2ZISA

Crystal structure of rat protein farnesyltransferase complexed with a bezoruran inhibitor and fpp
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
314
structure length
314
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and structure-activity relationships of novel benzofuran farnesyltransferase inhibitors
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase subunit alpha
total genus 124
structure length 314
sequence length 314
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 2zisA00
2H6IA 4LNBA 1D8DA 3Q7AA 4GTMA 4GTPA 1N9AA 1TNZA 3Q79A 3DSUA 2ZIRA 1FPPA 1TNUA 1N4SA 1O1RA 2F0YA 4GTSA 3KSLA 4LNGA 3PZ1A 3PZ3A 4L9PA 3Q75A 3Q7FA 4EHMA 2H6GA 1N95A 2H6HA 3PZ4A 1JCSA 1QBQA 1NI1A 1O1SA 3DSTA 1KZOA 1N4QA 3HXDA 1S63A 2H6FA 3DRAA 2IEJA 3DSXA 4GTRA 3E37A 3HXCA 1N94A 1TNYA 1TNBA 1MZCA 3E30A 2R2LA 3DSVA 3PZ2A 3HXBA 3Q73A 1TN8A 3EU5A 1FT1A 1LTXA 1TN6A 4GTOA 1TN7A 1NL4A 3DPYA 1N4PA 1X81A 3Q78A 1N4RA 3DSSA 1LD7A 3E34A 2BEDA 4YDOA 1TNOA 3C72A 4GTTA 1S64A 1KZPA 3SFXA 3E33A 1LD8A 1DCEA 3HXFA 4GTVA 1JCQA 3HXEA 3E32A 1JCRA 1O5MA 3KSQA 1SA5A 1FT2A 3SFYA 2ZISA 4GTQA 1O1TA 4YDEA 4MBGA 1SA4A 1D8EA 3DSWA 3EUVA
chains in the Genus database with same CATH superfamily
4I43A 4RQIA 5KWDA 2X6FA 2QC9A 3FH7A 4L7TA 1WG0A 4Q69A 3CR3A 4GMRA 2KBXA 2P9SG 3NZSA 3FY4A 4NRHB 3NF1A 2F37A 1PC2A 4CCAA 2PNNA 2VQ2A 2ETAA 1QNFA 1OWOA 3IV0A 2WMOA 3PZ4A 1O1SA 4TRQA 5EYLA 4I1OB 1IKND 2XHEA 3U64A 1HU3A 2PL2A 2I2OA 3R9MA 3DSXA 3C3RA 3HXCA 3AG4E 1TNBA 2XS8A 1XGWA 3JUEA 1HZ4A 3HHMA 5AJDA 4B8CB 2AWIA 2XGSA 3MZLB 3PZ2A 4ILGA 4F7AA 2WXFA 5CERB 3ZW3A 4M7CA 4O6FA 1TN6A 2FO7A 2WXRA 4BWRA 1ZB1A 4Q94A 4TXQA 3DSSA 3E34A 5BV0A 3AU4A 3Q9NC 3LXUX 5FT9A 4BFRA 2ONDA 1N0QA 2HYZA 2WXGA 2I6HA 4I9EA 3C72A 3CKBA 4KXKB 3ZHEA 4ATZD 4N2SA 4OAUC 3L9TA 3HXEA 1JCRA 4CT4A 4NACA 2XZDG 1HE8A 3SFYA 4GTQA 4K5BA 2Y4TA 4DRXE 4HOUA 2XEVA 4FJZA 1HH8A 1QZ2A 3LPZA 3IBEA 3MKQB 3Q47B 3G2TA 4UUCA 2GRNB 3LY8A 