2GGFA

Solution structure of the ma3 domain of human programmed cell death 4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
GSSGSSGLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the MA3 domain of human Programmed cell death 4
rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords Programmed cell death 4, isoform 1
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ggfA00
2GGFA 2VSOE 3D3MA 4GMJA 4C9BB 2ZU6B 4B8AA 1N54A 3FEYA 1UG3A 2RG8A 4B8CB 2VSXE 3EIJA 2NSZA 1H6KA 2FULA 1N52A 2KZTB 1H2TC 2IOLA 1H2UA 1H2VC 4GMLA 3FEXA 4CT4A 2KZTA 3L6AA 2IONA 3EIQC 2I2OA 2HM8A 3JUIA 4JHJA 1PAQA 4CEMA 2IU1A 4CRWA 4JHKA 4LUNU 4B89A 3RK6A 1HU3A 2IOSA 4IULA 5ANRA 1UW4B
chains in the Genus database with same CATH superfamily
2IY0C 4JL0A 4I2WA 2FF4A 4ANUA 2VGEA 5FT9A 4EPZA 2GRRB 3D9PA 3RSEG 2WPVA 3B7RL 2J8SD 3GZ2A 5BPPA 1K1BA 3APDA 2J09A 3OXGA 3ZUVB 3R7QA 3L08A 4U95D 4GMJA 3FU0A 3QKYA 4LRZA 4XEIG 5CRVA 2PL2A 3L17A 3FWVA 4B93B 4U8VD 2FO7A 3QC1A 2X3MA 4EZJA 3APCA 4AIFA 1HF8A 3FUEA 4GAAA 1N95A 3BU8A 4U04A 5A6CA 2VSOE 4EECA 3LY9A 4GPKA 3LJNA 2VSXE 1EPUA 2EQXA 2EINE 4GYOA 2Y3AA 3OTNA 4FHKA 2UY1B 5HKPA 3L54A 3GZSA 3ASOE 4A55A 3LKUA 2XEEA 3NZUA 4FLHA 2LO6A 1SZ9A 5ITZF 3B13A 4TXPA 4KT6B 1JPLA 1HFAA 4EZKA 1OWMA 4N3AA 3HXDA 4A1SA 4ANWA 4EZLA 4O1PA 4APFA 2GRNB 3CQGB 4UUCA 4JVSA 3TGOA 2P2CP 2X6FA 4GMRA 3D9MA 4BETA 5AJLA 3U64A 1BI7B 4GTPA 1YYHA 4J0UA 4FC8A 3NZSA 3FEYA 1A17A 2R5SA 3CVPA 4GTQA 2X6HA 4Q94A 2YINA 1H2TC 2IOLA 2XENA 3EHMA 2CFZA 4JB8P 2KBXA 3E37A 2B6CA 1LTXA 1IQUA 2MHKA 3DSSA 3FU6A 4XKCA 1UW4B 3BUAA 3DRAA 4E6HA 3VLEA 4CYMD 2AXUA 5BNWA 3C3OA 1H2UA 2JABA 1KT1A 3VTYA 4TXRA 3PVLA 2IONA 1SZAA 5AN8A 3ZXSA 4K5CA 5JHBA 2DIWA 1JCQA 3D9IA 4G1TA 2WXMA 4BFRA 3AS4A 4P29A 1TN8A 4FU3A 1TR4A 2AW6A 4A3VA 4KMOA 2WMOA 3AJIA 1ELRA 4BX9A 2XPZA 4M3OA 4GYWA 5FIOA 4AOFA 3ASNE 3R9MA 3QJZA 4G8LA 2JLBA 5FZRA 2F8XK 2PZIA 2UY1A 4EBAA 3KD7A 1E8ZA 1RW2A 4N39A 2WQHA 4GB9A 3U3WA 1SW6A 3S7DA 5AYWD 3V2XA 2J49A 3RU0A 5BT1A 3DEOA 3HHMA 3TWWA 2Y0BG 3R9AB 5C2YA 2I6HA 4GA0A 1GW6A 3ASHA 2FEZA 2LXMA 2P9SG 2X6IA 3ZN3A 2GRLA 4C9BB 4CDNA 1FVFA 2HO1A 4A63B 3ZRHA 3CHRA 1NA3A 4RQIA 2HE0A 3LVRE 5AQBA 4ATZD 4JHKA 2AVPA 2ZU6B 2WXPA 2MRIA 3ESLA 2KM4A 5A7DB 2LSUA 3VLDA 1JCSA 4ACKA 4JHJA 3KEAA 3SY2A 2WXJA 4OVUA 3NQPA 2V8SE 2LAIA 2F0YA 3FHEA 2RFAA 3X2QE 4LSZE 3JQ1A 3UKRG 1JUQA 2WXKA 1JWGA 3D9OA 4PS7A 4U8HA 2PQNA 4I43A 4G23A 1AP7A 1HG5A 3JYSA 3UT7A 5B1AE 4AVXA 1E7VA 5AAOA 4EQFA 4DX1A 2WQ7A 3NOGD 5KJMA 4J7WA 5DBKA 5CBNA 2B0OE 3Q78A 2YQ8A 4G2VA 4HFGA 4TUUA 3SBTB 1N9AA 4BY6A 5CEDB 1TNOA 3Q79A 2WXNA 2IOSA 4I1OB 4BSZB 3GYZA 1VDYA 2QC9A 4KYOB 4TRQA 5AARA 1LF8A 3UINC 4OYSA 5JJ6A 4DX7D 3E30A 3UUXA 2Y4UA 3ZXPA 4HOQA 5FJYA 3W9GA 3SFYA 3PZ3A 5ENNA 1YMPA 4Z68A 2WXOA 2VTBA 3TWSA 3CVVA 1YA0A 2WXIA 4BX8A 1NL4A 1V55E 5EX3A 4GTVA 3QOUA 4DX5D 4UWFA 3CK9A 3CEQA 3SQVA 1S0PA 3V79K 1MZCA 3CSTA 1ZBPA 3FU5A 5ENQD 1DCQA 2IQCA 4UWGA 3PZDA 2AXZA 3FUIA 2L0TB 2XZTG 2XGSA 3RRNB 4U7EB 4RG9A 4N5CA 5BXUA 3T5VA 4ILHB 1OCCE 5LX8A 4DRXE 5ANLA 5B1BE 4J8SA 2Q7FA 2HM8A 3PEUB 1NZNA 1N0RA 1IHBA 4ILGA 2I1KA 2RFMA 4AM9A 2OEVA 4IULA 3FU3A 1FPPA 4YVQC 1H0AA 2VGYA 3J5PA 1QNFA 2OOEA 3LJ3A 1UN8A 3DSTA 3D9JA 5CCMA 3CHPA 1K8KG 3CK7A 3TG5A 2Y1LE 5T4YA 3JXIA 3SZ7A 3TWRA 4URKA 1HXIA 1N54A 1OWOA 4BEPA 4BESA 4WNGA 3JQ0A 2LAHA 5LCWJ 3DEPA 1INZA 4O6FA 2IU1A 1FCHA 3PUJA 4E85A 2QY7A 3SGHA 2WXQA 5AQAA 3RKVA 3QDNA 2EIJE 3Q9UC 1N4RA 1H6PA 3CHOA 4JPSA 4APOA 2KATA 3Q7FA 2V5FA 3MZLB 3L13A 3KEZA 4ANVA 4FLBA 3QARA 5D0QD 2H6IA 3Q75A 1D9SA 2I9CA 1TJFA 4HOTA 5B3SE 4C48B 1HZ4A 1OCRE 5A23A 3D9KA 2X38A 3DSUA 3W9FA 3TXNA 1EF1C 3AAAC 5KCMA 1UOHA 3E34A 3L6AA 1PAQA 4H7YA 3PH0C 3RO3A 3SNXA 4N3CA 1DVPA 2DZNA 4L2YA 2A5EA 4J8EA 2ZXWE 4WWNA 4F53A 4ANXA 3DXKG 1KZPA 1E8YA 4GZ3A 4UWLA 3TWXA 4OAUC 4ATGA 1Y8MA 2XCBA 2A4ZA 4HOSA 2CFUA 3PZ1A 3BEEA 4F1SA 5BXOA 4Y6CA 2C2LA 1X81A 5G05J 5FQ6A 4JD2G 5KNGA 3HDXA 1U2VG 4TUMA 3UM3A 3ZHEA 3IEGA 3ASGA 3WXXA 4AXHA 2XRYA 1SA5A 4HI8A 4AP2A 1KT0A 4BTBA 4L2LA 4LG6A 4RVBA 3FY4A 4XKBA 2DCPA 2KCVA 4HNAD 2Y69E 4MKTA 4EHMA 1W3BA 5EX0A 1TNUA 4LNUD 3UIPC 3Q5MA 2KXPC 1HH8A 4YNDA 2ZISA 3UT8A 3ONKA 4XE0A 4ZHBA 3ABLE 3Q9NC 5BV0A 2VGXB 3AG1E 5EILA 3AG2E 1NA0A 4N3BA 4R7LA 2ONDA 2ZGGA 1OUVA 3FTSA 5H7PA 2WQ6A 3I4GA 5T8IA 2R02A 1FT2A 2ETAA 4F6RD 3S2AA 1U3CA 2X6KA 2E2EA 1TJCA 1IKND 2H6GA 2KC7A 4O1OA 3PE3A 4HOUA 2CG3A 4B8AA 3UT4A 2KCLA 3CK8A 3EIJA 4Q96A 5HS0A 2PNNA 5LOZA 4GMLA 5J90A 4JXTA 4YVOA 4B94A 2IEJA 3LYAA 4I6JA 4HXIA 5CMWA 3C72A 1WY6A 3G2SA 4K5AB 2XGMA 2H6FA 2L0IA 1KLXA 3RRUA 4J8FA 4CDMA 2LNIA 4K5BA 4I17A 3MKRA 2MYOA 1OY3D 3CVQA 5ARGA 4NURA 3PREA 3EJNA 2L6JA 4JEHA 5LFAA 2J9QA 4GTSA 2OV8A 3TG4A 4FULA 3ZNGA 2AJAA 3TWTA 4U8YD 2PM7A 3ZHEB 4WAFA 4CGWA 1JWFA 3DWLG 1HU3A 3DSWA 3SFXA 