2ZISA

Crystal structure of rat protein farnesyltransferase complexed with a bezoruran inhibitor and fpp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase subunit alpha
publication title Synthesis and structure-activity relationships of novel benzofuran farnesyltransferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
total genus 124
structure length 314
sequence length 314
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2zisA00
3DSTA 3HXBA 4L9PA 4LNGA 1NI1A 1FT2A 1TNBA 3HXCA 3E32A 3PZ1A 2IEJA 1N95A 2BEDA 3HXFA 1N9AA 1JCSA 1TNZA 3DSXA 2R2LA 4GTMA 1TN6A 1LTXA 1S63A 4LNBA 1JCRA 1S64A 1NL4A 1TNUA 2H6FA 3DSSA 3E37A 3DSUA 3E30A 3PZ4A 1O5MA 1N4RA 3Q75A 3E33A 1N94A 1SA4A 3HXDA 1KZPA 3SFXA 1TN7A 4YDEA 4EHMA 1O1TA 1N4SA 3EU5A 1N4QA 1D8DA 3DRAA 3PZ3A 1KZOA 3Q78A 2ZIRA 3Q73A 1QBQA 2H6GA 1FPPA 4GTVA 3DSVA 1LD8A 3DSWA 1TNOA 4YDOA 1O1RA 2H6HA 3Q79A 4GTOA 2F0YA 1TNYA 1X81A 1MZCA 3KSQA 1O1SA 3SFYA 3PZ2A 1TN8A 3Q7AA 1D8EA 3E34A 4GTRA 1FT1A 3KSLA 1JCQA 4GTQA 4MBGA 1DCEA 3HXEA 4GTTA 1N4PA 3Q7FA 4GTPA 2ZISA 2H6IA 4GTSA 3DPYA 1SA5A 3EUVA 1LD7A 3C72A
chains in the Genus database with same CATH superfamily
3HXBA 4XX5A 3UTMA 4AOFA 3CKCA 3TWXA 4GZCA 3UM2A 3ML9A 2E2EA 1JWGA 4BERA 3L6AA 4UUCA 1Q2ZA 3HXFA 3N71A 4OYSA 3MV3B 3OXFA 1N0RA 4U0SA 2WXQA 3JXJA 1EDUA 2GRPB 4ANWA 2X6JA 4J8DA 3IBEA 2QZAA 4JEHA 5BUZA 3NQPA 1UN9A 5AQ9A 3TWRA 4PS7A 3MEKA 4RG6A 3B13A 3TAXA 1WG0A 1TN7A 4AJWA 3ASOE 2L0TB 2RFAA 4CGVA 3UKUG 3FUMA 2XQ0A 4CGWA 5CRVA 4XKCA 5CCMA 1N52A 3FWVA 5FTPA 3G2TA 5EIBE 1BLXB 2UY1A 2HYZA 1HF8A 3ZXSA 3IXEA 5AARA 4N2QA 2J9QA 3LXUX 5DIZA 3ZVVA 1WAO1 1DCQA 3D9OA 4PDXA 5EYPF 2H6IA 4KBQA 3Q5MA 2DBAA 4A3TA 4KZ0A 3FU6A 3MJWA 3O4ZA 3FY4A 1A5EA 1HE8A 4I2WA 3B95A 1VDYA 5HKPA 3ZPJA 1WY6A 1INZA 2XS1A 3QWPA 5BV1A 4J8SA 2BF0X 4HOTA 2WXLA 1ZB1A 3ASFA 2OVFA 3CK9A 3ONLA 3SBTB 3ZNGA 2VGXB 3U66A 3UIOC 2KM4A 4GU5A 2GRLA 5ENSD 4CZ2D 2V0PA 3FU3A 3BU8A 5A7DB 4JW1A 4AP2A 5B3SE 1N4SA 3EU5A 3PZ3A 2RG8A 3MX3A 5T3RA 1QZ2A 2YQ8A 3UT7A 3TL5A 2ETAA 2X6FA 4DJAA 2GRRB 1FVFA 2AXVA 1HZ4A 3CV0A 4B8CB 4P29A 4OAUC 3UT8A 4U8YD 1D8EA 2VJ8A 3ASHA 3G2VA 4AIFA 2XS8A 3T5XA 3MZLB 2B0OE 3SQVA 1K3ZD 3HVEB 4DK5A 3L08A 2V5FA 3ONKA 4A55A 5CRUA 3FUFA 2I2OA 5ANRA 4A63B 1NI1A 2YNQA 3VLEA 3SO8A 2VSXE 3KD7A 2DIWA 3TJPA 1BD8A 3D9LA 5JHAA 2NC9A 4YDWA 1LTXA 2RKKA 3EHMA 3EHNA 1S63A 3HRAA 2WMOA 2C0MA 2BKKB 1P5QA 3PRZA 3ZW3A 5FQ4A 3FHEA 4I9EA 2MYOA 5FQ6A 3NZUA 2Q7FA 3CHSA 4DI4A 2XCCA 1FCHA 3G2UA 1JWFA 3JYSA 4EPZA 1N4QA 4GMJA 3EIQC 4HI8A 2OOEA 3EJNA 1H19A 4KVMA 3D9IA 3CVXA 1RZ4A 1X81A 4DUIA 3PZ2A 4O60A 4PH4B 3ZYLA 2XZTG 1YMPA 5LFAA 4Q94A 3AG3E 1N4PA 2XRYA 3D3MA 1LF8A 3P1UA 3C3RA 3EUVA 2DVWA 4KVOA 3C72A 3PS6A 3JXIA 3DEPA 5KNHD 3APCA 4LNGA 3PZ1A 3AU4A 5CMYA 4HORA 5AQ7A 4BY6A 4HLLA 2BUGA 3D9HA 4JHKA 3I4RB 2RD0A 3ASGA 4K5AB 4HOSA 4MLPA 1XGWA 5FT9A 1E8ZA 3C98A 4ABNA 4O1PA 2KBXA 1WM5A 4CT0A 4L2LA 4WNFA 3V2OA 1NL4A 2VGYA 3E37A 4B0ZA 4A1SA 1DNPA 1H2UA 3RK6A 4Q96A 4MRUA 5KWDA 3GZ1A 4GCOA 3TWSA 4J8FA 1MYOA 3MKQB 2OEWA 2EIME 3L22A 4GZDA 4U63A 3ML8A 4B93B 3WG7E 3LVRE 5FJYA 1EPUA 3DEOA 3C3OA 2AJAA 5EN5D 2Y4TA 4U96D 4UWFA 4ATGA 4I2ZA 3TG4A 3ZRHA 2ZISA 4TXQA 4G2VA 4F3VA 2AWIA 3PNLB 1Z3YA 3NB2A 1HFAA 3LDZA 1TYQG 4XIFA 