5CRUA 3D9MA 4GYOA 5KBAA 1UN8A 4PUCA 2NYJA 4OYSA 3GZSA 2VGXA 2F0YA 3PZ3A 2CG3A 4U0SA 5E75A 1YCSB 4L2YA 5J90A 4Y6WA 3T9KA 4G8KA 1MZCA 4BT9A 3O48A 4U7EB 5ENNA 3E30A 2R2LA 1OUVA 4APFA 4JZYA 3AU5A 2XS1A 3CVQA 3VLEA 2FEZA 1NFIE 3B95A 3Q9UC 1OXJA 5ENSD 3TWRA 1BI7B 2BKKB 1WM5A 2P2CP 3SZ7A 2R17C 1N52A 4K03A 4PH4B 3NBNB 3AAAC 2PM7A 2ILRA 3QWPA 4KVMA 2J07A 1HFAA 3ZN3A 4BESA 3I5PA 1UW4B 3LJNA 3EHMA 2A5EA 3LEWA 1RZ4A 2LXLA 4GU5A 3MA5A 4G23A 3ZYQA 2JLBA 1EF1C 1K8KG 4EQFA 3CK9A 3ZYKA 5AJLA 2IOLA 2EQXA 3AS4A 5ENRD 3UM2A 3QC1A 1E7VA 5ENTD 1OCZE 4I6JA 3IHYA 3ZFWA 5T3RA 3N71A 2LO6A 3FU5A 3DEOA 1HG2A 3FTXA 4ZHBA 1YA0A 3ASDA 4JA7A 3B7SA 3MEKA 3CHSA 1TN8A 3CSTA 2Y69E 1KLXA 3SF4A 1QQEA 3RRMB 4RG6A 3ZRHA 4YDOA 4CDMA 4WAFA 3B13A 4TXRA 2VGYA 3UXGA 4J8DA 1A17A 4TUMA 4OVUA 4CYMD 2GW1A 5ANLA 4L1BA 4F1SA 2AW6A 3QKYA 3T5XA 2A4ZA 1IHBA 1HXIA 5D66A 3RO2A 2XPYA 2ZISA 3QWVA 1TYQG 5CCMA 4N39A 3NQPA 2KCVA 4HOQA 2IO3C 3FUDA 5A7DB 3ZU7B 5EILA 2BUGA 1XNFA 3IKOB 4TXPA 5AAOA 1U3DA 1L5JA 3D9OA 1WY6A 1TNZA 3PE4A 3ZYMA 2ZIRA 5D0QD 5HS0A 3QK0A 3U66A 3SI5A 3TXNA 5FZRA 4L9PA 2LNIA 5DIZA 2XCCA 4RG9A 2ZGDA 4PS3A 3RK6A 2VSXE 3UKUG 4E6HA 2Q7FA 2RFAA 4ANUA 3EJNA 3FH8A 3TGOA 3E37A 4RVBA 4F53A 3D9JA 3ASNE 3CVXA 4BT8A 5CMWA 1TN7A 3D9LA 4LSZE 1VDYA 3U9WA 4CDNA 3SFXA 1LD8A 2PQRA 1AWCB 3K9IA 3FTVA 3BG1B 3CVNA 3TWUA 4H7XA 1Z3XA 5KNHD 4DLQA 4A1GA 3QWWA 3X2QE 3SO8A 3DSWA 3HIZA 5EX0A 2IOSA 5CBNA 2EIJE 2VSNA 3TWWA 1JWGA 1MQSA 5B1BE 2WXNA 5G05C 5FQ6A 3W9GA 1H6OA 3EIQC 3Q79A 3CVUA 4GCOA 3BEEA 3PREA 5FZSA 5FTPA 3CHQA 3OXGA 1DVPA 4HLLA 1MX2A 4APOA 2AXVA 5CBOA 4GA0A 3EHNA 5FJYA 2J4BA 4DJAA 2H6GA 4HRNA 1QBQA 2XPZA 3D9NA 2LSUA 5A6CA 2GRPB 3ML8A 4U8YD 1SZAA 3D9KA 5ITZF 2BTDA 4UQYA 2B0OE 2Y3AA 1HO8A 5CCLA 5JJ6A 5FQ8A 3UM1A 4GA2A 2J8SD 3CV0A 4FULA 3CK7A 3MYVA 2LUHA 3L08A 4JHRA 3PDNA 1SW6A 5EX3A 2XCBA 4DX5D 1N11A 1LD7A 3Q15A 1E96B 2JABA 4I1AA 3KS2A 3FTSA 3DEPA 4DLOA 3FTZA 1Z5SC 4U95D 2GRRB 4U8HA 5AARA 4EZLA 2ETCA 3JQ0A 