2GGFA

Solution structure of the ma3 domain of human programmed cell death 4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
GSSGSSGLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the MA3 domain of human Programmed cell death 4
rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Programmed cell death 4, isoform 1
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ggfA00
2ZU6B 4GMJA 4CT4A 2I2OA 3JUIA 1HU3A 2IOSA 2FULA 4LUNU 2KZTB 3FEXA 4JHJA 3RK6A 2VSOE 1N54A 1N52A 4CEMA 4C9BB 4GMLA 3EIQC 2RG8A 5ANRA 1H2UA 3L6AA 4B89A 2IU1A 1UW4B 2NSZA 1H2TC 4B8CB 2IONA 2KZTA 2IOLA 4IULA 1H6KA 3EIJA 1PAQA 1UG3A 4CRWA 2HM8A 3FEYA 2GGFA 1H2VC 4JHKA 4B8AA 2VSXE 3D3MA
chains in the Genus database with same CATH superfamily
2WQHA 3O48A 4HLEA 2R59A 2WXQA 3PZ1A 3UIPC 2V8SE 1MX6A 3FTVA 4HLLA 3DSVA 4KT6B 4NQ0A 5E76A 4O1PA 2L6JA 4KXKB 5CHEE 5KJKA 2VTBA 3FHEA 1RZ4A 3FTSA 2XRZA 4GTTA 3ONKA 4Q96A 2V4HC 4J6IA 3BU8A 3GYZA 2XGMA 5ENTD 4FADA 3CLJA 3LYAA 3I3NA 1OWPA 3ASHA 1DC2A 2WXMA 2ZGDA 2EQXA 3E33A 2DYSE 1OCZE 3SO8A 1OY3D 2VJ8A 2VSNA 4BSZB 4E85A 4GMJA 1TJCA 3CKBA 2V5FA 1B89A 4JHJA 1OWMA 3PEVB 5FIOA 4HOUA 4CEMA 5LP0A 2PQRA 5AQ7A 5CMYA 1X81A 2XCCA 4OVUA 2H6IA 3FH8A 2XZTG 3ULEG 4DPRA 3MV3B 5AQ9A 3QDNA 3CHSA 4AJWA 1YCSB 3E37A 3ZYMA 2XEVA 3UQ3A 4F1SA 4NRHB 1OXJA 4U96D 2MHKA 4ABNA 2IEJA 2OVFA 2XS8A 5KJLA 4XIFA 4I17A 4FJZA 4O60A 2LSUA 3AG1E 5CBNA 3TXMA 3TG5A 2WVIA 2I1JA 1ZU2A 5KCMA 1SZ9A 3RSEG 2WXLA 3KSLA 1S70B 4I2WA 5FJYA 3SHFA 5CERB 4DX7D 4U07A 3JXJA 4RG9A 3T8MA 3PVLA 4HQDA 1HS6A 2AJAA 5JJ6A 4C0MA 3MGBA 3RKVA 1K3ZD 3LY8A 3D9HA 4L23A 3DSTA 3BG1B 1MYOA 1HXIA 3FULA 3AU4A 1W3BA 3FH7A 4NACA 3CVVA 3ENEA 3CHPA 1KLXA 3TAXA 4BTAA 4BEPA 1L5JA 5ITZF 1O1SA 3AG4E 1D8DA 4EBAG 2XS1A 4GTOA 1YYHA 2PM7A 3D9KA 1OUVA 3PDNA 2L6BA 3OXLA 5ENRD 5B3SE 3ZPJA 2DVWA 5ARFA 3P1UA 2WXGA 3ABLE 3L54A 4J8SA 3DSXA 1Z5SC 4ANXA 1WG0A 4XI0A 4KMOA 4YDYA 4DRXE 3FDHA 3C3OA 3MKRA 4JA9A 3IXEA 3TJPA 1UG3A 1TN7A 3EU5A 3HYMB 1PY1A 3ZXSA 2AXUA 2R17C 1NFIE 5G2NA 1E90A 1EDUA 4I6JA 3T5VA 4ANUA 5T8IA 1QZ2A 5LCWC 4YVQC 2CFUA 3EHMA 2P2CP 2ZGGA 4GZ6A 4N3AA 2X6HA 2LAIA 5CRVA 2V0PA 5CRUA 3DXMG 4U95D 3F6QA 3L82A 2WPVA 4ACLA 3W9FA 3RRNB 2XPIA 3UM1A 4U0SA 4Y6CA 1WM5A 3DSUA 2DZNA 1ELWA 4A55A 1HE8A 2XGSA 5BNWA 2IU1A 4HFGA 4XEIG 2Y4TA 4GYYA 3ZKJA 3ML9A 2E2EA 2IO3C 4FJYA 1IXVA 5G05J 4TUMA 3RRUA 3R9AB 3MCXA 4K5BA 2XPZA 4I1OB 1N52A 1BPOA 2LAHA 4DI4A 4BY6A 2UY1B 3UMVA 1TJFA 2VSYA 5AENA 3U3WA 5LOZA 1FT1A 3D9IA 5EKQD 3Q49B 4GPKA 1H2VC 3GW4A 1E7VA 4QFVA 4CT4A 4BX9A 2CHZA 5CECB 1SA5A 4DX5D 4HI9A 1TN6A 4X8QA 3CSTA 4BERA 4CDRA 2A5EA 3UM3A 4L1BA 3T9KA 3HVEB 4I1AA 1N4SA 3I4RB 1OCCE 3NOGD 4G24A 3S7DA 4PS7A 4UWGA 1H6PA 2BKGA 3DPDA 3QK0A 3UM0A 1E8WA 4UQZA 1BLXB 1UJJA 4ILGA 2ETBA 4Z68A 4UI9C 3IEGA 3CK7A 2RD0A 2MOWA 2R5SA 1PC2A 2GRQB 3CQGB 4B8CB 2C0MA 3PE4A 4CGVA 4CRWA 1WDYA 1EPUA 2HE0A 3CGHA 3JYSA 3MKQB 1ELKA 4GMRA 1P5QA 3HXBA 4GTMA 3Q5MA 4DJAA 4ME2A 3BEEA 3OAWA 1H2UA 2J8SD 2JLBA 3I5PA 5EDSA 2FF4A 1S63A 2L0IA 1HX8A 1TR4A 2AWIA 1FPPA 3B7UX 4F1PA 1XNFA 3R7QA 3APDA 2WXKA 2Y0BG 4H7YA 3EIQC 3ABME 5D2MC 3QNKA 3VLEA 3QJZA 4HORA 2X6FA 2IOLA 4J8DA 4HRNA 2QC9A 2H6FA 3UT7A 1RW2A 3HG0D 2IJGX 3CHOA 4E6HA 2ILRA 4WNGA 5JA4D 2DWZA 4F53A 3MYVA 4BSXA 5J08A 3OXGA 5KBAA 2DZOA 2WMOA 4R7LA 3SI5A 1HFAA 3C72A 3FU6A 3PZ2A 2GRNB 3FEYA 1ZB1A 4PS8A 4XZ4A 1LF8A 3ZRHA 2IF4A 2GRRB 3QB2A 5LX8A 1Z3YA 2MYOA 2P9NG 4EZLA 3FUIA 4AXHA 5ANRA 4N39A 3DEPA 2GRPB 3BUAA 3KEZA 2WMNA 4TV3A 3VTYA 4CDNA 3AG2E 3CVYA 2LO6A 5C2YA 3URZA 1YMPA 2YHCA 5JHBA 1DCQA 3UKUG 1IKND 3TWWA 2XZDG 2VGEA 3ISMC 3J5PA 3JUIA 4ZHBA 4DLQA 1Q2ZA 2LXLA 2QFCA 1MQSA 3LY9A 3WXXA 3Q9UC 4AP2A 2R02A 3ASNE 3GZSA 2I9CA 1EYHA 5G04J 3LVRE 2XPYA 4UWFA 2FULA 3FU0A 4ILIA 2GRLA 4XE0A 2P9KG 4JC8A 2JABA 3TWTA 4JHRA 2WXRA 5EYLA 2GGFA 1MHQA 1QQEA 4UI9J 5DIZA 2YHEA 2KZTB 1A5EA 3L9TA 2NC9A 3CK8A 4FA6A 3L6AA 5T3RA 3VLFA 1YA0A 2EIKE 1H19A 2CG2A 1JUQA 3EIJA 3CHRA 4G8KA 3ZU7B 2RKKA 3ONLA 2HR2A 3SD5A 5BPPA 3B95A 5BXUA 3LJ3A 4Q94A 2KCLA 5BW8C 2CHWA 3ESLA 4GA2A 3O4ZA 3LDZA 3D9OA 2Y4UA 4M3OA 4UQYA 2A5UA 5D66A 3D3MA 4LNUD 3EHRA 3Q15A 3PE3A 4HRLA 4L9PA 4FHKA 3DWLG 1H0AA 2KBXA 4K5AB 2DBAA 3NB2A 4PH4B 5HI7A 1QNFA 5ENQD 3CVUA 4GPMA 3PS6A 3FUMA 2QZAA 3D9PA 3ASGA 2WQ6A 2XEHA 2BUGA 3Q75A 3FUEA 3RJVA 3L22A 4O6FA 2HM8A 1GW6A 2X6KA 4OVVA 1JCRA 2IO2C 2YINA 2YNQA 3G2WA 1U3DA 4OAVB 4EZJA 4LRZA 4B89A 1UW4B 4EPZA 1INZA 3QOUA 4K5CA 4RSYA 5AAOA 3PZ4A 3JCKC 2C0LA 1N9AA 1JPLA 1NA3A 2VYIA 5FQ4A 4G11A 3T8KA 4N5QA 1JWGA 3V79K 5EILA 4LUNU 2FI7A 5H7PA 4J8EA 4AV7A 4TXQA 4ACKA 2J09A 3ESKA 4GYOA 3U66A 4GCNA 2VGXA 1Z3XA 4U8YD 3FTXA 4FLBA 3L08A 1OCOE 3PUJA 3UX4A 3AG3E 4BTBA 3FUNA 4I9EA 5AIJA 2P9IG 5FINA 4UWLA 4WNEA 4N3BA 3U9WA 4I43A 4HVBA 3TWXA 3FUHA 3L13A 3CQCB 3LS8A 2OEWA 1IHGA 