2ZISA

Crystal structure of rat protein farnesyltransferase complexed with a bezoruran inhibitor and fpp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and structure-activity relationships of novel benzofuran farnesyltransferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase subunit alpha
total genus 124
structure length 314
sequence length 314
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2zisA00
2R2LA 3DPYA 4GTQA 1TNBA 1JCSA 1N4RA 1LTXA 4GTOA 3HXFA 4YDOA 3SFXA 1TNZA 1NL4A 1X81A 2BEDA 3PZ2A 4GTMA 1SA4A 3Q7AA 3EU5A 3HXDA 1N4SA 1LD8A 1TNOA 3PZ3A 1N4PA 4EHMA 4GTPA 4GTVA 1QBQA 1S64A 1TN6A 2ZISA 3DRAA 1D8DA 1TN7A 4LNGA 1LD7A 2H6HA 3KSQA 1N95A 3E30A 4LNBA 3SFYA 1N9AA 3DSTA 1MZCA 1O1TA 4MBGA 1O5MA 1TNYA 3E33A 2H6GA 3DSVA 1TNUA 1SA5A 1TN8A 3HXCA 3DSSA 3PZ1A 1FT1A 1FT2A 2IEJA 3PZ4A 3C72A 1KZPA 4L9PA 1O1SA 3E32A 1NI1A 3EUVA 1JCRA 1DCEA 3Q75A 3HXBA 3E34A 1N94A 3Q73A 1N4QA 1O1RA 2H6IA 3Q7FA 3DSWA 1FPPA 4YDEA 1JCQA 3HXEA 4GTTA 2F0YA 4GTRA 3DSXA 1D8EA 3KSLA 3E37A 4GTSA 2ZIRA 3Q79A 3Q78A 2H6FA 1KZOA 1S63A 3DSUA
chains in the Genus database with same CATH superfamily
4L7TA 5ENQD 4U95D 4Z68A 1JWGA 3T9KA 2R59A 3CVLA 4DX5D 2VTBB 2WXFA 3RRMB 3ESLA 4L23A 4APOA 5BV0A 4BTBA 3FEXA 4GZ6A 5AARA 4CDMA 1H2UA 4B8CB 3KSQA 3AJIA 3DSTA 3AS8A 3L13A 3HYMB 3IXEA 3ZYLA 4G26A 2CHWA 3ABLE 3L16A 2VSYA 2L6JA 5FINA 1IHBA 4A55A 4L9PA 3E32A 1N54A 4N3AA 3PUKA 5FZRA 5ENNA 2KCVA 3TWUA 2EQXA 3QARA 4AIFA 2RG8A 5FQ4A 4JW1A 5E76A 2C2LA 2IOLA 4GTRA 3APFA 2L0TB 5LOZA 3E37A 2GROB 2LUHA 1DVPA 3BG1B 4NRHB 5ARFA 2A5UA 1S63A 4JA7A 3DSUA 2IOSA 1TNBA 4J8EA 1JUQA 1JCSA 4WNEA 3L54A 4Q96A 3UKRG 3FTUA 2DIWA 3ML9A 4CZ2D 1Q2ZA 3NF1A 4LCTA 4MLPA 3SFXA 4BT9A 4KBQA 3PRZA 4BTAA 2XEVA 2DCPA 4U07A 3L22A 4UWKA 4BSZB 4I9EA 1SA4A 2HYZA 3ZKJA 4F3VA 3PVLA 3TAXA 3PZ3A 4EHMA 4WWOA 2OOEA 1PAQA 4XE0A 4OVVA 4U8VD 4B94A 1OCRE 1OWOA 3I4GA 5T8IA 3MA5A 3EJNA 3MCXA 2CHZA 5EIBE 2AXVA 4J6IA 3MYVA 5HS0A 1WDYA 1ELRA 4OAUC 4ILHB 4F7AA 3HXBA 2IO3C 2GRPB 4AY6A 3TWSA 3RO3A 2ETCA 5C2YA 4Y6WA 3FTXA 3L82A 5AAOA 4FP7A 3MX3A 4CDNA 5J90A 2BKKB 4HBDA 4M3OA 3OXLA 5CHEE 4N3CA 4WUYA 4I6EA 1D9SA 4O1OA 2M63A 1N4RA 3ASHA 4P29A 3TGOA 3D9LA 2FI7A 4DX2A 2XZTG 4A63B 1NL4A 5AENA 2LO6A 5EDSA 5BXOA 3LPZA 2YHEA 4I6JA 1TR4A 3ENEA 1N4SA 4EZKA 3UX4A 2X38A 5ARGA 4HXIA 4HORA 3UMVA 2XEEA 4XIFA 3EHMA 2V4HC 4O60A 4LNBA 3SFYA 3LYAA 3U3WA 4I1MA 3N71A 2LSUA 5CMYA 1Z3XA 5D0OD 3CSFA 1HZ4A 5EX3A 1N52A 3LY7A 2JEKA 4RVBA 3SZ7A 4UQYA 4ZFHA 3R7RA 2X6JA 3JCKC 3PDNA 4G2VA 4BSXA 1JCRA 4LERA 2CFZA 1E8ZA 3Q73A 2KXPC 4U8YD 3ML8A 2AWIA 3ZRHA 4HOUA 4TXPA 3PNLB 3FUKA 4ANWA 2CG2A 4HS2A 4L1BA 3BUAA 4GPMA 4E85A 5HI7A 4I17A 4BX9A 3CV0A 1OUVA 2QY7A 2XGSA 2BKGA 3U4TA 4XKBA 1BD8A 4JA9A 2L9BA 4N5CA 1JPLA 3TWRA 3K9IA 4DX7D 3HXFA 1H2VC 2GRRB 2VSXE 4AY5A 3NQPA 3FY4A 5T4YA 4N2SA 3HXDA 4AOFA 2KZTA 4WNGA 4FC8A 1MQSA 4ME2A 2OVBA 4HQDA 1OWPA 1D8DA 3D9HA 3CVUA 5AIJA 3CHRA 1TN8A 4WNDA 1QQEA 5JHAA 2CHXA 2IQCA 4EBAG 2ETBA 3ASDA 3D9KA 2IU1A 3I3NA 4CGVA 1N94A 2Y69E 4H7XA 3HRAA 5LFAA 1HO8A 3IHYA 1FCHA 3ESKA 3FDHA 3FWVA 1KT1A 4QFVA 3FU0A 3V30A 3UT8A 2DYRE 3Q9NC 2KM4A 3D9NA 2R2LA 4J8FA 4GTQA 3RJVA 3RU0A 1H2TC 3UM0A 4EECA 2QYUA 4A3VA 1LTXA 5FJYA 4GTOA 4JEHA 5CCMA 3Q49B 