2IY0C 3FFLA 4CDMA 1MQSA 4AM9A 2CHWA 2KXPC 1N95A 2BEDA 4DX7D 2VSYA 1Z5SC 2V4LA 4HLEA 4UWKA 2CG2A 3BUAA 1HG2A 3ZYQA 2AXUA 4HS2A 5KJKA 3IHVA 1QQEA 2CHXA 3CHQA 4FHJA 3FTYA 2L0IA 2ZU6B 1S70B 4CEMA 3QWWA 4UI9C 1OWNA 5AQAA 3ULQA 1NP7A 4PUCA 2XCBA 4BWRA 4Z68A 4CDRA 3CHPA 5H7PA 5B1BE 2WXGA 2WXHA 4UI9K 1JUQA 3Q9NC 3FH7A 3R9AB 3Q49B 4K5BA 5EX0A 3DXKG 4GAAA 2WXNA 2ONDA 2JLBA 3FULA 4EECA 2YINA 3ZHEB 4AV7A 3D9KA 1Y8MA 3E34A 4GTRA 4ZHBA 4BEPA 4XI0A 1IKND 1HX8A 4JC8A 4UQXA 4N5CA 4FJYA 4EQFA 2V8SE 4G26A 2IFUA 3ZIMA 4U0ZA 4BX8A 4G24A 4DRXE 2J4BA 3ZN3A 3KEZA 5CEDB 4L9PA 4R7LA 1BI8B 3DXMG 5FWQA 3ZUVB 2J09A 3ZGQA 5HI7A 3EHQA 4URKA 2X6IA 2FO7A 4J7WA 3PDNA 2R2LA 5ARGA 2EIKE 4O1OA 2XZDG 5ENPD 3TXNA 1U3DA 4OAVB 4BTBA 3ASDA 2Y4UA 3LY9A 4FHKA 3DBSA 1S64A 3DWLG 5LX8A 3CR3A 3RU0A 3DSSA 2Y69E 4GZ5A 3FUEA 1EF1C 4B89A 3T5VA 1SA4A 4N3AA 4IN3B 2WXRA 4HRMB 3DRAA 3LY8A 3CVYA 2QY7A 3NF1A 4BFRA 3AS4A 3IEGA 1BI7B 3UPVA 2XGSA 2LXLA 2HM8A 5FZRA 3PH0C 4JXTA 4NACA 3OAWA 3NZSA 2C2LA 3PVLA 4GYOA 3GW4A 4AY5A 3Q7AA 4ANVA 5LOZA 4BESA 3Q47B 1AP7A 2I1KA 1OCRE 5BNWA 2P9NG 4GTTA 3EHRA 4LG6A 3APDA 3QC1A 2PQNA 4HXIA 4GMLA 5CHEE 4F1PA 1OWPA 2AW6A 1E7VA 2MOWA 1UN8A 3HG0D 1FT2A 5BW8C 3CK7A 2VYIA 2XRZA 4EZJA 4I6JA 4FA6A 3CHRA 3CHMA 1E8WA 3UMVA 4TRQA 2WXFA 3S7JA 3DSUA 2PM7A 3PZ4A 4ME2A 3FUKA 4PS8A 2J49A 3KEAA 5G04J 2DWZA 4OVVA 4H7XA 3R9MA 3G2WA 5HS0A 3CVUA 4TV3A 4EHMA 1O1TA 4LSZE 5ENOD 4AVXA 4WWNA 3URZA 3DSVA 1Z3XA 2XEVA 4C0EA 3FDHA 3UXGA 1TNOA 2R59A 3RO2A 4O6FA 1SVXA 4N2SA 4U95D 4KXKB 5D0QD 1TNYA 5FZSA 1N0QA 2IONA 3QNKA 2XGOA 2JEKA 1Y6IA 4GTQA 4BTAA 5KBAA 1OCZE 3O48A 4JHRA 5C2YA 3B7SA 3BQOA 4L2YA 2LSVA 4FP7A 4AEZC 1MHQA 2WXKA 3IKOB 1KPSB 4HI9A 3UKRG 2EQXA 4DX2A 4GCNA 2YHEA 1ZU2A 3L9TA 4UWGA 2WXJA 2IEJA 4HOQA 3TXMA 3E4BA 4A3VA 2KZTB 5LP0A 3AS8A 3W9GA 2BTDA 2DYSE 1WDYA 3FTWA 2R02A 1TJCA 3Q75A 4ATZD 5JJTA 2M63A 3E33A 2FO1E 4GMRA 4JA7A 2VGXA 3S7FA 2OEVA 3ULYA 3SF4A 2A5UA 3MCXA 2WXPA 3VTYA 3ABME 2WVIA 3L82A 3PZDA 1HH8A 3FUDA 1SW6A 3V2XA 4RG9A 3GZ2A 1YCSB 4F1SA 1V54E 4CYMD 2ZGGA 3P2BA 4KMOA 2NXPA 3QB2A 3AG4E 3CIAA 3LYAA 3TWWA 2VTBB 5B1AE 4G8LA 3PE4A 2HE0A 3Q7FA 4ANXA 2J08A 2XENA 1H2TC 3SZ7A 2PM6A 2L9BA 3RIBA 4D10C 1G3NB 2WM9A 2LUHA 2JABA 3S2AA 1DVPA 1PY1A 2P2CP 2VQ2A 1MX2A 1FVHA 3HVEA 1JCSA 3LPZA 4L23A 1U3CA 3FP3A 1MX4A 3CQCB 4WAFA 1NA0A 4N3CA 2NSZA 1UW4B 2F8XK 2IJGX 2OCCE 2WXIA 1TNUA 3SHFA 1NZNA 5G55A 4TXPA 5BXUA 1N4RA 3ENEA 4NQ0A 5J90A 3V30A 3T8MA 3ZFWA 3FTUA 2NYJA 3JUEA 5CECB 5FINA 4V3IA 4I1MA 5EX3A 2KC7A 2DZOA 2ZIRA 3FUHA 1KT0A 3HHMA 4Q69A 4GTVA 3ZYKA 1LD8A 4GYWA 5AJLA 5G05J 5JMND 4GTOA 5AJDA 3ZKJA 4FLBA 1NFIE 3I3NA 3CK8A 5JHBA 1E8XA 3CSTA 3CVPA 3KSLA 4Y6CA 1BPOA 2IO3C 3HXEA 3SGHA 1IXVA 4NRHB 3U3WA 4HVBA 4G25A 4XEIG 5G2NA 1L5JA 1XNFA 2QC9A 2CHZA 4GTSA 4UWLA 1OWMA 2P58C 3DPDA 4YVOA 4I17A 4CT4A 1H6KA 5JJ6A 4LERA 4A1GA 3UINC 4LRZA 1TNBA 3K9IA 2XHEA 2GRQB 4U8HA 2ZGDA 4AXHA 3WXXA 1N11A 2ETCA 4XE0A 3BG0B 5D0OD 4JEUA 1KT1A 3CSFA 5G05C 1OCOE 2P9KG 4MKTA 5FQ8A 5AYWD 1A17A 3VLFA 3E30A 4GZ3A 3CVLA 5ANLA 3PE3A 3TWVA 5BPPA 2LAHA 3LY7A 3UQ3A 5CMWA 5AQBA 1HXIA 3LKUA 5EKQD 3Q79A 2J4DA 2F0YA 5ENQD 2QYUA 1MZCA 5JA4D 2XPYA 1OWLA 4ACKA 3MKQA 1DC2A 3F6QA 1IHBA 3LEWA 3AAAC 2CFZA 2Y1LE 2A5EA 1H6PA 3T8KA 2X38A 