3HDXA 4FP7A 4CZ2D 3G2UA 3ZHEB 1VDYA 4GZCA 2GW1A 3TWQA 2BKKB 3UI2A 2F8YA 1N4PA 3AU5A 4JXTA 3CKCA 5FQ7A 2PL2A 3ASDA 3EUVA 3ZIMA 2R05A 2JEKA 3ZEFA 1NZNA 3HXCA 4ATZD 4G23A 4UI9K 3FUKA 3TWSA 2WQ7A 3B7SA 3FU5A 4KZCA 2IOSA 1QYMA 3QKYA 3FTWA 4GU5A 1KT0A 2XEEA 2C2LA 3FTUA 3FU3A 4LNGA 4DLOA 3KAEA 3RIBA 3DSSA 3ZYQA 1AWCB 4IYPA 4JB8P 3W9GA 5HRYA 3RO2A 1BU9A 3Q47B 3Q4AB 3QWPA 2V4LA 4A63B 5ANLA 3DPYA 4G8LA 3TL5A 3AAAC 3ZYLA 3QARA 1K1BA 1DVPA 4LCTA 4B8AA 1FCHA 4UUCA 3ULYA 3Q79A 3IV0A 1BI7B 3TGOA 2B0OE 3CR3A 4TXPA 3LJNA 3B13A 3Q7FA 5CMWA 3HIZA 5HQ8A 1SQMA 2OEVA 4H7XA 3B7BA 4YNDA 2Y69E 2P9UG 5AQAA 2I2OA 4J8YA 3CSFA 3FH5A 4FU3A 3V2XA 2ZXWE 4WUYA 5G04C 5E75A 1QBQA 2UY1A 4JHKA 4O1OA 4DX2A 4JPSA 3B7RL 3JXIA 3TXNA 2KCVA 4B94A 4WNDA 2J49A 3AS4A 1IYGA 3MKQA 4YDWA 2WB2A 3AJIA 3MX3A 3D9JA 3TG4A 4AEZC 2X6IA 4J7WA 5KJNA 4GTPA 5JJTA 5D0OD 4CYMD 3KSQA 4EQFA 4ATGA 5G05C 1DCEA 1IHBA 4ANVA 3CVNA 2OOEA 1TNUA 3APFA 3TWRA 3CHMA 3TWVA 1ZBPA 2BEDA 2XGOA 4APFA 3OTNA 3QC1A 1UN8A 4URKA 4AIFA 3SZ7A 3ZYKA 4WWPA 1N54A 2PZIA 5CEAA 3ZNGA 1IQUA 1LD8A 5AARA 3RU0A 5M72A 3IHYA 3V30A 5HKPA 3JUEA 2L9BA 3CIAA 2ETAA 1JWFA 4PDXA 3NQPA 4HNAD 3I4GA 3MEKA 1NP7A 1E8ZA 1TN8A 4JZYA 4ZFHA 4MS6A 1KZPA 5A7DB 4HBDA 5KNGA 2EIME 3EHQA 3ULQA 3L17A 3PRZA 5B1AE 3SQVA 2KATA 4Q69A 2FO1E 3U4TA 3FTZA 4YDOA 1N4RA 2CFZA 4DUIA 3ZXPA 3FFLA 1OCRE 5KWDA 5AJDA 2I6HA 3E30A 3U64A 4HI8A 3GZ2A 2VSOE 3V31A 3C3RA 5BT1A 1KPSB 4FHJA 4JEHA 4ILHB 3ZHEA 2XQ0A 2QYUA 3IBEA 4AVXA 5BV0A 4F3VA 3AS5A 2F8XK 2MRIA 5KNHD 4XI9A 3UUXA 1EF1C 4I2ZA 4AY5A 2VQ2A 4IN3B 3RAUA 1BI8B 2GROB 5AYWD 4IRUA 5G55A 1AP7A 1H6KA 4PS3A 3HXFA 4F6RD 1O1TA 2ZU6B 3KD7A 3SBTB 1UOHA 3NF1A 2UWJG 4GTQA 2KC7A 2J9QA 2IY0C 4JVSA 3ZFWA 4UWKA 2V5QC 3G2VA 3R7RA 4APOA 4N2QA 2WXNA 4WAFA 3IHVA 3SFYA 5BXOA 1WY6A 4J0UA 2PM6A 3IKOB 4HRMB 3NZSA 4U7EB 3EU9A 3TWUA 1TYQG 1D8EA 1MX4A 2XRYA 4F7AA 1A17A 3CVLA 3UINC 3ZUVB 4JW1A 1KT1A 1E96B 3UT4A 4U04A 4TUUA 4XKBA 3E32A 3L16A 4UWHA 2BTDA 3MV2B 5A23A 2WXHA 5T4YA 3LPZA 1HU3A 1ELRA 1TEZA 2OV8A 2WXIA 1OWNA 3QWVA 5BV1A 1N94A 2HO1A 4NIKA 1NA0A 3HRAA 3MA5A 3UM2A 3DXKG 3HXDA 3JQ1A 4K03A 1LTXA 4V3IA 1TNBA 3DRAA 3B7TA 5FZSA 5CEDB 2XCBA 4RLYA 4BX8A 1MX2A 3X2QE 1N0QA 1FT2A 3PREA 1Y8MA 4YVOA 3HVEA 2EINE 3FUJA 3S7BA 3C98A 3FWVA 5JMND 5CBOA 3SNXA 1BD8A 5DBKA 3CVXA 5D0QD 4GTRA 5LCWJ 4DX6D 2AXZA 2VTBB 1O5MA 2X38A 4U8HA 4P29A 2WXFA 5ENSD 3LKUA 3K9IA 3CV0A 1N11A 3WG7E 2DIWA 3LEWA 4KVMA 3BG0B 4HXIA 1OWLA 4XX5A 2LNIA 1E8XA 2KXPC 4RVBA 3OXFA 2J08A 4OYSA 4AM9A 2IQCA 1UN9A 2KZTA 2B6CA 4EHMA 1G3NB 2IFUA 4L2YA 3NZUA 5HS0A 2FEZA 4MRUA 4GA0A 4GB9A 4BWRA 4RG6A 4LERA 5ENOD 4RQIA 5AJLA 4BT8A 5FQ8A 4LG6A 3G2TA 4GZ5A 3ZN3A 2AW6A 1U2VG 1D9SA 2WXJA 3S7JA 4BETA 1OT8A 4U8VD 2OVBA 1E7UA 2LSVA 3QWWA 4N2SA 5FTPA 2ZIRA 1H2TC 1TNZA 5EN5D 2NYJA 2P9LG 4G1TA 3RO3A 3V2OA 4A1SA 5JHAA 3MZLB 4L7TA 4MLPA 4C0EA 4JEUA 4I9CA 1K1AA 3Q78A 4JD2G 4KYOB 3DSWA 4HOSA 3FP3A 4BESA 3DBSA 4GTVA 4IULA 2ETCA 5JJ7A 1WAO1 2QY7A 2WM9A 2RFAA 4EBAA 4LNBA 2PNNA 4WWOA 2H6GA 2ONDA 3S7FA 4L2LA 1N4QA 3C5RA 5FZRA 3ASOE 1MJ0A 4GTSA 5EX3A 2E0IA 4NURA 3SY2A 1LD7A 4FLHA 3N71A 1JCSA 1N95A 3GZ1A 3D9MA 2L0TB 4CGWA 3G2SA 3JQ0A 4OAUC 5ENPD 4AOFA 4U0UA 4CCAA 1S0PA 1XGWA 2AVPA 2ZISA 5A6CA 3ZW3A 3CHQA 1JCQA 3KS2A 3PZDA 4EZKA 5AQBA 4GZ3A 2J4BA 4GMLA 3UPVA 3EHNA 3Q73A 2EIJE 3FTYA 4N5CA 4KBQA 2IONA 2RFMA 1HF8A 5B1BE 4XKCA 4C48B 2DCPA 4G26A 5FQ6A 1KZOA 3ZVVA 4A3TA 4K0RA 3P2BA 1HG2A 4Y6WA 1IQRA 4HS2A 2Y1LE 4LSZE 4CT0A 1U3CA 2GRMA 4G25A 4I6EA 4ANWA 5CCMA 3PUKA 4BFRA 1HZ4A 1TNYA 2P9SG 2OCCE 4U63A 4EECA 5LFAA 4KZ0A 5AN8A 3EJNA 4TXRA 3E4BA 4HOQA 3QAQA 2J4DA 2FO7A 2R03A 4GA1A 1TNOA 4CDMA 2H6HA 4C9BB 5FWQA 3VLDA 4W9RA 1NL4A 2F0YA 3HHMA 4WWNA 2WXOA 1S64A 4HOTA 1E8YA 1O1RA 3HXEA 3SF4A 2YQ8A 3Q7AA 5EX0A 3VTXA 1SA4A 3Q9NC 2X6JA 2XENA 4PUCA 4A3VA 2P58C 2Q7FA 4A1GA 3T5XA 4B93B 4DX1A 1NI1A 4M7CA 3SGHA 2KCKA 4MKTA 4U0ZA 4YDEA 2NXPA 2J07A 2AXVA 3NAWA 5J90A 3EDTB 1UJKA 1DNPA 3CVQA 3RK6A 3J5QB 4GAAA 1SVXA 1MZCA 1K8KG 3PNTB 4UQXA 2X3MA 2KM4A 3UKRG 4FC8A 2F37A 3FUFA 3AS8A 4GYWA 5KJMA 3FEXA 1FVHA 5C1DA 4LEUA 5EIDA 5BUZA 1OWOA 5EIBE 2NSZA 4JL0A 2WXPA 4G2VA 1PAQA 1SZAA 4AY6A 4I1MA 3RRMB 4JA7A 3UIOC 4DK5A 2QYJA 4J8FA 4FULA 3UXGA 4KVOA 3E34A 3MJWA 5FZQA 3UTMA 2P9PG 1HH8A 2VGXB 2DYRE 5IY5E 3NBNB 2HYZA 4QQIA 1V55E 3CVWA 4GCOA 2CG3A 3FY4A 2CHXA 4MBGA 3ML8A 5FT9A 1X5BA 3APCA 2LXMA 3D9LA 3ZGQA 1Z6TA 2FBNA 3PNLB 4BT9A 3LY7A 4D10C 2PQNA 3C3QA 3R9MA 3UT8A 1HO8A 3ASFA 1HG5A 3LXUX 5ARGA 2I1KA 5EYPF 3SBSA 3PH0C 2LUHA 4DI3A 3SFZA 2M63A 4B0ZA 3S2AA 3BQOA 3SFXA 4WNFA 1V54E 3DEOA 2EILE 2VGYA 3LCAA 5CCLA 3KEAA 3CEQA 4GZDA 1Y6IA 3CK9A 3LVQE 3D9NA 4N3CA 5ENNA 2A4ZA 3PEUB 4HB5A 3NOCD 2Y3AA 2XHEA 2BF0X 2RG8A 2R2LA 3CVPA 3ABKE 1FVFA 3FUDA 1H6OA 3PZ3A 1N0RA 4I6GA 2VSXE 4TRQA 1SW6A
