3URZA

Crystal structure of a putative protein binding protein (bacova_03105) from bacteroides ovatus atcc 8483 at 2.19 a resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
201
Chain Sequence
SVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYKSPTKMQYARYRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACOVA_03105) from Bacteroides ovatus ATCC 8483 at 2.19 A resolution
rcsb
source organism Bacteroides ovatus
molecule tags Protein binding
total genus 70
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3urzA00
3ASGA 5CHEE 1KT1A 3Q4AB 4Y6WA 4KXKB 5KJMA 4B94A 5G04J 2C0LA 2KC7A 2KCLA 2FI7A 4ME2A 3Q47B 1QQEA 3VTXA 4BTAA 3RO3A 1A17A 3CK9A 3RKVA 3PE4A 3LKUA 1WAO1 3SF4A 4I9EA 4N3BA 2KATA 2VQ2A 2C2LA 2WQHA 3UUXA 2JLBA 5FZRA 5EX0A 5JJ6A 2XGSA 4U07A 4GA0A 5DBKA 1QZ2A 1ELWA 1PC2A 3S7JA 4RG9A 3RO2A 3U4TA 4U0ZA 2UY1B 4BT8A 1NA0A 2GW1A 5A6CA 5KJLA 3OXGA 3AS5A 3LYAA 1NZNA 2L6JA 1HZ4A 4JA7A 4GCNA 2QFCA 4XI0A 3E4BA 1TJCA 4Y6CA 4WNEA 3OXFA 4GYOA 5BW8C 5JJTA 2R5SA 3AS8A 3LY8A 3QWPA 4I2WA 5LCWC 3CVPA 3OXLA 4N2SA 2KCVA 2IF4A 3UPVA 4HOSA 2VYIA 4CDRA 3LY9A 4UI9C 3ZHEA 3RJVA 4GZ5A 2VGXB 4G2VA 3Q5MA 3RU0A 4H7XA 3URZA 4N3AA 2OOEA 1W3BA 4G1TA 4CGVA 3AS4A 5EX3A 3CKCA 3ULQA 2VSYA 5BNWA 4UQXA 4GA2A 5G05J 2C0MA 4BTBA 3IEGA 3ZFWA 4WNDA 4N3CA 4GYYA 2XCBA 4I1AA 4LEUA 1ZU2A 2FEZA 3MEKA 4J8DA 2XEVA 4EQFA 3CK7A 3QWVA 4YVOA 2XCCA 4AY5A 5CCLA 2XPIA 2FBNA 2FO7A 2E2EA 1IYGA 3CVQA 4KYOB 4U0UA 4GPKA 5G04C 4I17A 4JL0A 4U0SA 4J0UA 5D0OD 2PQNA 4W9RA 4G23A 1KT0A 4RG6A 3N71A 3SZ7A 4UQZA 3S7FA 5BT1A 3BEEA 4WUYA 3ASDA 4BWRA 3HYMB 3QWWA 2AVPA 3ESKA 1NA3A 1YA0A 5C1DA 3TG5A 4IN3B 4XI9A 2YHCA 3RIBA 5JJ7A 2UY1A 2DBAA 4JHRA 5FZQA 5KJNA 3CKBA 4I9CA 4G25A 4APOA 2VGYA 5KJKA 4CGWA 4F3VA 4U04A 3LCAA 2LSUA 4J8FA 3U3WA 4G26A 3CV0A 2I6HA 2IFUA 4WNFA 5DIZA 4UI9K 2PL2A 1IHGA 2VSNA 3K9IA 2BUGA 5FT9A 3TAXA 3KD7A 3GZ1A 3MV2B 3LY7A 3JYSA 4GCOA 5D0QD 2FF4A 4HOTA 1E96B 3ZGQA 1XNFA 4N39A 3KS2A 2LNIA 3ASHA 3CVNA 3GYZA 3PE3A 5FZSA 3LPZA 3ASFA 5M72A 1HXIA 4XIFA 1FCHA 4AY6A 2HO1A 5G05C 3S7BA 1HH8A 3UQ3A 1WM5A 1ZBPA 4ABNA 3NF1A 2PZIA 2XGMA 4WNGA 4O6FA 2Y4UA 5ARGA 3O48A 4BT9A 3VTYA 4GZ6A 3FP3A 1ELRA 3R9AB 3GW4A 2HYZA 2LSVA 1P5QA 4YNDA 2MHKA 3FFLA 3Q15A 4G24A 5LCWJ 4I2ZA 2J9QA 2KCKA 5HI7A 2XGOA 3MA5A 4UI9J 4JA9A 3ZPJA 5EKQD 3TGOA 2ONDA 3FWVA 4H7YA 5A7DB 3S7DA 3TG4A 4N5CA 4UQYA 4NRHB 3ZHEB 3EDTB 3QDNA 3MV3B 3QKYA 4YVQC 5ARFA 4A1SA 3ZN3A 4GYWA 3CEQA 4AM9A 2UWJG 2PQRA 2Y4TA 3CK8A 4NQ0A 1B89A 1KLXA 3GZ2A 4HOQA 4KBQA 2Q7FA 2NC9A 5FJYA 4AIFA 2VGXA 3WXXA 2P58C 4GA1A 3Q49B 4HORA 2HR2A 4N2QA 3QOUA 5FTPA 3CVLA 4HOUA 2YQ8A 2V5FA 3PDNA 4J8EA 3MKRA 1Y8MA 5HQ8A 4GZ3A 2WPVA 5CCMA 5AYWD 3KAEA 1OUVA
chains in the Genus database with same CATH superfamily
3S2AA 5D66A 2R05A 3HXEA 4IYPA 4B94A 3HXCA 4F7AA 2FI7A 3UMVA 2E0IA 3Q47B 5E75A 4JEUA 3RO3A 2B6CA 5AIJA 3RKVA 5HS0A 1IXVA 3VLDA 5KNHD 5AQAA 1WAO1 2QYUA 3ULYA 2J08A 2KATA 3ZVVA 5FZRA 2WXPA 1INZA 2QYJA 1LD7A 3FTVA 3DPYA 1ELWA 4LNBA 4ATZD 4Z68A 5BV0A 2CHZA 3UM3A 4YDEA 2Y69E 4U0ZA 2UY1B 4WWOA 1NA0A 1FT2A 3CVXA 5KJLA 2GRQB 1NZNA 1HZ4A 3UIOC 1OWLA 3JQ1A 3E4BA 1TJCA 1IKND 3B95A 3OXFA 2I2OA 3TWQA 2JEKA 5JJTA 5G55A 5LCWC 3MJWA 4WAFA 2MYOA 2KCVA 2IF4A 5KWDA 3DSVA 1OWPA 2OCCE 3LY9A 5B1BE 5LP0A 5AN8A 3B7SA 5ENQD 5B1AE 2YHEA 3TJPA 1MX4A 3R7RA 4WWPA 2KZTA 4DUIA 3AAAC 2EINE 4H7XA 3PH0C 3D3MA 3NB2A 2DVWA 2WVIA 4C0EA 3CVWA 3DXMG 5EX3A 2ETAA 3CKCA 2VSYA 1MJ0A 4GA2A 3LJNA 1QBQA 3SQVA 3IEGA 4WNDA 2Y1LE 3R9MA 3UKRG 4N3CA 2R17C 2ZXWE 2P9KG 3CK7A 4AY5A 2OVBA 4AVXA 4I1MA 2IO2C 3ONLA 2XPIA 2KBXA 4CYMD 2E2EA 4K5BA 3CVQA 4U0UA 2X6FA 1H2VC 5FWQA 3EHMA 4LRZA 3SGHA 4DX2A 1KT0A 4RG6A 3N71A 5J08A 4TV3A 4EBAG 4HRMB 3FY4A 4WUYA 1TEZA 4MS6A 3CSTA 2IJGX 3HYMB 1YYHA 4PS8A 2XRYA 3ESKA 2BTDA 3UI2A 1UG3A 3CVYA 3ZEFA 4IULA 5BUZA 4IN3B 3MGBA 4A55A 1D8DA 2QC9A 4APOA 1HU3A 5FQ6A 2X6KA 4CGWA 1BPOA 3LJ3A 4ANWA 3CVUA 3PZ1A 4J8FA 1SA5A 3HG0D 2I6HA 2IFUA 3LVRE 4WNFA 4DLQA 2CG2A 5DIZA 4UUCA 2PL2A 3Q78A 2VSNA 4CDNA 4MKTA 4L7TA 4FU3A 4MBGA 3JXJA 2BUGA 1TR4A 3KD7A 3ULEG 2AXVA 3QB2A 2WXJA 5D0QD 4B89A 3CHMA 4NIKA 4HOTA 4N39A 3ONKA 3IHVA 3CVNA 3PE3A 4U63A 5ENRD 4CDMA 3AJIA 4RVBA 1FCHA 5LOZA 1UN8A 1HE8A 2YINA 5G05C 4XKCA 2GRRB 3UQ3A 2R03A 4OVUA 2WXIA 3NF1A 4J8SA 3GZSA 3ABLE 2L0TB 4FJYA 4BEPA 4GZ6A 3R9AB 3GW4A 3L16A 1S63A 3T9KA 2A5EA 2HYZA 3AU5A 4HI8A 3WG7E 3DSUA 3ML8A 1H6PA 3HIZA 2RG8A 5FINA 3DEOA 3FUJA 3FEXA 1IQUA 4TXRA 3DSTA 5FIOA 4TXQA 1MZCA 4LCTA 4JA9A 4UI9J 3ZPJA 2X6IA 5EDSA 2ONDA 3KEZA 1N0RA 5A7DB 1KPSB 1K1BA 5CEDB 3QDNA 2ZISA 1H6KA 5ANRA 1JPLA 5CBNA 4GYWA 3CEQA 4Q96A 2GROB 3CHSA 3U64A 1X5BA 2V0PA 1N9AA 3GZ2A 5FJYA 3ZW3A 4HORA 3SBTB 3QOUA 3CVLA 4HOUA 4I6GA 4C48B 4YDWA 3SNXA 1N4PA 1Y8MA 4O60A 2WPVA 1TYQG 3ZYQA 3CHOA 3RSEG 3IKOB 3APCA 4HNAD 4JHJA 1OUVA 1KT1A 4C9BB 1MHQA 4KXKB 2AJAA 5G04J 1E7UA 2KC7A 1MYOA 3VLFA 2X6JA 3TWVA 1N0QA 3IV0A 4GZDA 3VTXA 5CRUA 3G2SA 1OWOA 3PE4A 4XKBA 4D10C 4I9EA 4N3BA 2VQ2A 2C2LA 5BPPA 2JLBA 3BG0B 2EILE 4J8YA 4HLEA 2LO6A 4F1PA 5ENPD 4ACLA 3FTYA 4U07A 4GA0A 5AJLA 3I5PA 4HS2A 1U3DA 1QZ2A 1O1TA 4YDOA 3DPDA 3PZDA 4HBDA 3RO2A 3U4TA 3TWXA 1IQRA 3ZKJA 3APFA 4M3OA 4KMOA 3BQOA 3AS5A 2H6GA 5KCMA 3C3QA 4XE0A 4GCNA 1H2UA 2J49A 5EIDA 2L6BA 4HQDA 4BX8A 3AS8A 2DCPA 3PNLB 3EU5A 3NZSA 4L2YA 2VYIA 3UM1A 1SW6A 3ZHEA 3FU5A 4JC8A 3QARA 4GZ5A 1KZOA 2VGXB 2RFAA 2IOLA 3PZ3A 3MYVA 4G2VA 