2ZISA

Crystal structure of rat protein farnesyltransferase complexed with a bezoruran inhibitor and fpp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and structure-activity relationships of novel benzofuran farnesyltransferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase subunit alpha
total genus 124
structure length 314
sequence length 314
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2zisA00
1N4SA 1O1TA 1TN7A 1S64A 4MBGA 3HXDA 2R2LA 4YDEA 1QBQA 3Q79A 3Q78A 3DSVA 1KZOA 2F0YA 3PZ4A 3DPYA 1TNYA 3Q7FA 1FT2A 3HXFA 4LNBA 1D8DA 4GTSA 4L9PA 1N95A 2ZISA 3C72A 3E34A 3PZ3A 1LTXA 1TNZA 3KSLA 4YDOA 1KZPA 3DSSA 1TN8A 1JCQA 3DSUA 1SA4A 1D8EA 3HXEA 3Q7AA 4GTOA 3HXBA 1JCRA 1TNUA 1DCEA 1N94A 2IEJA 3KSQA 1TN6A 1FPPA 3DRAA 3PZ1A 3DSTA 1JCSA 3HXCA 1SA5A 1LD8A 1O1SA 3PZ2A 1TNBA 4GTMA 2H6IA 3Q73A 1LD7A 2H6GA 2BEDA 4GTTA 3Q75A 3EU5A 2H6HA 2H6FA 3E33A 3SFXA 3E37A 3E30A 3DSWA 1MZCA 3DSXA 1FT1A 1X81A 4EHMA 1N9AA 3SFYA 1N4PA 4GTRA 1N4RA 3E32A 1NI1A 1O1RA 1O5MA 1TNOA 4LNGA 2ZIRA 4GTPA 1N4QA 4GTVA 1S63A 3EUVA 4GTQA 1NL4A
chains in the Genus database with same CATH superfamily
4C0MA 2UWJG 2LSVA 3TAXA 1TN7A 2Y4TA 4XE0A 2R2LA 4EZLA 2KZTB 2BKKB 1OY3D 2CFUA 1W3BA 3C98A 3ONKA 3FH8A 2ZXWE 5T3RA 3FULA 1TNYA 3Q5MA 3CHPA 4GZ3A 2J07A 5KJLA 3ASFA 1S70B 2XEEA 1E8WA 3SBTB 4AIFA 2FO7A 2V5QC 4J8FA 4WNDA 2WXKA 3FEYA 4KMOA 4KZ0A 4HLLA 4B89A 1A17A 1U3CA 2NSZA 4BX8A 4AY5A 4AEZC 3ABLE 3KSQA 1TN6A 4UQZA 2IO3C 5JJ7A 3ZU7B 3LKUA 3UX4A 1ZBPA 3GW4A 3IEGA 3PS6A 2EINE 4M7CA 2KCKA 4LEUA 2P9PG 1UOHA 1E7UA 3FUJA 2XZDG 3SF4A 4I2ZA 3CHSA 1OUVA 4YVOA 2XRYA 1XGWA 5AIJA 4ILGA 5KJKA 2QZAA 4IRUA 5JJ6A 3UI2A 3VLFA 2CHWA 4C0EA 4MKTA 3MA5A 3V31A 3FU0A 3BQOA 4PS8A 3FY4A 4U7EB 2KZTA 3MZLB 3HIZA 1SW6A 4K5AB 2B6CA 3FUNA 4IULA 1D8DA 3ZKJA 3JUIA 4LERA 2P9LG 3TG5A 2LAHA 4TXRA 1YYHA 3CHMA 3FTZA 5EKQD 1TN8A 1SZAA 3ZGQA 5FTPA 4WWOA 4N39A 3L54A 5J08A 4XI0A 5AQ9A 2IEJA 5ANLA 3L82A 2NC9A 3D9LA 3V79K 1PY1A 3C5RA 3RAUA 1EDUA 3RRNB 2BEDA 4MLPA 5BW8C 3UXGA 2IO2C 2H6FA 2ONDA 4RG9A 2PM7A 2WXIA 3T5VA 3W9FA 3QDNA 3D9OA 3UM1A 2WXPA 3L16A 3TG4A 2VSOE 3APDA 4LNGA 4OYSA 1TNOA 1TJFA 3ZHEB 4NQ0A 3LEWA 4JXTA 4GTPA 5D66A 1YMPA 4EZJA 4U8YD 3VLEA 4CDRA 3CK7A 4GTQA 2OVFA 4UWKA 4WNGA 2X38A 4Y6CA 1S64A 4CT4A 3URZA 5A23A 4IYPA 3ZFWA 3G2SA 5FQ8A 2XRZA 4LRZA 2KBXA 2VTBB 2AVPA 1IHBA 1E96B 3IV0A 5ANRA 3CVUA 3LJ3A 3GZSA 2GRLA 3S7BA 1S0PA 2ILRA 2X6KA 4PS3A 3FU3A 3TGOA 4LUNU 3CVVA 4RQIA 4J8EA 4BSXA 1EYHA 3UM0A 1QQEA 2MRIA 3ASDA 2DCPA 3MV3B 5D2MC 2IONA 3FU6A 3T5XA 3PNLB 2KCLA 3Q9UC 4XZ4A 3C3QA 5AENA 3JQ1A 5CERB 3DRAA 1ZB1A 4I2WA 5EYPF 3O48A 3LDZA 2KXPC 3TWVA 4HRMB 3D9HA 4ATGA 2LSUA 3TWXA 3SNXA 1MZCA 3T8KA 4GZ6A 4R7LA 1ELWA 3FTXA 3P1UA 4FLBA 2RFAA 3ZHEA 3Q9NC 1O5MA 5ARFA 4L2LA 2GW1A 3DWLG 3KD7A 5LCWJ 3VTYA 2FULA 4TV3A 3FUKA 5FQ7A 3UPVA 2YHEA 3CHRA 1TYQG 4I1MA 4ILIA 1OWLA 4HORA 4LSZE 4F3VA 1P5QA 4J8DA 2VTBA 4ME2A 2WXOA 3CVXA 3FWVA 3ZYMA 4N3AA 3DPYA 5CRUA 4TRQA 5BT1A 1FT2A 3Q4AB 2PQNA 4UQYA 2PM6A 4F7AA 1ELRA 3JQ0A 4YDOA 3FDHA 4BSZB 2F8YA 4K5BA 2EIME 3QKYA 1WDYA 3QWVA 1WY6A 3ZYLA 4HLEA 5HS0A 3RO2A 3NOGD 4JHRA 2WXHA 1V55E 2VSNA 3HVEB 4A63B 1TJCA 4CRWA 1UG3A 4XI9A 1N11A 2VGXA 5FZQA 5KWDA 1K1BA 2H6GA 3JXJA 2HM8A 3CKBA 