  5KJL A;  4N2Q A;  3ONK A;  4FJY A;  3B7S A;  3FEX A;  4B94 A;  4WWN A;  3FH7 A;  1ZBP A;  3D3M A;  1HE8 A;  1OWN A;  2C0L A;  3HVE B;  2I1J A;  5BV1 A;  2BUG A;  4XI9 A;  4I6J A;  2J49 A;  3MGB A;  2QFC A;  3B13 A;  2WQH A;  3GW4 A;  4ACK A;  2J08 A;  3RRN B;  3FUK A;  4HOT A;  3B7U X;  2UY1 A;  5BNW A;  3APD A;  3Q5M A;  5G04 J;  2XCB A;  1UG3 A;  2WXJ A;  4IUL A;  3BG0 B;  4GYW A;  2GRL A;  4UWL A;  4WND A;  2WQ6 A;  3CGH A;  4R7L A;  1ZU2 A;  3PZD A;  1Z3X A;  4FLH A;  2WXK A;  3I3N A;  2AXV A;  4KBQ A;  3S7D A;  2WVI A;  4UQY A;  1L5J A;  2J9Q A;  2CG2 A;  4LUN U;  4UQX A;  4KVO A;  2MOW A;  3HVE A;  2PQR A;  2KAT A;  4UI9 C;  2WXH A;  4H7X A;  4J8S A;  2LSV A;  4JHK A;  4N39 A;  4MS6 A;  5FQ6 A;  2QY7 A;  3CLJ A;  3SHF A;  3UUX A;  3ZYM A;  1XNF A;  3LJ3 A;  4KYO B;  3CVU A;  4YND A;  4AVX A;  2R59 A;  3JQ1 A;  5FQ7 A;  3S7F A;  2LSU A;  4JZY A;  4RG9 A;  3FUL A;  4G1T A;  3I5P A;  2CG3 A;  1PAQ A;  4GZD A;  4J8E A;  4I2W A;  4WWO A;  2RG8 A;  3QJZ A;  4KMO A;  5CMY A;  3CKC A;  3RK6 A;  4EZJ A;  4HS2 A;  4TUU A;  2LAH A;  4APO A;  2XGO A;  3AU5 A;  3MA5 A;  3ZVV A;  4JEH A;  4KVM A;  1E8Y A;  3L22 A;  5ENN A;  4C0E A;  2VSY A;  3S7B A;  3LDZ A;  1XGW A;  2XQ0 A;  4EPZ A;  3Q15 A;  1IHG A;  2LNI A;  4GB9 A;  4EBA A;  4Q69 A;  3LS8 A;  5ANR A;  1LF8 A;  4GML A;  5T8I A;  4UWF A;  4N3C A;  3FEY A;  3LCA A;  1JWF A;  4AP2 A;  1W3B A;  5JJT A;  1DVP A;  4ATG A;  3FUI A;  4BWR A;  4PS8 A;  4DPR A;  2E0I A;  2XGM A;  3RO3 A;  4Y6W A;  3L08 A;  4L7T A;  3LY7 A;  5JJ6 A;  3UT8 A;  2I6H A;  3FTU A;  4CT4 A;  3CK9 A;  3TG4 A;  4G26 A;  2AXU A;  4BY6 A;  3FUN A;  3ONL A;  1VDY A;  4MLP A;  4TV3 A;  4Y6C A;  1DNP A;  3MYV A;  4ILG A;  4AIF A;  3PS6 A;  4KT6 B;  4M3O A;  4RG6 A;  4AJW A;  1FVF A;  3MX3 A;  3RJV A;  3FFL A;  1OWL A;  3NF1 A;  2MHK A;  1UW4 B;  1KLX A;  2FEZ A;  4JHR A;  1JPL A;  2CHW A;  5A6C A;  2WB2 A;  3MKR A;  2VSN A;  3SD5 A;  4WUY A;  3SI5 A;  5HQ8 A;  3AS8 A;  4CDM A;  2CHX A;  4YVO A;  4GAA A;  4HOS A;  3PVL A;  1WY6 A;  2KM4 A;  4WNE A;  4J8D A;  4AOF A;  3QOU A;  5DIZ A;  3U9W A;  2XPY A;  4A3V A;  1TJC A;  3KS2 A;  1QNF A;  3SF4 A;  3QK0 A;  2ION A;  4W9R A;  3D9J A;  2E2E A;  3PEV B;  5AIJ A;  5J08 A;  2HO1 A;  2HR2 A;  3FTZ A;  1U3D A;  2LO6 A;  1TJF A;  4JPS A;  4FHK A;  2VTB B;  1ELW A;  1FVH A;  3MJW A;  4ME2 A;  5EDS A;  4OVV A;  2I1K A;  4G11 A;  4Q94 A;  2JEK A;  5FTP A;  4I1M A;  1B89 A;  3ML9 A;  4PS7 A;  5A23 A;  3G2W A;  4MRU A;  1N54 A;  4N3A A;  3ULQ A;  3CV0 A;  3FTV A;  4UQZ A;  3I4G A;  3FP3 A;  2WXM A;  3UT4 A;  1H6K A;  5LCW C;  2XEV A;  3CVV A;  3FTS A;  3L16 A;  3CR3 A;  3LKU A;  3ZFW A;  3Q4A B;  4XZ4 A;  2V5F A;  3ZRH A;  1Z6T A;  4EZL A;  4GYY A;  5LX8 A;  1SQM A;  1FCH A;  3CHQ A;  4GCN A;  4URK A;  3VTX A;  2WMO A;  3PRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...