chains in the Genus database with same CATH topology
1ELKA 3RO2A 2WQHA 3Q47B 2LNIA 1P5QA 1E8XA 3O48A 3Q4AB 4RVBA 2R59A 3OXFA 3QWPA 4HLEA 2J08A 2WXQA 4OYSA 4AM9A 2V8SE 3Q5MA 2V4LA 4DJAA 4ME2A 3BEEA 3FTVA 1H2UA 2JLBA 3OAWA 3I5PA 5ANLA 4KT6B 4NQ0A 5EDSA 2FF4A 1UN9A 2IQCA 3TL5A 2KZTA 5E76A 3QARA 3ZYLA 2L6JA 4KXKB 2IFUA 1DVPA 4LCTA 4L2YA 3NZUA 4B8AA 2L0IA 5CHEE 5KJKA 1HX8A 2FEZA 1FCHA 4MRUA 2AWIA 3B7UX 3IV0A 2VTBA 3FHEA 4GA0A 3TGOA 3FTSA 2XRZA 1XNFA 3R7QA 3APDA 2WXKA 3CR3A 3ONKA 4H7YA 4Q96A 3EIQC 4GB9A 4BWRA 4RG6A 3QNKA 4LERA 4J6IA 3VLEA 3GYZA 3B13A 5AJLA 3QJZA 4BT8A 4HORA 2X6FA 2XGMA 5FQ8A 2IOLA 3G2TA 5CMWA 3HIZA 5HQ8A 4GZ5A 4J8DA 1SQMA 3ZN3A 4H7XA 4YNDA 3UT7A 4FADA 2AW6A 2IJGX 3CHOA 3CLJA 2WXJA 3I3NA 3LYAA 2I2OA 3S7JA 1OWPA 3ASHA 4E6HA 2ILRA 4WNGA 2OVBA 3CSFA 1E7UA 4F53A 2LSVA 3MYVA 4BSXA 5J08A 3FH5A 4FU3A 3QWWA 3OXGA 2WXMA 4N2SA 2EQXA 5FTPA 1H2TC 2WMOA 4R7LA 4WUYA 5G04C 3SI5A 5E75A 1HFAA 3FU6A 4G1TA 3FEYA 4PS8A 4XZ4A 3RO3A 2UY1A 2VJ8A 4JHKA 1LF8A 4A1SA 2VSNA 2IF4A 3ZRHA 5JHAA 3MZLB 4L7TA 4MLPA 3QB2A 4C0EA 4E85A 4JEUA 5LX8A 1Z3YA 4GMJA 4JPSA 1TJCA 3CKBA 2V5FA 4EZLA 1B89A 4I9CA 4JHJA 3FUIA 1OWMA 3B7RL 3PEVB 4AXHA 4HOUA 4CEMA 5LP0A 2PQRA 4KYOB 5ANRA 4N39A 3TXNA 4HOSA 2KCVA 5CMYA 4WNDA 2J49A 4B94A 3FP3A 3AS4A 1IYGA 3KEZA 2XCCA 3DBSA 3MKQA 2WMNA 4OVUA 3FH8A 4TV3A 3VTYA 4CDNA 4IULA 5JJ7A 3CVYA 4DPRA 1WAO1 2LO6A 5C2YA 3URZA 2YHCA 5JHBA 3MV3B 2WB2A 2QY7A 2WM9A 3QDNA 3CHSA 3JUIA 4EBAA 3MX3A 4AJWA 3D9JA 3TG4A 4DLQA 4WWOA 4AEZC 2ONDA 2X6IA 2QFCA 3S7FA 4L2LA 1MQSA 3LY9A 3ZYMA 3WXXA 2XEVA 5FZRA 3UQ3A 4AP2A 5EX3A 4F1SA 4NRHB 2E0IA 4NURA 5KJNA 5JJTA 2MHKA 3GZSA 4ABNA 5D0OD 4FLHA 2I9CA 1EYHA 3N71A 4EQFA 5G04J 3GZ1A 2OVFA 3D9MA 2L0TB 4CGWA 3LVRE 2XPYA 4UWFA 3G2SA 3JQ0A 4ATGA 5KJLA 2FULA 4XIFA 4I17A 3FU0A 4FJZA 5G05C 4ILIA 4AOFA 4U0UA 2GRLA 2LSUA 4CCAA 1S0PA 1XGWA 2AVPA 4XE0A 4JC8A 3TXMA 4ANVA 3CVNA 5A6CA 2OOEA 4JHRA 3APFA 3TG5A 2WVIA 2WXRA 2I1JA 3CHMA 3ZW3A 1ZU2A 1ZBPA 2GGFA 3CHQA 1MHQA 2XGOA 3OTNA 5KCMA 3QC1A 3KS2A 3PZDA 1UN8A 4APFA 4EZKA 4URKA 1SZ9A 4AIFA 1QQEA 4UI9J 2WXLA 3SZ7A 5DIZA 2YHEA 2KZTB 4GZ3A 3ZYKA 4WWPA 4I2WA 1N54A 5FJYA 2PZIA 2J4BA 2NC9A 3CK8A 4FA6A 4GMLA 3SHFA 3UPVA 3EHNA 1IQUA 3L6AA 5T3RA 4N5CA 3FTYA 3VLFA 4U07A 1YA0A 4KBQA 1H19A 3RU0A 4RG9A 2IONA 3IHYA 2CG2A 3T8MA 5M72A 1JUQA 1HF8A 3EIJA 3PVLA 3CHRA 1HS6A 4XKCA 3ONLA 2DCPA 2L9BA 3CIAA 3MGBA 5JJ6A 2HR2A 3RKVA 4C0MA 4G26A 3SD5A 5FQ6A 1JWFA 5BPPA 3LY8A 3ZVVA 4A3TA 4K0RA 3P2BA 1HG2A 4Y6WA 1IQRA 4HS2A 4PDXA 3NQPA 3I4GA 4L23A 4CT0A 3LJ3A 1U3CA 3MEKA 2GRMA 2KCLA 3BG1B 2CHWA 1NP7A 3ESLA 4G25A 4I6EA 5BW8C 4ANWA 5CCMA 3PUKA 1E8ZA 1HXIA 3FULA 4GA2A 1HZ4A 4JZYA 3O4ZA 4MS6A 4BFRA 3AU4A 4U63A 1W3BA 4EECA 5LFAA 4KZ0A 5A7DB 3LDZA 3D9OA 3FH7A 4NACA 3CVVA 2Y4UA 4M3OA 3EJNA 3ENEA 4UQYA 2A5UA 3E4BA 3CHPA 4HOQA 1KLXA 3QAQA 2J4DA 3D3MA 2FO7A 3TAXA 4BTAA 1L5JA 3Q15A 3L17A 3PRZA 3ULQA 3PE3A 4GA1A 2KATA 4CDMA 4EBAG 4Q69A 4C9BB 4FHKA 5FWQA 3VLDA 4W9RA 3U4TA 3FTZA 3HHMA 4WWNA 2PM7A 1H0AA 3D9KA 2CFZA 1OUVA 2WXOA 2DBAA 3PDNA 4HOTA 1E8YA 3FFLA 3OXLA 4PH4B 3ZPJA 5AJDA 5HI7A 2I6HA 1QNFA 3SF4A 3U64A 5ARFA 2YQ8A 3P1UA 2WXGA 3CVUA 5EX0A 3VTXA 3L54A 1TEZA 3GZ2A 3PS6A 2X6JA 4PUCA 3FUMA 4A3VA 2VSOE 3D9PA 4J8SA 2P58C 4ANXA 2Q7FA 4A1GA 4XI0A 3T5XA 4KMOA 3ASGA 2WQ6A 5BT1A 3FDHA 4FHJA 2BUGA 4JEHA 3FUEA 4ILHB 3MKRA 3RJVA 3L22A 3SGHA 3ZHEA 4JA9A 4O6FA 3TJPA 1UG3A 2XQ0A 2KCKA 3IBEA 2HM8A 4MKTA 1GW6A 2X6KA 4OVVA 4U0ZA 2NXPA 4AVXA 2J07A 2AXVA 5BV0A 2YINA 2YNQA 3G2WA 3AS5A 4F3VA 3HYMB 2MRIA 5J90A 3EDTB 4XI9A 3UUXA 1EF1C 4I2ZA 1UJKA 4AY5A 1U3DA 2VQ2A 1DNPA 3CVQA 3RK6A 4IN3B 4EZJA 1PY1A 3ZXSA 2AXUA 4GAAA 2R17C 4LRZA 4B89A 5G2NA 1E90A 1UW4B 1EDUA 5AYWD 4EPZA 1INZA 4IRUA 3QOUA 4RSYA 5G55A 3PNTB 3JCKC 2C0LA 4UQXA 1H6KA 2X3MA 4PS3A 4I6JA 1JPLA 2KM4A 4FC8A 3T5VA 1NA3A 2VYIA 5FQ4A 4G11A 3FUFA 3AS8A 1JWGA 2ZU6B 3KD7A 4GYWA 3SBTB 3NF1A 4ANUA 4LUNU 5T8IA 1QZ2A 2FI7A 2UWJG 5KJMA 3FEXA 4YVQC 5LCWC 2CFUA 1FVHA 2KC7A 4J8EA 4LEUA 5C1DA 4AV7A 3EHMA 5BUZA 4GZ6A 4N3AA 2J9QA 2X6HA 1OWOA 4JVSA 3ZFWA 2LAIA 4ACKA 2V0PA 2NSZA 4JL0A 2J09A 4UWKA 3ESKA 3G2VA 2WXPA 4G2VA 3R7RA 4GYOA 4APOA 1PAQA 1SZAA 4N2QA 3U66A 2WPVA 4ACLA 4GCNA 4I1MA 2WXNA 2VGXA 4Q94A 4WAFA 4AY6A 1Z3XA 3IHVA 3RRMB 1WY6A 3FTXA 4J0UA 4FLBA 4JA7A 3RRNB 3L08A 2XPIA 3PUJA 2PM6A 3IKOB 4U0SA 3NZSA 4DK5A 4Y6CA 1WM5A 4J8FA 4FULA 4KVOA 3UX4A 4BTBA 3FUNA 1ELWA 4A55A 4I9EA 5AIJA 3MJWA 2XRYA 4F7AA 1A17A 5FZQA 1HE8A 2XGSA 3CVLA 1HH8A 5BNWA 2IU1A 4UWLA 4HFGA 4JW1A 1KT1A 2VGXB 2Y4TA 4GYYA 4N3BA 4WNEA 3U9WA 3ML9A 4I43A 4HVBA 1E96B 3UT4A 2E2EA 3FUHA 3L13A 2HYZA 4U04A 3CQCB 4TUUA 4XKBA 4FJYA 5G05J 3L16A 4UWHA 3LS8A 2BTDA 3RRUA 3R9AB 3MV2B 1IHGA 3HDXA 4FP7A 3G2UA 5A23A 2WXHA 4GCOA 3CVWA 5T4YA 3LPZA 1HU3A 1ELRA 2CG3A 1VDYA 2OV8A 2CHXA 