4W9RA 3DPDA 3X2QE 2FO1E 3ULEG 3D9IA 3DSWA 3PE3A 5G04J 2Q7FA 3RJVA 4G24A 4LG6A 1O1RA 2GRQB 2J4BA 3CEQA 4ZFHA 3LVRE 1HF8A 3D9PA 1S63A 5BXUA 3OXFA 3CV0A 2WQ7A 3WG7E 4GA2A 3LCAA 3TWSA 3NBNB 4BERA 3RRUA 4RVBA 3MYVA 4XKCA 3CLJA 1UN9A 4EQFA 3CK9A 4YDEA 1QBQA 2V4HC 2P9SG 3PREA 1U2VG 2V8SE 3ASHA 3LXUX 1KT0A 3RRMB 5FT9A 3UKRG 4BTBA 4U0ZA 3C3OA 2DZNA 3BU8A 4UWLA 3WXXA 1HG5A 2WXFA 3EU9A 5AAOA 2Y4UA 5BNWA 2AXZA 5LP0A 3SD5A 3J5QB 5JHAA 3PZ3A 2LNIA 3HYMB 2AXVA 2HR2A 3UKUG 3KEAA 2AJAA 1TR4A 3TWWA 3MX3A 3LY8A 3MV2B 4BEPA 3ML9A 2E2EA 1OWPA 3SQVA 2R02A 4TXPA 3DXKG 3UT4A 4C9BB 3L13A 3EIQC 4J6IA 4UWHA 2Y69E 5H7PA 3BUAA 3PEUB 5A6CA 4DX1A 4H7YA 4WWNA 4XEIG 5CBOA 4HI9A 2XCBA 2YHCA 3LYAA 2WXJA 1OCRE 1FT1A 3FP3A 2RFMA 4EHMA 2KATA 5G2NA 2LAIA 3MCXA 1TEZA 2DYSE 3FUEA 3PRZA 2I1JA 1VDYA 2MOWA 2PQRA 2E0IA 4G2VA 5IY5E 2XS8A 4LCTA 3CVWA 1SQMA 1H6OA 1Z3XA 4APFA 1NL4A 4GPMA 2V5FA 4U8VD 5LFAA 4GA1A 4I43A 4KVOA 3HXDA 4G1TA 4FJZA 5AQAA 4I6JA 4MS6A 2CHZA 4GCOA 4PUCA 1QNFA 1UJKA 3R7RA 4FA6A 3ESLA 2C2LA 3C72A 5E75A 1UJJA 3CSTA 3ZUVB 5ITZF 5ENNA 5EX0A 1TNZA 1Z5SC 4Q69A 4A3VA 4FULA 2I6HA 4D10C 2IOLA 4F1PA 1D8EA 2ETBA 2IFUA 4RG6A 3SHFA 5EILA 4K0RA 4M3OA 2JABA 5BV0A 3ASGA 3G2UA 4LNUD 3SY2A 3U3WA 1SA5A 5B3SE 3QC1A 3MGBA 2FEZA 4GTMA 2FBNA 1JPLA 3SFXA 4N2QA 4DI4A 2P9KG 2OV8A 4ABNA 2LO6A 4N3CA 4Q96A 4ZHBA 5AQ7A 1N4PA 1MQSA 3AJIA 4NIKA 4EECA 3BEEA 3NF1A 3B7TA 4CT0A 3ULQA 4HB5A 1EF1C 4FHKA 1N4SA 5BV1A 1RW2A 4U07A 2L6JA 2WXQA 2FI7A 4O1OA 3CQCB 5ENSD 1YCSB 2XHEA 2ZISA 3CK8A 3BG1B 2EILE 3LY7A 2BKGA 4AM9A 3FH5A 1BU9A 3U4TA 3EHQA 4JPSA 3ENEA 5KNHD 1G3NB 3AU5A 3U9WA 3TXNA 3PUJA 4N5QA 2YQ8A 1X5BA 2A4ZA 3R9MA 3DSTA 3UINC 2VSYA 3B7RL 4GB9A 2WXGA 5CCMA 2R03A 3Q49B 4WNEA 3SFZA 1MX2A 4EBAA 3CVQA 4I1AA 1BLXB 3W9GA 1E8XA 1OWMA 5G55A 3ULYA 2AXUA 1E8YA 3L22A 4JL0A 4UI9J 4KZCA 4AVXA 3IHYA 2DVWA 1BD8A 4ANVA 3EIJA 4O1PA 3Q15A 2VGXB 4KVMA 4G25A 3S7JA 2FF4A 2LUHA 3B7SA 3VLDA 3OAWA 1HH8A 3APCA 4RLYA 4L7TA 2DYRE 2OEWA 1LF8A 3CSFA 4OVUA 4F1SA 4I9CA 2CG3A 2PL2A 4PH4B 3OXLA 5G05C 1BI8B 4FP7A 1H6KA 2J49A 2KCVA 1IQUA 3HG0D 4KT6B 4V3IA 1A5EA 1SA4A 5AJLA 2IOSA 3NB2A 5E76A 5CRVA 1KT1A 4JHJA 4WWPA 2IU1A 3FTUA 4HOSA 5ENOD 3OTNA 1FVHA 2YNQA 2A5EA 1LD7A 4U96D 3V2OA 2HO1A 3TWQA 1V54E 3FU5A 2P2CP 3ISMC 5KCMA 3NZSA 4GTRA 3E32A 5BXOA 2XQ0A 4NURA 4QQIA 3DBSA 5FJYA 2Y3AA 3SZ7A 4ATZD 2WVIA 2MHKA 3NAWA 3FFLA 5CMWA 4TXQA 2DBAA 4G23A 1FCHA 2F0YA 5KBAA 3KEZA 5CCLA 1E8ZA 5B1BE 3SO8A 3AU4A 4A55A 1IYGA 1KZPA 3DSSA 4DX5D 4JHKA 4JEHA 4APOA 2CFZA 5CEDB 1AP7A 1DNPA 3V2XA 2QY7A 4Z68A 2P9NG 4N5CA 4ILHB 1NP7A 4CDMA 4J8SA 5CBNA 4UI9C 1N52A 2NYJA 2J4DA 1JCSA 3HVEA 4DRXE 1MX4A 1Z3YA 3FUHA 3ZYKA 2PZIA 3EU5A 1MHQA 3SI5A 3E30A 4GPKA 5HQ8A 4G11A 3BG0B 3S7DA 4JEUA 4TUUA 3TL5A 5C2YA 2OOEA 5CEAA 4IN3B 1L5JA 3NOCD 4JA7A 2F8XK 2OVBA 1DVPA 4F6RD 2I2OA 5CECB 4EZKA 1Q2ZA 1OWOA 1IQRA 3PZDA 1INZA 2CG2A 4JVSA 4U04A 2VGEA 1BI7B 2XCCA 5AARA 4H7XA 3ZPJA 2XGOA 3UMVA 4CDNA 3DEPA 2GRNB 3F6QA 2M63A 4YNDA 4GMJA 3AG3E 2IQCA 2X6IA 4P29A 5EYLA 1MX6A 4J0UA 2Y0BG 1ELKA 2ZU6B 1IHGA 3L08A 3QARA 4ANUA 1SVXA 1UW4B 3UTMA 4JW1A 3IKOB 2KC7A 4DX2A 3O4ZA 3EDTB 1FVFA 4UWFA 4B93B 3CVYA 1JWGA 2HE0A 4GMLA 1GW6A 3MKQB 2GROB 3IBEA 2GRRB 3UT8A 3PVLA 5FIOA 4KXKB 4BTAA 5ENRD 2IF4A 