4XKBA 3FTSA 5EDSA 2KCVA 2FF4A 3PUJA 1PAQA 1AWCB 3TG5A 2LAIA 4W9RA 4AY6A 5CEAA 3BEEA 5HRYA 1W3BA 4HBDA 4IULA 2IQCA 3FUNA 1N9AA 3J5QB 4C48B 3DSXA 1YYHA 3IHYA 2AVPA 3NOCD 2R17C 3I5PA 4F6RD 4TXRA 3QAQA 2C0LA 2R03A 2KCKA 2PL2A 5T8IA 3RAUA 2PZIA 4XZ4A 2R05A 5ARFA 3KAEA 1KZPA 3EU9A 1X5BA 3UX4A 4EZKA 2UY1B 5FZQA 3UI2A 4C0MA 1D9SA 3CHOA 5BV0A 4F53A 4C9BB 2CFUA 1UJKA 4HQDA 4DLQA 2ETBA 4IYPA 2X3MA 2XEHA 3OTNA 3OXGA 5EYLA 4I6GA 5EIDA 2XGMA 4YNDA 1ELKA 4N39A 4U8VD 2HO1A 1IYGA 1JCQA 2KATA 3SY2A 3L13A 4I43A 2EILE 2GGFA 1JPLA 2RFMA 4J8YA 4LNUD 1OY3D 4RLYA 2L6JA 4JA9A 2FULA 3RRUA 3T9KA 3HYMB 3ZHEA 5BT1A 5LCWJ 3LJNA 5T4YA 4LNBA 2I1JA 3QARA 4DX1A 2XEEA 1Z6TA 1SZ9A 1OUVA 3Q4AB 4YVQC 1E96B 3FH8A 3FTVA 1TJFA 1TNZA 5AN8A 4GTMA 3ZEFA 1TN6A 5ITZF 3S7BA 4K5CA 3QKYA 2XPZA 3NAWA 4WNEA 1SQMA 3MKRA 1ELRA 3QJZA 2MRIA 4CDNA 4GZ6A 2IOLA 3B7BA 4RQIA 2QYJA 4DX6D 1K8KG 3ESLA 3UM3A 3GZSA 3CKBA 4EBAA 4K0RA 4JZYA 3Q73A 4Y6WA 1HO8A 3VTXA 1HU3A 1S0PA 3PEUB 5BXOA 4GA2A 1K1BA 5CBOA 5LCWC 4IRUA 4U7EB 4J8EA 3APFA 3RRMB 4UQYA 1OWOA 2WXOA 3I4GA 1TN8A 3FUIA 2X6KA 1E90A 2PNNA 4GPMA 1DCEA 2V5QC 2GW1A 3CGHA 3Q9UC 4E85A 4HFGA 1B89A 5JJ7A 5CERB 4JB8P 1SA5A 3SBSA 4B94A 3JCKC 2F8YA 2VSOE 3RJVA 4MS6A 2CG3A 1OXJA 3MV2B 2VGEA 3FU5A 4WUYA 2WMNA 3UT4A 4BSZB 1UJJA 3G2SA 3UM0A 2WQHA 4UQZA 4JHJA 2LO6A 4I1OB 3JQ1A 4G8KA 3RO3A 2IU1A 5ENRD 2WXMA 3V79K 4GYYA 5G04C 2BKGA 3U4TA 2E0IA 4M7CA 4U04A 5HQ8A 1IQUA 5IY5E 3LS8A 4ILIA 2IF4A 4N3BA 3D9PA 1OCCE 5CBNA 5KNGA 3SI5A 4X8QA 3D9JA 1QBQA 3ABKE 3ZXPA 2H6GA 1FPPA 4WWPA 2FBNA 2LNIA 2WQ7A 1GW6A 4YDOA 4KT6B 3L54A 1V55E 3LVQE 2QFCA 3S7DA 3RSEG 1YA0A 1N54A 3QDNA 4YDYA 4GA0A 4LUNU 3MYVA 3Q15A 3ULEG 4E6HA 4GTPA 3ABLE 4JVSA 4BETA 4BT8A 5AENA 3DPYA 2LSUA 3DSTA 4I6EA 3V31A 1MJ0A 2WQ6A 3R7RA 1NA3A 2EINE 3PREA 4G11A 2FEZA 4G1TA 3E32A 4ILHB 4K03A 4EBAG 4KZCA 4BSXA 5KJMA 1ELWA 5KJLA 3FEXA 3JUIA 5J08A 5CCLA 3BG1B 2FI7A 3VLDA 1JCRA 4ANUA 3UM1A 4ILGA 3AS5A 2H6FA 2PQRA 1E8YA 3C5RA 4TUMA 1O5MA 2P9UG 2F37A 2UWJG 1N94A 2J8SD 2KZTA 4QFVA 4HB5A 3EIJA 2V4HC 3ASNE 5AAOA 1KZOA 3Q78A 2KCLA 1TEZA 4FU3A 4APOA 3AJIA 2P9LG 3KS2A 1HG5A 1E7UA 3L16A 4J6IA 3EDTB 4PS3A 2H6HA 3QWVA 3CVWA 4HNAD 1KLXA 3AU5A 5E76A 1FT1A 1HS6A 3CEQA 4ACLA 4WNDA 4HRNA 4APFA 4GB9A 3CLJA 5M72A 4U0UA 1EYHA 1UOHA 4UWHA 3L17A 3HIZA 4DX5D 4CCAA 2WB2A 1LD7A 4J0UA 4FULA 2VTBA 3IV0A 3HXCA 3J5PA 4BX9A 3D9MA 4XI9A 2P9PG 1UG3A 3U64A 4KYOB 2I6HA 4CRWA 2DCPA 4F7AA 2P9IG 4GA1A 5KCMA 3SFZA 3ESKA 4U07A 3FUJA 3TWQA 3HDXA 3MA5A 1K1AA 3C3QA 4FLHA 3TWUA 3AG1E 2LXMA 3B7UX 3QOUA 3HXDA 2Y0BG 4YDEA 1H2VC 3NOGD 2J07A 4UI9J 4FADA 2GRMA 5FIOA 3AG2E 2YHCA 4TUUA 1TR4A 3DSWA 1O1RA 4M3OA 3JQ0A 3FEYA 5KJNA 2ILRA 3UIPC 4I9CA 2A4ZA 1O1SA 2GRNB 4N5QA 3U9WA 5C1DA 3FTZA 5A6CA 4MBGA 3ZU7B 4H7YA 5ENNA 5DBKA 3PUKA 2ZXWE 2MHKA 4LEUA 3X2QE 3R7QA 3LJ3A 3OXLA 4LCTA 5D2MC 3FH5A 4RSYA 1PC2A 1IHGA 1QNFA 4JD2G 3UUXA 1RW2A 4OVUA 2WPVA 3TGOA 5E75A 3B7RL 2AXZA 3B7TA 2OV8A 2HR2A 4QQIA 1ZBPA 1QYMA 2B6CA 1SZAA 3D9NA 3CQGB 1U2VG 1IQRA 3PNTB 2IOSA 4FJZA 2VSNA 1H6OA 3W9FA 3ZYMA 3MGBA 3LCAA 4B8AA 3RKVA 3TWTA 3SD5A 4WWOA 5ENTD 4JPSA 2I9CA 2DYRE 4L1BA 4I1AA 5D66A 3FTXA 4RVBA 4NURA 3SFXA 5EILA 5AIJA 2GROB 2EIJE 1BU9A 2IO2C 2DZNA 1D8DA 3CVQA 3FU0A 2P9SG 2L6BA 2X6HA 1MX6A 4GPKA 4FC8A 3RRNB 4ZFHA 3PEVB 3SNXA 3KSQA 2XPIA 3SFYA 4DI3A 5FQ7A 4G23A 3GYZA 3NBNB 4EZLA 1H0AA 4HRLA 2R5SA 3ISMC 4WNGA 3QK0A 4HOUA 4DPRA 4BT9A 5A23A 4JL0A 2OVBA 2Y3AA 3CVVA 4NIKA 3CVNA 4DLOA 4L7TA 1OT8A