4ZFHA 2V5QC 2OEWA 3ULYA 1N4PA 3QK0A 4G8KA 2HYZA 3LDZA 4HRMB 5BW8C 1N94A 4V3IA 1WG0A 3SO8A 4XI9A 1OWNA 4D10C 4N2SA 3QB2A 4LUNU 4KBQA 3MX3A 5EIBE 1MJ0A 1X5BA 4AEZC 3FTVA 3ASFA 4L1BA 3PNTB 5G55A 4A3TA 1UJJA 4AY5A 4DLOA 3ZGQA 3IXEA 5CBOA 2C0LA 3CSFA 3JUIA 4CEMA 2VYIA 2WXGA 3EU9A 4JA9A 1MX4A 2V4LA 3FTUA 3J5QB 4ILIA 2CHXA 2M63A 4AY6A 3LCAA 1E8XA 1PC2A 3ABME 3FH5A 1BI8B 3O4ZA 3V2OA 1O5MA 2R05A 3HXEA 5T3RA 2MOWA 2FBNA 3EIQC 2FO1E 4PH4B 1H6OA 4F7AA 2VQ2A 5FTPA 2IF4A 4HS2A 5ENTD 5AJDA 4J8YA 4WNFA 2R03A 2WXHA 3MEKA 4UI9J 5JA4D 3FTXA 3MKQB 5CECB 1Z6TA 2Y4TA 4CRWA 4DX6D 5G05C 3ML9A 3RJVA 3IHVA 3UI2A 2ZIRA 5ANRA 3EU5A 3D9HA 3L9TA 4U63A 3DPYA 2CHWA 3TL5A 2RG8A 3ZYMA 4JC8A 2YHEA 4MS6A 3FUKA 1OCOE 5E75A 3ZU7B 4GTOA 4JEUA 2P58C 4HORA 4LNBA 2BKKB 4TXQA 3D9NA 2XGOA 5CCLA 3PE4A 1N0QA 1BD8A 3DPDA 3QWVA 3AG3E 1XGWA 4KXKB 2GRPB 3C3RA 4YDOA 1QYMA 5EIDA 3IHYA 3I3NA 4K03A 4G11A 3K9IA 4WWPA 2DYRE 4PUCA 1E96B 3UX4A 3FTWA 5EN5D 5G2NA 2BF0X 2WB2A 5KNHD 1PY1A 3LEWA 4I6GA 4CCAA 3NB2A 3CV0A 2XEHA 4RLYA 4Q69A 4J8DA 2R17C 2NSZA 3EUVA 4MLPA 2C0MA 1H2VC 3FEXA 1WAO1 2P9NG 3CVLA 4X8QA 2DZOA 1N11A 5BV1A 2X6JA 3G2UA 1LD8A 4M7CA 1HS6A 1U3DA 4ABNA 1SA4A 2E0IA 3VTXA 4I1MA 3LY7A 4G25A 4WUYA 5FQ8A 3B7BA 1TNYA 1S63A 2R2LA 1UN9A 3SF4A 2IO3C 3TWQA 4DI3A 1BLXB 3E33A 2ILRA 2PM6A 1NI1A 3G2TA 3NF1A 2EIME 4CDRA 3UIOC 4NIKA 3HYMB 5FZQA 4BWRA 3G2WA 2L9BA 1NP7A 3FH8A 5D2MC 4XX5A 3KSQA 4UI9C 4CT0A 4G26A 2A5UA 5FQ7A 4UQZA 1O1SA 3S7BA 1DC2A 3B7SA 3FH7A 4OAVB 4WNEA 1UG3A 3ZIMA 5EDSA 1AWCB 4N2QA 4PDXA 4Y6WA 5CRUA 3O48A 3ULEG 3FUDA 1A5EA 4UWKA 3JXJA 2WXLA 3HVEA 4I2ZA 4U0UA 1MHQA 4BT8A 4F1PA 3T5XA 1HX8A 4OVVA 2J4BA 4B8CB 2XQ0A 3CQCB 4YDEA 2WXRA 1MX6A 4NRHB 3MA5A 4GYYA 4GTMA 2ZGDA 2JEKA 4N5QA 4HRNA 1RZ4A 3FUHA 3S7JA 1JCRA 1QZ2A 2OVBA 5HI7A 3I4RB 2WMNA 4BT9A 4GCOA 3RO2A 4PS8A 1EDUA 1MYOA 3ZYQA 2YHCA 1HO8A 4NQ0A 1E8WA 2LUHA 2IJGX 2PQRA 3BG0B 2UWJG 4UQXA 1Q2ZA 4UQYA 5E76A 2XRZA 3Q7AA 1L5JA 4HB5A 2GGFA 1S64A 2KCKA 3ZPJA 4U0ZA 4HI9A 2J08A 2OVFA 2GW1A 5D0OD 3MGBA 3PEVB 4IYPA 3HIZA 3RK6A 2VSNA 3ZFWA 4MRUA 3DSXA 1ELKA 1IQRA 4GZCA 3TWUA 3HXCA 1TNBA 5CEAA 4J6IA 3KS2A 4JZYA 1SVXA 3OAWA 5AENA 2F37A 3G2VA 4HLEA 4MBGA 3PNLB 4WNDA 1K3ZD 3QWPA 4U96D 1P5QA 3RIBA 1BPOA 3MKQA 2RKKA 3EHNA 2DBAA 3FFLA 3CVXA 3B7TA 3EHQA 1Y6IA 1TN7A 4YDYA 4JA7A 5KJKA 1E90A 3JCKC 4C0MA 3ESKA 3IKOB 5HRYA 1G3NB 4FP7A 3MYVA 3ONLA 1Z3XA 1H19A 3Q73A 4HBDA 2BUGA 3UKUG 1QQEA 2R59A 3S7FA 4LEUA 5LCWC 3AG4E 3MV3B 4QQIA 2P9LG 3MV2B 2VTBB 2AWIA 3P1UA 3EHRA 1OCZE 4CZ2D 4GCNA 3RAUA 4UWHA 3KSLA 1XNFA 3C5RA 3CGHA 5C1DA 2CHZA 1Z3YA 1IYGA 5JHAA 4PS3A 4UI9K 2VSYA 1IXVA 1NFIE 4GU5A 1HE8A 3TXMA 3L82A 1N4SA 2DYSE 3ZVVA 4FADA 1B89A 1Z5SC 2DVWA 3V31A 4DLQA 3DSVA 3CKBA 2J4DA 4XIFA 3FUJA 4ME2A 3T8MA 2P9PG 3C98A 1BU9A 4DJAA 5HQ8A 5CHEE 1OXJA 2QYUA 4H7XA 1EYHA 2XEVA 5ENOD 5EKQD 1ZB1A 5DIZA 4GA1A 3B7UX 3ML8A 1N4QA 2EIKE 3AU4A 4QFVA 4GZ5A 3ZEFA 3CHSA 1D8EA 3SBSA 5ENRD 4CT4A 5KJLA 3E32A 5CMYA 3MCXA 1QBQA 4G24A 4HVBA 4DK5A 1V54E 2P9KG 5AQ7A 2BTDA 2FULA 3HXBA 2NXPA 2ETBA 3FDHA 2OCCE 3CVWA 4WWOA 2IO2C 3D9LA 3MJWA 3NBNB 1OWLA 2EILE 1ELWA 3C3QA 3UMVA 2XPYA 2GROB 3BQOA 2RD0A 4GZDA 3PZ4A 3QWWA 1TEZA 2VJ8A 3Q49B 3IV0A 5FQ4A 1YCSB 3B95A 5KBAA 3UPVA 1E7UA 4W9RA 3TWVA 3GW4A 1DCEA 3FP3A 3ENEA 5JMND 2QFCA 5AIJA 2XCCA 3UM2A 3Q47B 3P2BA 2L6BA 1KZOA 4B0ZA 3ULQA 2BKGA 5M72A 1O1TA 4GPMA 2XPIA 4F3VA 5ARFA 3CKCA 3ISMC 2GRQB 3HG0D 3TAXA 5LP0A 1TNZA 3OXFA 3TJPA 2NC9A 4U0SA 3PUKA 2P9IG 2LXLA 3SD5A 2AXVA 3IBEA 3QAQA 2H6HA 4LNGA 5FWQA 2WM9A 2CG2A 1OT8A 1K1AA 3F6QA 2DWZA 3APFA 3LVQE 4KZ0A 4L7TA 3JUEA 3D3MA 3FTYA 3SHFA 3L16A 3DBSA 3UQ3A 3VLFA 1OWPA 3GZ1A 2QZAA 3Q4AB 5EYPF 2V4HC 5KJNA 4KVOA 3UM1A 4NACA 2WXFA 3NOCD 2NYJA 4GTTA 3T9KA 3CVUA 3UM0A 1S70B 3PRZA 3HRAA 1MQSA 4A1GA 3BG1B 3L22A 1IHGA 2F8YA 1MX2A 1HG2A 3V30A 3ZYKA 4CGVA 1FT1A 3CHQA 3OXLA 3HVEB 4LERA 5FINA 3I5PA 4GZ6A 2KZTA 2VGXA 3UTMA 1UJKA 1KPSB 4GTRA 3CVNA 5JJ7A 4FJYA 4L9PA 3FUNA 3R7RA 2IFUA 3AU5A 3CHMA 1LD7A 2LSVA 3E4BA 3N71A 4O60A 5G04C 1O1RA 1D8DA 1H6KA 4DPRA 1N52A 3AS5A 4K0RA 3NAWA 1FVHA 3DXMG 3LXUX 3CIAA 5BUZA 4I6EA 4DUIA 2WVIA 4IN3B 2YNQA 5J08A 1DNPA 3Q15A 5EYLA 4I9EA 4HLLA 1ZU2A 3PDNA 4L23A 3SFZA 5ENSD 4KVMA 5JJTA 4HQDA 3FUMA 4BTAA 5FZSA 3SI5A 2QYJA 4TV3A 4DI4A 4JHRA 4BERA 4ACLA 3AS8A 1WM5A 2P9UG 3FTZA 5G04J 3LY8A 3WG7E 5AQ9A 4AJWA 2XS8A 3HXFA 4XI0A 4RSYA 3UXGA 3RRMB 4RG6A 5ENPD 4JW1A 3QNKA 4B89A 3ZKJA 2XHEA 3LPZA 4EBAG 4IRUA 4AV7A 1WDYA 2XS1A 1TYQG 1TN6A 3T8KA 4YDWA 2BEDA 4U07A 2FI7A 3ABKE 5D66A 2XZDG 4KZCA 3PZ2A 4DX2A 3U66A 3ASDA 5KWDA 3PS6A 3EDTB 3CR3A 2GRMA 4GA2A 4I9CA 2V0PA 3FUFA 3KAEA 2I1JA 3CVYA 3FULA 3ZYLA 2J07A 1SQMA 3U9WA 4HRLA 4I1AA 4BSXA 2KZTB 4C0EA 4XZ4A 4FA6A 3URZA 5CERB 3ZW3A 5IY5E 2I2OA 4LCTA 2HR2A 2ETCA 4FHJA 3U4TA 3LS8A 3CLJA 4FJZA