3DSXA 3GZ1A 3ZN3A 5FINA 1MJ0A 3FUDA 3TWRA 3N71A 4HS2A 5D0OD 3QOUA 1HG2A 1K8KG 4DX7D 2QC9A 3L17A 4GTVA 3UQ3A 4GCNA 4I6GA 4KBQA 1Z6TA 3RIBA 3AS5A 3GZ2A 3CR3A 3FUFA 5T4YA 4CGVA 3TWTA 3L9TA 4GYWA 5LOZA 1OXJA 3CKCA 3B7BA 1RZ4A 3PZ4A 2RD0A 4HVBA 4HRLA 4LNBA 4GTSA 3AG2E 1N95A 3ZRHA 5AQBA 3G2TA 3MEKA 3D9KA 3LVQE 2P9UG 3E4BA 2WPVA 4HOTA 4OVVA 1KLXA 4BT9A 3CHOA 2JLBA 2XZTG 5CHEE 1JWFA 2B0OE 3ZEFA 2J09A 2L0IA 3ZYQA 4ANXA 4KYOB 3ZNGA 4HRNA 3AAAC 3AG4E 4U63A 5AJDA 3Q75A 4UI9K 2H6HA 1Y8MA 1HFAA 3FHEA 4GA0A 3RO3A 4FC8A 4MRUA 3CHQA 5FZSA 2XS1A 3QJZA 4PS7A 4ACLA 3LPZA 4DLOA 1HO8A 1N4QA 1K3ZD 3UUXA 3RK6A 3I3NA 4AV7A 5FWQA 4HXIA 4JZYA 4J7WA 1DCQA 2IJGX 4E6HA 1HZ4A 4MBGA 2PNNA 4AOFA 2JEKA 3KAEA 4I9EA 1D9SA 3I4RB 3Q79A 4XX5A 3DSVA 4GMRA 4JD2G 3V30A 4L23A 3UM3A 5EN5D 5KJNA 3ZW3A 3S7FA 4L9PA 2XGMA 1XNFA 1E90A 1PAQA 2BF0X 3ESKA 3KS2A 1OWNA 5EIDA 1JCQA 4OAVB 4YVQC 4N2SA 2R5SA 3OXGA 3U64A 4U0UA 4AXHA 4BFRA 4DX6D 2QFCA 1JCRA 3JYSA 2VYIA 3EJNA 2XPYA 3JXIA 4L2YA 3D9JA 4FADA 3ASNE 3PZ2A 1TNBA 2UY1B 2OCCE 4B8AA 2H6IA 3Q73A 5DIZA 4URKA 5ENQD 3E33A 3D3MA 3EHRA 3TJPA 2RKKA 4AY6A 4CGWA 3ML8A 4EPZA 5ENPD 1N4RA 4FLHA 1N0QA 4DLQA 4HOQA 3K9IA 4NACA 2I1KA 1WG0A 2AWIA 4X8QA 3B7UX 4HOUA 1HXIA 5DBKA 2X6FA 4O60A 3IHVA 5AN8A 2EIKE 5KJMA 3FTSA 2WMNA 2DZOA 2ZGGA 1JUQA 4DK5A 4JA9A 3MKQA 1N54A 1LTXA 3T8MA 3DEOA 5B1AE 3EHNA 2F37A 3KSLA 3I5PA 2R05A 1H19A 1WAO1 3R7QA 4Y6WA 2J8SD 3APFA 4HI8A 3G2VA 4O6FA 4HFGA 2V0PA 2VSXE 3HXEA 4BESA 4GZDA 1TNUA 1OCCE 3SGHA 1N94A 1ZU2A 2WXMA 4YDWA 3UM2A 2X6HA 2CHXA 4G26A 2HYZA 2C0MA 2XGSA 2YINA 2A5UA 5M72A 5BUZA 3PEVB 3QWPA 2LXLA 2WM9A 2L0TB 1H6PA 3RU0A 3HDXA 2BTDA 3ONLA 3CVNA 1N9AA 1BPOA 1HX8A 2WQ6A 3FH7A 4FJYA 4BY6A 1SZ9A 3EUVA 4GYYA 4NRHB 2WB2A 4CCAA 4BX9A 2ETAA 2MYOA 3B13A 4GAAA 2DWZA 4G8LA 4QFVA 4BETA 4UWGA 2Y1LE 3Q47B 1HS6A 3QAQA 2GRMA 5EIBE 2WMOA 3UIPC 4HQDA 2LXMA 5JMND 1MYOA 3D9NA 4OAUC 4K5CA 5FQ4A 5AYWD 4UQXA 5D0QD 2X6JA 3CIAA 3FTYA 5G05J 3GYZA 5EDSA 3S2AA 2R17C 1WM5A 5J90A 2RG8A 3UIOC 1DCEA 4G8KA 5FZRA 1DC2A 1LD8A 3ZXSA 4CYMD 1E7VA 2ETCA 4CEMA 5HI7A 4J8YA 1UN8A 4PDXA 3CQGB 2QYJA 4I1OB 4GTTA 3L6AA 1NFIE 4L1BA 4XKBA 2C0LA 2L9BA 1X81A 4AP2A 4JC8A 3SFYA 3AS8A 3AG1E 2L6BA 1H2VC 2ZIRA 4GZ5A 2AW6A 4WAFA 4A3TA 1H0AA 2J9QA 1EPUA 3QNKA 3EHMA 4WUYA 3ASOE 4WNFA 3LY9A 1O1TA 3SBSA 3ABKE 3ABME 3LJNA 2XEHA 2XPZA 1IKND 3B95A 3J5PA 2GRPB 1OCOE 2DIWA 3Q78A 5HKPA 1KZOA 3NZUA 1OCZE 2XENA 3VTXA 3PNTB 5ENTD 3CVPA 3MKRA 1Y6IA 3FEXA 3D9MA 5LCWC 1KPSB 2WXNA 4TUMA 3CGHA 1N0RA 2NXPA 1HU3A 4XIFA 1QZ2A 5LX8A 3ZIMA 4U0SA 2XPIA 3QWWA 4UUCA 4F53A 1OT8A 5G04C 1QYMA 4GTOA 4GYOA 1B89A 2BUGA 4HNAD 2VQ2A 3U66A 2J08A 3PZ1A 1H2UA 3QB2A 5JA4D 1O1SA 3FTVA 2WXRA 3NQPA 4ANWA 1NA3A 3AS4A 5KNGA 4DJAA 3FUMA 1HE8A 2P58C 4GU5A 3JCKC 3DXMG 3C3RA 3HHMA 4FHJA 5EX3A 5JJTA 4U95D 4I17A 3PE4A 3FTWA 5BPPA 5T8IA 4AJWA 3UT7A 2X3MA 2GGFA 5C1DA 4DUIA 2QYUA 2WQHA 3RKVA 3JUEA 3T9KA 3P2BA 2UY1A 4DPRA 4ACKA 4FU3A 3R9AB 4I6EA 2R59A 4BT8A 2KM4A 1IXVA 2I9CA 3PH0C 3Q7FA 4B8CB 3HXFA 2VJ8A 4B0ZA 3E34A 5FQ6A 3CVLA 2ZGDA 4U8HA 3QK0A 5JHBA 3IXEA 4CZ2D 5ARGA 1YA0A 3DSUA 3LS8A 4E85A 4N3BA 3RSEG 3ZVVA 3Q7AA 3HXBA 4Q94A 4K03A 3PUKA 1FPPA 4YDYA 3HXCA 3ZXPA 1H2TC 2OEVA 2XEVA 3TWUA 2WXLA 4RSYA 2EQXA 3E37A 3PDNA 1PC2A 4JB8P 2IY0C 3TXMA 1K1AA 2VGYA 1NZNA 5CMYA 3I4GA 3MJWA 3FUIA 5A7DB 4EBAG 1NI1A 2P9IG 4HBDA 2EIJE 5HRYA 4DI3A 3G2WA 4B94A 4C48B 3HRAA 1NA0A 4A1GA 1AWCB 1U3DA 4A1SA 4GZCA 2V4LA 4BWRA
