2GGFA

Solution structure of the ma3 domain of human programmed cell death 4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
b'GSSGSSGLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Programmed cell death 4, isoform 1
publication title Solution structure of the MA3 domain of human Programmed cell death 4
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ggfA00
2IONA 3FEYA 4CT4A 1H2UA 3L6AA 1UG3A 1H2TC 4B8CB 1H2VC 4GMLA 4CEMA 2KZTA 2VSXE 3FEXA 4JHKA 5ANRA 2RG8A 4LUNU 1PAQA 4CRWA 3EIQC 1UW4B 2I2OA 3EIJA 4GMJA 2NSZA 3JUIA 4C9BB 1N52A 2HM8A 2VSOE 2IOLA 2KZTB 2GGFA 2FULA 4B89A 1N54A 2IU1A 4IULA 2ZU6B 1HU3A 4JHJA 3RK6A 3D3MA 1H6KA 4B8AA 2IOSA
chains in the Genus database with same CATH superfamily
4RQIA 3NOCD 4DX1A 4CCAA 2P9PG 4ILHB 2RD0A 4B94A 1P5QA 2KZTB 3FUIA 4DI4A 3CKBA 4B89A 4L9PA 3CVYA 4KZ0A 1KZPA 3U64A 4WNEA 3CHQA 1N95A 2FEZA 2PQNA 3EIJA 4GU5A 3C3OA 1TN7A 4HOUA 4OAUC 1OCOE 1JUQA 4L1BA 5ENNA 3ZUVB 3JQ0A 3I5PA 3IHVA 1PAQA 4JPSA 1IKND 1BLXB 3CKCA 2IEJA 1FT1A 2VSNA 2IO2C 4N3CA 3SF4A 3Q4AB 4FLHA 1UJJA 3CSFA 5BPPA 4DJAA 5BW8C 4L2LA 1H2TC 3MEKA 4ACLA 5CBNA 1SA4A 2P2CP 4GMJA 3ASGA 1AWCB 3DBSA 1N54A 2KCVA 3DSWA 3RK6A 5J08A 3Q78A 2BKKB 3O48A 4GCNA 4JZYA 3QDNA 2QYJA 3U4TA 3Q9UC 3KEZA 4DK5A 4N5QA 3CVVA 4N3AA 1S0PA 2QYUA 3JYSA 3TGOA 3OXLA 5FWQA 4GTVA 3G2TA 2X6HA 3KSQA 3ML9A 3HXCA 4LNUD 2L0TB 4K0RA 2P9IG 3PVLA 1H6OA 4TXQA 1WY6A 3LYAA 1YYHA 2KZTA 4JC8A 4U8YD 3T8MA 4HRMB 4RG9A 4TRQA 4ZHBA 2EQXA 2XZDG 3R9MA 2RKKA 3L08A 3FP3A 5T4YA 5DIZA 4GZ3A 3L22A 2H6GA 2KATA 1MYOA 5FINA 2UWJG 3RRMB 4HLLA 3CVUA 2WXRA 4GTMA 2WXOA 3WG7E 1U2VG 5EYLA 4EZJA 3FUFA 2NYJA 5AJLA 5KJMA 2XZTG 3ISMC 4B8CB 4KXKB 1NA3A 3PUKA 3QWPA 2BUGA 2WB2A 3IKOB 4DX5D 1HG5A 2WXNA 1OCZE 1Z3XA 1MZCA 2OVBA 3F6QA 2VJ8A 4F1SA 1N0QA 1YCSB 3ZN3A 5LOZA 1VDYA 2RFAA 1OY3D 5B1AE 5D2MC 2EINE 2HR2A 3X2QE 4PS7A 3SFZA 4U7EB 4Y6CA 2WVIA 2ZISA 1HU3A 4WWNA 1MJ0A 1QBQA 2E0IA 5D0QD 4UI9C 3OXFA 4BERA 4V3IA 5CHEE 3W9FA 4BWRA 4K5CA 2ZGDA 4WNFA 4HOSA 1OCRE 1ELWA 3Q73A 2I9CA 5LCWC 5KWDA 3RU0A 1YMPA 3BG0B 2IJGX 4AY6A 3MYVA 2LXMA 5BUZA 2AJAA 3Q49B 1UN9A 3NF1A 3BUAA 2PM7A 3FH7A 3K9IA 4GPMA 4GA2A 4GB9A 3NZSA 3KD7A 1OWMA 3CVPA 3ZYLA 1DC2A 3RAUA 2MOWA 3EHQA 3CQGB 3LDZA 4APOA 2MHKA 2Y1LE 3AJIA 4WUYA 3TWTA 1X81A 4FP7A 1N94A 4YDYA 1TNOA 1E90A 1A17A 3ZHEB 3E4BA 2HE0A 1MX2A 3UT4A 1LD7A 4G8LA 3DPYA 3TG5A 4N39A 2F8XK 3V31A 2WXKA 1A5EA 2GRMA 3B95A 1JCSA 4GTRA 4DLQA 5EX0A 2ETBA 3ULEG 1ELKA 3G2VA 3UINC 3D9OA 4CZ2D 3FTXA 3AG3E 2ONDA 4CT4A 1K1BA 4UWFA 1BI8B 4O1OA 4GYYA 3Q9NC 3FTVA 2HYZA 3D9HA 2GW1A 5E75A 3FU6A 3D3MA 3SI5A 3FTWA 1S70B 1TJFA 3PE4A 4O1PA 3VTXA 4HLEA 4DX6D 1OT8A 1E7VA 1SVXA 3FEXA 2WXHA 4LUNU 3DRAA 5JJ7A 3DWLG 4HRLA 4HXIA 2I2OA 2YHEA 4B93B 2I1KA 1WG0A 4J8YA 3U9WA 3L9TA 3GZ2A 4XI0A 4GZCA 2R05A 3CHMA 1HZ4A 4HOQA 1PC2A 1KPSB 4DRXE 5G2NA 3HDXA 4GTTA 1JWFA 2LXLA 2Y0BG 2WXFA 3NZUA 1L5JA 1N0RA 3MKQB 4C9BB 3B7SA 2PNNA 3MGBA 4HB5A 4JHJA 3T5VA 2FF4A 4KMOA 4FJYA 4OVUA 4ATGA 3AU5A 2GRRB 4WWPA 1O5MA 4CEMA 3UUXA 3FFLA 1OWNA 4UWGA 4F53A 1OWPA 1N11A 3ZHEA 4RSYA 2OCCE 3B7UX 1V54E 1TR4A 2WM9A 3TWUA 3E32A 3MCXA 4U8HA 5AJDA 3V79K 3QB2A 4J8SA 1XNFA 2EILE 3DSSA 5EIDA 2DYSE 4HI8A 2GRPB 2J07A 2KCLA 3JCKC 4NIKA 5CMWA 4UWLA 3PZ2A 4L2YA 2LSVA 3L13A 1GW6A 4NQ0A 4WAFA 2XCBA 2AXZA 4FA6A 2HM8A 4G11A 3MA5A 4KVOA 5BV1A 4UI9J 3QWVA 1UN8A 5A6CA 1NA0A 4U8VD 4L7TA 3O4ZA 2V5QC 3SY2A 4N3BA 1N4QA 3FHEA 4R7LA 5LCWJ 2J4BA 3MKRA 3ASNE 1Z6TA 5EYPF 5CEAA 4HORA 2JLBA 5A7DB 3UTMA 3FWVA 3CK8A 1K3ZD 4DX7D 3ASFA 5AYWD 3MKQA 3L17A 5ENSD 2YQ8A 3PEVB 5FQ6A 2KCKA 1FCHA 3JXJA 5IY5E 5AQ7A 2B0OE 2Y4TA 2LAIA 4XX5A 4Q69A 4BX9A 3SQVA 2ZGGA 2L6BA 2QFCA 3VLEA 2VSYA 4ILIA 1OCCE 3PZ1A 4AY5A 2L0IA 3TWXA 2VSOE 2V8SE 3DSXA 2XEVA 5AN8A 4J6IA 2C0MA 3TXNA 3TWSA 3PEUB 1OUVA 2J9QA 1OWLA 2VGEA 4G25A 5T3RA 3SFXA 5J90A 3HRAA 4LNGA 3JUIA 3ASHA 1Y6IA 3E33A 2FULA 3AU4A 3D9JA 4JHRA 4U63A 3HXBA 5AQBA 4HOTA 3S7DA 2AXUA 5JJTA 5B1BE 2EIKE 4GMLA 3QJZA 1O1SA 1E8YA 1XGWA 2VTBB 2I6HA 4MLPA 2HO1A 3CLJA 4OYSA 3AS4A 2VGXB 2KBXA 3HYMB 2XEHA 3RO3A 3B7TA 4BY6A 4ABNA 3SBSA 1HS6A 1PY1A 4CDRA 4EBAG 2P9LG 3ENEA 2EIME 5ENTD 4GTQA 4OVVA 3QAQA 3TWWA 2J08A 1H2VC 4F6RD 4FU3A 3ZGQA 1AP7A 3SFYA 3N71A 1QQEA 2P9SG 5HS0A 4O60A 4UQXA 4GCOA 3R9AB 4I9CA 3KSLA 4KYOB 3EJNA 2A5EA 3LEWA 2NC9A 3TXMA 4Q94A 3EUVA 3ZPJA 4IRUA 1D8DA 3FU5A 3C72A 4BEPA 4JEHA 3MV2B 4LERA 5ENPD 4MKTA 4GZ5A 3NOGD 5C1DA 3V2OA 4A1SA 3R7RA 5ENOD 2JEKA 2IY0C 5CRVA 3ONLA 4GAAA 1JCRA 2B6CA 3LY7A 4P29A 4HVBA 4BX8A 4U0ZA 3SZ7A 1E8ZA 3J5QB 4XKBA 4UWHA 3APCA 2BEDA 1FVHA 3ZKJA 3IEGA 1TN6A 5AQAA 3CVNA 2VTBA 4LCTA 2X6FA 5KNHD 4LG6A 4DX2A 4U96D 2DVWA 1Q2ZA 2IO3C 4I9EA 2XEEA 5FQ8A 5EN5D 2R59A 2H6IA 4BTBA 4EBAA 3BQOA 4AV7A 3W9GA 3Q79A 1DCEA 2CG3A 5FT9A 4UQZA 2XHEA 3ASDA 2H6HA 3ABME 