2GGFA

Solution structure of the ma3 domain of human programmed cell death 4
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
137
structure length
137
Chain Sequence
GSSGSSGLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords Programmed cell death 4, isoform 1
publication title Solution structure of the MA3 domain of human Programmed cell death 4
rcsb
source organism Homo sapiens
total genus 39
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2006-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02847 MA3 MA3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2ggfA00
2IOSA 4JHKA 2IONA 1N52A 3EIQC 1H2UA 4B89A 2I2OA 4GMJA 1UG3A 2ZU6B 4C9BB 2IU1A 1HU3A 4CRWA 1N54A 1PAQA 4LUNU 2NSZA 1H6KA 3D3MA 4IULA 4JHJA 5ANRA 2VSXE 3JUIA 4GMLA 2HM8A 1UW4B 3EIJA 3FEXA 2IOLA 3RK6A 3L6AA 2FULA 4B8CB 1H2TC 1H2VC 2KZTA 4CT4A 2RG8A 4CEMA 4B8AA 2VSOE 3FEYA 2KZTB 2GGFA
chains in the Genus database with same CATH superfamily
5A7DB 4AP2A 4K03A 2WXPA 4GMJA 5BV1A 4TRQA 1WM5A 4N3BA 2ZISA 3PVLA 4QQIA 5T4YA 4YDYA 5T8IA 2KATA 4AY6A 4CYMD 4GU5A 3FEYA 3CVUA 3AS4A 4TXQA 3SFZA 2LXLA 3HXCA 2LNIA 3QK0A 2J4BA 3RO2A 4ACKA 2H6GA 3JCKC 2F0YA 1FT2A 5FQ7A 2WXFA 4EHMA 2KXPC 3L6AA 3D9JA 3UT7A 2VJ8A 2YQ8A 4GTVA 3UT8A 1JPLA 5JMND 2OOEA 5KJKA 3NZSA 2WMNA 5IY5E 1ELRA 4UWFA 3SO8A 2C0LA 4AOFA 3ISMC 1H19A 4G23A 3P2BA 1IQRA 1OXJA 3SZ7A 3Q47B 2LUHA 2IF4A 3UX4A 4MS6A 3UUXA 1TNOA 1D9SA 4ZFHA 4HS2A 2QYUA 2I2OA 4TXRA 4YNDA 4WWOA 2VGYA 3PZDA 3TGOA 4KT6B 3RAUA 5EIDA 3AG2E 3HVEB 1YYHA 3HXDA 3U3WA 2L0IA 2KZTB 2PZIA 3JYSA 3QWPA 3RU0A 5AJLA 4G26A 4EBAG 3UKUG 3FUNA 3HDXA 1JCQA 3AU5A 3CSTA 4K5CA 2JABA 2YINA 2XRZA 3G2VA 3C72A 2V5FA 3J5PA 5FJYA 5KJMA 5JHAA 4BX8A 1UOHA 1JCSA 3LKUA 1HX8A 3ZW3A 2P9NG 4JA7A 2DYSE 3UM2A 2DIWA 3E34A 2VYIA 4U95D 4I6GA 2KCKA 2FF4A 2WM9A 5G55A 1EF1C 5EDSA 1B89A 1OWMA 5CMYA 4HRNA 5FT9A 3I4GA 3ZVVA 3FTSA 4UQYA 2IONA 5LP0A 4UQXA 2P9KG 1YMPA 4CZ2D 5EIBE 2Y69E 2A4ZA 3ZU7B 3NOGD 4CDNA 4PS8A 4OVUA 4DPRA 1E8YA 4I6EA 2DCPA 4A55A 3UTMA 5J90A 4OAVB 2A5EA 4AXHA 4UI9C 2P2CP 4GZ3A 4LNBA 3CHPA 1W3BA 3UIPC 2WVIA 5FQ6A 3ZRHA 3S7DA 4RG6A 2QC9A 3B7SA 2Q7FA 4F7AA 4U8VD 3HYMB 4BWRA 3FTYA 4I2WA 4GB9A 3O4ZA 3ZXSA 3EJNA 3AJIA 3CQGB 3LY7A 3TJPA 1XNFA 2GRLA 3MCXA 2VSXE 2V4LA 3FDHA 4XKCA 3AS5A 4EQFA 1OCRE 4BSZB 4K5BA 1FVFA 1S70B 1V54E 3DSSA 3IKOB 4K0RA 2LSVA 5AYWD 3ENEA 1G3NB 5KNHD 4J8EA 3ZFWA 3FTZA 3KS2A 5ENSD 3NAWA 3IEGA 3L82A 3CVNA 3V2XA 4J8SA 5CRVA 3DXMG 2VGEA 1IHGA 2R03A 5B1BE 4X8QA 2EIKE 2VQ2A 4GCNA 2X38A 2XCCA 2B6CA 3CKCA 2DZNA 1P5QA 3FUHA 4EZKA 5G05J 1UW4B 2X6KA 3CHMA 1EYHA 4PDXA 5AIJA 2XGOA 1H2UA 3UKRG 5KBAA 1E8WA 4UWLA 3KEAA 4L23A 4CCAA 4RSYA 4HORA 4ANUA 4FP7A 3CQCB 4GPMA 3JUIA 2VSNA 1IKND 3UQ3A 3Q7FA 5DBKA 2PNNA 4BFRA 5ENNA 4JZYA 1N95A 2ETCA 5EILA 2L6JA 3SD5A 4L2LA 1DCQA 2I6HA 2DYRE 2GRPB 2GRNB 2LAHA 2CFZA 1EDUA 3FH8A 2V0PA 2KCVA 3NQPA 3MKRA 4B94A 5HQ8A 2WXKA 2R02A 4DI4A 5KCMA 4HI8A 1TJCA 3SBTB 4ME2A 3LJNA 5D0QD 4HB5A 3L17A 1ZB1A 1SA5A 1QZ2A 3G2WA 4L1BA 3PNLB 3GW4A 2ZXWE 3WXXA 3U66A 3CVYA 3S7FA 3MX3A 2PL2A 5BT1A 4HVBA 5AQAA 4CDMA 3ULYA 1D8DA 2KCLA 3R7QA 4W9RA 5EKQD 5FZSA 5HKPA 5EN5D 4A3VA 1ELWA 1S0PA 2NYJA 3ZEFA 2Y4TA 2PM7A 3T9KA 2IY0C 4OVVA 4GTTA 3FUEA 3LY9A 5FZRA 2J07A 3MKQA 2J8SD 4JVSA 4GCOA 2WXRA 3R9MA 2WXOA 1OT8A 1FCHA 1NA3A 3TWXA 2OEVA 4O1OA 4O6FA 2XS8A 4I1OB 3HXEA 1BD8A 3QWWA 4ILIA 4AJWA 5BPPA 3EIJA 3CIAA 3SBSA 2ETAA 5AJDA 2IJGX 1FVHA 5FWQA 2XENA 3ZYKA 2PQRA 2F8XK 2MOWA 4EZJA 2XGMA 3OAWA 3CVVA 1WY6A 3JUEA 3ML9A 5FTPA 4R7LA 4OAUC 3ASOE 3ABME 3CVLA 3ZUVB 4F1PA 1LD7A 4Q94A 4GTSA 1VDYA 3CKBA 2P58C 4U8YD 2C0MA 1O1RA 1KT1A 4MKTA 4GA1A 4AM9A 5BV0A 4XI9A 3UMVA 2BUGA 3IXEA 3F6QA 4JB8P 3HRAA 4LNGA 3ESKA 4A1SA 5LX8A 4JPSA 2JLBA 4WAFA 2X6FA 1WG0A 3LJ3A 5ENTD 2WQ6A 1HO8A 2AW6A 4E85A 1DNPA 4UQZA 5DIZA 1PY1A 3MA5A 4J7WA 1DC2A 3FWVA 4A1GA 3L16A 1SQMA 5JJ7A 2ONDA 3G2TA 4L7TA 5FINA 2DZOA 2XCBA 3LS8A 2IQCA 5JHBA 4AV7A 2F8YA 3ZXPA 2NC9A 2NSZA 4U96D 3HVEA 1V55E 1X5BA 2AJAA 4B8CB 2FO7A 2KZTA 1SA4A 3QAQA 5E76A 4J8YA 2WXLA 5JJTA 3PZ4A 4LUNU 4U63A 5ENPD 3TL5A 3B7TA 3CK9A 3BUAA 4O1PA 3E32A 4F3VA 1OWNA 1RW2A 3DSXA 3FTXA 3VTXA 3ZYQA 2AWIA 3DBSA 3G2UA 1OWLA 3QC1A 3ZIMA 1JCRA 1PAQA 5BXOA 2EIJE 1D8EA 2GRMA 3NF1A 3RSEG 5T3RA 4GTOA 3FP3A 4BTBA 4YVQC 1NA0A 4I2ZA 4BESA 4GA2A 3O48A 2ETBA 3GZ1A 3HXBA 3PUKA 2OVFA 3NOCD 4UWKA 1MJ0A 4G25A 2WXIA 1LF8A 2KM4A 3FH5A 4I9CA 1E8XA 2RFMA 3KSQA 3SFXA 2I9CA 2XRYA 2YHCA 2HR2A 3LDZA 2Y4UA 3D9PA 3ZYMA 3CV0A 4U0UA 4ILGA 4HNAD 4G8KA 1MZCA 2R59A 3DEOA 4JHJA 3SFYA 3W9GA 4ATZD 4LG6A 4BY6A 5ARGA 4EZLA 4H7YA 2P9UG 4HRLA 5AQ7A 3D9MA 1JWGA 5BNWA 2GW1A 5AENA 1TJFA 2IEJA 1OCZE 3APDA 4WNEA 5CBOA 2HYZA 3FH7A 4G8LA 4G1TA 3Q9NC 2H6FA 4L9PA 5ARFA 3UI2A 2FULA 4JXTA 1N0RA 1N0QA 3NBNB 3CVPA 2IOSA 3ASNE 3VTYA 4XKBA 4APOA 2H6HA 2L0TB 