1E8ZA 3AU4A 3RRUA 4N3AA 3P1UA 4O1PA 2ZIRA 2OOEA 4KT6B 3LVQE 2AW6A 4B93B 5FQ4A 3CR3A 2R2LA 3TWTA 3ULQA 1EPUA 1LF8A 5T8IA 1SA4A 4ATGA 2C0MA 4EBAA 5CMYA 1K3ZD 4UWFA 1BLXB 3ZFWA 4GYYA 2XCBA 1K1AA 2WMNA 1ZU2A 3D9IA 5E76A 1AWCB 3MZLB 4GMLA 5ENTD 4EQFA 3QWVA 3G2UA 3FH7A 3W9FA 4GMJA 3SFXA 4K5CA 5ENOD 2FBNA 4IRUA 2WXNA 4PS3A 1IYGA 2XHEA 2OEVA 2P9SG 1NI1A 3NOGD 4GPKA 3FUKA 4J0UA 2PQNA 3I3NA 2PNNA 4JEHA 4G23A 3SZ7A 4GZCA 3DSWA 1JWGA 3UKUG 2LAIA 4JHKA 1BI8B 5A23A 2ZU6B 1A5EA 3AG3E 4GMRA 2ETCA 4XI9A 2DWZA 3RIBA 2DBAA 3T8KA 5FZQA 1ELKA 3PEUB 4GTTA 4I43A 5H7PA 3EJNA 2OEWA 3ABKE 4JD2G 4AOFA 3T5XA 3CQCB 1AP7A 5AAOA 4F3VA 2PM7A 3LCAA 2LSUA 3UT4A 3NQPA 3CV0A 3FUDA 5AQBA 2B0OE 2AWIA 1N54A 4TRQA 2X38A 2PM6A 4PUCA 3PS6A 1Z3XA 4FA6A 3R7QA 4U96D 4JPSA 4RSYA 3UT8A 4DX5D 1E96B 4UWLA 4PS7A 4R7LA 2WXMA 3PNTB 5C2YA 2LNIA 3ASHA 2AXZA 1FPPA 3LPZA 5CERB 3Q75A 1HXIA 4AY6A 4P29A 5AQ9A 3S7BA 2I1KA 1QNFA 3MX3A 3ZNGA 2Y3AA 3RRNB 2M63A 3KSLA 3ZUVB 2F8YA 4ILGA 5ARGA 3PZ4A 3J5QB 2XRZA 2RKKA 4U7EB 3CVVA 4OYSA 3DSXA 5CMWA 2P9LG 4QQIA 3D9NA 1TN7A 4LG6A 3ZRHA 4A63B 3E32A 4XEIG 4F6RD 2JABA 2J4DA 3TWSA 2R59A 4BESA 5LCWJ 4PH4B 2XZDG 1H2TC 4ACKA 4I2ZA 4K5AB 4Q69A 3Q9UC 2XGOA 2OVFA 3EUVA 3QK0A 1N94A 5EKQD 3RK6A 1TN8A 3S7DA 5BV1A 4GTRA 4NRHB 3ZHEB 1SVXA 3E30A 4APFA 3HXFA 4FHJA 5LFAA 2VTBA 4AM9A 2UWJG 1BU9A 1B89A 1VDYA 4AIFA 2VGXA 3L9TA 2BF0X 4JXTA 2IEJA 3FTZA 4J6IA 2KXPC 3ASNE 1MQSA 2A5UA 3PDNA 4NURA 4ANVA 4AP2A 5ITZF 4DK5A 2VSOE 5CCMA 4L1BA 3C98A 2XS1A 3AG1E 3UM0A 4V3IA 2CFUA 3CIAA 4LNGA 4Y6WA 3HXBA 1TNYA 2XS8A 3ENEA 3DRAA 5KJMA 5T3RA 5BXUA 3SFYA 4MRUA 3EIJA 4ANXA 4ILIA 4ME2A 3U9WA 1MX2A 4EHMA 1A17A 3BUAA 3CK9A 5EILA 3LKUA 3D9OA 3AG4E 3NAWA 3PEVB 2NXPA 3HRAA 3JQ0A 3UUXA 3HVEA 3L08A 4G8LA 1FVFA 5EX0A 1TNOA 4AEZC 5JJ6A 3FHEA 2DYRE 3APDA 2X3MA 2XGSA 4K03A 3ISMC 1K8KG 2XEHA 1SZAA 3FUFA 3EIQC 4GTOA 3S7JA 2BEDA 3UIPC 1O5MA 1Q2ZA 3FUMA 3ZIMA 1OXJA 2WXKA 3X2QE 4BT8A 3SO8A 2LUHA 1N11A 1E8YA 3B7UX 2NYJA 3OXGA 4JVSA 3LYAA 4L2LA 3C72A 4M7CA 1V54E 4C0MA 2QFCA 1BD8A 4XI0A 4CT4A 3PUJA 2HE0A 5AENA 3FU0A 5BW8C 5CRVA 1RZ4A 3LY8A 3FTUA 1HF8A 3QWPA 3TWUA 4XX5A 1HS6A 3CVPA 3OXLA 5AQ7A 3SBSA 2R02A 3OTNA 2GRLA 4U8HA 3DWLG 1JUQA 3EU9A 3ASOE 2NSZA 1Z6TA 2J07A 4GTPA 3RJVA 2J09A 4HI9A 2I1JA 3D9KA 3HDXA 3RU0A 3JCKC 2XEEA 2WM9A 4TUMA 4HB5A 4JW1A 1W3BA 3D9JA 4G1TA 3AS4A 3FTWA 4K0RA 3C3OA 5BNWA 4UQXA 3UT7A 5G05J 1E8WA 2IQCA 1IHBA 5KNGA 4I1AA 1HG5A 1V55E 3ZYMA 3J5PA 1Z5SC 2XCCA 2P9PG 3UXGA 5CCLA 4LUNU 1TNBA 1H0AA 5CEAA 2FO7A 1D8EA 3V2OA 5T4YA 4OAUC 4I17A 3QNKA 2QY7A 2VJ8A 4YDYA 2XPYA 4DX6D 1E8XA 4E6HA 2IO3C 4DX1A 1S64A 2WXOA 2I9CA 4LNUD 4BWRA 4DX7D 2WXQA 3FEYA 1OY3D 2AVPA 3CQGB 3SD5A 4ZFHA 1NA3A 4U95D 1H6OA 1YA0A 5EYLA 2V4LA 3B13A 3DBSA 4A3TA 2YHCA 5JJ7A 4FP7A 1OCCE 4JZYA 2OV8A 3T5VA 3CLJA 1WY6A 1MX6A 4G25A 4UWHA 4FC8A 4A1GA 4TXPA 2VGYA 5KJKA 2VTBB 2MOWA 2F0YA 2WMOA 2DIWA 3QAQA 3ZU7B 1OT8A 1L5JA 4G26A 3LEWA 5JA4D 2WXRA 1TN6A 4UI9K 4N5QA 1EDUA 1IHGA 1JCQA 5B3SE 2YNQA 2WXGA 3SHFA 4X8QA 3K9IA 4AJWA 3Q7FA 3D9LA 5JHBA 3LXUX 5FQ7A 5CECB 5FT9A 3ZXPA 3NZUA 3E37A 3GZ1A 3MV2B 3PUKA 3LY7A 2CFZA 3VLEA 4GCOA 2FF4A 5EYPF 3ZGQA 2J4BA 2VSXE 5ENSD 3V30A 3KS2A 3UTMA 3GYZA 5FZSA 3AG2E 5M72A 3BU8A 4LERA 1BI7B 3DEPA 4PDXA 4HFGA 2IU1A 4GTVA 2RFMA 3HVEB 1ZBPA 4ABNA 2PZIA 2XGMA 2LXLA 4BSXA 4BT9A 3VTYA 1OCZE 4MLPA 2F37A 1EF1C 3FP3A 1ELRA 3ZYLA 2LSVA 3Q7AA 3D9MA 3EHNA 2MHKA 2QZAA 3FFLA 1O1SA 2V5QC 3FUIA 3Q15A 1U3CA 2GGFA 1Z3YA 4HRNA 2RD0A 1EYHA 4FLHA 2H6FA 1ZB1A 3FH5A 2CHXA 1UJJA 2J9QA 5HI7A 1O1RA 3MA5A 3TGOA 5BXOA 4H7YA 4DPRA 3HXDA 3I4GA 4L9PA 3RRMB 3EDTB 1S70B 3MV3B 3QKYA 1OCRE 4A1SA 3IXEA 3HHMA 1N95A 1UOHA 3G2TA 5IY5E 3MKQB 3CK8A 3PZ2A 4NQ0A 1SQMA 4KBQA 2Q7FA 5HKPA 3PREA 4HLLA 3IHYA 3TL5A 3Q49B 5LX8A 2X6HA 2HR2A 4FULA 1LTXA 3T8MA 1H19A 3ABME 4J7WA 3FUNA 4J8EA 3MKRA 3CHPA 4GZ3A 1N4QA 1QYMA 4I6EA 2IY0C 5AYWD 3KAEA 1D9SA 3ASGA 2CHWA 5CHEE 3Q4AB 2WXHA 4I6JA 1HG2A 3FUEA 1N4SA 4UWGA 3FU6A 4QFVA 2C0LA 4CRWA 3C3RA 2KCLA 1X81A 4ANUA 4EZJA 3EHRA 1QQEA 3L22A 4BTAA 3DXKG 1XGWA 3SF4A 5KBAA 2WQHA 4RLYA 4BX9A 2KM4A 1DC2A 3B7BA 2Y0BG 3CGHA 3L17A 2A4ZA 3SY2A 3CSFA 1PAQA 1E90A 1DCEA 5DBKA 4CZ2D 1PC2A 1U2VG 1WG0A 3EHQA 3QC1A 3ESLA 4RG9A 2WQ6A 3UM2A 1PY1A 2BKGA 4OAVB 4BETA 4GTSA 5ENNA 5ANLA 2H6IA 2GW1A 5A6CA 2EIKE 2XPZA 4U8VD 4DI4A 2L6JA 4Q94A 2F8XK 4JA7A 3LS8A 5J90A 4Y6CA 4WNEA 4AV7A 4XZ4A 3JUIA 4GYOA 4FLBA 2R5SA 4I2WA 3MCXA 4N2SA 3E34A 3UPVA 4HOSA 4RQIA 3FTSA 4CDRA 1HFAA 3B7TA 4UI9C 4EZKA 3TXMA 4FADA 1G3NB 1FVHA 2HM8A 3Q5MA 4GAAA 2IONA 1SZ9A 2LXMA 2GRMA 3URZA 4CCAA 3NOCD 4CGVA 4F1SA 2ZGDA 3LDZA 3RAUA 1DVPA 3I4RB 3FDHA 4BTBA 1UN9A 3TXNA 3B7RL 2XZTG 3UX4A 4GU5A 4LEUA 2EIJE 2FEZA 4U8YD 3MEKA 4DI3A 4UWKA 4OVVA 4J8DA 1E7VA 2XEVA 4YVOA 1N52A 4G11A 4BSZB 4URKA 3FTXA 2GRNB 4HXIA 1DCQA 4KYOB 2FO1E 5CBOA 5G04C 4WWNA 3JUEA 4JL0A 1OWMA 2P9NG 4U0SA 5G2NA 5D0OD 4W9RA 1RW2A 1N4RA 2FULA 4UQZA 3S7FA 5BT1A 2ILRA 3BEEA 3ASDA 3TWRA 2ETBA 3W9GA 3QWWA 1HX8A 1DNPA 2IOSA 3NBNB 4BY6A 3L6AA 4GPMA 3OAWA 5AARA 4EECA 3F6QA 5C1DA 3TG5A 1YCSB 4DJAA 2UY1A 4KZ0A 4JHRA 1LD8A 5KJNA 2DYSE 2BKKB 3CKBA 4B8AA 1JCSA 4I9CA 3UINC 2GRPB 1FT1A 2XENA 1YMPA 1TNUA 3FH8A 2J8SD 5JHAA 4U04A 3L54A 3G2VA 4HVBA 2EIME 3U3WA 4DLOA 1HO8A 3MKQA 2KZTB 3JXIA 3SFZA 4A3VA 4CT0A 4BERA 1KZPA 2MRIA 4KZCA 4LSZE 5JMND 1UJKA 3FULA 3TAXA 2DZNA 4I1OB 3KEAA 3KSQA 3JYSA 3D9PA 3L13A 3C5RA 1S0PA 2LAHA 1XNFA 5D2MC 3FUHA 3FU3A 3TWWA 4KVMA 5EIBE 1Y6IA 4GTQA 1JCRA 1OWNA 1JWFA 2V4HC 1UW4B 3CHRA 3ASFA 4XIFA 4GB9A 3QJZA 3SI5A 4FJZA 2HO1A 4F53A 3BG1B 2VGEA 1HH8A 2XQ0A 3U66A 4KVOA 5HRYA 1WM5A 3G2WA 3ZXSA 3CHQA 4WNGA 4B8CB 4O6FA 2Y4UA 1NL4A 2P2CP 4EZLA 1GW6A 4ZHBA 3O48A 3PVLA 4DRXE 4E85A 4JB8P 1NFIE 4AXHA 3V79K 3ZYKA 4NACA 4BFRA 4FHKA 3L82A 3Q79A 1P5QA 4YNDA 4GTMA 2WXFA 5AJDA 3PRZA 2V8SE 4HRLA 4G24A 3V31A 4ILHB 3V2XA 1NP7A 2L9BA 4G8KA 3P2BA 2WXLA 2KCKA 3IBEA 2AXUA 2DZOA 3FWVA 4O1OA 2EQXA 3TG4A 2P9IG 1WDYA 4N5CA 4UQYA 3ML9A 3E33A 2WQ7A 4CEMA 4B0ZA 4YVQC 3DSSA 5ARFA 5FQ8A 3ZN3A 2CG3A 3O4ZA 2WB2A 1OCOE 2PQRA 2Y4TA 1KLXA 1TNZA 3Q9NC 4HOQA 2L0IA 2NC9A 2H6HA 3WXXA 5EN5D 2P58C 4GA1A 2ZGGA 4L23A 4N2QA 5FTPA 3D9HA 2YQ8A 4TUUA 2V5FA 3Q73A 5HQ8A 4EPZA 1TJFA 2P9UG