1DNPA 3JUEA 2R03A 3QK0A 3HXDA 4GTSA 4A3VA 3QARA 3B13A 3GW4A 2LO6A 5JMND 3AG4E 2J4DA 3GZSA 1NL4A 4RG6A 4EECA 3I4RB 4I1MA 4ZFHA 5CRUA 4I6JA 2CHZA 2MRIA 2WPVA 4Y6WA 2V5FA 1B89A 1IXVA 3UQ3A 4HI9A 5CECB 2VSXE 2FO7A 5AIJA 4XIFA 3PZ4A 3URZA 2CG2A 3LPZA 3FTZA 4GPKA 3OAWA 2ZIRA 3I3NA 3IXEA 2OV8A 4NURA 3D9IA 2E2EA 3SO8A 4G26A 4K5BA 2X3MA 1H0AA 2GGFA 1BD8A 3QNKA 5CMYA 1E96B 4FLBA 4I6EA 2WXQA 3CK9A 4FJZA 3NB2A 4J8DA 4G2VA 4J0UA 2R2LA 5CCLA 5G04C 2F0YA 2F8YA 3CIAA 2Y4UA 3G2SA 3MZLB 4CDNA 3D9KA 3S7BA 4GA1A 3CEQA 4B0ZA 4KVMA 5HRYA 1KT1A 4BFRA 3DEPA 2I1JA 3LKUA 3G2UA 4GTPA 4JEUA 5CBOA 3QKYA 5ITZF 1H2UA 2IFUA 3SGHA 3MJWA 5JHAA 4YDEA 4ANUA 5LP0A 2ILRA 3FU3A 4GZ6A 4IN3B 5FQ7A 1E7UA 5D66A 2Y3AA 3HXEA 1IYGA 2YHCA 4CT0A 1LD8A 3UIPC 4FC8A 1RZ4A 2GRNB 4JB8P 1HXIA 1SA5A 2P9NG 3AG2E 2WQHA 5M72A 4FADA 2L6JA 3LXUX 5KCMA 5G05C 2DIWA 1OWOA 4UQYA 5EX3A 3ZRHA 4JA9A 2WXGA 2CHWA 2LUHA 3NAWA 4APFA 5JJ6A 1Z5SC 1QZ2A 1TNUA 1H19A 2XS1A 5T8IA 3FTUA 2J8SD 1TN8A 4JXTA 3GYZA 3T9KA 4MS6A 3ULYA 4B8AA 3HG0D 5CEDB 3UX4A 3Q15A 4AP2A 5EILA 1BU9A 4FULA 3ZXSA 2NXPA 1LTXA 3ML8A 4A55A 1ZBPA 3PZDA 4GYWA 4UI9K 1NZNA 3L16A 5KJNA 1HG2A 2VYIA 4BESA 4BSXA 2P9KG 5A23A 3E34A 1KLXA 4YDWA 5FTPA 3AG1E 5D0OD 4YNDA 4HNAD 2L9BA 1NI1A 2BF0X 4I6GA 3D9NA 3ZYKA 1MQSA 4OAVB 1WDYA 3B7RL 3PH0C 1INZA 4BSZB 2QY7A 3UT7A 4U0SA 1SW6A 1ZB1A 3ONKA 4BT8A 2V4HC 4DPRA 4BETA 3C3QA 4I43A 3PE3A 4A3TA 3APDA 3D9PA 1KZOA 3BEEA 2XPZA 2WXIA 3FUDA 2WXMA 2WXJA 1S63A 4HQDA 4DUIA 2GRLA 3CVQA 5HI7A 2RG8A 4CYMD 4I1OB 4ANVA 3UM0A 1SQMA 3AS8A 1EPUA 3LCAA 4NRHB 4K03A 3S2AA 4W9RA 1TJCA 1IQRA 1EF1C 1TYQG 1JCQA 1OXJA 2OEWA 4ILGA 5ANLA 4EQFA 2DYRE 2PQRA 3UPVA 3JQ1A 1TEZA 2ETCA 3LY8A 2XGSA 4GZDA 3KEAA 3ABKE 4IULA 3HVEB 3PREA 1U3CA 2OEVA 3FUNA 3ABLE 4YDOA 4JVSA 3RIBA 3JXIA 4XZ4A 3CHRA 3ZYQA 1Y8MA 4I17A 3TWQA 5KBAA 5KNGA 4TUMA 3R7QA 1HX8A 2VQ2A 3UMVA 4D10C 2F37A 3EIQC 1JPLA 5HQ8A 3CV0A 3WXXA 1N52A 2IOLA 4U95D 5DBKA 3RO2A 3Q75A 2QZAA 4ME2A 1H6KA 2XQ0A 1BPOA 2JABA 3EHMA 3FEYA 5FZQA 1S64A 2P58C 2XENA 4E6HA 1N4RA 5CCMA 3DSVA 5AENA 4QQIA 3FH8A 3EHRA 4G8KA 1KT0A 4J8EA 3LJNA 3E30A 5EKQD 3CHOA 3FUMA 1ELRA 4J8FA 3TWRA 5EIBE 2LNIA 4AJWA 2FI7A 2J09A 4GMRA 5C2YA 1W3BA 5G05J 2CHXA 3V2XA 5H7PA 4N5CA 1DVPA 3D9MA 3EHNA 3S7FA 4MRUA 2BTDA 4JD2G 5KJLA 4GTOA 2XS8A 4A1GA 3RRUA 3CVWA 2NSZA 3FULA 3HVEA 3ULQA 2XRZA 4MBGA 2ZXWE 3ZU7B 3J5PA 3SD5A 5E76A 4LRZA 2GROB 5KJKA 2C0LA 1MX6A 2GRQB 1WAO1 3CGHA 4HS2A 4TUUA 2KC7A 4KBQA 2MYOA 3P1UA 4ANXA 3VLDA 2XCCA 5ENRD 4C0EA 2XGMA 4BTAA 4IYPA 5BNWA 2CFZA 4XEIG 3PNLB 4F7AA 3ESKA 4AXHA 3G2WA 2XPIA 2OOEA 5AAOA 2YNQA 5ARFA 2PZIA 1HH8A 3FUEA 1RW2A 1UG3A 4JL0A 3NBNB 2UY1B 3TWVA 2EIJE 4I1AA 3MV3B 1MX4A 3B7BA 2Q7FA 2FO1E 3UM1A 3PNTB 3SNXA 2X6JA 5AQ9A 2H6FA 1FT2A 1K8KG 3Q7FA 4XKCA 4L23A 3S7JA 1IHGA 3CVXA 3DXKG 2X38A 2M63A 3Q47B 3HHMA 3FUJA 4I2ZA 2WQ7A 3UM3A 3CQCB 2J49A 3UIOC 4AEZC 2VGXA 4LNBA 4M3OA 3PUJA 5ANRA 4U07A 3UKUG 2Y69E 3QOUA 4RLYA 1SZ9A 4CGWA 5FIOA 4TV3A 3CK7A 1E8XA 1QNFA 2R17C 1LF8A 3EU9A 4I2WA 1FPPA 4KT6B 3ZFWA 4C48B 4U04A 3EDTB 1QYMA 3IBEA 2OVFA 3LY9A 2PL2A 3T8KA 3ZNGA 4TXRA 3FUKA 4YVOA 5BT1A 3C5RA 2AVPA 1JWGA 1HFAA 1D9SA 4HRNA 4H7YA 1TNZA 2IF4A 5AARA 4ATZD 3EU5A 2V4LA 2UY1A 3Q7AA 5LFAA 3L6AA 1UOHA 3PRZA 2DZNA 4G1TA 3CHSA 1Z3YA 2KXPC 2IU1A 4PDXA 5FJYA 3BG1B 3FY4A 4DLOA 3CHPA 3DEOA 2DWZA 2WMNA 3SHFA 4FHJA 4GA0A 2RFMA 3TAXA 2AXVA 1NFIE 4N2SA 4G23A 3VLFA 3NQPA 1DCQA 3KAEA 2DBAA 3V30A 4A63B 2V0PA 5BXUA 3I4GA 3CR3A 3FTSA 4F3VA 3ASOE 4BT9A 3DSTA 1WM5A 4UUCA 1G3NB 4N2QA 3RJVA 5LX8A 2A4ZA 3HXFA 2WMOA 3L82A 2CFUA 3P2BA 3DXMG 4CGVA 3DSUA 4HBDA 1N4PA 4YVQC 1UJKA 1FVFA 3C98A 3E37A 3UI2A 2R02A 2R5SA 3CVLA 3TJPA 4G24A 2DCPA 1UW4B 4URKA 4PUCA 1O1RA 4WWOA 5FQ4A 3ZIMA 3LJ3A 4LEUA 3T5XA 3Q5MA 2FBNA 4EPZA 3ZW3A 2X6IA 4AVXA 4CDMA 2AW6A 5JA4D 5B3SE 4Z68A 5HKPA 4PH4B 5FZSA 3FU0A 1N9AA 5BV0A 4EZKA 2DZOA 4KZCA 3U66A 4J7WA 2AWIA 4EHMA 2XPYA 2PM6A 3FDHA 3RRNB 1TNBA 3TG4A 3APFA 3PZ3A 1TNYA 5CERB 1MHQA 4ANWA 5ENQD 1HE8A 3OTNA 4TXPA 1O1TA 4X8QA 4C0MA 2IONA 3FH5A 4AIFA 3ZXPA 3QC1A 4AOFA 4DI3A 3RSEG 1IQUA 3AS5A 4E85A 3D9LA 4M7CA 4XI9A 5FZRA 5G55A 2P9UG 2KM4A 3FUHA 1IHBA 2WXPA 4GYOA 3SBTB 4RVBA 3IV0A 2VGYA 1V55E 4CRWA 4F1PA 1U3DA 4WNGA 1K1AA 1HO8A 3LVQE 3BU8A 2BKGA 1NP7A 2C2LA 5BXOA 1X5BA 4EZLA 4WNDA 4ACKA 4O6FA 4K5AB 2XRYA 3IHYA 4FHKA 4H7XA 4U0UA 2LSUA 5EDSA 1BI7B 3MX3A 1HF8A 2X6KA 3HIZA 3OXGA 2ETAA 3UM2A 3UKRG 3VTYA 2QC9A 2YINA 1N4SA 3LS8A 1EDUA 2XGOA 4PS8A 3ZYMA 1D8EA 5ARGA 4HFGA 4AM9A 4Q96A 4PS3A 3KS2A 2IOSA 3GZ1A 3PS6A 4UWKA 3L54A 2WQ6A 3ZVVA 3PDNA 2LAHA 1E8WA 1SZAA 2IQCA 3CSTA 3UT8A 3U3WA 3DPDA 3AAAC 4QFVA 4JW1A 1H6PA 2ZU6B 3C3RA 1EYHA 1YA0A 4JA7A 5JHBA 3FTYA 4NACA 2A5UA 3RKVA 3TL5A 4XE0A 5G04J 4JHKA 3ZEFA 3LVRE 3QWWA 1ZU2A 3UXGA 4LSZE 3ESLA 2WXLA