chains in the Genus database with same CATH topology
1N4SA 1O1TA 1TN7A 1S64A 4MBGA 3HXDA 2R2LA 4YDEA 1QBQA 3Q79A 3Q78A 3DSVA 1KZOA 2F0YA 3PZ4A 3DPYA 1TNYA 3Q7FA 1FT2A 3HXFA 4LNBA 1D8DA 4GTSA 4L9PA 1N95A 2ZISA 3C72A 3E34A 3PZ3A 1LTXA 1TNZA 3KSLA 4YDOA 1KZPA 3DSSA 1TN8A 1JCQA 3DSUA 1SA4A 1D8EA 3HXEA 3Q7AA 4GTOA 3HXBA 1JCRA 1TNUA 1DCEA 1N94A 2IEJA 3KSQA 1TN6A 1FPPA 3DRAA 3PZ1A 3DSTA 1JCSA 3HXCA 1SA5A 1LD8A 1O1SA 3PZ2A 1TNBA 4GTMA 2H6IA 3Q73A 1LD7A 2H6GA 2BEDA 4GTTA 3Q75A 3EU5A 2H6HA 2H6FA 3E33A 3SFXA 3E37A 3E30A 3DSWA 1MZCA 3DSXA 1FT1A 1X81A 4EHMA 1N9AA 3SFYA 1N4PA 4GTRA 1N4RA 3E32A 1NI1A 1O1RA 1O5MA 1TNOA 4LNGA 2ZIRA 4GTPA 1N4QA 4GTVA 1S63A 3EUVA 4GTQA 1NL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4S A;  1O1T A;  1TN7 A;  1S64 A;  4MBG A;  3HXD A;  2R2L A;  4YDE A;  1QBQ A;  3Q79 A;  3Q78 A;  3DSV A;  1KZO A;  2F0Y A;  3PZ4 A;  3DPY A;  1TNY A;  3Q7F A;  1FT2 A;  3HXF A;  4LNB A;  1D8D A;  4GTS A;  4L9P A;  1N95 A;  2ZIS A;  3C72 A;  3E34 A;  3PZ3 A;  1LTX A;  1TNZ A;  3KSL A;  4YDO A;  1KZP A;  3DSS A;  1TN8 A;  1JCQ A;  3DSU A;  1SA4 A;  1D8E A;  3HXE A;  3Q7A A;  4GTO A;  3HXB A;  1JCR A;  1TNU A;  1DCE A;  1N94 A;  2IEJ A;  3KSQ A;  1TN6 A;  1FPP A;  3DRA A;  3PZ1 A;  3DST A;  1JCS A;  3HXC A;  1SA5 A;  1LD8 A;  1O1S A;  3PZ2 A;  1TNB A;  4GTM A;  2H6I A;  3Q73 A;  1LD7 A;  2H6G A;  2BED A;  4GTT A;  3Q75 A;  3EU5 A;  2H6H A;  2H6F A;  3E33 A;  3SFX A;  3E37 A;  3E30 A;  3DSW A;  1MZC A;  3DSX A;  1FT1 A;  1X81 A;  4EHM A;  1N9A A;  3SFY A;  1N4P A;  4GTR A;  1N4R A;  3E32 A;  1NI1 A;  1O1R A;  1O5M A;  1TNO A;  4LNG A;  2ZIR A;  4GTP A;  1N4Q A;  4GTV A;  1S63 A;  3EUV A;  4GTQ A;  1NL4 A; 
#chains in the Genus database with same CATH topology
 4C0M A;  2UWJ G;  2LSV A;  3TAX A;  1TN7 A;  2Y4T A;  4XE0 A;  2R2L A;  4EZL A;  2KZT B;  2BKK B;  1OY3 D;  2CFU A;  1W3B A;  3C98 A;  3ONK A;  3FH8 A;  2ZXW E;  5T3R A;  3FUL A;  1TNY A;  3Q5M A;  3CHP A;  4GZ3 A;  2J07 A;  5KJL A;  3ASF A;  1S70 B;  2XEE A;  1E8W A;  3SBT B;  4AIF A;  2FO7 A;  2V5Q C;  4J8F A;  4WND A;  2WXK A;  3FEY A;  4KMO A;  4KZ0 A;  4HLL A;  4B89 A;  1A17 A;  1U3C A;  2NSZ A;  4BX8 A;  4AY5 A;  4AEZ C;  3ABL E;  3KSQ A;  1TN6 A;  4UQZ A;  2IO3 C;  5JJ7 A;  3ZU7 B;  3LKU A;  3UX4 A;  1ZBP A;  3GW4 A;  3IEG A;  3PS6 A;  2EIN E;  4M7C A;  2KCK A;  4LEU A;  2P9P G;  1UOH A;  1E7U A;  3FUJ A;  2XZD G;  3SF4 A;  4I2Z A;  3CHS A;  1OUV A;  4YVO A;  2XRY A;  1XGW A;  5AIJ A;  4ILG A;  5KJK A;  2QZA A;  4IRU A;  5JJ6 A;  3UI2 A;  3VLF A;  2CHW A;  4C0E A;  4MKT A;  3MA5 A;  3V31 A;  3FU0 A;  3BQO A;  4PS8 A;  3FY4 A;  4U7E B;  2KZT A;  3MZL B;  3HIZ A;  1SW6 A;  4K5A B;  2B6C A;  3FUN A;  4IUL A;  1D8D A;  3ZKJ A;  3JUI A;  4LER A;  2P9L G;  3TG5 A;  2LAH A;  4TXR A;  1YYH A;  3CHM A;  3FTZ A;  5EKQ D;  1TN8 A;  1SZA A;  3ZGQ A;  5FTP A;  4WWO A;  4N39 A;  3L54 A;  5J08 A;  4XI0 A;  5AQ9 A;  2IEJ A;  5ANL A;  3L82 A;  2NC9 A;  3D9L A;  3V79 K;  1PY1 A;  3C5R A;  3RAU A;  1EDU