3URZA

Crystal structure of a putative protein binding protein (bacova_03105) from bacteroides ovatus atcc 8483 at 2.19 a resolution
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
205
structure length
201
Chain Sequence
b'SVDEMLQKVSAAIEAGQNGQAVSYFRQTIALNIDRTEMYYWTNVDKNSEISSKLATELALAYKKNRNYDKAYLFYKELLQKAPNNVDLEACAEMQVCRGQEKDALRMYEKILQLEADNLAANIFLGNYYYLTAEQEKKKLETDYKSPTKMQYARYRDGLSKLFTTRYEKARNSLQKVILRFPSTEAQKTLDKILRIEKEVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BACOVA_03105) from Bacteroides ovatus ATCC 8483 at 2.19 A resolution
rcsb
molecule keywords Uncharacterized protein
source organism Bacteroides ovatus
molecule tags Protein binding
total genus 70
structure length 201
sequence length 205
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3urzA00
4BTAA 5JJTA 1PC2A 2V5FA 4CGWA 2WQHA 4O6FA 3CVPA 4ABNA 5LCWC 4WNDA 2YQ8A 4HOSA 3S7FA 5CCLA 3E4BA 3KS2A 2XCBA 3RO3A 2UY1B 5G04J 1FCHA 1E96B 3S7DA 3CVNA 1HXIA 4KBQA 3MKRA 4GYWA 3LY7A 3PE3A 1KLXA 3AS4A 5FTPA 5AYWD 3Q49B 1Y8MA 5KJLA 3CKBA 3QDNA 4UQXA 3CK7A 3AS8A 1NZNA 1XNFA 2FO7A 4WNFA 3K9IA 3CK9A 5KJNA 4I9CA 4Y6CA 2QFCA 3NF1A 4YVOA 5HQ8A 4LEUA 4AIFA 3OXGA 4G24A 2YHCA 1KT0A 3QWWA 5BNWA 2FF4A 3GZ1A 5G05C 4NQ0A 5M72A 5ARGA 4XI0A 4BTBA 3ULQA 5JJ7A 3TG4A 1TJCA 3MV3B 4UQZA 2XCCA 4GCOA 3OXFA 4GZ5A 4I1AA 2PQNA 4N5CA 3IEGA 2PZIA 2C0MA 3ASFA 2KCLA 3SF4A 4RG9A 2WPVA 3CK8A 4AY6A 3URZA 4W9RA 2XPIA 3U3WA 3ESKA 4GZ3A 2KCVA 4CDRA 3ZPJA 2J9QA 1W3BA 3EDTB 2JLBA 3KD7A 3RKVA 2OOEA 4UI9J 2UWJG 1ZBPA 3FP3A 3JYSA 4U0ZA 4CGVA 4XI9A 4AM9A 4I2ZA 1YA0A 5A6CA 3MV2B 1NA3A 2E2EA 5FJYA 5KJKA 5HI7A 4YVQC 2VSYA 5KJMA 2DBAA 4H7XA 3ZHEA 3BEEA 3TAXA 5ARFA 4APOA 5BW8C 1HH8A 1WM5A 3LY9A 3PDNA 3ASGA 1ELWA 4ME2A 4GPKA 2FBNA 1OUVA 2KC7A 3RO2A 4J8EA 4Y6WA 4RG6A 4IN3B 2NC9A 5D0QD 4N39A 4HOUA 1ELRA 1WAO1 4WNEA 5EX0A 3LCAA 5FZQA 1A17A 2ONDA 4HORA 5G05J 4WUYA 5CHEE 3UPVA 5BT1A 2VYIA 2PQRA 3N71A 2LSUA 3CV0A 2XEVA 5FZSA 2KCKA 2XGSA 4U0SA 5A7DB 4G25A 5JJ6A 3R9AB 4G2VA 4I2WA 2C2LA 3Q4AB 3CKCA 3FFLA 3MA5A 2IFUA 2XGOA 4J8FA 2L6JA 2Y4UA 2LNIA 2HYZA 4GA0A 2Y4TA 4H7YA 3CEQA 1P5QA 2IF4A 1KT1A 4EQFA 2HO1A 4N2SA 4N3BA 4I17A 4GA2A 4N3AA 4A1SA 5LCWJ 3RU0A 5DIZA 3O48A 3ASHA 3TG5A 3VTYA 5FZRA 3LY8A 2VGXA 4UI9C 5CCMA 3S7JA 1ZU2A 2VQ2A 4KXKB 5G04C 4GYYA 3SZ7A 2UY1A 3ZHEB 4HOTA 2I6HA 4J0UA 4N2QA 4G26A 3ZGQA 4WNGA 2P58C 2MHKA 3FWVA 3RIBA 2AVPA 1IYGA 3GYZA 4YNDA 4NRHB 4B94A 4BT8A 1B89A 2FEZA 3GW4A 2GW1A 4U0UA 3UQ3A 4XIFA 4J8DA 3ASDA 3KAEA 5D0OD 3U4TA 4I9EA 4JL0A 4HOQA 4UI9K 1HZ4A 5DBKA 4KYOB 2VSNA 4JA9A 5EX3A 2BUGA 4G23A 1QQEA 3CVLA 3LPZA 4U04A 4JA7A 3LKUA 3QWVA 4GZ6A 4BWRA 5EKQD 2R5SA 3VTXA 2XGMA 1QZ2A 5C1DA 4N3CA 2C0LA 1IHGA 2PL2A 3UUXA 3ZN3A 3QKYA 1NA0A 3AS5A 3CVQA 3LYAA 4UQYA 4U07A 5FT9A 3Q47B 4GCNA 2Q7FA 3Q5MA 3TGOA 4BT9A 4JHRA 4GA1A 2VGYA 3S7BA 3GZ2A 4F3VA 3Q15A 3HYMB 3QOUA 2FI7A 2HR2A 3PE4A 3QWPA 4G1TA 4AY5A 4GYOA 2KATA 3RJVA 3WXXA 3ZFWA 3MEKA 3OXLA 2LSVA 2VGXB
chains in the Genus database with same CATH superfamily
3CQCB 5JJTA 2ZISA 1EYHA 4ACLA 5AAOA 1IHBA 3CVPA 3R7RA 4ABNA 4HOSA 5CRVA 4O60A 1E8ZA 4TXRA 1E7VA 2YNQA 5KBAA 4HBDA 3PNTB 1UOHA 4FHJA 5G04J 2JABA 1FCHA 3EIQC 5EIBE 1K1AA 3Q75A 3RAUA 1KZOA 2IONA 3MKRA 3T5VA 2WXIA 3L16A 3FUKA 3DSXA 3CSFA 5AYWD 3Q49B 3C98A 1Y8MA 3NB2A 3CKBA 3FHEA 2PM6A 2KM4A 2H6GA 4FP7A 2XS8A 4APFA 5KJNA 4I9CA 4YDYA 5IY5E 4NACA 5D66A 1E7UA 3QB2A 2V4LA 2QFCA 3U64A 4BFRA 4M7CA 1H0AA 3CVYA 5FQ4A 3R9MA 2RKKA 2PNNA 4LUNU 3PZ1A 3TWQA 2FF4A 2WXJA 4DI3A 4Q96A 5M72A 3D9MA 4DLOA 3PRZA 2QYJA 4L9PA 5LX8A 3CVUA 1EDUA 3VLFA 3ULQA 4GTSA 3MV3B 4B0ZA 1N0RA 3Q73A 4FJYA 4UQZA 3FUFA 1S0PA 4HRMB 5E76A 5G55A 1O1TA 4N5CA 4I6GA 3D9NA 2EIME 1QYMA 4IRUA 3NQPA 4RQIA 2GRQB 2KCLA 2R59A 3ZUVB 1E8YA 5ENPD 4MKTA 3FTXA 2L9BA 4RG9A 4AY6A 4MS6A 3URZA 2XPIA 3ESKA 1OXJA 4CDRA 3ZPJA 1W3BA 3EHRA 3CQGB 4KZCA 1HG5A 4JEHA 4KT6B 3SNXA 3PEUB 1HX8A 1MZCA 4UI9J 3DSSA 4EHMA 4U0ZA 4E6HA 3B7UX 5H7PA 4XI9A 4AM9A 4ZHBA 1V54E 1JCSA 1LD8A 3O4ZA 3D9IA 1BI7B 3MV2B 4X8QA 5FJYA 4CT0A 2DIWA 4YVQC 4Q69A 4I43A 4K0RA 3L9TA 4GPMA 2HM8A 3FUEA 5EIDA 4PUCA 4A3VA 3BEEA 4KZ0A 4AOFA 5BW8C 1HH8A 1WM5A 2XRYA 2IO2C 2MYOA 3SQVA 1OWNA 3AU5A 3FH5A 4XZ4A 4ME2A 5ENRD 4LNUD 1DCQA 2KC7A 4AEZC 4E85A 4BX8A 4IN3B 4FHKA 3I4GA 3OTNA 1WAO1 5EX0A 5ENTD 4A3TA 1A17A 1U2VG 3BU8A 4HORA 1HU3A 3MCXA 3UTMA 3ABKE 3N71A 1OCCE 4PS3A 3ZW3A 3DWLG 4U96D 2OEVA 3BG1B 4GTTA 3HDXA 5FQ8A 3MKQB 3MA5A 3ASNE 3F6QA 2Y4UA 4BSZB 5CERB 4UWGA 3ABME 1K8KG 2Y4TA 4XEIG 2XS1A 2P9SG 4H7YA 3HHMA 2IF4A 1OCRE 2HO1A 3Q78A 4XE0A 5AENA 4GA2A 4N3AA 4A1SA 4DX5D 3LY8A 4J8SA 2GRLA 2ZXWE 3D9KA 4A55A 3ZNGA 1ZU2A 1TEZA 3ULEG 3PNLB 2EIKE 2H6FA 1IXVA 3TWWA 1TN7A 3ZHEB 3TWUA 3ZGQA 4WNGA 3UT4A 3QK0A 3RIBA 2AVPA 3ZU7B 3ZYMA 4NRHB 1O1SA 3JXJA 3V31A 3GW4A 4U0UA 2AXVA 3UQ3A 5BXUA 2WQ6A 2J09A 2J08A 2V5QC 4C0MA 1OWLA 3L22A 3NZUA 4A63B 2VTBB 2WMOA 4HOQA 1HZ4A 2VSNA 4JA9A 5EX3A 2VGEA 2EIJE 5BV0A 3P1UA 1D8DA 4AV7A 3SFXA 4OAVB 2KZTB 4ILGA 2X6IA 4PS7A 3D9OA 2RFAA 4ATGA 4BWRA 3VTXA 4N3CA 1JCRA 2C0LA 1IHGA 3ZN3A 4C48B 3CVQA 3LYAA 2XEEA 2X6FA 3FU0A 3GZSA 1NP7A 3B7TA 3Q7AA 4L23A 1N4QA 3ASOE 4GCNA 2Q7FA 3TGOA 4JHRA 2ETAA 3S7BA 3CVWA 2V4HC 2EILE 4OVVA 3JQ1A 3G2UA 3PEVB 3Q15A 2P9UG 5CMWA 2BF0X 2AXUA 2Y1LE 3JXIA 2LUHA 3KSQA 4G1TA 4AY5A 1DC2A 1QNFA 3NAWA 3T8MA 2J07A 4CGWA 1S70B 4GZCA 5BPPA 5LCWC 2YQ8A 3L6AA 3HXBA 5AQ9A 1S63A 4G8KA 4ILHB 3SGHA 4ACKA 1N0QA 3PVLA 