chains in the Genus database with same CATH topology
3ASGA 2CHWA 3S2AA 5CHEE 1KT1A 3Q4AB 4C9BB 1MHQA 2WXHA 4I6JA 4KXKB 4Y6WA 1HG2A 3ENEA 3FUEA 4IYPA 5KJMA 5T3RA 4UWGA 3FU6A 4MRUA 4B94A 4QFVA 5G04J 2C0LA 4F7AA 1E7UA 2KC7A 4CRWA 2KCLA 3EIJA 3VLFA 2X6JA 4ANXA 2FI7A 4ANUA 4ILIA 4ME2A 3U9WA 3UMVA 4EZJA 2E0IA 3Q47B 3IV0A 1QQEA 3L22A 4GZDA 5E75A 3VTXA 4BTAA 4JEUA 3RO3A 1A17A 3CK9A 3G2SA 3RKVA 5AIJA 1OWOA 3VLDA 3PE4A 1XGWA 3LKUA 4XKBA 1WAO1 4D10C 3D9OA 3SF4A 4I9EA 2J08A 3PEVB 2NXPA 4N3BA 2KATA 2VQ2A 2C2LA 2WQHA 3JQ0A 3UUXA 2JLBA 4BX9A 3BG0B 5BPPA 2KM4A 3ZVVA 5FZRA 3HVEA 3L08A 2WXPA 1FVFA 5EX0A 4AEZC 3CGHA 3FHEA 5JJ6A 4HLEA 2LO6A 1INZA 3L17A 2A4ZA 3APDA 4ACLA 2X3MA 2XGSA 3FTYA 4K03A 4U07A 4GA0A 5AJLA 3CSFA 1PAQA 3I5PA 1E90A 3FTVA 1SZAA 5DBKA 3FUFA 3EIQC 1U3DA 1QZ2A 4HS2A 1ELWA 1PC2A 3S7JA 3QC1A 3ESLA 4RG9A 2WQ6A 3DPDA 3PZDA 1PY1A 3FUMA 3ZIMA 5BV0A 3RO2A 3U4TA 2CHZA 2WXKA 5ENNA 4U0ZA 2UY1B 4BT8A 1IQRA 5ANLA 4WWOA 1NA0A 3APFA 3CVXA 1E8YA 2GW1A 4M3OA 3B7UX 2XPZA 5A6CA 4KMOA 4DI4A 5KJLA 3OXGA 3AS5A 5KCMA 4JVSA 4XE0A 3LYAA 4L2LA 1NZNA 2L6JA 1HZ4A 4Q94A 4C0MA 1OWLA 4JA7A 3LS8A 4GCNA 1H2UA 2J49A 2QFCA 3JQ1A 4XI0A 5J90A 3E4BA 1TJCA 4CT4A 3PUJA 4Y6CA 4WNEA 4AV7A 5AENA 4XZ4A 3JUIA 3FU0A 3OXFA 4GYOA 2I2OA 5BW8C 2JEKA 5JJTA 4FLBA 4BX8A 2R5SA 3AS8A 3LY8A 2DCPA 3FTUA 1HF8A 3QWPA 4I2WA 5G55A 4XX5A 5LCWC 1HS6A 3MCXA 3CVPA 3MJWA 3PNLB 4WAFA 3OXLA 3SBSA 4N2SA 2KCVA 2IF4A 3NZSA 3OTNA 3UPVA 4HOSA 2GRLA 4U8HA 4L2YA 2VYIA 1OWPA 3FTSA 1JUQA 4CDRA 3LY9A 5LP0A 2NSZA 1Z6TA 1HFAA 3B7TA 4UI9C 3ZHEA 3FU5A 2J07A 4JC8A 3B7SA 3QARA 3RJVA 2J09A 3TXMA 4EZKA 2YHEA 4FADA 4GZ5A 3TJPA 2VGXB 2I1JA 1FVHA 2HM8A 2IOLA 3D9KA 3HDXA 3MYVA 4G2VA 3Q5MA 4GAAA 1E8ZA 3R7RA 2IONA 3RU0A 3JCKC 4WWPA 1SZ9A 2KZTA 3AU4A 2GRMA 4H7XA 3URZA 3RRUA 3PH0C 2WM9A 3D3MA 4N3AA 4CCAA 3P1UA 2WVIA 4C0EA 2OOEA 4KT6B 4JW1A 1W3BA 3D9JA 2AW6A 3LVQE 5FQ4A 3CVWA 4G1TA 3CR3A 4CGVA 3AS4A 3FTWA 5EX3A 3CKCA 4K0RA 3ULQA 2VSYA 3LDZA 4F1SA 1DVPA 5BNWA 4UQXA 3UT7A 4GA2A 1EPUA 1E8WA 1LF8A 3I4RB 5G05J 2C0MA 5T8IA 3FDHA 2IQCA 5CMYA 4ATGA 4EBAA 4BTBA 4UWFA 3IEGA 3ZFWA 4WNDA 1UN9A 3TXNA 4N3CA 2R17C 3B7RL 4GYYA 2XCBA 4I1AA 3UX4A 4GU5A 2WMNA 4LEUA 1ZU2A 2FEZA 1HG5A 3MEKA 4DI3A 4UWKA 3D9IA 5E76A 3ZYMA 3MZLB 4GMLA 4OVVA 4J8DA 1E7VA 2XEVA 4EQFA 3CK7A 1N52A 3QWVA 4G11A 2XCCA 4YVOA 4AY5A 2OVBA 3G2UA 4AVXA 5CCLA 3FH7A 4LUNU 4URKA 4GMJA 1H0AA 3FTXA 4I1MA 3ONLA 2XPIA 2FBNA 4IRUA 2FO7A 2E2EA 2WXNA 4PS3A 1IYGA 5T4YA 4HXIA 2XHEA 3CVQA 4KYOB 4U0UA 2X6FA 1H2VC 5FWQA 3EHMA 4GPKA 5G04C 4I17A 4LRZA 4WWNA 3QNKA 4JL0A 2QY7A 2VJ8A 2XPYA 3FUKA 1OWMA 4U0SA 5G2NA 4J0UA 5D0OD 2PQNA 3I3NA 4W9RA 3SGHA 1E8XA 4JEHA 4E6HA 4G23A 1KT0A 4RG6A 3N71A 5J08A 4TV3A 2WXOA 3SZ7A 4GZCA 4EBAG 2FULA 3FY4A 2I9CA 4UQZA 3S7FA 1JWGA 2ILRA 3BEEA 4WUYA 5BT1A 3ASDA 1TEZA 4BWRA 4MS6A 3CSTA 2IJGX 3HYMB 2LAIA 2WXQA 4PS8A 4JHKA 3QWWA 1HX8A 3FEYA 1DNPA 2IOSA 2AVPA 3CQGB 3SD5A 4BY6A 3L6AA 2XRYA 3ESKA 1NA3A 3OAWA 1YA0A 4EECA 2BTDA 1UG3A 5A23A 2V4LA 2ZU6B 3ZEFA 4IULA 3TG5A 5C1DA 3B13A 3CVYA 5BUZA 4IN3B 4DJAA 4XI9A 3DBSA 4A3TA 2YHCA 3MGBA 3RIBA 5JJ7A 2UY1A 2DBAA 4KZ0A 4FP7A 4JHRA 5FZQA 1ELKA 4JZYA 4A55A 3PEUB 4I43A 5KJNA 2OV8A 3EJNA 3T5VA 3CLJA 4B8AA 3CKBA 4I9CA 1WY6A 4G25A 4UWHA 4FC8A 4AOFA 4A1GA 3T5XA 4APOA 1HU3A 2VGYA 5KJKA 3CQCB 5FQ6A 2VTBB 2X6KA 4CGWA 2MOWA 1BPOA 3FH8A 3LJ3A 4F3VA 2WMOA 4ANWA 2DIWA 3QAQA 4U04A 5JHAA 2PM7A 3L54A 3LCAA 3G2VA 2LSUA 3UT4A 3CVUA 4J8FA 1L5JA 4HVBA 3NQPA 3U3WA 4G26A 4DLOA 3CV0A 3FUDA 2I6HA 2IFUA 3LEWA 3LVRE 4WNFA 2AWIA 2WXRA 4DLQA 2CG2A 5DIZA 4UI9K 1EDUA 1N54A 2PL2A 1HO8A 1IHGA 2VSNA 4TRQA 3MKQA 4CDNA 2X38A 2PM6A 2KZTB 4MKTA 2YNQA 4PUCA 4L7TA 2WXGA 3SHFA 3SFZA 4A3VA 3K9IA 4CT0A 3PS6A 4AJWA 4FU3A 1Z3XA 2MRIA 3D9LA 4FA6A 5JHBA 4KZCA 3LXUX 2BUGA 5FQ7A 1UJKA 5FT9A 3R7QA 3FULA 3TAXA 3NZUA 3KD7A 4JPSA 4RSYA 4I1OB 2AXVA 3GZ1A 3QB2A 3MV2B 3UT8A 3PUKA 3LY7A 2CFZA 2WXJA 3VLEA 3JYSA 4GCOA 5D0QD 3D9PA 2FF4A 4B89A 3L13A 3CHMA 1S0PA 4HOTA 1E96B 3ZGQA 2LAHA 4UWLA 1XNFA 2J4BA 4N39A 4PS7A 2VSXE 3FUHA 3ONKA 2WXMA 3IHVA 4R7LA 3KS2A 3PNTB 5C2YA 2LNIA 3ASHA 3CVNA 3GYZA 3FU3A 2AXZA 3PE3A 4U63A 4KVMA 1Y6IA 4CDMA 5FZSA 3LPZA 1OWNA 1JWFA 4RVBA 1UW4B 3CHRA 3ASFA 5M72A 1HXIA 4XIFA 1FCHA 5LOZA 4AY6A 1UN8A 4GB9A 1HE8A 4LERA 3QJZA 3SI5A 4FJZA 4P29A 4PDXA 2YINA 2HO1A 5G05C 4HFGA 3S7BA 2IU1A 3BG1B 4F53A 4XKCA 2I1KA 1HH8A 1QNFA 2XQ0A 3MX3A 3U66A 4KVOA 3UQ3A 2Y3AA 3HVEB 1WM5A 1ZBPA 3G2WA 4OVUA 3RRNB 2M63A 2WXIA 3ZXSA 4ABNA 3NF1A 2PZIA 4J8SA 2XGMA 3CHQA 3GZSA 4WNGA 4B8CB 4O6FA 2Y4UA 4BSXA 4ILGA 2L0TB 5ARGA 4EZLA 1GW6A 