chains in the Genus database with same CATH topology
4FJYA 4OVUA 4ATGA 3AU5A 4XKCA 4WWPA 4CEMA 3CK9A 4L23A 4FJZA 4J8DA 3UUXA 4G2VA 3S7JA 3FFLA 4J0UA 1IHGA 1OWNA 4CCAA 3CVXA 2X38A 5CCLA 5G04C 2M63A 3CIAA 4ILHB 2RD0A 2Y4UA 3G2SA 3MZLB 4UWGA 3Q47B 1OWPA 4B94A 4CDNA 4F53A 3D9KA 3HHMA 3FUJA 4I2ZA 3S7BA 1P5QA 2KZTB 3ZHEA 4RSYA 3FUIA 4DI4A 2WQ7A 3CKBA 3B7UX 4GA1A 4B89A 3CQCB 2WM9A 3CEQA 4B0ZA 4KVMA 1KT1A 4BFRA 3LKUA 2I1JA 2J49A 3G2UA 4JEUA 3QKYA 3CVYA 1H2UA 2IFUA 3MCXA 4AEZC 3SGHA 3MJWA 2VGXA 4U8HA 5AJDA 4KZ0A 4M3OA 5JHAA 3QB2A 3PUJA 5ANRA 4J8SA 4ANUA 1XNFA 3U64A 4WNEA 4U07A 5LP0A 3CHQA 2ILRA 3FU3A 4GZ6A 2FEZA 2PQNA 3EIJA 4IN3B 5FQ7A 1E7UA 3QOUA 2Y3AA 1SZ9A 1IYGA 4CGWA 2YHCA 4TV3A 4CT0A 4GU5A 3CK7A 1E8XA 2J07A 2KCLA 4FC8A 4HOUA 3JCKC 5CMWA 1QNFA 2R17C 1JUQA 4L1BA 1LF8A 5ENNA 4UWLA 4L2YA 3JQ0A 1HXIA 3I5PA 3IHVA 4I2WA 2LSVA 4KT6B 3ZFWA 4U04A 3EDTB 1PAQA 4JPSA 3CKCA 3L13A 1GW6A 3IBEA 4NQ0A 4WAFA 2VSNA 2XCBA 2OVFA 2WQHA 5M72A 2AXZA 4FA6A 2HM8A 4G11A 4FADA 3LY9A 2L6JA 3LXUX 5KCMA 3MA5A 4KVOA 5G05C 5BV1A 2DIWA 1OWOA 3QWVA 2PL2A 4UQYA 4UI9J 4JA9A 4N3CA 5EX3A 3SF4A 3ZRHA 1UN8A 3Q4AB 2WXGA 4FLHA 5A6CA 1UJJA 3CSFA 3CVWA 1NA0A 4DJAA 5BPPA 5BW8C 2CHWA 4L7TA 3O4ZA 1H2TC 3FUKA 3MEKA 4L2LA 4ACLA 4YVOA 5BT1A 4N3BA 4APFA 5JJ6A 3FHEA 4R7LA 2AVPA 1JWGA 5LCWJ 1HFAA 2J4BA 3MKRA 4H7YA 1QZ2A 4GMJA 1H19A 3ASGA 2IF4A 1Z6TA 5T8IA 3FTUA 3DBSA 1N54A 2KCVA 4HORA 4JXTA 2JLBA 5A7DB 2V4LA 3RK6A 3GYZA 3FWVA 5J08A 2UY1A 3CK8A 4MS6A 4B8AA 3O48A 3ASFA 3L6AA 5LFAA 3UX4A 3Q15A 5AYWD 4GCNA 3MKQA 3PRZA 4AP2A 4JZYA 3L17A 2YQ8A 3QDNA 3PEVB 4FULA 5FQ6A 2KCKA 4G1TA 3U4TA 2NXPA 3ZXSA 3KEZA 3ML8A 4DK5A 3CHSA 4A55A 1FCHA 1ZBPA 1Z3YA 3PZDA 4GYWA 1NZNA 3L16A 4UI9K 3CVVA 4N3AA 1S0PA 2Y4TA 3JYSA 3TGOA 5KJNA 3OXLA 5FWQA 2LAIA 2IU1A 1HG2A 3G2TA 4XX5A 2X6HA 2VYIA 4Q69A 4BSXA 3ML9A 4PDXA 5A23A 1KLXA 2L0TB 5FJYA 4BX9A 3BG1B 3FY4A 2QFCA 3VLEA 2VSYA 4K0RA 5FTPA 4DLOA 3CHPA 4ILIA 5D0OD 3PVLA 4YNDA 2WMNA 3SHFA 4FHJA 4GA0A 1WY6A 3TAXA 2AXVA 3LYAA 2KZTA 2L9BA 2BF0X 4N2SA 4JC8A 3T8MA 4AY5A 2L0IA 4I6GA 4G23A 3VLFA 3NQPA 3D9NA 2VSOE 3KAEA 4RG9A 2DBAA 4TRQA 3ZYKA 2EQXA 1MQSA 2V8SE 3B7RL 3PH0C 1INZA 2V0PA 3L08A 3FP3A 2QY7A 2XEVA 3I4GA 3CR3A 3FTSA 4J6IA 5DIZA 4U0SA 5T4YA 3UT7A 3ONKA 4F3VA 2C0MA 3TXNA 4GZ3A 3L22A 3PEUB 4BT8A 4BT9A 4DPRA 1OUVA 2KATA 1WM5A 2J9QA 4I43A 3PE3A 4A3TA 1OWLA 3APDA 4N2QA 4G25A 5T3RA 3RJVA 5LX8A 3D9PA 2A4ZA 5J90A 2UWJG 3RRMB 3JUIA 3ASHA 3CVUA 2WXRA 3BEEA 1Y6IA 2FULA 2WXOA 2WMOA 3AU4A 3D9JA 2XPZA 4JHRA 2CFUA 2WXIA 3P2BA 4U63A 3FUDA 2WXMA 4EZJA 4CGVA 3FUFA 4HOTA 5AJLA 3S7DA 5KJMA 2AXUA 4YVQC 1UJKA 5JJTA 2WXJA 4B8CB 4GMLA 3QJZA 4KXKB 1E8YA 1NA3A 1XGWA 3PUKA 3QWPA 2VTBB 1FVFA 2I6HA 4MLPA 2HO1A 2BUGA 2GRLA 3C98A 3CLJA 3CVQA 4OYSA 5HI7A 2RG8A 3IKOB 3AS4A 1HG5A 2R5SA 3CVLA 2WXNA 4I1OB 2VGXB 3TJPA 4G24A 1UW4B 1Z3XA 2DCPA 4URKA 2OVBA 4PUCA 3HYMB 3RO3A 4ANVA 3B7TA 4BY6A 4ABNA 4WWOA 3SBSA 1HS6A 1PY1A 2VJ8A 1SQMA 4CDRA 3AS8A 4F1SA 4EBAG 5FQ4A 1EPUA 3ZIMA 3ENEA 3ZN3A 3LJ3A 4LEUA 3T5XA 3LCAA 4OVVA 4NRHB 5LOZA 1VDYA 3QAQA 4K03A 2J08A 3S2AA 4W9RA 3Q5MA 1H2VC 1TJCA 2FBNA 1IQRA 1EF1C 4FU3A 4EPZA 3ZW3A 5ANLA 3ZGQA 4ILGA 2X6IA 4EQFA 2HR2A 2PQRA 3UPVA 3JQ1A 1TEZA 3N71A 4AVXA 4CDMA 2AW6A 3LY8A 1QQEA 4PS7A 3SFZA 4UQXA 2XGSA 4GZDA 4PH4B 4GCOA 4Y6CA 3R9AB 2WVIA 5FZSA 3FU0A 4I9CA 5BV0A 4EZKA 4IULA 1HU3A 4WWNA 2E0IA 5D0QD 3HVEB 4UI9C 3PREA 4KZCA 3OXFA 4KYOB 3U66A 1U3CA 4A1GA 2AWIA 4V3IA 5CHEE 3FUNA 4BWRA 4JVSA 3EJNA 2XPYA 4WNFA 4HOSA 2PM6A 3FDHA 3LEWA 3RIBA 3RRNB 2NC9A 3TXMA 1ELWA 3CHRA 3APFA 4Q94A 4XZ4A 3TG4A 3ZYQA 1Y8MA 3ZPJA 2I9CA 5LCWC 4I17A 4IRUA 3RU0A 3FU5A 1MHQA 4ANWA 3BG0B 4JEHA 3MV2B 4LERA 1HE8A 2IJGX 3OTNA 4MKTA 4C0MA 2IONA 3FH5A 4GZ5A 4AY6A 3R7QA 3MYVA 4AIFA 5C1DA 3QC1A 4AOFA 4DI3A 4A1SA 1IQUA 1HX8A 5BUZA 3AS5A 3R7RA 2JEKA 2VQ2A 3UMVA 4E85A 3Q49B 1UN9A 3EIQC 4D10C 1JPLA 3D9LA 3CV0A 5HQ8A 3NF1A 3WXXA 1N52A 2IOLA 2PM7A 3FH7A 3K9IA 3ONLA 5DBKA 4GAAA 4XI9A 3RO2A 3LY7A 5FZRA 5G55A 4P29A 4HVBA 4GA2A 4ME2A 4BX8A 4U0ZA 3SZ7A 1H6KA 2XQ0A 4GB9A 3NZSA 1BPOA 2KM4A 3FUHA 3EHMA 3KD7A 2WXPA 1OWMA 3CVPA 3FEYA 3ZYLA 1E8ZA 4GYOA 4XKBA 5FZQA 2P58C 2MOWA 3SBTB 4RVBA 4UWHA 4E6HA 3CQGB 3APCA 3LDZA 3IV0A 5CCMA 2VGYA 4APOA 4CRWA 1U3DA 4WNGA 2MHKA 1FVHA 4WUYA 5AENA 1HO8A 3LVQE 3FH8A 4FP7A 1NP7A 2C2LA 1X5BA 4EZLA 3IEGA 1KT0A 4WNDA 4J8EA 1E90A 3CVNA 2VTBA 4ACKA 1A17A 4LCTA 2X6FA 4O6FA 5EKQD 3CHOA 3ZHEB 3E4BA 3FUMA 2XRYA 1ELRA 4J8FA 3IHYA 4FHKA 4H7XA 2LNIA 4U0UA 3UT4A 2LSUA 3TG5A 4N39A 5EDSA 4AJWA 2FI7A 2J09A 2WXKA 3MX3A 2GRMA 1HF8A 4I9EA 5C2YA 4DLQA 5EX0A 2X6KA 1W3BA 5FQ8A 5G05J 2R59A 1ELKA 3HIZA 3G2VA 4BTBA 3D9OA 2CHXA 4EBAA 3OXGA 4AV7A 3FTXA 4N5CA 3VTYA 2WB2A 2YINA 2ONDA 1DVPA 2CG3A 5FT9A 4CT4A 3D9MA 4UQZA 2XHEA 3EHNA 3LS8A 3ASDA 3S7FA 1EDUA 1DNPA 4MRUA 