chains in the Genus database with same CATH topology
2M63A 4UWFA 4JL0A 3CK9A 4I2WA 2FF4A 3CGHA 5C1DA 4AY6A 2CHZA 3CEQA 1Z3YA 1IYGA 1S0PA 3LCAA 1E8XA 1PC2A 5JHAA 4PS3A 4UI9K 2VSYA 4ANUA 3CSTA 5FT9A 1ZBPA 3FH5A 3FU5A 4EPZA 4GU5A 3O4ZA 1HE8A 3D9PA 5T3RA 3TXMA 2WPVA 3B7RL 2IQCA 2MOWA 2FBNA 3EIQC 3GZ2A 4UWGA 3PZDA 4PH4B 5BPPA 3APDA 3ZVVA 2AXZA 2J09A 4FADA 3FUIA 2L0TB 3OXGA 1B89A 4F7AA 4DLQA 3R7QA 3L08A 2XGSA 3CKBA 2J4DA 2VQ2A 3RRNB 5FTPA 2IF4A 4HS2A 4RG9A 4XIFA 4GMJA 4N5CA 3FU0A 3FUJA 3QKYA 4ME2A 4LRZA 3T8MA 3C98A 3T5VA 5AJDA 4DJAA 5HQ8A 2PL2A 4ILHB 5CHEE 4WNFA 2WXHA 3MEKA 3L17A 3FWVA 5LX8A 4UI9J 4H7XA 5ANLA 2FO7A 3FTXA 1EYHA 3MKQB 3QC1A 2X3MA 4J8SA 2XEVA 3APCA 4EZJA 5EKQD 1Z6TA 2Y4TA 2Q7FA 5DIZA 4AIFA 2HM8A 4CRWA 3PEUB 4GA1A 3B7UX 1NZNA 1HF8A 5G05C 3ML9A 3FUEA 4GAAA 2I1KA 4ILGA 3ML8A 3RJVA 3IHVA 4AM9A 4IULA 3FU3A 3AU4A 5ANRA 4QFVA 4U04A 4YVQC 5A6CA 2VSOE 4GZ5A 4U63A 1H0AA 3ZEFA 4EECA 2CHWA 3CHSA 3LY9A 2VGYA 3TL5A 1QNFA 2OOEA 2RG8A 3LJ3A 3SBSA 3ZYMA 2VSXE 4JC8A 1EPUA 1UN8A 2YHEA 4MS6A 2EQXA 3D9JA 3FUKA 5CCMA 3CHPA 4CT4A 5KJLA 5E75A 4JEUA 5CMYA 3CK7A 4GYOA 3TG5A 3MCXA 4G24A 2Y3AA 5T4YA 2P58C 4HORA 3OTNA 4FHKA 2UY1B 3D9NA 2XGOA 5CCLA 3PE4A 3L54A 4HVBA 3GZSA 4A55A 3SZ7A 4DK5A 3LKUA 4URKA 1HXIA 3DPDA 1N54A 1OWOA 3NZUA 2BTDA 3QWVA 4FLHA 2LO6A 1SZ9A 4WNGA 1XGWA 3JQ0A 4KXKB 2FULA 2LAHA 3B13A 3IHYA 5LCWJ 3I3NA 2NXPA 4KT6B 1INZA 1JPLA 3FDHA 4G11A 4K03A 4O6FA 1HFAA 4EZKA 1OWMA 3CVWA 2IU1A 3K9IA 4N3AA 4WWOA 1FCHA 3PUJA 4WWPA 4A1SA 4ANWA 4E85A 3D9LA 2QY7A 4PUCA 3SGHA 1E96B 4EZLA 2WXQA 3MJWA 1OWLA 3RKVA 3UX4A 1ELWA 3QDNA 3UMVA 3FTWA 4APFA 3CHOA 4JPSA 2XPYA 4APOA 2KATA 2RD0A 2V5FA 5G2NA 3MZLB 3CQGB 3L13A 2BF0X 3KEZA 4GZDA 4ANVA 3QWWA 1TEZA 4JVSA 2VJ8A 2WB2A 4FLBA 3Q49B 3TGOA 3QARA 3IV0A 5D0QD 2X6FA 3D9MA 5FQ4A 3UPVA 5AJLA 1E7UA 2I9CA 1PY1A 4W9RA 3GW4A 1TJFA 3LEWA 3U64A 4I6GA 4CCAA 4HOTA 3FP3A 1HZ4A 3CV0A 3ENEA 4J0UA 5A23A 4FC8A 3D9KA 2X38A 3NZSA 2QFCA 3FEYA 5AIJA 1A17A 2R5SA 2XCCA 3CVPA 4Q69A 4J8DA 2X6HA 2R17C 3Q47B 2NSZA 3TXNA 4Q94A 2YINA 1H2TC 3P2BA 2IOLA 4MLPA 1EF1C 2C0MA 1H2VC 3EHMA 3FEXA 2CFZA 4B0ZA 1WAO1 3ULQA 5KCMA 3CVLA 3L6AA 5M72A 1PAQA 1IQUA 4F3VA 2XPIA 2MHKA 4H7YA 2X6JA 5BV1A 3G2UA 5ARFA 3CKCA 3FU6A 4XKCA 1HS6A 3PH0C 1U3DA 4ABNA 3RO3A 1UW4B 3TAXA 4E6HA 3SNXA 2E0IA 4N3CA 3VLEA 1DVPA 3VTXA 5LP0A 3OXFA 2AXUA 4I1MA 5BNWA 3TJPA 2NC9A 4L2YA 3LY7A 4G25A 1H2UA 1KT1A 3PUKA 4U0SA 3VTYA 4WUYA 4J8EA 3IBEA 2AXVA 3SD5A 3PVLA 3QAQA 2IONA 4WWNA 5FWQA 5FQ8A 4F53A 4ANXA 1SZAA 2WM9A 1UN9A 3ZXSA 2CG2A 3SF4A 1E8YA 5JHBA 2DIWA 4GZ3A 4DI3A 3D9IA 4G1TA 2WXMA 4BFRA 2ILRA 4UWLA 3APFA 3AS4A 4P29A 4ATGA 2PM6A 3LVQE 4L7TA 4KZ0A 3D3MA 3G2TA 3NF1A 4GPKA 3FTYA 4CDRA 1Y8MA 3SHFA 3L16A 4FU3A 3DBSA 2XCBA 2AW6A 3HYMB 5FZQA 2A4ZA 4BWRA 4HOSA 4A3VA 3UQ3A 4KMOA 2CFUA 2L9BA 3G2WA 3VLFA 1NP7A 3FH8A 1OWPA 3GZ1A 3BEEA 4XX5A 2WMOA 3Q4AB 1ELRA 4UI9C 4CT0A 4G26A 4KVOA 4F1SA 5KJNA 4BX9A 2A5UA 2C2LA 4NACA 2WXFA 2XPZA 4M3OA 4Y6CA 5FQ7A 4GYWA 4UQZA 5FQ6A 5G05J 3S7BA 3HDXA 3B7SA 3ZHEA 3FH7A 4AOFA 3IEGA 3ASGA 3WXXA 3CVUA 4WNEA 4AXHA 1UG3A 3PRZA 3ZIMA 3QJZA 1MQSA 5EDSA 2XRYA 4A1GA 3BG1B 4AP2A 1KT0A 4N2QA 4BTBA 4PDXA 4Y6WA 4L2LA 3L22A 3O48A 2JLBA 3FUDA 1IHGA 5FZRA 4UWKA 4RVBA 3FY4A 4XKBA 2PZIA 2UY1A 2WXLA 2DCPA 3HVEA 4I2ZA 2KCVA 1MHQA 4U0UA 4EBAA 1HG2A 3KD7A 1E8ZA 4BT8A 4N39A 2WQHA 4GB9A 4MKTA 1W3BA 5EX0A 3U3WA 3ZYKA 3S7DA 3T5XA 4CGVA 3Q5MA 3CHQA 5AYWD 1HX8A 4OVVA 2J4BA 3OXLA 4B8CB 2J49A 3HVEB 3RU0A 2XQ0A 3CQCB 1HH8A 5BT1A 4YNDA 3HHMA 4LERA 3UT8A 3I5PA 2WXRA 3ONKA 4XE0A 4GZ6A 2KZTA 4NRHB 3R9AB 2VGXA 5C2YA 1UJKA 2I6HA 3MA5A 4GA0A 4GYYA 1GW6A 3ASHA 5BV0A 2FEZA 2JEKA 3CVNA 2X6IA 5JJ7A 2VGXB 4FJYA 3ZN3A 3FUNA 2GRLA 1NA0A 3R7RA 4N3BA 2IFUA 3AU5A 3CHMA 3E4BA 2LSVA 3N71A 4C9BB 4R7LA 1FVFA 2HO1A 2ONDA 5G04C 4CDNA 3FUHA 1OUVA 3FTSA 3S7JA 1H6KA 4DPRA 1QZ2A 1N52A 3ZRHA 3AS5A 2WQ6A 3CHRA 4K0RA 3I4GA 5T8IA 1NA3A 2OVBA 1FVHA 3LVRE 5HI7A 3I4RB 3S2AA 3LXUX 2WMNA 1U3CA 3CIAA 4BT9A 2X6KA 4GCOA 4JHKA 5BUZA 2E2EA 1TJCA 4I6EA 3RO2A 4PS8A 2WVIA 4IN3B 2KC7A 2YNQA 1EDUA 5J08A 3PE3A 3ZYQA 2AVPA 4HOUA 1DNPA 2CG3A 1HO8A 2YHCA 2ZU6B 3Q15A 4NQ0A 3UT4A 4B8AA 1E8WA 4I9EA 2KCLA 2WXPA 2IJGX 2MRIA 1ZU2A 3CK8A 3EIJA 3ESLA 3PDNA 2PQRA 4L23A 4Q96A 3SFZA 2KM4A 3BG0B 5LOZA 4KVMA 2LSUA 2UWJG 5A7DB 4GMLA 5JJTA 5J90A 3FUMA 4JXTA 4YVOA 3VLDA 4B94A 4UQXA 4BTAA 4UQYA 5FZSA 3LYAA 5E76A 4ACKA 2XRZA 4JHJA 1L5JA 4I6JA 4HXIA 5CMWA 3SI5A 2WXJA 1WY6A 4OVUA 3G2SA 3NQPA 2XGMA 4TV3A 4DI4A 2GGFA 2KCKA 2L0IA 2V8SE 2LAIA 4JHRA 3ZPJA 4ACLA 1KLXA 3FHEA 3AS8A 1WM5A 4U0ZA 3RRUA 2J08A 2OVFA 3FTZA 4J8FA 4CDMA 3JQ1A 5G04J 3LY8A 1JUQA 2WXKA 4AJWA 2GW1A 1JWGA 4XI0A 5D0OD 4RSYA 2LNIA 4I17A 3D9OA 4PS7A 3MGBA 4U8HA 3RRMB 3PEVB 2PQNA 4I43A 4RG6A 3MKRA 4IYPA 3HIZA 4G23A 4JW1A 1HG5A 