A;  3RRN B;  2BED A;  4MLP A;  5BW8 C;  3UXG A;  2IO2 C;  2H6F A;  2OND A;  4RG9 A;  2PM7 A;  2WXI A;  3T5V A;  3W9F A;  3QDN A;  3D9O A;  3UM1 A;  2WXP A;  3L16 A;  3TG4 A;  2VSO E;  3APD A;  4LNG A;  4OYS A;  1TNO A;  1TJF A;  3ZHE B;  4NQ0 A;  3LEW A;  4JXT A;  4GTP A;  5D66 A;  1YMP A;  4EZJ A;  4U8Y D;  3VLE A;  4CDR A;  3CK7 A;  4GTQ A;  2OVF A;  4UWK A;  4WNG A;  2X38 A;  4Y6C A;  1S64 A;  4CT4 A;  3URZ A;  5A23 A;  4IYP A;  3ZFW A;  3G2S A;  5FQ8 A;  2XRZ A;  4LRZ A;  2KBX A;  2VTB B;  2AVP A;  1IHB A;  1E96 B;  3IV0 A;  5ANR A;  3CVU A;  3LJ3 A;  3GZS A;  2GRL A;  3S7B A;  1S0P A;  2ILR A;  2X6K A;  4PS3 A;  3FU3 A;  3TGO A;  4LUN U;  3CVV A;  4RQI A;  4J8E A;  4BSX A;  1EYH A;  3UM0 A;  1QQE A;  2MRI A;  3ASD A;  2DCP A;  3MV3 B;  5D2M C;  2ION A;  3FU6 A;  3T5X A;  3PNL B;  2KCL A;  3Q9U C;  4XZ4 A;  3C3Q A;  5AEN A;  3JQ1 A;  5CER B;  3DRA A;  1ZB1 A;  4I2W A;  5EYP F;  3O48 A;  3LDZ A;  2KXP C;  3TWV A;  4HRM B;  3D9H A;  4ATG A;  2LSU A;  3TWX A;  3SNX A;  1MZC A;  3T8K A;  4GZ6 A;  4R7L A;  1ELW A;  3FTX A;  3P1U A;  4FLB A;  2RFA A;  3ZHE A;  3Q9N C;  1O5M A;  5ARF A;  4L2L A;  2GW1 A;  3DWL G;  3KD7 A;  5LCW J;  3VTY A;  2FUL A;  4TV3 A;  3FUK A;  5FQ7 A;  3UPV A;  2YHE A;  3CHR A;  1TYQ G;  4I1M A;  4ILI A;  1OWL A;  4HOR A;  4LSZ E;  4F3V A;  1P5Q A;  4J8D A;  2VTB A;  4ME2 A;  2WXO A;  3CVX A;  3FWV A;  3ZYM A;  4N3A A;  3DPY A;  5CRU A;  4TRQ A;  5BT1 A;  1FT2 A;  3Q4A B;  2PQN A;  4UQY A;  2PM6 A;  4F7A A;  1ELR A;  3JQ0 A;  4YDO A;  3FDH A;  4BSZ B;  2F8Y A;  4K5B A;  2EIM E;  3QKY A;  1WDY A;  3QWV A;  1WY6 A;  3ZYL A;  4HLE A;  5HS0 A;  3RO2 A;  3NOG D;  4JHR A;  2WXH A;  1V55 E;  2VSN A;  3HVE B;  4A63 B;  1TJC A;  4CRW A;  1UG3 A;  4XI9 A;  1N11 A;  2VGX A;  5FZQ A;  5KWD A;  1K1B A;  2H6G A;  3JXJ A;  2HM8 A;  3CKB A;  4W9R A;  3DPD A;  3X2Q E;  2FO1 E;  3ULE G;  3D9I A;  3DSW A;  3PE3 A;  5G04 J;  2Q7F A;  3RJV A;  4G24 A;  4LG6 A;  1O1R A;  2GRQ B;  2J4B A;  3CEQ A;  4ZFH A;  3LVR E;  1HF8 A;  3D9P A;  1S63 A;  5BXU A;  3OXF A;  3CV0 A;  2WQ7 A;  3WG7 E;  4GA2 A;  3LCA A;  3TWS A;  3NBN B;  4BER A;  3RRU A;  4RVB A;  3MYV A;  4XKC A;  3CLJ A;  1UN9 A;  4EQF A;  3CK9 A;  4YDE A;  1QBQ A;  2V4H C;  2P9S G;  3PRE A;  1U2V G;  2V8S E;  3ASH A;  3LXU X;  1KT0 A;  3RRM B;  5FT9 A;  3UKR G;  4BTB A;  4U0Z A;  3C3O A;  2DZN A;  3BU8 A;  4UWL A;  3WXX A;  1HG5 A;  2WXF A;  3EU9 A;  5AAO A;  2Y4U A;  5BNW A;  2AXZ A;  5LP0 A;  3SD5 A;  3J5Q B;  5JHA A;  3PZ3 A;  2LNI A;  3HYM B;  2AXV A;  2HR2 A;  3UKU G;  3KEA A;  2AJA A;  1TR4 A;  3TWW A;  3MX3 A;  3LY8 A;  3MV2 B;  4BEP A;  3ML9 A;  2E2E A;  1OWP A;  3SQV A;  2R02 A;  4TXP A;  3DXK G;  3UT4 A;  4C9B B;  3L13 A;  3EIQ C;  4J6I A;  4UWH A;  2Y69 E;  5H7P A;  3BUA A;  3PEU B;  5A6C A;  4DX1 A;  4H7Y A;  4WWN A;  4XEI G;  5CBO A;  4HI9 A;  2XCB A;  2YHC A;  3LYA A;  2WXJ A;  1OCR E;  1FT1 A;  3FP3 A;  2RFM A;  4EHM A;  2KAT A;  5G2N A;  2LAI A;  3MCX A;  1TEZ A;  2DYS E;  3FUE A;  3PRZ A;  2I1J A;  1VDY A;  2MOW A;  2PQR A;  2E0I A;  4G2V A;  5IY5 E;  2XS8 A;  4LCT A;  3CVW A;  1SQM A;  1H6O A;  1Z3X A;  4APF A;  1NL4 A;  4GPM A;  2V5F A;  4U8V D;  5LFA