2BTDA 4UWFA 5KJLA 3QK0A 2XGOA 4GYYA 4A3VA 4PS8A 3QARA 3B13A 3GW4A 2LO6A 3FTVA 3ZYMA 2HYZA 2J4DA 3GZSA 2NSZA 3RRUA 5ARGA 3FULA 3HVEA 4RG6A 3ULQA 2GW1A 4EECA 4HFGA 2XRZA 5E75A 3I4RB 4AM9A 4I1MA 3SD5A 4Q96A 3FU6A 4PS3A 5E76A 3D3MA 3KS2A 4I6JA 3SI5A 2CHZA 2MRIA 2WPVA 3FTWA 2IOSA 4LRZA 1TJFA 3GZ1A 3PE4A 4Y6WA 2V5FA 3VTXA 3PS6A 5KJKA 1B89A 4HLEA 2C0LA 4UWKA 3UQ3A 3L54A 1WAO1 2WQ6A 3CGHA 4HS2A 1E7VA 4TUUA 3ZVVA 2KC7A 2VSXE 3FEXA 4KBQA 3PDNA 3P1UA 2WXHA 3VLDA 2FO7A 2LAHA 2XCCA 4LUNU 4ANXA 5AIJA 5JJ7A 4C0EA 4XIFA 1E8WA 1SZAA 2XGMA 4HXIA 2IQCA 3CSTA 2I2OA 3UT8A 3URZA 3U3WA 3DPDA 2YHEA 4BTAA 4IYPA 4QFVA 2CG2A 2I1KA 3LPZA 5BNWA 3FTZA 4JW1A 4GPKA 2CFZA 3OAWA 3PNLB 2ZU6B 3ESKA 3I3NA 4F7AA 4AXHA 3G2WA 3U9WA 2XPIA 1EYHA 3GZ2A 2OOEA 4XI0A 2YNQA 4GZCA 5ARFA 2PZIA 1YA0A 1HH8A 3CHMA 3FUEA 4JA7A 2OV8A 5JHBA 3FTYA 1UG3A 4NACA 2A5UA 4JL0A 4NURA 1HZ4A 4HOQA 3RKVA 3TL5A 1PC2A 2UY1B 5G2NA 3HDXA 4I1AA 4XE0A 3MV3B 4JHKA 1JWFA 5G04J 3D9IA 2E2EA 3ZEFA 2Q7FA 2WXFA 4G26A 3NZUA 2X3MA 3LVRE 1L5JA 1H0AA 3MKQB 4C9BB 3QWWA 3B7SA 3PNTB 2GGFA 3SNXA 3MGBA 1ZU2A 2X6JA 3QNKA 4JHJA 3T5VA 5CMYA 2FF4A 1E96B 4FLBA 3ESLA 4KMOA 2WXLA 4I6EA 2WXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ION A;  3FEY A;  4CT4 A;  1H2U A;  3L6A A;  1UG3 A;  1H2T C;  4B8C B;  1H2V C;  4GML A;  4CEM A;  2KZT A;  2VSX E;  3FEX A;  4JHK A;  5ANR A;  2RG8 A;  4LUN U;  1PAQ A;  4CRW A;  3EIQ C;  1UW4 B;  2I2O A;  3EIJ A;  4GMJ A;  2NSZ A;  3JUI A;  4C9B B;  1N52 A;  2HM8 A;  2VSO E;  2IOL A;  2KZT B;  2GGF A;  2FUL A;  4B89 A;  1N54 A;  2IU1 A;  4IUL A;  2ZU6 B;  1HU3 A;  4JHJ A;  3RK6 A;  3D3M A;  1H6K A;  4B8A A;  2IOS A; 
#chains in the Genus database with same CATH topology
 4RQI A;  3NOC D;  4DX1 A;  4CCA A;  2P9P G;  4ILH B;  2RD0 A;  4B94 A;  1P5Q A;  2KZT B;  3FUI A;  4DI4 A;  3CKB A;  4B89 A;  4L9P A;  3CVY A;  4KZ0 A;  1KZP A;  3U64 A;  4WNE A;  3CHQ A;  1N95 A;  2FEZ A;  2PQN A;  3EIJ A;  4GU5 A;  3C3O A;  1TN7 A;  4HOU A;  4OAU C;  1OCO E;  1JUQ A;  4L1B A;  5ENN A;  3ZUV B;  3JQ0 A;  3I5P A;  3IHV A;  1PAQ A;  4JPS A;  1IKN D;  1BLX B;  3CKC A;  2IEJ A;  1FT1 A;  2VSN A;  2IO2 C;  4N3C A;  3SF4 A;  3Q4A B;  4FLH A;  1UJJ A;  3CSF A;  5BPP A;  4DJA A;  5BW8 C;  4L2L A;  1H2T C;  3MEK A;  4ACL A;  5CBN A;  1SA4 A;  2P2C P;  4GMJ A;  3ASG A;  1AWC B;  3DBS A;  1N54 A;  2KCV A;  3DSW A;  3RK6 A;  5J08 A;  3Q78 A;  2BKK B;  3O48 A;  4GCN A;  4JZY A;  3QDN A;  2QYJ A;  3U4T A;  3Q9U C;  3KEZ A;  4DK5 A;  4N5Q A;  3CVV A;  4N3A A;  1S0P A;  2QYU A;  3JYS A;  3TGO A;  3OXL A;  5FWQ A;  4GTV A;  3G2T A;  2X6H A;  3KSQ A;  3ML9 A;  3HXC A;  4LNU D;  2L0T B;  4K0R A;  2P9I G;  3PVL A;  1H6O A;  4TXQ A;  1WY6 A;  3LYA A;  1YYH A;  2KZT A;  4JC8 A;  4U8Y D;  3T8M A;  4HRM B;  4RG9 A;  4TRQ A;  4ZHB A;  2EQX A;  2XZD G;  3R9M A;  2RKK A;  3L08 A;  3FP3 A;  5T4Y A;  5DIZ A;  4GZ3 A;  3L22 A;  2H6G A;  2KAT A;  1MYO A;  5FIN A;  2UWJ G;  3RRM B;  4HLL A;  3CVU A;  2WXR A;  4GTM A;  2WXO A;  3WG7 E;  1U2V G;  5EYL A;  4EZJ A;  3FUF A;  2NYJ A;  5AJL A;  5KJM A;  2XZT G;  3ISM C;  4B8C B;  4KXK B;  1NA3 A;  3PUK A;  3QWP A;  2BUG A;  2WB2 A;  3IKO B;  4DX5 D;  1HG5 A;  2WXN A;  1OCZ E;  1Z3X A;  1MZC A;  2OVB A;  3F6Q A;  2VJ8 A;  4F1S A;  1N0Q A;  1YCS B;  3ZN3 A;  5LOZ A;  1VDY A;  2RFA A;  1OY3 D;  5B1A E;  5D2M C;  2EIN E;  2HR2 A;  3X2Q E;  4PS7 A;  3SFZ A;  4U7E B;  4Y6C A;  2WVI A;  2ZIS A;  1HU3 A;  4WWN A;  1MJ0 A;  1QBQ A;  2E0I A;  5D0Q D;  4UI9 C;  3OXF A;  4BER A;  4V3I A;  5CHE E;  3W9F A;  4BWR A;  4K5C A;  2ZGD A;  4WNF A;  4HOS A;  1OCR E;  1ELW A;  3Q73 A;  2I9C A;  5LCW C;  5KWD A;  3RU0 A;  1YMP A;  3BG0 B;  2IJG X;  4AY6 A;  3MYV A;  2LXM A;  5BUZ A;  2AJA A;  3Q49 B;  1UN9 A;  3NF1 A;  3BUA A;  2PM7 A;  3FH7 A;  3K9I A;  4GPM A;  4GA2 A;  4GB9 A;  3NZS A;  3KD7 A;  1OWM A;  3CVP A;  3ZYL A;  1DC2 A;  3RAU A;  2MOW A;  3EHQ A;  3CQG B;  3LDZ A;  4APO A;  2MHK A;  2Y1L E;  3AJI A;  4WUY A;  3TWT A;  1X81 A;  4FP7 A;  1N94 A;  4YDY A;  1TNO A;  1E90 A;  1A17 A;  3ZHE B;  3E4B A;  2HE0 A;  1MX2 A;  3UT4 A;  1LD7 A;  4G8L A;  3DPY A;  3TG5 A;  4N39 A;  2F8X K;  3V31 A;  2WXK A;  1A5E A;  2GRM A;  3B95 A;  1JCS A;  4GTR A;  4DLQ A;  5EX0 A;  2ETB A;  3ULE G;  1ELK A;  3G2V A;  3UIN C;  3D9O A;  4CZ2 D;  3FTX A;  3AG3 E;  2OND A;  4CT4 A;  1K1B A;  4UWF A;  1BI8 B;  4O1O A;  4GYY A;  3Q9N C;  3FTV A;  2HYZ A;  3D9H A;  2GW1 A;  5E75 A;  3FU6 A;  3D3M A;  3SI5 A;  3FTW A;  1S70 B;  1TJF A;  3PE4 A;  4O1P A;  3VTX A;  4HLE A;  4DX6 D;  1OT8 A;  1E7V A;  1SVX A;  3FEX A;  2WXH A;  4LUN U;  3DRA A;  5JJ7 A;  3DWL G;  4HRL A;  4HXI A;  2I2O A;  2YHE A;  4B93 B;  2I1K A;  1WG0 A;  4J8Y A;  3U9W A;  3L9T A;  3GZ2 