3DXMG 5JA4D 1HG5A 4AP2A 1X5BA 2AW6A 3IHVA 3S7FA 2V8SE 1BPOA 3TWXA 1S0PA 3BU8A 4BY6A 4MS6A 1E8YA 3KS2A 2XS8A 1SQMA 4CT0A 2WQ7A 1FVHA 5BV1A 5BUZA 1S64A 3C3RA 2I9CA 1P5QA 4F6RD 4TUUA 4N3BA 3CK9A 4LEUA 4ANXA 1NA0A 5AQ9A 3DSVA 5CEDB 1SA5A 4ANVA 4LG6A 4FJYA 2XZDG 2R05A 3PZ1A 1IXVA 1UOHA 2WXOA 4YDYA 3CR3A 3J5QB 2FO7A 4B8AA 3FEYA 4DX1A 4B0ZA 4YNDA 3JQ0A 4RQIA 4DRXE 4GTTA 2IY0C 5CMWA 4I1AA 3KSLA 4PS7A 4YVOA 3UINC 3OXFA 4G23A 4O6FA 4UI9K 3SI5A 2BTDA 2A5EA 5KNHD 1H6OA 3RAUA 4GZ3A 3IV0A 1IYGA 4IULA 4GYYA 3AS4A 3CHQA 2WXNA 1VDYA 4ATGA 2XPIA 4H7YA 4HRNA 3LJNA 1L5JA 2P58C 1GW6A 3ZYMA 1E8XA 3BEEA 3MKRA 5EX0A 1MX6A 3FFLA 2OEWA 2LNIA 4GTVA 3ZU7B 3VLEA 1IQUA 5AN8A 4GB9A 5CRVA 4MKTA 2I6HA 3CIAA 4HRMB 5ANLA 1E90A 2H6GA 3S2AA 4UQXA 3ZN3A 2R17C 4AJWA 1TYQG 3OAWA 3CVNA 1ZU2A 3CHPA 2Y4TA 1OY3D 3T5XA 3TXNA 1HF8A 1DCQA 4IN3B 4YVQC 4I6GA 3LS8A 4CDRA 4JD2G 3FUIA 4BFRA 2EINE 4DPRA 2WXJA 2XENA 3TWTA 4TXQA 3Q9UC 2MYOA 3UIPC 2HO1A 4BESA 4G25A 5AYWD 3NB2A 5KCMA 5EILA 2J4BA 3ZHEB 4G8KA 4GMRA 1G3NB 1HFAA 5E75A 3KAEA 3HDXA 3AU4A 2CG3A 2WMOA 4NACA 1IHGA 1PY1A 2MHKA 3FH5A 1X81A 1QZ2A 3MKQB 2AVPA 1TNOA 3CHSA 2RFAA 5LP0A 2KC7A 4UWGA 4LUNU 3SY2A 2VGXA 2V4LA 2GGFA 3E4BA 2VQ2A 2XGOA 4ATZD 3S7DA 3CVYA 3DBSA 3TWVA 3VLFA 2LSVA 1HE8A 3NAWA 4E6HA 1U3DA 2DBAA 3DSSA 4A1GA 3W9GA 4BT8A 1OCOE 1E96B 3R7QA 1FT2A 4L2YA 3KEZA 3L9TA 4K0RA 4HRLA 1UW4B 4DX6D 3EIJA 3QNKA 5D0QD 5ENTD 4L2LA 4U0UA 4C48B 4IYPA 1AP7A 3L08A 3DSWA 3MKQA 1Y8MA 4EZLA 4WWNA 2P9LG 3HXEA 4U96D 3HIZA 2PM7A 2Y1LE 1Y6IA 4GTSA 4HOTA 3ASGA 1PC2A 3CK8A 2I1JA 1WY6A 3LVQE 4U0ZA 3DPYA 3EHQA 3ONKA 4A3TA 4JZYA 5EYPF 3CKBA 5DBKA 4CEMA 4X8QA 4O1PA 4KYOB 2FO1E 2A4ZA 3GYZA 2I2OA 3LKUA 2ZU6B 1TN6A 3EU9A 3G2UA 4EPZA 2PQRA 3D9JA 2FULA 4LSZE 3BG0B 4RLYA 2P2CP 1MX4A 2XPYA 4R7LA 3D9OA 3PEVB 3HXCA 3T8MA 4MRUA 1U3CA 1FT1A 4F1SA 3ONLA 2VSOE 3L6AA 1EF1C 2V0PA 2FBNA 5JMND 2X6FA 4JB8P 2Y4UA 3VTYA 5CBNA 3UUXA 1QYMA 1XGWA 4NURA 2F8XK 5G2NA 4N39A 3T5VA 4I2ZA 2OVFA 4FHKA 4GA2A 3D9PA 5ITZF 1ZBPA 2NSZA 4UI9C 3APCA 5FZQA 4J8YA 4PDXA 3I4RB 3CHMA 3VTXA 1RZ4A 5G55A 4ZHBA 5KBAA 2QZAA 4Y6CA 3SF4A 4GZ5A 4D10C 4FULA 4BERA 2YHCA 1UJJA 1ELWA 3CQGB 5DIZA 4JL0A 4BX8A 2BEDA 4ACLA 1U2VG 2E0IA 4IRUA 2DVWA 4TXRA 3UT4A 3Q47B 3GW4A 4GCNA 3DRAA 1BI8B 3CSTA 3PZDA 1TN7A 5KWDA 1UN8A 2HM8A 4FJZA 4WWPA 1N9AA 3FUEA 1O1TA 2DWZA 2WM9A 1TNYA 2VJ8A 1TJCA 1YA0A 5KJKA 3TG5A 4U7EB 4N2QA 4LRZA 2GRLA 2XQ0A 1MJ0A 3ASOE 2GRMA 2IO2C 2OV8A 3TWWA 3ZYKA 4EQFA 4OYSA 1MYOA 2BF0X 1OWMA 3QJZA 4G11A 1K1AA 2PM6A 2LXMA 4A1SA 3MEKA 2XPZA 4KVMA 4CT4A 3LXUX 4FLHA 4Q94A 4XEIG 3FUMA 4W9RA 3ASFA 4I1OB 4HOQA 5A23A 3V31A 4TRQA 3DEOA 1UJKA 5H7PA 2NXPA 4KXKB 3QWWA 2WB2A 5FQ8A 4J0UA 2UWJG 2F8YA 4JEUA 3ISMC 1UG3A 3ZXPA 2WQ6A 2ILRA 3TWQA 3ZHEA 4U8HA 4DK5A 4LNGA 4HNAD 1LD7A 2H6HA 3X2QE 2Y0BG 3P2BA 3ZEFA 3FU3A 1MZCA 2IONA 3KD7A 2MRIA 1WG0A 4FU3A 3UKUG 2R5SA 2VYIA 5D2MC 1LF8A 2XCCA 2EIKE 3ZYQA 3ZVVA 2C0LA 5KJNA 3UTMA 3AU5A 3Q4AB 4AVXA 5G04J 3AG3E 3C3OA 1AWCB 1XNFA 2P9IG 2IJGX 4TUMA 1N0QA 3GZ2A 4UUCA 4DJAA 4GAAA 1EPUA 4B89A 1BLXB 3ZIMA 3MV3B 2X6KA 3CK7A 1OT8A 3ABKE 3FUHA 4EBAA 3R9MA 2X6HA 3GZ1A 3ASNE 3LVRE 2OEVA 4KVOA 3CGHA 4KZ0A 2WXRA 3ZPJA 4G1TA 3CVWA 3QAQA 2J9QA 2YNQA 5CEAA 4ANUA 3PNTB 3UM1A 3V2OA 2DZOA 2HE0A 