4FJYA 3O48A 3PVLA 2XRZA 4BT9A 3VTYA 4E85A 4MLPA 4GZ6A 1EF1C 3FP3A 1ELRA 3R9AB 3CVVA 4AXHA 3GW4A 3ZYLA 3ZYKA 4OYSA 4NACA 3L16A 4FHKA 4BFRA 5CMWA 3AU5A 2HYZA 2LSVA 1P5QA 3D9MA 3D9NA 3EHNA 4YNDA 2MHKA 3FFLA 2WXFA 5AJDA 3ZRHA 3FUIA 3ML8A 3Q15A 3PRZA 1U3CA 2V8SE 2GGFA 1Z3YA 2J4DA 2R59A 3HIZA 4G24A 5LCWJ 2RD0A 4PH4B 1EYHA 2RG8A 4FLHA 4ILHB 1H2TC 4ACKA 1NP7A 2L9BA 4I2ZA 3FUJA 3FEXA 1IQUA 3FH5A 2CHXA 3P2BA 1UJJA 2J9QA 4Q69A 2WXLA 2KCKA 5HI7A 2XGOA 2OVFA 3MA5A 3IBEA 4UI9J 4LCTA 2AXUA 4JA9A 3QK0A 3ZPJA 2X6IA 5EKQD 5EDSA 3TGOA 2ONDA 3FWVA 3RK6A 3KEZA 2EQXA 4H7YA 5A7DB 3S7DA 3TG4A 4DPRA 5BV1A 3I4GA 4N5CA 4UQYA 3ML9A 4NRHB 3RRMB 2WQ7A 4CEMA 3ZHEB 3EDTB 3QDNA 4B0ZA 4APFA 3MV3B 1H6KA 3QKYA 5ANRA 1JPLA 4FHJA 4YVQC 5ARFA 4A1SA 5LFAA 5FQ8A 3ZN3A 4GYWA 3CEQA 4Q96A 3HHMA 2CG3A 2VTBA 3CHSA 3O4ZA 3U64A 1X5BA 2WB2A 4AM9A 2UWJG 2PQRA 2V0PA 2Y4TA 3G2TA 3MKQB 3CK8A 1B89A 1KLXA 1VDYA 4NQ0A 3GZ2A 1SQMA 4HOQA 4KBQA 2Q7FA 2L0IA 2NC9A 5FJYA 4AIFA 2VGXA 3PREA 2BF0X 4JXTA 3WXXA 2P58C 4GA1A 3IHYA 3FTZA 3TL5A 3Q49B 4J6IA 5LX8A 3ZW3A 2X6HA 2HR2A 4HORA 4FULA 4L23A 3SBTB 4N2QA 3QOUA 5FTPA 3CVLA 3T8MA 1H19A 4HOUA 2YQ8A 4I6GA 3FUNA 4TUUA 2V5FA 1MQSA 2A5UA 3PDNA 4J8EA 3MKRA 4NURA 3SNXA 4ANVA 1Y8MA 4AP2A 4DK5A 3CHPA 4EPZA 5HQ8A 4GZ3A 2WPVA 2VSOE 5CCMA 4L1BA 3ZYQA 1TJFA 3C98A 3CHOA 3IKOB 4I6EA 3APCA 4V3IA 2CFUA 3CIAA 4JHJA 5AYWD 3KAEA 1OUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ASG A;  5CHE E;  1KT1 A;  3Q4A B;  4Y6W A;  4KXK B;  5KJM A;  4B94 A;  5G04 J;  2C0L A;  2KC7 A;  2KCL A;  2FI7 A;  4ME2 A;  3Q47 B;  1QQE A;  3VTX A;  4BTA A;  3RO3 A;  1A17 A;  3CK9 A;  3RKV A;  3PE4 A;  3LKU A;  1WAO 1;  3SF4 A;  4I9E A;  4N3B A;  2KAT A;  2VQ2 A;  2C2L A;  2WQH A;  3UUX A;  2JLB A;  5FZR A;  5EX0 A;  5JJ6 A;  2XGS A;  4U07 A;  4GA0 A;  5DBK A;  1QZ2 A;  1ELW A;  1PC2 A;  3S7J A;  4RG9 A;  3RO2 A;  3U4T A;  4U0Z A;  2UY1 B;  4BT8 A;  1NA0 A;  2GW1 A;  5A6C A;  5KJL A;  3OXG A;  3AS5 A;  3LYA A;  1NZN A;  2L6J A;  1HZ4 A;  4JA7 A;  4GCN A;  2QFC A;  4XI0 A;  3E4B A;  1TJC A;  4Y6C A;  4WNE A;  3OXF A;  4GYO A;  5BW8 C;  5JJT A;  2R5S A;  3AS8 A;  3LY8 A;  3QWP A;  4I2W A;  5LCW C;  3CVP A;  3OXL A;  4N2S A;  2KCV A;  2IF4 A;  3UPV A;  4HOS A;  2VYI A;  4CDR A;  3LY9 A;  4UI9 C;  3ZHE A;  3RJV A;  4GZ5 A;  2VGX B;  4G2V A;  3Q5M A;  3RU0 A;  4H7X A;  3URZ A;  4N3A A;  2OOE A;  1W3B A;  4G1T A;  4CGV A;  3AS4 A;  5EX3 A;  3CKC A;  3ULQ A;  2VSY A;  5BNW A;  4UQX A;  4GA2 A;  5G05 J;  2C0M A;  4BTB A;  3IEG A;  3ZFW A;  4WND A;  4N3C A;  4GYY A;  2XCB A;  4I1A A;  4LEU A;  1ZU2 A;  2FEZ A;  3MEK A;  4J8D A;  2XEV A;  4EQF A;  3CK7 A;  3QWV A;  4YVO A;  2XCC A;  4AY5 A;  5CCL A;  2XPI A;  2FBN A;  2FO7 A;  2E2E A;  1IYG A;  3CVQ A;  4KYO B;  4U0U A;  4GPK A;  5G04 C;  4I17 A;  4JL0 A;  4U0S A;  4J0U A;  5D0O D;  2PQN A;  4W9R A;  4G23 A;  1KT0 A;  4RG6 A;  3N71 A;  3SZ7 A;  4UQZ A;  3S7F A;  5BT1 A;  3BEE A;  4WUY A;  3ASD A;  4BWR A;  3HYM B;  3QWW A;  2AVP A;  3ESK A;  1NA3 A;  1YA0 A;  5C1D A;  3TG5 A;  4IN3 B;  4XI9 A;  2YHC A;  3RIB A;  5JJ7 A;  2UY1 A;  2DBA A;  4JHR A;  5FZQ A;  5KJN A;  3CKB A;  4I9C A;  4G25 A;  4APO A;  2VGY A;  5KJK A;  4CGW A;  4F3V A;  4U04 A;  3LCA A;  2LSU A;  4J8F A;  3U3W A;  4G26 A;  3CV0 A;  2I6H A;  2IFU A;  4WNF A;  5DIZ A;  4UI9 K;  2PL2 A;  1IHG A;  2VSN A;  3K9I A;  2BUG A;  5FT9 A;  3TAX A;  3KD7 A;  3GZ1 A;  3MV2 B;  3LY7 A;  3JYS A;  4GCO A;  5D0Q D;  2FF4 A;  4HOT A;  1E96 B;  3ZGQ A;  1XNF A;  4N39 A;  3KS2 A;  2LNI A;  3ASH A;  3CVN A;  3GYZ A;  3PE3 A;  5FZS A;  3LPZ A;  3ASF A;  5M72 A;  1HXI A;  4XIF A;  1FCH A;  4AY6 A;  2HO1 A;  5G05 C;  3S7B A;  1HH8 A;  3UQ3 A;  1WM5 A;  1ZBP A;  4ABN A;  3NF1 A;  2PZI A;  2XGM A;  4WNG A;  4O6F A;  2Y4U A;  5ARG A;  3O48 A;  4BT9 A;  3VTY A;  4GZ6 A;  3FP3 A;  1ELR A;  3R9A B;  3GW4 A;  2HYZ A;  2LSV A;  1P5Q A;  4YND A;  2MHK A;  3FFL A;  3Q15 A;  4G24 A;  5LCW J;  4I2Z A;  2J9Q A;  2KCK A;  5HI7 A;  2XGO A;  3MA5 A;  4UI9 J;  4JA9 A;  3ZPJ A;  5EKQ D;  3TGO A;  2OND A;  3FWV A;  4H7Y A;  5A7D B;  3S7D A;  3TG4 A;  4N5C A;  4UQY A;  4NRH B;  3ZHE B;  3EDT B;  3QDN A;  3MV3 B;  3QKY A;  4YVQ C;  5ARF A;  4A1S A;  3ZN3 A;  4GYW A;  3CEQ A;  4AM9 A;  2UWJ G;  2PQR A;  2Y4T A;  3CK8 A;  4NQ0 A;  1B89 A;  1KLX A;  3GZ2 A;  4HOQ A;  4KBQ A;  2Q7F A;  2NC9 A;  5FJY A;  4AIF A;  2VGX A;  3WXX A;  2P58 C;  4GA1 A;  3Q49 B;  4HOR A;  2HR2 A;  4N2Q A;  3QOU A;  5FTP A;  3CVL A;  4HOU A;  2YQ8 A;  2V5F A;  3PDN A;  4J8E A;  3MKR A;  1Y8M A;  5HQ8 A;  4GZ3 A;  2WPV A;  5CCM A;  5AYW D;  3KAE A;  1OUV A; 
#chains in the Genus database with same CATH topology