A;  4GA1 A;  4I43 A;  4KVO A;  3HXD A;  4G1T A;  4FJZ A;  5AQA A;  4I6J A;  4MS6 A;  2CHZ A;  4GCO A;  4PUC A;  1QNF A;  1UJK A;  3R7R A;  4FA6 A;  3ESL A;  2C2L A;  3C72 A;  5E75 A;  1UJJ A;  3CST A;  3ZUV B;  5ITZ F;  5ENN A;  5EX0 A;  1TNZ A;  1Z5S C;  4Q69 A;  4A3V A;  4FUL A;  2I6H A;  4D10 C;  2IOL A;  4F1P A;  1D8E A;  2ETB A;  2IFU A;  4RG6 A;  3SHF A;  5EIL A;  4K0R A;  4M3O A;  2JAB A;  5BV0 A;  3ASG A;  3G2U A;  4LNU D;  3SY2 A;  3U3W A;  1SA5 A;  5B3S E;  3QC1 A;  3MGB A;  2FEZ A;  4GTM A;  2FBN A;  1JPL A;  3SFX A;  4N2Q A;  4DI4 A;  2P9K G;  2OV8 A;  4ABN A;  2LO6 A;  4N3C A;  4Q96 A;  4ZHB A;  5AQ7 A;  1N4P A;  1MQS A;  3AJI A;  4NIK A;  4EEC A;  3BEE A;  3NF1 A;  3B7T A;  4CT0 A;  3ULQ A;  4HB5 A;  1EF1 C;  4FHK A;  1N4S A;  5BV1 A;  1RW2 A;  4U07 A;  2L6J A;  2WXQ A;  2FI7 A;  4O1O A;  3CQC B;  5ENS D;  1YCS B;  2XHE A;  2ZIS A;  3CK8 A;  3BG1 B;  2EIL E;  3LY7 A;  2BKG A;  4AM9 A;  3FH5 A;  1BU9 A;  3U4T A;  3EHQ A;  4JPS A;  3ENE A;  5KNH D;  1G3N B;  3AU5 A;  3U9W A;  3TXN A;  3PUJ A;  4N5Q A;  2YQ8 A;  1X5B A;  2A4Z A;  3R9M A;  3DST A;  3UIN C;  2VSY A;  3B7R L;  4GB9 A;  2WXG A;  5CCM A;  2R03 A;  3Q49 B;  4WNE A;  3SFZ A;  1MX2 A;  4EBA A;  3CVQ A;  4I1A A;  1BLX B;  3W9G A;  1E8X A;  1OWM A;  5G55 A;  3ULY A;  2AXU A;  1E8Y A;  3L22 A;  4JL0 A;  4UI9 J;  4KZC A;  4AVX A;  3IHY A;  2DVW A;  1BD8 A;  4ANV A;  3EIJ A;  4O1P A;  3Q15 A;  2VGX B;  4KVM A;  4G25 A;  3S7J A;  2FF4 A;  2LUH A;  3B7S A;  3VLD A;  3OAW A;  1HH8 A;  3APC A;  4RLY A;  4L7T A;  2DYR E;  2OEW A;  1LF8 A;  3CSF A;  4OVU A;  4F1S A;  4I9C A;  2CG3 A;  2PL2 A;  4PH4 B;  3OXL A;  5G05 C;  1BI8 B;  4FP7 A;  1H6K A;  2J49 A;  2KCV A;  1IQU A;  3HG0 D;  4KT6 B;  4V3I A;  1A5E A;  1SA4 A;  5AJL A;  2IOS A;  3NB2 A;  5E76 A;  5CRV A;  1KT1 A;  4JHJ A;  4WWP A;  2IU1 A;  3FTU A;  4HOS A;  5ENO D;  3OTN A;  1FVH A;  2YNQ A;  2A5E A;  1LD7 A;  4U96 D;  3V2O A;  2HO1 A;  3TWQ A;  1V54 E;  3FU5 A;  2P2C P;  3ISM C;  5KCM A;  3NZS A;  4GTR A;  3E32 A;  5BXO A;  2XQ0 A;  4NUR A;  4QQI A;  3DBS A;  5FJY A;  2Y3A A;  3SZ7 A;  4ATZ D;  2WVI A;  2MHK A;  3NAW A;  3FFL A;  5CMW A;  4TXQ A;  2DBA A;  4G23 A;  1FCH A;  2F0Y A;  5KBA A;  3KEZ A;  5CCL A;  1E8Z A;  5B1B E;  3SO8 A;  3AU4 A;  4A55 A;  1IYG A;  1KZP A;  3DSS A;  4DX5 D;  4JHK A;  4JEH A;  4APO A;  2CFZ A;  5CED B;  1AP7 A;  1DNP A;  3V2X A;  2QY7 A;  4Z68 A;  2P9N G;  4N5C A;  4ILH B;  1NP7 A;  4CDM A;  4J8S A;  5CBN A;  4UI9 C;  1N52 A;  2NYJ A;  2J4D A;  1JCS A;  3HVE A;  4DRX E;  1MX4 A;  1Z3Y A;  3FUH A;  3ZYK A;  2PZI A;  3EU5 A;  1MHQ A;  3SI5 A;  3E30 A;  4GPK A;  5HQ8 A;  4G11 A;  3BG0 B;  3S7D A;  4JEU A;  4TUU A;  3TL5 A;  5C2Y A;  2OOE A;  5CEA A;  4IN3 B;  1L5J A;  3NOC D;  4JA7 A;  2F8X K;  2OVB A;  1DVP A;  4F6R D;  2I2O A;  5CEC B;  4EZK A;  1Q2Z A;  1OWO A;  1IQR A;  3PZD A;  1INZ A;  2CG2 A;  4JVS A;  4U04 A;  2VGE A;  1BI7 B;  2XCC A;  5AAR A;  4H7X A;  3ZPJ A;  2XGO A;  3UMV A;  4CDN A;  3DEP A;  2GRN B;  3F6Q A;  2M63 A;  4YND A;  4GMJ A;  3AG3 E;  2IQC A;  2X6I A;  4P29 A;  5EYL A;  1MX6 A;  4J0U A;  2Y0B G;  1ELK A;  2ZU6 B;  1IHG A;  3L08 A;  3QAR A;  4ANU A;  1SVX A;  