4GMJA 4JHJA 1YMPA 4YDOA 5CCLA 3U66A 3F6QA 4F53A 5KJMA 1QNFA 3CHOA 1V54E 5BW8C 2FEZA 3WXXA 5FWQA 5M72A 3S7JA 4DI4A 3SD5A 1H19A 3B7BA 3SNXA 3FTWA 3UPVA 4EZJA 3E30A 3P1UA 2GW1A 1HXIA 2LAHA 2J4DA 1TNUA 5AJDA 3AG1E 3NZUA 1TJFA 4M7CA 3D3MA 3W9FA 3PEUB 3LDZA 1W3BA 5B1BE 4XX5A 1IKND 2P9PG 5CERB 3C98A 5ENSD 3HG0D 3FULA 1DC2A 3RSEG 2P9NG 2F37A 3LY9A 2XRYA 4GPKA 1JWFA 3O4ZA 4TV3A 1KZOA 5JJ7A 3FP3A 4PS8A 4AEZC 1HU3A 1N0RA 3LJ3A 3FTYA 3TG4A 5LCWJ 4GZCA 1HG2A 4FHJA 5A7DB 4GZDA 5EYLA 1EYHA 5CECB 2WXHA 3FTVA 1TNZA 5G04C 1SZ9A 4ACKA 1OWNA 5A6CA 3G2TA 4HFGA 3CKCA 4K03A 2ZISA 5FT9A 2QYJA 4GYWA 1SZAA 2P9SG 3I5PA 5G05J 4MBGA 3G2VA 3FUFA 4Q69A 1O5MA 3UM3A 3JYSA 3LCAA 4U04A 2AJAA 1HX8A 2XEHA 3Q15A 4JHRA 5LX8A 1HH8A 4KMOA 3PZ4A 4UWHA 1FVFA 3EHNA 5C1DA 1O1SA 3RRNB 5EN5D 3EUVA 3LY8A 2J8SD 1HS6A 1YCSB 3E34A 4GA1A 4JXTA 2I1KA 3UIOC 4G24A 3Q7FA 4PS3A 1WM5A 3ULEG 3QWPA 1FPPA 3CQCB 2J49A 3URZA 3FU6A 1OXJA 4ILIA 3QDNA 3GZSA 4ABNA 2J07A 4HLLA 3FUNA 3Q79A 2Q7FA 2B0OE 3HVEB 4U63A 4C0EA 3B95A 4RG9A 2HR2A 3EHRA 4C0MA 3APDA 4XKCA 4U0SA 3DEPA 1Z5SC 3RO2A 3MGBA 5AQBA 5AQAA 4NQ0A 3FTZA 4CCAA 3PUJA 5FQ7A 2AXZA 1TEZA 5J08A 1IQRA 4GTMA 4LNUD 1NP7A 5FQ6A 3WG7E 2R03A 3PS6A 2WXGA 4N5QA 2GRQB 2PNNA 3TXMA 1H0AA 3JXIA 4V3IA 2UY1B 1DNPA 3OXGA 1E7UA 4J8DA 1NZNA 4GU5A 4F1PA 3E33A 5FTPA 5KNGA 4JPSA 2VSNA 4HI9A 2KBXA 3ZXSA 3QB2A 4OAVB 5BPPA 3QC1A 1KZPA 2R02A 3SBTB 3CLJA 1NA3A 2X3MA 2V5FA 3UM2A 1INZA 4XZ4A 4K5BA 2Y3AA 1Z3YA 4GCOA 5B1AE 4AM9A 1ZB1A 3BQOA 5FZSA 3D9MA 2E2EA 3QK0A 2WPVA 2PL2A 3RRUA 5ENPD 1N11A 4GYOA 3NOCD 3R9AB 3SBSA 5JJ6A 5T3RA 1OWLA 2ZIRA 3ZFWA 5HKPA 2H6FA 5EKQD 2LAIA 3CVXA 4CYMD 3D9IA 5EIDA 2WXIA 3ABME 4J7WA 3UQ3A 2QC9A 3IBEA 4HB5A 3CEQA 3SHFA 2UY1A 3G2WA 2RD0A 3C5RA 3PREA 3MJWA 2MOWA 2GRNB 3T8KA 2DZNA 3O48A 3U9WA 4BETA 5G05C 3FH7A 3JQ1A 3FHEA 1UN9A 4FA6A 1LD8A 3RIBA 1N4PA 2XS1A 2XRZA 3B7TA 3FU5A 2X6IA 3V79K 1A17A 3ZNGA 2V5QC 2DYSE 1A5EA 4UWFA 1N95A 3FH8A 4I2WA 4WAFA 3MZLB 3TJPA 1WAO1 4B93B 4QQIA 3IKOB 3NOGD 2XCBA 5D66A 4JC8A 4FLBA 4G8LA 1K1BA 2ZGDA 5LCWC 4GMLA 4HOSA 4UWLA 4XI9A 4J8SA 4YDWA 4C9BB 5HQ8A 1B89A 3FTSA 3SO8A 5ENRD 3JUEA 5HRYA 3U64A 1SVXA 2WVIA 2IFUA 2KCLA 4YDEA 2XHEA 2XGMA 3CVPA 1V55E 4DUIA 5BT1A 3L17A 1E8WA 1MX2A 2F0YA 3NBNB 2KZTB 3ZGQA 5JJTA 3Q78A 1MHQA 5AQ7A 3Q5MA 4JHKA 2C0MA 2YINA 2VGEA 5BXUA 1EDUA 3UI2A 5IY5E 3DWLG 3AAAC 2FF4A 2ZGGA 2AXUA 4BEPA 2ZXWE 3PZ2A 1K3ZD 1YYHA 5ENOD 3EU5A 4UQZA 4APFA 2RFMA 3JUIA 3AG4E 3B7SA 4OVUA 2JLBA 4GTPA 1BU9A 1QBQA 2ONDA 2WXLA 2P9KG 5CRUA 2VGXB 3QOUA 1S70B 3ZW3A 5ANRA 3ULQA 3EIQC 3SGHA 1BI7B 1NFIE 4WNFA 3PE3A 4DLOA 1H6KA 5B3SE 4CGWA 3C72A 1H6PA 3B7UX 3PH0C 4RG6A 3C3QA 2JABA 4GA0A 5KJLA 3RK6A 4I43A 4PH4B 3AS5A 2PQNA 4HVBA 4DI3A 2WMNA 4NIKA 4PUCA 1N4QA 3S7BA 4KT6B 2WXQA 2H6IA 2L6BA 4UI9J 5JHBA 1OCZE 3RKVA 1JCQA 2EIME 2PZIA 3CVVA 2ETAA 3SQVA 2KCKA 3B13A 4HI8A 4FADA 4DLQA 3DSXA 2BUGA 3J5PA 3QWVA 4ILGA 2WXMA 3FUDA 3DXKG 3TL5A 3B7RL 4K5AB 1KPSB 3SFZA 4XI0A 3MV2B 1E7VA 3NZSA 2EILE 3FUJA 3HHMA 4BWRA 2B6CA 2VGYA 3Q7AA 2RKKA 3CVQA 2QFCA 3VLDA 2L0IA 3UXGA 1Z6TA 2WXPA 1ELKA 2CFUA 2IF4A 2VTBA 1KT0A 3EDTB 2J09A 1SW6A 5CBOA 1RW2A 3PE4A 1K8KG 2YQ8A 2IEJA 4K5CA 3IEGA 2EIJE 3AG2E 5FIOA 4AV7A 2OCCE 2J08A 3LEWA 1NI1A 2LXLA 2NC9A 3ZUVB 1KLXA 3UT7A 2P9UG 1DCEA 4CRWA 1OCCE 3Q75A 3KEAA 3QKYA 3JXJA 2KATA 2WXKA 1O1RA 4JVSA 5BNWA 4KZCA 2WQHA 4RSYA 3G2SA 3ULYA 2NYJA 3HVEA 3OTNA 4I9CA 3DPDA 4URKA 1D8EA 4AXHA 5AJLA 3V2XA 4HLEA