2UY1B 3CSTA 2IY0C 2DWZA 3T9KA 3S7DA 1HXIA 4O1PA 3PS6A 4BSXA 3IXEA 2IEJA 5FQ7A 4RSYA 3D3MA 4BETA 4JEUA 4F6RD 4YDOA 1KPSB 2X6KA 3CK7A 1NZNA 1XNFA 2VSXE 3E37A 2B0OE 2L0TB 3BG0B 2CFZA 3FTYA 2V0PA 4ATZD 1KZPA 3FULA 3V30A 1G3NB 3FH8A 4DPRA 3TL5A 5HQ8A 4FLHA 3AG1E 4BERA 3UI2A 4DLQA 2XPZA 2YHCA 3CHSA 1E8WA 3JUEA 4U95D 4K5BA 1IQUA 1U3DA 3Q79A 3TXNA 5G05C 2R03A 4DUIA 3FU3A 5ARGA 1Z5SC 3ML8A 2ILRA 4HI8A 3FDHA 2X6JA 1QBQA 1H2UA 4CCAA 3ZKJA 4GCOA 3S2AA 4GZ5A 2NXPA 3KEAA 5ITZF 2C0MA 2ZGGA 4HI9A 3KSLA 3SBSA 3HG0D 3MKQA 2X38A 5EYPF 4W9RA 1YYHA 3MGBA 4M3OA 3AJIA 1SA4A 4L2LA 3FEXA 4J7WA 2J9QA 3X2QE 1SZ9A 2JLBA 4WWOA 4GTOA 2XEHA 2DCPA 3SO8A 2OOEA 1TJFA 2WXPA 3RRMB 2R02A 1Z3XA 1NI1A 4CEMA 3CIAA 1NA3A 1AP7A 2WXGA 1OCZE 3QC1A 3ZHEA 4F7AA 4JB8P 3TAXA 4GTRA 2XRZA 4A1GA 3LY9A 1SVXA 2P9LG 3PDNA 3ZIMA 5FIOA 2J8SD 3SD5A 3UXGA 1FVFA 3HXFA 4GPKA 5AJDA 4U8HA 1H19A 1JPLA 1GW6A 4HVBA 4JHJA 4RG6A 3APCA 3PZ2A 2NC9A 5D0QD 1E8XA 1DVPA 1ELRA 5HS0A 2CG2A 4U8YD 5AJLA 2VTBA 3LCAA 1OCOE 4GMJA 2ONDA 4GTQA 2MOWA 1MX2A 1FPPA 2XHEA 5CHEE 2AWIA 2KZTA 5ANRA 2DZNA 2LSUA 3LEWA 3CV0A 5FZSA 5AIJA 2KCKA 4U63A 5JJ6A 5CRUA 4G2VA 4TXPA 1XGWA 3CKCA 3FFLA 2WB2A 4K5AB 2IFUA 3ABLE 4J8FA 2WXHA 2L6JA 1YMPA 3LJ3A 2Y3AA 1AWCB 3CEQA 1Z3YA 1P5QA 3TWXA 4EZKA 1SA5A 1O5MA 2L6BA 5BUZA 4I17A 1VDYA 2ZIRA 3CVVA 4L1BA 5EN5D 2IO3C 2XZTG 3LXUX 4AJWA 2GRMA 4UI9C 3FTUA 2L0IA 3APDA 5LOZA 4KXKB 3JCKC 1MJ0A 4HRNA 3IHVA 4TV3A 4TUUA 2UY1A 3DEOA 1N4SA 3ESLA 4NIKA 4DRXE 4HOTA 3LDZA 3CHOA 4G26A 3CHQA 4GU5A 3ZYLA 2MHKA 3ENEA 5ENNA 2AXZA 1HE8A 3TXMA 3D9HA 2GW1A 4XIFA 2WM9A 3PUJA 2BKGA 3ZRHA 2KBXA 2F37A 5D0OD 3U4TA 1YCSB 5DBKA 4XKCA 3V2XA 3IV0A 1N54A 1QQEA 3UKRG 5AQ7A 1RZ4A 3LPZA 1WY6A 4LCTA 1TNYA 2GRNB 2P2CP 4JA7A 3E33A 3LKUA 1SW6A 3QWVA 2R5SA 2XGMA 3QAQA 5JHBA 4GTPA 3UUXA 4C9BB 1N52A 1NA0A 1SZAA 3HVEB 3L17A 4V3IA 4FADA 4GMLA 4C0EA 1OT8A 3C3OA 5CEDB 5FT9A 1O1RA 1H6KA 4GA1A 4EBAG 2VGYA 3GZ2A 1HO8A 1N95A 1EPUA 3HYMB 3QOUA 5ANLA 2FI7A 2HR2A 3PE4A 5CECB 2R05A 2J4BA 1UN9A 2R17C 3MX3A 2CHWA 3WXXA 3UT7A 4OVUA 5LP0A 4HNAD 2OVFA 1PC2A 2WQHA 4O6FA 2IOSA 4WNDA 3ZEFA 3S7FA 5CCLA 3HXDA 4BX9A 3E4BA 4QQIA 2XCBA 4D10C 3D9PA 1A5EA 2WXLA 1Y6IA 1TNOA 4ANUA 3B7RL 1TNBA 3UMVA 3DSWA 1E96B 4ILIA 4OAUC 4N5QA 1JWFA 2WXRA 2I1KA 2IOLA 4GYWA 3LY7A 5ENOD 3PE3A 3E34A 5JMND 3AS4A 3FH7A 5FTPA 5KJLA 3QDNA 4UQXA 3AS8A 4DI4A 4DJAA 3DSTA 3K9IA 4FU3A 2DVWA 3FUJA 3CK9A 3DSVA 5CEAA 2WXQA 2B6CA 5AARA 2OEWA 4Y6CA 2MRIA 3NF1A 3SHFA 3E30A 4EBAA 4BESA 5AQBA 4G24A 4TUMA 3QWWA 4JD2G 1LF8A 3ZXPA 4PH4B 5BV1A 4JPSA 3J5QB 2WQ7A 3Q9UC 4I1MA 5JJ7A 2NSZA 3TG4A 2RG8A 2XCCA 3QJZA 3L82A 1TN6A 4MBGA 4K5CA 2AJAA 2Y69E 1H6OA 4F53A 1E90A 4LNGA 3C72A 3NZSA 3FTSA 5JA4D 2J49A 2R2LA 5B1BE 1MQSA 5KCMA 3U3WA 4NURA 3PH0C 2KCVA 4HRLA 2I2OA 4HS2A 1V55E 3KD7A 3WG7E 3L08A 4ANVA 3Q7FA 3CHRA 3APFA 1K3ZD 3VLEA 4FULA 5E75A 2HE0A 1ELKA 4CGVA 1WDYA 1OWOA 3ZXSA 4GB9A 1YA0A 4LG6A 4YDEA 5A6CA 5BXOA 2E2EA 5KJKA 3UM2A 2VSYA 4EECA 2DBAA 1MX4A 2YINA 2BTDA 2NYJA 2GRRB 4H7XA 3J5PA 3MJWA 3B95A 4ANWA 2GRPB 3DBSA 3ASGA 3PUKA 2I1JA 1H6PA 3AG4E 3IBEA 2IQCA 3DRAA 2J4DA 3EIJA 2E0IA 4F1PA 2F8YA 4CDMA 5ENQD 5FWQA 1HS6A 5EDSA 1NFIE 3I3NA 4N39A 1IKND 3L13A 1PAQA 1K1BA 4ZFHA 2YHEA 3HXEA 4HQDA 4HXIA 4JW1A 5G05J 3UINC 1TN8A 3CHPA 3JQ0A 3UM0A 2VYIA 2PQRA 4CT4A 1OWPA 3UIOC 2WXNA 3EU9A 1IQRA 1H2VC 2WVIA 4U0SA 1TNZA 5A7DB 3ISMC 3I4RB 4FC8A 4I2WA 3ZVVA 2EQXA 2C2LA 3IHYA 3Q4AB 3HVEA 4XKBA 2WXFA 4GTVA 1L5JA 2KXPC 3HIZA 1JCQA 3NBNB 3TWSA 3DXKG 4IULA 4GZDA 1DCEA 3SFYA 4N2SA 4JHKA 4N3BA 3UM1A 3RU0A 3VTYA 5FZRA 4BEPA 3LVRE 1BLXB 4J8YA 5CCMA 1S64A 1X5BA 2VQ2A 5EYLA 5G04C 4GYYA 3FUIA 3SZ7A 2BKKB 2CHZA 4I6EA 4J0UA 2RFMA 1FVHA 1HF8A 4TXQA 2P58C 3CGHA 1OWMA 3GYZA 1MYOA 4YNDA 4JXTA 2M63A 1B89A 2WXKA 1WG0A 4Z68A 4J8DA 5ENSD 4UWLA 3ASDA 3PZ4A 3EUVA 4JL0A 2CHXA 3FTVA 4KMOA 1UJJA 4FA6A 2WXMA 3HRAA 4DX1A 3RRUA 3RK6A 2BUGA 3CR3A 4BY6A 5C2YA 4AVXA 4U8VD 4U04A 3B13A 1PY1A 3R7QA 2CG3A 2ZU6B 1JUQA 1U3CA 5EKQD 4LERA 2A5UA 2IU1A 1FT2A 2ETBA 5AQAA 1TNUA 3AS5A 4CZ2D 4DX6D 4UWFA 3TJPA 1TR4A 2VSOE 4UQYA 3SY2A 3Q47B 1EF1C 3Q5MA 4R7LA 4BT9A 3ONLA 4F3VA 2V8SE 3DSUA 4RLYA 2LAHA 3D9LA 3FTZA 3FUNA 3E32A 5FQ6A 4RVBA 3QWPA 3T5XA 2H6IA 3DXMG 3VLDA 3FUHA 2ZGDA 4GYOA 2LXLA 1JWGA 2KATA 3EU5A 3ZFWA 2P9NG 3UX4A 3OXLA 2VGXB 4BTAA 1UJKA 4U7EB 1UW4B 1MX6A 3BQOA 1X81A 2V5FA 3TWVA 1BI8B 2PM7A 1RW2A 2GGFA 5KNGA 3U66A 3KS2A 3RO3A 3AAAC 4FJZA 5AN8A 3AG3E 3PZ3A 3CVNA 4KBQA 4QFVA 5HRYA 3DEPA 1KLXA 3PZDA 3JUIA 3AG2E 4CRWA 3LS8A 2RD0A 4OYSA 2XPYA 4DX2A 3G2WA 3ZYQA 2FO7A 4I6JA 4LNBA 4WNFA 3W9GA 3AU4A 3ZYKA 1N11A 3TWTA 3T8KA 3QARA 4HFGA 4YVOA 3MYVA 4LEUA 4AIFA 3OXGA 4DK5A 1OY3D 1KT0A 4HLLA 1D9SA 3UM3A 5BNWA 3GZ1A 4GAAA 4WAFA 4NQ0A 4I1OB 3OAWA 3MZLB 4B89A 4AXHA 3PREA 2EINE 1LTXA 4XI0A 4BTBA 1HG2A 4KVOA 1TJCA 5CBOA 2X6HA 3OXFA 4I1AA 2PQNA 2CFUA 3IEGA 2PZIA 2GROB 3ASFA 3EHQA 4YDWA 4JVSA 2LO6A 1NL4A 1D8EA 3SF4A 2QYUA 3V79K 3EHNA 5T8IA 2WPVA 3CK8A 1N4RA 5KNHD 2Y0BG 2WXOA 2QC9A 3L54A 4GZ3A 4GMRA 3BUAA 3RRNB 3EDTB 2P9IG 3RKVA 1Z6TA 3ULYA 2QZAA 4P29A 3FTWA 2UWJG 3LVQE 4PS8A 1ZBPA 3FP3A 5T4YA 3JYSA 4EPZA 1SQMA 3B7SA 4I2ZA 5J08A 1HFAA 5B3SE 4LSZE 2FULA 5T3RA 3FU6A 5HI7A 2FO1E 5KJMA 2A4ZA 3DPYA 3IKOB 3P2BA 3FEYA 3B7BA 2F0YA 2XENA 4ANXA 3G2TA 3UT8A 1N9AA 5ARFA 4APOA 2OCCE 4F1SA 1ELWA 3FUMA 2IJGX 2XQ0A 3W9FA 2FBNA 2AW6A 1OUVA 4DX7D 4J6IA 5D2MC 3C3QA 3RO2A 4J8EA 4Y6WA 1FT1A 4HOUA 4O1OA 4WNEA 