3FY4A 2WXIA 1OWNA 3QWVA 3ZHEB 5BV1A 3MCXA 2XPZA 2GW1A 4GZCA 1N52A 3ML8A 4I1OB 1BPOA 5FT9A 1X5BA 2HO1A 2LAHA 3APCA 3D9LA 3ZGQA 4DI4A 4BY6A 1NA0A 1Z6TA 2FBNA 2UY1B 3MA5A 3UMVA 1TJFA 3PNLB 2VSYA 4BT9A 5AENA 3LY7A 4D10C 3AU5A 3U3WA 5LOZA 2PQNA 3D9IA 5EKQD 4JXTA 3Q49B 3JQ1A 4GPKA 4K03A 3UT8A 1H2VC 1HO8A 3ASFA 1HG5A 3LXUX 4V3IA 3CKCA 3GW4A 5ARGA 5FQ7A 1E7VA 4QFVA 2I1KA 4BX9A 3B7TA 2CHZA 3SBSA 4CT4A 3PH0C 5FZSA 2XCBA 2PL2A 4DI3A 3SFZA 2M63A 4B0ZA 3ASDA 3S2AA 4BX8A 3CSTA 4CDRA 4WNFA 3ZIMA 3PREA 1Y8MA 4YVOA 3HVEA 4L1BA 2JEKA 3HVEB 3ZEFA 3FUJA 4I1AA 1NZNA 3I4RB 3S7BA 2VGYA 4G23A 3C98A 3FWVA 4UI9K 3LCAA 3FUKA 2WQ7A 4G24A 3S7DA 3SNXA 5CCLA 5DBKA 3B7SA 3CVXA 4PS7A 5D0QD 4UWGA 3FU5A 3CEQA 3DPDA 4GZDA 3QK0A 5LCWJ 1Y6IA 3CK9A 3LVQE 3D9NA 1E8WA 4KZCA 4UQZA 1UJJA 2IOSA 4N3CA 4ILGA 3QKYA 5ENNA 2A4ZA 3PEUB 3FTWA 4GU5A 1KT0A 3IEGA 4UI9C 2AXZA 2Y3AA 3CK7A 2XHEA 2BF0X 2RD0A 2MOWA 2VTBB 4U8HA 2C2LA 2RG8A 2X38A 4P29A 2R5SA 3CVPA 1PC2A 3FTUA 2WXFA 3FU3A 4DLOA 3CQGB 1FVFA 3KAEA 3K9IA 2C0MA 3CV0A 3LKUA 3RIBA 4B8CB 3FUDA 3ZYQA 3PE4A 2DIWA 3LEWA 4KVMA 4IYPA 4CGVA 3BG0B 4CRWA 4HXIA 1EPUA 3CGHA 3JYSA 1OWLA 3MKQB 4XX5A 4I6GA 2VSXE 4TRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZU6 B;  4GMJ A;  4CT4 A;  2I2O A;  3JUI A;  1HU3 A;  2IOS A;  2FUL A;  4LUN U;  2KZT B;  3FEX A;  4JHJ A;  3RK6 A;  2VSO E;  1N54 A;  1N52 A;  4CEM A;  4C9B B;  4GML A;  3EIQ C;  2RG8 A;  5ANR A;  1H2U A;  3L6A A;  4B89 A;  2IU1 A;  1UW4 B;  2NSZ A;  1H2T C;  4B8C B;  2ION A;  2KZT A;  2IOL A;  4IUL A;  1H6K A;  3EIJ A;  1PAQ A;  1UG3 A;  4CRW A;  2HM8 A;  3FEY A;  2GGF A;  1H2V C;  4JHK A;  4B8A A;  2VSX E;  3D3M A; 
#chains in the Genus database with same CATH topology
 2WQH A;  3O48 A;  4HLE A;  2R59 A;  2WXQ A;  3PZ1 A;  3UIP C;  2V8S E;  1MX6 A;  3FTV A;  4HLL A;  3DSV A;  4KT6 B;  4NQ0 A;  5E76 A;  4O1P A;  2L6J A;  4KXK B;  5CHE E;  5KJK A;  2VTB A;  3FHE A;  1RZ4 A;  3FTS A;  2XRZ A;  4GTT A;  3ONK A;  4Q96 A;  2V4H C;  4J6I A;  3BU8 A;  3GYZ A;  2XGM A;  5ENT D;  4FAD A;  3CLJ A;  3LYA A;  3I3N A;  1OWP A;  3ASH A;  1DC2 A;  2WXM A;  2ZGD A;  2EQX A;  3E33 A;  2DYS E;  1OCZ E;  3SO8 A;  1OY3 D;  2VJ8 A;  2VSN A;  4BSZ B;  4E85 A;  4GMJ A;  1TJC A;  3CKB A;  2V5F A;  1B89 A;  4JHJ A;  1OWM A;  3PEV B;  5FIO A;  4HOU A;  4CEM A;  5LP0 A;  2PQR A;  5AQ7 A;  5CMY A;  1X81 A;  2XCC A;  4OVU A;  2H6I A;  3FH8 A;  2XZT G;  3ULE G;  4DPR A;  3MV3 B;  5AQ9 A;  3QDN A;  3CHS A;  4AJW A;  1YCS B;  3E37 A;  3ZYM A;  2XEV A;  3UQ3 A;  4F1S A;  4NRH B;  1OXJ A;  4U96 D;  2MHK A;  4ABN A;  2IEJ A;  2OVF A;  2XS8 A;  5KJL A;  4XIF A;  4I17 A;  4FJZ A;  4O60 A;  2LSU A;  3AG1 E;  5CBN A;  3TXM A;  3TG5 A;  2WVI A;  2I1J A;  1ZU2 A;  5KCM A;  1SZ9 A;  3RSE G;  2WXL A;  3KSL A;  1S70 B;  4I2W A;  5FJY A;  3SHF A;  5CER B;  4DX7 D;  4U07 A;  3JXJ A;  4RG9 A;  3T8M A;  3PVL A;  4HQD A;  1HS6 A;  2AJA A;  5JJ6 A;  4C0M A;  3MGB A;  3RKV A;  1K3Z D;  3LY8 A;  3D9H A;  4L23 A;  3DST A;  3BG1 B;  1MYO A;  1HXI A;  3FUL A;  3AU4 A;  1W3B A;  3FH7 A;  4NAC A;  3CVV A;  3ENE A;  3CHP A;  1KLX A;  3TAX A;  4BTA A;  4BEP A;  1L5J A;  5ITZ F;  1O1S A;  3AG4 E;  1D8D A;  4EBA G;  2XS1 A;  4GTO A;  1YYH A;  2PM7 A;  3D9K A;  1OUV A;  3PDN A;  2L6B A;  3OXL A;  5ENR D;  5B3S E;  3ZPJ A;  2DVW A;  5ARF A;  3P1U A;  2WXG A;  3ABL E;  3L54 A;  4J8S A;  3DSX A;  1Z5S C;  4ANX A;  1WG0 A;  4XI0 A;  4KMO A;  4YDY A;  4DRX E;  3FDH A;  3C3O A;  3MKR A;  4JA9 A;  3IXE A;  3TJP A;  1UG3 A;  1TN7 A;  3EU5 A;  3HYM B;  1PY1 A;  3ZXS A;  2AXU A;  2R17 C;  1NFI E;  5G2N A;  1E90 A;  1EDU A;  4I6J A;  3T5V A;  4ANU A;  5T8I A;  1QZ2 A;  5LCW C;  4YVQ C;  2CFU A;  3EHM A;  2P2C P;  2ZGG A;  4GZ6 A;  4N3A A;  2X6H A;  2LAI A;  5CRV A;  2V0P A;  5CRU A;  3DXM G;  4U95 D;  3F6Q A;  3L82 A;  2WPV A;  4ACL A;  3W9F A;  3RRN B;  2XPI A;  3UM1 A;  4U0S A;  4Y6C A;  1WM5 A;  3DSU A;  2DZN A;  1ELW A;  4A55 A;  1HE8 A;  2XGS A;  5BNW A;  2IU1 A;  4HFG A;  4XEI G;  2Y4T A;  4GYY A;  3ZKJ A;  3ML9 A;  2E2E A;  2IO3 C;  4FJY A;  1IXV A;  5G05 J;  4TUM A;  3RRU A;  3R9A B;  3MCX A;  4K5B A;  2XPZ A;  4I1O B;  1N52 A;  1BPO A;  2LAH A;  4DI4 A;  4BY6 A;  2UY1 B;  3UMV A;  1TJF A;  2VSY A;  5AEN A;  3U3W A;  5LOZ A;  1FT1 A;  3D9I A;  5EKQ D;  3Q49 B;  4GPK A;  1H2V C;  3GW4 A;  1E7V A;  4QFV A;  4CT4 A;  4BX9 A;  2CHZ A;  5CEC B;  1SA5 A;  4DX5 D;  4HI9 A;  1TN6 A;  4X8Q A;  3CST A;  4BER A;  4CDR A;  2A5E A;  3UM3 A;  4L1B A;  3T9K A;  3HVE B;  4I1A A;  1N4S A;  3I4R B;  1OCC E;  3NOG D;  4G24 A;  3S7D A;  4PS7 A;  4UWG A;  1H6P A;  2BKG A;  3DPD A;  3QK0 A;  3UM0 A;  1E8W A;  4UQZ A;  1BLX B;  1UJJ A;  4ILG A;  2ETB A;  4Z68 A;  4UI9 C;  3IEG A;  3CK7 A;  2RD0 A;  2MOW A;  2R5S A;  1PC2 A;  2GRQ B;  3CQG B;  4B8C B;  2C0M A;  3PE4 A;  4CGV A;  4CRW A;  1WDY A;  1EPU A;  2HE0 A;  3CGH A;  3JYS A;  3MKQ B;  1ELK A;  4GMR A;  1P5Q A;  3HXB A;  4GTM A;  3Q5M A;  4DJA A;  4ME2 A;  3BEE A;  3OAW A;  1H2U A;  2J8S D;  2JLB A;  3I5P A;  5EDS A;  2FF4 A;  1S63 A;  2L0I A;  1HX8 A;  1TR4 A;  2AWI A;  1FPP A;  3B7U X;  4F1P A;  1XNF A;  3R7Q A;  3APD A;  2WXK A;  2Y0B G;  4H7Y A;  3EIQ C;  3ABM E;  5D2M C;  3QNK A;  3VLE A;  3QJZ A;  4HOR A;  2X6F A;  2IOL A;  4J8D A;  4HRN A;  2QC9 A;  2H6F A;  3UT7 A;  1RW2 A;  3HG0 D;  2IJG X;  3CHO A;  4E6H A;  2ILR A;  4WNG A;  5JA4 D;  2DWZ A;  4F53 A;  3MYV A;  4BSX A;  5J08 A;  3OXG A;  5KBA A;  2DZO A;  2WMO A;  4R7L A;  3SI5 A;  1HFA A;  3C72 A;  3FU6 A;  3PZ2 A;  2GRN B;  3FEY A;  1ZB1 A;  4PS8 A;  4XZ4 A;  1LF8 A;  3ZRH A;  2IF4 A;  2GRR B;  3QB2 A;  5LX8 A;  1Z3Y A;  2MYO A;  2P9N G;  4EZL A;  3FUI A;  4AXH A;  5ANR A;  4N39 A;  3DEP A;  2GRP B;  3BUA A;  3KEZ A;  2WMN A;  4TV3 A;  3VTY A;  4CDN A;  3AG2 E;  3CVY A;  2LO6 A;  5C2Y A;  3URZ A;  1YMP A;  2YHC A;  5JHB A;  1DCQ A;  3UKU G;  1IKN D;  3TWW A;  2XZD G;  2VGE A;  3ISM C;  3J5P A;  3JUI A;  4ZHB A;  4DLQ A;  1Q2Z A;  2LXL A;  2QFC A;  1MQS A;  3LY9 A;  3WXX A;  3Q9U C;  4AP2 A;  2R02 A;  3ASN E;  3GZS A;  2I9C A;  1EYH A;  5G04 J;  3LVR E;  2XPY A;  4UWF A;  2FUL A;  3FU0 A;  4ILI A;  2GRL A;  4XE0 A;  2P9K G;  4JC8 A;  2JAB A;  3TWT A;  4JHR A;  2WXR A;  5EYL A;  2GGF A;  1MHQ A;  1QQE A;  4UI9 J;  5DIZ A;  2YHE A;  2KZT B;  1A5E A;  3L9T A;  2NC9 A;  3CK8 A;  4FA6 A;  3L6A A;  5T3R A;  3VLF A;  1YA0 A;  2EIK E;  1H19 A;  2CG2 A;  1JUQ A;  3EIJ A;  3CHR A;  4G8K A;  3ZU7 B;  2RKK A;  3ONL A;  2HR2 A;  3SD5 A;  5BPP A;  3B95 A;  5BXU A;  3LJ3 A;  4Q94 A;  2KCL A;  5BW8 C;  2CHW A;  3ESL A;  4GA2 A;  3O4Z A;  3LDZ A;  3D9O A;  2Y4U A;  4M3O A;  4UQY A;  2A5U A;  5D66 A;  3D3M A;  4LNU D;  3EHR A;  3Q15 A;  3PE3 A;  4HRL A;  4L9P A;  4FHK A;  3DWL G;  1H0A A;  2KBX A;  4K5A B;  2DBA A;  3NB2 A;  4PH4 B;  5HI7 A;  1QNF A;  5ENQ D;  3CVU A;  4GPM A;  3PS6 A;  3FUM A;  2QZA A;  3D9P A;  3ASG A;  2WQ6 A;  2XEH A;  2BUG A;  3Q75 A;  3FUE A;  3RJV A;  3L22 A;  4O6F A;  2HM8 A;  1GW6 A;  2X6K A;  4OVV A;  1JCR A;  2IO2 C;  2YIN A;  2YNQ A;  3G2W A;  1U3D A;  4OAV B;  4EZJ A;  4LRZ A;  4B89 A;  1UW4 B;  4EPZ A;  1INZ A;  3QOU A;  4K5C A;  4RSY A;  5AAO A;  3PZ4 A;  3JCK C;  2C0L A;  1N9A A;  1JPL A;  1NA3 A;  2VYI A;  5FQ4 A;  4G11 A;  3T8K A;  4N5Q A;  1JWG A;  3V79 K;  5EIL A;  4LUN U;  2FI7 A;  5H7P A;  4J8E A;  4AV7 A;  4TXQ A;  4ACK A;  2J09 A;  3ESK A;  4GYO A;  3U66 A;  4GCN A;  2VGX A;  1Z3X A;  4U8Y D;  3FTX A;  4FLB A;  3L08 A;  1OCO E;  3PUJ A;  3UX4 A;  3AG3 E;  4BTB A;  3FUN A;  4I9E A;  5AIJ A;  2P9I G;  5FIN A;  4UWL A;  4WNE A;  4N3B A;  3U9W A;  4I43 A;  4HVB A;  3TWX A;  3FUH A;  3L13 A;  3CQC B;  3LS8 A;  2OEW A;  1IHG A;  3HDX A;  4FP7 A;  4CZ2 D;  3G2U A;  3ZHE B;  1VDY A;  4GZC A;  2GW1 A;  3TWQ A;  2BKK B;  3UI2 A;  2F8Y A;  1N4P A;  3AU5 A;  4JXT A;  3CKC A;  5FQ7 A;  2PL2 A;  3ASD A;  3EUV A;  3ZIM A;  2R05 A;  2JEK A;  3ZEF A;  1NZN A;  3HXC A;  4ATZ D;  4G23 A;  4UI9 K;  3FUK A;  3TWS A;  2WQ7 A;  3B7S A;  3FU5 A;  4KZC A;  2IOS A;  1QYM A;  3QKY A;  3FTW A;  4GU5 A;  1KT0 A;  2XEE A;  2C2L A;  3FTU A;  3FU3 A;  4LNG A;  4DLO A;  3KAE A;  3RIB A;  3DSS A;  3ZYQ A;  1AWC B;  4IYP A;  4JB8 P;  3W9G A;  5HRY A;  3RO2 A;  1BU9 A;  3Q47 B;  3Q4A B;  3QWP A;  2V4L A;  4A63 B;  5ANL A;  3DPY A;  4G8L A;  3TL5 A;  3AAA C;  3ZYL A;  3QAR A;  1K1B A;  1DVP A;  4LCT A;  4B8A A;  1FCH A;  4UUC A;  3ULY A;  3Q79 A;  3IV0 A;  1BI7 B;  3TGO A;  2B0O E;  3CR3 A;  4TXP A;  3LJN A;  3B13 A;  3Q7F A;  5CMW A;  3HIZ A;  5HQ8 A;  1SQM A;  2OEV A;  4H7X A;  3B7B A;  4YND A;  2Y69 E;  2P9U G;  5AQA A;  2I2O A;  4J8Y A;  3CSF A;  3FH5 A;  4FU3 A;  3V2X A;  2ZXW E;  4WUY A;  5G04 C;  5E75 A;  1QBQ A;  2UY1 A;  4JHK A;  4O1O A;  4DX2 A;  4JPS A;  3B7R L;  3JXI A;  3TXN A;  2KCV A;  4B94 A;  4WND A;  2J49 A;  3AS4 A;  1IYG A;  3MKQ A;  4YDW A;  2WB2 A;  3AJI A;  3MX3 A;  3D9J A;  3TG4 A;  4AEZ C;  2X6I A;  4J7W A;  5KJN A;  4GTP A;  5JJT A;  5D0O D;  4CYM D;  3KSQ A;  4EQF A;  4ATG A;  5G05 C;  1DCE A;  1IHB A;  4ANV A;  3CVN A;  2OOE A;  1TNU A;  3APF A;  3TWR A;  3CHM A;  3TWV A;  1ZBP A;  2BED A;  2XGO A;  4APF A;  3OTN A;  3QC1 A;  1UN8 A;  4URK A;  4AIF A;  3SZ7 A;  3ZYK A;  4WWP A;  1N54 A;  2PZI A;  5CEA A;  3ZNG A;  1IQU A;  1LD8 A;  5AAR A;  3RU0 A;  5M72 A;  3IHY A;  3V30 A;  5HKP A;  3JUE A;  2L9B A;  3CIA A;  2ETA A;  1JWF A;  4PDX A;  3NQP A;  4HNA D;  3I4G A;  3MEK A;  1NP7 A;  1E8Z A;  1TN8 A;  4JZY