chains in the Genus database with same CATH topology
2R2LA 3DPYA 4GTQA 1TNBA 1JCSA 1N4RA 1LTXA 4GTOA 3HXFA 4YDOA 3SFXA 1TNZA 1NL4A 1X81A 2BEDA 3PZ2A 4GTMA 1SA4A 3Q7AA 3EU5A 3HXDA 1N4SA 1LD8A 1TNOA 3PZ3A 1N4PA 4EHMA 4GTPA 4GTVA 1QBQA 1S64A 1TN6A 2ZISA 3DRAA 1D8DA 1TN7A 4LNGA 1LD7A 2H6HA 3KSQA 1N95A 3E30A 4LNBA 3SFYA 1N9AA 3DSTA 1MZCA 1O1TA 4MBGA 1O5MA 1TNYA 3E33A 2H6GA 3DSVA 1TNUA 1SA5A 1TN8A 3HXCA 3DSSA 3PZ1A 1FT1A 1FT2A 2IEJA 3PZ4A 3C72A 1KZPA 4L9PA 1O1SA 3E32A 1NI1A 3EUVA 1JCRA 1DCEA 3Q75A 3HXBA 3E34A 1N94A 3Q73A 1N4QA 1O1RA 2H6IA 3Q7FA 3DSWA 1FPPA 4YDEA 1JCQA 3HXEA 4GTTA 2F0YA 4GTRA 3DSXA 1D8EA 3KSLA 3E37A 4GTSA 2ZIRA 3Q79A 3Q78A 2H6FA 1KZOA 1S63A 3DSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2L A;  3DPY A;  4GTQ A;  1TNB A;  1JCS A;  1N4R A;  1LTX A;  4GTO A;  3HXF A;  4YDO A;  3SFX A;  1TNZ A;  1NL4 A;  1X81 A;  2BED A;  3PZ2 A;  4GTM A;  1SA4 A;  3Q7A A;  3EU5 A;  3HXD A;  1N4S A;  1LD8 A;  1TNO A;  3PZ3 A;  1N4P A;  4EHM A;  4GTP A;  4GTV A;  1QBQ A;  1S64 A;  1TN6 A;  2ZIS A;  3DRA A;  1D8D A;  1TN7 A;  4LNG A;  1LD7 A;  2H6H A;  3KSQ A;  1N95 A;  3E30 A;  4LNB A;  3SFY A;  1N9A A;  3DST A;  1MZC A;  1O1T A;  4MBG A;  1O5M A;  1TNY A;  3E33 A;  2H6G A;  3DSV A;  1TNU A;  1SA5 A;  1TN8 A;  3HXC A;  3DSS A;  3PZ1 A;  1FT1 A;  1FT2 A;  2IEJ A;  3PZ4 A;  3C72 A;  1KZP A;  4L9P A;  1O1S A;  3E32 A;  1NI1 A;  3EUV A;  1JCR A;  1DCE A;  3Q75 A;  3HXB A;  3E34 A;  1N94 A;  3Q73 A;  1N4Q A;  1O1R A;  2H6I A;  3Q7F A;  3DSW A;  1FPP A;  4YDE A;  1JCQ A;  3HXE A;  4GTT A;  2F0Y A;  4GTR A;  3DSX A;  1D8E A;  3KSL A;  3E37 A;  4GTS A;  2ZIR A;  3Q79 A;  3Q78 A;  2H6F A;  1KZO A;  1S63 A;  3DSU A; 
#chains in the Genus database with same CATH topology
 4L7T A;  5ENQ D;  4U95 D;  4Z68 A;  1JWG A;  3T9K A;  2R59 A;  3CVL A;  4DX5 D;  2VTB B;  2WXF A;  3RRM B;  3ESL A;  4L23 A;  4APO A;  5BV0 A;  4BTB A;  3FEX A;  4GZ6 A;  5AAR A;  4CDM A;  1H2U A;  4B8C B;  3KSQ A;  3AJI A;  3DST A;  3AS8 A;  3L13 A;  3HYM B;  3IXE A;  3ZYL A;  4G26 A;  2CHW A;  3ABL E;  3L16 A;  2VSY A;  2L6J A;  5FIN A;  1IHB A;  4A55 A;  4L9P A;  3E32 A;  1N54 A;  4N3A A;  3PUK A;  5FZR A;  5ENN A;  2KCV A;  3TWU A;  2EQX A;  3QAR A;  4AIF A;  2RG8 A;  5FQ4 A;  4JW1 A;  5E76 A;  2C2L A;  2IOL A;  4GTR A;  3APF A;  2L0T B;  5LOZ A;  3E37 A;  2GRO B;  2LUH A;  1DVP A;  3BG1 B;  4NRH B;  5ARF A;  2A5U A;  1S63 A;  4JA7 A;  3DSU A;  2IOS A;  1TNB A;  4J8E A;  1JUQ A;  1JCS A;  4WNE A;  3L54 A;  4Q96 A;  3UKR G;  3FTU A;  2DIW A;  3ML9 A;  4CZ2 D;  1Q2Z A;  3NF1 A;  4LCT A;  4MLP A;  3SFX A;  4BT9 A;  4KBQ A;  3PRZ A;  4BTA A;  2XEV A;  2DCP A;  4U07 A;  3L22 A;  4UWK A;  4BSZ B;  4I9E A;  1SA4 A;  2HYZ A;  3ZKJ A;  4F3V A;  3PVL A;  3TAX A;  3PZ3 A;  4EHM A;  4WWO A;  2OOE A;  1PAQ A;  4XE0 A;  4OVV A;  4U8V D;  4B94 A;  1OCR E;  1OWO A;  3I4G A;  5T8I A;  3MA5 A;  3EJN A;  3MCX A;  2CHZ A;  5EIB E;  2AXV A;  4J6I A;  3MYV A;  5HS0 A;  1WDY A;  1ELR A;  4OAU C;  4ILH B;  4F7A