1INZA 5FZQA 4UWHA 4KVMA 3FUDA 4B8AA 4AP2A 4WUYA 3UPVA 5BT1A 4G8LA 3UKUG 3SBTB 2XEVA 3FY4A 4URKA 2XGSA 4MRUA 1BD8A 4FLBA 4G25A 3R9AB 3G2SA 3Q9NC 5KWDA 3NOGD 2H6HA 2F8XK 2XZDG 2XGOA 3EJNA 4B8CB 3CLJA 2LAIA 2LNIA 3C5RA 2HYZA 4EZJA 4GA0A 3ONKA 5B1AE 5LFAA 4CDNA 3UIPC 3NOCD 5G2NA 1KT1A 4MLPA 4EQFA 2P9KG 5LCWJ 5DIZA 3O48A 3ASHA 1H2TC 3TG5A 4L2YA 4LRZA 5FINA 3EHMA 2A5EA 2VGXA 3RSEG 5EILA 1UG3A 3ML9A 1ZB1A 2P9PG 3SFZA 3S7JA 3CVXA 5J90A 4WWNA 4JC8A 3DPDA 4CYMD 3HXCA 2OV8A 4EZLA 3LJNA 2I6HA 4N2QA 3C3RA 1UN8A 4B93B 4K03A 1BU9A 3FWVA 1IYGA 5HKPA 4UWKA 4G11A 4IYPA 4B94A 4BT8A 2FEZA 1N4PA 1BPOA 2ETCA 2DYRE 1TYQG 5A23A 4GTMA 4Q94A 2QY7A 3FU5A 5JHAA 3KAEA 4I9EA 2VJ8A 1Q2ZA 4UI9K 1MHQA 4KYOB 4HB5A 5CMYA 1LD7A 4G23A 3D9JA 3CVLA 2X3MA 3SI5A 4PDXA 3CHMA 3U9WA 3TWRA 4WWPA 4GZ6A 1DNPA 3QNKA 1QZ2A 5C1DA 2I9CA 2PL2A 3QKYA 2DZOA 3G2VA 5CBNA 2JEKA 4U07A 2LXMA 3KEZA 3I5PA 1N94A 2OVBA 4HLEA 4XX5A 2WMNA 2BEDA 4UUCA 4JZYA 4L7TA 3V2OA 3RJVA 4TRQA 2DYSE 3MEKA 2LSVA
chains in the Genus database with same CATH topology
3T8MA 4BTAA 1UJKA 2J07A 3CQCB 1UW4B 2OVFA 5JJTA 1PC2A 2V5FA 4CGWA 1EYHA 4GZCA 4ACLA 2WQHA 4O6FA 5BPPA 2PM7A 3CVPA 3R7RA 4ABNA 2IOSA 2YQ8A 4WNDA 3ZEFA 5LCWC 4HOSA 3S7FA 2GGFA 3L6AA 5CCLA 4BX9A 3U66A 1E8ZA 4ILHB 3E4BA 3SGHA 1E7VA 2XCBA 2YNQA 3KS2A 4ACKA 3D9PA 4D10C 3PNTB 3RO3A 2WXLA 1Y6IA 3PVLA 4FJZA 4ANUA 2UY1B 3B7RL 4FHJA 5G04J 3UMVA 3CSTA 1FCHA 3EIQC 1E96B 4ILIA 1JWFA 2WXRA 3S7DA 3CVNA 1HXIA 2I1KA 4KBQA 4QFVA 2IOLA 2IONA 3MKRA 3PS6A 4BSXA 3T5VA 4GYWA 2WXIA 3LY7A 3PE3A 3L16A 5FQ7A 1KLXA 3AS4A 3PZDA 3FH7A 3FUKA 4RSYA 3D3MA 3JUIA 3CSFA 5FTPA 5AYWD 3Q49B 4JEUA 4CRWA 3C98A 1Y8MA 3LS8A 5KJLA 3CKBA 3FHEA 2PM6A 3QDNA 2KM4A 4UQXA 2X6KA 3AS8A 3CK7A 2RD0A 1NZNA 1XNFA 4OYSA 2VSXE 4FP7A 2XPYA 4DI4A 3G2WA 4DJAA 2L0TB 2FO7A 4I6JA 4WNFA 3BG0B 2CFZA 3FTYA 2V0PA 3AU4A 3K9IA 3FUJA 4FU3A 3ZYKA 3CK9A 4APFA 5KJNA 2WXQA 4I9CA 3FULA 3QARA 4NACA 3FH8A 1E7UA 3QB2A 4DPRA 3TL5A 4Y6CA 2V4LA 2MRIA 2QFCA 3NF1A 4HFGA 4YVOA 3U64A 3MYVA 5HQ8A 4FLHA 4BFRA 4LEUA 4AIFA 3SHFA 3OXGA 4DLQA 1H0AA 4DK5A 2XPZA 4EBAA 4G24A 2YHCA 3CVYA 3CHSA 5FQ4A 1E8WA 1KT0A 3QWWA 1LF8A 1IQUA 4LUNU 1U3DA 5BNWA 2FF4A 3GZ1A 4GAAA 4PH4B 3TXNA 5BV1A 5G05C 4WAFA 4JPSA 4NQ0A 2WXJA 4DI3A 4I1OB 4Q96A 3FU3A 5ARGA 5M72A 3OAWA 3MZLB 3ML8A 4B89A 2ILRA 3D9MA 4DLOA 2WQ7A 3FDHA 4AXHA 2X6JA 3PRZA 3PREA 4XI0A 5LX8A 4BTBA 3CVUA 1H2UA 1EDUA 3VLFA 3ULQA 4I1MA 5JJ7A 1HG2A 2NSZA 4KVOA 3TG4A 1TJCA 3MV3B 4B0ZA 2RG8A 4FJYA 4UQZA 4CCAA 2X6HA 2XCCA 4GCOA 3OXFA 3QJZA 4GZ5A 3S2AA 3FUFA 4I1AA 1S0PA 2PQNA 2NXPA 5E76A 5G55A 4N5CA 4I6GA 2CFUA 3D9NA 3IEGA 2PZIA 2C0MA 3ASFA 4IRUA 3NQPA 4JVSA 2LO6A 4F53A 1E90A 2KCLA 3SF4A 3NZSA 3FTSA 3SBSA 2R59A 1E8YA 2J49A 3EHNA 4MKTA 3FTXA 2L9BA 3MKQA 5T8IA 4RG9A 1MQSA 5KCMA 2WPVA 3CK8A 4AY6A 4MS6A 2WXOA 3URZA 2X38A 4W9RA 2XPIA 3U3WA 4NURA 3ESKA 3L54A 3MGBA 4M3OA 3PH0C 4GZ3A 3RRNB 2KCVA 4L2LA 4CDRA 3ZPJA 3FEXA 2J9QA 1W3BA 1SZ9A 3EDTB 2I2OA 3CQGB 4KZCA 1HG5A 4HS2A 2JLBA 3KD7A 4WWOA 4JEHA 3L08A 4ANVA 3RKVA 1Z6TA 4KT6B 3SNXA 3PEUB 3CHRA 3APFA 3VLEA 1HX8A 2DCPA 2OOEA 4P29A 1TJFA 2WXPA 3FTWA 4FULA 4UI9J 2UWJG 3LVQE 3RRMB 4PS8A 5E75A 1ZBPA 1Z3XA 3FP3A 5T4YA 3JYSA 4U0ZA 4E6HA 1ELKA 3B7UX 4CGVA 4XI9A 4AM9A 4EPZA 1OWOA 1SQMA 3B7SA 4I2ZA 5J08A 3ZXSA 4GB9A 1HFAA 1YA0A 4CEMA 3O4ZA 5A6CA 3D9IA 2FULA 3CIAA 3MV2B 5T3RA 3FU6A 1NA3A 2E2EA 5FJYA 4CT0A 5KJKA 5HI7A 2DIWA 4YVQC 4Q69A 2VSYA 4I43A 5KJMA 4EECA 2DBAA 2A4ZA 2WXGA 2YINA 4K0RA 3IKOB 3P2BA 3FEYA 2HM8A 3FUEA 2BTDA 3QC1A 4H7XA 4PUCA 3ZHEA 4F7AA 4ANXA 3G2TA 3UT8A 3BEEA 4A3VA 3MJWA 4KZ0A 3TAXA 2XRZA 5ARFA 4APOA 4AOFA 4ANWA 5BW8C 1HH8A 4A1GA 4F1SA 1WM5A 3LY9A 2XRYA 3PDNA 3ZIMA 3DBSA 3ASGA 1ELWA 2I1JA 3PUKA 3FUMA 1OWNA 3AU5A 3SD5A 1FVFA 3FH5A 4ME2A 4XZ4A 2IJGX 2XQ0A 3IBEA 2IQCA 4GPKA 2FBNA 2AW6A 1OUVA 2J4DA 3EIJA 2E0IA 4J6IA 2KC7A 5AJDA 4U8HA 1H19A 1JPLA 1GW6A 4AEZC 4HVBA 3RO2A 4E85A 4J8EA 4BX8A 4CDMA 4JHJA 4Y6WA 4RG6A 4IN3B 5FWQA 1HS6A 3APCA 4FHKA 5EDSA 2NC9A 5D0QD 3I3NA 1E8XA 4N39A 1DVPA 3L13A 1ELRA 4HOUA 3I4GA 2CG2A 1WAO1 3OTNA 4WNEA 5AJLA 2VTBA 1PAQA 5EX0A 1INZA 3LCAA 5FZQA 4A3TA 4UWHA 1A17A 2YHEA 4KVMA 4GMJA 2ONDA 4HORA 1HU3A 3MCXA 2MOWA 4HXIA 4JW1A 3FUDA 5G05J 4B8AA 4AP2A 5LP0A 2XHEA 4WUYA 5CHEE 3UPVA 3CHPA 5BT1A 2AWIA 3JQ0A 2KZTA 5ANRA 2VYIA 2PQRA 4CT4A 1OWPA 3N71A 3SBTB 2LSUA 2WXNA 3LEWA 4PS3A 3ZW3A 3CV0A 1IQRA 2XEVA 5FZSA 5AIJA 2KCKA 3FY4A 1H2VC 4U63A 2WVIA 2XGSA 4URKA 4MRUA 4FLBA 4U0SA 5A7DB 4G25A 5JJ6A 3BG1B 3I4RB 3R9AB 4FC8A 4G2VA 3G2SA 3HDXA 4I2WA 5FQ8A 2EQXA 3ZVVA 2C2LA 3IHYA 3Q4AB 1XGWA 3CKCA 3FFLA 3HVEA 3MKQB 2WB2A 3MA5A 2IFUA 2XGOA 3EJNA 4J8FA 2WXHA 4B8CB 3CLJA 2L6JA 4XKBA 2LAIA 2WXFA 2Y4UA 2LNIA 3LJ3A 1L5JA 4UWGA 2HYZA 4EZJA 4GA0A 3HIZA 2Y4TA 3ONKA 2Y3AA 4H7YA 5LFAA 4CDNA 3CEQA 1Z3YA 1P5QA 3HHMA 2IF4A 4IULA 4EZKA 5G2NA 1KT1A 4GZDA 4MLPA 4EQFA 2HO1A 4N2SA 4JHKA 5BUZA 4N3BA 4I17A 4XE0A 5AENA 1VDYA 4GA2A 4N3AA 4A1SA 5LCWJ 3CVVA 3RU0A 5DIZA 3O48A 3ASHA 1H2TC 3TG5A 4L2YA 4LRZA 5FZRA 3LY8A 3VTYA 3EHMA 4J8SA 4L1BA 2VGXA 3LVRE 3LXUX 2GRLA 4AJWA 3D9KA 1UG3A 2GRMA 3ML9A 4UI9C 3FTUA 4A55A 3SFZA 2L0IA 5CCMA 3APDA 3S7JA 1X5BA 1ZU2A 3CVXA 5J90A 1TEZA 2VQ2A 4WWNA 5LOZA 4JC8A 4KXKB 3DPDA 5G04C 4GYYA 3PNLB 3FUIA 3JCKC 3SZ7A 2CHZA 3IHVA 4TV3A 2OV8A 4TUUA 4EZLA 4I6EA 2UY1A 3ESLA 3ZHEB 4HOTA 2I6HA 3LDZA 3CHOA 4J0UA 4N2QA 1FVHA 4G26A 1UN8A 1HF8A 3CHQA 3ZGQA 4WNGA 4K03A 2P58C 4GU5A 3ZYLA 