5AQBA 2MHKA 4I17A 3EHRA 2RD0A 3R7RA 4J8FA 2BF0X 4CT4A 1NZNA 4A63B 3RO3A 3G2SA 1HFAA 2WXNA 1YCSB 2IO2C 2I1JA 1H0AA 4JHKA 1TN8A 3EU9A 1ZBPA 3D9OA 2UY1B 4ACLA 3JXIA 2C2LA 1IHBA 3MV3B 3FEXA 3WG7E 4DUIA 3ABLE 4CEMA 1K1BA 4DX2A 4ZHBA 4J6IA 5LCWC 2KBXA 2EIME 3CVQA 4DRXE 4JEUA 2B0OE 3Q4AB 4DK5A 3C5RA 1O5MA 4JEHA 3E4BA 5AQ9A 3PZ2A 3OXGA 4NRHB 3Q78A 2I1KA 3E33A 1FPPA 4N2QA 4WNFA 2GRRB 3AG1E 4I43A 3S2AA 4LRZA 3JQ1A 5G2NA 4I6JA 5D66A 1IYGA 1H6KA 1LD8A 4HLEA 2CG3A 3V30A 2L9BA 2ZGGA 4ABNA 3CVXA 3N71A 1NL4A 4N3CA 3SNXA 4XE0A 5G04J 4J0UA 3OXLA 3ZN3A 2XGSA 4FA6A 4RVBA 5AAOA 1N11A 4EECA 3J5QB 2Y3AA 4MLPA 2WXHA 4PS7A 1EPUA 4FHJA 4BT8A 3CHQA 3CHSA 4XI0A 3UM1A 5EX0A 2R2LA 4FHKA 1N4RA 5CHEE 3DPYA 5B3SE 1Z5SC 1BPOA 1PC2A 1SW6A 4N39A 4ANXA 3SF4A 2XQ0A 3B7RL 3BQOA 3D9NA 3RRUA 3VLEA 1MX6A 4GMRA 2XEHA 3RIBA 3L54A 5AN8A 3TWVA 5CRUA 5B1AE 3ASDA 2QFCA 2R5SA 4C0EA 3FFLA 1HG5A 3Q75A 3C3RA 3FU3A 4XIFA 4U7EB 4U0ZA 4FADA 3FTUA 3HIZA 3MGBA 3RKVA 4KBQA 3TXNA 3QWVA 4DI3A 4YDEA 2ZIRA 3FU0A 1N9AA 4KVOA 3IHYA 3ULQA 3MEKA 5LOZA 4WWNA 4JW1A 3CGHA 3MYVA 2P9IG 3BEEA 5KJLA 2AXVA 5CEDB 1OWPA 1OCCE 1UG3A 4C9BB 1BU9A 5BUZA 2AXZA 3LPZA 3ZNGA 1UJJA 3IV0A 3E37A 4N5QA 3CHRA 4GMLA 1KZOA 1TNYA 1WDYA 2ZGDA 2V8SE 2X6HA 2GROB 2VSOE 4GA0A 4CT0A 4B0ZA 4Q69A 3FUKA 1QNFA 2CHXA 4UWGA 5CBNA 1JWFA 1TR4A 4GYWA 1INZA 1K1AA 5A23A 2AXUA 4L2YA 3Q79A 3S7JA 4BT9A 3D9LA 2CG2A 3FUJA 3DSVA 4CGVA 4PS3A 3U9WA 4AVXA 4WNDA 3QB2A 2NXPA 2P9PG 2JEKA 3BG1B 1XGWA 1Z3YA 3RJVA 3TG5A 2KC7A 4G2VA 4C48B 3FY4A 3APCA 2F37A 5KNGA 3CR3A 3S7BA 2J49A 3FTVA 3LEWA 2HE0A 2FBNA 4HRMB 3EHNA 2EQXA 3V2OA 3DRAA 4LCTA 1HS6A 4XZ4A 3HHMA 3UT4A 4HOTA 5CECB 3QKYA 1QQEA 4DX7D 4NQ0A 4LSZE 5AARA 1JUQA 4KZ0A 3QDNA 4Z68A 3PZ3A 5CERB 1E8ZA 2XEEA 4DJAA 3TWQA 1OCOE 1K3ZD 1TNZA 4JC8A 4JHRA 4YDOA 1H2VC 1U2VG 3FU5A 1S63A 4YVOA 4FLHA 3QNKA 1DCEA 1L5JA 5FIOA 3SI5A 4B89A 3L9TA 5D2MC 3C98A 1MX4A 2R17C 3L22A 4GTRA 3CSFA 5C1DA 4GZCA 5FQ4A 3B95A 3VLDA 3FULA 3P1UA 5ITZF 4KZCA 4UI9J 4F6RD 1A17A 2J4DA 3FHEA 5G05C 1ELKA 3LVRE 3B13A 3JQ0A 2J08A 3I3NA 2FEZA 3EU5A 1S64A 3RK6A 4BSXA 2PQNA 3I5PA 3FUFA 4DLOA 3L08A 1OY3D 2RKKA 3ONLA 4HOUA 3ML8A 2V4HC 2PM6A 3HG0D 4P29A 4DLQA 1TYQG 1HF8A 4U0SA 3B7BA 2WXGA 3KD7A 4LEUA 1HH8A 4IN3B 4UUCA 3LY8A 3QOUA 2BTDA 1IXVA 3AAAC 1KLXA 2ZU6B 4DX1A 4TUMA 3E30A 3AS8A 4G24A 4PUCA 4BERA 3T8KA 1H6OA 3ONKA 5CMWA 2HM8A 3HXFA 2BKKB 3TWUA 2LXMA 2L6BA 4O60A 2LO6A 3Q9UC 2GGFA 1SVXA 3SGHA 1K8KG 4BTAA 1O1SA 2EINE 4ATGA 3Q73A 1KPSB 2GRQB 2XPYA 1N94A 1BI8B 3V31A 4APFA 3TWRA 3IBEA 5ENOD 4AY5A 5CEAA 2Y0BG 5D0OD 2J9QA 2XPZA 3R9AB 4CDRA 4GZ5A 2MYOA 4D10C 2UY1A 3T5XA 3UM0A 4KYOB 3TAXA 3B7UX 1Z3XA 5A6CA 4QFVA 2HO1A 5HI7A 3URZA 3C3OA 5ANLA 1U3DA 3FUDA 1IQUA 4IRUA 1OWOA 1N52A 3UXGA 3PREA 1E96B 4FJZA 2EILE 2VTBB 3K9IA 3KAEA 3QARA 3MJWA 4AEZC 4F1SA 4UI9K 3X2QE 4B93B 3CLJA 2XZDG 5J08A 3BG0B 3FTWA 4YDWA 5HRYA 4A3TA 3DWLG 4TV3A 3UM3A 5M72A 5ANRA 3JXJA 3CHOA 3RRMB 3KEZA 3EDTB 4K5AB 4FC8A 2YNQA 5H7PA 2XPIA 3PS6A 3I4RB 1MX2A 1TNBA 2XEVA 1N54A 1MYOA 3ASFA 3Q15A 3PE3A 4JL0A 5CCLA 3ABKE 4HI9A 5EYLA 2Y1LE 3V79K 4GYYA 2IO3C 2QY7A 3SQVA 1NFIE 2WMOA 1HG2A 2H6IA 2P9LG 2MRIA 4I1MA 4N5CA 3AU4A 3FU6A 1NP7A 4KXKB 1NI1A 2IOLA 3C3QA 3TWSA 4M7CA 2XS1A 2BKGA 3EIQC 1TNUA 4WWPA 1QYMA 4BX9A 2CHWA 1LTXA 2OEWA 4GYOA 3EUVA 4HOQA 5FQ8A 5JA4D 3DPDA 2J09A 1E7VA 2XHEA 4U07A 3T8MA 4LERA 2X6IA 5CCMA 5JJ6A 5EX3A 5FZQA 3CEQA 1A5EA 2DWZA 1TEZA 3Q5MA 1AP7A 3AG4E 3D9KA 2VSYA 3PEVB 4FJYA 4IYPA 4ILHB 3D3MA 2LSUA 2X3MA 1HE8A 1ZU2A 4DX6D 3L13A 4MRUA 5BW8C 2WQHA 4H7XA 4HQDA 4JA9A 3RRNB 3EHQA 3PEUB 4PH4B 2DBAA 3EHMA 4JD2G 1Z6TA 3APFA 4NACA 4KVMA 4MBGA 2X6JA 3D9IA 1H2TC 2E2EA 3DEPA 1KT0A 3BU8A 4WUYA 4V3IA 1MHQA 1E7UA 4HOSA 1Y8MA 4LNUD 4GZ6A 4NURA 4EPZA 3U64A 2M63A 5KWDA 3CK7A 3MZLB 3PDNA 4FLBA 1UN8A 4HBDA 4GPKA 3OXFA 3PH0C 3TWWA 1N4SA 1BI7B 4OYSA 3TXMA 4N2SA 3LVQE 3SY2A 2WXMA 4HXIA 2LAIA 4WNGA 3DSUA 3U4TA 2WXJA 1GW6A 2R05A 5ENRD 1E90A 3DSTA 3ASGA 1UJKA 3LYAA 3Q49B 4IULA 3UPVA 3NB2A 1Y6IA 3GYZA 2RG8A 2VGXA 3FUMA 2YHEA 2CHZA 4Y6CA 3ASHA 4RLYA 1AWCB 2DVWA 4Q96A 3AG3E 3PE4A 5ENQD 4ANVA 1MQSA 1RZ4A 2QZAA 1N4PA 3ZYLA 3ZGQA 1WAO1 4HFGA 2OV8A 2OCCE 2A5UA 4U8HA 2XZTG 4I9EA 3ZHEA 4UWHA 4M3OA 2AVPA 4G11A 3GZSA 4RG9A 2IFUA 3ESLA 4CGWA 3OTNA 3GZ2A 4GTQA 4KMOA 2IU1A 3IHVA 4EBAA 4DX5D 3PUJA 3MV2B 1Q2ZA 3ULEG 2V5QC 4J8DA 1O1TA 1KZPA 3NZUA 1X81A 3ZKJA 5C2YA 2P9SG 3SHFA 1BLXB 4Y6WA 3KSLA 4AIFA 1HU3A 3DXKG 3T5VA 3ZPJA 4BETA 1H6PA 3CVWA 5BXUA 4GZDA 4XX5A 1OUVA 2VGXB 4URKA 2FI7A 1HZ4A 3UIOC 1HXIA 2WXQA 4BEPA 2UWJG 5E75A 5EYPF 1SZ9A 4C0MA 4I1AA 2WB2A 4B8AA 3PZ1A 4U04A 2ILRA 2OVBA 3DSWA 3Q7AA 4F53A 4GTMA 5G04C 3ZHEB 3PRZA 2QYJA 1UN9A 2WQ7A 2RFAA 3FUIA 3QJZA 1TN6A 4N3AA 4NIKA 3TWTA 3W9FA 4XEIG 4GAAA 1TN7A 5LFAA 2BEDA 4TXPA 1N4QA 4HLLA 3LXUX 4FULA 1DVPA 3UINC 4ANWA 4RQIA 5LCWJ 1YA0A 3MKQB 2WPVA 4GTPA 1FT1A 5KJNA 2FO1E 2VTBA 3LCAA 2CFUA 4CRWA 1U3CA 2E0IA 3D9HA 4FU3A 1QBQA 3TG4A 1SZAA 3VLFA 3CK8A 5HS0A 4TUUA 4E6HA 3PNTB