A;  3HXB A;  2IO3 C;  2GRP B;  4AY6 A;  3TWS A;  3RO3 A;  2ETC A;  5C2Y A;  4Y6W A;  3FTX A;  3L82 A;  5AAO A;  4FP7 A;  3MX3 A;  4CDN A;  5J90 A;  2BKK B;  4HBD A;  4M3O A;  3OXL A;  5CHE E;  4N3C A;  4WUY A;  4I6E A;  1D9S A;  4O1O A;  2M63 A;  1N4R A;  3ASH A;  4P29 A;  3TGO A;  3D9L A;  2FI7 A;  4DX2 A;  2XZT G;  4A63 B;  1NL4 A;  5AEN A;  2LO6 A;  5EDS A;  5BXO A;  3LPZ A;  2YHE A;  4I6J A;  1TR4 A;  3ENE A;  1N4S A;  4EZK A;  3UX4 A;  2X38 A;  5ARG A;  4HXI A;  4HOR A;  3UMV A;  2XEE A;  4XIF A;  3EHM A;  2V4H C;  4O60 A;  4LNB A;  3SFY A;  3LYA A;  3U3W A;  4I1M A;  3N71 A;  2LSU A;  5CMY A;  1Z3X A;  5D0O D;  3CSF A;  1HZ4 A;  5EX3 A;  1N52 A;  3LY7 A;  2JEK A;  4RVB A;  3SZ7 A;  4UQY A;  4ZFH A;  3R7R A;  2X6J A;  3JCK C;  3PDN A;  4G2V A;  4BSX A;  1JCR A;  4LER A;  2CFZ A;  1E8Z A;  3Q73 A;  2KXP C;  4U8Y D;  3ML8 A;  2AWI A;  3ZRH A;  4HOU A;  4TXP A;  3PNL B;  3FUK A;  4ANW A;  2CG2 A;  4HS2 A;  4L1B A;  3BUA A;  4GPM A;  4E85 A;  5HI7 A;  4I17 A;  4BX9 A;  3CV0 A;  1OUV A;  2QY7 A;  2XGS A;  2BKG A;  3U4T A;  4XKB A;  1BD8 A;  4JA9 A;  2L9B A;  4N5C A;  1JPL A;  3TWR A;  3K9I A;  4DX7 D;  3HXF A;  1H2V C;  2GRR B;  2VSX E;  4AY5 A;  3NQP A;  3FY4 A;  5T4Y A;  4N2S A;  3HXD A;  4AOF A;  2KZT A;  4WNG A;  4FC8 A;  1MQS A;  4ME2 A;  2OVB A;  4HQD A;  1OWP A;  1D8D A;  3D9H A;  3CVU A;  5AIJ A;  3CHR A;  1TN8 A;  4WND A;  1QQE A;  5JHA A;  2CHX A;  2IQC A;  4EBA G;  2ETB A;  3ASD A;  3D9K A;  2IU1 A;  3I3N A;  4CGV A;  1N94 A;  2Y69 E;  4H7X A;  3HRA A;  5LFA A;  1HO8 A;  3IHY A;  1FCH A;  3ESK A;  3FDH A;  3FWV A;  1KT1 A;  4QFV A;  3FU0 A;  3V30 A;  3UT8 A;  2DYR E;  3Q9N C;  2KM4 A;  3D9N A;  2R2L A;  4J8F A;  4GTQ A;  3RJV A;  3RU0 A;  1H2T C;  3UM0 A;  4EEC A;  2QYU A;  4A3V A;  1LTX A;  5FJY A;  4GTO A;  4JEH A;  5CCM A;  3Q49 B;  3DXM G;  5JA4 D;  1HG5 A;  4AP2 A;  1X5B A;  2AW6 A;  3IHV A;  3S7F A;  2V8S E;  1BPO A;  3TWX A;  1S0P A;  3BU8 A;  4BY6 A;  4MS6 A;  1E8Y A;  3KS2 A;  2XS8 A;  1SQM A;  4CT0 A;  2WQ7 A;  1FVH A;  5BV1 A;  5BUZ A;  1S64 A;  3C3R A;  2I9C A;  1P5Q A;  4F6R D;  4TUU A;  4N3B A;  3CK9 A;  4LEU A;  4ANX A;  1NA0 A;  5AQ9 A;  3DSV A;  5CED B;  1SA5 A;  4ANV A;  4LG6 A;  4FJY A;  2XZD G;  2R05 A;  3PZ1 A;  1IXV A;  1UOH A;  2WXO A;  4YDY A;  3CR3 A;  3J5Q B;  2FO7 A;  4B8A A;  3FEY A;  4DX1 A;  4B0Z A;  4YND A;  3JQ0 A;  4RQI A;  4DRX E;  4GTT A;  2IY0 C;  5CMW A;  4I1A A;  3KSL A;  4PS7 A;  4YVO A;  3UIN C;  3OXF A;  4G23 A;  4O6F A;  4UI9 K;  3SI5 A;  2BTD A;  2A5E A;  5KNH D;  1H6O A;  3RAU A;  4GZ3 A;  3IV0 A;  1IYG A;  4IUL A;  4GYY A;  3AS4 A;  3CHQ A;  2WXN A;  1VDY A;  4ATG A;  2XPI A;  4H7Y A;  4HRN A;  3LJN A;  1L5J A;  2P58 C;  1GW6 A;  3ZYM A;  1E8X A;  3BEE A;  3MKR A;  5EX0 A;  1MX6 A;  3FFL A;  2OEW A;  2LNI A;  4GTV A;  3ZU7 B;  3VLE A;  1IQU A;  5AN8 A;  4GB9 A;  5CRV A;  4MKT A;  2I6H A;  3CIA A;  4HRM B;  5ANL A;  1E90 A;  2H6G A;  3S2A A;  4UQX A;  3ZN3 A;  2R17 C;  4AJW A;  1TYQ G;  3OAW A;  3CVN A;  1ZU2 A;  3CHP A;  2Y4T A;  1OY3 D;  3T5X A;  3TXN A;  1HF8 A;  1DCQ A;  4IN3 B;  4YVQ C;  4I6G A;  3LS8 A;  4CDR A;  4JD2 G;  3FUI A;  4BFR A;  2EIN E;  4DPR A;  2WXJ A;  2XEN A;  3TWT A;  4TXQ A;  3Q9U C;  2MYO A;  3UIP C;  2HO1 A;  4BES A;  4G25 A;  5AYW D;  3NB2 A;  5KCM A;  5EIL A;  2J4B A;  3ZHE B;  4G8K A;  4GMR A;  1G3N B;  1HFA A;  5E75 A;  3KAE A;  3HDX A;  3AU4 A;  2CG3 A;  2WMO A;  4NAC A;  1IHG A;  1PY1 A;  2MHK A;  3FH5 A;  1X81 A;  1QZ2 A;  3MKQ B;  2AVP A;  1TNO A;  3CHS A;  2RFA A;  5LP0 A;  2KC7 A;  4UWG A;  4LUN U;  3SY2 A;  2VGX A;  2V4L A;  2GGF A;  3E4B A;  2VQ2 A;  2XGO A;  4ATZ D;  3S7D A;  3CVY A;  3DBS A;  3TWV A;  3VLF A;  2LSV A;  1HE8 A;  3NAW A;  4E6H A;  1U3D A;  2DBA A;  3DSS A;  4A1G A;  3W9G A;  4BT8 A;  1OCO E;  1E96 B;  3R7Q A;  1FT2 A;  4L2Y A;  3KEZ A;  3L9T A;  4K0R A;  4HRL A;  1UW4 B;  4DX6 D;  3EIJ A;  3QNK A;  5D0Q D;  5ENT D;  4L2L A;  4U0U A;  4C48 B;  4IYP A;  1AP7 A;  3L08 A;  3DSW A;  3MKQ A;  1Y8M A;  4EZL A;  4WWN A;  2P9L G;  3HXE A;  4U96 D;  3HIZ A;  2PM7 A;  2Y1L E;  1Y6I A;  4GTS A;  4HOT A;  3ASG A;  1PC2 A;  3CK8 A;  2I1J A;  1WY6 A;  3LVQ E;  4U0Z A;  3DPY A;  3EHQ A;  3ONK A;  4A3T A;  4JZY A;  5EYP F;  3CKB A;  5DBK A;  4CEM A;  4X8Q A;  4O1P A;  4KYO B;  2FO1 E;  2A4Z A;  3GYZ A;  2I2O A;  3LKU A;  2ZU6 B;  1TN6 A;  3EU9 A;  3G2U A;  4EPZ A;  2PQR A;  3D9J A;  2FUL A;  4LSZ E;  3BG0 B;  4RLY A;  2P2C P;  1MX4 A;  2XPY A;  4R7L A;  3D9O A;  3PEV B;  3HXC A;  3T8M A;  4MRU A;  1U3C A;  1FT1 A;  4F1S A;  3ONL A;  2VSO E;  3L6A A;  1EF1 C;  2V0P A;  2FBN A;  5JMN D;  2X6F A;  4JB8 P;  2Y4U A;  3VTY A;  5CBN A;  3UUX A;  1QYM A;  1XGW A;  4NUR A;  2F8X K;  5G2N A;  4N39 A;  3T5V A;  4I2Z A;  2OVF A;  4FHK A;  4GA2 A;  3D9P A;  5ITZ F;  1ZBP A;  2NSZ A;  4UI9 C;  3APC A;  5FZQ A;  4J8Y A;  4PDX A;  3I4R B;  3CHM A;  3VTX A;  1RZ4 A;  5G55 A;  4ZHB A;  5KBA A;  2QZA A;  4Y6C A;  3SF4 A;  4GZ5 A;  4D10 C;  4FUL A;  4BER A;  2YHC A;  1UJJ A;  1ELW A;  3CQG B;  5DIZ A;  4JL0 A;  4BX8 A;  2BED A;  4ACL A;  1U2V G;  2E0I A;  4IRU A;  2DVW A;  4TXR A;  3UT4 A;  3Q47 B;  3GW4 A;  4GCN A;  3DRA A;  1BI8 B;  3CST A;  3PZD A;  1TN7 A;  5KWD A;  1UN8 A;  2HM8 A;  4FJZ A;  4WWP A;  1N9A A;  3FUE A;  1O1T A;  2DWZ A;  2WM9 A;  1TNY A;  2VJ8 A;  1TJC A;  1YA0 A;  5KJK A;  3TG5 A;  4U7E B;  4N2Q A;  4LRZ A;  2GRL A;  2XQ0 A;  1MJ0 A;  3ASO E;  2GRM A;  2IO2 C;  2OV8 A;  3TWW A;  3ZYK A;  4EQF A;  4OYS A;  1MYO A;  2BF0 X;  1OWM A;  3QJZ A;  4G11 A;  1K1A A;  2PM6 A;  2LXM A;  4A1S A;  3MEK A;  2XPZ A;  4KVM A;  4CT4 A;  3LXU X;  4FLH A;  4Q94 A;  4XEI G;  3FUM A;  4W9R A;  3ASF A;  4I1O B;  4HOQ A;  5A23 A;  3V31 A;  4TRQ A;  3DEO A;  1UJK A;  5H7P A;  2NXP A;  4KXK B;  3QWW A;  2WB2 A;  5FQ8 A;  4J0U A;  2UWJ G;  2F8Y A;  4JEU A;  3ISM C;  1UG3 A;  3ZXP A;  2WQ6 A;  2ILR A;  3TWQ A;  3ZHE A;  4U8H A;  4DK5 A;  4LNG A;  4HNA D;  1LD7 A;  2H6H A;  3X2Q E;  2Y0B G;  3P2B A;  3ZEF A;  3FU3 A;  1MZC A;  2ION A;  3KD7 A;  2MRI A;  1WG0 A;  4FU3 A;  3UKU G;  2R5S A;  2VYI A;  5D2M C;  1LF8 A;  2XCC A;  2EIK E;  3ZYQ A;  3ZVV A;  2C0L A;  5KJN A;  3UTM A;  3AU5 A;  3Q4A B;  4AVX A;  5G04 J;  3AG3 E;  3C3O A;  1AWC B;  1XNF A;  2P9I G;  2IJG X;  4TUM A;  1N0Q A;  3GZ2 A;  4UUC A;  4DJA A;  4GAA A;  1EPU A;  4B89 A;  1BLX B;  3ZIM A;  3MV3 B;  2X6K A;  3CK7 A;  