A;  4XI0 A;  4GZC A;  2R05 A;  3CHM A;  1HZ4 A;  4HOQ A;  1PC2 A;  1KPS B;  4DRX E;  5G2N A;  3HDX A;  4GTT A;  1JWF A;  2LXL A;  2Y0B G;  2WXF A;  3NZU A;  1L5J A;  1N0R A;  3MKQ B;  4C9B B;  3B7S A;  2PNN A;  3MGB A;  4HB5 A;  4JHJ A;  3T5V A;  2FF4 A;  4KMO A;  4FJY A;  4OVU A;  4ATG A;  3AU5 A;  2GRR B;  4WWP A;  1O5M A;  4CEM A;  3UUX A;  3FFL A;  1OWN A;  4UWG A;  4F53 A;  1OWP A;  1N11 A;  3ZHE A;  4RSY A;  2OCC E;  3B7U X;  1V54 E;  1TR4 A;  2WM9 A;  3TWU A;  3E32 A;  3MCX A;  4U8H A;  5AJD A;  3V79 K;  3QB2 A;  4J8S A;  1XNF A;  2EIL E;  3DSS A;  5EID A;  2DYS E;  4HI8 A;  2GRP B;  2J07 A;  2KCL A;  3JCK C;  4NIK A;  5CMW A;  4UWL A;  3PZ2 A;  4L2Y A;  2LSV A;  3L13 A;  1GW6 A;  4NQ0 A;  4WAF A;  2XCB A;  2AXZ A;  4FA6 A;  2HM8 A;  4G11 A;  3MA5 A;  4KVO A;  5BV1 A;  4UI9 J;  3QWV A;  1UN8 A;  5A6C A;  1NA0 A;  4U8V D;  4L7T A;  3O4Z A;  2V5Q C;  3SY2 A;  4N3B A;  1N4Q A;  3FHE A;  4R7L A;  5LCW J;  2J4B A;  3MKR A;  3ASN E;  1Z6T A;  5EYP F;  5CEA A;  4HOR A;  2JLB A;  5A7D B;  3UTM A;  3FWV A;  3CK8 A;  1K3Z D;  4DX7 D;  3ASF A;  5AYW D;  3MKQ A;  3L17 A;  5ENS D;  2YQ8 A;  3PEV B;  5FQ6 A;  2KCK A;  1FCH A;  3JXJ A;  5IY5 E;  5AQ7 A;  2B0O E;  2Y4T A;  2LAI A;  4XX5 A;  4Q69 A;  4BX9 A;  3SQV A;  2ZGG A;  2L6B A;  2QFC A;  3VLE A;  2VSY A;  4ILI A;  1OCC E;  3PZ1 A;  4AY5 A;  2L0I A;  3TWX A;  2VSO E;  2V8S E;  3DSX A;  2XEV A;  5AN8 A;  4J6I A;  2C0M A;  3TXN A;  3TWS A;  3PEU B;  1OUV A;  2J9Q A;  1OWL A;  2VGE A;  4G25 A;  5T3R A;  3SFX A;  5J90 A;  3HRA A;  4LNG A;  3JUI A;  3ASH A;  1Y6I A;  3E33 A;  2FUL A;  3AU4 A;  3D9J A;  4JHR A;  4U63 A;  3HXB A;  5AQB A;  4HOT A;  3S7D A;  2AXU A;  5JJT A;  5B1B E;  2EIK E;  4GML A;  3QJZ A;  1O1S A;  1E8Y A;  1XGW A;  2VTB B;  2I6H A;  4MLP A;  2HO1 A;  3CLJ A;  4OYS A;  3AS4 A;  2VGX B;  2KBX A;  3HYM B;  2XEH A;  3RO3 A;  3B7T A;  4BY6 A;  4ABN A;  3SBS A;  1HS6 A;  1PY1 A;  4CDR A;  4EBA G;  2P9L G;  3ENE A;  2EIM E;  5ENT D;  4GTQ A;  4OVV A;  3QAQ A;  3TWW A;  2J08 A;  1H2V C;  4F6R D;  4FU3 A;  3ZGQ A;  1AP7 A;  3SFY A;  3N71 A;  1QQE A;  2P9S G;  5HS0 A;  4O60 A;  4UQX A;  4GCO A;  3R9A B;  4I9C A;  3KSL A;  4KYO B;  3EJN A;  2A5E A;  3LEW A;  2NC9 A;  3TXM A;  4Q94 A;  3EUV A;  3ZPJ A;  4IRU A;  1D8D A;  3FU5 A;  3C72 A;  4BEP A;  4JEH A;  3MV2 B;  4LER A;  5ENP D;  4MKT A;  4GZ5 A;  3NOG D;  5C1D A;  3V2O A;  4A1S A;  3R7R A;  5ENO D;  2JEK A;  2IY0 C;  5CRV A;  3ONL A;  4GAA A;  1JCR A;  2B6C A;  3LY7 A;  4P29 A;  4HVB A;  4BX8 A;  4U0Z A;  3SZ7 A;  1E8Z A;  3J5Q B;  4XKB A;  4UWH A;  3APC A;  2BED A;  1FVH A;  3ZKJ A;  3IEG A;  1TN6 A;  5AQA A;  3CVN A;  2VTB A;  4LCT A;  2X6F A;  5KNH D;  4LG6 A;  4DX2 A;  4U96 D;  2DVW A;  1Q2Z A;  2IO3 C;  4I9E A;  2XEE A;  5FQ8 A;  5EN5 D;  2R59 A;  2H6I A;  4BTB A;  4EBA A;  3BQO A;  4AV7 A;  3W9G A;  3Q79 A;  1DCE A;  2CG3 A;  5FT9 A;  4UQZ A;  2XHE A;  3ASD A;  2H6H A;  3ABM E;  1DNP A;  3JUE A;  2R03 A;  3QK0 A;  3HXD A;  4GTS A;  4A3V A;  3QAR A;  3B13 A;  3GW4 A;  2LO6 A;  5JMN D;  3AG4 E;  2J4D A;  3GZS A;  1NL4 A;  4RG6 A;  4EEC A;  3I4R B;  4I1M A;  4ZFH A;  5CRU A;  4I6J A;  2CHZ A;  2MRI A;  2WPV A;  4Y6W A;  2V5F A;  1B89 A;  1IXV A;  3UQ3 A;  4HI9 A;  5CEC B;  2VSX E;  2FO7 A;  5AIJ A;  4XIF A;  3PZ4 A;  3URZ A;  2CG2 A;  3LPZ A;  3FTZ A;  4GPK A;  3OAW A;  2ZIR A;  3I3N A;  3IXE A;  2OV8 A;  4NUR A;  3D9I A;  2E2E A;  3SO8 A;  4G26 A;  4K5B A;  2X3M A;  1H0A A;  2GGF A;  1BD8 A;  3QNK A;  5CMY A;  1E96 B;  4FLB A;  4I6E A;  2WXQ A;  3CK9 A;  4FJZ A;  3NB2 A;  4J8D A;  4G2V A;  4J0U A;  2R2L A;  5CCL A;  5G04 C;  2F0Y A;  2F8Y A;  3CIA A;  2Y4U A;  3G2S A;  3MZL B;  4CDN A;  3D9K A;  3S7B A;  4GA1 A;  3CEQ A;  4B0Z A;  4KVM A;  5HRY A;  1KT1 A;  4BFR A;  3DEP A;  2I1J A;  3LKU A;  3G2U A;  4GTP A;  4JEU A;  5CBO A;  3QKY A;  5ITZ F;  1H2U A;  2IFU A;  3SGH A;  3MJW A;  5JHA A;  4YDE A;  4ANU A;  5LP0 A;  2ILR A;  3FU3 A;  4GZ6 A;  4IN3 B;  5FQ7 A;  1E7U A;  5D66 A;  2Y3A A;  3HXE A;  1IYG A;  2YHC A;  4CT0 A;  1LD8 A;  3UIP C;  4FC8 A;  1RZ4 A;  2GRN B;  4JB8 P;  1HXI A;  1SA5 A;  2P9N G;  3AG2 E;  2WQH A;  5M72 A;  4FAD A;  2L6J A;  3LXU X;  5KCM A;  5G05 C;  2DIW A;  1OWO A;  4UQY A;  5EX3 A;  3ZRH A;  4JA9 A;  2WXG A;  2CHW A;  2LUH A;  3NAW A;  4APF A;  5JJ6 A;  1Z5S C;  1QZ2 A;  1TNU A;  1H19 A;  2XS1 A;  5T8I A;  3FTU A;  2J8S D;  1TN8 A;  4JXT A;  3GYZ A;  3T9K A;  4MS6 A;  3ULY A;  4B8A A;  3HG0 D;  5CED B;  3UX4 A;  3Q15 A;  4AP2 A;  5EIL A;  1BU9 A;  4FUL A;  3ZXS A;  2NXP A;  1LTX A;  3ML8 A;  4A55 A;  1ZBP A;  3PZD A;  4GYW A;  4UI9 K;  1NZN A;  3L16 A;  5KJN A;  1HG2 A;  2VYI A;  4BES A;  4BSX A;  2P9K G;  5A23 A;  