2MHKA 3CGHA 3FWVA 3QK0A 3RIBA 2AVPA 3UT4A 1IYGA 1OWMA 3ENEA 3GYZA 5ENNA 4YNDA 3ZYMA 4JXTA 4NRHB 4UWKA 4G11A 2M63A 4IYPA 4B94A 1B89A 2FEZA 4BT8A 2AXZA 1HE8A 1BPOA 3TXMA 2WXKA 3GW4A 2GW1A 4U0UA 2AXVA 3UQ3A 4XIFA 2WM9A 3PUJA 2J09A 2WQ6A 5A23A 4J8DA 4UWLA 2J08A 4Q94A 3ASDA 3ZRHA 4C0MA 1OWLA 3L22A 2QY7A 3NZUA 3FU5A 5JHAA 3KAEA 5D0OD 3U4TA 4I9EA 4JL0A 2WMOA 2CHXA 4HOQA 2VJ8A 2VTBB 3FTVA 4UI9K 1MHQA 3TGOA 4KMOA 1HZ4A 1UJJA 5DBKA 4KYOB 4XKCA 2VSNA 2WXMA 4JA9A 4FA6A 5EX3A 3RRUA 5CMYA 5BV0A 3P1UA 3RK6A 2BUGA 3CR3A 4BY6A 3IV0A 1N54A 4G23A 1QQEA 5C2YA 4AV7A 3D9JA 3CVLA 3ZYQA 3LPZA 1WY6A 4LCTA 4AVXA 2KZTB 2X3MA 4U04A 4ILGA 2X6IA 3SI5A 4PDXA 3CHMA 4PS7A 3B13A 1PY1A 3D9OA 4JA7A 2CG3A 3R7QA 3U9WA 3LKUA 4WWPA 2ZU6B 4ATGA 3QWVA 4GZ6A 1DNPA 1JUQA 1U3CA 4BWRA 5EKQD 2R5SA 3VTXA 2XGMA 3QAQA 3QNKA 1QZ2A 5C1DA 4LERA 4N3CA 2A5UA 5JHBA 2I9CA 2C0LA 1IHGA 2IU1A 2PL2A 3UUXA 3ZN3A 4C9BB 3QKYA 1N52A 1NA0A 3AS5A 1SZAA 3G2VA 3HVEB 3L17A 4V3IA 4UWFA 3CVQA 3LYAA 3TJPA 4FADA 4GMLA 4C0EA 2X6FA 2VSOE 3FU0A 4UQYA 2JEKA 3GZSA 1NP7A 3B7TA 4U07A 4L23A 5FT9A 3KEZA 3I5PA 3Q47B 1EF1C 2Q7FA 1H6KA 3Q5MA 3ONLA 4GCNA 4R7LA 4JHRA 4BT9A 4GA1A 4EBAG 2OVBA 2VGYA 3S7BA 3CVWA 4HLEA 3GZ2A 2V8SE 4F3VA 4OVVA 3JQ1A 3G2UA 4XX5A 3PEVB 1HO8A 2LAHA 3D9LA 3Q15A 3FTZA 1EPUA 2WMNA 3HYMB 3QOUA 5ANLA 3FUNA 5CMWA 5FQ6A 2BF0X 2FI7A 2HR2A 3PE4A 4RVBA 2AXUA 3QWPA 3T5XA 4G1TA 2J4BA 1UN9A 3VLDA 3FUHA 2R17C 4AY5A 4GYOA 4JZYA 4L7TA 3MX3A 1JWGA 2KATA 2CHWA 3RJVA 4TRQA 3WXXA 3ZFWA 3UT7A 1QNFA 3MEKA 4OVUA 3UX4A 3OXLA 2LSVA 2VGXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BTA A;  5JJT A;  1PC2 A;  2V5F A;  4CGW A;  2WQH A;  4O6F A;  3CVP A;  4ABN A;  5LCW C;  4WND A;  2YQ8 A;  4HOS A;  3S7F A;  5CCL A;  3E4B A;  3KS2 A;  2XCB A;  3RO3 A;  2UY1 B;  5G04 J;  1FCH A;  1E96 B;  3S7D A;  3CVN A;  1HXI A;  4KBQ A;  3MKR A;  4GYW A;  3LY7 A;  3PE3 A;  1KLX A;  3AS4 A;  5FTP A;  5AYW D;  3Q49 B;  1Y8M A;  5KJL A;  3CKB A;  3QDN A;  4UQX A;  3CK7 A;  3AS8 A;  1NZN A;  1XNF A;  2FO7 A;  4WNF A;  3K9I A;  3CK9 A;  5KJN A;  4I9C A;  4Y6C A;  2QFC A;  3NF1 A;  4YVO A;  5HQ8 A;  4LEU A;  4AIF A;  3OXG A;  4G24 A;  2YHC A;  1KT0 A;  3QWW A;  5BNW A;  2FF4 A;  3GZ1 A;  5G05 C;  4NQ0 A;  5M72 A;  5ARG A;  4XI0 A;  4BTB A;  3ULQ A;  5JJ7 A;  3TG4 A;  1TJC A;  3MV3 B;  4UQZ A;  2XCC A;  4GCO A;  3OXF A;  4GZ5 A;  4I1A A;  2PQN A;  4N5C A;  3IEG A;  2PZI A;  2C0M A;  3ASF A;  2KCL A;  3SF4 A;  4RG9 A;  2WPV A;  3CK8 A;  4AY6 A;  3URZ A;  4W9R A;  2XPI A;  3U3W A;  3ESK A;  4GZ3 A;  2KCV A;  4CDR A;  3ZPJ A;  2J9Q A;  1W3B A;  3EDT B;  2JLB A;  3KD7 A;  3RKV A;  2OOE A;  4UI9 J;  2UWJ G;  1ZBP A;  3FP3 A;  3JYS A;  4U0Z A;  4CGV A;  4XI9 A;  4AM9 A;  4I2Z A;  1YA0 A;  5A6C A;  3MV2 B;  1NA3 A;  2E2E A;  5FJY A;  5KJK A;  5HI7 A;  4YVQ C;  2VSY A;  5KJM A;  2DBA A;  4H7X A;  3ZHE A;  3BEE A;  3TAX A;  5ARF A;  4APO A;  5BW8 C;  1HH8 A;  1WM5 A;  3LY9 A;  3PDN A;  3ASG A;  1ELW A;  4ME2 A;  4GPK A;  2FBN A;  1OUV A;  2KC7 A;  3RO2 A;  4J8E A;  4Y6W A;  4RG6 A;  4IN3 B;  2NC9 A;  5D0Q D;  4N39 A;  4HOU A;  1ELR A;  1WAO 1;  4WNE A;  5EX0 A;  3LCA A;  5FZQ A;  1A17 A;  2OND A;  4HOR A;  5G05 J;  4WUY A;  5CHE E;  3UPV A;  5BT1 A;  2VYI A;  2PQR A;  3N71 A;  2LSU A;  3CV0 A;  2XEV A;  5FZS A;  2KCK A;  2XGS A;  4U0S A;  5A7D B;  4G25 A;  5JJ6 A;  3R9A B;  4G2V A;  4I2W A;  2C2L A;  3Q4A B;  3CKC A;  3FFL A;  3MA5 A;  2IFU A;  2XGO A;  4J8F A;  2L6J A;  2Y4U A;  2LNI A;  2HYZ A;  4GA0 A;  2Y4T A;  4H7Y A;  3CEQ A;  1P5Q A;  2IF4 A;  1KT1 A;  4EQF A;  2HO1 A;  4N2S A;  4N3B A;  4I17 A;  4GA2 A;  4N3A A;  4A1S A;  5LCW J;  3RU0 A;  5DIZ A;  3O48 A;  3ASH A;  3TG5 A;  3VTY A;  5FZR A;  3LY8 A;  2VGX A;  4UI9 C;  5CCM A;  3S7J A;  1ZU2 A;  2VQ2 A;  4KXK B;  5G04 C;  4GYY A;  3SZ7 A;  2UY1 A;  3ZHE B;  4HOT A;  2I6H A;  4J0U A;  4N2Q A;  4G26 A;  3ZGQ A;  4WNG A;  2P58 C;  2MHK A;  3FWV A;  3RIB A;  2AVP A;  1IYG A;  3GYZ A;  4YND A;  4NRH B;  4B94 A;  4BT8 A;  1B89 A;  2FEZ A;  3GW4 A;  2GW1 A;  4U0U A;  3UQ3 A;  4XIF A;  4J8D A;  3ASD A;  3KAE A;  5D0O D;  3U4T A;  4I9E A;  4JL0 A;  4HOQ A;  4UI9 K;  1HZ4 A;  5DBK A;  4KYO B;  2VSN A;  4JA9 A;  5EX3 A;  2BUG A;  4G23 A;  1QQE A;  3CVL A;  3LPZ A;  4U04 A;  4JA7 A;  3LKU A;  3QWV A;  4GZ6 A;  4BWR A;  5EKQ D;  2R5S A;  3VTX A;  2XGM A;  1QZ2 A;  5C1D A;  4N3C A;  2C0L A;  1IHG A;  2PL2 A;  3UUX A;  3ZN3 A;  3QKY A;  1NA0 A;  3AS5 A;  3CVQ A;  3LYA A;  4UQY A;  4U07 A;  5FT9 A;  3Q47 B;  4GCN A;  2Q7F A;  3Q5M A;  3TGO A;  4BT9 A;  4JHR A;  4GA1 A;  2VGY A;  3S7B A;  3GZ2 A;  4F3V A;  3Q15 A;  3HYM B;  3QOU A;  2FI7 A;  2HR2 A;  3PE4 A;  3QWP A;  4G1T A;  4AY5 A;  4GYO A;  2KAT A;  3RJV A;  3WXX A;  3ZFW A;  3MEK A;  3OXL A;  2LSV A;  2VGX B; 
#chains in the Genus database with same CATH topology