1OT8 A;  3ABK E;  3FUH A;  4EBA A;  3R9M A;  2X6H A;  3GZ1 A;  3ASN E;  3LVR E;  2OEV A;  4KVO A;  3CGH A;  4KZ0 A;  2WXR A;  3ZPJ A;  4G1T A;  3CVW A;  3QAQ A;  2J9Q A;  2YNQ A;  5CEA A;  4ANU A;  3PNT B;  3UM1 A;  3V2O A;  2DZO A;  2HE0 A;  4GMJ A;  4JHJ A;  1YMP A;  4YDO A;  5CCL A;  3U66 A;  3F6Q A;  4F53 A;  5KJM A;  1QNF A;  3CHO A;  1V54 E;  5BW8 C;  2FEZ A;  3WXX A;  5FWQ A;  5M72 A;  3S7J A;  4DI4 A;  3SD5 A;  1H19 A;  3B7B A;  3SNX A;  3FTW A;  3UPV A;  4EZJ A;  3E30 A;  3P1U A;  2GW1 A;  1HXI A;  2LAH A;  2J4D A;  1TNU A;  5AJD A;  3AG1 E;  3NZU A;  1TJF A;  4M7C A;  3D3M A;  3W9F A;  3PEU B;  3LDZ A;  1W3B A;  5B1B E;  4XX5 A;  1IKN D;  2P9P G;  5CER B;  3C98 A;  5ENS D;  3HG0 D;  3FUL A;  1DC2 A;  3RSE G;  2P9N G;  2F37 A;  3LY9 A;  2XRY A;  4GPK A;  1JWF A;  3O4Z A;  4TV3 A;  1KZO A;  5JJ7 A;  3FP3 A;  4PS8 A;  4AEZ C;  1HU3 A;  1N0R A;  3LJ3 A;  3FTY A;  3TG4 A;  5LCW J;  4GZC A;  1HG2 A;  4FHJ A;  5A7D B;  4GZD A;  5EYL A;  1EYH A;  5CEC B;  2WXH A;  3FTV A;  1TNZ A;  5G04 C;  1SZ9 A;  4ACK A;  1OWN A;  5A6C A;  3G2T A;  4HFG A;  3CKC A;  4K03 A;  2ZIS A;  5FT9 A;  2QYJ A;  4GYW A;  1SZA A;  2P9S G;  3I5P A;  5G05 J;  4MBG A;  3G2V A;  3FUF A;  4Q69 A;  1O5M A;  3UM3 A;  3JYS A;  3LCA A;  4U04 A;  2AJA A;  1HX8 A;  2XEH A;  3Q15 A;  4JHR A;  5LX8 A;  1HH8 A;  4KMO A;  3PZ4 A;  4UWH A;  1FVF A;  3EHN A;  5C1D A;  1O1S A;  3RRN B;  5EN5 D;  3EUV A;  3LY8 A;  2J8S D;  1HS6 A;  1YCS B;  3E34 A;  4GA1 A;  4JXT A;  2I1K A;  3UIO C;  4G24 A;  3Q7F A;  4PS3 A;  1WM5 A;  3ULE G;  3QWP A;  1FPP A;  3CQC B;  2J49 A;  3URZ A;  3FU6 A;  1OXJ A;  4ILI A;  3QDN A;  3GZS A;  4ABN A;  2J07 A;  4HLL A;  3FUN A;  3Q79 A;  2Q7F A;  2B0O E;  3HVE B;  4U63 A;  4C0E A;  3B95 A;  4RG9 A;  2HR2 A;  3EHR A;  4C0M A;  3APD A;  4XKC A;  4U0S A;  3DEP A;  1Z5S C;  3RO2 A;  3MGB A;  5AQB A;  5AQA A;  4NQ0 A;  3FTZ A;  4CCA A;  3PUJ A;  5FQ7 A;  2AXZ A;  1TEZ A;  5J08 A;  1IQR A;  4GTM A;  4LNU D;  1NP7 A;  5FQ6 A;  3WG7 E;  2R03 A;  3PS6 A;  2WXG A;  4N5Q A;  2GRQ B;  2PNN A;  3TXM A;  1H0A A;  3JXI A;  4V3I A;  2UY1 B;  1DNP A;  3OXG A;  1E7U A;  4J8D A;  1NZN A;  4GU5 A;  4F1P A;  3E33 A;  5FTP A;  5KNG A;  4JPS A;  2VSN A;  4HI9 A;  2KBX A;  3ZXS A;  3QB2 A;  4OAV B;  5BPP A;  3QC1 A;  1KZP A;  2R02 A;  3SBT B;  3CLJ A;  1NA3 A;  2X3M A;  2V5F A;  3UM2 A;  1INZ A;  4XZ4 A;  4K5B A;  2Y3A A;  1Z3Y A;  4GCO A;  5B1A E;  4AM9 A;  1ZB1 A;  3BQO A;  5FZS A;  3D9M A;  2E2E A;  3QK0 A;  2WPV A;  2PL2 A;  3RRU A;  5ENP D;  1N11 A;  4GYO A;  3NOC D;  3R9A B;  3SBS A;  5JJ6 A;  5T3R A;  1OWL A;  2ZIR A;  3ZFW A;  5HKP A;  2H6F A;  5EKQ D;  2LAI A;  3CVX A;  4CYM D;  3D9I A;  5EID A;  2WXI A;  3ABM E;  4J7W A;  3UQ3 A;  2QC9 A;  3IBE A;  4HB5 A;  3CEQ A;  3SHF A;  2UY1 A;  3G2W A;  2RD0 A;  3C5R A;  3PRE A;  3MJW A;  2MOW A;  2GRN B;  3T8K A;  2DZN A;  3O48 A;  3U9W A;  4BET A;  5G05 C;  3FH7 A;  3JQ1 A;  3FHE A;  1UN9 A;  4FA6 A;  1LD8 A;  3RIB A;  1N4P A;  2XS1 A;  2XRZ A;  3B7T A;  3FU5 A;  2X6I A;  3V79 K;  1A17 A;  3ZNG A;  2V5Q C;  2DYS E;  1A5E A;  4UWF A;  1N95 A;  3FH8 A;  4I2W A;  4WAF A;  3MZL B;  3TJP A;  1WAO 1;  4B93 B;  4QQI A;  3IKO