4ACKA 5JJ7A 2C2LA 2A5UA 1QYMA 4YDEA 3HVEA 3Q49B 3SY2A 3B7TA 2RG8A 1NZNA 3R7QA 3WG7E 3B7RL 1N0RA 4DX1A 2FO1E 3RO3A 1E8WA 2RKKA 2WXLA 2QZAA 1IQRA 2GRQB 4GTMA 3GW4A 3APFA 2Y1LE 3ZEFA 4ACLA 4ANVA 4LNGA 1BI8B 3HYMB 1H19A 3ZIMA 2DZOA 5AYWD 1H2TC 5ARGA 3ISMC 2R5SA 5B1AE 2H6FA 5CECB 4XI9A 3Q5MA 4C9BB 2KATA 1SVXA 2KZTB 4ABNA 3QDNA 4DI3A 3HXBA 4HI9A 3KD7A 4GTOA 2BF0X 4JW1A 4P29A 4FC8A 5KJKA 3C3QA 1N4RA 1BPOA 1H2UA 3URZA 3B7BA 4U04A 2WPVA 2V4LA 3Q4AB 4FU3A 1KZPA 2LXMA 3CHOA 1JCQA 4A63B 3ULYA 2X6JA 1TR4A 4W9RA 3PUKA 2WXOA 3T8MA 2FBNA 3PVLA 3UI2A 4URKA 3CQGB 2HR2A 2QFCA 4XZ4A 5G2NA 4N3CA 4JA9A 3UUXA 4YDWA 1OY3D 3Q7AA 5C1DA 2VTBB 4LUNU 2L0TB 1Q2ZA 3FFLA 2LAHA 1HX8A 4N3AA 3QARA 1O1RA 3UX4A 2IJGX 4UQXA 1E8ZA 2J09A 3FTYA 4XIFA 3TL5A 4GZ5A 3L82A 4EECA 3QJZA 1E90A 4I2WA 3LY7A 1ZU2A 4AY6A 4OVVA 3LKUA 4A55A 2WXJA 3SQVA 2MOWA 2FI7A 2XQ0A 3TWVA 4ATGA 3HXDA 2P9UG 3UKRG 3DRAA 3LVQE 3HG0D 3LYAA 3CVPA 5FINA 3PRZA 4X8QA 5CHEE 4AXHA 5FQ4A 5JMND 1LTXA 4LCTA 3ESLA 3CHPA 5IY5E 4JVSA 3CVYA 4CZ2D 4MKTA 3FHEA 2WXHA 3FUIA 4DI4A 3RJVA 4KT6B 5G55A 4GYYA 3BUAA 2P9NG 4JEUA 3CKCA 5ANRA 1DNPA 2KCLA 4KMOA 3ABLE 3EUVA 5G05J 1H6PA 3JYSA 3AS8A 2X3MA 3UIOC 5DBKA 4AOFA 4NIKA 1TNUA 2PM6A 5CMYA 2VGXB 3UTMA 2XRZA 4O1OA 4HVBA 3AG1E 2I1JA 4EHMA 2YHEA 2XGOA 4J8SA 1EYHA 2Y4UA 4UI9C 4HQDA 1PY1A 3RRNB 3W9FA 4B0ZA 3FUHA 5CRVA 3TJPA 3ONLA 4LEUA 4UWHA 4F3VA 2FULA 4G25A 2EILE 3MKRA 3CEQA 2ZGGA 2EIKE 4JXTA 1NL4A 3KEAA 3Q78A 5LP0A 3GZ2A 3GYZA 1KPSB 4G2VA 5FZQA 1A5EA 2OV8A 2OCCE 1S64A 2GRMA 3QOUA 3E33A 2RFMA 1DCEA 1UJJA 2ETBA 4BY6A 2OOEA 1JPLA 3FTUA 3ZGQA 1SQMA 4FLBA 1HS6A 4HORA 4XKCA 4WNEA 1UN9A 2AXUA 1NA3A 5AQ7A 5KJMA 2YNQA 2KXPC 4RLYA 3EHQA 2DWZA 2P58C 3VLFA 1BU9A 1MX6A 4G26A 3TAXA 3JXIA 2LSVA 3Q7FA 1E8YA 1K3ZD 2EINE 2HE0A 1GW6A 2I1KA 3V79K 1HG5A 3MV2B 2KM4A 2L0IA 1PAQA 2DZNA 3RAUA 2F8XK 2OVBA 2QY7A 1W3BA 4Z68A 4MLPA 4CRWA 4FADA 3U4TA 4GAAA 4LERA 1FVFA 4ME2A 3CQCB 2BEDA 2ZXWE 5KJLA 4F6RD 4UWFA 2Y0BG 