 3S2A A;  5D66 A;  2R05 A;  3HXE A;  4IYP A;  4B94 A;  3HXC A;  4F7A A;  2FI7 A;  3UMV A;  2E0I A;  3Q47 B;  5E75 A;  4JEU A;  3RO3 A;  2B6C A;  5AIJ A;  3RKV A;  5HS0 A;  1IXV A;  3VLD A;  5KNH D;  5AQA A;  1WAO 1;  2QYU A;  3ULY A;  2J08 A;  2KAT A;  3ZVV A;  5FZR A;  2WXP A;  1INZ A;  2QYJ A;  1LD7 A;  3FTV A;  3DPY A;  1ELW A;  4LNB A;  4ATZ D;  4Z68 A;  5BV0 A;  2CHZ A;  3UM3 A;  4YDE A;  2Y69 E;  4U0Z A;  2UY1 B;  4WWO A;  1NA0 A;  1FT2 A;  3CVX A;  5KJL A;  2GRQ B;  1NZN A;  1HZ4 A;  3UIO C;  1OWL A;  3JQ1 A;  3E4B A;  1TJC A;  1IKN D;  3B95 A;  3OXF A;  2I2O A;  3TWQ A;  2JEK A;  5JJT A;  5G55 A;  5LCW C;  3MJW A;  4WAF A;  2MYO A;  2KCV A;  2IF4 A;  5KWD A;  3DSV A;  1OWP A;  2OCC E;  3LY9 A;  5B1B E;  5LP0 A;  5AN8 A;  3B7S A;  5ENQ D;  5B1A E;  2YHE A;  3TJP A;  1MX4 A;  3R7R A;  4WWP A;  2KZT A;  4DUI A;  3AAA C;  2EIN E;  4H7X A;  3PH0 C;  3D3M A;  3NB2 A;  2DVW A;  2WVI A;  4C0E A;  3CVW A;  3DXM G;  5EX3 A;  2ETA A;  3CKC A;  2VSY A;  1MJ0 A;  4GA2 A;  3LJN A;  1QBQ A;  3SQV A;  3IEG A;  4WND A;  2Y1L E;  3R9M A;  3UKR G;  4N3C A;  2R17 C;  2ZXW E;  2P9K G;  3CK7 A;  4AY5 A;  2OVB A;  4AVX A;  4I1M A;  2IO2 C;  3ONL A;  2XPI A;  2KBX A;  4CYM D;  2E2E A;  4K5B A;  3CVQ A;  4U0U A;  2X6F A;  1H2V C;  5FWQ A;  3EHM A;  4LRZ A;  3SGH A;  4DX2 A;  1KT0 A;  4RG6 A;  3N71 A;  5J08 A;  4TV3 A;  4EBA G;  4HRM B;  3FY4 A;  4WUY A;  1TEZ A;  4MS6 A;  3CST A;  2IJG X;  3HYM B;  1YYH A;  4PS8 A;  2XRY A;  3ESK A;  2BTD A;  3UI2 A;  1UG3 A;  3CVY A;  3ZEF A;  4IUL A;  5BUZ A;  4IN3 B;  3MGB A;  4A55 A;  1D8D A;  2QC9 A;  4APO A;  1HU3 A;  5FQ6 A;  2X6K A;  4CGW A;  1BPO A;  3LJ3 A;  4ANW A;  3CVU A;  3PZ1 A;  4J8F A;  1SA5 A;  3HG0 D;  2I6H A;  2IFU A;  3LVR E;  4WNF A;  4DLQ A;  2CG2 A;  5DIZ A;  4UUC A;  2PL2 A;  3Q78 A;  2VSN A;  4CDN A;  4MKT A;  4L7T A;  4FU3 A;  4MBG A;  3JXJ A;  2BUG A;  1TR4 A;  3KD7 A;  3ULE G;  2AXV A;  3QB2 A;  2WXJ A;  5D0Q D;  4B89 A;  3CHM A;  4NIK A;  4HOT A;  4N39 A;  3ONK A;  3IHV A;  3CVN A;  3PE3 A;  4U63 A;  5ENR D;  4CDM A;  3AJI A;  4RVB A;  1FCH A;  5LOZ A;  1UN8 A;  1HE8 A;  2YIN A;  5G05 C;  4XKC A;  2GRR B;  3UQ3 A;  2R03 A;  4OVU A;  2WXI A;  3NF1 A;  4J8S A;  3GZS A;  3ABL E;  2L0T B;  4FJY A;  4BEP A;  4GZ6 A;  3R9A B;  3GW4 A;  3L16 A;  1S63 A;  3T9K A;  2A5E A;  2HYZ A;  3AU5 A;  4HI8 A;  3WG7 E;  3DSU A;  3ML8 A;  1H6P A;  3HIZ A;  2RG8 A;  5FIN A;  3DEO A;  3FUJ A;  3FEX A;  1IQU A;  4TXR A;  3DST A;  5FIO A;  4TXQ A;  1MZC A;  4LCT A;  4JA9 A;  4UI9 J;  3ZPJ A;  2X6I A;  5EDS A;  2OND A;  3KEZ A;  1N0R A;  5A7D B;  1KPS B;  1K1B A;  5CED B;  3QDN A;  2ZIS A;  1H6K A;  5ANR A;  1JPL A;  5CBN A;  4GYW A;  3CEQ A;  4Q96 A;  2GRO B;  3CHS A;  3U64 A;  1X5B A;  2V0P A;  1N9A A;  3GZ2 A;  5FJY A;  3ZW3 A;  4HOR A;  3SBT B;  3QOU A;  3CVL A;  4HOU A;  4I6G A;  4C48 B;  4YDW A;  3SNX A;  1N4P A;  1Y8M A;  4O60 A;  2WPV A;  1TYQ G;  3ZYQ A;  3CHO A;  3RSE G;  3IKO B;  3APC A;  4HNA D;  4JHJ A;  1OUV A;  1KT1 A;  4C9B B;  1MHQ A;  4KXK B;  2AJA A;  5G04 J;  1E7U A;  2KC7 A;  1MYO A;  3VLF A;  2X6J A;  3TWV A;  1N0Q A;  3IV0 A;  4GZD A;  3VTX A;  5CRU A;  3G2S A;  1OWO A;  3PE4 A;  4XKB A;  4D10 C;  4I9E A;  4N3B A;  2VQ2 A;  2C2L A;  5BPP A;  2JLB A;  3BG0 B;  2EIL E;  4J8Y A;  4HLE A;  2LO6 A;  4F1P A;  5ENP D;  4ACL A;  3FTY A;  4U07 A;  4GA0 A;  5AJL A;  3I5P A;  4HS2 A;  1U3D A;  1QZ2 A;  1O1T A;  4YDO A;  3DPD A;  3PZD A;  4HBD A;  3RO2 A;  3U4T A;  3TWX A;  1IQR A;  3ZKJ A;  3APF A;  4M3O A;  4KMO A;  3BQO A;  3AS5 A;  2H6G A;  5KCM A;  3C3Q A;  4XE0 A;  4GCN A;  1H2U A;  2J49 A;  5EID A;  2L6B A;  4HQD A;  4BX8 A;  3AS8 A;  2DCP A;  3PNL B;  3EU5 A;  3NZS A;  4L2Y A;  2VYI A;  3UM1 A;  1SW6 A;  3ZHE A;  3FU5 A;  4JC8 A;  3QAR A;  4GZ5 A;  1KZO A;  2VGX B;  2RFA A;  2IOL A;  3PZ3 A;  3MYV A;  4G2V A;  1E8Z A;  3AU4 A;  3RRU A;  4N3A A;  3P1U A;  4O1P A;  2ZIR A;  2OOE A;  4KT6 B;  3LVQ E;  2AW6 A;  4B93 B;  5FQ4 A;  3CR3 A;  2R2L A;  3TWT A;  3ULQ A;  1EPU A;  1LF8 A;  5T8I A;  1SA4 A;  4ATG A;  2C0M A;  4EBA A;  5CMY A;  1K3Z D;  4UWF A;  1BLX B;  3ZFW A;  4GYY A;  2XCB A;  1K1A A;  2WMN A;  1ZU2 A;  3D9I A;  5E76 A;  1AWC B;  3MZL B;  4GML A;  5ENT D;  4EQF A;  3QWV A;  3G2U A;  3FH7 A;  3W9F A;  4GMJ A;  3SFX A;  4K5C A;  5ENO D;  2FBN A;  4IRU A;  2WXN A;  4PS3 A;  1IYG A;  2XHE A;  2OEV A;  2P9S G;  1NI1 A;  3NOG D;  4GPK A;  3FUK A;  4J0U A;  2PQN A;  3I3N A;  2PNN A;  4JEH A;  4G23 A;  3SZ7 A;  4GZC A;  3DSW A;  1JWG A;  3UKU G;  2LAI A;  4JHK A;  1BI8 B;  5A23 A;  2ZU6 B;  1A5E A;  3AG3 E;  4GMR A;  2ETC A;  4XI9 A;  2DWZ A;  3RIB A;  2DBA A;  3T8K A;  5FZQ A;  1ELK A;  3PEU B;  4GTT A;  4I43 A;  5H7P A;  3EJN A;  2OEW A;  3ABK E;  4JD2 G;  4AOF A;  3T5X A;  3CQC B;  1AP7 A;  5AAO A;  4F3V A;  2PM7 A;  3LCA A;  2LSU A;  3UT4 A;  3NQP A;  3CV0 A;  3FUD A;  5AQB A;  2B0O E;  2AWI A;  1N54 A;  4TRQ A;  2X38 A;  2PM6 A;  4PUC A;  3PS6 A;  1Z3X A;  4FA6 A;  3R7Q A;  4U96 D;  4JPS A;  4RSY A;  3UT8 A;  4DX5 D;  1E96 B;  4UWL A;  4PS7 A;  4R7L A;  2WXM A;  3PNT B;  5C2Y A;  2LNI A;  3ASH A;  2AXZ A;  1FPP A;  3LPZ A;  5CER B;  3Q75 A;  1HXI A;  4AY6 A;  4P29 A;  5AQ9 A;  3S7B A;  2I1K A;  1QNF A;  3MX3 A;  3ZNG A;  2Y3A A;  3RRN B;  2M63 A;  3KSL A;  3ZUV B;  2F8Y A;  4ILG A;  5ARG A;  3PZ4 A;  3J5Q B;  2XRZ A;  2RKK A;  4U7E B;  3CVV A;  4OYS A;  3DSX A;  5CMW A;  2P9L G;  4QQI A;  3D9N A;  1TN7 A;  4LG6 A;  3ZRH A;  4A63 B;  3E32 A;  4XEI G;  4F6R D;  2JAB A;  2J4D A;  3TWS A;  2R59 A;  4BES A;  5LCW J;  4PH4 B;  2XZD G;  1H2T C;  4ACK A;  4I2Z A;  4K5A B;  4Q69 A;  3Q9U C;  2XGO A;  2OVF A;  3EUV A;  3QK0 A;  1N94 A;  5EKQ D;  3RK6 A;  1TN8 A;  3S7D A;  5BV1 A;  4GTR A;  4NRH B;  3ZHE B;  1SVX A;  3E30 A;  4APF A;  3HXF A;  4FHJ A;  5LFA A;  2VTB A;  4AM9 A;  2UWJ G;  1BU9 A;  1B89 A;  1VDY A;  4AIF A;  2VGX A;  3L9T A;  2BF0 X;  4JXT A;  2IEJ A;  3FTZ A;  4J6I A;  