 3CQC B;  5JJT A;  2ZIS A;  1EYH A;  4ACL A;  5AAO A;  1IHB A;  3CVP A;  3R7R A;  4ABN A;  4HOS A;  5CRV A;  4O60 A;  1E8Z A;  4TXR A;  1E7V A;  2YNQ A;  5KBA A;  4HBD A;  3PNT B;  1UOH A;  4FHJ A;  5G04 J;  2JAB A;  1FCH A;  3EIQ C;  5EIB E;  1K1A A;  3Q75 A;  3RAU A;  1KZO A;  2ION A;  3MKR A;  3T5V A;  2WXI A;  3L16 A;  3FUK A;  3DSX A;  3CSF A;  5AYW D;  3Q49 B;  3C98 A;  1Y8M A;  3NB2 A;  3CKB A;  3FHE A;  2PM6 A;  2KM4 A;  2H6G A;  4FP7 A;  2XS8 A;  4APF A;  5KJN A;  4I9C A;  4YDY A;  5IY5 E;  4NAC A;  5D66 A;  1E7U A;  3QB2 A;  2V4L A;  2QFC A;  3U64 A;  4BFR A;  4M7C A;  1H0A A;  3CVY A;  5FQ4 A;  3R9M A;  2RKK A;  2PNN A;  4LUN U;  3PZ1 A;  3TWQ A;  2FF4 A;  2WXJ A;  4DI3 A;  4Q96 A;  5M72 A;  3D9M A;  4DLO A;  3PRZ A;  2QYJ A;  4L9P A;  5LX8 A;  3CVU A;  1EDU A;  3VLF A;  3ULQ A;  4GTS A;  3MV3 B;  4B0Z A;  1N0R A;  3Q73 A;  4FJY A;  4UQZ A;  3FUF A;  1S0P A;  4HRM B;  5E76 A;  5G55 A;  1O1T A;  4N5C A;  4I6G A;  3D9N A;  2EIM E;  1QYM A;  4IRU A;  3NQP A;  4RQI A;  2GRQ B;  2KCL A;  2R59 A;  3ZUV B;  1E8Y A;  5ENP D;  4MKT A;  3FTX A;  2L9B A;  4RG9 A;  4AY6 A;  4MS6 A;  3URZ A;  2XPI A;  3ESK A;  1OXJ A;  4CDR A;  3ZPJ A;  1W3B A;  3EHR A;  3CQG B;  4KZC A;  1HG5 A;  4JEH A;  4KT6 B;  3SNX A;  3PEU B;  1HX8 A;  1MZC A;  4UI9 J;  3DSS A;  4EHM A;  4U0Z A;  4E6H A;  3B7U X;  5H7P A;  4XI9 A;  4AM9 A;  4ZHB A;  1V54 E;  1JCS A;  1LD8 A;  3O4Z A;  3D9I A;  1BI7 B;  3MV2 B;  4X8Q A;  5FJY A;  4CT0 A;  2DIW A;  4YVQ C;  4Q69 A;  4I43 A;  4K0R A;  3L9T A;  4GPM A;  2HM8 A;  3FUE A;  5EID A;  4PUC A;  4A3V A;  3BEE A;  4KZ0 A;  4AOF A;  5BW8 C;  1HH8 A;  1WM5 A;  2XRY A;  2IO2 C;  2MYO A;  3SQV A;  1OWN A;  3AU5 A;  3FH5 A;  4XZ4 A;  4ME2 A;  5ENR D;  4LNU D;  1DCQ A;  2KC7 A;  4AEZ C;  4E85 A;  4BX8 A;  4IN3 B;  4FHK A;  3I4G A;  3OTN A;  1WAO 1;  5EX0 A;  5ENT D;  4A3T A;  1A17 A;  1U2V G;  3BU8 A;  4HOR A;  1HU3 A;  3MCX A;  3UTM A;  3ABK E;  3N71 A;  1OCC E;  4PS3 A;  3ZW3 A;  3DWL G;  4U96 D;  2OEV A;  3BG1 B;  4GTT A;  3HDX A;  5FQ8 A;  3MKQ B;  3MA5 A;  3ASN E;  3F6Q A;  2Y4U A;  4BSZ B;  5CER B;  4UWG A;  3ABM E;  1K8K G;  2Y4T A;  4XEI G;  2XS1 A;  2P9S G;  4H7Y A;  3HHM A;  2IF4 A;  1OCR E;  2HO1 A;  3Q78 A;  4XE0 A;  5AEN A;  4GA2 A;  4N3A A;  4A1S A;  4DX5 D;  3LY8 A;  4J8S A;  2GRL A;  2ZXW E;  3D9K A;  4A55 A;  3ZNG A;  1ZU2 A;  1TEZ A;  3ULE G;  3PNL B;  2EIK E;  2H6F A;  1IXV A;  3TWW A;  1TN7 A;  3ZHE B;  3TWU A;  3ZGQ A;  4WNG A;  3UT4 A;  3QK0 A;  3RIB A;  2AVP A;  3ZU7 B;  3ZYM A;  4NRH B;  1O1S A;  3JXJ A;  3V31 A;  3GW4 A;  4U0U A;  2AXV A;  3UQ3 A;  5BXU A;  2WQ6 A;  2J09 A;  2J08 A;  2V5Q C;  4C0M A;  1OWL A;  3L22 A;  3NZU A;  4A63 B;  2VTB B;  2WMO A;  4HOQ A;  1HZ4 A;  2VSN A;  4JA9 A;  5EX3 A;  2VGE A;  2EIJ E;  5BV0 A;  3P1U A;  1D8D A;  4AV7 A;  3SFX A;  4OAV B;  2KZT B;  4ILG A;  2X6I A;  4PS7 A;  3D9O A;  2RFA A;  4ATG A;  4BWR A;  3VTX A;  4N3C A;  1JCR A;  2C0L A;  1IHG A;  3ZN3 A;  4C48 B;  3CVQ A;  3LYA A;  2XEE A;  2X6F A;  3FU0 A;  3GZS A;  1NP7 A;  3B7T A;  3Q7A A;  4L23 A;  1N4Q A;  3ASO E;  4GCN A;  2Q7F A;  3TGO A;  4JHR A;  2ETA A;  3S7B A;  3CVW A;  2V4H C;  2EIL E;  4OVV A;  3JQ1 A;  3G2U A;  3PEV B;  3Q15 A;  2P9U G;  5CMW A;  2BF0 X;  2AXU A;  2Y1L E;  3JXI A;  2LUH A;  3KSQ A;  4G1T A;  4AY5 A;  1DC2 A;  1QNF A;  3NAW A;  3T8M A;  2J07 A;  4CGW A;  1S70 B;  4GZC A;  5BPP A;  5LCW C;  2YQ8 A;  3L6A A;  3HXB A;  5AQ9 A;  1S63 A;  4G8K A;  4ILH B;  3SGH A;  4ACK A;  1N0Q A;  3PVL A;  2UY1 B;  3CST A;  2IY0 C;  2DWZ A;  3T9K A;  3S7D A;  1HXI A;  4O1P A;  3PS6 A;  4BSX A;  3IXE A;  2IEJ A;  5FQ7 A;  4RSY A;  3D3M A;  4BET A;  4JEU A;  4F6R D;  4YDO A;  1KPS B;  2X6K A;  3CK7 A;  1NZN A;  1XNF A;  2VSX E;  3E37 A;  2B0O E;  2L0T B;  3BG0 B;  2CFZ A;  3FTY A;  2V0P A;  4ATZ D;  1KZP A;  3FUL A;  3V30 A;  1G3N B;  3FH8 A;  4DPR A;  3TL5 A;  5HQ8 A;  4FLH A;  3AG1 E;  4BER A;  3UI2 A;  4DLQ A;  2XPZ A;  2YHC A;  3CHS A;  1E8W A;  3JUE A;  4U95 D;  4K5B A;  1IQU A;  1U3D A;  3Q79 A;  3TXN A;  5G05 C;  2R03 A;  4DUI A;  3FU3 A;  5ARG A;  1Z5S C;  3ML8 A;  2ILR A;  4HI8 A;  3FDH A;  2X6J A;  1QBQ A;  1H2U A;  4CCA A;  3ZKJ A;  4GCO A;  3S2A A;  4GZ5 A;  2NXP A;  3KEA A;  5ITZ F;  2C0M A;  2ZGG A;  4HI9 A;  3KSL A;  3SBS A;  3HG0 D;  3MKQ A;  2X38 A;  5EYP F;  4W9R A;  1YYH A;  3MGB A;  4M3O A;  3AJI A;  1SA4 A;  4L2L A;  3FEX A;  4J7W A;  2J9Q A;  3X2Q E;  1SZ9 A;  2JLB A;  4WWO A;  4GTO A;  2XEH A;  2DCP A;  3SO8 A;  2OOE A;  1TJF A;  2WXP A;  3RRM B;  2R02 A;  1Z3X A;  1NI1 A;  4CEM A;  3CIA A;  1NA3 A;  1AP7 A;  2WXG A;  1OCZ E;  3QC1 A;  3ZHE A;  4F7A A;  4JB8 P;  3TAX A;  4GTR A;  2XRZ A;  4A1G A;  3LY9 A;  1SVX A;  2P9L G;  3PDN A;  3ZIM A;  5FIO A;  2J8S D;  3SD5 A;  3UXG A;  1FVF A;  3HXF A;  4GPK A;  5AJD A;  4U8H A;  1H19 A;  1JPL A;  1GW6 A;  4HVB A;  4JHJ A;  4RG6 A;  3APC A;  3PZ2 A;  2NC9 A;  5D0Q D;  1E8X A;  1DVP A;  1ELR A;  5HS0 A;  2CG2 A;  4U8Y D;  5AJL A;  2VTB A;  3LCA A;  1OCO E;  4GMJ A;  2OND A;  4GTQ A;  2MOW A;  1MX2 A;  1FPP A;  2XHE A;  5CHE E;  2AWI A;  2KZT A;  5ANR A;  2DZN A;  2LSU A;  3LEW A;  3CV0 A;  5FZS A;  5AIJ A;  2KCK A;  4U63 A;  5JJ6 A;  5CRU A;  4G2V A;  4TXP A;  1XGW A;  3CKC A;  3FFL A;  2WB2 A;  4K5A B;  2IFU A;  3ABL E;  4J8F A;  2WXH A;  2L6J A;  1YMP A;  3LJ3 A;  2Y3A A;  1AWC B;  3CEQ A;  1Z3Y A;  1P5Q A;  3TWX A;  4EZK A;  1SA5 A;  1O5M A;  2L6B A;  5BUZ A;  4I17 A;  1VDY A;  2ZIR A;  3CVV A;  4L1B A;  5EN5 D;  2IO3 C;  2XZT G;  3LXU X;  4AJW A;  2GRM A;  4UI9 C;  3FTU A;  2L0I A;  3APD A;  5LOZ A;  4KXK B;  3JCK C;  1MJ0 A;  4HRN A;  3IHV A;  4TV3 A;  4TUU A;  2UY1 A;  3DEO A;  1N4S A;  3ESL A;  4NIK A;  4DRX E;  4HOT A;  3LDZ A;  3CHO A;  4G26 A;  3CHQ A;  4GU5 A;  3ZYL A;  2MHK A;  3ENE A;  5ENN A;  2AXZ A;  1HE8 A;  3TXM A;  3D9H A;  