3QNKA 4B89A 3RK6A 3JYSA 3UT7A 3CVQA 2VSNA 2XHEA 5ARGA 3LPZA 4AVXA 4NURA 3ZFWA 4MRUA 3PREA 1E7VA 3EJNA 1ELKA 2L6JA 4EQFA 4JEHA 5LFAA 4EBAG 1IQRA 4GZCA 2J9QA 2WQ7A 2OV8A 5KJMA 3TG4A 5DBKA 4IRUA 4FULA 4J6IA 4AV7A 3KS2A 2YQ8A 4JZYA 4G2VA 3OAWA 4HFGA 4TUUA 3SBTB 5AENA 4BY6A 2PM7A 3ZHEB 4WAFA 3G2VA 4HLEA 1JWFA 4CGWA 4U07A 3PNLB 4WNDA 1HU3A 2WXNA 3QWPA 2IOSA 1P5QA 2FI7A 4I1OB 3RIBA 1BPOA 3GYZA 3QK0A 4KZCA 1VDYA 3MKQA 2HYZA 4KYOB 4TRQA 3LDZA 3U66A 5BW8C 1LF8A 3EHNA 2DBAA 3FFLA 3ASDA 4V3IA 3CVXA 3PS6A 4OYSA 3B7TA 3EDTB 4XI9A 3CR3A 2GRMA 4GA2A 4I9CA 5JJ6A 3UUXA 1OWNA 1Y6IA 2Y4UA 4D10C 2V0PA 3FUFA 4N2SA 4JA7A 3KAEA 3QB2A 4HOQA 5KJKA 4LUNU 1E90A 3JCKC 3MX3A 4KBQA 5FJYA 4C0MA 3ESKA 3IKOB 2I1JA 1X5BA 4FP7A 3CVYA 3FULA 4AEZC 3FTVA 3MYVA 3ONLA 1Z3XA 3ASFA 5ENNA 1H19A 3ZYLA 1SQMA 2BUGA 2J07A 4L1BA 3PNTB 5G55A 3U9WA 1QQEA 2R59A 2WXOA 4I1AA 2VTBA 4BSXA 3S7FA 4A3TA 1UJJA 2KZTB 4AY5A 4DLOA 3CVVA 1YA0A 2WXIA 4C0EA 4LEUA 5LCWC 3ZGQA 4XZ4A 4BX8A 4FA6A 3URZA 2C0LA 3MV3B 3ZW3A 3MV2B 2VTBB 2I2OA 3CSFA 3JUIA 4LCTA 2HR2A 4CEMA 4FHJA 3U4TA 2VYIA 2WXGA 5EX3A 2AWIA 4JA9A 3P1UA 2V4LA 4GCNA 3FTUA 3LS8A 3QOUA 4ILIA 4UWHA 3CLJA 4FJZA 1XNFA 2CHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGF A;  2VSO E;  3D3M A;  4GMJ A;  4C9B B;  2ZU6 B;  4B8A A;  1N54 A;  3FEY A;  1UG3 A;  2RG8 A;  4B8C B;  2VSX E;  3EIJ A;  2NSZ A;  1H6K A;  2FUL A;  1N52 A;  2KZT B;  1H2T C;  2IOL A;  1H2U A;  1H2V C;  4GML A;  3FEX A;  4CT4 A;  2KZT A;  3L6A A;  2ION A;  3EIQ C;  2I2O A;  2HM8 A;  3JUI A;  4JHJ A;  1PAQ A;  4CEM A;  2IU1 A;  4CRW A;  4JHK A;  4LUN U;  4B89 A;  3RK6 A;  1HU3 A;  2IOS A;  4IUL A;  5ANR A;  1UW4 B; 
#chains in the Genus database with same CATH topology
 2IY0 C;  4JL0 A;  4I2W A;  2FF4 A;  4ANU A;  2VGE A;  5FT9 A;  4EPZ A;  2GRR B;  3D9P A;  3RSE G;  2WPV A;  3B7R L;  2J8S D;  3GZ2 A;  5BPP A;  1K1B A;  3APD A;  2J09 A;  3OXG A;  3ZUV B;  3R7Q A;  3L08 A;  4U95 D;  4GMJ A;  3FU0 A;  3QKY A;  4LRZ A;  4XEI G;  5CRV A;  2PL2 A;  3L17 A;  3FWV A;  4B93 B;  4U8V D;  2FO7 A;  3QC1 A;  2X3M A;  4EZJ A;  3APC A;  4AIF A;  1HF8 A;  3FUE A;  4GAA A;  1N95 A;  3BU8 A;  4U04 A;  5A6C A;  2VSO E;  4EEC A;  3LY9 A;  4GPK A;  3LJN A;  2VSX E;  1EPU A;  2EQX A;  2EIN E;  4GYO A;  2Y3A A;  3OTN A;  4FHK A;  2UY1 B;  5HKP A;  3L54 A;  3GZS A;  3ASO E;  4A55 A;  3LKU A;  2XEE A;  3NZU A;  4FLH A;  2LO6 A;  1SZ9 A;  5ITZ F;  3B13 A;  4TXP A;  4KT6 B;  1JPL A;  1HFA A;  4EZK A;  1OWM A;  4N3A A;  3HXD A;  4A1S A;  4ANW A;  4EZL A;  4O1P A;  4APF A;  2GRN B;  3CQG B;  4UUC A;  4JVS A;  3TGO A;  2P2C P;  2X6F A;  4GMR A;  3D9M A;  4BET A;  5AJL A;  3U64 A;  1BI7 B;  4GTP A;  1YYH A;  4J0U A;  4FC8 A;  3NZS A;  3FEY A;  1A17 A;  2R5S A;  3CVP A;  4GTQ A;  2X6H A;  4Q94 A;  2YIN A;  1H2T C;  2IOL A;  2XEN A;  3EHM A;  2CFZ A;  4JB8 P;  2KBX A;  3E37 A;  2B6C A;  1LTX A;  1IQU A;  2MHK A;  3DSS A;  3FU6 A;  4XKC A;  1UW4 B;  3BUA A;  3DRA A;  4E6H A;  3VLE A;  4CYM D;  2AXU A;  5BNW A;  3C3O A;  1H2U A;  2JAB A;  1KT1 A;  3VTY A;  4TXR A;  3PVL A;  2ION A;  1SZA A;  5AN8 A;  3ZXS A;  4K5C A;  5JHB A;  2DIW A;  1JCQ A;  3D9I A;  4G1T A;  2WXM A;  4BFR A;  3AS4 A;  4P29 A;  1TN8 A;  4FU3 A;  1TR4 A;  2AW6 A;  4A3V A;  4KMO A;  2WMO A;  3AJI A;  1ELR A;  4BX9 A;  2XPZ A;  4M3O A;  4GYW A;  5FIO A;  4AOF A;  3ASN E;  3R9M A;  3QJZ A;  4G8L A;  2JLB A;  5FZR A;  2F8X K;  2PZI A;  2UY1 A;  4EBA A;  3KD7 A;  1E8Z A;  1RW2 A;  4N39 A;  2WQH A;  4GB9 A;  3U3W A;  1SW6 A;  3S7D A;  5AYW D;  3V2X A;  2J49 A;  3RU0 A;  5BT1 A;  3DEO A;  3HHM A;  3TWW A;  2Y0B G;  3R9A B;  5C2Y A;  2I6H A;  4GA0 A;  1GW6 A;  3ASH A;  2FEZ A;  2LXM A;  2P9S G;  2X6I A;  3ZN3 A;  2GRL A;  4C9B B;  4CDN A;  1FVF A;  2HO1 A;  4A63 B;  3ZRH A;  3CHR A;  1NA3 A;  4RQI A;  2HE0 A;  3LVR E;  5AQB A;  4ATZ D;  4JHK A;  2AVP A;  2ZU6 B;  2WXP A;  2MRI A;  3ESL A;  2KM4 A;  5A7D B;  2LSU A;  3VLD A;  1JCS A;  4ACK A;  4JHJ A;  3KEA A;  3SY2 A;  2WXJ A;  4OVU A;  3NQP A;  2V8S E;  2LAI A;  2F0Y A;  3FHE A;  2RFA A;  3X2Q E;  4LSZ E;  3JQ1 A;  3UKR G;  1JUQ A;  2WXK A;  1JWG A;  3D9O A;  4PS7 A;  4U8H A;  2PQN A;  4I43 A;  4G23 A;  1AP7 A;  1HG5 A;  3JYS A;  3UT7 A;  5B1A E;  4AVX A;  1E7V A;  5AAO A;  4EQF A;  4DX1 A;  2WQ7 A;  3NOG D;  5KJM A;  4J7W A;  5DBK A;  5CBN A;  2B0O E;  3Q78 A;  2YQ8 A;  4G2V A;  4HFG A;  4TUU A;  3SBT B;  1N9A A;  4BY6 A;  5CED B;  1TNO A;  3Q79 A;  2WXN A;  2IOS A;  4I1O B;  4BSZ B;  3GYZ A;  1VDY A;  2QC9 A;  4KYO B;  4TRQ A;  5AAR A;  1LF8 A;  3UIN C;  4OYS A;  5JJ6 A;  4DX7 D;  3E30 A;  3UUX A;  2Y4U A;  3ZXP A;  4HOQ A;  5FJY A;  3W9G A;  3SFY A;  3PZ3 A;  5ENN A;  1YMP A;  4Z68 A;  2WXO A;  2VTB A;  3TWS A;  3CVV