2KXP C;  3ASN E;  1MQS A;  2A5U A;  3PDN A;  4NUR A;  4ANV A;  4AP2 A;  5ITZ F;  4DK5 A;  2VSO E;  5CCM A;  4L1B A;  3C98 A;  2XS1 A;  3AG1 E;  3UM0 A;  4V3I A;  2CFU A;  3CIA A;  4LNG A;  4Y6W A;  3HXB A;  1TNY A;  2XS8 A;  3ENE A;  3DRA A;  5KJM A;  5T3R A;  5BXU A;  3SFY A;  4MRU A;  3EIJ A;  4ANX A;  4ILI A;  4ME2 A;  3U9W A;  1MX2 A;  4EHM A;  1A17 A;  3BUA A;  3CK9 A;  5EIL A;  3LKU A;  3D9O A;  3AG4 E;  3NAW A;  3PEV B;  2NXP A;  3HRA A;  3JQ0 A;  3UUX A;  3HVE A;  3L08 A;  4G8L A;  1FVF A;  5EX0 A;  1TNO A;  4AEZ C;  5JJ6 A;  3FHE A;  2DYR E;  3APD A;  2X3M A;  2XGS A;  4K03 A;  3ISM C;  1K8K G;  2XEH A;  1SZA A;  3FUF A;  3EIQ C;  4GTO A;  3S7J A;  2BED A;  3UIP C;  1O5M A;  1Q2Z A;  3FUM A;  3ZIM A;  1OXJ A;  2WXK A;  3X2Q E;  4BT8 A;  3SO8 A;  2LUH A;  1N11 A;  1E8Y A;  3B7U X;  2NYJ A;  3OXG A;  4JVS A;  3LYA A;  4L2L A;  3C72 A;  4M7C A;  1V54 E;  4C0M A;  2QFC A;  1BD8 A;  4XI0 A;  4CT4 A;  3PUJ A;  2HE0 A;  5AEN A;  3FU0 A;  5BW8 C;  5CRV A;  1RZ4 A;  3LY8 A;  3FTU A;  1HF8 A;  3QWP A;  3TWU A;  4XX5 A;  1HS6 A;  3CVP A;  3OXL A;  5AQ7 A;  3SBS A;  2R02 A;  3OTN A;  2GRL A;  4U8H A;  3DWL G;  1JUQ A;  3EU9 A;  3ASO E;  2NSZ A;  1Z6T A;  2J07 A;  4GTP A;  3RJV A;  2J09 A;  4HI9 A;  2I1J A;  3D9K A;  3HDX A;  3RU0 A;  3JCK C;  2XEE A;  2WM9 A;  4TUM A;  4HB5 A;  4JW1 A;  1W3B A;  3D9J A;  4G1T A;  3AS4 A;  3FTW A;  4K0R A;  3C3O A;  5BNW A;  4UQX A;  3UT7 A;  5G05 J;  1E8W A;  2IQC A;  1IHB A;  5KNG A;  4I1A A;  1HG5 A;  1V55 E;  3ZYM A;  3J5P A;  1Z5S C;  2XCC A;  2P9P G;  3UXG A;  5CCL A;  4LUN U;  1TNB A;  1H0A A;  5CEA A;  2FO7 A;  1D8E A;  3V2O A;  5T4Y A;  4OAU C;  4I17 A;  3QNK A;  2QY7 A;  2VJ8 A;  4YDY A;  2XPY A;  4DX6 D;  1E8X A;  4E6H A;  2IO3 C;  4DX1 A;  1S64 A;  2WXO A;  2I9C A;  4LNU D;  4BWR A;  4DX7 D;  2WXQ A;  3FEY A;  1OY3 D;  2AVP A;  3CQG B;  3SD5 A;  4ZFH A;  1NA3 A;  4U95 D;  1H6O A;  1YA0 A;  5EYL A;  2V4L A;  3B13 A;  3DBS A;  4A3T A;  2YHC A;  5JJ7 A;  4FP7 A;  1OCC E;  4JZY A;  2OV8 A;  3T5V A;  3CLJ A;  1WY6 A;  1MX6 A;  4G25 A;  4UWH A;  4FC8 A;  4A1G A;  4TXP A;  2VGY A;  5KJK A;  2VTB B;  2MOW A;  2F0Y A;  2WMO A;  2DIW A;  3QAQ A;  3ZU7 B;  1OT8 A;  1L5J A;  4G26 A;  3LEW A;  5JA4 D;  2WXR A;  1TN6 A;  4UI9 K;  4N5Q A;  1EDU A;  1IHG A;  1JCQ A;  5B3S E;  2YNQ A;  2WXG A;  3SHF A;  4X8Q A;  3K9I A;  4AJW A;  3Q7F A;  3D9L A;  5JHB A;  3LXU X;  5FQ7 A;  5CEC B;  5FT9 A;  3ZXP A;  3NZU A;  3E37 A;  3GZ1 A;  3MV2 B;  3PUK A;  3LY7 A;  2CFZ A;  3VLE A;  4GCO A;  2FF4 A;  5EYP F;  3ZGQ A;  2J4B A;  2VSX E;  5ENS D;  3V30 A;  3KS2 A;  3UTM A;  3GYZ A;  5FZS A;  3AG2 E;  5M72 A;  3BU8 A;  4LER A;  1BI7 B;  3DEP A;  4PDX A;  4HFG A;  2IU1 A;  4GTV A;  2RFM A;  3HVE B;  1ZBP A;  4ABN A;  2PZI A;  2XGM A;  2LXL A;  4BSX A;  4BT9 A;  3VTY A;  1OCZ E;  4MLP A;  2F37 A;  1EF1 C;  3FP3 A;  1ELR A;  3ZYL A;  2LSV A;  3Q7A A;  3D9M A;  3EHN A;  2MHK A;  2QZA A;  3FFL A;  1O1S A;  2V5Q C;  3FUI A;  3Q15 A;  1U3C A;  2GGF A;  1Z3Y A;  4HRN A;  2RD0 A;  1EYH A;  4FLH A;  2H6F A;  1ZB1 A;  3FH5 A;  2CHX A;  1UJJ A;  2J9Q A;  5HI7 A;  1O1R A;  3MA5 A;  3TGO A;  5BXO A;  4H7Y A;  4DPR A;  3HXD A;  3I4G A;  4L9P A;  3RRM B;  3EDT B;  1S70 B;  3MV3 B;  3QKY A;  1OCR E;  4A1S A;  3IXE A;  3HHM A;  1N95 A;  1UOH A;  3G2T A;  5IY5 E;  3MKQ B;  3CK8 A;  3PZ2 A;  4NQ0 A;  1SQM A;  4KBQ A;  2Q7F A;  5HKP A;  3PRE A;  4HLL A;  3IHY A;  3TL5 A;  3Q49 B;  5LX8 A;  2X6H A;  2HR2 A;  4FUL A;  1LTX A;  3T8M A;  1H19 A;  3ABM E;  4J7W A;  3FUN A;  4J8E A;  3MKR A;  3CHP A;  4GZ3 A;  1N4Q A;  1QYM A;  4I6E A;  2IY0 C;  5AYW D;  3KAE A;  1D9S A;  3ASG A;  2CHW A;  5CHE E;  3Q4A B;  2WXH A;  4I6J A;  1HG2 A;  3FUE A;  1N4S A;  4UWG A;  3FU6 A;  4QFV A;  2C0L A;  4CRW A;  3C3R A;  2KCL A;  1X81 A;  4ANU A;  4EZJ A;  3EHR A;  1QQE A;  3L22 A;  4BTA A;  3DXK G;  1XGW A;  3SF4 A;  5KBA A;  2WQH A;  4RLY A;  4BX9 A;  2KM4 A;  1DC2 A;  3B7B A;  2Y0B G;  3CGH A;  3L17 A;  2A4Z A;  3SY2 A;  3CSF A;  1PAQ A;  1E90 A;  1DCE A;  5DBK A;  4CZ2 D;  1PC2 A;  1U2V G;  1WG0 A;  3EHQ A;  3QC1 A;  3ESL A;  4RG9 A;  2WQ6 A;  3UM2 A;  1PY1 A;  2BKG A;  4OAV B;  4BET A;  4GTS A;  5ENN A;  5ANL A;  2H6I A;  2GW1 A;  5A6C A;  2EIK E;  2XPZ A;  4U8V D;  4DI4 A;  2L6J A;  4Q94 A;  2F8X K;  4JA7 A;  3LS8 A;  5J90 A;  4Y6C A;  4WNE A;  4AV7 A;  4XZ4 A;  3JUI A;  4GYO A;  4FLB A;  2R5S A;  4I2W A;  3MCX A;  4N2S A;  3E34 A;  3UPV A;  4HOS A;  4RQI A;  3FTS A;  4CDR A;  1HFA A;  3B7T A;  4UI9 C;  4EZK A;  3TXM A;  4FAD A;  1G3N B;  1FVH A;  2HM8 A;  3Q5M A;  4GAA A;  2ION A;  1SZ9 A;  2LXM A;  2GRM A;  3URZ A;  4CCA A;  3NOC D;  4CGV A;  4F1S A;  2ZGD A;  3LDZ A;  3RAU A;  1DVP A;  3I4R B;  3FDH A;  4BTB A;  1UN9 A;  3TXN A;  3B7R L;  2XZT G;  3UX4 A;  4GU5 A;  4LEU A;  2EIJ E;  2FEZ A;  4U8Y D;  3MEK A;  4DI3 A;  4UWK A;  4OVV A;  4J8D A;  1E7V A;  2XEV A;  4YVO A;  1N52 A;  4G11 A;  4BSZ B;  4URK A;  3FTX A;  2GRN B;  4HXI A;  1DCQ A;  4KYO B;  2FO1 E;  5CBO A;  5G04 C;  4WWN A;  3JUE A;  4JL0 A;  1OWM A;  2P9N G;  4U0S A;  5G2N A;  5D0O D;  4W9R A;  1RW2 A;  1N4R A;  2FUL A;  4UQZ A;  3S7F A;  5BT1 A;  2ILR A;  3BEE A;  3ASD A;  3TWR A;  2ETB A;  3W9G A;  3QWW A;  1HX8 A;  1DNP A;  2IOS A;  3NBN B;  4BY6 A;  3L6A A;  4GPM A;  