chains in the Genus database with same CATH topology
3DSTA 3HXBA 4L9PA 4LNGA 1NI1A 1FT2A 1TNBA 3HXCA 3E32A 3PZ1A 2IEJA 1N95A 2BEDA 3HXFA 1N9AA 1JCSA 1TNZA 3DSXA 2R2LA 4GTMA 1TN6A 1LTXA 1S63A 4LNBA 1JCRA 1S64A 1NL4A 1TNUA 2H6FA 3DSSA 3E37A 3DSUA 3E30A 3PZ4A 1O5MA 1N4RA 3Q75A 3E33A 1N94A 1SA4A 3HXDA 1KZPA 3SFXA 1TN7A 4YDEA 4EHMA 1O1TA 1N4SA 3EU5A 1N4QA 1D8DA 3DRAA 3PZ3A 1KZOA 3Q78A 2ZIRA 3Q73A 1QBQA 2H6GA 1FPPA 4GTVA 3DSVA 1LD8A 3DSWA 1TNOA 4YDOA 1O1RA 2H6HA 3Q79A 4GTOA 2F0YA 1TNYA 1X81A 1MZCA 3KSQA 1O1SA 3SFYA 3PZ2A 1TN8A 3Q7AA 1D8EA 3E34A 4GTRA 1FT1A 3KSLA 1JCQA 4GTQA 4MBGA 1DCEA 3HXEA 4GTTA 1N4PA 3Q7FA 4GTPA 2ZISA 2H6IA 4GTSA 3DPYA 1SA5A 3EUVA 1LD7A 3C72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DST A;  3HXB A;  4L9P A;  4LNG A;  1NI1 A;  1FT2 A;  1TNB A;  3HXC A;  3E32 A;  3PZ1 A;  2IEJ A;  1N95 A;  2BED A;  3HXF A;  1N9A A;  1JCS A;  1TNZ A;  3DSX A;  2R2L A;  4GTM A;  1TN6 A;  1LTX A;  1S63 A;  4LNB A;  1JCR A;  1S64 A;  1NL4 A;  1TNU A;  2H6F A;  3DSS A;  3E37 A;  3DSU A;  3E30 A;  3PZ4 A;  1O5M A;  1N4R A;  3Q75 A;  3E33 A;  1N94 A;  1SA4 A;  3HXD A;  1KZP A;  3SFX A;  1TN7 A;  4YDE A;  4EHM A;  1O1T A;  1N4S A;  3EU5 A;  1N4Q A;  1D8D A;  3DRA A;  3PZ3 A;  1KZO A;  3Q78 A;  2ZIR A;  3Q73 A;  1QBQ A;  2H6G A;  1FPP A;  4GTV A;  3DSV A;  1LD8 A;  3DSW A;  1TNO A;  4YDO A;  1O1R A;  2H6H A;  3Q79 A;  4GTO A;  2F0Y A;  1TNY A;  1X81 A;  1MZC A;  3KSQ A;  1O1S A;  3SFY A;  3PZ2 A;  1TN8 A;  3Q7A A;  1D8E A;  3E34 A;  4GTR A;  1FT1 A;  3KSL A;  1JCQ A;  4GTQ A;  4MBG A;  1DCE A;  3HXE A;  4GTT A;  1N4P A;  3Q7F A;  4GTP A;  2ZIS A;  2H6I A;  4GTS A;  3DPY A;  1SA5 A;  3EUV A;  1LD7 A;  3C72 A; 
#chains in the Genus database with same CATH topology
 3HXB A;  4XX5 A;  3UTM A;  4AOF A;  3CKC A;  3TWX A;  4GZC A;  3UM2 A;  3ML9 A;  2E2E A;  1JWG A;  4BER A;  3L6A A;  4UUC A;  1Q2Z A;  3HXF A;  3N71 A;  4OYS A;  3MV3 B;  3OXF A;  1N0R A;  4U0S A;  2WXQ A;  3JXJ A;  1EDU A;  2GRP B;  4ANW A;  2X6J A;  4J8D A;  3IBE A;  2QZA A;  4JEH A;  5BUZ A;  3NQP A;  1UN9 A;  5AQ9 A;  3TWR A;  4PS7 A;  3MEK A;  4RG6 A;  3B13 A;  3TAX A;  1WG0 A;  1TN7 A;  4AJW A;  3ASO E;  2L0T B;  2RFA A;  4CGV A;  3UKU G;  3FUM A;  2XQ0 A;  4CGW A;  5CRV A;  4XKC A;  5CCM A;  1N52 A;  3FWV A;  5FTP A;  3G2T A;  5EIB E;  1BLX B;  2UY1 A;  2HYZ A;  1HF8 A;  3ZXS A;  3IXE A;  5AAR A;  4N2Q A;  2J9Q A;  3LXU X;  5DIZ A;  3ZVV A;  1WAO 1;  1DCQ A;  3D9O A;  4PDX A;  5EYP F;  2H6I A;  4KBQ A;  3Q5M A;  2DBA A;  4A3T A;  4KZ0 A;  3FU6 A;  3MJW A;  3O4Z A;  3FY4 A;  1A5E A;  1HE8 A;  4I2W A;  3B95 A;  1VDY A;  5HKP A;  3ZPJ A;  1WY6 A;  1INZ A;  2XS1 A;  3QWP A;  5BV1 A;  4J8S A;  2BF0 X;  4HOT A;  2WXL A;  1ZB1 A;  3ASF A;  2OVF A;  3CK9 A;  3ONL A;  3SBT B;  3ZNG A;  2VGX B;  3U66 A;  3UIO C;  2KM4 A;  4GU5 A;  2GRL A;  5ENS D;  4CZ2 D;  2V0P A;  3FU3 A;  3BU8 A;  5A7D B;  4JW1 A;  4AP2 A;  5B3S E;  1N4S A;  3EU5 A;  3PZ3 A;  2RG8 A;  3MX3 A;  5T3R A;  1QZ2 