3NOGD 4JPSA 3IEGA 4G11A 1P5QA 4K0RA 3AG2E 1LF8A 4UWLA 2MHKA 3SBSA 3MKQA 3LVRE 3CHRA 2BKGA 2V5QC 1MX4A 4BERA 3UT8A 1NP7A 2VTBA 3P2BA 5BXOA 2F8YA 4U63A 2MRIA 2J49A 3NAWA 3J5QB 2XEHA 3HDXA 4JHJA 3ASOE 4F1PA 1IQUA 1Y6IA 3JUIA 3CHMA 4EZJA 1YYHA 5JHAA 1OWNA 1HF8A 3R7RA 3SFZA 2GROB 1NI1A 3S7JA 1N4QA 2V5FA 3FUEA 2KZTA 4WWOA 5HKPA 5C2YA 1MJ0A 4CT0A 4QQIA 3SD5A 5BW8C 4FA6A 2V4HC 3ZXPA 1D9SA 2WXPA 5AENA 3L6AA 3C3OA 5FIOA 1E8XA 2WB2A 4C0EA 1FCHA 3CVLA 3D3MA 4HBDA 1UG3A 1TJFA 5ENPD 1TEZA 2DYRE 3EDTB 5AQAA 2YINA 4GZ3A 3E4BA 4HRLA 3E32A 1U2VG 3D9IA 3UINC 4EBAA 1ELWA 3S7BA 3OTNA 4AEZC 4WWPA 2AVPA 5LCWJ 2IU1A 3UM0A 3ABKE 4HRMB 1ELRA 4GPMA 2WVIA 3ENEA 4LRZA 5ENOD 5G04C 4OAVB 3LY9A 2YHCA 4AP2A 3I3NA 4I2ZA 3ULEG 4J8FA 3SNXA 4HOSA 3ZPJA 1OWPA 3FULA 1NA0A 5ENQD 4EBAG 1E7UA 3MJWA 2R59A 3L13A 3SBTB 4C48B 3TG4A 2IONA 2MYOA 4ANWA 1N4SA 4GZCA 4HOTA 4DX7D 4N3BA 4ZFHA 4YDYA 4JB8P 3TWTA 1OWMA 3B7UX 3ASHA 3FU3A 4GZDA 3BG0B 2L6JA 2IEJA 4RSYA 1N94A 4KZ0A 3FTWA 4AIFA 4DK5A 3FP3A 3RKVA 4B93B 2OEVA 4YVOA 1H2VC 3FU6A 2NC9A 4CGVA 4HNAD 4Q96A 2J4DA 2UWJG 5EIBE 4TUUA 4GTTA 1WDYA 5HRYA 4U8VD 1B89A 4UWKA 5HQ8A 5JHBA 4DX6D 1SA5A 4J8EA 3PNLB 2CFUA 4BTAA 1SA4A 3IHVA 4Y6CA 4LG6A 3ZHEB 5LX8A 4ANXA 2R03A 2H6IA 3CIAA 1IYGA 2OEWA 2X6KA 3UT7A 5CEDB 4ILIA 4J7WA 4V3IA 3MX3A 1EDUA 2PQNA 3V2XA 3APDA 5BUZA 3FEXA 2OVFA 3CLJA 2DIWA 4HLEA 3PNTB 3D9PA 2VJ8A 3DSTA 1KZOA 2IQCA 2J08A 3QNKA 2XENA 4GTRA 3I4RB 5J08A 4I6GA 3LJ3A 2X6HA 4FLHA 2E0IA 3EIJA 3PH0C 4FHKA 4UWGA 4M3OA 1OWLA 2L6BA 3ZKJA 4EZKA 1K1BA 4YNDA 5T4YA 4L2LA 3UPVA 2HM8A 2DYSE 4BTBA 4XE0A 2I9CA 4IN3B 5EYPF 3UQ3A 4BSXA 2J9QA 4A3TA 1V55E 5AIJA 3T8KA 3CSFA 5A23A 3NB2A 4XX5A 4MBGA 4U0UA 3J5PA 4JC8A 1OCCE 1G3NB 1ELKA 3CVVA 3VTYA 4YVQC 4KBQA 4AM9A 4AY5A 1S70B 1K1AA 4L23A 5EKQD 4CEMA 4PDXA 4I6EA 1DCQA 3L16A 1N9AA 3G2SA 4K5AB 3DSUA 3RIBA 4WWNA 4LNUD 1AP7A 3NZUA 4UI9K 3KEZA 3C98A 4B89A 2IY0C 3VLDA 4BX8A 3BU8A 3RU0A 5BXUA 2V0PA 3FWVA 2WXMA 3JXJA 3MV3B 