chains in the Genus database with same CATH topology
3EDTB 5A7DB 4AP2A 4FC8A 2WXRA 2WXOA 4K03A 2YNQA 2WXPA 4GMJA 5BV1A 2XPIA 2Y3AA 1FCHA 1NA3A 3PS6A 3I4RB 4TRQA 4MLPA 2WXHA 4PS7A 1EPUA 4FHJA 1WM5A 2XEVA 3CHQA 1N54A 3CHSA 4O6FA 4XI0A 4BT8A 5EX0A 4N3BA 3PVLA 3ASFA 3Q15A 4I1OB 5T4YA 4FHKA 3PE3A 3QWWA 5T8IA 4JL0A 4ILIA 5CCLA 4AJWA 5BPPA 2KATA 3EIJA 3CIAA 3SBSA 4AY6A 5AJDA 5CHEE 1BPOA 2IJGX 4GU5A 1FVHA 1PC2A 4GYYA 3FEYA 4N39A 5FWQA 4ANXA 3ZYKA 3SF4A 3CVUA 3AS4A 2PQRA 2QY7A 2XQ0A 3B7RL 3D9NA 2MOWA 3RRUA 3SFZA 2WMOA 3VLEA 1HG2A 2LNIA 3QK0A 4EZJA 3RIBA 2XGMA 2J4BA 3OAWA 1WY6A 3ML9A 3CVVA 5FTPA 4R7LA 3RO2A 4ACKA 2MRIA 3JCKC 3L54A 4I1MA 4N5CA 3AU4A 3ASDA 2QFCA 2R5SA 3FU6A 1NP7A 4KXKB 5FQ7A 4C0EA 2WXFA 3CVLA 2IOLA 3FFLA 1HG5A 3L6AA 3D9JA 3UT7A 2VJ8A 3FU3A 2YQ8A 4XIFA 3UT8A 1JPLA 4Q94A 4U0ZA 1VDYA 4FADA 2OOEA 3CKBA 3EIQC 5KJKA 3NZSA 2P58C 2WMNA 3FTUA 4WWPA 1ELRA 3HIZA 3MGBA 4UWFA 4BX9A 2C0MA 2CHWA 3RKVA 1KT1A 2C0LA 4AOFA 4KBQA 3TXNA 3QWVA 4DI3A 4GYOA 4HOQA 4MKTA 1H19A 4GA1A 4AM9A 4G23A 5FQ8A 3P2BA 5BV0A 1IQRA 4XI9A 3DPDA 3UMVA 3FU0A 2J09A 2BUGA 3SZ7A 3Q47B 4KVOA 3IHYA 2IF4A 1E7VA 3ULQA 2XHEA 3UX4A 4MS6A 4U07A 3ESKA 4A1SA 5LX8A 3MEKA 5LOZA 3UUXA 4JPSA 4WWNA 4JW1A 3T8MA 2JLBA 3CGHA 2X6FA 4LERA 2X6IA 4WAFA 3LJ3A 5CCMA 3MYVA 5JJ6A 3BEEA 5KJLA 5EX3A 2AXVA 5FZQA 4HS2A 2WQ6A 1HO8A 1OWPA 2AW6A 3CEQA 4E85A 2I2OA 1UG3A 4C9BB 1DNPA 4UQZA 1TEZA 3Q5MA 4YNDA 4WWOA 5BUZA 2VGYA 3PZDA 3D9KA 3TGOA 4KT6B 2AXZA 2VSYA 3LPZA 3PEVB 5DIZA 4FJYA 4IYPA 4ILHB 3D3MA 2LSUA 1PY1A 3MA5A 1UJJA 2X3MA 3IV0A 3FWVA 3HVEB 1HE8A 3CHRA 4GMLA 4A1GA 3L16A 1SQMA 5JJ7A 1ZU2A 3L13A 3U3WA 2ONDA 3G2TA 4L7TA 4MRUA 5BW8C 2V8SE 2X6HA 2XCBA 2VSOE 3LS8A 2L0IA 2KZTB 2WQHA 4GA0A 2IQCA 4H7XA 4B0ZA 4CT0A 2PZIA 3JYSA 4Q69A 3FUKA 3QWPA 1QNFA 5JHBA 2CHXA 5AJLA 3RU0A 4UWGA 4AV7A 4JA9A 4G26A 4EBAG 3RRNB 3FUNA 3PEUB 4PH4B 3HDXA 2DBAA 2NC9A 3AU5A 2NSZA 1JWFA 3HVEA 3CSTA 4GYWA 1X5BA 3EHMA 2YINA 2XRZA 1INZA 1Z6TA 3APFA 4NACA 5A23A 3G2VA 2AXUA 4KVMA 2X6JA 4B8CB 3D9IA 1H2TC 2E2EA 2FO7A 2KZTA 2V5FA 4L2YA 3S7JA 4BT9A 5FJYA 5KJMA 3D9LA 1KT0A 5JHAA 4WUYA 4BX8A 4V3IA 2CG2A 1MHQA 3FUJA 1E7UA 3LKUA 1HX8A 3QAQA 5E76A 4CGVA 2WXLA 3ZW3A 4HOSA 5JJTA 1Y8MA 4PS3A 3U9WA 4JA7A 4AVXA 4GZ6A 2DIWA 2VYIA 4WNDA 4LUNU 3QB2A 4U63A 2NXPA 2KCKA 4I6GA 4NURA 4EPZA 2FF4A 2WM9A 2JEKA 2M63A 5G55A 3TL5A 3B7TA 3U64A 1EF1C 3BG1B 3CK9A 1B89A 5EDSA 1OWMA 1XGWA 4F3VA 5CMYA 1Z3YA 3RJVA 3TG5A 3CK7A 1OWNA 2KC7A 3MZLB 4G2VA 3I4GA 3FTXA 3FTSA 5FT9A 3ZVVA 3VTXA 3ZYQA 2AWIA 2IONA 3PDNA 3FY4A 3DBSA 3APCA 4FLBA 4UQYA 5LP0A 1UN8A 3CR3A 4UQXA 3G2UA 4GPKA 1OWLA 3S7BA 2J49A 3FTVA 3LEWA 3OXFA 3QC1A 3PH0C 3ZIMA 2FBNA 3EHNA 2EQXA 2A4ZA 1PAQA 4LCTA 1HS6A 4XZ4A 4CDNA 3HHMA 4OYSA 3UT4A 4HOTA 3TXMA 4N2SA 3LVQE 2GRMA 3NF1A 3QKYA 5T3RA 1QQEA 4PS8A 4OVUA 2WXMA 3FP3A 4NQ0A 4BTBA 4DPRA 4YVQC 1E8YA 1NA0A 4I2ZA 4I6EA 4HXIA 4GA2A 2LAIA 3O48A 4WNGA 3U4TA 1JUQA 2WXJA 2DCPA 1GW6A 3GZ1A 4A55A 4KZ0A 3PUKA 3QDNA 1E8ZA 2OVFA 1E90A 4UWKA 4DJAA 5J90A 4G25A 2WXIA 1LF8A 4AXHA 3ASGA 2KM4A 4UI9C 1UJKA 3FH5A 3LYAA 4I9CA 3Q49B 4GZ3A 1E8XA 3CHPA 4IULA 1W3BA 4JC8A 3UPVA 2WVIA 5FQ6A 4JHRA 2I9CA 2XRYA 3S7DA 3ZRHA 1Y6IA 4RG6A 1H2VC 3GYZA 2RG8A 3B7SA 2VGXA 3FU5A 2YHCA 3FUMA 2Q7FA 2HR2A 3LDZA 2Y4UA 4YVOA 2YHEA 4FLHA 4F7AA 2CHZA 3HYMB 3QNKA 1L5JA 4Y6CA 3SI5A 4B89A 4BWRA 3ASHA 3FTYA 3C98A 3D9PA 4I2WA 4GB9A 3ZYMA 3CV0A 2R17C 4U0UA 3L22A 4ILGA 3CSFA 5C1DA 3O4ZA 3ZXSA 2R59A 4Q96A 3EJNA 3CQGB 3LY7A 4JHJA 3TJPA 1XNFA 2GRLA 3PE4A 3MCXA 2VSXE 4GZCA 5FQ4A 3VLDA 2V4LA 3FULA 4ANVA 1MQSA 3P1UA 4BY6A 3FDHA 5ARGA 4XKCA 3ZYLA 3AS5A 4H7YA 4EZLA 3ZGQA 4EQFA 4KZCA 4UI9J 1A17A 2J4DA 1WAO1 3FHEA 5G05C 3D9MA 1ELKA 1FVFA 4HFGA 2OV8A 1JWGA 5BNWA 2GW1A 5AENA 1TJFA 2A5UA 3LVRE 3B13A 4U8HA 3IKOB 4I9EA 2LSVA 4K0RA 3ENEA 5AYWD 3ZHEA 4UWHA 3APDA 3JQ0A 2J08A 4J8EA 3ZFWA 3FTZA 3KS2A 3I3NA 4M3OA 4WNEA 2HYZA 3FH7A 2AVPA 4G1TA 2FEZA 4G11A 3IEGA 3GZSA 5ARFA 4RG9A 2IFUA 3RK6A 2FULA 3ESLA 4CGWA 4JXTA 4BSXA 3CVNA 4J8SA 2PQNA 3OTNA 3CVPA 2IOSA 3I5PA 3FUFA 4DLOA 3GZ2A 3L08A 3VTYA 4XKBA 1IHGA 3ONLA 4HOUA 4KMOA 3ML8A 2IU1A 4APOA 2VQ2A 2PM6A 2L0TB 3IHVA 4P29A 4GCNA 2X38A 4DLQA 4EBAA 2XCCA 3CKCA 2MHKA 3PUJA 3MV2B 1P5QA 3FUHA 4EZKA 4I17A 1HF8A 4U0SA 2WXGA 3KD7A 4J8DA 2RD0A 4LEUA 5G05J 3R7RA 1UW4B 3NZUA 4J8FA 1HH8A 4IN3B 5C2YA 2BF0X 3LY8A 3SHFA 2X6KA 3CHMA 4CT4A 1EYHA 3QOUA 1NZNA 4PDXA 2BTDA 4Y6WA 5AIJA 1KLXA 2XGOA 1H2UA 4AIFA 2ZU6B 1E8WA 4UWLA 3RO3A 3G2SA 1HU3A 3AS8A 4G24A 1HFAA 4L23A 3T5VA 4PUCA 2WXNA 4CCAA 4RSYA 4HORA 3ZPJA 4ANUA 4FP7A 3CQCB 3ONKA 5CMWA 3JUIA 2HM8A 2VSNA 2I1JA 1H0AA 3UQ3A 3CVWA 5DBKA 2LO6A 2GGFA 4BFRA 4JHKA 4GZDA 4XX5A 