3E34 A;  1KLX A;  4YDW A;  5FTP A;  3AG1 E;  5D0O D;  4YND A;  4HNA D;  2L9B A;  1NI1 A;  2BF0 X;  4I6G A;  3D9N A;  3ZYK A;  1MQS A;  4OAV B;  1WDY A;  3B7R L;  3PH0 C;  1INZ A;  4BSZ B;  2QY7 A;  3UT7 A;  4U0S A;  1SW6 A;  1ZB1 A;  3ONK A;  4BT8 A;  2V4H C;  4DPR A;  4BET A;  3C3Q A;  4I43 A;  3PE3 A;  4A3T A;  3APD A;  3D9P A;  1KZO A;  3BEE A;  2XPZ A;  2WXI A;  3FUD A;  2WXM A;  2WXJ A;  1S63 A;  4HQD A;  4DUI A;  2GRL A;  3CVQ A;  5HI7 A;  2RG8 A;  4CYM D;  4I1O B;  4ANV A;  3UM0 A;  1SQM A;  3AS8 A;  1EPU A;  3LCA A;  4NRH B;  4K03 A;  3S2A A;  4W9R A;  1TJC A;  1IQR A;  1EF1 C;  1TYQ G;  1JCQ A;  1OXJ A;  2OEW A;  4ILG A;  5ANL A;  4EQF A;  2DYR E;  2PQR A;  3UPV A;  3JQ1 A;  1TEZ A;  2ETC A;  3LY8 A;  2XGS A;  4GZD A;  3KEA A;  3ABK E;  4IUL A;  3HVE B;  3PRE A;  1U3C A;  2OEV A;  3FUN A;  3ABL E;  4YDO A;  4JVS A;  3RIB A;  3JXI A;  4XZ4 A;  3CHR A;  3ZYQ A;  1Y8M A;  4I17 A;  3TWQ A;  5KBA A;  5KNG A;  4TUM A;  3R7Q A;  1HX8 A;  2VQ2 A;  3UMV A;  4D10 C;  2F37 A;  3EIQ C;  1JPL A;  5HQ8 A;  3CV0 A;  3WXX A;  1N52 A;  2IOL A;  4U95 D;  5DBK A;  3RO2 A;  3Q75 A;  2QZA A;  4ME2 A;  1H6K A;  2XQ0 A;  1BPO A;  2JAB A;  3EHM A;  3FEY A;  5FZQ A;  1S64 A;  2P58 C;  2XEN A;  4E6H A;  1N4R A;  5CCM A;  3DSV A;  5AEN A;  4QQI A;  3FH8 A;  3EHR A;  4G8K A;  1KT0 A;  4J8E A;  3LJN A;  3E30 A;  5EKQ D;  3CHO A;  3FUM A;  1ELR A;  4J8F A;  3TWR A;  5EIB E;  2LNI A;  4AJW A;  2FI7 A;  2J09 A;  4GMR A;  5C2Y A;  1W3B A;  5G05 J;  2CHX A;  3V2X A;  5H7P A;  4N5C A;  1DVP A;  3D9M A;  3EHN A;  3S7F A;  4MRU A;  2BTD A;  4JD2 G;  5KJL A;  4GTO A;  2XS8 A;  4A1G A;  3RRU A;  3CVW A;  2NSZ A;  3FUL A;  3HVE A;  3ULQ A;  2XRZ A;  4MBG A;  2ZXW E;  3ZU7 B;  3J5P A;  3SD5 A;  5E76 A;  4LRZ A;  2GRO B;  5KJK A;  2C0L A;  1MX6 A;  2GRQ B;  1WAO 1;  3CGH A;  4HS2 A;  4TUU A;  2KC7 A;  4KBQ A;  2MYO A;  3P1U A;  4ANX A;  3VLD A;  2XCC A;  5ENR D;  4C0E A;  2XGM A;  4BTA A;  4IYP A;  5BNW A;  2CFZ A;  4XEI G;  3PNL B;  4F7A A;  3ESK A;  4AXH A;  3G2W A;  2XPI A;  2OOE A;  5AAO A;  2YNQ A;  5ARF A;  2PZI A;  1HH8 A;  3FUE A;  1RW2 A;  1UG3 A;  4JL0 A;  3NBN B;  2UY1 B;  3TWV A;  2EIJ E;  4I1A A;  3MV3 B;  1MX4 A;  3B7B A;  2Q7F A;  2FO1 E;  3UM1 A;  3PNT B;  3SNX A;  2X6J A;  5AQ9 A;  2H6F A;  1FT2 A;  1K8K G;  3Q7F A;  4XKC A;  4L23 A;  3S7J A;  1IHG A;  3CVX A;  3DXK G;  2X38 A;  2M63 A;  3Q47 B;  3HHM A;  3FUJ A;  4I2Z A;  2WQ7 A;  3UM3 A;  3CQC B;  2J49 A;  3UIO C;  4AEZ C;  2VGX A;  4LNB A;  4M3O A;  3PUJ A;  5ANR A;  4U07 A;  3UKU G;  2Y69 E;  3QOU A;  4RLY A;  1SZ9 A;  4CGW A;  5FIO A;  4TV3 A;  3CK7 A;  1E8X A;  1QNF A;  2R17 C;  1LF8 A;  3EU9 A;  4I2W A;  1FPP A;  4KT6 B;  3ZFW A;  4C48 B;  4U04 A;  3EDT B;  1QYM A;  3IBE A;  2OVF A;  3LY9 A;  2PL2 A;  3T8K A;  3ZNG A;  4TXR A;  3FUK A;  4YVO A;  5BT1 A;  3C5R A;  2AVP A;  1JWG A;  1HFA A;  1D9S A;  4HRN A;  4H7Y A;  1TNZ A;  2IF4 A;  5AAR A;  4ATZ D;  3EU5 A;  2V4L A;  2UY1 A;  3Q7A A;  5LFA A;  3L6A A;  1UOH A;  3PRZ A;  2DZN A;  4G1T A;  3CHS A;  1Z3Y A;  2KXP C;  2IU1 A;  4PDX A;  5FJY A;  3BG1 B;  3FY4 A;  4DLO A;  3CHP A;  3DEO A;  2DWZ A;  2WMN A;  3SHF A;  4FHJ A;  4GA0 A;  2RFM A;  3TAX A;  2AXV A;  1NFI E;  4N2S A;  4G23 A;  3VLF A;  3NQP A;  1DCQ A;  3KAE A;  2DBA A;  3V30 A;  4A63 B;  2V0P A;  5BXU A;  3I4G A;  3CR3 A;  3FTS A;  4F3V A;  3ASO E;  4BT9 A;  3DST A;  1WM5 A;  4UUC A;  1G3N B;  4N2Q A;  3RJV A;  5LX8 A;  2A4Z A;  3HXF A;  2WMO A;  3L82 A;  2CFU A;  3P2B A;  3DXM G;  4CGV A;  3DSU A;  4HBD A;  1N4P A;  4YVQ C;  1UJK A;  1FVF A;  3C98 A;  3E37 A;  3UI2 A;  2R02 A;  2R5S A;  3CVL A;  3TJP A;  4G24 A;  2DCP A;  1UW4 B;  4URK A;  4PUC A;  1O1R A;  4WWO A;  5FQ4 A;  3ZIM A;  3LJ3 A;  4LEU A;  3T5X A;  3Q5M A;  2FBN A;  4EPZ A;  3ZW3 A;  2X6I A;  4AVX A;  4CDM A;  2AW6 A;  5JA4 D;  5B3S E;  4Z68 A;  5HKP A;  4PH4 B;  5FZS A;  3FU0 A;  1N9A A;  5BV0 A;  4EZK A;  2DZO A;  4KZC A;  3U66 A;  4J7W A;  2AWI A;  4EHM A;  2XPY A;  2PM6 A;  3FDH A;  3RRN B;  1TNB A;  3TG4 A;  3APF A;  3PZ3 A;  1TNY A;  5CER B;  1MHQ A;  4ANW A;  5ENQ D;  1HE8 A;  3OTN A;  4TXP A;  1O1T A;  4X8Q A;  4C0M A;  2ION A;  3FH5 A;  4AIF A;  3ZXP A;  3QC1 A;  4AOF A;  4DI3 A;  3RSE G;  1IQU A;  3AS5 A;  4E85 A;  3D9L A;  4M7C A;  4XI9 A;  5FZR A;  5G55 A;  2P9U G;  2KM4 A;  3FUH A;  1IHB A;  2WXP A;  4GYO A;  3SBT B;  4RVB A;  3IV0 A;  2VGY A;  1V55 E;  4CRW A;  4F1P A;  1U3D A;  4WNG A;  1K1A A;  1HO8 A;  3LVQ E;  3BU8 A;  2BKG A;  1NP7 A;  2C2L A;  5BXO A;  1X5B A;  4EZL A;  4WND A;  4ACK A;  4O6F A;  4K5A B;  2XRY A;  3IHY A;  4FHK A;  4H7X A;  4U0U A;  2LSU A;  5EDS A;  1BI7 B;  3MX3 A;  1HF8 A;  2X6K A;  3HIZ A;  3OXG A;  2ETA A;  3UM2 A;  3UKR G;  3VTY A;  2QC9 A;  2YIN A;  1N4S A;  3LS8 A;  1EDU A;  2XGO A;  4PS8 A;  3ZYM A;  1D8E A;  5ARG A;  4HFG A;  4AM9 A;  4Q96 A;  4PS3 A;  3KS2 A;  2IOS A;  3GZ1 A;  3PS6 A;  4UWK A;  3L54 A;  2WQ6 A;  3ZVV A;  3PDN A;  2LAH A;  1E8W A;  1SZA A;  2IQC A;  3CST A;  3UT8 A;  3U3W A;  3DPD A;  3AAA C;  4QFV A;  4JW1 A;  1H6P A;  2ZU6 B;  3C3R A;  1EYH A;  1YA0 A;  4JA7 A;  5JHB A;  3FTY A;  4NAC A;  2A5U A;  3RKV A;  3TL5 A;  4XE0 A;  5G04 J;  4JHK A;  3ZEF A;  3LVR E;  3QWW A;  1ZU2 A;  3UXG A;  4LSZ E;  3ESL A;  2WXL A; 