2LAIA 3DXMG 3F6QA 4GPKA 5ARFA 2R02A 3OXFA 5BT1A 4ILHB 4IRUA 3KAEA 2M63A 3ZVVA 1INZA 1BLXB 3L54A 4O60A 4I9CA 3ONKA 1X81A 3DPDA 3V30A 3RRUA 3T5VA 3UIPC 4XEIG 5KJNA 2ZU6B 5KCMA 2XGMA 3G2VA 2VGEA 4GTVA 1O5MA 1X5BA 3D9HA 4WNFA 3FUJA 2NSZA 4J6IA 3C5RA 3V2OA 1D8EA 2WQHA 4B8AA 2QYUA 4K5CA 5BV1A 2KC7A 1BD8A 1UJKA 3OXLA 4AVXA 3L17A 4WNDA 4I17A 4JD2G 2DCPA 3S7DA 4NQ0A 5D0OD 5EDSA 4H7YA 4GTSA 3KSLA 4CDRA 2YQ8A 3PE3A 4J0UA 4KYOB 4JL0A 3MCXA 5EN5D 3FH5A 5G04J 5B3SE 2KCKA 4BEPA 4KVOA 4N5QA 3HVEB 2VSOE 3CK8A 2FF4A 3V31A 5T8IA 1S63A 4U07A 4EPZA 1WAO1 3QAQA 3TG5A 4AV7A 3G2WA 5M72A 1KT0A 4FP7A 2WMNA 1OT8A 2EIME 4J8YA 3UMVA 2P9LG 1Z3YA 1V54E 2R05A 3P1UA 3G2UA 3EU9A 3TWSA 3VTXA 4G24A 3HRAA 1N4PA 5LOZA 1MHQA 2RD0A 3AJIA 3PEVB 2QYJA 3O4ZA 4U0ZA 3TXMA 2IFUA 1KT1A 5JA4D 3ML9A 3NOCD 1TNOA 3LCAA 4A3VA 1ZBPA 3PS6A 3IXEA 2IF4A 1SZ9A 1YMPA 4DX2A 3S7FA 3AG3E 4XI0A 1RW2A 2AJAA 1OCOE 3U3WA 4FHJA 4PS8A 1UOHA 3APCA 4LNBA 2CHZA 2AXZA 1D8DA 2DVWA 4NURA 3UM3A 5KNGA 3DWLG 4XKBA 5E76A 5JJTA 5LFAA 3DBSA 1H0AA 1IXVA 3ASFA 4D10C 3JQ1A 3OAWA 4G1TA 3ZYLA 3RSEG 4IULA 3ZUVB 4AJWA 4E85A 3FUMA 4JHKA 2WQ7A 4HFGA 3Q75A 2CHXA 4HS2A 5FWQA 4N2QA 1N95A 2H6HA 5BNWA 2GRLA 1JCSA 4A1SA 4GMLA 1MYOA 5HI7A 4R7LA 4C0MA 2VYIA 2CG2A 3UT4A 3DSVA 1FVHA 2B6CA 3SGHA 2XPIA 3S2AA 3Q73A 3FU0A 4HI8A 4HXIA 3DPYA 3QB2A 2X38A 3FUFA 1S0PA 3I4GA 4GYWA 2P9IG 1IHGA 2NXPA 2PZIA 4WNGA 2GGFA 1H6KA 3LDZA 3CGHA 1Y8MA 2V8SE 4UI9J 2X6IA 3KSQA 3TWQA 1N54A 3TWXA 4CGWA 2XRYA 5H7PA 2UY1B 5D2MC 5AQBA 3L22A 2WXIA 2C0LA 4KZCA 3FUNA 4IYPA 4GTPA 2WQ6A 2WXKA 2IO2C 1FPPA 2HO1A 2DBAA 5BPPA 2XEEA 5CEAA 2C0MA 5LCWC 3ZNGA 3PZ1A 2P9KG 2WXQA 4BX9A 3BQOA 4MS6A 5EIDA 3PEUB 4FJYA 4DUIA 3FUKA 3ASGA 3JCKC 3ULQA 3ZXSA 4QFVA 5FQ7A 4GZ6A 2VSYA 2E2EA 3FDHA 3WXXA 1TNYA 2JEKA 3AS5A 3EHRA 3MGBA 1EPUA 3LS8A 4PS7A 4WUYA 4HB5A 2P9PG 4MRUA 3EU5A 1FT1A 3DXKG 2WM9A 3PZDA 4GB9A 5AQ9A 1U3CA 2L9BA 1TJCA 3SHFA 2CFZA 5AN8A 1Z6TA 2XZTG 4BSZB 4N5CA 4BETA 1OCRE 3ABME 4B94A 3HXFA 4I1MA 4GA1A 3FEYA 1FT2A 4DPRA 1DC2A 2UY1A 4GCNA 3GZ1A 3PUJA 1O1TA 3ESKA 4UQZA 1JWFA 3CVWA 1JUQA 4TV3A 4GMJA 4JEHA 2CHWA 4U96D 3R9AB 4O1PA 4G8LA