3OAW A;  5AAR A;  4EEC A;  3F6Q A;  5C1D A;  3TG5 A;  1YCS B;  4DJA A;  2UY1 A;  4KZ0 A;  4JHR A;  1LD8 A;  5KJN A;  2DYS E;  2BKK B;  3CKB A;  4B8A A;  1JCS A;  4I9C A;  3UIN C;  2GRP B;  1FT1 A;  2XEN A;  1YMP A;  1TNU A;  3FH8 A;  2J8S D;  5JHA A;  4U04 A;  3L54 A;  3G2V A;  4HVB A;  2EIM E;  3U3W A;  4DLO A;  1HO8 A;  3MKQ A;  2KZT B;  3JXI A;  3SFZ A;  4A3V A;  4CT0 A;  4BER A;  1KZP A;  2MRI A;  4KZC A;  4LSZ E;  5JMN D;  1UJK A;  3FUL A;  3TAX A;  2DZN A;  4I1O B;  3KEA A;  3KSQ A;  3JYS A;  3D9P A;  3L13 A;  3C5R A;  1S0P A;  2LAH A;  1XNF A;  5D2M C;  3FUH A;  3FU3 A;  3TWW A;  4KVM A;  5EIB E;  1Y6I A;  4GTQ A;  1JCR A;  1OWN A;  1JWF A;  2V4H C;  1UW4 B;  3CHR A;  3ASF A;  4XIF A;  4GB9 A;  3QJZ A;  3SI5 A;  4FJZ A;  2HO1 A;  4F53 A;  3BG1 B;  2VGE A;  1HH8 A;  2XQ0 A;  3U66 A;  4KVO A;  5HRY A;  1WM5 A;  3G2W A;  3ZXS A;  3CHQ A;  4WNG A;  4B8C B;  4O6F A;  2Y4U A;  1NL4 A;  2P2C P;  4EZL A;  1GW6 A;  4ZHB A;  3O48 A;  3PVL A;  4DRX E;  4E85 A;  4JB8 P;  1NFI E;  4AXH A;  3V79 K;  3ZYK A;  4NAC A;  4BFR A;  4FHK A;  3L82 A;  3Q79 A;  1P5Q A;  4YND A;  4GTM A;  2WXF A;  5AJD A;  3PRZ A;  2V8S E;  4HRL A;  4G24 A;  3V31 A;  4ILH B;  3V2X A;  1NP7 A;  2L9B A;  4G8K A;  3P2B A;  2WXL A;  2KCK A;  3IBE A;  2AXU A;  2DZO A;  3FWV A;  4O1O A;  2EQX A;  3TG4 A;  2P9I G;  1WDY A;  4N5C A;  4UQY A;  3ML9 A;  3E33 A;  2WQ7 A;  4CEM A;  4B0Z A;  4YVQ C;  3DSS A;  5ARF A;  5FQ8 A;  3ZN3 A;  2CG3 A;  3O4Z A;  2WB2 A;  1OCO E;  2PQR A;  2Y4T A;  1KLX A;  1TNZ A;  3Q9N C;  4HOQ A;  2L0I A;  2NC9 A;  2H6H A;  3WXX A;  5EN5 D;  2P58 C;  4GA1 A;  2ZGG A;  4L23 A;  4N2Q A;  5FTP A;  3D9H A;  2YQ8 A;  4TUU A;  2V5F A;  3Q73 A;  5HQ8 A;  4EPZ A;  1TJF A;  2P9U G; 
#chains in the Genus database with same CATH homology
 3ASG A;  2CHW A;  3S2A A;  5CHE E;  1KT1 A;  3Q4A B;  4C9B B;  1MHQ A;  2WXH A;  4I6J A;  4KXK B;  4Y6W A;  1HG2 A;  3ENE A;  3FUE A;  4IYP A;  5KJM A;  5T3R A;  4UWG A;  3FU6 A;  4MRU A;  4B94 A;  4QFV A;  5G04 J;  2C0L A;  4F7A A;  1E7U A;  2KC7 A;  4CRW A;  2KCL A;  3EIJ A;  3VLF A;  2X6J A;  4ANX A;  2FI7 A;  4ANU A;  4ILI A;  4ME2 A;  3U9W A;  3UMV A;  4EZJ A;  2E0I A;  3Q47 B;  3IV0 A;  1QQE A;  3L22 A;  4GZD A;  5E75 A;  3VTX A;  4BTA A;  4JEU A;  3RO3 A;  1A17 A;  3CK9 A;  3G2S A;  3RKV A;  5AIJ A;  1OWO A;  3VLD A;  3PE4 A;  1XGW A;  3LKU A;  4XKB A;  1WAO 1;  4D10 C;  3D9O A;  3SF4 A;  4I9E A;  2J08 A;  3PEV B;  2NXP A;  4N3B A;  2KAT A;  2VQ2 A;  2C2L A;  2WQH A;  3JQ0 A;  3UUX A;  2JLB A;  4BX9 A;  3BG0 B;  5BPP A;  2KM4 A;  3ZVV A;  5FZR A;  3HVE A;  3L08 A;  2WXP A;  1FVF A;  5EX0 A;  4AEZ C;  3CGH A;  3FHE A;  5JJ6 A;  4HLE A;  2LO6 A;  1INZ A;  3L17 A;  2A4Z A;  3APD A;  4ACL A;  2X3M A;  2XGS A;  3FTY A;  4K03 A;  4U07 A;  4GA0 A;  5AJL A;  3CSF A;  1PAQ A;  3I5P A;  1E90 A;  3FTV A;  1SZA A;  5DBK A;  3FUF A;  3EIQ C;  1U3D A;  1QZ2 A;  4HS2 A;  1ELW A;  1PC2 A;  3S7J A;  3QC1 A;  3ESL A;  4RG9 A;  2WQ6 A;  3DPD A;  3PZD A;  1PY1 A;  3FUM A;  3ZIM A;  5BV0 A;  3RO2 A;  3U4T A;  2CHZ A;  2WXK A;  5ENN A;  4U0Z A;  2UY1 B;  4BT8 A;  1IQR A;  5ANL A;  4WWO A;  1NA0 A;  3APF A;  3CVX A;  1E8Y A;  2GW1 A;  4M3O A;  3B7U X;  2XPZ A;  5A6C A;  4KMO A;  4DI4 A;  5KJL A;  3OXG A;  3AS5 A;  5KCM A;  4JVS A;  4XE0 A;  3LYA A;  4L2L A;  1NZN A;  2L6J A;  1HZ4 A;  4Q94 A;  4C0M A;  1OWL A;  4JA7 A;  3LS8 A;  4GCN A;  1H2U A;  2J49 A;  2QFC A;  3JQ1 A;  4XI0 A;  5J90 A;  3E4B A;  1TJC A;  4CT4 A;  3PUJ A;  4Y6C A;  4WNE A;  4AV7 A;  5AEN A;  4XZ4 A;  3JUI A;  3FU0 A;  3OXF A;  4GYO A;  2I2O A;  5BW8 C;  2JEK A;  5JJT A;  4FLB A;  4BX8 A;  2R5S A;  3AS8 A;  3LY8 A;  2DCP A;  3FTU A;  1HF8 A;  3QWP A;  4I2W A;  5G55 A;  4XX5 A;  5LCW C;  1HS6 A;  3MCX A;  3CVP A;  3MJW A;  3PNL B;  4WAF A;  3OXL A;  3SBS A;  4N2S A;  2KCV A;  2IF4 A;  3NZS A;  3OTN A;  3UPV A;  4HOS A;  2GRL A;  4U8H A;  4L2Y A;  2VYI A;  1OWP A;  3FTS A;  1JUQ A;  4CDR A;  3LY9 A;  5LP0 A;  2NSZ A;  1Z6T A;  1HFA A;  3B7T A;  4UI9 C;  3ZHE A;  3FU5 A;  2J07 A;  4JC8 A;  3B7S A;  3QAR A;  3RJV A;  2J09 A;  3TXM A;  4EZK A;  2YHE A;  4FAD A;  4GZ5 A;  3TJP A;  2VGX B;  2I1J A;  1FVH A;  2HM8 A;  2IOL A;  3D9K A;  3HDX A;  3MYV A;  4G2V A;  3Q5M A;  4GAA A;  1E8Z A;  3R7R A;  2ION A;  3RU0 A;  3JCK C;  4WWP A;  1SZ9 A;  2KZT A;  3AU4 A;  2GRM A;  4H7X A;  3URZ A;  3RRU A;  3PH0 C;  2WM9 A;  3D3M A;  4N3A A;  4CCA A;  3P1U A;  2WVI A;  4C0E A;  2OOE A;  4KT6 B;  4JW1 A;  1W3B A;  3D9J A;  2AW6 A;  3LVQ E;  5FQ4 A;  3CVW A;  4G1T A;  3CR3 A;  4CGV A;  3AS4 A;  3FTW A;  5EX3 A;  3CKC A;  4K0R A;  3ULQ A;  2VSY A;  3LDZ A;  4F1S A;  1DVP A;  5BNW A;  4UQX A;  3UT7 A;  4GA2 A;  1EPU A;  1E8W A;  1LF8 A;  3I4R B;  5G05 J;  2C0M A;  5T8I A;  3FDH A;  2IQC A;  5CMY A;  4ATG A;  4EBA A;  4BTB A;  4UWF A;  3IEG A;  3ZFW A;  4WND A;  1UN9 A;  3TXN A;  4N3C A;  2R17 C;  3B7R L;  4GYY A;  2XCB A;  4I1A A;  3UX4 A;  4GU5 A;  2WMN A;  4LEU A;  1ZU2 A;  2FEZ A;  1HG5 A;  3MEK A;  4DI3 A;  4UWK A;  3D9I A;  5E76 A;  3ZYM A;  3MZL B;  4GML A;  4OVV A;  4J8D A;  1E7V A;  2XEV A;  4EQF A;  3CK7 A;  1N52 A;  3QWV A;  4G11 A;  2XCC A;  4YVO A;  4AY5 A;  2OVB A;  3G2U A;  4AVX A;  5CCL A;  3FH7 A;  4LUN U;  4URK A;  4GMJ A;  1H0A A;  3FTX A;  4I1M A;  3ONL