2GW1 A;  4XIF A;  2WM9 A;  3PUJ A;  2BKG A;  3ZRH A;  2KBX A;  2F37 A;  5D0O D;  3U4T A;  1YCS B;  5DBK A;  4XKC A;  3V2X A;  3IV0 A;  1N54 A;  1QQE A;  3UKR G;  5AQ7 A;  1RZ4 A;  3LPZ A;  1WY6 A;  4LCT A;  1TNY A;  2GRN B;  2P2C P;  4JA7 A;  3E33 A;  3LKU A;  1SW6 A;  3QWV A;  2R5S A;  2XGM A;  3QAQ A;  5JHB A;  4GTP A;  3UUX A;  4C9B B;  1N52 A;  1NA0 A;  1SZA A;  3HVE B;  3L17 A;  4V3I A;  4FAD A;  4GML A;  4C0E A;  1OT8 A;  3C3O A;  5CED B;  5FT9 A;  1O1R A;  1H6K A;  4GA1 A;  4EBA G;  2VGY A;  3GZ2 A;  1HO8 A;  1N95 A;  1EPU A;  3HYM B;  3QOU A;  5ANL A;  2FI7 A;  2HR2 A;  3PE4 A;  5CEC B;  2R05 A;  2J4B A;  1UN9 A;  2R17 C;  3MX3 A;  2CHW A;  3WXX A;  3UT7 A;  4OVU A;  5LP0 A;  4HNA D;  2OVF A;  1PC2 A;  2WQH A;  4O6F A;  2IOS A;  4WND A;  3ZEF A;  3S7F A;  5CCL A;  3HXD A;  4BX9 A;  3E4B A;  4QQI A;  2XCB A;  4D10 C;  3D9P A;  1A5E A;  2WXL A;  1Y6I A;  1TNO A;  4ANU A;  3B7R L;  1TNB A;  3UMV A;  3DSW A;  1E96 B;  4ILI A;  4OAU C;  4N5Q A;  1JWF A;  2WXR A;  2I1K A;  2IOL A;  4GYW A;  3LY7 A;  5ENO D;  3PE3 A;  3E34 A;  5JMN D;  3AS4 A;  3FH7 A;  5FTP A;  5KJL A;  3QDN A;  4UQX A;  3AS8 A;  4DI4 A;  4DJA A;  3DST A;  3K9I A;  4FU3 A;  2DVW A;  3FUJ A;  3CK9 A;  3DSV A;  5CEA A;  2WXQ A;  2B6C A;  5AAR A;  2OEW A;  4Y6C A;  2MRI A;  3NF1 A;  3SHF A;  3E30 A;  4EBA A;  4BES A;  5AQB A;  4G24 A;  4TUM A;  3QWW A;  4JD2 G;  1LF8 A;  3ZXP A;  4PH4 B;  5BV1 A;  4JPS A;  3J5Q B;  2WQ7 A;  3Q9U C;  4I1M A;  5JJ7 A;  2NSZ A;  3TG4 A;  2RG8 A;  2XCC A;  3QJZ A;  3L82 A;  1TN6 A;  4MBG A;  4K5C A;  2AJA A;  2Y69 E;  1H6O A;  4F53 A;  1E90 A;  4LNG A;  3C72 A;  3NZS A;  3FTS A;  5JA4 D;  2J49 A;  2R2L A;  5B1B E;  1MQS A;  5KCM A;  3U3W A;  4NUR A;  3PH0 C;  2KCV A;  4HRL A;  2I2O A;  4HS2 A;  1V55 E;  3KD7 A;  3WG7 E;  3L08 A;  4ANV A;  3Q7F A;  3CHR A;  3APF A;  1K3Z D;  3VLE A;  4FUL A;  5E75 A;  2HE0 A;  1ELK A;  4CGV A;  1WDY A;  1OWO A;  3ZXS A;  4GB9 A;  1YA0 A;  4LG6 A;  4YDE A;  5A6C A;  5BXO A;  2E2E A;  5KJK A;  3UM2 A;  2VSY A;  4EEC A;  2DBA A;  1MX4 A;  2YIN A;  2BTD A;  2NYJ A;  2GRR B;  4H7X A;  3J5P A;  3MJW A;  3B95 A;  4ANW A;  2GRP B;  3DBS A;  3ASG A;  3PUK A;  2I1J A;  1H6P A;  3AG4 E;  3IBE A;  2IQC A;  3DRA A;  2J4D A;  3EIJ A;  2E0I A;  4F1P A;  2F8Y A;  4CDM A;  5ENQ D;  5FWQ A;  1HS6 A;  5EDS A;  1NFI E;  3I3N A;  4N39 A;  1IKN D;  3L13 A;  1PAQ A;  1K1B A;  4ZFH A;  2YHE A;  3HXE A;  4HQD A;  4HXI A;  4JW1 A;  5G05 J;  3UIN C;  1TN8 A;  3CHP A;  3JQ0 A;  3UM0 A;  2VYI A;  2PQR A;  4CT4 A;  1OWP A;  3UIO C;  2WXN A;  3EU9 A;  1IQR A;  1H2V C;  2WVI A;  4U0S A;  1TNZ A;  5A7D B;  3ISM C;  3I4R B;  4FC8 A;  4I2W A;  3ZVV A;  2EQX A;  2C2L A;  3IHY A;  3Q4A B;  3HVE A;  4XKB A;  2WXF A;  4GTV A;  1L5J A;  2KXP C;  3HIZ A;  1JCQ A;  3NBN B;  3TWS A;  3DXK G;  4IUL A;  4GZD A;  1DCE A;  3SFY A;  4N2S A;  4JHK A;  4N3B A;  3UM1 A;  3RU0 A;  3VTY A;  5FZR A;  4BEP A;  3LVR E;  1BLX B;  4J8Y A;  5CCM A;  1S64 A;  1X5B A;  2VQ2 A;  5EYL A;  5G04 C;  4GYY A;  3FUI A;  3SZ7 A;  2BKK B;  2CHZ A;  4I6E A;  4J0U A;  2RFM A;  1FVH A;  1HF8 A;  4TXQ A;  2P58 C;  3CGH A;  1OWM A;  3GYZ A;  1MYO A;  4YND A;  4JXT A;  2M63 A;  1B89 A;  2WXK A;  1WG0 A;  4Z68 A;  4J8D A;  5ENS D;  4UWL A;  3ASD A;  3PZ4 A;  3EUV A;  4JL0 A;  2CHX A;  3FTV A;  4KMO A;  1UJJ A;  4FA6 A;  2WXM A;  3HRA A;  4DX1 A;  3RRU A;  3RK6 A;  2BUG A;  3CR3 A;  4BY6 A;  5C2Y A;  4AVX A;  4U8V D;  4U04 A;  3B13 A;  1PY1 A;  3R7Q A;  2CG3 A;  2ZU6 B;  1JUQ A;  1U3C A;  5EKQ D;  4LER A;  2A5U A;  2IU1 A;  1FT2 A;  2ETB A;  5AQA A;  1TNU A;  3AS5 A;  4CZ2 D;  4DX6 D;  4UWF A;  3TJP A;  1TR4 A;  2VSO E;  4UQY A;  3SY2 A;  3Q47 B;  1EF1 C;  3Q5M A;  4R7L A;  4BT9 A;  3ONL A;  4F3V A;  2V8S E;  3DSU A;  4RLY A;  2LAH A;  3D9L A;  3FTZ A;  3FUN A;  3E32 A;  5FQ6 A;  4RVB A;  3QWP A;  3T5X A;  2H6I A;  3DXM G;  3VLD A;  3FUH A;  2ZGD A;  4GYO A;  2LXL A;  1JWG A;  2KAT A;  3EU5 A;  3ZFW A;  2P9N G;  3UX4 A;  3OXL A;  2VGX B;  4BTA A;  1UJK A;  4U7E B;  1UW4 B;  1MX6 A;  3BQO A;  1X81 A;  2V5F A;  3TWV A;  1BI8 B;  2PM7 A;  1RW2 A;  2GGF A;  5KNG A;  3U66 A;  3KS2 A;  3RO3 A;  3AAA C;  4FJZ A;  5AN8 A;  3AG3 E;  3PZ3 A;  3CVN A;  4KBQ A;  4QFV A;  5HRY A;  3DEP A;  1KLX A;  3PZD A;  3JUI A;  3AG2 E;  4CRW A;  3LS8 A;  2RD0 A;  4OYS A;  2XPY A;  4DX2 A;  3G2W A;  3ZYQ A;  2FO7 A;  4I6J A;  4LNB A;  4WNF A;  3W9G A;  3AU4 A;  3ZYK A;  1N11 A;  3TWT A;  3T8K A;  3QAR A;  4HFG A;  4YVO A;  3MYV A;  4LEU A;  4AIF A;  3OXG A;  4DK5 A;  1OY3 D;  1KT0 A;  4HLL A;  1D9S A;  3UM3 A;  5BNW A;  3GZ1 A;  4GAA A;  4WAF A;  4NQ0 A;  4I1O B;  3OAW A;  3MZL B;  4B89 A;  4AXH A;  3PRE A;  2EIN E;  1LTX A;  4XI0 A;  4BTB A;  1HG2 A;  4KVO A;  1TJC A;  5CBO A;  2X6H A;  3OXF A;  4I1A A;  2PQN A;  2CFU A;  3IEG A;  2PZI A;  2GRO B;  3ASF A;  3EHQ A;  4YDW A;  4JVS A;  2LO6 A;  1NL4 A;  1D8E A;  3SF4 A;  2QYU A;  3V79 K;  3EHN A;  5T8I A;  2WPV A;  3CK8 A;  1N4R A;  5KNH D;  2Y0B G;  2WXO A;  2QC9 A;  3L54 A;  4GZ3 A;  4GMR A;  3BUA A;  3RRN B;  3EDT B;  2P9I G;  3RKV A;  1Z6T A;  3ULY A;  2QZA A;  4P29 A;  3FTW A;  2UWJ G;  3LVQ E;  4PS8 A;  1ZBP A;  3FP3 A;  5T4Y A;  3JYS A;  4EPZ A;  1SQM A;  3B7S A;  4I2Z A;  5J08 A;  1HFA A;  5B3S E;  4LSZ E;  2FUL A;  5T3R A;  3FU6 A;  5HI7 A;  2FO1 E;  