chains in the Genus database with same CATH topology
2H6IA 4LNBA 1D8DA 3Q7AA 4GTMA 4GTPA 1N9AA 1TNZA 3Q79A 3DSUA 2ZIRA 1FPPA 1TNUA 1N4SA 1O1RA 2F0YA 4GTSA 3KSLA 4LNGA 3PZ1A 3PZ3A 4L9PA 3Q75A 3Q7FA 4EHMA 2H6GA 1N95A 2H6HA 3PZ4A 1JCSA 1QBQA 1NI1A 1O1SA 3DSTA 1KZOA 1N4QA 3HXDA 1S63A 2H6FA 3DRAA 2IEJA 3DSXA 4GTRA 3E37A 3HXCA 1N94A 1TNYA 1TNBA 1MZCA 3E30A 2R2LA 3DSVA 3PZ2A 3HXBA 3Q73A 1TN8A 3EU5A 1FT1A 1LTXA 1TN6A 4GTOA 1TN7A 1NL4A 3DPYA 1N4PA 1X81A 3Q78A 1N4RA 3DSSA 1LD7A 3E34A 2BEDA 4YDOA 1TNOA 3C72A 4GTTA 1S64A 1KZPA 3SFXA 3E33A 1LD8A 1DCEA 3HXFA 4GTVA 1JCQA 3HXEA 3E32A 1JCRA 1O5MA 3KSQA 1SA5A 1FT2A 3SFYA 2ZISA 4GTQA 1O1TA 4YDEA 4MBGA 1SA4A 1D8EA 3DSWA 3EUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6I A;  4LNB A;  1D8D A;  3Q7A A;  4GTM A;  4GTP A;  1N9A A;  1TNZ A;  3Q79 A;  3DSU A;  2ZIR A;  1FPP A;  1TNU A;  1N4S A;  1O1R A;  2F0Y A;  4GTS A;  3KSL A;  4LNG A;  3PZ1 A;  3PZ3 A;  4L9P A;  3Q75 A;  3Q7F A;  4EHM A;  2H6G A;  1N95 A;  2H6H A;  3PZ4 A;  1JCS A;  1QBQ A;  1NI1 A;  1O1S A;  3DST A;  1KZO A;  1N4Q A;  3HXD A;  1S63 A;  2H6F A;  3DRA A;  2IEJ A;  3DSX A;  4GTR A;  3E37 A;  3HXC A;  1N94 A;  1TNY A;  1TNB A;  1MZC A;  3E30 A;  2R2L A;  3DSV A;  3PZ2 A;  3HXB A;  3Q73 A;  1TN8 A;  3EU5 A;  1FT1 A;  1LTX A;  1TN6 A;  4GTO A;  1TN7 A;  1NL4 A;  3DPY A;  1N4P A;  1X81 A;  3Q78 A;  1N4R A;  3DSS A;  1LD7 A;  3E34 A;  2BED A;  4YDO A;  1TNO A;  3C72 A;  4GTT A;  1S64 A;  1KZP A;  3SFX A;  3E33 A;  1LD8 A;  1DCE A;  3HXF A;  4GTV A;  1JCQ A;  3HXE A;  3E32 A;  1JCR A;  1O5M A;  3KSQ A;  1SA5 A;  1FT2 A;  3SFY A;  2ZIS A;  4GTQ A;  1O1T A;  4YDE A;  4MBG A;  1SA4 A;  1D8E A;  3DSW A;  3EUV A; 
#chains in the Genus database with same CATH topology