A;  2YQ8 A;  3UT7 A;  3TL5 A;  2ETA A;  2X6F A;  4DJA A;  2GRR B;  1FVF A;  2AXV A;  1HZ4 A;  3CV0 A;  4B8C B;  4P29 A;  4OAU C;  3UT8 A;  4U8Y D;  1D8E A;  2VJ8 A;  3ASH A;  3G2V A;  4AIF A;  2XS8 A;  3T5X A;  3MZL B;  2B0O E;  3SQV A;  1K3Z D;  3HVE B;  4DK5 A;  3L08 A;  2V5F A;  3ONK A;  4A55 A;  5CRU A;  3FUF A;  2I2O A;  5ANR A;  4A63 B;  1NI1 A;  2YNQ A;  3VLE A;  3SO8 A;  2VSX E;  3KD7 A;  2DIW A;  3TJP A;  1BD8 A;  3D9L A;  5JHA A;  2NC9 A;  4YDW A;  1LTX A;  2RKK A;  3EHM A;  3EHN A;  1S63 A;  3HRA A;  2WMO A;  2C0M A;  2BKK B;  1P5Q A;  3PRZ A;  3ZW3 A;  5FQ4 A;  3FHE A;  4I9E A;  2MYO A;  5FQ6 A;  3NZU A;  2Q7F A;  3CHS A;  4DI4 A;  2XCC A;  1FCH A;  3G2U A;  1JWF A;  3JYS A;  4EPZ A;  1N4Q A;  4GMJ A;  3EIQ C;  4HI8 A;  2OOE A;  3EJN A;  1H19 A;  4KVM A;  3D9I A;  3CVX A;  1RZ4 A;  1X81 A;  4DUI A;  3PZ2 A;  4O60 A;  4PH4 B;  3ZYL A;  2XZT G;  1YMP A;  5LFA A;  4Q94 A;  3AG3 E;  1N4P A;  2XRY A;  3D3M A;  1LF8 A;  3P1U A;  3C3R A;  3EUV A;  2DVW A;  4KVO A;  3C72 A;  3PS6 A;  3JXI A;  3DEP A;  5KNH D;  3APC A;  4LNG A;  3PZ1 A;  3AU4 A;  5CMY A;  4HOR A;  5AQ7 A;  4BY6 A;  4HLL A;  2BUG A;  3D9H A;  4JHK A;  3I4R B;  2RD0 A;  3ASG A;  4K5A B;  4HOS A;  4MLP A;  1XGW A;  5FT9 A;  1E8Z A;  3C98 A;  4ABN A;  4O1P A;  2KBX A;  1WM5 A;  4CT0 A;  4L2L A;  4WNF A;  3V2O A;  1NL4 A;  2VGY A;  3E37 A;  4B0Z A;  4A1S A;  1DNP A;  1H2U A;  3RK6 A;  4Q96 A;  4MRU A;  5KWD A;  3GZ1 A;  4GCO A;  3TWS A;  4J8F A;  1MYO A;  3MKQ B;  2OEW A;  2EIM E;  3L22 A;  4GZD A;  4U63 A;  3ML8 A;  4B93 B;  3WG7 E;  3LVR E;  5FJY A;  1EPU A;  3DEO A;  3C3O A;  2AJA A;  5EN5 D;  2Y4T A;  4U96 D;  4UWF A;  4ATG A;  4I2Z A;  3TG4 A;  3ZRH A;  2ZIS A;  4TXQ A;  4G2V A;  4F3V A;  2AWI A;  3PNL B;  1Z3Y A;  3NB2 A;  1HFA A;  3LDZ A;  1TYQ G;  4XIF A;  2IY0 C;  3FFL A;  4CDM A;  1MQS A;  4AM9 A;  2CHW A;  2KXP C;  1N95 A;  2BED A;  4DX7 D;  2VSY A;  1Z5S C;  2V4L A;  4HLE A;  4UWK A;  2CG2 A;  3BUA A;  1HG2 A;  3ZYQ A;  2AXU A;  4HS2 A;  5KJK A;  3IHV A;  1QQE A;  2CHX A;  3CHQ A;  4FHJ A;  3FTY A;  2L0I A;  2ZU6 B;  1S70 B;  4CEM A;  3QWW A;  4UI9 C;  1OWN A;  5AQA A;  3ULQ A;  1NP7 A;  4PUC A;  2XCB A;  4BWR A;  4Z68 A;  4CDR A;  3CHP A;  5H7P A;  5B1B E;  2WXG A;  2WXH A;  4UI9 K;  1JUQ A;  3Q9N C;  3FH7 A;  3R9A B;  3Q49 B;  4K5B A;  5EX0 A;  3DXK G;  4GAA A;  2WXN A;  2OND A;  2JLB A;  3FUL A;  4EEC A;  2YIN A;  3ZHE B;  4AV7 A;  3D9K A;  1Y8M A;  3E34 A;  4GTR A;  4ZHB A;  4BEP A;  4XI0 A;  1IKN D;  1HX8 A;  4JC8 A;  4UQX A;  4N5C A;  4FJY A;  4EQF A;  2V8S E;  4G26 A;  2IFU A;  3ZIM A;  4U0Z A;  4BX8 A;  4G24 A;  4DRX E;  2J4B A;  3ZN3 A;  3KEZ A;  5CED B;  4L9P A;  4R7L A;  1BI8 B;  3DXM G;  5FWQ A;  3ZUV B;  2J09 A;  3ZGQ A;  5HI7 A;  3EHQ A;  4URK A;  2X6I A;  2FO7 A;  4J7W A;  3PDN A;  2R2L A;  5ARG A;  2EIK E;  4O1O A;  2XZD G;  5ENP D;  3TXN A;  1U3D A;  4OAV B;  4BTB A;  3ASD A;  2Y4U A;  3LY9 A;  4FHK A;  3DBS A;  1S64 A;  3DWL G;  5LX8 A;  3CR3 A;  3RU0 A;  3DSS A;  2Y69 E;  4GZ5 A;  3FUE A;  1EF1 C;  4B89 A;  3T5V A;  1SA4 A;  4N3A A;  4IN3 B;  2WXR A;  4HRM B;  3DRA A;  3LY8 A;  3CVY A;  2QY7 A;  3NF1 A;  4BFR A;  3AS4 A;  3IEG A;  1BI7 