B;  3NOG D;  2XCB A;  5D66 A;  4JC8 A;  4FLB A;  4G8L A;  1K1B A;  2ZGD A;  5LCW C;  4GML A;  4HOS A;  4UWL A;  4XI9 A;  4J8S A;  4YDW A;  4C9B B;  5HQ8 A;  1B89 A;  3FTS A;  3SO8 A;  5ENR D;  3JUE A;  5HRY A;  3U64 A;  1SVX A;  2WVI A;  2IFU A;  2KCL A;  4YDE A;  2XHE A;  2XGM A;  3CVP A;  1V55 E;  4DUI A;  5BT1 A;  3L17 A;  1E8W A;  1MX2 A;  2F0Y A;  3NBN B;  2KZT B;  3ZGQ A;  5JJT A;  3Q78 A;  1MHQ A;  5AQ7 A;  3Q5M A;  4JHK A;  2C0M A;  2YIN A;  2VGE A;  5BXU A;  1EDU A;  3UI2 A;  5IY5 E;  3DWL G;  3AAA C;  2FF4 A;  2ZGG A;  2AXU A;  4BEP A;  2ZXW E;  3PZ2 A;  1K3Z D;  1YYH A;  5ENO D;  3EU5 A;  4UQZ A;  4APF A;  2RFM A;  3JUI A;  3AG4 E;  3B7S A;  4OVU A;  2JLB A;  4GTP A;  1BU9 A;  1QBQ A;  2OND A;  2WXL A;  2P9K G;  5CRU A;  2VGX B;  3QOU A;  1S70 B;  3ZW3 A;  5ANR A;  3ULQ A;  3EIQ C;  3SGH A;  1BI7 B;  1NFI E;  4WNF A;  3PE3 A;  4DLO A;  1H6K A;  5B3S E;  4CGW A;  3C72 A;  1H6P A;  3B7U X;  3PH0 C;  4RG6 A;  3C3Q A;  2JAB A;  4GA0 A;  5KJL A;  3RK6 A;  4I43 A;  4PH4 B;  3AS5 A;  2PQN A;  4HVB A;  4DI3 A;  2WMN A;  4NIK A;  4PUC A;  1N4Q A;  3S7B A;  4KT6 B;  2WXQ A;  2H6I A;  2L6B A;  4UI9 J;  5JHB A;  1OCZ E;  3RKV A;  1JCQ A;  2EIM E;  2PZI A;  3CVV A;  2ETA A;  3SQV A;  2KCK A;  3B13 A;  4HI8 A;  4FAD A;  4DLQ A;  3DSX A;  2BUG A;  3J5P A;  3QWV A;  4ILG A;  2WXM A;  3FUD A;  3DXK G;  3TL5 A;  3B7R L;  4K5A B;  1KPS B;  3SFZ A;  4XI0 A;  3MV2 B;  1E7V A;  3NZS A;  2EIL E;  3FUJ A;  3HHM A;  4BWR A;  2B6C A;  2VGY A;  3Q7A A;  2RKK A;  3CVQ A;  2QFC A;  3VLD A;  2L0I A;  3UXG A;  1Z6T A;  2WXP A;  1ELK A;  2CFU A;  2IF4 A;  2VTB A;  1KT0 A;  3EDT B;  2J09 A;  1SW6 A;  5CBO A;  1RW2 A;  3PE4 A;  1K8K G;  2YQ8 A;  2IEJ A;  4K5C A;  3IEG A;  2EIJ E;  3AG2 E;  5FIO A;  4AV7 A;  2OCC E;  2J08 A;  3LEW A;  1NI1 A;  2LXL A;  2NC9 A;  3ZUV B;  1KLX A;  3UT7 A;  2P9U G;  1DCE A;  4CRW A;  1OCC E;  3Q75 A;  3KEA A;  3QKY A;  3JXJ A;  2KAT A;  2WXK A;  1O1R A;  4JVS A;  5BNW A;  4KZC A;  2WQH A;  4RSY A;  3G2S A;  3ULY A;  2NYJ A;  3HVE A;  3OTN A;  4I9C A;  3DPD A;  4URK A;  1D8E A;  4AXH A;  5AJL A;  3V2X A;  4HLE A; 
#chains in the Genus database with same CATH homology
 2R2L A;  3DPY A;  4GTQ A;  1TNB A;  1JCS A;  1N4R A;  1LTX A;  4GTO A;  3HXF A;  4YDO A;  3SFX A;  1TNZ A;  1NL4 A;  1X81 A;  2BED A;  3PZ2 A;  4GTM A;  1SA4 A;  3Q7A A;  3EU5 A;  3HXD A;  1N4S A;  1LD8 A;  1TNO A;  3PZ3 A;  1N4P A;  4EHM A;  4GTP A;  4GTV A;  1QBQ A;  1S64 A;  1TN6 A;  2ZIS A;  3DRA A;  1D8D A;  1TN7 A;  4LNG A;  1LD7 A;  2H6H A;  3KSQ A;  1N95 A;  3E30 A;  4LNB A;  3SFY A;  1N9A A;  3DST A;  1MZC A;  1O1T A;  4MBG A;  1O5M A;  1TNY A;  3E33 A;  2H6G A;  3DSV A;  1TNU A;  1SA5 A;  1TN8 A;  3HXC A;  3DSS A;  3PZ1 A;  1FT1 A;  1FT2 A;  2IEJ A;  3PZ4 A;  3C72 A;  1KZP A;  4L9P A;  1O1S A;  3E32 A;  1NI1 A;  3EUV A;  1JCR A;  1DCE A;  3Q75 A;  3HXB A;  3E34 A;  1N94 A;  3Q73 A;  1N4Q A;  1O1R A;  2H6I A;  3Q7F A;  3DSW A;  1FPP A;  4YDE A;  1JCQ A;  3HXE A;  4GTT A;  2F0Y A;  4GTR A;  3DSX A;  1D8E A;  3KSL A;  3E37 A;  4GTS A;  2ZIR A;  3Q79 A;  3Q78 A;  2H6F A;  1KZO A;  1S63 A;  3DSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...