3SGHA 1OUVA 2VGXB 5ENNA 4URKA 2FI7A 4JZYA 1HZ4A 1ZBPA 4BTAA 3D9OA 1HXIA 2UY1B 2WXQA 4ACLA 2C2LA 2L6JA 2UWJG 3SD5A 4ATGA 4L2LA 3MV3B 5E75A 2XPYA 2I6HA 1SZ9A 2LAHA 3FEXA 4C0MA 4I1AA 2WB2A 4APFA 2CFZA 1EDUA 4CEMA 4B8AA 3IBEA 4AY5A 3FH8A 2V0PA 5D0OD 2J9QA 4J6IA 2XPZA 5LCWC 3R9AB 2KCVA 3NQPA 4CDRA 4GZ5A 3CVQA 3MKRA 4D10C 2UY1A 3T5XA 4U04A 2ILRA 4JEUA 4B94A 4KYOB 5HQ8A 3TAXA 2OVBA 2WXKA 3Q4AB 4DK5A 3B7UX 4DI4A 4F53A 1Z3XA 5A6CA 4QFVA 5KCMA 5G04C 1TJCA 2HO1A 3ZHEB 3SBTB 3PRZA 4JEHA 4ME2A 5HI7A 5D0QD 3E4BA 1UN9A 2WQ7A 3L17A 3URZA 5ANLA 1U3DA 1QZ2A 3FUIA 3OXGA 3QJZA 4N3AA 3FUDA 1IQUA 4NRHB 4IRUA 1OWOA 2I1KA 3G2WA 1N52A 4N2QA 4L1BA 4WNFA 4GAAA 5LFAA 3PREA 1E96B 4FJZA 3PNLB 3GW4A 4I43A 3WXXA 3S2AA 3U66A 4LRZA 3LXUX 3S7FA 3JQ1A 2VTBB 3CVYA 3K9IA 3MX3A 2PL2A 3KAEA 3QARA 4I6JA 3MJWA 5G2NA 4HVBA 5BT1A 1IYGA 4FULA 1H6KA 1DVPA 4CDMA 4AEZC 2CG3A 4F1SA 4HLEA 4ANWA 5LCWJ 2KCLA 2L9BA 1YA0A 3R7QA 4ABNA 4W9RA 5EKQD 3CVXA 3N71A 4N3CA 5FZSA 4UI9K 3MKQB 4A3VA 2WPVA 1ELWA 5KJNA 3SNXA 4XE0A 5G04J 4J0UA 3OXLA 3ZN3A 2XGSA 2VTBA 3CLJA 3LCAA 2CFUA 4FA6A 1S0PA 4CRWA 3BG0B 5J08A 1U3CA 2E0IA 3ZEFA 3FTWA 4FU3A 2Y4TA 2PM7A 1SZAA 3TG4A 4RVBA 3VLFA 4A3TA 3CK8A 4OVVA 4TV3A 5M72A 5ANRA 3FUEA 3LY9A 5FZRA 3CHOA 4TUUA 3RRMB 2J07A 4E6HA 3MKQA 4JVSA 3PNTB 4GCOA 4EECA 3KEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IOS A;  4JHK A;  2ION A;  1N52 A;  3EIQ C;  1H2U A;  4B89 A;  2I2O A;  4GMJ A;  1UG3 A;  2ZU6 B;  4C9B B;  2IU1 A;  1HU3 A;  4CRW A;  1N54 A;  1PAQ A;  4LUN U;  2NSZ A;  1H6K A;  3D3M A;  4IUL A;  4JHJ A;  5ANR A;  2VSX E;  3JUI A;  4GML A;  2HM8 A;  1UW4 B;  3EIJ A;  3FEX A;  2IOL A;  3RK6 A;  3L6A A;  2FUL A;  4B8C B;  1H2T C;  1H2V C;  2KZT A;  4CT4 A;  2RG8 A;  4CEM A;  4B8A A;  2VSO E;  3FEY A;  2KZT B;  2GGF A; 
#chains in the Genus database with same CATH topology
 5A7D B;  4AP2 A;  4K03 A;  2WXP A;  4GMJ A;  5BV1 A;  4TRQ A;  1WM5 A;  4N3B A;  2ZIS A;  3PVL A;  4QQI A;  5T4Y A;  4YDY A;  5T8I A;  2KAT A;  4AY6 A;  4CYM D;  4GU5 A;  3FEY A;  3CVU A;  3AS4 A;  4TXQ A;  3SFZ A;  2LXL A;  3HXC A;  2LNI A;  3QK0 A;  2J4B A;  3RO2 A;  4ACK A;  2H6G A;  3JCK C;  2F0Y A;  1FT2 A;  5FQ7 A;  2WXF A;  4EHM A;  2KXP C;  3L6A A;  3D9J A;  3UT7 A;  2VJ8 A;  2YQ8 A;  4GTV A;  3UT8 A;  1JPL A;  5JMN D;  2OOE A;  5KJK A;  3NZS A;  2WMN A;  5IY5 E;  1ELR A;  4UWF A;  3SO8 A;  2C0L A;  4AOF A;  3ISM C;  1H19 A;  4G23 A;  3P2B A;  1IQR A;  1OXJ A;  3SZ7 A;  3Q47 B;  2LUH A;  2IF4 A;  3UX4 A;  4MS6 A;  3UUX A;  1TNO A;  1D9S A;  4ZFH A;  4HS2 A;  2QYU A;  2I2O A;  4TXR A;  4YND A;  4WWO A;  2VGY A;  3PZD A;  3TGO A;  4KT6 B;  3RAU A;  5EID A;  3AG2 E;  3HVE B;  1YYH A;  3HXD A;  3U3W A;  2L0I A;  2KZT B;  2PZI A;  3JYS A;  3QWP A;  3RU0 A;  5AJL A;  4G26 A;  4EBA G;  3UKU G;  3FUN A;  3HDX A;  1JCQ A;  3AU5 A;  3CST A;  4K5C A;  2JAB A;  2YIN A;  2XRZ A;  3G2V A;  3C72 A;  2V5F A;  3J5P A;  5FJY A;  5KJM A;  5JHA A;  4BX8 A;  1UOH A;  1JCS A;  3LKU A;  1HX8 A;  3ZW3 A;  2P9N G;  4JA7 A;  2DYS E;  3UM2 A;  2DIW A;  3E34 A;  2VYI A;  4U95 D;  4I6G A;  2KCK A;  2FF4 A;  2WM9 A;  5G55 A;  1EF1 C;  5EDS A;  1B89 A;  1OWM A;  5CMY A;  4HRN A;  5FT9 A;  3I4G A;  3ZVV A;  3FTS A;  4UQY A;  2ION A;  5LP0 A;  4UQX A;  2P9K G;  1YMP A;  4CZ2 D;  5EIB E;  2Y69 E;  2A4Z A;  3ZU7 B;  3NOG D;  4CDN A;  4PS8 A;  4OVU A;  4DPR A;  1E8Y A;  4I6E A;  2DCP A;  4A55 A;  3UTM A;  5J90 A;  4OAV B;  2A5E A;  4AXH A;  4UI9 C;  2P2C P;  4GZ3 A;  4LNB A;  3CHP A;  1W3B A;  3UIP C;  2WVI A;  5FQ6 A;  3ZRH A;  3S7D A;  4RG6 A;  2QC9 A;  3B7S A;  2Q7F A;  4F7A A;  4U8V D;  3HYM B;  4BWR A;  3FTY A;  4I2W A;  4GB9 A;  3O4Z A;  3ZXS A;  3EJN A;  3AJI A;  3CQG B;  3LY7 A;  3TJP A;  1XNF A;  2GRL A;  3MCX A;  2VSX E;  2V4L A;  3FDH A;  4XKC A;  3AS5 A;  4EQF A;  1OCR E;  4BSZ B;  4K5B A;  1FVF A;  1S70 B;  1V54 E;  3DSS A;  3IKO B;  4K0R A;  2LSV A;  5AYW D;  3ENE A;  1G3N B;  5KNH D;  4J8E A;  3ZFW A;  3FTZ A;  3KS2 A;  5ENS D;  3NAW A;  3IEG A;  3L82 A;  3CVN A;  3V2X A;  4J8S A;  5CRV A;  3DXM G;  2VGE A;  1IHG A;  2R03 A;  5B1B E;  4X8Q A;  2EIK E;  2VQ2 A;  4GCN A;  2X38 A;  2XCC A;  2B6C A;  3CKC A;  2DZN A;  1P5Q A;  3FUH A;  4EZK A;  5G05 J;  1UW4 B;  2X6K A;  3CHM A;  1EYH A;  4PDX A;  5AIJ A;  2XGO A;  1H2U A;  3UKR G;  5KBA A;  1E8W A;  4UWL A;  3KEA A;  4L23 A;  4CCA A;  4RSY A;  4HOR A;  4ANU A;  4FP7 A;  3CQC B;  4GPM A;  3JUI A;  2VSN A;  1IKN D;  3UQ3 A;  3Q7F A;  5DBK A;  2PNN A;  4BFR A;  5ENN A;  4JZY A;  1N95 A;  2ETC A;  5EIL A;  2L6J A;  3SD5 A;  4L2L A;  1DCQ A;  2I6H A;  2DYR E;  2GRP B;  2GRN B;  2LAH A;  2CFZ A;  1EDU A;  3FH8 A;  2V0P A;  2KCV A;  3NQP A;  3MKR A;  4B94 A;  5HQ8 A;  2WXK A;  2R02 A;  4DI4 A;  5KCM A;  4HI8 