A;  1YA0 A;  2WXI A;  4BX8 A;  1NL4 A;  1V55 E;  5EX3 A;  4GTV A;  3QOU A;  4DX5 D;  4UWF A;  3CK9 A;  3CEQ A;  3SQV A;  1S0P A;  3V79 K;  1MZC A;  3CST A;  1ZBP A;  3FU5 A;  5ENQ D;  1DCQ A;  2IQC A;  4UWG A;  3PZD A;  2AXZ A;  3FUI A;  2L0T B;  2XZT G;  2XGS A;  3RRN B;  4U7E B;  4RG9 A;  4N5C A;  5BXU A;  3T5V A;  4ILH B;  1OCC E;  5LX8 A;  4DRX E;  5ANL A;  5B1B E;  4J8S A;  2Q7F A;  2HM8 A;  3PEU B;  1NZN A;  1N0R A;  1IHB A;  4ILG A;  2I1K A;  2RFM A;  4AM9 A;  2OEV A;  4IUL A;  3FU3 A;  1FPP A;  4YVQ C;  1H0A A;  2VGY A;  3J5P A;  1QNF A;  2OOE A;  3LJ3 A;  1UN8 A;  3DST A;  3D9J A;  5CCM A;  3CHP A;  1K8K G;  3CK7 A;  3TG5 A;  2Y1L E;  5T4Y A;  3JXI A;  3SZ7 A;  3TWR A;  4URK A;  1HXI A;  1N54 A;  1OWO A;  4BEP A;  4BES A;  4WNG A;  3JQ0 A;  2LAH A;  5LCW J;  3DEP A;  1INZ A;  4O6F A;  2IU1 A;  1FCH A;  3PUJ A;  4E85 A;  2QY7 A;  3SGH A;  2WXQ A;  5AQA A;  3RKV A;  3QDN A;  2EIJ E;  3Q9U C;  1N4R A;  1H6P A;  3CHO A;  4JPS A;  4APO A;  2KAT A;  3Q7F A;  2V5F A;  3MZL B;  3L13 A;  3KEZ A;  4ANV A;  4FLB A;  3QAR A;  5D0Q D;  2H6I A;  3Q75 A;  1D9S A;  2I9C A;  1TJF A;  4HOT A;  5B3S E;  4C48 B;  1HZ4 A;  1OCR E;  5A23 A;  3D9K A;  2X38 A;  3DSU A;  3W9F A;  3TXN A;  1EF1 C;  3AAA C;  5KCM A;  1UOH A;  3E34 A;  3L6A A;  1PAQ A;  4H7Y A;  3PH0 C;  3RO3 A;  3SNX A;  4N3C A;  1DVP A;  2DZN A;  4L2Y A;  2A5E A;  4J8E A;  2ZXW E;  4WWN A;  4F53 A;  4ANX A;  3DXK G;  1KZP A;  1E8Y A;  4GZ3 A;  4UWL A;  3TWX A;  4OAU C;  4ATG A;  1Y8M A;  2XCB A;  2A4Z A;  4HOS A;  2CFU A;  3PZ1 A;  3BEE A;  4F1S A;  5BXO A;  4Y6C A;  2C2L A;  1X81 A;  5G05 J;  5FQ6 A;  4JD2 G;  5KNG A;  3HDX A;  1U2V G;  4TUM A;  3UM3 A;  3ZHE A;  3IEG A;  3ASG A;  3WXX A;  4AXH A;  2XRY A;  1SA5 A;  4HI8 A;  4AP2 A;  1KT0 A;  4BTB A;  4L2L A;  4LG6 A;  4RVB A;  3FY4 A;  4XKB A;  2DCP A;  2KCV A;  4HNA D;  2Y69 E;  4MKT A;  4EHM A;  1W3B A;  5EX0 A;  1TNU A;  4LNU D;  3UIP C;  3Q5M A;  2KXP C;  1HH8 A;  4YND A;  2ZIS A;  3UT8 A;  3ONK A;  4XE0 A;  4ZHB A;  3ABL E;  3Q9N C;  5BV0 A;  2VGX B;  3AG1 E;  5EIL A;  3AG2 E;  1NA0 A;  4N3B A;  4R7L A;  2OND A;  2ZGG A;  1OUV A;  3FTS A;  5H7P A;  2WQ6 A;  3I4G A;  5T8I A;  2R02 A;  1FT2 A;  2ETA A;  4F6R D;  3S2A A;  1U3C A;  2X6K A;  2E2E A;  1TJC A;  1IKN D;  2H6G A;  2KC7 A;  4O1O A;  3PE3 A;  4HOU A;  2CG3 A;  4B8A A;  3UT4 A;  2KCL A;  3CK8 A;  3EIJ A;  4Q96 A;  5HS0 A;  2PNN A;  5LOZ A;  4GML A;  5J90 A;  4JXT A;  4YVO A;  4B94 A;  2IEJ A;  3LYA A;  4I6J A;  4HXI A;  5CMW A;  3C72 A;  1WY6 A;  3G2S A;  4K5A B;  2XGM A;  2H6F A;  2L0I A;  1KLX A;  3RRU A;  4J8F A;  4CDM A;  2LNI A;  4K5B A;  4I17 A;  3MKR A;  2MYO A;  1OY3 D;  3CVQ A;  5ARG A;  4NUR A;  3PRE A;  3EJN A;  2L6J A;  4JEH A;  5LFA A;  2J9Q A;  4GTS A;  2OV8 A;  3TG4 A;  4FUL A;  3ZNG A;  2AJA A;  3TWT A;  4U8Y D;  2PM7 A;  3ZHE B;  4WAF A;  4CGW A;  1JWF A;  3DWL G;  1HU3 A;  3DSW A;  3SFX A;  4ZFH A;  2V5Q C;  2OEW A;  3ULY A;  1N4P A;  3QK0 A;  4G8K A;  2HYZ A;  3LDZ A;  4HRM B;  5BW8 C;  1N94 A;  4V3I A;  1WG0 A;  3SO8 A;  4XI9 A;  1OWN A;  4D10 C;  4N2S A;  3QB2 A;  4LUN U;  4KBQ A;  3MX3 A;  5EIB E;  1MJ0 A;  1X5B A;  4AEZ C;  3FTV A;  3ASF A;  4L1B A;  3PNT B;  5G55 A;  4A3T A;  1UJJ A;  4AY5 A;  4DLO A;  3ZGQ A;  3IXE A;  5CBO A;  2C0L A;  3CSF A;  3JUI A;  4CEM A;  2VYI A;  2WXG A;  3EU9 A;  4JA9 A;  1MX4 A;  2V4L A;  3FTU A;  3J5Q B;  4ILI A;  2CHX A;  2M63 A;  4AY6 A;  3LCA A;  1E8X A;  1PC2 A;  3ABM E;  3FH5 A;  1BI8 B;  3O4Z A;  3V2O A;  1O5M A;  2R05 A;  3HXE A;  5T3R A;  2MOW A;  2FBN A;  3EIQ C;  2FO1 E;  4PH4 B;  1H6O A;  4F7A A;  2VQ2 A;  5FTP A;  2IF4 A;  4HS2 A;  5ENT D;  5AJD A;  4J8Y A;  4WNF A;  2R03 A;  2WXH A;  3MEK A;  4UI9 J;  5JA4 D;  3FTX A;  3MKQ B;  5CEC B;  1Z6T A;  2Y4T A;  4CRW A;  4DX6 D;  5G05 C;  3ML9 A;  3RJV A;  3IHV A;  3UI2 A;  2ZIR A;  5ANR A;  3EU5 A;  3D9H A;  3L9T A;  4U63 A;  3DPY A;  2CHW A;  3TL5 A;  2RG8 A;  3ZYM A;  4JC8 A;  2YHE A;  4MS6 A;  3FUK A;  1OCO E;  5E75 A;  3ZU7 B;  4GTO A;  4JEU A;  2P58 C;  4HOR A;  4LNB A;  2BKK B;  4TXQ A;  3D9N A;  2XGO A;  5CCL A;  3PE4 A;  1N0Q A;  1BD8 A;  3DPD A;  3QWV A;  3AG3 E;  1XGW A;  4KXK B;  2GRP B;  3C3R A;  4YDO A;  1QYM A;  5EID A;  3IHY A;  3I3N A;  4K03 A;  4G11 A;  3K9I A;  4WWP A;  2DYR E;  4PUC A;  1E96 B;  3UX4 A;  3FTW A;  5EN5 D;  5G2N A;  2BF0 X;  2WB2 A;  5KNH D;  1PY1 A;  3LEW A;  4I6G A;  4CCA A;  3NB2 A;  3CV0 A;  2XEH A;  4RLY A;  4Q69 A;  4J8D A;  2R17 C;  2NSZ A;  3EUV A;  4MLP A;  2C0M A;  1H2V C;  3FEX A;  1WAO 1;  2P9N G;  3CVL A;  4X8Q A;  2DZO A;  1N11 A;  5BV1 A;  2X6J A;  3G2U A;  1LD8 A;  4M7C A;  1HS6 A;  1U3D A;  4ABN A;  1SA4 A;  2E0I A;  3VTX A;  4I1M