A;  4ZFH A;  4MS6 A;  1KZP A;  5A7D B;  4HBD A;  5KNG A;  2EIM E;  3EHQ A;  3ULQ A;  3L17 A;  3PRZ A;  5B1A E;  3SQV A;  2KAT A;  4Q69 A;  2FO1 E;  3U4T A;  3FTZ A;  4YDO A;  1N4R A;  2CFZ A;  4DUI A;  3ZXP A;  3FFL A;  1OCR E;  5KWD A;  5AJD A;  2I6H A;  3E30 A;  3U64 A;  4HI8 A;  3GZ2 A;  2VSO E;  3V31 A;  3C3R A;  5BT1 A;  1KPS B;  4FHJ A;  4JEH A;  4ILH B;  3ZHE A;  2XQ0 A;  2QYU A;  3IBE A;  4AVX A;  5BV0 A;  4F3V A;  3AS5 A;  2F8X K;  2MRI A;  5KNH D;  4XI9 A;  3UUX A;  1EF1 C;  4I2Z A;  4AY5 A;  2VQ2 A;  4IN3 B;  3RAU A;  1BI8 B;  2GRO B;  5AYW D;  4IRU A;  5G55 A;  1AP7 A;  1H6K A;  4PS3 A;  3HXF A;  4F6R D;  1O1T A;  2ZU6 B;  3KD7 A;  3SBT B;  1UOH A;  3NF1 A;  2UWJ G;  4GTQ A;  2KC7 A;  2J9Q A;  2IY0 C;  4JVS A;  3ZFW A;  4UWK A;  2V5Q C;  3G2V A;  3R7R A;  4APO A;  4N2Q A;  2WXN A;  4WAF A;  3IHV A;  3SFY A;  5BXO A;  1WY6 A;  4J0U A;  2PM6 A;  3IKO B;  4HRM B;  3NZS A;  4U7E B;  3EU9 A;  3TWU A;  1TYQ G;  1D8E A;  1MX4 A;  2XRY A;  4F7A A;  1A17 A;  3CVL A;  3UIN C;  3ZUV B;  4JW1 A;  1KT1 A;  1E96 B;  3UT4 A;  4U04 A;  4TUU A;  4XKB A;  3E32 A;  3L16 A;  4UWH A;  2BTD A;  3MV2 B;  5A23 A;  2WXH A;  5T4Y A;  3LPZ A;  1HU3 A;  1ELR A;  1TEZ A;  2OV8 A;  2WXI A;  1OWN A;  3QWV A;  5BV1 A;  1N94 A;  2HO1 A;  4NIK A;  1NA0 A;  3HRA A;  3MA5 A;  3UM2 A;  3DXK G;  3HXD A;  3JQ1 A;  4K03 A;  1LTX A;  4V3I A;  1TNB A;  3DRA A;  3B7T A;  5FZS A;  5CED B;  2XCB A;  4RLY A;  4BX8 A;  1MX2 A;  3X2Q E;  1N0Q A;  1FT2 A;  3PRE A;  1Y8M A;  4YVO A;  3HVE A;  2EIN E;  3FUJ A;  3S7B A;  3C98 A;  3FWV A;  5JMN D;  5CBO A;  3SNX A;  1BD8 A;  5DBK A;  3CVX A;  5D0Q D;  4GTR A;  5LCW J;  4DX6 D;  2AXZ A;  2VTB B;  1O5M A;  2X38 A;  4U8H A;  4P29 A;  2WXF A;  5ENS D;  3LKU A;  3K9I A;  3CV0 A;  1N11 A;  3WG7 E;  2DIW A;  3LEW A;  4KVM A;  3BG0 B;  4HXI A;  1OWL A;  4XX5 A;  2LNI A;  1E8X A;  2KXP C;  4RVB A;  3OXF A;  2J08 A;  4OYS A;  4AM9 A;  2IQC A;  1UN9 A;  2KZT A;  2B6C A;  4EHM A;  1G3N B;  2IFU A;  4L2Y A;  3NZU A;  5HS0 A;  2FEZ A;  4MRU A;  4GA0 A;  4GB9 A;  4BWR A;  4RG6 A;  4LER A;  5ENO D;  4RQI A;  5AJL A;  4BT8 A;  5FQ8 A;  4LG6 A;  3G2T A;  4GZ5 A;  3ZN3 A;  2AW6 A;  1U2V G;  1D9S A;  2WXJ A;  3S7J A;  4BET A;  1OT8 A;  4U8V D;  2OVB A;  1E7U A;  2LSV A;  3QWW A;  4N2S A;  5FTP A;  2ZIR A;  1H2T C;  1TNZ A;  5EN5 D;  2NYJ A;  2P9L G;  4G1T A;  3RO3 A;  3V2O A;  4A1S A;  5JHA A;  3MZL B;  4L7T A;  4MLP A;  4C0E A;  4JEU A;  4I9C A;  1K1A A;  3Q78 A;  4JD2 G;  4KYO B;  3DSW A;  4HOS A;  3FP3 A;  4BES A;  3DBS A;  4GTV A;  4IUL A;  2ETC A;  5JJ7 A;  1WAO 1;  2QY7 A;  2WM9 A;  2RFA A;  4EBA A;  4LNB A;  2PNN A;  4WWO A;  2H6G A;  2OND A;  3S7F A;  4L2L A;  1N4Q A;  3C5R A;  5FZR A;  3ASO E;  1MJ0 A;  4GTS A;  5EX3 A;  2E0I A;  4NUR A;  3SY2 A;  1LD7 A;  4FLH A;  3N71 A;  1JCS A;  1N95 A;  3GZ1 A;  3D9M A;  2L0T B;  4CGW A;  3G2S A;  3JQ0 A;  4OAU C;  5ENP D;  4AOF A;  4U0U A;  4CCA A;  1S0P A;  1XGW A;  2AVP A;  2ZIS A;  5A6C A;  3ZW3 A;  3CHQ A;  1JCQ A;  3KS2 A;  3PZD A;  4EZK A;  5AQB A;  4GZ3 A;  2J4B A;  4GML A;  3UPV A;  3EHN A;  3Q73 A;  2EIJ E;  3FTY A;  4N5C A;  4KBQ A;  2ION A;  2RFM A;  1HF8 A;  5B1B E;  4XKC A;  4C48 B;  2DCP A;  4G26 A;  5FQ6 A;  1KZO A;  3ZVV A;  4A3T A;  4K0R A;  3P2B A;  1HG2 A;  4Y6W A;  1IQR A;  4HS2 A;  2Y1L E;  4LSZ E;  4CT0 A;  1U3C A;  2GRM A;  4G25 A;  4I6E A;  4ANW A;  5CCM A;  3PUK A;  4BFR A;  1HZ4 A;  1TNY A;  2P9S G;  2OCC E;  4U63 A;  4EEC A;  5LFA A;  4KZ0 A;  5AN8 A;  3EJN A;  4TXR A;  3E4B A;  4HOQ A;  3QAQ A;  2J4D A;  2FO7 A;  2R03 A;  4GA1 A;  1TNO A;  4CDM A;  2H6H A;  4C9B B;  5FWQ A;  3VLD A;  4W9R A;  1NL4 A;  2F0Y A;  3HHM A;  4WWN A;  2WXO A;  1S64 A;  4HOT A;  1E8Y A;  1O1R A;  3HXE A;  3SF4 A;  2YQ8 A;  3Q7A A;  5EX0 A;  3VTX A;  1SA4 A;  3Q9N C;  2X6J A;  2XEN A;  4PUC A;  4A3V A;  2P58 C;  2Q7F A;  4A1G A;  3T5X A;  4B93 B;  4DX1 A;  1NI1 A;  4M7C A;  3SGH A;  2KCK A;  4MKT A;  4U0Z A;  4YDE A;  2NXP A;  2J07 A;  2AXV A;  3NAW A;  5J90 A;  3EDT B;  1UJK A;  1DNP A;  3CVQ A;  3RK6 A;  3J5Q B;  4GAA A;  1SVX A;  1MZC A;  1K8K G;  3PNT B;  4UQX A;  2X3M A;  2KM4 A;  3UKR G;  4FC8 A;  2F37 A;  3FUF A;  3AS8 A;  4GYW A;  5KJM A;  3FEX A;  1FVH A;  5C1D A;  4LEU A;  5EID A;  5BUZ A;  1OWO A;  5EIB E;  2NSZ A;  4JL0 A;  2WXP A;  4G2V A;  1PAQ A;  1SZA A;  4AY6 A;  4I1M A;  3RRM B;  4JA7 A;  3UIO C;  4DK5 A;  2QYJ A;  4J8F A;  4FUL A;  3UXG A;  4KVO A;  3E34 A;  3MJW A;  5FZQ A;  3UTM A;  2P9P G;  1HH8 A;  2VGX B;  2DYR E;  5IY5 E;  3NBN B;  2HYZ A;  4QQI A;  1V55 E;  3CVW A;  4GCO A;  2CG3 A;  3FY4 A;  2CHX A;  4MBG A;  3ML8 A;  5FT9 A;  1X5B A;  3APC A;  2LXM A;  3D9L A;  3ZGQ A;  1Z6T A;  2FBN A;  3PNL B;  4BT9 A;  3LY7 A;  4D10 C;  2PQN A;  3C3Q A;  3R9M A;  3UT8 A;  1HO8 A;  3ASF A;  1HG5 A;  3LXU X;  5ARG A;  2I1K A;  5EYP F;  3SBS A;  3PH0 C;  2LUH A;  4DI3 A;  3SFZ A;  2M63 A;  4B0Z A;  3S2A A;  3BQO A;  3SFX A;  4WNF A;  1V54 E;  3DEO A;  2EIL E;  2VGY A;  3LCA A;  5CCL A;  3KEA A;  3CEQ A;  4GZD A;  1Y6I A;  3CK9 A;  3LVQ E;  3D9N A;  4N3C A;  5ENN A;  2A4Z A;  3PEU B;  4HB5 A;  3NOC D;  2Y3A A;  2XHE A;  2BF0 X;  2RG8 A;  2R2L A;  3CVP A;  3ABK E;  1FVF A;  3FUD A;  1H6O A;  3PZ3 A;  1N0R A;  4I6G A;  2VSX E;  4TRQ A;  1SW6 A; 