A;  1TJC A;  3SBT B;  4ME2 A;  3LJN A;  5D0Q D;  4HB5 A;  3L17 A;  1ZB1 A;  1SA5 A;  1QZ2 A;  3G2W A;  4L1B A;  3PNL B;  3GW4 A;  2ZXW E;  3WXX A;  3U66 A;  3CVY A;  3S7F A;  3MX3 A;  2PL2 A;  5BT1 A;  4HVB A;  5AQA A;  4CDM A;  3ULY A;  1D8D A;  2KCL A;  3R7Q A;  4W9R A;  5EKQ D;  5FZS A;  5HKP A;  5EN5 D;  4A3V A;  1ELW A;  1S0P A;  2NYJ A;  3ZEF A;  2Y4T A;  2PM7 A;  3T9K A;  2IY0 C;  4OVV A;  4GTT A;  3FUE A;  3LY9 A;  5FZR A;  2J07 A;  3MKQ A;  2J8S D;  4JVS A;  4GCO A;  2WXR A;  3R9M A;  2WXO A;  1OT8 A;  1FCH A;  1NA3 A;  3TWX A;  2OEV A;  4O1O A;  4O6F A;  2XS8 A;  4I1O B;  3HXE A;  1BD8 A;  3QWW A;  4ILI A;  4AJW A;  5BPP A;  3EIJ A;  3CIA A;  3SBS A;  2ETA A;  5AJD A;  2IJG X;  1FVH A;  5FWQ A;  2XEN A;  3ZYK A;  2PQR A;  2F8X K;  2MOW A;  4EZJ A;  2XGM A;  3OAW A;  3CVV A;  1WY6 A;  3JUE A;  3ML9 A;  5FTP A;  4R7L A;  4OAU C;  3ASO E;  3ABM E;  3CVL A;  3ZUV B;  4F1P A;  1LD7 A;  4Q94 A;  4GTS A;  1VDY A;  3CKB A;  2P58 C;  4U8Y D;  2C0M A;  1O1R A;  1KT1 A;  4MKT A;  4GA1 A;  4AM9 A;  5BV0 A;  4XI9 A;  3UMV A;  2BUG A;  3IXE A;  3F6Q A;  4JB8 P;  3HRA A;  4LNG A;  3ESK A;  4A1S A;  5LX8 A;  4JPS A;  2JLB A;  4WAF A;  2X6F A;  1WG0 A;  3LJ3 A;  5ENT D;  2WQ6 A;  1HO8 A;  2AW6 A;  4E85 A;  1DNP A;  4UQZ A;  5DIZ A;  1PY1 A;  3MA5 A;  4J7W A;  1DC2 A;  3FWV A;  4A1G A;  3L16 A;  1SQM A;  5JJ7 A;  2OND A;  3G2T A;  4L7T A;  5FIN A;  2DZO A;  2XCB A;  3LS8 A;  2IQC A;  5JHB A;  4AV7 A;  2F8Y A;  3ZXP A;  2NC9 A;  2NSZ A;  4U96 D;  3HVE A;  1V55 E;  1X5B A;  2AJA A;  4B8C B;  2FO7 A;  2KZT A;  1SA4 A;  3QAQ A;  5E76 A;  4J8Y A;  2WXL A;  5JJT A;  3PZ4 A;  4LUN U;  4U63 A;  5ENP D;  3TL5 A;  3B7T A;  3CK9 A;  3BUA A;  4O1P A;  3E32 A;  4F3V A;  1OWN A;  1RW2 A;  3DSX A;  3FTX A;  3VTX A;  3ZYQ A;  2AWI A;  3DBS A;  3G2U A;  1OWL A;  3QC1 A;  3ZIM A;  1JCR A;  1PAQ A;  5BXO A;  2EIJ E;  1D8E A;  2GRM A;  3NF1 A;  3RSE G;  5T3R A;  4GTO A;  3FP3 A;  4BTB A;  4YVQ C;  1NA0 A;  4I2Z A;  4BES A;  4GA2 A;  3O48 A;  2ETB A;  3GZ1 A;  3HXB A;  3PUK A;  2OVF A;  3NOC D;  4UWK A;  1MJ0 A;  4G25 A;  2WXI A;  1LF8 A;  2KM4 A;  3FH5 A;  4I9C A;  1E8X A;  2RFM A;  3KSQ A;  3SFX A;  2I9C A;  2XRY A;  2YHC A;  2HR2 A;  3LDZ A;  2Y4U A;  3D9P A;  3ZYM A;  3CV0 A;  4U0U A;  4ILG A;  4HNA D;  4G8K A;  1MZC A;  2R59 A;  3DEO A;  4JHJ A;  3SFY A;  3W9G A;  4ATZ D;  4LG6 A;  4BY6 A;  5ARG A;  4EZL A;  4H7Y A;  2P9U G;  4HRL A;  5AQ7 A;  3D9M A;  1JWG A;  5BNW A;  2GW1 A;  5AEN A;  1TJF A;  2IEJ A;  1OCZ E;  3APD A;  4WNE A;  5CBO A;  2HYZ A;  3FH7 A;  4G8L A;  4G1T A;  3Q9N C;  2H6F A;  4L9P A;  5ARF A;  3UI2 A;  2FUL A;  4JXT A;  1N0R A;  1N0Q A;  3NBN B;  3CVP A;  2IOS A;  3ASN E;  3VTY A;  4XKB A;  4APO A;  2H6H A;  2L0T B;  5AQB A;  2MHK A;  4I17 A;  3EHR A;  2RD0 A;  3R7R A;  4J8F A;  2BF0 X;  4CT4 A;  1NZN A;  4A63 B;  3RO3 A;  3G2S A;  1HFA A;  2WXN A;  1YCS B;  2IO2 C;  2I1J A;  1H0A A;  4JHK A;  1TN8 A;  3EU9 A;  1ZBP A;  3D9O A;  2UY1 B;  4ACL A;  3JXI A;  2C2L A;  1IHB A;  3MV3 B;  3FEX A;  3WG7 E;  4DUI A;  3ABL E;  4CEM A;  1K1B A;  4DX2 A;  4ZHB A;  4J6I A;  5LCW C;  2KBX A;  2EIM E;  3CVQ A;  4DRX E;  4JEU A;  2B0O E;  3Q4A B;  4DK5 A;  3C5R A;  1O5M A;  4JEH A;  3E4B A;  5AQ9 A;  3PZ2 A;  3OXG A;  4NRH B;  3Q78 A;  2I1K A;  3E33 A;  1FPP A;  4N2Q A;  4WNF A;  2GRR B;  3AG1 E;  4I43 A;  3S2A A;  4LRZ A;  3JQ1 A;  5G2N A;  4I6J A;  5D66 A;  1IYG A;  1H6K A;  1LD8 A;  4HLE A;  2CG3 A;  3V30 A;  2L9B A;  2ZGG A;  4ABN A;  3CVX A;  3N71 A;  1NL4 A;  4N3C A;  3SNX A;  4XE0 A;  5G04 J;  4J0U A;  3OXL A;  3ZN3 A;  2XGS A;  4FA6 A;  4RVB A;  5AAO A;  1N11 A;  4EEC A;  3J5Q B;  2Y3A A;  4MLP A;  2WXH A;  4PS7 A;  1EPU A;  4FHJ A;  4BT8 A;  3CHQ A;  3CHS A;  4XI0 A;  3UM1 A;  5EX0 A;  2R2L A;  4FHK A;  1N4R A;  5CHE E;  3DPY A;  5B3S E;  1Z5S C;  1BPO A;  1PC2 A;  1SW6 A;  4N39 A;  4ANX A;  3SF4 A;  2XQ0 A;  3B7R L;  3BQO A;  3D9N A;  3RRU A;  3VLE A;  1MX6 A;  4GMR A;  2XEH A;  3RIB A;  3L54 A;  5AN8 A;  3TWV A;  5CRU A;  5B1A E;  3ASD A;  2QFC A;  2R5S A;  4C0E A;  3FFL A;  1HG5 A;  3Q75 A;  3C3R A;  3FU3 A;  4XIF A;  4U7E B;  4U0Z A;  4FAD A;  3FTU A;  3HIZ A;  3MGB A;  3RKV A;  4KBQ A;  3TXN A;  3QWV A;  4DI3 A;  4YDE A;  2ZIR A;  3FU0 A;  1N9A A;  4KVO A;  3IHY A;  3ULQ A;  3MEK A;  5LOZ A;  4WWN A;  4JW1 A;  3CGH A;  3MYV A;  2P9I G;  3BEE A;  5KJL A;  2AXV A;  5CED B;  1OWP A;  1OCC E;  1UG3 A;  4C9B B;  1BU9 A;  5BUZ A;  2AXZ A;  3LPZ A;  3ZNG A;  1UJJ A;  3IV0 A;  3E37 A;  4N5Q A;  3CHR A;  4GML A;  1KZO A;  1TNY A;  1WDY A;  2ZGD A;  2V8S E;  2X6H A;  2GRO B;  2VSO E;  4GA0 A;  4CT0 A;  4B0Z A;  4Q69 A;  3FUK A;  1QNF A;  2CHX A;  4UWG A;  5CBN A;  1JWF A;  1TR4 A;  4GYW A;  