#chains in the Genus database with same CATH homology
 4FJY A;  4OVU A;  4ATG A;  3AU5 A;  4XKC A;  4WWP A;  4CEM A;  3CK9 A;  4L23 A;  4FJZ A;  4J8D A;  3UUX A;  4G2V A;  3S7J A;  3FFL A;  4J0U A;  1IHG A;  1OWN A;  4CCA A;  3CVX A;  2X38 A;  5CCL A;  5G04 C;  2M63 A;  3CIA A;  4ILH B;  2RD0 A;  2Y4U A;  3G2S A;  3MZL B;  4UWG A;  3Q47 B;  1OWP A;  4B94 A;  4CDN A;  4F53 A;  3D9K A;  3HHM A;  3FUJ A;  4I2Z A;  3S7B A;  1P5Q A;  2KZT B;  3ZHE A;  4RSY A;  3FUI A;  4DI4 A;  2WQ7 A;  3CKB A;  3B7U X;  4GA1 A;  4B89 A;  3CQC B;  2WM9 A;  3CEQ A;  4B0Z A;  4KVM A;  1KT1 A;  4BFR A;  3LKU A;  2I1J A;  2J49 A;  3G2U A;  4JEU A;  3QKY A;  3CVY A;  1H2U A;  2IFU A;  3MCX A;  4AEZ C;  3SGH A;  3MJW A;  2VGX A;  4U8H A;  5AJD A;  4KZ0 A;  4M3O A;  5JHA A;  3QB2 A;  3PUJ A;  5ANR A;  4J8S A;  4ANU A;  1XNF A;  3U64 A;  4WNE A;  4U07 A;  5LP0 A;  3CHQ A;  2ILR A;  3FU3 A;  4GZ6 A;  2FEZ A;  2PQN A;  3EIJ A;  4IN3 B;  5FQ7 A;  1E7U A;  3QOU A;  2Y3A A;  1SZ9 A;  1IYG A;  4CGW A;  2YHC A;  4TV3 A;  4CT0 A;  4GU5 A;  3CK7 A;  1E8X A;  2J07 A;  2KCL A;  4FC8 A;  4HOU A;  3JCK C;  5CMW A;  1QNF A;  2R17 C;  1JUQ A;  4L1B A;  1LF8 A;  5ENN A;  4UWL A;  4L2Y A;  3JQ0 A;  1HXI A;  3I5P A;  3IHV A;  4I2W A;  2LSV A;  4KT6 B;  3ZFW A;  4U04 A;  3EDT B;  1PAQ A;  4JPS A;  3CKC A;  3L13 A;  1GW6 A;  3IBE A;  4NQ0 A;  4WAF A;  2VSN A;  2XCB A;  2OVF A;  2WQH A;  5M72 A;  2AXZ A;  4FA6 A;  2HM8 A;  4G11 A;  4FAD A;  3LY9 A;  2L6J A;  3LXU X;  5KCM A;  3MA5 A;  4KVO A;  5G05 C;  5BV1 A;  2DIW A;  1OWO A;  3QWV A;  2PL2 A;  4UQY A;  4UI9 J;  4JA9 A;  4N3C A;  5EX3 A;  3SF4 A;  3ZRH A;  1UN8 A;  3Q4A B;  2WXG A;  4FLH A;  5A6C A;  1UJJ A;  3CSF A;  3CVW A;  1NA0 A;  4DJA A;  5BPP A;  5BW8 C;  2CHW A;  4L7T A;  3O4Z A;  1H2T C;  3FUK A;  3MEK A;  4L2L A;  4ACL A;  4YVO A;  5BT1 A;  4N3B A;  4APF A;  5JJ6 A;  3FHE A;  4R7L A;  2AVP A;  1JWG A;  5LCW J;  1HFA A;  2J4B A;  3MKR A;  4H7Y A;  1QZ2 A;  4GMJ A;  1H19 A;  3ASG A;  2IF4 A;  1Z6T A;  5T8I A;  3FTU A;  3DBS A;  1N54 A;  2KCV A;  4HOR A;  4JXT A;  2JLB A;  5A7D B;  2V4L A;  3RK6 A;  3GYZ A;  3FWV A;  5J08 A;  2UY1 A;  3CK8 A;  4MS6 A;  4B8A A;  3O48 A;  3ASF A;  3L6A A;  5LFA A;  3UX4 A;  3Q15 A;  5AYW D;  4GCN A;  3MKQ A;  3PRZ A;  4AP2 A;  4JZY A;  3L17 A;  2YQ8 A;  3QDN A;  3PEV B;  4FUL A;  5FQ6 A;  2KCK A;  4G1T A;  3U4T A;  2NXP A;  3ZXS A;  3KEZ A;  3ML8 A;  4DK5 A;  3CHS A;  4A55 A;  1FCH A;  1ZBP A;  1Z3Y A;  3PZD A;  4GYW A;  1NZN A;  3L16 A;  4UI9 K;  3CVV A;  4N3A A;  1S0P A;  2Y4T A;  3JYS A;  3TGO A;  5KJN A;  3OXL A;  5FWQ A;  2LAI A;  2IU1 A;  1HG2 A;  3G2T A;  4XX5 A;  2X6H A;  2VYI A;  4Q69 A;  4BSX A;  3ML9 A;  4PDX A;  5A23 A;  1KLX A;  2L0T B;  5FJY A;  4BX9 A;  3BG1 B;  3FY4 A;  2QFC A;  3VLE A;  2VSY A;  4K0R A;  5FTP A;  4DLO A;  3CHP A;  4ILI A;  5D0O D;  3PVL A;  4YND A;  2WMN A;  3SHF A;  4FHJ A;  4GA0 A;  1WY6 A;  3TAX A;  2AXV A;  3LYA A;  2KZT A;  2L9B A;  2BF0 X;  4N2S A;  4JC8 A;  3T8M A;  4AY5 A;  2L0I A;  4I6G A;  4G23 A;  3VLF A;  3NQP A;  3D9N A;  2VSO E;  3KAE A;  4RG9 A;  2DBA A;  4TRQ A;  3ZYK A;  2EQX A;  1MQS A;  2V8S E;  3B7R L;  3PH0 C;  1INZ A;  2V0P A;  3L08 A;  3FP3 A;  2QY7 A;  2XEV A;  3I4G A;  3CR3 A;  3FTS A;  4J6I A;  5DIZ A;  4U0S A;  5T4Y A;  3UT7 A;  3ONK A;  4F3V A;  2C0M A;  3TXN A;  4GZ3 A;  3L22 A;  3PEU B;  4BT8 A;  4BT9 A;  4DPR A;  1OUV A;  2KAT A;  1WM5 A;  2J9Q A;  4I43 A;  3PE3 A;  4A3T A;  1OWL A;  3APD A;  4N2Q A;  4G25 A;  5T3R A;  3RJV A;  5LX8 A;  3D9P A;  2A4Z A;  5J90 A;  2UWJ G;  3RRM B;  3JUI A;  3ASH A;  3CVU A;  2WXR A;  3BEE A;  1Y6I A;  2FUL A;  2WXO A;  2WMO A;  3AU4 A;  3D9J A;  2XPZ A;  4JHR A;  2CFU A;  2WXI A;  3P2B A;  4U63 A;  3FUD A;  2WXM A;  4EZJ A;  4CGV A;  3FUF A;  4HOT A;  5AJL A;  3S7D A;  5KJM A;  2AXU A;  4YVQ C;  1UJK A;  5JJT A;  2WXJ A;  4B8C B;  4GML A;  3QJZ A;  4KXK B;  1E8Y A;  1NA3 A;  1XGW A;  3PUK A;  3QWP A;  2VTB B;  1FVF A;  2I6H A;  4MLP A;  2HO1 A;  2BUG A;  2GRL A;  3C98 A;  3CLJ A;  3CVQ A;  4OYS A;  5HI7 A;  2RG8 A;  3IKO B;  3AS4 A;  1HG5 A;  2R5S A;  3CVL A;  2WXN A;  4I1O