1UW4 B;  3UTM A;  4JW1 A;  3IKO B;  2KC7 A;  4DX2 A;  3O4Z A;  3EDT B;  1FVF A;  4UWF A;  4B93 B;  3CVY A;  1JWG A;  2HE0 A;  4GML A;  1GW6 A;  3MKQ B;  2GRO B;  3IBE A;  2GRR B;  3UT8 A;  3PVL A;  5FIO A;  4KXK B;  4BTA A;  5ENR D;  2IF4 A;  3DSX A;  3GZ1 A;  3ZN3 A;  5FIN A;  1MJ0 A;  3FUD A;  3TWR A;  3N71 A;  4HS2 A;  5D0O D;  3QOU A;  1HG2 A;  1K8K G;  4DX7 D;  2QC9 A;  3L17 A;  4GTV A;  3UQ3 A;  4GCN A;  4I6G A;  4KBQ A;  1Z6T A;  3RIB A;  3AS5 A;  3GZ2 A;  3CR3 A;  3FUF A;  5T4Y A;  4CGV A;  3TWT A;  3L9T A;  4GYW A;  5LOZ A;  1OXJ A;  3CKC A;  3B7B A;  1RZ4 A;  3PZ4 A;  2RD0 A;  4HVB A;  4HRL A;  4LNB A;  4GTS A;  3AG2 E;  1N95 A;  3ZRH A;  5AQB A;  3G2T A;  3MEK A;  3D9K A;  3LVQ E;  2P9U G;  3E4B A;  2WPV A;  4HOT A;  4OVV A;  1KLX A;  4BT9 A;  3CHO A;  2JLB A;  2XZT G;  5CHE E;  1JWF A;  2B0O E;  3ZEF A;  2J09 A;  2L0I A;  3ZYQ A;  4ANX A;  4KYO B;  3ZNG A;  4HRN A;  3AAA C;  3AG4 E;  4U63 A;  5AJD A;  3Q75 A;  4UI9 K;  2H6H A;  1Y8M A;  1HFA A;  3FHE A;  4GA0 A;  3RO3 A;  4FC8 A;  4MRU A;  3CHQ A;  5FZS A;  2XS1 A;  3QJZ A;  4PS7 A;  4ACL A;  3LPZ A;  4DLO A;  1HO8 A;  1N4Q A;  1K3Z D;  3UUX A;  3RK6 A;  3I3N A;  4AV7 A;  5FWQ A;  4HXI A;  4JZY A;  4J7W A;  1DCQ A;  2IJG X;  4E6H A;  1HZ4 A;  4MBG A;  2PNN A;  4AOF A;  2JEK A;  3KAE A;  4I9E A;  1D9S A;  3I4R B;  3Q79 A;  4XX5 A;  3DSV A;  4GMR A;  4JD2 G;  3V30 A;  4L23 A;  3UM3 A;  5EN5 D;  5KJN A;  3ZW3 A;  3S7F A;  4L9P A;  2XGM A;  1XNF A;  1E90 A;  1PAQ A;  2BF0 X;  3ESK A;  3KS2 A;  1OWN A;  5EID A;  1JCQ A;  4OAV B;  4YVQ C;  4N2S A;  2R5S A;  3OXG A;  3U64 A;  4U0U A;  4AXH A;  4BFR A;  4DX6 D;  2QFC A;  1JCR A;  3JYS A;  2VYI A;  3EJN A;  2XPY A;  3JXI A;  4L2Y A;  3D9J A;  4FAD A;  3ASN E;  3PZ2 A;  1TNB A;  2UY1 B;  2OCC E;  4B8A A;  2H6I A;  3Q73 A;  5DIZ A;  4URK A;  5ENQ D;  3E33 A;  3D3M A;  3EHR A;  3TJP A;  2RKK A;  4AY6 A;  4CGW A;  3ML8 A;  4EPZ A;  5ENP D;  1N4R A;  4FLH A;  1N0Q A;  4DLQ A;  4HOQ A;  3K9I A;  4NAC A;  2I1K A;  1WG0 A;  2AWI A;  4X8Q A;  3B7U X;  4HOU A;  1HXI A;  5DBK A;  2X6F A;  4O60 A;  3IHV A;  5AN8 A;  2EIK E;  5KJM A;  3FTS A;  2WMN A;  2DZO A;  2ZGG A;  1JUQ A;  4DK5 A;  4JA9 A;  3MKQ A;  1N54 A;  1LTX A;  3T8M A;  3DEO A;  5B1A E;  3EHN A;  2F37 A;  3KSL A;  3I5P A;  2R05 A;  1H19 A;  1WAO 1;  3R7Q A;  4Y6W A;  2J8S D;  3APF A;  4HI8 A;  3G2V A;  4O6F A;  4HFG A;  2V0P A;  2VSX E;  3HXE A;  4BES A;  4GZD A;  1TNU A;  1OCC E;  3SGH A;  1N94 A;  1ZU2 A;  2WXM A;  4YDW A;  3UM2 A;  2X6H A;  2CHX A;  4G26 A;  2HYZ A;  2C0M A;  2XGS A;  2YIN A;  2A5U A;  5M72 A;  5BUZ A;  3PEV B;  3QWP A;  2LXL A;  2WM9 A;  2L0T B;  1H6P A;  3RU0 A;  3HDX A;  2BTD A;  3ONL A;  3CVN A;  1N9A A;  1BPO A;  1HX8 A;  2WQ6 A;  3FH7 A;  4FJY A;  4BY6 A;  1SZ9 A;  3EUV A;  4GYY A;  4NRH B;  2WB2 A;  4CCA A;  4BX9 A;  2ETA A;  2MYO A;  3B13 A;  4GAA A;  2DWZ A;  4G8L A;  4QFV A;  4BET A;  4UWG A;  2Y1L E;  3Q47 B;  1HS6 A;  3QAQ A;  2GRM A;  5EIB E;  2WMO A;  3UIP C;  4HQD A;  2LXM A;  5JMN D;  1MYO A;  3D9N A;  4OAU C;  4K5C A;  5FQ4 A;  5AYW D;  4UQX A;  5D0Q D;  2X6J A;  3CIA A;  3FTY A;  5G05 J;  3GYZ A;  5EDS A;  3S2A A;  2R17 C;  1WM5 A;  5J90 