1INZ A;  1K1A A;  5A23 A;  2AXU A;  4L2Y A;  3Q79 A;  3S7J A;  4BT9 A;  3D9L A;  2CG2 A;  3FUJ A;  3DSV A;  4CGV A;  4PS3 A;  3U9W A;  4AVX A;  4WND A;  3QB2 A;  2NXP A;  2P9P G;  2JEK A;  3BG1 B;  1XGW A;  1Z3Y A;  3RJV A;  3TG5 A;  2KC7 A;  4G2V A;  4C48 B;  3FY4 A;  3APC A;  2F37 A;  5KNG A;  3CR3 A;  3S7B A;  2J49 A;  3FTV A;  3LEW A;  2HE0 A;  2FBN A;  4HRM B;  3EHN A;  2EQX A;  3V2O A;  3DRA A;  4LCT A;  1HS6 A;  4XZ4 A;  3HHM A;  3UT4 A;  4HOT A;  5CEC B;  3QKY A;  1QQE A;  4DX7 D;  4NQ0 A;  4LSZ E;  5AAR A;  1JUQ A;  4KZ0 A;  3QDN A;  4Z68 A;  3PZ3 A;  5CER B;  1E8Z A;  2XEE A;  4DJA A;  3TWQ A;  1OCO E;  1K3Z D;  1TNZ A;  4JC8 A;  4JHR A;  4YDO A;  1H2V C;  1U2V G;  3FU5 A;  1S63 A;  4YVO A;  4FLH A;  3QNK A;  1DCE A;  1L5J A;  5FIO A;  3SI5 A;  4B89 A;  3L9T A;  5D2M C;  3C98 A;  1MX4 A;  2R17 C;  3L22 A;  4GTR A;  3CSF A;  5C1D A;  4GZC A;  5FQ4 A;  3B95 A;  3VLD A;  3FUL A;  3P1U A;  5ITZ F;  4KZC A;  4UI9 J;  4F6R D;  1A17 A;  2J4D A;  3FHE A;  5G05 C;  1ELK A;  3LVR E;  3B13 A;  3JQ0 A;  2J08 A;  3I3N A;  2FEZ A;  3EU5 A;  1S64 A;  3RK6 A;  4BSX A;  2PQN A;  3I5P A;  3FUF A;  4DLO A;  3L08 A;  1OY3 D;  2RKK A;  3ONL A;  4HOU A;  3ML8 A;  2V4H C;  2PM6 A;  3HG0 D;  4P29 A;  4DLQ A;  1TYQ G;  1HF8 A;  4U0S A;  3B7B A;  2WXG A;  3KD7 A;  4LEU A;  1HH8 A;  4IN3 B;  4UUC A;  3LY8 A;  3QOU A;  2BTD A;  1IXV A;  3AAA C;  1KLX A;  2ZU6 B;  4DX1 A;  4TUM A;  3E30 A;  3AS8 A;  4G24 A;  4PUC A;  4BER A;  3T8K A;  1H6O A;  3ONK A;  5CMW A;  2HM8 A;  3HXF A;  2BKK B;  3TWU A;  2LXM A;  2L6B A;  4O60 A;  2LO6 A;  3Q9U C;  2GGF A;  1SVX A;  3SGH A;  1K8K G;  4BTA A;  1O1S A;  2EIN E;  4ATG A;  3Q73 A;  1KPS B;  2GRQ B;  2XPY A;  1N94 A;  1BI8 B;  3V31 A;  4APF A;  3TWR A;  3IBE A;  5ENO D;  4AY5 A;  5CEA A;  2Y0B G;  5D0O D;  2J9Q A;  2XPZ A;  3R9A B;  4CDR A;  4GZ5 A;  2MYO A;  4D10 C;  2UY1 A;  3T5X A;  3UM0 A;  4KYO B;  3TAX A;  3B7U X;  1Z3X A;  5A6C A;  4QFV A;  2HO1 A;  5HI7 A;  3URZ A;  3C3O A;  5ANL A;  1U3D A;  3FUD A;  1IQU A;  4IRU A;  1OWO A;  1N52 A;  3UXG A;  3PRE A;  1E96 B;  4FJZ A;  2EIL E;  2VTB B;  3K9I A;  3KAE A;  3QAR A;  3MJW A;  4AEZ C;  4F1S A;  4UI9 K;  3X2Q E;  4B93 B;  3CLJ A;  2XZD G;  5J08 A;  3BG0 B;  3FTW A;  4YDW A;  5HRY A;  4A3T A;  3DWL G;  4TV3 A;  3UM3 A;  5M72 A;  5ANR A;  3JXJ A;  3CHO A;  3RRM B;  3KEZ A;  3EDT B;  4K5A B;  4FC8 A;  2YNQ A;  5H7P A;  2XPI A;  3PS6 A;  3I4R B;  1MX2 A;  1TNB A;  2XEV A;  1N54 A;  1MYO A;  3ASF A;  3Q15 A;  3PE3 A;  4JL0 A;  5CCL A;  3ABK E;  4HI9 A;  5EYL A;  2Y1L E;  3V79 K;  4GYY A;  2IO3 C;  2QY7 A;  3SQV A;  1NFI E;  2WMO A;  1HG2 A;  2H6I A;  2P9L G;  2MRI A;  4I1M A;  4N5C A;  3AU4 A;  3FU6 A;  1NP7 A;  4KXK B;  1NI1 A;  2IOL A;  3C3Q A;  3TWS A;  4M7C A;  2XS1 A;  2BKG A;  3EIQ C;  1TNU A;  4WWP A;  1QYM A;  4BX9 A;  2CHW A;  1LTX A;  2OEW A;  4GYO A;  3EUV A;  4HOQ A;  5FQ8 A;  5JA4 D;  3DPD A;  2J09 A;  1E7V A;  2XHE A;  4U07 A;  3T8M A;  4LER A;  2X6I A;  5CCM A;  5JJ6 A;  5EX3 A;  5FZQ A;  3CEQ A;  1A5E A;  2DWZ A;  1TEZ A;  3Q5M A;  1AP7 A;  3AG4 E;  3D9K A;  2VSY A;  3PEV B;  4FJY A;  4IYP A;  4ILH B;  3D3M A;  2LSU A;  2X3M A;  1HE8 A;  1ZU2 A;  4DX6 D;  3L13 A;  4MRU A;  5BW8 C;  2WQH A;  4H7X A;  4HQD A;  4JA9 A;  3RRN B;  3EHQ A;  3PEU B;  4PH4 B;  2DBA A;  3EHM A;  4JD2 G;  1Z6T A;  3APF A;  4NAC A;  4KVM A;  4MBG A;  2X6J A;  3D9I A;  1H2T C;  2E2E A;  3DEP A;  1KT0 A;  3BU8 A;  4WUY A;  4V3I A;  1MHQ A;  1E7U A;  4HOS A;  1Y8M A;  4LNU D;  4GZ6 A;  4NUR A;  4EPZ A;  3U64 A;  2M63 A;  5KWD A;  3CK7 A;  3MZL B;  3PDN A;  4FLB A;  1UN8 A;  4HBD A;  4GPK A;  3OXF A;  3PH0 C;  3TWW A;  1N4S A;  1BI7 B;  4OYS A;  3TXM A;  4N2S A;  3LVQ E;  3SY2 A;  2WXM A;  4HXI A;  2LAI A;  4WNG A;  3DSU A;  3U4T A;  2WXJ A;  1GW6 A;  2R05 A;  5ENR D;  1E90 A;  3DST A;  3ASG A;  1UJK A;  3LYA A;  3Q49 B;  4IUL A;  3UPV A;  3NB2 A;  1Y6I A;  3GYZ A;  2RG8 A;  2VGX A;  3FUM A;  2YHE A;  2CHZ A;  4Y6C A;  3ASH A;  4RLY A;  1AWC B;  2DVW A;  4Q96 A;  3AG3 E;  3PE4 A;  5ENQ D;  4ANV A;  1MQS A;  1RZ4 A;  2QZA A;  1N4P A;  3ZYL A;  3ZGQ A;  1WAO 1;  4HFG A;  2OV8 A;  2OCC E;  2A5U A;  4U8H A;  2XZT G;  4I9E A;  3ZHE A;  4UWH A;  4M3O A;  2AVP A;  4G11 A;  3GZS A;  4RG9 A;  2IFU A;  3ESL A;  4CGW A;  3OTN A;  3GZ2 A;  4GTQ A;  4KMO A;  2IU1 A;  3IHV A;  4EBA A;  4DX5 D;  3PUJ A;  3MV2 B;  1Q2Z A;  3ULE G;  2V5Q C;  4J8D A;  1O1T A;  1KZP A;  3NZU A;  1X81 A;  3ZKJ A;  5C2Y A;  2P9S G;  3SHF A;  1BLX B;  4Y6W A;  3KSL A;  4AIF A;  1HU3 A;  3DXK G;  3T5V A;  3ZPJ A;  4BET A;  1H6P A;  3CVW A;  5BXU A;  4GZD A;  4XX5 A;  1OUV A;  2VGX B;  4URK A;  2FI7 A;  1HZ4 A;  3UIO C;  1HXI A;  2WXQ A;  4BEP A;  2UWJ G;  5E75 A;  5EYP F;  1SZ9 A;  4C0M A;  4I1A A;  2WB2 A;  4B8A A;  3PZ1 A;  4U04 A;  2ILR A;  2OVB A;  3DSW A;  3Q7A A;  4F53 A;  4GTM A;  5G04 C;  3ZHE B;  3PRZ A;  2QYJ A;  1UN9 A;  2WQ7 A;  2RFA A;  3FUI A;  3QJZ A;  1TN6 A;  4N3A A;  4NIK A;  3TWT A;  3W9F A;  4XEI G;  4GAA A;  1TN7 A;  5LFA A;  2BED A;  4TXP A;  1N4Q A;  4HLL A;  3LXU X;  4FUL A;  1DVP A;  3UIN C;  4ANW A;  4RQI A;  5LCW J;  1YA0 A;  3MKQ B;  2WPV A;  4GTP A;  1FT1 A;  5KJN A;  2FO1 E;  2VTB A;  3LCA A;  2CFU A;  4CRW A;  1U3C A;  2E0I A;  3D9H A;  4FU3 A;  1QBQ A;  3TG4 A;  1SZA A;  3VLF A;  3CK8 A;  5HS0 A;  4TUU A;  4E6H A;  3PNT B; 