#chains in the Genus database with same CATH homology
 1ELK A;  3RO2 A;  2WQH A;  3Q47 B;  2LNI A;  1P5Q A;  1E8X A;  3O48 A;  3Q4A B;  4RVB A;  2R59 A;  3OXF A;  3QWP A;  4HLE A;  2J08 A;  2WXQ A;  4OYS A;  4AM9 A;  2V8S E;  3Q5M A;  2V4L A;  4DJA A;  4ME2 A;  3BEE A;  3FTV A;  1H2U A;  2JLB A;  3OAW A;  3I5P A;  5ANL A;  4KT6 B;  4NQ0 A;  5EDS A;  2FF4 A;  1UN9 A;  2IQC A;  3TL5 A;  2KZT A;  5E76 A;  3QAR A;  3ZYL A;  2L6J A;  4KXK B;  2IFU A;  1DVP A;  4LCT A;  4L2Y A;  3NZU A;  4B8A A;  2L0I A;  5CHE E;  5KJK A;  1HX8 A;  2FEZ A;  1FCH A;  4MRU A;  2AWI A;  3B7U X;  3IV0 A;  2VTB A;  3FHE A;  4GA0 A;  3TGO A;  3FTS A;  2XRZ A;  1XNF A;  3R7Q A;  3APD A;  2WXK A;  3CR3 A;  3ONK A;  4H7Y A;  4Q96 A;  3EIQ C;  4GB9 A;  4BWR A;  4RG6 A;  3QNK A;  4LER A;  4J6I A;  3VLE A;  3GYZ A;  3B13 A;  5AJL A;  3QJZ A;  4BT8 A;  4HOR A;  2X6F A;  2XGM A;  5FQ8 A;  2IOL A;  3G2T A;  5CMW A;  3HIZ A;  5HQ8 A;  4GZ5 A;  4J8D A;  1SQM A;  3ZN3 A;  4H7X A;  4YND A;  3UT7 A;  4FAD A;  2AW6 A;  2IJG X;  3CHO A;  3CLJ A;  2WXJ A;  3I3N A;  3LYA A;  2I2O A;  3S7J A;  1OWP A;  3ASH A;  4E6H A;  2ILR A;  4WNG A;  2OVB A;  3CSF A;  1E7U A;  4F53 A;  2LSV A;  3MYV A;  4BSX A;  5J08 A;  3FH5 A;  4FU3 A;  3QWW A;  3OXG A;  2WXM A;  4N2S A;  2EQX A;  5FTP A;  1H2T C;  2WMO A;  4R7L A;  4WUY A;  5G04 C;  3SI5 A;  5E75 A;  1HFA A;  3FU6 A;  4G1T A;  3FEY A;  4PS8 A;  4XZ4 A;  3RO3 A;  2UY1 A;  2VJ8 A;  4JHK A;  1LF8 A;  4A1S A;  2VSN A;  2IF4 A;  3ZRH A;  5JHA A;  3MZL B;  4L7T A;  4MLP A;  3QB2 A;  4C0E A;  4E85 A;  4JEU A;  5LX8 A;  1Z3Y A;  4GMJ A;  4JPS A;  1TJC A;  3CKB A;  2V5F A;  4EZL A;  1B89 A;  4I9C A;  4JHJ A;  3FUI A;  1OWM A;  3B7R L;  3PEV B;  4AXH A;  4HOU A;  4CEM A;  5LP0 A;  2PQR A;  4KYO B;  5ANR A;  4N39 A;  3TXN A;  4HOS A;  2KCV A;  5CMY A;  4WND A;  2J49 A;  4B94 A;  3FP3 A;  3AS4 A;  1IYG A;  3KEZ A;  2XCC A;  3DBS A;  3MKQ A;  2WMN A;  4OVU A;  3FH8 A;  4TV3 A;  3VTY A;  4CDN A;  4IUL A;  5JJ7 A;  3CVY A;  4DPR A;  1WAO 1;  2LO6 A;  5C2Y A;  3URZ A;  2YHC A;  5JHB A;  3MV3 B;  2WB2 A;  2QY7 A;  2WM9 A;  3QDN A;  3CHS A;  3JUI A;  4EBA A;  3MX3 A;  4AJW A;  3D9J A;  3TG4 A;  4DLQ A;  4WWO A;  4AEZ C;  2OND A;  2X6I A;  2QFC A;  3S7F A;  4L2L A;  1MQS A;  3LY9 A;  3ZYM A;  3WXX A;  2XEV A;  5FZR A;  3UQ3 A;  4AP2 A;  5EX3 A;  4F1S A;  4NRH B;  2E0I A;  4NUR A;  5KJN A;  5JJT A;  2MHK A;  3GZS A;  4ABN A;  5D0O D;  4FLH A;  2I9C A;  1EYH A;  3N71 A;  4EQF A;  5G04 J;  3GZ1 A;  2OVF A;  3D9M A;  2L0T B;  4CGW A;  3LVR E;  2XPY A;  4UWF A;  3G2S A;  3JQ0 A;  4ATG A;  5KJL A;  2FUL A;  4XIF A;  4I17 A;  3FU0 A;  4FJZ A;  5G05 C;  4ILI A;  4AOF A;  4U0U A;  2GRL A;  2LSU A;  4CCA A;  1S0P A;  1XGW A;  2AVP A;  4XE0 A;  4JC8 A;  3TXM A;  4ANV A;  3CVN A;  5A6C A;  2OOE A;  4JHR A;  3APF A;  3TG5 A;  2WVI A;  2WXR A;  2I1J A;  3CHM A;  3ZW3 A;  1ZU2 A;  1ZBP A;  2GGF A;  3CHQ A;  1MHQ A;  2XGO A;  3OTN A;  5KCM A;  3QC1 A;  3KS2 A;  3PZD A;  1UN8 A;  4APF A;  4EZK A;  4URK A;  1SZ9 A;  4AIF A;  1QQE A;  4UI9 J;  2WXL A;  3SZ7 A;  5DIZ A;  2YHE A;  2KZT B;  4GZ3 A;  3ZYK A;  4WWP A;  4I2W A;  1N54 A;  5FJY A;  2PZI A;  2J4B A;  2NC9 A;  3CK8 A;  4FA6 A;  4GML A;  3SHF A;  3UPV A;  3EHN A;  1IQU A;  3L6A A;  5T3R A;  4N5C A;  3FTY A;  3VLF A;  4U07 A;  1YA0 A;  4KBQ A;  1H19 A;  3RU0 A;  4RG9 A;  2ION A;  3IHY A;  2CG2 A;  3T8M A;  5M72 A;  1JUQ A;  1HF8 A;  3EIJ A;  3PVL A;  3CHR A;  1HS6 A;  4XKC A;  3ONL A;  2DCP A;  2L9B A;  3CIA A;  3MGB A;  5JJ6 A;  2HR2 A;  3RKV A;  4C0M A;  4G26 A;  3SD5 A;  5FQ6 A;  1JWF A;  5BPP A;  3LY8 A;  3ZVV A;  4A3T A;  4K0R A;  3P2B A;  1HG2 A;  4Y6W A;  1IQR A;  4HS2 A;  4PDX A;  3NQP A;  3I4G A;  4L23 A;  4CT0 A;  3LJ3 A;  1U3C A;  3MEK A;  2GRM A;  2KCL A;  3BG1 B;  2CHW A;  1NP7 A;  3ESL A;  4G25 A;  4I6E A;  5BW8 C;  4ANW A;  5CCM A;  3PUK A;  1E8Z A;  1HXI A;  3FUL A;  4GA2 A;  1HZ4 A;  4JZY A;  3O4Z A;  4MS6 A;  4BFR A;  3AU4 A;  4U63 A;  1W3B A;  4EEC A;  5LFA A;  4KZ0 A;  5A7D B;  3LDZ A;  3D9O A;  3FH7 A;  4NAC A;  3CVV A;  2Y4U A;  4M3O A;  3EJN A;  3ENE A;  4UQY A;  2A5U A;  3E4B