5KJM A;  2A4Z A;  3DPY A;  3IKO B;  3P2B A;  3FEY A;  3B7B A;  2F0Y A;  2XEN A;  4ANX A;  3G2T A;  3UT8 A;  1N9A A;  5ARF A;  4APO A;  2OCC E;  4F1S A;  1ELW A;  3FUM A;  2IJG X;  2XQ0 A;  3W9F A;  2FBN A;  2AW6 A;  1OUV A;  4DX7 D;  4J6I A;  5D2M C;  3C3Q A;  3RO2 A;  4J8E A;  4Y6W A;  1FT1 A;  4HOU A;  4O1O A;  4WNE A;  1INZ A;  5FZQ A;  4UWH A;  4KVM A;  3FUD A;  4B8A A;  4AP2 A;  4WUY A;  3UPV A;  5BT1 A;  4G8L A;  3UKU G;  3SBT B;  2XEV A;  3FY4 A;  4URK A;  2XGS A;  4MRU A;  1BD8 A;  4FLB A;  4G25 A;  3R9A B;  3G2S A;  3Q9N C;  5KWD A;  3NOG D;  2H6H A;  2F8X K;  2XZD G;  2XGO A;  3EJN A;  4B8C B;  3CLJ A;  2LAI A;  2LNI A;  3C5R A;  2HYZ A;  4EZJ A;  4GA0 A;  3ONK A;  5B1A E;  5LFA A;  4CDN A;  3UIP C;  3NOC D;  5G2N A;  1KT1 A;  4MLP A;  4EQF A;  2P9K G;  5LCW J;  5DIZ A;  3O48 A;  3ASH A;  1H2T C;  3TG5 A;  4L2Y A;  4LRZ A;  5FIN A;  3EHM A;  2A5E A;  2VGX A;  3RSE G;  5EIL A;  1UG3 A;  3ML9 A;  1ZB1 A;  2P9P G;  3SFZ A;  3S7J A;  3CVX A;  5J90 A;  4WWN A;  4JC8 A;  3DPD A;  4CYM D;  3HXC A;  2OV8 A;  4EZL A;  3LJN A;  2I6H A;  4N2Q A;  3C3R A;  1UN8 A;  4B93 B;  4K03 A;  1BU9 A;  3FWV A;  1IYG A;  5HKP A;  4UWK A;  4G11 A;  4IYP A;  4B94 A;  4BT8 A;  2FEZ A;  1N4P A;  1BPO A;  2ETC A;  2DYR E;  1TYQ G;  5A23 A;  4GTM A;  4Q94 A;  2QY7 A;  3FU5 A;  5JHA A;  3KAE A;  4I9E A;  2VJ8 A;  1Q2Z A;  4UI9 K;  1MHQ A;  4KYO B;  4HB5 A;  5CMY A;  1LD7 A;  4G23 A;  3D9J A;  3CVL A;  2X3M A;  3SI5 A;  4PDX A;  3CHM A;  3U9W A;  3TWR A;  4WWP A;  4GZ6 A;  1DNP A;  3QNK A;  1QZ2 A;  5C1D A;  2I9C A;  2PL2 A;  3QKY A;  2DZO A;  3G2V A;  5CBN A;  2JEK A;  4U07 A;  2LXM A;  3KEZ A;  3I5P A;  1N94 A;  2OVB A;  4HLE A;  4XX5 A;  2WMN A;  2BED A;  4UUC A;  4JZY A;  4L7T A;  3V2O A;  3RJV A;  4TRQ A;  2DYS E;  3MEK A;  2LSV A; 
#chains in the Genus database with same CATH homology
 3T8M A;  4BTA A;  1UJK A;  2J07 A;  3CQC B;  1UW4 B;  2OVF A;  5JJT A;  1PC2 A;  2V5F A;  4CGW A;  1EYH A;  4GZC A;  4ACL A;  2WQH A;  4O6F A;  5BPP A;  2PM7 A;  3CVP A;  3R7R A;  4ABN A;  2IOS A;  2YQ8 A;  4WND A;  3ZEF A;  5LCW C;  4HOS A;  3S7F A;  2GGF A;  3L6A A;  5CCL A;  4BX9 A;  3U66 A;  1E8Z A;  4ILH B;  3E4B A;  3SGH A;  1E7V A;  2XCB A;  2YNQ A;  3KS2 A;  4ACK A;  3D9P A;  4D10 C;  3PNT B;  3RO3 A;  2WXL A;  1Y6I A;  3PVL A;  4FJZ A;  4ANU A;  2UY1 B;  3B7R L;  4FHJ A;  5G04 J;  3UMV A;  3CST A;  1FCH A;  3EIQ C;  1E96 B;  4ILI A;  1JWF A;  2WXR A;  3S7D A;  3CVN A;  1HXI A;  2I1K A;  4KBQ A;  4QFV A;  2IOL A;  2ION A;  3MKR A;  3PS6 A;  4BSX A;  3T5V A;  4GYW A;  2WXI A;  3LY7 A;  3PE3 A;  3L16 A;  5FQ7 A;  1KLX A;  3AS4 A;  3PZD A;  3FH7 A;  3FUK A;  4RSY A;  3D3M A;  3JUI A;  3CSF A;  5FTP A;  5AYW D;  3Q49 B;  4JEU A;  4CRW A;  3C98 A;  1Y8M A;  3LS8 A;  5KJL A;  3CKB A;  3FHE A;  2PM6 A;  3QDN A;  2KM4 A;  4UQX A;  2X6K A;  3AS8 A;  3CK7 A;  2RD0 A;  1NZN A;  1XNF A;  4OYS A;  2VSX E;  4FP7 A;  2XPY A;  4DI4 A;  3G2W A;  4DJA A;  2L0T B;  2FO7 A;  4I6J A;  4WNF A;  3BG0 B;  2CFZ A;  3FTY A;  2V0P A;  3AU4 A;  3K9I A;  3FUJ A;  4FU3 A;  3ZYK A;  3CK9 A;  4APF A;  5KJN A;  2WXQ A;  4I9C A;  3FUL A;  3QAR A;  4NAC A;  3FH8 A;  1E7U A;  3QB2 A;  4DPR A;  3TL5 A;  4Y6C A;  2V4L A;  2MRI A;  2QFC A;  3NF1 A;  4HFG A;  4YVO A;  3U64 A;  3MYV A;  5HQ8 A;  4FLH A;  4BFR A;  4LEU A;  4AIF A;  3SHF A;  3OXG A;  4DLQ A;  1H0A A;  4DK5 A;  2XPZ A;  4EBA A;  4G24 A;  2YHC A;  3CVY A;  3CHS A;  5FQ4 A;  1E8W A;  1KT0 A;  3QWW A;  1LF8 A;  1IQU A;  4LUN U;  1U3D A;  5BNW A;  2FF4 A;  3GZ1 A;  4GAA A;  4PH4 B;  3TXN A;  5BV1 A;  5G05 C;  4WAF A;  4JPS A;  4NQ0 A;  2WXJ A;  4DI3 A;  4I1O B;  4Q96 A;  3FU3 A;  5ARG A;  5M72 A;  3OAW A;  3MZL B;  3ML8 A;  4B89 A;  2ILR A;  3D9M A;  4DLO A;  2WQ7 A;  3FDH A;  4AXH A;  2X6J A;  3PRZ A;  3PRE A;  4XI0 A;  5LX8 A;  4BTB A;  3CVU A;  1H2U A;  1EDU A;  3VLF A;  3ULQ A;  4I1M A;  5JJ7 A;  1HG2 A;  2NSZ A;  4KVO A;  3TG4 A;  1TJC A;  3MV3 B;  4B0Z A;  2RG8 A;  4FJY A;  4UQZ A;  4CCA A;  2X6H A;  2XCC A;  4GCO A;  3OXF A;  3QJZ A;  4GZ5 A;  3S2A A;  3FUF A;  4I1A A;  1S0P A;  2PQN A;  2NXP A;  5E76 A;  5G55 A;  4N5C A;  4I6G A;  2CFU A;  3D9N A;  3IEG A;  2PZI A;  2C0M A;  3ASF A;  4IRU A;  3NQP A;  4JVS A;  2LO6 A;  4F53 A;  1E90 A;  2KCL A;  3SF4 A;  3NZS A;  3FTS A;  3SBS A;  2R59 A;  1E8Y A;  2J49 A;  3EHN A;  4MKT A;  3FTX A;  2L9B A;  3MKQ A;  5T8I A;  4RG9 A;  1MQS A;  5KCM A;  2WPV A;  3CK8 A;  4AY6 A;  4MS6 A;  2WXO A;  3URZ A;  2X38 A;  4W9R A;  2XPI A;  3U3W A;  4NUR A;  3ESK A;  3L54 A;  3MGB A;  4M3O A;  3PH0 C;  4GZ3 A;  3RRN B;  2KCV A;  4L2L A;  4CDR A;  3ZPJ A;  3FEX A;  2J9Q A;  1W3B A;  1SZ9 A;  3EDT B;  2I2O A;  3CQG B;  4KZC A;  1HG5 A;  4HS2 A;  2JLB A;  3KD7 A;  4WWO A;  4JEH A;  3L08 A;  4ANV A;  3RKV A;  1Z6T A;  4KT6 B;  3SNX A;  3PEU B;  3CHR A;  3APF A;  3VLE A;  1HX8 A;  2DCP A;  2OOE A;  4P29 A;  1TJF A;  2WXP A;  3FTW A;  4FUL A;  4UI9 J;  2UWJ G;  3LVQ E;  3RRM B;  4PS8 A;  5E75 A;  1ZBP A;  1Z3X A;  3FP3 A;  5T4Y A;  3JYS A;  4U0Z A;  4E6H A;  1ELK A;  3B7U X;  4CGV A;  4XI9 A;  4AM9 A;  4EPZ A;  1OWO A;  1SQM A;  3B7S A;  4I2Z A;  5J08 A;  3ZXS A;  4GB9 A;  1HFA A;  1YA0 A;  4CEM A;  3O4Z A;  5A6C A;  3D9I A;  2FUL A;  3CIA A;  3MV2 B;  5T3R A;  3FU6 A;  1NA3 A;  2E2E A;  5FJY A;  4CT0 A;  5KJK A;  5HI7 