#chains in the Genus database with same CATH homology
 3EDT B;  5A7D B;  4AP2 A;  4FC8 A;  2WXR A;  2WXO A;  4K03 A;  2YNQ A;  2WXP A;  4GMJ A;  5BV1 A;  2XPI A;  2Y3A A;  1FCH A;  1NA3 A;  3PS6 A;  3I4R B;  4TRQ A;  4MLP A;  2WXH A;  4PS7 A;  1EPU A;  4FHJ A;  1WM5 A;  2XEV A;  3CHQ A;  1N54 A;  3CHS A;  4O6F A;  4XI0 A;  4BT8 A;  5EX0 A;  4N3B A;  3PVL A;  3ASF A;  3Q15 A;  4I1O B;  5T4Y A;  4FHK A;  3PE3 A;  3QWW A;  5T8I A;  4JL0 A;  4ILI A;  5CCL A;  4AJW A;  5BPP A;  2KAT A;  3EIJ A;  3CIA A;  3SBS A;  4AY6 A;  5AJD A;  5CHE E;  1BPO A;  2IJG X;  4GU5 A;  1FVH A;  1PC2 A;  4GYY A;  3FEY A;  4N39 A;  5FWQ A;  4ANX A;  3ZYK A;  3SF4 A;  3CVU A;  3AS4 A;  2PQR A;  2QY7 A;  2XQ0 A;  3B7R L;  3D9N A;  2MOW A;  3RRU A;  3SFZ A;  2WMO A;  3VLE A;  1HG2 A;  2LNI A;  3QK0 A;  4EZJ A;  3RIB A;  2XGM A;  2J4B A;  3OAW A;  1WY6 A;  3ML9 A;  3CVV A;  5FTP A;  4R7L A;  3RO2 A;  4ACK A;  2MRI A;  3JCK C;  3L54 A;  4I1M A;  4N5C A;  3AU4 A;  3ASD A;  2QFC A;  2R5S A;  3FU6 A;  1NP7 A;  4KXK B;  5FQ7 A;  4C0E A;  2WXF A;  3CVL A;  2IOL A;  3FFL A;  1HG5 A;  3L6A A;  3D9J A;  3UT7 A;  2VJ8 A;  3FU3 A;  2YQ8 A;  4XIF A;  3UT8 A;  1JPL A;  4Q94 A;  4U0Z A;  1VDY A;  4FAD A;  2OOE A;  3CKB A;  3EIQ C;  5KJK A;  3NZS A;  2P58 C;  2WMN A;  3FTU A;  4WWP A;  1ELR A;  3HIZ A;  3MGB A;  4UWF A;  4BX9 A;  2C0M A;  2CHW A;  3RKV A;  1KT1 A;  2C0L A;  4AOF A;  4KBQ A;  3TXN A;  3QWV A;  4DI3 A;  4GYO A;  4HOQ A;  4MKT A;  1H19 A;  4GA1 A;  4AM9 A;  4G23 A;  5FQ8 A;  3P2B A;  5BV0 A;  1IQR A;  4XI9 A;  3DPD A;  3UMV A;  3FU0 A;  2J09 A;  2BUG A;  3SZ7 A;  3Q47 B;  4KVO A;  3IHY A;  2IF4 A;  1E7V A;  3ULQ A;  2XHE A;  3UX4 A;  4MS6 A;  4U07 A;  3ESK A;  4A1S A;  5LX8 A;  3MEK A;  5LOZ A;  3UUX A;  4JPS A;  4WWN A;  4JW1 A;  3T8M A;  2JLB A;  3CGH A;  2X6F A;  4LER A;  2X6I A;  4WAF A;  3LJ3 A;  5CCM A;  3MYV A;  5JJ6 A;  3BEE A;  5KJL A;  5EX3 A;  2AXV A;  5FZQ A;  4HS2 A;  2WQ6 A;  1HO8 A;  1OWP A;  2AW6 A;  3CEQ A;  4E85 A;  2I2O A;  1UG3 A;  4C9B B;  1DNP A;  4UQZ A;  1TEZ A;  3Q5M A;  4YND A;  4WWO A;  5BUZ A;  2VGY A;  3PZD A;  3D9K A;  3TGO A;  4KT6 B;  2AXZ A;  2VSY A;  3LPZ A;  3PEV B;  5DIZ A;  4FJY A;  4IYP A;  4ILH B;  3D3M A;  2LSU A;  1PY1 A;  3MA5 A;  1UJJ A;  2X3M A;  3IV0 A;  3FWV A;  3HVE B;  1HE8 A;  3CHR A;  4GML A;  4A1G A;  3L16 A;  1SQM A;  5JJ7 A;  1ZU2 A;  3L13 A;  3U3W A;  2OND A;  3G2T A;  4L7T A;  4MRU A;  5BW8 C;  2V8S E;  2X6H A;  2XCB A;  2VSO E;  3LS8 A;  2L0I A;  2KZT B;  2WQH A;  4GA0 A;  2IQC A;  4H7X A;  4B0Z A;  4CT0 A;  2PZI A;  3JYS A;  4Q69 A;  3FUK A;  3QWP A;  1QNF A;  5JHB A;  2CHX A;  5AJL A;  3RU0 A;  4UWG A;  4AV7 A;  4JA9 A;  4G26 A;  4EBA G;  3RRN B;  3FUN A;  3PEU B;  4PH4 B;  3HDX A;  2DBA A;  2NC9 A;  3AU5 A;  2NSZ A;  1JWF A;  3HVE A;  3CST A;  4GYW A;  1X5B A;  3EHM A;  2YIN A;  2XRZ A;  1INZ A;  1Z6T A;  3APF A;  4NAC A;  5A23 A;  3G2V A;  2AXU A;  4KVM A;  2X6J A;  4B8C B;  3D9I A;  1H2T C;  2E2E A;  2FO7 A;  2KZT A;  2V5F A;  4L2Y A;  3S7J A;  4BT9 A;  5FJY A;  5KJM A;  3D9L A;  1KT0 A;  5JHA A;  4WUY A;  4BX8 A;  4V3I A;  2CG2 A;  1MHQ A;  3FUJ A;  1E7U A;  3LKU A;  1HX8 A;  3QAQ A;  5E76 A;  4CGV A;  2WXL A;  3ZW3 A;  4HOS A;  5JJT A;  1Y8M A;  4PS3 A;  3U9W A;  4JA7 A;  4AVX A;  4GZ6 A;  2DIW A;  2VYI A;  4WND A;  4LUN U;  3QB2 A;  4U63 A;  2NXP A;  2KCK A;  4I6G A;  4NUR A;  4EPZ A;  2FF4 A;  2WM9 A;  2JEK A;  2M63 A;  5G55 A;  3TL5 A;  3B7T A;  3U64 A;  1EF1 C;  3BG1 B;  3CK9 A;  1B89 A;  5EDS A;  1OWM A;  1XGW A;  4F3V A;  5CMY A;  1Z3Y A;  3RJV A;  3TG5 A;  3CK7 A;  1OWN A;  2KC7 A;  3MZL B;  4G2V A;  3I4G A;  3FTX A;  3FTS A;  5FT9 A;  3ZVV A;  3VTX A;  3ZYQ A;  2AWI A;  2ION A;  3PDN A;  3FY4 A;  3DBS A;  3APC A;  4FLB A;  4UQY A;  5LP0 A;  1UN8 A;  3CR3 A;  4UQX A;  3G2U A;  4GPK A;  1OWL A;  3S7B A;  2J49 A;  3FTV A;  3LEW A;  3OXF A;  3QC1 A;  3PH0 C;  3ZIM A;  2FBN A;  3EHN A;  2EQX A;  2A4Z A;  1PAQ A;  4LCT A;  1HS6 A;  4XZ4 A;  4CDN A;  3HHM A;  4OYS A;  3UT4 A;  4HOT A;  3TXM A;  4N2S A;  3LVQ E;  2GRM A;  3NF1 A;  3QKY A;  5T3R A;  1QQE