B;  3UPV A;  2XGS A;  2LXL A;  2HM8 A;  5FZR A;  3PH0 C;  4JXT A;  4NAC A;  3OAW A;  3NZS A;  2C2L A;  3PVL A;  4GYO A;  3GW4 A;  4AY5 A;  3Q7A A;  4ANV A;  5LOZ A;  4BES A;  3Q47 B;  1AP7 A;  2I1K A;  1OCR E;  5BNW A;  2P9N G;  4GTT A;  3EHR A;  4LG6 A;  3APD A;  3QC1 A;  2PQN A;  4HXI A;  4GML A;  5CHE E;  4F1P A;  1OWP A;  2AW6 A;  1E7V A;  2MOW A;  1UN8 A;  3HG0 D;  1FT2 A;  5BW8 C;  3CK7 A;  2VYI A;  2XRZ A;  4EZJ A;  4I6J A;  4FA6 A;  3CHR A;  3CHM A;  1E8W A;  3UMV A;  4TRQ A;  2WXF A;  3S7J A;  3DSU A;  2PM7 A;  3PZ4 A;  4ME2 A;  3FUK A;  4PS8 A;  2J49 A;  3KEA A;  5G04 J;  2DWZ A;  4OVV A;  4H7X A;  3R9M A;  3G2W A;  5HS0 A;  3CVU A;  4TV3 A;  4EHM A;  1O1T A;  4LSZ E;  5ENO D;  4AVX A;  4WWN A;  3URZ A;  3DSV A;  1Z3X A;  2XEV A;  4C0E A;  3FDH A;  3UXG A;  1TNO A;  2R59 A;  3RO2 A;  4O6F A;  1SVX A;  4N2S A;  4U95 D;  4KXK B;  5D0Q D;  1TNY A;  5FZS A;  1N0Q A;  2ION A;  3QNK A;  2XGO A;  2JEK A;  1Y6I A;  4GTQ A;  4BTA A;  5KBA A;  1OCZ E;  3O48 A;  4JHR A;  5C2Y A;  3B7S A;  3BQO A;  4L2Y A;  2LSV A;  4FP7 A;  4AEZ C;  1MHQ A;  2WXK A;  3IKO B;  1KPS B;  4HI9 A;  3UKR G;  2EQX A;  4DX2 A;  4GCN A;  2YHE A;  1ZU2 A;  3L9T A;  4UWG A;  2WXJ A;  2IEJ A;  4HOQ A;  3TXM A;  3E4B A;  4A3V A;  2KZT B;  5LP0 A;  3AS8 A;  3W9G A;  2BTD A;  2DYS E;  1WDY A;  3FTW A;  2R02 A;  1TJC A;  3Q75 A;  4ATZ D;  5JJT A;  2M63 A;  3E33 A;  2FO1 E;  4GMR A;  4JA7 A;  2VGX A;  3S7F A;  2OEV A;  3ULY A;  3SF4 A;  2A5U A;  3MCX A;  2WXP A;  3VTY A;  3ABM E;  2WVI A;  3L82 A;  3PZD A;  1HH8 A;  3FUD A;  1SW6 A;  3V2X A;  4RG9 A;  3GZ2 A;  1YCS B;  4F1S A;  1V54 E;  4CYM D;  2ZGG A;  3P2B A;  4KMO A;  2NXP A;  3QB2 A;  3AG4 E;  3CIA A;  3LYA A;  3TWW A;  2VTB B;  5B1A E;  4G8L A;  3PE4 A;  2HE0 A;  3Q7F A;  4ANX A;  2J08 A;  2XEN A;  1H2T C;  3SZ7 A;  2PM6 A;  2L9B A;  3RIB A;  4D10 C;  1G3N B;  2WM9 A;  2LUH A;  2JAB A;  3S2A A;  1DVP A;  1PY1 A;  2P2C P;  2VQ2 A;  1MX2 A;  1FVH A;  3HVE A;  1JCS A;  3LPZ A;  4L23 A;  1U3C A;  3FP3 A;  1MX4 A;  3CQC B;  4WAF A;  1NA0 A;  4N3C A;  2NSZ A;  1UW4 B;  2F8X K;  2IJG X;  2OCC E;  2WXI A;  1TNU A;  3SHF A;  1NZN A;  5G55 A;  4TXP A;  5BXU A;  1N4R A;  3ENE A;  4NQ0 A;  5J90 A;  3V30 A;  3T8M A;  3ZFW A;  3FTU A;  2NYJ A;  3JUE A;  5CEC B;  5FIN A;  4V3I A;  4I1M A;  5EX3 A;  2KC7 A;  2DZO A;  2ZIR A;  3FUH A;  1KT0 A;  3HHM A;  4Q69 A;  4GTV A;  3ZYK A;  1LD8 A;  4GYW A;  5AJL A;  5G05 J;  5JMN D;  4GTO A;  5AJD A;  3ZKJ A;  4FLB A;  1NFI E;  3I3N A;  3CK8 A;  5JHB A;  1E8X A;  3CST A;  3CVP A;  3KSL A;  4Y6C A;  1BPO A;  2IO3 C;  3HXE A;  3SGH A;  1IXV A;  4NRH B;  3U3W A;  4HVB A;  4G25 A;  4XEI G;  5G2N A;  1L5J A;  1XNF A;  2QC9 A;  2CHZ A;  4GTS A;  4UWL A;  1OWM A;  2P58 C;  3DPD A;  4YVO A;  4I17 A;  4CT4 A;  1H6K A;  5JJ6 A;  4LER A;  4A1G A;  3UIN C;  4LRZ A;  1TNB A;  3K9I A;  2XHE A;  2GRQ B;  4U8H A;  2ZGD A;  4AXH A;  3WXX A;  1N11 A;  2ETC A;  4XE0 A;  3BG0 B;  5D0O D;  4JEU A;  1KT1 A;  3CSF A;  5G05 C;  1OCO E;  2P9K G;  4MKT A;  5FQ8 A;  5AYW D;  1A17 A;  3VLF A;  3E30 A;  4GZ3 A;  3CVL A;  5ANL A;  3PE3 A;  3TWV A;  5BPP A;  2LAH A;  3LY7 A;  3UQ3 A;  5CMW A;  5AQB A;  1HXI A;  