A;  3CHP A;  4HOQ A;  1KLX A;  3QAQ A;  2J4D A;  3D3M A;  2FO7 A;  3TAX A;  4BTA A;  1L5J A;  3Q15 A;  3L17 A;  3PRZ A;  3ULQ A;  3PE3 A;  4GA1 A;  2KAT A;  4CDM A;  4EBA G;  4Q69 A;  4C9B B;  4FHK A;  5FWQ A;  3VLD A;  4W9R A;  3U4T A;  3FTZ A;  3HHM A;  4WWN A;  2PM7 A;  1H0A A;  3D9K A;  2CFZ A;  1OUV A;  2WXO A;  2DBA A;  3PDN A;  4HOT A;  1E8Y A;  3FFL A;  3OXL A;  4PH4 B;  3ZPJ A;  5AJD A;  5HI7 A;  2I6H A;  1QNF A;  3SF4 A;  3U64 A;  5ARF A;  2YQ8 A;  3P1U A;  2WXG A;  3CVU A;  5EX0 A;  3VTX A;  3L54 A;  1TEZ A;  3GZ2 A;  3PS6 A;  2X6J A;  4PUC A;  3FUM A;  4A3V A;  2VSO E;  3D9P A;  4J8S A;  2P58 C;  4ANX A;  2Q7F A;  4A1G A;  4XI0 A;  3T5X A;  4KMO A;  3ASG A;  2WQ6 A;  5BT1 A;  3FDH A;  4FHJ A;  2BUG A;  4JEH A;  3FUE A;  4ILH B;  3MKR A;  3RJV A;  3L22 A;  3SGH A;  3ZHE A;  4JA9 A;  4O6F A;  3TJP A;  1UG3 A;  2XQ0 A;  2KCK A;  3IBE A;  2HM8 A;  4MKT A;  1GW6 A;  2X6K A;  4OVV A;  4U0Z A;  2NXP A;  4AVX A;  2J07 A;  2AXV A;  5BV0 A;  2YIN A;  2YNQ A;  3G2W A;  3AS5 A;  4F3V A;  3HYM B;  2MRI A;  5J90 A;  3EDT B;  4XI9 A;  3UUX A;  1EF1 C;  4I2Z A;  1UJK A;  4AY5 A;  1U3D A;  2VQ2 A;  1DNP A;  3CVQ A;  3RK6 A;  4IN3 B;  4EZJ A;  1PY1 A;  3ZXS A;  2AXU A;  4GAA A;  2R17 C;  4LRZ A;  4B89 A;  5G2N A;  1E90 A;  1UW4 B;  1EDU A;  5AYW D;  4EPZ A;  1INZ A;  4IRU A;  3QOU A;  4RSY A;  5G55 A;  3PNT B;  3JCK C;  2C0L A;  4UQX A;  1H6K A;  2X3M A;  4PS3 A;  4I6J A;  1JPL A;  2KM4 A;  4FC8 A;  3T5V A;  1NA3 A;  2VYI A;  5FQ4 A;  4G11 A;  3FUF A;  3AS8 A;  1JWG A;  2ZU6 B;  3KD7 A;  4GYW A;  3SBT B;  3NF1 A;  4ANU A;  4LUN U;  5T8I A;  1QZ2 A;  2FI7 A;  2UWJ G;  5KJM A;  3FEX A;  4YVQ C;  5LCW C;  2CFU A;  1FVH A;  2KC7 A;  4J8E A;  4LEU A;  5C1D A;  4AV7 A;  3EHM A;  5BUZ A;  4GZ6 A;  4N3A A;  2J9Q A;  2X6H A;  1OWO A;  4JVS A;  3ZFW A;  2LAI A;  4ACK A;  2V0P A;  2NSZ A;  4JL0 A;  2J09 A;  4UWK A;  3ESK A;  3G2V A;  2WXP A;  4G2V A;  3R7R A;  4GYO A;  4APO A;  1PAQ A;  1SZA A;  4N2Q A;  3U66 A;  2WPV A;  4ACL A;  4GCN A;  4I1M A;  2WXN A;  2VGX A;  4Q94 A;  4WAF A;  4AY6 A;  1Z3X A;  3IHV A;  3RRM B;  1WY6 A;  3FTX A;  4J0U A;  4FLB A;  4JA7 A;  3RRN B;  3L08 A;  2XPI A;  3PUJ A;  2PM6 A;  3IKO B;  4U0S A;  3NZS A;  4DK5 A;  4Y6C A;  1WM5 A;  4J8F A;  4FUL A;  4KVO A;  3UX4 A;  4BTB A;  3FUN A;  1ELW A;  4A55 A;  4I9E A;  5AIJ A;  3MJW A;  2XRY A;  4F7A A;  1A17 A;  5FZQ A;  1HE8 A;  2XGS A;  3CVL A;  1HH8 A;  5BNW A;  2IU1 A;  4UWL A;  4HFG A;  4JW1 A;  1KT1 A;  2VGX B;  2Y4T A;  4GYY A;  4N3B A;  4WNE A;  3U9W A;  3ML9 A;  4I43 A;  4HVB A;  1E96 B;  3UT4 A;  2E2E A;  3FUH A;  3L13 A;  2HYZ A;  4U04 A;  3CQC B;  4TUU A;  4XKB A;  4FJY A;  5G05 J;  3L16 A;  4UWH A;  3LS8 A;  2BTD A;  3RRU A;  3R9A B;  3MV2 B;  1IHG A;  3HDX A;  4FP7 A;  3G2U A;  5A23 A;  2WXH A;  4GCO A;  3CVW A;  5T4Y A;  3LPZ A;  1HU3 A;  1ELR A;  2CG3 A;  1VDY A;  2OV8 A;  2CHX A;  3FY4 A;  2WXI A;  1OWN A;  3QWV A;  3ZHE B;  5BV1 A;  3MCX A;  2XPZ A;  2GW1 A;  4GZC A;  1N52 A;  3ML8 A;  4I1O B;  1BPO A;  5FT9 A;  1X5B A;  2HO1 A;  2LAH A;  3APC A;  3D9L A;  3ZGQ A;  4DI4 A;  4BY6 A;  1NA0 A;  1Z6T A;  2FBN A;  2UY1 B;  3MA5 A;  3UMV A;  1TJF A;  3PNL B;  2VSY A;  4BT9 A;  5AEN A;  3LY7 A;  4D10 C;  3AU5 A;  3U3W A;  5LOZ A;  2PQN A;  3D9I A;  5EKQ D;  4JXT A;  3Q49 B;  3JQ1 A;  4GPK A;  4K03 A;  3UT8 A;  1H2V C;  1HO8 A;  3ASF A;  1HG5 A;  3LXU X;  4V3I A;  3CKC A;  3GW4 A;  5ARG A;  5FQ7 A;  1E7V A;  4QFV A;  2I1K A;  4BX9 A;  3B7T A;  2CHZ A;  3SBS A;  4CT4 A;  3PH0 C;  5FZS A;  2XCB A;  2PL2 A;  4DI3 A;  3SFZ A;  2M63 A;  4B0Z A;  3ASD A;  3S2A A;  4BX8 A;  3CST A;  4CDR A;  4WNF A;  3ZIM A;  3PRE A;  1Y8M A;  4YVO A;  3HVE A;  4L1B A;  2JEK A;  3HVE B;  3ZEF A;  3FUJ A;  4I1A A;  1NZN A;  3I4R B;  3S7B A;  2VGY A;  4G23 A;  3C98 A;  3FWV A;  4UI9 K;  3LCA A;  3FUK A;  2WQ7 A;  4G24 A;  3S7D A;  3SNX A;  5CCL A;  5DBK A;  3B7S A;  3CVX A;  4PS7 A;  5D0Q D;  4UWG A;  3FU5 A;  3CEQ A;  3DPD A;  4GZD A;  3QK0 A;  5LCW J;  1Y6I A;  3CK9 A;  3LVQ E;  3D9N A;  1E8W A;  4KZC A;  4UQZ A;  1UJJ A;  2IOS A;  4N3C A;  4ILG A;  3QKY A;  5ENN A;  2A4Z A;  3PEU B;  3FTW A;  4GU5 A;  1KT0 A;  3IEG A;  4UI9 C;  2AXZ A;  2Y3A A;  3CK7 A;  2XHE A;  2BF0 X;  2RD0 A;  2MOW A;  2VTB B;  4U8H A;  2C2L A;  2RG8 A;  2X38 A;  4P29 A;  2R5S A;  3CVP A;  1PC2 A;  3FTU A;  2WXF A;  3FU3 A;  4DLO A;  3CQG B;  1FVF A;  3KAE A;  3K9I A;  2C0M A;  3CV0 A;  3LKU A;  3RIB A;  4B8C B;  3FUD A;  3ZYQ A;  3PE4 A;  2DIW A;  3LEW A;  4KVM A;  4IYP A;  4CGV A;  3BG0 B;  4CRW A;  4HXI A;  1EPU A;  3CGH A;  3JYS A;  1OWL A;  3MKQ B;  4XX5 A;  4I6G A;  2VSX E;  4TRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...