A;  3LY7 A;  4G25 A;  4WUY A;  5FQ8 A;  3B7B A;  1TNY A;  1S63 A;  2R2L A;  1UN9 A;  3SF4 A;  2IO3 C;  3TWQ A;  4DI3 A;  1BLX B;  3E33 A;  2ILR A;  2PM6 A;  1NI1 A;  3G2T A;  3NF1 A;  2EIM E;  4CDR A;  3UIO C;  4NIK A;  3HYM B;  5FZQ A;  4BWR A;  3G2W A;  2L9B A;  1NP7 A;  3FH8 A;  5D2M C;  4XX5 A;  3KSQ A;  4UI9 C;  4CT0 A;  4G26 A;  2A5U A;  5FQ7 A;  4UQZ A;  1O1S A;  3S7B A;  1DC2 A;  3B7S A;  3FH7 A;  4OAV B;  4WNE A;  1UG3 A;  3ZIM A;  5EDS A;  1AWC B;  4N2Q A;  4PDX A;  4Y6W A;  5CRU A;  3O48 A;  3ULE G;  3FUD A;  1A5E A;  4UWK A;  3JXJ A;  2WXL A;  3HVE A;  4I2Z A;  4U0U A;  1MHQ A;  4BT8 A;  4F1P A;  3T5X A;  1HX8 A;  4OVV A;  2J4B A;  4B8C B;  2XQ0 A;  3CQC B;  4YDE A;  2WXR A;  1MX6 A;  4NRH B;  3MA5 A;  4GYY A;  4GTM A;  2ZGD A;  2JEK A;  4N5Q A;  4HRN A;  1RZ4 A;  3FUH A;  3S7J A;  1JCR A;  1QZ2 A;  2OVB A;  5HI7 A;  3I4R B;  2WMN A;  4BT9 A;  4GCO A;  3RO2 A;  4PS8 A;  1EDU A;  1MYO A;  3ZYQ A;  2YHC A;  1HO8 A;  4NQ0 A;  1E8W A;  2LUH A;  2IJG X;  2PQR A;  3BG0 B;  2UWJ G;  4UQX A;  1Q2Z A;  4UQY A;  5E76 A;  2XRZ A;  3Q7A A;  1L5J A;  4HB5 A;  2GGF A;  1S64 A;  2KCK A;  3ZPJ A;  4U0Z A;  4HI9 A;  2J08 A;  2OVF A;  2GW1 A;  5D0O D;  3MGB A;  3PEV B;  4IYP A;  3HIZ A;  3RK6 A;  2VSN A;  3ZFW A;  4MRU A;  3DSX A;  1ELK A;  1IQR A;  4GZC A;  3TWU A;  3HXC A;  1TNB A;  5CEA A;  4J6I A;  3KS2 A;  4JZY A;  1SVX A;  3OAW A;  5AEN A;  2F37 A;  3G2V A;  4HLE A;  4MBG A;  3PNL B;  4WND A;  1K3Z D;  3QWP A;  4U96 D;  1P5Q A;  3RIB A;  1BPO A;  3MKQ A;  2RKK A;  3EHN A;  2DBA A;  3FFL A;  3CVX A;  3B7T A;  3EHQ A;  1Y6I A;  1TN7 A;  4YDY A;  4JA7 A;  5KJK A;  1E90 A;  3JCK C;  4C0M A;  3ESK A;  3IKO B;  5HRY A;  1G3N B;  4FP7 A;  3MYV A;  3ONL A;  1Z3X A;  1H19 A;  3Q73 A;  4HBD A;  2BUG A;  3UKU G;  1QQE A;  2R59 A;  3S7F A;  4LEU A;  5LCW C;  3AG4 E;  3MV3 B;  4QQI A;  2P9L G;  3MV2 B;  2VTB B;  2AWI A;  3P1U A;  3EHR A;  1OCZ E;  4CZ2 D;  4GCN A;  3RAU A;  4UWH A;  3KSL A;  1XNF A;  3C5R A;  3CGH A;  5C1D A;  2CHZ A;  1Z3Y A;  1IYG A;  5JHA A;  4PS3 A;  4UI9 K;  2VSY A;  1IXV A;  1NFI E;  4GU5 A;  1HE8 A;  3TXM A;  3L82 A;  1N4S A;  2DYS E;  3ZVV A;  4FAD A;  1B89 A;  1Z5S C;  2DVW A;  3V31 A;  4DLQ A;  3DSV A;  3CKB A;  2J4D A;  4XIF A;  3FUJ A;  4ME2 A;  3T8M A;  2P9P G;  3C98 A;  1BU9 A;  4DJA A;  5HQ8 A;  5CHE E;  1OXJ A;  2QYU A;  4H7X A;  1EYH A;  2XEV A;  5ENO D;  5EKQ D;  1ZB1 A;  5DIZ A;  4GA1 A;  3B7U X;  3ML8 A;  1N4Q A;  2EIK E;  3AU4 A;  4QFV A;  4GZ5 A;  3ZEF A;  3CHS A;  1D8E A;  3SBS A;  5ENR D;  4CT4 A;  5KJL A;  3E32 A;  5CMY A;  3MCX A;  1QBQ A;  4G24 A;  4HVB A;  4DK5 A;  1V54 E;  2P9K G;  5AQ7 A;  2BTD A;  2FUL A;  3HXB A;  2NXP A;  2ETB A;  3FDH A;  2OCC E;  3CVW A;  4WWO A;  2IO2 C;  3D9L A;  3MJW A;  3NBN B;  1OWL A;  2EIL E;  1ELW A;  3C3Q A;  3UMV A;  2XPY A;  2GRO B;  3BQO A;  2RD0 A;  4GZD A;  3PZ4 A;  3QWW A;  1TEZ A;  2VJ8 A;  3Q49 B;  3IV0 A;  5FQ4 A;  1YCS B;  3B95 A;  5KBA A;  3UPV A;  1E7U A;  4W9R A;  3TWV A;  3GW4 A;  1DCE A;  3FP3 A;  3ENE A;  5JMN D;  2QFC A;  5AIJ A;  2XCC A;  3UM2 A;  3Q47 B;  3P2B A;  2L6B A;  1KZO A;  4B0Z A;  3ULQ A;  2BKG A;  5M72 A;  1O1T A;  4GPM A;  2XPI A;  4F3V A;  5ARF A;  3CKC A;  3ISM C;  2GRQ B;  3HG0 D;  3TAX A;  5LP0 A;  1TNZ A;  3OXF A;  3TJP A;  2NC9 A;  4U0S A;  3PUK A;  2P9I G;  2LXL A;  3SD5 A;  2AXV A;  3IBE A;  3QAQ A;  2H6H A;  4LNG A;  5FWQ A;  2WM9 A;  2CG2 A;  1OT8 A;  1K1A A;  3F6Q A;  2DWZ A;  3APF A;  3LVQ E;  4KZ0 A;  4L7T A;  3JUE A;  3D3M A;  3FTY A;  3SHF A;  3L16 A;  3DBS A;  3UQ3 A;  3VLF A;  1OWP A;  3GZ1 A;  2QZA A;  3Q4A B;  5EYP F;  2V4H C;  5KJN A;  4KVO A;  3UM1 A;  4NAC A;  2WXF A;  3NOC D;  2NYJ A;  4GTT A;  3T9K A;  3CVU A;  3UM0 A;  1S70 B;  3PRZ A;  3HRA A;  1MQS A;  4A1G A;  3BG1 B;  3L22 A;  1IHG A;  2F8Y A;  1MX2 A;  1HG2 A;  3V30 A;  3ZYK A;  4CGV A;  1FT1 A;  3CHQ A;  3OXL A;  3HVE B;  4LER A;  5FIN A;  3I5P A;  4GZ6 A;  2KZT A;  2VGX A;  3UTM A;  1UJK A;  1KPS B;  4GTR A;  3CVN A;  5JJ7 A;  4FJY A;  4L9P A;  3FUN A;  3R7R A;  2IFU A;  3AU5 A;  3CHM A;  1LD7 A;  2LSV A;  3E4B A;  3N71 A;  4O60 A;  5G04 C;  1O1R A;  1D8D A;  1H6K A;  4DPR A;  1N52 A;  3AS5 A;  4K0R A;  3NAW A;  1FVH A;  3DXM G;  3LXU X;  3CIA A;  5BUZ A;  4I6E A;  4DUI A;  2WVI A;  4IN3 B;  2YNQ A;  5J08 A;  1DNP A;  3Q15 A;  5EYL A;  4I9E A;  4HLL A;  1ZU2 A;  3PDN A;  4L23 A;  3SFZ A;  5ENS D;  4KVM A;  5JJT A;  4HQD A;  3FUM A;  4BTA A;  5FZS A;  3SI5 A;  2QYJ A;  4TV3 A;  4DI4 A;  4JHR A;  4BER A;  4ACL A;  3AS8 A;  1WM5 A;  2P9U G;  3FTZ A;  5G04 J;  3LY8 A;  3WG7 E;  5AQ9 A;  4AJW A;  2XS8 A;  3HXF A;  4XI0 A;  4RSY A;  3UXG A;  3RRM B;  4RG6 A;  5ENP D;  4JW1 A;  3QNK A;  4B89 A;  3ZKJ A;  2XHE A;  3LPZ A;  4EBA G;  4IRU A;  4AV7 A;  1WDY A;  2XS1 A;  1TYQ G;  1TN6 A;  3T8K A;  4YDW A;  2BED A;  4U07 A;  2FI7 A;  3ABK E;  5D66 A;  2XZD G;  4KZC A;  3PZ2 A;  4DX2 A;  3U66 A;  3ASD A;  5KWD A;  3PS6 A;  3EDT B;  3CR3 A;  2GRM A;  4GA2 A;  4I9C A;  2V0P A;  3FUF A;  3KAE A;  2I1J A;  3CVY A;  3FUL A;  3ZYL A;  2J07 A;  1SQM A;  3U9W A;  4HRL A;  4I1A A;  4BSX A;  2KZT B;  4C0E A;  4XZ4 A;  4FA6 A;  3URZ A;  5CER B;  3ZW3 A;  5IY5 E;  2I2O A;  4LCT A;  2HR2 A;  2ETC A;  4FHJ A;  3U4T A;  3LS8 A;  3CLJ A;  4FJZ A; 