A;  2XPI A;  2FBN A;  4IRU A;  2FO7 A;  2E2E A;  2WXN A;  4PS3 A;  1IYG A;  5T4Y A;  4HXI A;  2XHE A;  3CVQ A;  4KYO B;  4U0U A;  2X6F A;  1H2V C;  5FWQ A;  3EHM A;  4GPK A;  5G04 C;  4I17 A;  4LRZ A;  4WWN A;  3QNK A;  4JL0 A;  2QY7 A;  2VJ8 A;  2XPY A;  3FUK A;  1OWM A;  4U0S A;  5G2N A;  4J0U A;  5D0O D;  2PQN A;  3I3N A;  4W9R A;  3SGH A;  1E8X A;  4JEH A;  4E6H A;  4G23 A;  1KT0 A;  4RG6 A;  3N71 A;  5J08 A;  4TV3 A;  2WXO A;  3SZ7 A;  4GZC A;  4EBA G;  2FUL A;  3FY4 A;  2I9C A;  4UQZ A;  3S7F A;  1JWG A;  2ILR A;  3BEE A;  4WUY A;  5BT1 A;  3ASD A;  1TEZ A;  4BWR A;  4MS6 A;  3CST A;  2IJG X;  3HYM B;  2LAI A;  2WXQ A;  4PS8 A;  4JHK A;  3QWW A;  1HX8 A;  3FEY A;  1DNP A;  2IOS A;  2AVP A;  3CQG B;  3SD5 A;  4BY6 A;  3L6A A;  2XRY A;  3ESK A;  1NA3 A;  3OAW A;  1YA0 A;  4EEC A;  2BTD A;  1UG3 A;  5A23 A;  2V4L A;  2ZU6 B;  3ZEF A;  4IUL A;  3TG5 A;  5C1D A;  3B13 A;  3CVY A;  5BUZ A;  4IN3 B;  4DJA A;  4XI9 A;  3DBS A;  4A3T A;  2YHC A;  3MGB A;  3RIB A;  5JJ7 A;  2UY1 A;  2DBA A;  4KZ0 A;  4FP7 A;  4JHR A;  5FZQ A;  1ELK A;  4JZY A;  4A55 A;  3PEU B;  4I43 A;  5KJN A;  2OV8 A;  3EJN A;  3T5V A;  3CLJ A;  4B8A A;  3CKB A;  4I9C A;  1WY6 A;  4G25 A;  4UWH A;  4FC8 A;  4AOF A;  4A1G A;  3T5X A;  4APO A;  1HU3 A;  2VGY A;  5KJK A;  3CQC B;  5FQ6 A;  2VTB B;  2X6K A;  4CGW A;  2MOW A;  1BPO A;  3FH8 A;  3LJ3 A;  4F3V A;  2WMO A;  4ANW A;  2DIW A;  3QAQ A;  4U04 A;  5JHA A;  2PM7 A;  3L54 A;  3LCA A;  3G2V A;  2LSU A;  3UT4 A;  3CVU A;  4J8F A;  1L5J A;  4HVB A;  3NQP A;  3U3W A;  4G26 A;  4DLO A;  3CV0 A;  3FUD A;  2I6H A;  2IFU A;  3LEW A;  3LVR E;  4WNF A;  2AWI A;  2WXR A;  4DLQ A;  2CG2 A;  5DIZ A;  4UI9 K;  1EDU A;  1N54 A;  2PL2 A;  1HO8 A;  1IHG A;  2VSN A;  4TRQ A;  3MKQ A;  4CDN A;  2X38 A;  2PM6 A;  2KZT B;  4MKT A;  2YNQ A;  4PUC A;  4L7T A;  2WXG A;  3SHF A;  3SFZ A;  4A3V A;  3K9I A;  4CT0 A;  3PS6 A;  4AJW A;  4FU3 A;  1Z3X A;  2MRI A;  3D9L A;  4FA6 A;  5JHB A;  4KZC A;  3LXU X;  2BUG A;  5FQ7 A;  1UJK A;  5FT9 A;  3R7Q A;  3FUL A;  3TAX A;  3NZU A;  3KD7 A;  4JPS A;  4RSY A;  4I1O B;  2AXV A;  3GZ1 A;  3QB2 A;  3MV2 B;  3UT8 A;  3PUK A;  3LY7 A;  2CFZ A;  2WXJ A;  3VLE A;  3JYS A;  4GCO A;  5D0Q D;  3D9P A;  2FF4 A;  4B89 A;  3L13 A;  3CHM A;  1S0P A;  4HOT A;  1E96 B;  3ZGQ A;  2LAH A;  4UWL A;  1XNF A;  2J4B A;  4N39 A;  4PS7 A;  2VSX E;  3FUH A;  3ONK A;  2WXM A;  3IHV A;  4R7L A;  3KS2 A;  3PNT B;  5C2Y A;  2LNI A;  3ASH A;  3CVN A;  3GYZ A;  3FU3 A;  2AXZ A;  3PE3 A;  4U63 A;  4KVM A;  1Y6I A;  4CDM A;  5FZS A;  3LPZ A;  1OWN A;  1JWF A;  4RVB A;  1UW4 B;  3CHR A;  3ASF A;  5M72 A;  1HXI A;  4XIF A;  1FCH A;  5LOZ A;  4AY6 A;  1UN8 A;  4GB9 A;  1HE8 A;  4LER A;  3QJZ A;  3SI5 A;  4FJZ A;  4P29 A;  4PDX A;  2YIN A;  2HO1 A;  5G05 C;  4HFG A;  3S7B A;  2IU1 A;  3BG1 B;  4F53 A;  4XKC A;  2I1K A;  1HH8 A;  1QNF A;  2XQ0 A;  3MX3 A;  3U66 A;  4KVO A;  3UQ3 A;  2Y3A A;  3HVE B;  1WM5 A;  1ZBP A;  3G2W A;  4OVU A;  3RRN B;  2M63 A;  2WXI A;  3ZXS A;  4ABN A;  3NF1 A;  2PZI A;  4J8S A;  2XGM A;  3CHQ A;  3GZS A;  4WNG A;  4B8C B;  4O6F A;  2Y4U A;  4BSX A;  4ILG A;  2L0T B;  5ARG A;  4EZL A;  1GW6 A;  4FJY A;  3O48 A;  3PVL A;  2XRZ A;  4BT9 A;  3VTY A;  4E85 A;  4MLP A;  4GZ6 A;  1EF1 C;  3FP3 A;  1ELR A;  3R9A B;  3CVV A;  4AXH A;  3GW4 A;  3ZYL A;  3ZYK A;  4OYS A;  4NAC A;  3L16 A;  4FHK A;  4BFR A;  5CMW A;  3AU5 A;  2HYZ A;  2LSV A;  1P5Q A;  3D9M A;  3D9N A;  3EHN A;  4YND A;  2MHK A;  3FFL A;  2WXF A;  5AJD A;  3ZRH A;  3FUI A;  3ML8 A;  3Q15 A;  3PRZ A;  1U3C A;  2V8S E;  2GGF A;  1Z3Y A;  2J4D A;  2R59 A;  3HIZ A;  4G24 A;  5LCW J;  2RD0 A;  4PH4 B;  1EYH A;  2RG8 A;  4FLH A;  4ILH B;  1H2T C;  4ACK A;  1NP7 A;  2L9B A;  4I2Z A;  3FUJ A;  3FEX A;  1IQU A;  3FH5 A;  2CHX A;  3P2B A;  1UJJ A;  2J9Q A;  4Q69 A;  2WXL A;  2KCK A;  5HI7 A;  2XGO A;  2OVF A;  3MA5 A;  3IBE A;  4UI9 J;  4LCT A;  2AXU A;  4JA9 A;  3QK0 A;  3ZPJ A;  2X6I A;  5EKQ D;  5EDS A;  3TGO A;  2OND A;  3FWV A;  3RK6 A;  3KEZ A;  2EQX A;  4H7Y A;  5A7D B;  3S7D A;  3TG4 A;  4DPR A;  5BV1 A;  3I4G A;  4N5C A;  4UQY A;  3ML9 A;  4NRH B;  3RRM B;  2WQ7 A;  4CEM A;  3ZHE B;  3EDT B;  3QDN A;  4B0Z A;  4APF A;  3MV3 B;  1H6K A;  3QKY A;  5ANR A;  1JPL A;  4FHJ A;  4YVQ C;  5ARF A;  4A1S A;  5LFA A;  5FQ8 A;  3ZN3 A;  4GYW A;  3CEQ A;  4Q96 A;  3HHM A;  2CG3 A;  2VTB A;  3CHS A;  3O4Z A;  3U64 A;  1X5B A;  2WB2 A;  4AM9 A;  2UWJ G;  2PQR A;  2V0P A;  2Y4T A;  3G2T A;  3MKQ B;  3CK8 A;  1B89 A;  1KLX A;  1VDY A;  4NQ0 A;  3GZ2 A;  1SQM A;  4HOQ A;  4KBQ A;  2Q7F A;  2L0I A;  2NC9 A;  5FJY A;  4AIF A;  2VGX A;  3PRE A;  2BF0 X;  4JXT A;  3WXX A;  2P58 C;  4GA1 A;  3IHY A;  3FTZ A;  3TL5 A;  3Q49 B;  4J6I A;  5LX8 A;  3ZW3 A;  2X6H A;  2HR2 A;  4HOR A;  4FUL A;  4L23 A;  3SBT B;  4N2Q A;  3QOU A;  5FTP A;  3CVL A;  3T8M A;  1H19 A;  4HOU A;  2YQ8 A;  4I6G A;  3FUN A;  4TUU A;  2V5F A;  1MQS A;  2A5U A;  3PDN A;  4J8E A;  3MKR A;  4NUR A;  3SNX A;  4ANV A;  1Y8M A;  4AP2 A;  4DK5 A;  3CHP A;  4EPZ A;  5HQ8 A;  4GZ3 A;  2WPV A;  2VSO E;  5CCM A;  4L1B A;  3ZYQ A;  1TJF A;  3C98 A;  3CHO A;  3IKO B;  4I6E A;  3APC A;  4V3I A;  2CFU A;  3CIA A;  4JHJ A;  5AYW D;  3KAE A;  1OUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...