A;  4PS8 A;  4OVU A;  2WXM A;  3FP3 A;  4NQ0 A;  4BTB A;  4DPR A;  4YVQ C;  1E8Y A;  1NA0 A;  4I2Z A;  4I6E A;  4HXI A;  4GA2 A;  2LAI A;  3O48 A;  4WNG A;  3U4T A;  1JUQ A;  2WXJ A;  2DCP A;  1GW6 A;  3GZ1 A;  4A55 A;  4KZ0 A;  3PUK A;  3QDN A;  1E8Z A;  2OVF A;  1E90 A;  4UWK A;  4DJA A;  5J90 A;  4G25 A;  2WXI A;  1LF8 A;  4AXH A;  3ASG A;  2KM4 A;  4UI9 C;  1UJK A;  3FH5 A;  3LYA A;  4I9C A;  3Q49 B;  4GZ3 A;  1E8X A;  3CHP A;  4IUL A;  1W3B A;  4JC8 A;  3UPV A;  2WVI A;  5FQ6 A;  4JHR A;  2I9C A;  2XRY A;  3S7D A;  3ZRH A;  1Y6I A;  4RG6 A;  1H2V C;  3GYZ A;  2RG8 A;  3B7S A;  2VGX A;  3FU5 A;  2YHC A;  3FUM A;  2Q7F A;  2HR2 A;  3LDZ A;  2Y4U A;  4YVO A;  2YHE A;  4FLH A;  4F7A A;  2CHZ A;  3HYM B;  3QNK A;  1L5J A;  4Y6C A;  3SI5 A;  4B89 A;  4BWR A;  3ASH A;  3FTY A;  3C98 A;  3D9P A;  4I2W A;  4GB9 A;  3ZYM A;  3CV0 A;  2R17 C;  4U0U A;  3L22 A;  4ILG A;  3CSF A;  5C1D A;  3O4Z A;  3ZXS A;  2R59 A;  4Q96 A;  3EJN A;  3CQG B;  3LY7 A;  4JHJ A;  3TJP A;  1XNF A;  2GRL A;  3PE4 A;  3MCX A;  2VSX E;  4GZC A;  5FQ4 A;  3VLD A;  2V4L A;  3FUL A;  4ANV A;  1MQS A;  3P1U A;  4BY6 A;  3FDH A;  5ARG A;  4XKC A;  3ZYL A;  3AS5 A;  4H7Y A;  4EZL A;  3ZGQ A;  4EQF A;  4KZC A;  4UI9 J;  1A17 A;  2J4D A;  1WAO 1;  3FHE A;  5G05 C;  3D9M A;  1ELK A;  1FVF A;  4HFG A;  2OV8 A;  1JWG A;  5BNW A;  2GW1 A;  5AEN A;  1TJF A;  2A5U A;  3LVR E;  3B13 A;  4U8H A;  3IKO B;  4I9E A;  2LSV A;  4K0R A;  3ENE A;  5AYW D;  3ZHE A;  4UWH A;  3APD A;  3JQ0 A;  2J08 A;  4J8E A;  3ZFW A;  3FTZ A;  3KS2 A;  3I3N A;  4M3O A;  4WNE A;  2HYZ A;  3FH7 A;  2AVP A;  4G1T A;  2FEZ A;  4G11 A;  3IEG A;  3GZS A;  5ARF A;  4RG9 A;  2IFU A;  3RK6 A;  2FUL A;  3ESL A;  4CGW A;  4JXT A;  4BSX A;  3CVN A;  4J8S A;  2PQN A;  3OTN A;  3CVP A;  2IOS A;  3I5P A;  3FUF A;  4DLO A;  3GZ2 A;  3L08 A;  3VTY A;  4XKB A;  1IHG A;  3ONL A;  4HOU A;  4KMO A;  3ML8 A;  2IU1 A;  4APO A;  2VQ2 A;  2PM6 A;  2L0T B;  3IHV A;  4P29 A;  4GCN A;  2X38 A;  4DLQ A;  4EBA A;  2XCC A;  3CKC A;  2MHK A;  3PUJ A;  3MV2 B;  1P5Q A;  3FUH A;  4EZK A;  4I17 A;  1HF8 A;  4U0S A;  2WXG A;  3KD7 A;  4J8D A;  2RD0 A;  4LEU A;  5G05 J;  3R7R A;  1UW4 B;  3NZU A;  4J8F A;  1HH8 A;  4IN3 B;  5C2Y A;  2BF0 X;  3LY8 A;  3SHF A;  2X6K A;  3CHM A;  4CT4 A;  1EYH A;  3QOU A;  1NZN A;  4PDX A;  2BTD A;  4Y6W A;  5AIJ A;  1KLX A;  2XGO A;  1H2U A;  4AIF A;  2ZU6 B;  1E8W A;  4UWL A;  3RO3 A;  3G2S A;  1HU3 A;  3AS8 A;  4G24 A;  1HFA A;  4L23 A;  3T5V A;  4PUC A;  2WXN A;  4CCA A;  4RSY A;  4HOR A;  3ZPJ A;  4ANU A;  4FP7 A;  3CQC B;  3ONK A;  5CMW A;  3JUI A;  2HM8 A;  2VSN A;  2I1J A;  1H0A A;  3UQ3 A;  3CVW A;  5DBK A;  2LO6 A;  2GGF A;  4BFR A;  4JHK A;  4GZD A;  4XX5 A;  3SGH A;  1OUV A;  2VGX B;  5ENN A;  4URK A;  2FI7 A;  4JZY A;  1HZ4 A;  1ZBP A;  4BTA A;  3D9O A;  1HXI A;  2UY1 B;  2WXQ A;  4ACL A;  2C2L A;  2L6J A;  2UWJ G;  3SD5 A;  4ATG A;  4L2L A;  3MV3 B;  5E75 A;  2XPY A;  2I6H A;  1SZ9 A;  2LAH A;  3FEX A;  4C0M A;  4I1A A;  2WB2 A;  4APF A;  2CFZ A;  1EDU A;  4CEM A;  4B8A A;  3IBE A;  4AY5 A;  3FH8 A;  2V0P A;  5D0O D;  2J9Q A;  4J6I A;  2XPZ A;  5LCW C;  3R9A B;  2KCV A;  3NQP A;  4CDR A;  4GZ5 A;  3CVQ A;  3MKR A;  4D10 C;  2UY1 A;  3T5X A;  4U04 A;  2ILR A;  4JEU A;  4B94 A;  4KYO B;  5HQ8 A;  3TAX A;  2OVB A;  2WXK A;  3Q4A B;  4DK5 A;  3B7U X;  4DI4 A;  4F53 A;  1Z3X A;  5A6C A;  4QFV A;  5KCM A;  5G04 C;  1TJC A;  2HO1 A;  3ZHE B;  3SBT B;  3PRZ A;  4JEH A;  4ME2 A;  5HI7 A;  5D0Q D;  3E4B A;  1UN9 A;  2WQ7 A;  3L17 A;  3URZ A;  5ANL A;  1U3D A;  1QZ2 A;  3FUI A;  3OXG A;  3QJZ A;  4N3A A;  3FUD A;  1IQU A;  4NRH B;  4IRU A;  1OWO A;  2I1K A;  3G2W A;  1N52 A;  4N2Q A;  4L1B A;  4WNF A;  4GAA A;  5LFA A;  3PRE A;  1E96 B;  4FJZ A;  3PNL B;  3GW4 A;  4I43 A;  3WXX A;  3S2A A;  3U66 A;  4LRZ A;  3LXU X;  3S7F A;  3JQ1 A;  2VTB B;  3CVY A;  3K9I A;  3MX3 A;  2PL2 A;  3KAE A;  3QAR A;  4I6J A;  3MJW A;  5G2N A;  4HVB A;  5BT1 A;  1IYG A;  4FUL A;  1H6K A;  1DVP A;  4CDM A;  4AEZ C;  2CG3 A;  4F1S A;  4HLE A;  4ANW A;  5LCW J;  2KCL A;  2L9B A;  1YA0 A;  3R7Q A;  4ABN A;  4W9R A;  5EKQ D;  3CVX A;  3N71 A;  4N3C A;  5FZS A;  4UI9 K;  3MKQ B;  4A3V A;  2WPV A;  1ELW A;  5KJN A;  3SNX A;  4XE0 A;  5G04 J;  4J0U A;  3OXL A;  3ZN3 A;  2XGS A;  2VTB A;  3CLJ A;  3LCA A;  2CFU A;  4FA6 A;  1S0P A;  4CRW A;  3BG0 B;  5J08 A;  1U3C A;  2E0I A;  3ZEF A;  3FTW A;  4FU3 A;  2Y4T A;  2PM7 A;  1SZA A;  3TG4 A;  4RVB A;  3VLF A;  4A3T A;  3CK8 A;  4OVV A;  4TV3 A;  5M72 A;  5ANR A;  3FUE A;  3LY9 A;  5FZR A;  3CHO A;  4TUU A;  3RRM B;  2J07 A;  4E6H A;  3MKQ A;  4JVS A;  3PNT B;  4GCO A;  4EEC A;  3KEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...