#chains in the Genus database with same CATH homology
 2M63 A;  4UWF A;  4JL0 A;  3CK9 A;  4I2W A;  2FF4 A;  3CGH A;  5C1D A;  4AY6 A;  2CHZ A;  3CEQ A;  1Z3Y A;  1IYG A;  1S0P A;  3LCA A;  1E8X A;  1PC2 A;  5JHA A;  4PS3 A;  4UI9 K;  2VSY A;  4ANU A;  3CST A;  5FT9 A;  1ZBP A;  3FH5 A;  3FU5 A;  4EPZ A;  4GU5 A;  3O4Z A;  1HE8 A;  3D9P A;  5T3R A;  3TXM A;  2WPV A;  3B7R L;  2IQC A;  2MOW A;  2FBN A;  3EIQ C;  3GZ2 A;  4UWG A;  3PZD A;  4PH4 B;  5BPP A;  3APD A;  3ZVV A;  2AXZ A;  2J09 A;  4FAD A;  3FUI A;  2L0T B;  3OXG A;  1B89 A;  4F7A A;  4DLQ A;  3R7Q A;  3L08 A;  2XGS A;  3CKB A;  2J4D A;  2VQ2 A;  3RRN B;  5FTP A;  2IF4 A;  4HS2 A;  4RG9 A;  4XIF A;  4GMJ A;  4N5C A;  3FU0 A;  3FUJ A;  3QKY A;  4ME2 A;  4LRZ A;  3T8M A;  3C98 A;  3T5V A;  5AJD A;  4DJA A;  5HQ8 A;  2PL2 A;  4ILH B;  5CHE E;  4WNF A;  2WXH A;  3MEK A;  3L17 A;  3FWV A;  5LX8 A;  4UI9 J;  4H7X A;  5ANL A;  2FO7 A;  3FTX A;  1EYH A;  3MKQ B;  3QC1 A;  2X3M A;  4J8S A;  2XEV A;  3APC A;  4EZJ A;  5EKQ D;  1Z6T A;  2Y4T A;  2Q7F A;  5DIZ A;  4AIF A;  2HM8 A;  4CRW A;  3PEU B;  4GA1 A;  3B7U X;  1NZN A;  1HF8 A;  5G05 C;  3ML9 A;  3FUE A;  4GAA A;  2I1K A;  4ILG A;  3ML8 A;  3RJV A;  3IHV A;  4AM9 A;  4IUL A;  3FU3 A;  3AU4 A;  5ANR A;  4QFV A;  4U04 A;  4YVQ C;  5A6C A;  2VSO E;  4GZ5 A;  4U63 A;  1H0A A;  3ZEF A;  4EEC A;  2CHW A;  3CHS A;  3LY9 A;  2VGY A;  3TL5 A;  1QNF A;  2OOE A;  2RG8 A;  3LJ3 A;  3SBS A;  3ZYM A;  2VSX E;  4JC8 A;  1EPU A;  1UN8 A;  2YHE A;  4MS6 A;  2EQX A;  3D9J A;  3FUK A;  5CCM A;  3CHP A;  4CT4 A;  5KJL A;  5E75 A;  4JEU A;  5CMY A;  3CK7 A;  4GYO A;  3TG5 A;  3MCX A;  4G24 A;  2Y3A A;  5T4Y A;  2P58 C;  4HOR A;  3OTN A;  4FHK A;  2UY1 B;  3D9N A;  2XGO A;  5CCL A;  3PE4 A;  3L54 A;  4HVB A;  3GZS A;  4A55 A;  3SZ7 A;  4DK5 A;  3LKU A;  4URK A;  1HXI A;  3DPD A;  1N54 A;  1OWO A;  3NZU A;  2BTD A;  3QWV A;  4FLH A;  2LO6 A;  1SZ9 A;  4WNG A;  1XGW A;  3JQ0 A;  4KXK B;  2FUL A;  2LAH A;  3B13 A;  3IHY A;  5LCW J;  3I3N A;  2NXP A;  4KT6 B;  1INZ A;  1JPL A;  3FDH A;  4G11 A;  4K03 A;  4O6F A;  1HFA A;  4EZK A;  1OWM A;  3CVW A;  2IU1 A;  3K9I A;  4N3A A;  4WWO A;  1FCH A;  3PUJ A;  4WWP A;  4A1S A;  4ANW A;  4E85 A;  3D9L A;  2QY7 A;  4PUC A;  3SGH A;  1E96 B;  4EZL A;  2WXQ A;  3MJW A;  1OWL A;  3RKV A;  3UX4 A;  1ELW A;  3QDN A;  3UMV A;  3FTW A;  4APF A;  3CHO A;  4JPS A;  2XPY A;  4APO A;  2KAT A;  2RD0 A;  2V5F A;  5G2N A;  3MZL B;  3CQG B;  3L13 A;  2BF0 X;  3KEZ A;  4GZD A;  4ANV A;  3QWW A;  1TEZ A;  4JVS A;  2VJ8 A;  2WB2 A;  4FLB A;  3Q49 B;  3TGO A;  3QAR A;  3IV0 A;  5D0Q D;  2X6F A;  3D9M A;  5FQ4 A;  3UPV A;  5AJL A;  1E7U A;  2I9C A;  1PY1 A;  4W9R A;  3GW4 A;  1TJF A;  3LEW A;  3U64 A;  4I6G A;  4CCA A;  4HOT A;  3FP3 A;  1HZ4 A;  3CV0 A;  3ENE A;  4J0U A;  5A23 A;  4FC8 A;  3D9K A;  2X38 A;  3NZS A;  2QFC A;  3FEY A;  5AIJ A;  1A17 A;  2R5S A;  2XCC A;  3CVP A;  4Q69 A;  4J8D A;  2X6H A;  2R17 C;  3Q47 B;  2NSZ A;  3TXN A;  4Q94 A;  2YIN A;  1H2T C;  3P2B A;  2IOL A;  4MLP A;  1EF1 C;  2C0M A;  1H2V C;  3EHM A;  3FEX A;  2CFZ A;  4B0Z A;  1WAO 1;  3ULQ A;  5KCM A;  3CVL A;  3L6A A;  5M72 A;  1PAQ A;  1IQU A;  4F3V A;  2XPI A;  2MHK A;  4H7Y A;  2X6J A;  5BV1 A;  3G2U A;  5ARF A;  3CKC A;  3FU6 A;  4XKC A;  1HS6 A;  3PH0 C;  1U3D A;  4ABN A;  3RO3 A;  1UW4 B;  3TAX A;  4E6H A;  3SNX A;  2E0I A;  4N3C A;  3VLE A;  1DVP A;  3VTX A;  5LP0 A;  3OXF A;  2AXU A;  4I1M A;  5BNW A;  3TJP A;  2NC9 A;  4L2Y A;  3LY7 A;  4G25 A;  1H2U A;  1KT1 A;  3PUK A;  4U0S A;  3VTY A;  4WUY A;  4J8E A;  3IBE A;  2AXV A;  3SD5 A;  3PVL A;  3QAQ A;  2ION A;  4WWN A;  5FWQ A;  5FQ8 A;  4F53 A;  4ANX A;  1SZA A;  2WM9 A;  1UN9 A;  3ZXS A;  2CG2 A;  3SF4 A;  1E8Y A;  5JHB A;  2DIW A;  4GZ3 A;  4DI3 A;  3D9I A;  4G1T A;  2WXM A;  4BFR A;  2ILR A;  4UWL A;  3APF A;  3AS4 A;  4P29 A;  4ATG A;  2PM6 A;  3LVQ E;  4L7T A;  4KZ0 A;  3D3M A;  3G2T A;  3NF1 A;  4GPK A;  3FTY A;  4CDR A;  1Y8M A;  3SHF A;  3L16 A;  4FU3 A;  3DBS A;  2XCB A;  2AW6 A;  3HYM B;  5FZQ A;  2A4Z A;  4BWR A;  4HOS A;  4A3V A;  3UQ3 A;  4KMO A;  2CFU A;  2L9B