A;  2DIW A;  4YVQ C;  4Q69 A;  2VSY A;  4I43 A;  5KJM A;  4EEC A;  2DBA A;  2A4Z A;  2WXG A;  2YIN A;  4K0R A;  3IKO B;  3P2B A;  3FEY A;  2HM8 A;  3FUE A;  2BTD A;  3QC1 A;  4H7X A;  4PUC A;  3ZHE A;  4F7A A;  4ANX A;  3G2T A;  3UT8 A;  3BEE A;  4A3V A;  3MJW A;  4KZ0 A;  3TAX A;  2XRZ A;  5ARF A;  4APO A;  4AOF A;  4ANW A;  5BW8 C;  1HH8 A;  4A1G A;  4F1S A;  1WM5 A;  3LY9 A;  2XRY A;  3PDN A;  3ZIM A;  3DBS A;  3ASG A;  1ELW A;  2I1J A;  3PUK A;  3FUM A;  1OWN A;  3AU5 A;  3SD5 A;  1FVF A;  3FH5 A;  4ME2 A;  4XZ4 A;  2IJG X;  2XQ0 A;  3IBE A;  2IQC A;  4GPK A;  2FBN A;  2AW6 A;  1OUV A;  2J4D A;  3EIJ A;  2E0I A;  4J6I A;  2KC7 A;  5AJD A;  4U8H A;  1H19 A;  1JPL A;  1GW6 A;  4AEZ C;  4HVB A;  3RO2 A;  4E85 A;  4J8E A;  4BX8 A;  4CDM A;  4JHJ A;  4Y6W A;  4RG6 A;  4IN3 B;  5FWQ A;  1HS6 A;  3APC A;  4FHK A;  5EDS A;  2NC9 A;  5D0Q D;  3I3N A;  1E8X A;  4N39 A;  1DVP A;  3L13 A;  1ELR A;  4HOU A;  3I4G A;  2CG2 A;  1WAO 1;  3OTN A;  4WNE A;  5AJL A;  2VTB A;  1PAQ A;  5EX0 A;  1INZ A;  3LCA A;  5FZQ A;  4A3T A;  4UWH A;  1A17 A;  2YHE A;  4KVM A;  4GMJ A;  2OND A;  4HOR A;  1HU3 A;  3MCX A;  2MOW A;  4HXI A;  4JW1 A;  3FUD A;  5G05 J;  4B8A A;  4AP2 A;  5LP0 A;  2XHE A;  4WUY A;  5CHE E;  3UPV A;  3CHP A;  5BT1 A;  2AWI A;  3JQ0 A;  2KZT A;  5ANR A;  2VYI A;  2PQR A;  4CT4 A;  1OWP A;  3N71 A;  3SBT B;  2LSU A;  2WXN A;  3LEW A;  4PS3 A;  3ZW3 A;  3CV0 A;  1IQR A;  2XEV A;  5FZS A;  5AIJ A;  2KCK A;  3FY4 A;  1H2V C;  4U63 A;  2WVI A;  2XGS A;  4URK A;  4MRU A;  4FLB A;  4U0S A;  5A7D B;  4G25 A;  5JJ6 A;  3BG1 B;  3I4R B;  3R9A B;  4FC8 A;  4G2V A;  3G2S A;  3HDX A;  4I2W A;  5FQ8 A;  2EQX A;  3ZVV A;  2C2L A;  3IHY A;  3Q4A B;  1XGW A;  3CKC A;  3FFL A;  3HVE A;  3MKQ B;  2WB2 A;  3MA5 A;  2IFU A;  2XGO A;  3EJN A;  4J8F A;  2WXH A;  4B8C B;  3CLJ A;  2L6J A;  4XKB A;  2LAI A;  2WXF A;  2Y4U A;  2LNI A;  3LJ3 A;  1L5J A;  4UWG A;  2HYZ A;  4EZJ A;  4GA0 A;  3HIZ A;  2Y4T A;  3ONK A;  2Y3A A;  4H7Y A;  5LFA A;  4CDN A;  3CEQ A;  1Z3Y A;  1P5Q A;  3HHM A;  2IF4 A;  4IUL A;  4EZK A;  5G2N A;  1KT1 A;  4GZD A;  4MLP A;  4EQF A;  2HO1 A;  4N2S A;  4JHK A;  5BUZ A;  4N3B A;  4I17 A;  4XE0 A;  5AEN A;  1VDY A;  4GA2 A;  4N3A A;  4A1S A;  5LCW J;  3CVV A;  3RU0 A;  5DIZ A;  3O48 A;  3ASH A;  1H2T C;  3TG5 A;  4L2Y A;  4LRZ A;  5FZR A;  3LY8 A;  3VTY A;  3EHM A;  4J8S A;  4L1B A;  2VGX A;  3LVR E;  3LXU X;  2GRL A;  4AJW A;  3D9K A;  1UG3 A;  2GRM A;  3ML9 A;  4UI9 C;  3FTU A;  4A55 A;  3SFZ A;  2L0I A;  5CCM A;  3APD A;  3S7J A;  1X5B A;  1ZU2 A;  3CVX A;  5J90 A;  1TEZ A;  2VQ2 A;  4WWN A;  5LOZ A;  4JC8 A;  4KXK B;  3DPD A;  5G04 C;  4GYY A;  3PNL B;  3FUI A;  3JCK C;  3SZ7 A;  2CHZ A;  3IHV A;  4TV3 A;  2OV8 A;  4TUU A;  4EZL A;  4I6E A;  2UY1 A;  3ESL A;  3ZHE B;  4HOT A;  2I6H A;  3LDZ A;  3CHO A;  4J0U A;  4N2Q A;  1FVH A;  4G26 A;  1UN8 A;  1HF8 A;  3CHQ A;  3ZGQ A;  4WNG A;  4K03 A;  2P58 C;  4GU5 A;  3ZYL A;  2MHK A;  3CGH A;  3FWV A;  3QK0 A;  3RIB A;  2AVP A;  3UT4 A;  1IYG A;  1OWM A;  3ENE A;  3GYZ A;  5ENN A;  4YND A;  3ZYM A;  4JXT A;  4NRH B;  4UWK A;  4G11 A;  2M63 A;  4IYP A;  4B94 A;  1B89 A;  2FEZ A;  4BT8 A;  2AXZ A;  1HE8 A;  1BPO A;  3TXM A;  2WXK A;  3GW4 A;  2GW1 A;  4U0U A;  2AXV A;  3UQ3 A;  4XIF A;  2WM9 A;  3PUJ A;  2J09 A;  2WQ6 A;  5A23 A;  4J8D A;  4UWL A;  2J08 A;  4Q94 A;  3ASD A;  3ZRH A;  4C0M A;  1OWL A;  3L22 A;  2QY7 A;  3NZU A;  3FU5 A;  5JHA A;  3KAE A;  5D0O D;  3U4T A;  4I9E A;  4JL0 A;  2WMO A;  2CHX A;  4HOQ A;  2VJ8 A;  2VTB B;  3FTV A;  4UI9 K;  1MHQ A;  3TGO A;  4KMO A;  1HZ4 A;  1UJJ A;  5DBK A;  4KYO B;  4XKC A;  2VSN A;  2WXM A;  4JA9 A;  4FA6 A;  5EX3 A;  3RRU A;  5CMY A;  5BV0 A;  3P1U A;  3RK6 A;  2BUG A;  3CR3 A;  4BY6 A;  3IV0 A;  1N54 A;  4G23 A;  1QQE A;  5C2Y A;  4AV7 A;  3D9J A;  3CVL A;  3ZYQ A;  3LPZ A;  1WY6 A;  4LCT A;  4AVX A;  2KZT B;  2X3M A;  4U04 A;  4ILG A;  2X6I A;  3SI5 A;  4PDX A;  3CHM A;  4PS7 A;  3B13 A;  1PY1 A;  3D9O A;  4JA7 A;  2CG3 A;  3R7Q A;  3U9W A;  3LKU A;  4WWP A;  2ZU6 B;  4ATG A;  3QWV A;  4GZ6 A;  1DNP A;  1JUQ A;  1U3C A;  4BWR A;  5EKQ D;  2R5S A;  3VTX A;  2XGM A;  3QAQ A;  3QNK A;  1QZ2 A;  5C1D A;  4LER A;  4N3C A;  2A5U A;  5JHB A;  2I9C A;  2C0L A;  1IHG A;  2IU1 A;  2PL2 A;  3UUX A;  3ZN3 A;  4C9B B;  3QKY A;  1N52 A;  1NA0 A;  3AS5 A;  1SZA A;  3G2V A;  3HVE B;  3L17 A;  4V3I A;  4UWF A;  3CVQ A;  3LYA A;  3TJP A;  4FAD A;  4GML A;  4C0E A;  2X6F A;  2VSO E;  3FU0 A;  4UQY A;  2JEK A;  3GZS A;  1NP7 A;  3B7T A;  4U07 A;  4L23 A;  5FT9 A;  3KEZ A;  3I5P A;  3Q47 B;  1EF1 C;  2Q7F A;  1H6K A;  3Q5M A;  3ONL A;  4GCN A;  4R7L A;  4JHR A;  4BT9 A;  4GA1 A;  4EBA G;  2OVB A;  2VGY A;  3S7B A;  3CVW A;  4HLE A;  3GZ2 A;  2V8S E;  4F3V A;  4OVV A;  3JQ1 A;  3G2U A;  4XX5 A;  3PEV B;  1HO8 A;  2LAH A;  3D9L A;  3Q15 A;  3FTZ A;  1EPU A;  2WMN A;  3HYM B;  3QOU A;  5ANL A;  3FUN A;  5CMW A;  5FQ6 A;  2BF0 X;  2FI7 A;  2HR2 A;  3PE4 A;  4RVB A;  2AXU A;  3QWP A;  3T5X A;  4G1T A;  2J4B A;  1UN9 A;  3VLD A;  3FUH A;  2R17 C;  4AY5 A;  4GYO A;  4JZY A;  4L7T A;  3MX3 A;  1JWG A;  2KAT A;  2CHW A;  3RJV A;  4TRQ A;  3WXX A;  3ZFW A;  3UT7 A;  1QNF A;  3MEK A;  4OVU A;  3UX4 A;  3OXL A;  2LSV A;  2VGX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...