3LKU A;  5EKQ D;  3Q79 A;  2J4D A;  2F0Y A;  5ENQ D;  2QYU A;  1MZC A;  5JA4 D;  2XPY A;  1OWL A;  4ACK A;  3MKQ A;  1DC2 A;  3F6Q A;  1IHB A;  3LEW A;  3AAA C;  2CFZ A;  2Y1L E;  2A5E A;  1H6P A;  3T8K A;  2X38 A;  4XKB A;  3FTS A;  5EDS A;  2KCV A;  2FF4 A;  3PUJ A;  1PAQ A;  1AWC B;  3TG5 A;  2LAI A;  4W9R A;  4AY6 A;  5CEA A;  3BEE A;  5HRY A;  1W3B A;  4HBD A;  4IUL A;  2IQC A;  3FUN A;  1N9A A;  3J5Q B;  4C48 B;  3DSX A;  1YYH A;  3IHY A;  2AVP A;  3NOC D;  2R17 C;  3I5P A;  4F6R D;  4TXR A;  3QAQ A;  2C0L A;  2R03 A;  2KCK A;  2PL2 A;  5T8I A;  3RAU A;  2PZI A;  4XZ4 A;  2R05 A;  5ARF A;  3KAE A;  1KZP A;  3EU9 A;  1X5B A;  3UX4 A;  4EZK A;  2UY1 B;  5FZQ A;  3UI2 A;  4C0M A;  1D9S A;  3CHO A;  5BV0 A;  4F53 A;  4C9B B;  2CFU A;  1UJK A;  4HQD A;  4DLQ A;  2ETB A;  4IYP A;  2X3M A;  2XEH A;  3OTN A;  3OXG A;  5EYL A;  4I6G A;  5EID A;  2XGM A;  4YND A;  1ELK A;  4N39 A;  4U8V D;  2HO1 A;  1IYG A;  1JCQ A;  2KAT A;  3SY2 A;  3L13 A;  4I43 A;  2EIL E;  2GGF A;  1JPL A;  2RFM A;  4J8Y A;  4LNU D;  1OY3 D;  4RLY A;  2L6J A;  4JA9 A;  2FUL A;  3RRU A;  3T9K A;  3HYM B;  3ZHE A;  5BT1 A;  5LCW J;  3LJN A;  5T4Y A;  4LNB A;  2I1J A;  3QAR A;  4DX1 A;  2XEE A;  1Z6T A;  1SZ9 A;  1OUV A;  3Q4A B;  4YVQ C;  1E96 B;  3FH8 A;  3FTV A;  1TJF A;  1TNZ A;  5AN8 A;  4GTM A;  3ZEF A;  1TN6 A;  5ITZ F;  3S7B A;  4K5C A;  3QKY A;  2XPZ A;  3NAW A;  4WNE A;  1SQM A;  3MKR A;  1ELR A;  3QJZ A;  2MRI A;  4CDN A;  4GZ6 A;  2IOL A;  3B7B A;  4RQI A;  2QYJ A;  4DX6 D;  1K8K G;  3ESL A;  3UM3 A;  3GZS A;  3CKB A;  4EBA A;  4K0R A;  4JZY A;  3Q73 A;  4Y6W A;  1HO8 A;  3VTX A;  1HU3 A;  1S0P A;  3PEU B;  5BXO A;  4GA2 A;  1K1B A;  5CBO A;  5LCW C;  4IRU A;  4U7E B;  4J8E A;  3APF A;  3RRM B;  4UQY A;  1OWO A;  2WXO A;  3I4G A;  1TN8 A;  3FUI A;  2X6K A;  1E90 A;  2PNN A;  4GPM A;  1DCE A;  2V5Q C;  2GW1 A;  3CGH A;  3Q9U C;  4E85 A;  4HFG A;  1B89 A;  5JJ7 A;  5CER B;  4JB8 P;  1SA5 A;  3SBS A;  4B94 A;  3JCK C;  2F8Y A;  2VSO E;  3RJV A;  4MS6 A;  2CG3 A;  1OXJ A;  3MV2 B;  2VGE A;  3FU5 A;  4WUY A;  2WMN A;  3UT4 A;  4BSZ B;  1UJJ A;  3G2S A;  3UM0 A;  2WQH A;  4UQZ A;  4JHJ A;  2LO6 A;  4I1O B;  3JQ1 A;  4G8K A;  3RO3 A;  2IU1 A;  5ENR D;  2WXM A;  3V79 K;  4GYY A;  5G04 C;  2BKG A;  3U4T A;  2E0I A;  4M7C A;  4U04 A;  5HQ8 A;  1IQU A;  5IY5 E;  3LS8 A;  4ILI A;  2IF4 A;  4N3B A;  3D9P A;  1OCC E;  5CBN A;  5KNG A;  3SI5 A;  4X8Q A;  3D9J A;  1QBQ A;  3ABK E;  3ZXP A;  2H6G A;  1FPP A;  4WWP A;  2FBN A;  2LNI A;  2WQ7 A;  1GW6 A;  4YDO A;  4KT6 B;  3L54 A;  1V55 E;  3LVQ E;  2QFC A;  3S7D A;  3RSE G;  1YA0 A;  1N54 A;  3QDN A;  4YDY A;  4GA0 A;  4LUN U;  3MYV A;  3Q15 A;  3ULE G;  4E6H A;  4GTP A;  3ABL E;  4JVS A;  4BET A;  4BT8 A;  5AEN A;  3DPY A;  2LSU A;  3DST A;  4I6E A;  3V31 A;  1MJ0 A;  2WQ6 A;  3R7R A;  1NA3 A;  2EIN E;  3PRE A;  4G11 A;  2FEZ A;  4G1T A;  3E32 A;  4ILH B;  4K03 A;  4EBA G;  4KZC A;  4BSX A;  5KJM A;  1ELW A;  5KJL A;  3FEX A;  3JUI A;  5J08 A;  5CCL A;  3BG1 B;  2FI7 A;  3VLD A;  1JCR A;  4ANU A;  3UM1 A;  4ILG A;  3AS5 A;  2H6F A;  2PQR A;  1E8Y A;  3C5R A;  4TUM A;  1O5M A;  2P9U G;  2F37 A;  2UWJ G;  1N94 A;  2J8S D;  