 4I43 A;  4RQI A;  5KWD A;  2X6F A;  2QC9 A;  3FH7 A;  4L7T A;  1WG0 A;  4Q69 A;  3CR3 A;  4GMR A;  2KBX A;  2P9S G;  3NZS A;  3FY4 A;  4NRH B;  3NF1 A;  2F37 A;  1PC2 A;  4CCA A;  2PNN A;  2VQ2 A;  2ETA A;  1QNF A;  1OWO A;  3IV0 A;  2WMO A;  3PZ4 A;  1O1S A;  4TRQ A;  5EYL A;  4I1O B;  1IKN D;  2XHE A;  3U64 A;  1HU3 A;  2PL2 A;  2I2O A;  3R9M A;  3DSX A;  3C3R A;  3HXC A;  3AG4 E;  1TNB A;  2XS8 A;  1XGW A;  3JUE A;  1HZ4 A;  3HHM A;  5AJD A;  4B8C B;  2AWI A;  2XGS A;  3MZL B;  3PZ2 A;  4ILG A;  4F7A A;  2WXF A;  5CER B;  3ZW3 A;  4M7C A;  4O6F A;  1TN6 A;  2FO7 A;  2WXR A;  4BWR A;  1ZB1 A;  4Q94 A;  4TXQ A;  3DSS A;  3E34 A;  5BV0 A;  3AU4 A;  3Q9N C;  3LXU X;  5FT9 A;  4BFR A;  2OND A;  1N0Q A;  2HYZ A;  2WXG A;  2I6H A;  4I9E A;  3C72 A;  3CKB A;  4KXK B;  3ZHE A;  4ATZ D;  4N2S A;  4OAU C;  3L9T A;  3HXE A;  1JCR A;  4CT4 A;  4NAC A;  2XZD G;  1HE8 A;  3SFY A;  4GTQ A;  4K5B A;  2Y4T A;  4DRX E;  4HOU A;  2XEV A;  4FJZ A;  1HH8 A;  1QZ2 A;  3LPZ A;  3IBE A;  3MKQ B;  3Q47 B;  3G2T A;  4UUC A;  2GRN B;  3LY8 A;  5CRU A;  3D9M A;  4GYO A;  5KBA A;  1UN8 A;  4PUC A;  2NYJ A;  4OYS A;  3GZS A;  2VGX A;  2F0Y A;  3PZ3 A;  2CG3 A;  4U0S A;  5E75 A;  1YCS B;  4L2Y A;  5J90 A;  4Y6W A;  3T9K A;  4G8K A;  1MZC A;  4BT9 A;  3O48 A;  4U7E B;  5ENN A;  3E30 A;  2R2L A;  1OUV A;  4APF A;  4JZY A;  3AU5 A;  2XS1 A;  3CVQ A;  3VLE A;  2FEZ A;  1NFI E;  3B95 A;  3Q9U C;  1OXJ A;  5ENS D;  3TWR A;  1BI7 B;  2BKK B;  1WM5 A;  2P2C P;  3SZ7 A;  2R17 C;  1N52 A;  4K03 A;  4PH4 B;  3NBN B;  3AAA C;  2PM7 A;  2ILR A;  3QWP A;  4KVM A;  2J07 A;  1HFA A;  3ZN3 A;  4BES A;  3I5P A;  1UW4 B;  3LJN A;  3EHM A;  2A5E A;  3LEW A;  1RZ4 A;  2LXL A;  4GU5 A;  3MA5 A;  4G23 A;  3ZYQ A;  2JLB A;  1EF1 C;  1K8K G;  4EQF A;  3CK9 A;  3ZYK A;  5AJL A;  2IOL A;  2EQX A;  3AS4 A;  5ENR D;  3UM2 A;  3QC1 A;  1E7V A;  5ENT D;  1OCZ E;  4I6J A;  3IHY A;  3ZFW A;  5T3R A;  3N71 A;  2LO6 A;  3FU5 A;  3DEO A;  1HG2 