B;  2VGX B;  3TJP A;  4G24 A;  1UW4 B;  1Z3X A;  2DCP A;  4URK A;  2OVB A;  4PUC A;  3HYM B;  3RO3 A;  4ANV A;  3B7T A;  4BY6 A;  4ABN A;  4WWO A;  3SBS A;  1HS6 A;  1PY1 A;  2VJ8 A;  1SQM A;  4CDR A;  3AS8 A;  4F1S A;  4EBA G;  5FQ4 A;  1EPU A;  3ZIM A;  3ENE A;  3ZN3 A;  3LJ3 A;  4LEU A;  3T5X A;  3LCA A;  4OVV A;  4NRH B;  5LOZ A;  1VDY A;  3QAQ A;  4K03 A;  2J08 A;  3S2A A;  4W9R A;  3Q5M A;  1H2V C;  1TJC A;  2FBN A;  1IQR A;  1EF1 C;  4FU3 A;  4EPZ A;  3ZW3 A;  5ANL A;  3ZGQ A;  4ILG A;  2X6I A;  4EQF A;  2HR2 A;  2PQR A;  3UPV A;  3JQ1 A;  1TEZ A;  3N71 A;  4AVX A;  4CDM A;  2AW6 A;  3LY8 A;  1QQE A;  4PS7 A;  3SFZ A;  4UQX A;  2XGS A;  4GZD A;  4PH4 B;  4GCO A;  4Y6C A;  3R9A B;  2WVI A;  5FZS A;  3FU0 A;  4I9C A;  5BV0 A;  4EZK A;  4IUL A;  1HU3 A;  4WWN A;  2E0I A;  5D0Q D;  3HVE B;  4UI9 C;  3PRE A;  4KZC A;  3OXF A;  4KYO B;  3U66 A;  1U3C A;  4A1G A;  2AWI A;  4V3I A;  5CHE E;  3FUN A;  4BWR A;  4JVS A;  3EJN A;  2XPY A;  4WNF A;  4HOS A;  2PM6 A;  3FDH A;  3LEW A;  3RIB A;  3RRN B;  2NC9 A;  3TXM A;  1ELW A;  3CHR A;  3APF A;  4Q94 A;  4XZ4 A;  3TG4 A;  3ZYQ A;  1Y8M A;  3ZPJ A;  2I9C A;  5LCW C;  4I17 A;  4IRU A;  3RU0 A;  3FU5 A;  1MHQ A;  4ANW A;  3BG0 B;  4JEH A;  3MV2 B;  4LER A;  1HE8 A;  2IJG X;  3OTN A;  4MKT A;  4C0M A;  2ION A;  3FH5 A;  4GZ5 A;  4AY6 A;  3R7Q A;  3MYV A;  4AIF A;  5C1D A;  3QC1 A;  4AOF A;  4DI3 A;  4A1S A;  1IQU A;  1HX8 A;  5BUZ A;  3AS5 A;  3R7R A;  2JEK A;  2VQ2 A;  3UMV A;  4E85 A;  3Q49 B;  1UN9 A;  3EIQ C;  4D10 C;  1JPL A;  3D9L A;  3CV0 A;  5HQ8 A;  3NF1 A;  3WXX A;  1N52 A;  2IOL A;  2PM7 A;  3FH7 A;  3K9I A;  3ONL A;  5DBK A;  4GAA A;  4XI9 A;  3RO2 A;  3LY7 A;  5FZR A;  5G55 A;  4P29 A;  4HVB A;  4GA2 A;  4ME2 A;  4BX8 A;  4U0Z A;  3SZ7 A;  1H6K A;  2XQ0 A;  4GB9 A;  3NZS A;  1BPO A;  2KM4 A;  3FUH A;  3EHM A;  3KD7 A;  2WXP A;  1OWM A;  3CVP A;  3FEY A;  3ZYL A;  1E8Z A;  4GYO A;  4XKB A;  5FZQ A;  2P58 C;  2MOW A;  3SBT B;  4RVB A;  4UWH A;  4E6H A;  3CQG B;  3APC A;  3LDZ A;  3IV0 A;  5CCM A;  2VGY A;  4APO A;  4CRW A;  1U3D A;  4WNG A;  2MHK A;  1FVH A;  4WUY A;  5AEN A;  1HO8 A;  3LVQ E;  3FH8 A;  4FP7 A;  1NP7 A;  2C2L A;  1X5B A;  4EZL A;  3IEG A;  1KT0 A;  4WND A;  4J8E A;  1E90 A;  3CVN A;  2VTB A;  4ACK A;  1A17 A;  4LCT A;  2X6F A;  4O6F A;  5EKQ D;  3CHO A;  3ZHE B;  3E4B A;  3FUM A;  2XRY A;  1ELR A;  4J8F A;  3IHY A;  4FHK A;  4H7X A;  2LNI A;  4U0U A;  3UT4 A;  2LSU A;  3TG5 A;  4N39 A;  5EDS A;  4AJW A;  2FI7 A;  2J09 A;  2WXK A;  3MX3 A;  2GRM A;  1HF8 A;  4I9E A;  5C2Y A;  4DLQ A;  5EX0 A;  2X6K A;  1W3B A;  5FQ8 A;  5G05 J;  2R59 A;  1ELK A;  3HIZ A;  3G2V A;  4BTB A;  3D9O A;  2CHX A;  4EBA A;  3OXG A;  4AV7 A;  3FTX A;  4N5C A;  3VTY A;  2WB2 A;  2YIN A;  2OND A;  1DVP A;  2CG3 A;  5FT9 A;  4CT4 A;  3D9M A;  4UQZ A;  2XHE A;  3EHN A;  3LS8 A;  3ASD A;  3S7F A;  1EDU A;  1DNP A;  4MRU A;  2BTD A;  4UWF A;  5KJL A;  3QK0 A;  2XGO A;  4GYY A;  4A3V A;  4PS8 A;  3QAR A;  3B13 A;  3GW4 A;  2LO6 A;  3FTV A;  3ZYM A;  2HYZ A;  2J4D A;  3GZS A;  2NSZ A;  3RRU A;  5ARG A;  3FUL A;  3HVE A;  4RG6 A;  3ULQ A;  2GW1 A;  4EEC A;  4HFG A;  2XRZ A;  5E75 A;  3I4R B;  4AM9 A;  4I1M A;  3SD5 A;  4Q96 A;  3FU6 A;  4PS3 A;  5E76 A;  3D3M A;  3KS2 A;  4I6J A;  3SI5 A;  2CHZ A;  2MRI A;  2WPV A;  3FTW A;  2IOS A;  4LRZ A;  1TJF A;  3GZ1 A;  3PE4 A;  4Y6W A;  2V5F A;  3VTX A;  3PS6 A;  5KJK A;  1B89 A;  4HLE A;  2C0L A;  4UWK A;  3UQ3 A;  3L54 A;  1WAO 1;  2WQ6 A;  3CGH A;  4HS2 A;  1E7V A;  4TUU A;  3ZVV A;  2KC7 A;  2VSX E;  3FEX A;  4KBQ A;  3PDN A;  3P1U A;  2WXH A;  3VLD A;  2FO7 A;  2LAH A;  2XCC A;  4LUN U;  4ANX A;  5AIJ A;  5JJ7 A;  4C0E A;  4XIF A;  1E8W A;  1SZA A;  2XGM A;  4HXI A;  2IQC A;  3CST A;  2I2O A;  3UT8 A;  3URZ A;  3U3W A;  3DPD A;  2YHE A;  4BTA A;  4IYP A;  4QFV A;  2CG2 A;  2I1K A;  3LPZ A;  5BNW A;  3FTZ A;  4JW1 A;  4GPK A;  2CFZ A;  3OAW A;  3PNL B;  2ZU6 B;  3ESK A;  3I3N A;  4F7A A;  4AXH A;  3G2W A;  3U9W A;  2XPI A;  1EYH A;  3GZ2 A;  2OOE A;  4XI0 A;  2YNQ A;  4GZC A;  5ARF A;  2PZI A;  1YA0 A;  1HH8 A;  3CHM A;  3FUE A;  4JA7 A;  2OV8 A;  5JHB A;  3FTY A;  1UG3 A;  4NAC A;  2A5U A;  4JL0 A;  4NUR A;  1HZ4 A;  4HOQ A;  3RKV A;  3TL5 A;  1PC2 A;  2UY1 B;  5G2N A;  3HDX A;  4I1A A;  4XE0 A;  3MV3 B;  4JHK A;  1JWF A;  5G04 J;  3D9I A;  2E2E A;  3ZEF A;  2Q7F A;  2WXF A;  4G26 A;  3NZU A;  2X3M A;  3LVR E;  1L5J A;  1H0A A;  3MKQ B;  4C9B B;  3QWW A;  3B7S A;  3PNT B;  2GGF A;  3SNX A;  3MGB A;  1ZU2 A;  2X6J A;  3QNK A;  4JHJ A;  3T5V A;  5CMY A;  2FF4 A;  1E96 B;  4FLB A;  3ESL A;  4KMO A;  2WXL A;  4I6E A;  2WXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...