2KZT A;  4QFV A;  4HB5 A;  3EIJ A;  2V4H C;  3ASN E;  5AAO A;  1KZO A;  3Q78 A;  2KCL A;  1TEZ A;  4FU3 A;  4APO A;  3AJI A;  2P9L G;  3KS2 A;  1HG5 A;  1E7U A;  3L16 A;  4J6I A;  3EDT B;  4PS3 A;  2H6H A;  3QWV A;  3CVW A;  4HNA D;  1KLX A;  3AU5 A;  5E76 A;  1FT1 A;  1HS6 A;  3CEQ A;  4ACL A;  4WND A;  4HRN A;  4APF A;  4GB9 A;  3CLJ A;  5M72 A;  4U0U A;  1EYH A;  1UOH A;  4UWH A;  3L17 A;  3HIZ A;  4DX5 D;  4CCA A;  2WB2 A;  1LD7 A;  4J0U A;  4FUL A;  2VTB A;  3IV0 A;  3HXC A;  3J5P A;  4BX9 A;  3D9M A;  4XI9 A;  2P9P G;  1UG3 A;  3U64 A;  4KYO B;  2I6H A;  4CRW A;  2DCP A;  4F7A A;  2P9I G;  4GA1 A;  5KCM A;  3SFZ A;  3ESK A;  4U07 A;  3FUJ A;  3TWQ A;  3HDX A;  3MA5 A;  1K1A A;  3C3Q A;  4FLH A;  3TWU A;  3AG1 E;  2LXM A;  3B7U X;  3QOU A;  3HXD A;  2Y0B G;  4YDE A;  1H2V C;  3NOG D;  2J07 A;  4UI9 J;  4FAD A;  2GRM A;  5FIO A;  3AG2 E;  2YHC A;  4TUU A;  1TR4 A;  3DSW A;  1O1R A;  4M3O A;  3JQ0 A;  3FEY A;  5KJN A;  2ILR A;  3UIP C;  4I9C A;  2A4Z A;  1O1S A;  2GRN B;  4N5Q A;  3U9W A;  5C1D A;  3FTZ A;  5A6C A;  4MBG A;  3ZU7 B;  4H7Y A;  5ENN A;  5DBK A;  3PUK A;  2ZXW E;  2MHK A;  4LEU A;  3X2Q E;  3R7Q A;  3LJ3 A;  3OXL A;  4LCT A;  5D2M C;  3FH5 A;  4RSY A;  1PC2 A;  1IHG A;  1QNF A;  4JD2 G;  3UUX A;  1RW2 A;  4OVU A;  2WPV A;  3TGO A;  5E75 A;  3B7R L;  2AXZ A;  3B7T A;  2OV8 A;  2HR2 A;  4QQI A;  1ZBP A;  1QYM A;  2B6C A;  1SZA A;  3D9N A;  3CQG B;  1U2V G;  1IQR A;  3PNT B;  2IOS A;  4FJZ A;  2VSN A;  1H6O A;  3W9F A;  3ZYM A;  3MGB A;  3LCA A;  4B8A A;  3RKV A;  3TWT A;  3SD5 A;  4WWO A;  5ENT D;  4JPS A;  2I9C A;  2DYR E;  4L1B A;  4I1A A;  5D66 A;  3FTX A;  4RVB A;  4NUR A;  3SFX A;  5EIL A;  5AIJ A;  2GRO B;  2EIJ E;  1BU9 A;  2IO2 C;  2DZN A;  1D8D A;  3CVQ A;  3FU0 A;  2P9S G;  2L6B A;  2X6H A;  1MX6 A;  4GPK A;  4FC8 A;  3RRN B;  4ZFH A;  3PEV B;  3SNX A;  3KSQ A;  2XPI A;  3SFY A;  4DI3 A;  5FQ7 A;  4G23 A;  3GYZ A;  3NBN B;  4EZL A;  1H0A A;  4HRL A;  2R5S A;  3ISM C;  4WNG A;  3QK0 A;  4HOU A;  4DPR A;  4BT9 A;  5A23 A;  4JL0 A;  2OVB A;  2Y3A A;  3CVV A;  4NIK A;  3CVN A;  4DLO A;  4L7T A;  1OT8 A; 
#chains in the Genus database with same CATH homology
 3DST A;  3HXB A;  4L9P A;  4LNG A;  1NI1 A;  1FT2 A;  1TNB A;  3HXC A;  3E32 A;  3PZ1 A;  2IEJ A;  1N95 A;  2BED A;  3HXF A;  1N9A A;  1JCS A;  1TNZ A;  3DSX A;  2R2L A;  4GTM A;  1TN6 A;  1LTX A;  1S63 A;  4LNB A;  1JCR A;  1S64 A;  1NL4 A;  1TNU A;  2H6F A;  3DSS A;  3E37 A;  3DSU A;  3E30 A;  3PZ4 A;  1O5M A;  1N4R A;  3Q75 A;  3E33 A;  1N94 A;  1SA4 A;  3HXD A;  1KZP A;  3SFX A;  1TN7 A;  4YDE A;  4EHM A;  1O1T A;  1N4S A;  3EU5 A;  1N4Q A;  1D8D A;  3DRA A;  3PZ3 A;  1KZO A;  3Q78 A;  2ZIR A;  3Q73 A;  1QBQ A;  2H6G A;  1FPP A;  4GTV A;  3DSV A;  1LD8 A;  3DSW A;  1TNO A;  4YDO A;  1O1R A;  2H6H A;  3Q79 A;  4GTO A;  2F0Y A;  1TNY A;  1X81 A;  1MZC A;  3KSQ A;  1O1S A;  3SFY A;  3PZ2 A;  1TN8 A;  3Q7A A;  1D8E A;  3E34 A;  4GTR A;  1FT1 A;  3KSL A;  1JCQ A;  4GTQ A;  4MBG A;  1DCE A;  3HXE A;  4GTT A;  1N4P A;  3Q7F A;  4GTP A;  2ZIS A;  2H6I A;  4GTS A;  3DPY A;  1SA5 A;  3EUV A;  1LD7 A;  3C72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...