A;  3G2W A;  3VLF A;  1NP7 A;  3FH8 A;  1OWP A;  3GZ1 A;  3BEE A;  4XX5 A;  2WMO A;  3Q4A B;  1ELR A;  4UI9 C;  4CT0 A;  4G26 A;  4KVO A;  4F1S A;  5KJN A;  4BX9 A;  2A5U A;  2C2L A;  4NAC A;  2WXF A;  2XPZ A;  4M3O A;  4Y6C A;  5FQ7 A;  4GYW A;  4UQZ A;  5FQ6 A;  5G05 J;  3S7B A;  3HDX A;  3B7S A;  3ZHE A;  3FH7 A;  4AOF A;  3IEG A;  3ASG A;  3WXX A;  3CVU A;  4WNE A;  4AXH A;  1UG3 A;  3PRZ A;  3ZIM A;  3QJZ A;  1MQS A;  5EDS A;  2XRY A;  4A1G A;  3BG1 B;  4AP2 A;  1KT0 A;  4N2Q A;  4BTB A;  4PDX A;  4Y6W A;  4L2L A;  3L22 A;  3O48 A;  2JLB A;  3FUD A;  1IHG A;  5FZR A;  4UWK A;  4RVB A;  3FY4 A;  4XKB A;  2PZI A;  2UY1 A;  2WXL A;  2DCP A;  3HVE A;  4I2Z A;  2KCV A;  1MHQ A;  4U0U A;  4EBA A;  1HG2 A;  3KD7 A;  1E8Z A;  4BT8 A;  4N39 A;  2WQH A;  4GB9 A;  4MKT A;  1W3B A;  5EX0 A;  3U3W A;  3ZYK A;  3S7D A;  3T5X A;  4CGV A;  3Q5M A;  3CHQ A;  5AYW D;  1HX8 A;  4OVV A;  2J4B A;  3OXL A;  4B8C B;  2J49 A;  3HVE B;  3RU0 A;  2XQ0 A;  3CQC B;  1HH8 A;  5BT1 A;  4YND A;  3HHM A;  4LER A;  3UT8 A;  3I5P A;  2WXR A;  3ONK A;  4XE0 A;  4GZ6 A;  2KZT A;  4NRH B;  3R9A B;  2VGX A;  5C2Y A;  1UJK A;  2I6H A;  3MA5 A;  4GA0 A;  4GYY A;  1GW6 A;  3ASH A;  5BV0 A;  2FEZ A;  2JEK A;  3CVN A;  2X6I A;  5JJ7 A;  2VGX B;  4FJY A;  3ZN3 A;  3FUN A;  2GRL A;  1NA0 A;  3R7R A;  4N3B A;  2IFU A;  3AU5 A;  3CHM A;  3E4B A;  2LSV A;  3N71 A;  4C9B B;  4R7L A;  1FVF A;  2HO1 A;  2OND A;  5G04 C;  4CDN A;  3FUH A;  1OUV A;  3FTS A;  3S7J A;  1H6K A;  4DPR A;  1QZ2 A;  1N52 A;  3ZRH A;  3AS5 A;  2WQ6 A;  3CHR A;  4K0R A;  3I4G A;  5T8I A;  1NA3 A;  2OVB A;  1FVH A;  3LVR E;  5HI7 A;  3I4R B;  3S2A A;  3LXU X;  2WMN A;  1U3C A;  3CIA A;  4BT9 A;  2X6K A;  4GCO A;  4JHK A;  5BUZ A;  2E2E A;  1TJC A;  4I6E A;  3RO2 A;  4PS8 A;  2WVI A;  4IN3 B;  2KC7 A;  2YNQ A;  1EDU A;  5J08 A;  3PE3 A;  3ZYQ A;  2AVP A;  4HOU A;  1DNP A;  2CG3 A;  1HO8 A;  2YHC A;  2ZU6 B;  3Q15 A;  4NQ0 A;  3UT4 A;  4B8A A;  1E8W A;  4I9E A;  2KCL A;  2WXP A;  2IJG X;  2MRI A;  1ZU2 A;  3CK8 A;  3EIJ A;  3ESL A;  3PDN A;  2PQR A;  4L23 A;  4Q96 A;  3SFZ A;  2KM4 A;  3BG0 B;  5LOZ A;  4KVM A;  2LSU A;  2UWJ G;  5A7D B;  4GML A;  5JJT A;  5J90 A;  3FUM A;  4JXT A;  4YVO A;  3VLD A;  4B94 A;  4UQX A;  4BTA A;  4UQY A;  5FZS A;  3LYA A;  5E76 A;  4ACK A;  2XRZ A;  4JHJ A;  1L5J A;  4I6J A;  4HXI A;  5CMW A;  3SI5 A;  2WXJ A;  1WY6 A;  4OVU A;  3G2S A;  3NQP A;  2XGM A;  4TV3 A;  4DI4 A;  2GGF A;  2KCK A;  2L0I A;  2V8S E;  2LAI A;  4JHR A;  3ZPJ A;  4ACL A;  1KLX A;  3FHE A;  3AS8 A;  1WM5 A;  4U0Z A;  3RRU A;  2J08 A;  2OVF A;  3FTZ A;  4J8F A;  4CDM A;  3JQ1 A;  5G04 J;  3LY8 A;  1JUQ A;  2WXK A;  4AJW A;  2GW1 A;  1JWG A;  4XI0 A;  5D0O D;  4RSY A;  2LNI A;  4I17 A;  3D9O A;  4PS7 A;  3MGB A;  4U8H A;  3RRM B;  3PEV B;  2PQN A;  4I43 A;  4RG6 A;  3MKR A;  4IYP A;  3HIZ A;  4G23 A;  4JW1 A;  1HG5 A;  3QNK A;  4B89 A;  3RK6 A;  3JYS A;  3UT7 A;  3CVQ A;  2VSN A;  2XHE A;  5ARG A;  3LPZ A;  4AVX A;  4NUR A;  3ZFW A;  4MRU A;  3PRE A;  1E7V A;  3EJN A;  1ELK A;  2L6J A;  4EQF A;  4JEH A;  5LFA A;  4EBA G;  1IQR A;  4GZC A;  2J9Q A;  2WQ7 A;  2OV8 A;  5KJM A;  3TG4 A;  5DBK A;  4IRU A;  4FUL A;  4J6I A;  4AV7 A;  3KS2 A;  2YQ8 A;  4JZY A;  4G2V A;  3OAW A;  4HFG A;  4TUU A;  3SBT B;  5AEN A;  4BY6 A;  2PM7 A;  3ZHE B;  4WAF A;  3G2V A;  4HLE A;  1JWF A;  4CGW A;  4U07 A;  3PNL B;  4WND A;  1HU3 A;  2WXN A;  3QWP A;  2IOS A;  1P5Q A;  2FI7 A;  4I1O B;  3RIB A;  1BPO A;  3GYZ A;  3QK0 A;  4KZC A;  1VDY A;  3MKQ A;  2HYZ A;  4KYO B;  4TRQ A;  3LDZ A;  3U66 A;  5BW8 C;  1LF8 A;  3EHN A;  2DBA A;  3FFL A;  3ASD A;  4V3I A;  3CVX A;  3PS6 A;  4OYS A;  3B7T A;  3EDT B;  4XI9 A;  3CR3 A;  2GRM A;  4GA2 A;  4I9C A;  5JJ6 A;  3UUX A;  1OWN A;  1Y6I A;  2Y4U A;  4D10 C;  2V0P A;  3FUF A;  4N2S A;  4JA7 A;  3KAE A;  3QB2 A;  4HOQ A;  5KJK A;  4LUN U;  1E90 A;  3JCK C;  3MX3 A;  4KBQ A;  5FJY A;  4C0M A;  3ESK A;  3IKO B;  2I1J A;  1X5B A;  4FP7 A;  3CVY A;  3FUL A;  4AEZ C;  3FTV A;  3MYV A;  3ONL A;  1Z3X A;  3ASF A;  5ENN A;  1H19 A;  3ZYL A;  1SQM A;  2BUG A;  2J07 A;  4L1B A;  3PNT B;  5G55 A;  3U9W A;  1QQE A;  2R59 A;  2WXO A;  4I1A A;  2VTB A;  4BSX A;  3S7F A;  4A3T A;  1UJJ A;  2KZT B;  4AY5 A;  4DLO A;  3CVV A;  1YA0 A;  2WXI A;  4C0E A;  4LEU A;  5LCW C;  3ZGQ A;  4XZ4 A;  4BX8 A;  4FA6 A;  3URZ A;  2C0L A;  3MV3 B;  3ZW3 A;  3MV2 B;  2VTB B;  2I2O A;  3CSF A;  3JUI A;  4LCT A;  2HR2 A;  4CEM A;  4FHJ A;  3U4T A;  2VYI A;  2WXG A;  5EX3 A;  2AWI A;  4JA9 A;  3P1U A;  2V4L A;  4GCN A;  3FTU A;  3LS8 A;  3QOU A;  4ILI A;  4UWH A;  3CLJ A;  4FJZ A;  1XNF A;  2CHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...