A;  2RG8 A;  3UIO C;  1DCE A;  4G8K A;  5FZR A;  1DC2 A;  1LD8 A;  3ZXS A;  4CYM D;  1E7V A;  2ETC A;  4CEM A;  5HI7 A;  4J8Y A;  1UN8 A;  4PDX A;  3CQG B;  2QYJ A;  4I1O B;  4GTT A;  3L6A A;  1NFI E;  4L1B A;  4XKB A;  2C0L A;  2L9B A;  1X81 A;  4AP2 A;  4JC8 A;  3SFY A;  3AS8 A;  3AG1 E;  2L6B A;  1H2V C;  2ZIR A;  4GZ5 A;  2AW6 A;  4WAF A;  4A3T A;  1H0A A;  2J9Q A;  1EPU A;  3QNK A;  3EHM A;  4WUY A;  3ASO E;  4WNF A;  3LY9 A;  1O1T A;  3SBS A;  3ABK E;  3ABM E;  3LJN A;  2XEH A;  2XPZ A;  1IKN D;  3B95 A;  3J5P A;  2GRP B;  1OCO E;  2DIW A;  3Q78 A;  5HKP A;  1KZO A;  3NZU A;  1OCZ E;  2XEN A;  3VTX A;  3PNT B;  5ENT D;  3CVP A;  3MKR A;  1Y6I A;  3FEX A;  3D9M A;  5LCW C;  1KPS B;  2WXN A;  4TUM A;  3CGH A;  1N0R A;  2NXP A;  1HU3 A;  4XIF A;  1QZ2 A;  5LX8 A;  3ZIM A;  4U0S A;  2XPI A;  3QWW A;  4UUC A;  4F53 A;  1OT8 A;  5G04 C;  1QYM A;  4GTO A;  4GYO A;  1B89 A;  2BUG A;  4HNA D;  2VQ2 A;  3U66 A;  2J08 A;  3PZ1 A;  1H2U A;  3QB2 A;  5JA4 D;  1O1S A;  3FTV A;  2WXR A;  3NQP A;  4ANW A;  1NA3 A;  3AS4 A;  5KNG A;  4DJA A;  3FUM A;  1HE8 A;  2P58 C;  4GU5 A;  3JCK C;  3DXM G;  3C3R A;  3HHM A;  4FHJ A;  5EX3 A;  5JJT A;  4U95 D;  4I17 A;  3PE4 A;  3FTW A;  5BPP A;  5T8I A;  4AJW A;  3UT7 A;  2X3M A;  2GGF A;  5C1D A;  4DUI A;  2QYU A;  2WQH A;  3RKV A;  3JUE A;  3T9K A;  3P2B A;  2UY1 A;  4DPR A;  4ACK A;  4FU3 A;  3R9A B;  4I6E A;  2R59 A;  4BT8 A;  2KM4 A;  1IXV A;  2I9C A;  3PH0 C;  3Q7F A;  4B8C B;  3HXF A;  2VJ8 A;  4B0Z A;  3E34 A;  5FQ6 A;  3CVL A;  2ZGD A;  4U8H A;  3QK0 A;  5JHB A;  3IXE A;  4CZ2 D;  5ARG A;  1YA0 A;  3DSU A;  3LS8 A;  4E85 A;  4N3B A;  3RSE G;  3ZVV A;  3Q7A A;  3HXB A;  4Q94 A;  4K03 A;  3PUK A;  1FPP A;  4YDY A;  3HXC A;  3ZXP A;  1H2T C;  2OEV A;  2XEV A;  3TWU A;  2WXL A;  4RSY A;  2EQX A;  3E37 A;  3PDN A;  1PC2 A;  4JB8 P;  2IY0 C;  3TXM A;  1K1A A;  2VGY A;  1NZN A;  5CMY A;  3I4G A;  3MJW A;  3FUI A;  5A7D B;  4EBA G;  1NI1 A;  2P9I G;  4HBD A;  2EIJ E;  5HRY A;  4DI3 A;  3G2W A;  4B94 A;  4C48 B;  3HRA A;  1NA0 A;  4A1G A;  1AWC B;  1U3D A;  4A1S A;  4GZC A;  2V4L A;  4BWR A; 
#chains in the Genus database with same CATH homology
 1N4S A;  1O1T A;  1TN7 A;  1S64 A;  4MBG A;  3HXD A;  2R2L A;  4YDE A;  1QBQ A;  3Q79 A;  3Q78 A;  3DSV A;  1KZO A;  2F0Y A;  3PZ4 A;  3DPY A;  1TNY A;  3Q7F A;  1FT2 A;  3HXF A;  4LNB A;  1D8D A;  4GTS A;  4L9P A;  1N95 A;  2ZIS A;  3C72 A;  3E34 A;  3PZ3 A;  1LTX A;  1TNZ A;  3KSL A;  4YDO A;  1KZP A;  3DSS A;  1TN8 A;  1JCQ A;  3DSU A;  1SA4 A;  1D8E A;  3HXE A;  3Q7A A;  4GTO A;  3HXB A;  1JCR A;  1TNU A;  1DCE A;  1N94 A;  2IEJ A;  3KSQ A;  1TN6 A;  1FPP A;  3DRA A;  3PZ1 A;  3DST A;  1JCS A;  3HXC A;  1SA5 A;  1LD8 A;  1O1S A;  3PZ2 A;  1TNB A;  4GTM A;  2H6I A;  3Q73 A;  1LD7 A;  2H6G A;  2BED A;  4GTT A;  3Q75 A;  3EU5 A;  2H6H A;  2H6F A;  3E33 A;  3SFX A;  3E37 A;  3E30 A;  3DSW A;  1MZC A;  3DSX A;  1FT1 A;  1X81 A;  4EHM A;  1N9A A;  3SFY A;  1N4P A;  4GTR A;  1N4R A;  3E32 A;  1NI1 A;  1O1R A;  1O5M A;  1TNO A;  4LNG A;  2ZIR A;  4GTP A;  1N4Q A;  4GTV A;  1S63 A;  3EUV A;  4GTQ A;  1NL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...