A;  3FTX A;  4ZHB A;  1YA0 A;  3ASD A;  4JA7 A;  3B7S A;  3MEK A;  3CHS A;  1TN8 A;  3CST A;  2Y69 E;  1KLX A;  3SF4 A;  1QQE A;  3RRM B;  4RG6 A;  3ZRH A;  4YDO A;  4CDM A;  4WAF A;  3B13 A;  4TXR A;  2VGY A;  3UXG A;  4J8D A;  1A17 A;  4TUM A;  4OVU A;  4CYM D;  2GW1 A;  5ANL A;  4L1B A;  4F1S A;  2AW6 A;  3QKY A;  3T5X A;  2A4Z A;  1IHB A;  1HXI A;  5D66 A;  3RO2 A;  2XPY A;  2ZIS A;  3QWV A;  1TYQ G;  5CCM A;  4N39 A;  3NQP A;  2KCV A;  4HOQ A;  2IO3 C;  3FUD A;  5A7D B;  3ZU7 B;  5EIL A;  2BUG A;  1XNF A;  3IKO B;  4TXP A;  5AAO A;  1U3D A;  1L5J A;  3D9O A;  1WY6 A;  1TNZ A;  3PE4 A;  3ZYM A;  2ZIR A;  5D0Q D;  5HS0 A;  3QK0 A;  3U66 A;  3SI5 A;  3TXN A;  5FZR A;  4L9P A;  2LNI A;  5DIZ A;  2XCC A;  4RG9 A;  2ZGD A;  4PS3 A;  3RK6 A;  2VSX E;  3UKU G;  4E6H A;  2Q7F A;  2RFA A;  4ANU A;  3EJN A;  3FH8 A;  3TGO A;  3E37 A;  4RVB A;  4F53 A;  3D9J A;  3ASN E;  3CVX A;  4BT8 A;  5CMW A;  1TN7 A;  3D9L A;  4LSZ E;  1VDY A;  3U9W A;  4CDN A;  3SFX A;  1LD8 A;  2PQR A;  1AWC B;  3K9I A;  3FTV A;  3BG1 B;  3CVN A;  3TWU A;  4H7X A;  1Z3X A;  5KNH D;  4DLQ A;  4A1G A;  3QWW A;  3X2Q E;  3SO8 A;  3DSW A;  3HIZ A;  5EX0 A;  2IOS A;  5CBN A;  2EIJ E;  2VSN A;  3TWW A;  1JWG A;  1MQS A;  5B1B E;  2WXN A;  5G05 C;  5FQ6 A;  3W9G A;  1H6O A;  3EIQ C;  3Q79 A;  3CVU A;  4GCO A;  3BEE A;  3PRE A;  5FZS A;  5FTP A;  3CHQ A;  3OXG A;  1DVP A;  4HLL A;  1MX2 A;  4APO A;  2AXV A;  5CBO A;  4GA0 A;  3EHN A;  5FJY A;  2J4B A;  4DJA A;  2H6G A;  4HRN A;  1QBQ A;  2XPZ A;  3D9N A;  2LSU A;  5A6C A;  2GRP B;  3ML8 A;  4U8Y D;  1SZA A;  3D9K A;  5ITZ F;  2BTD A;  4UQY A;  2B0O E;  2Y3A A;  1HO8 A;  5CCL A;  5JJ6 A;  5FQ8 A;  3UM1 A;  4GA2 A;  2J8S D;  3CV0 A;  4FUL A;  3CK7 A;  3MYV A;  2LUH A;  3L08 A;  4JHR A;  3PDN A;  1SW6 A;  5EX3 A;  2XCB A;  4DX5 D;  1N11 A;  1LD7 A;  3Q15 A;  1E96 B;  2JAB A;  4I1A A;  3KS2 A;  3FTS A;  3DEP A;  4DLO A;  3FTZ A;  1Z5S C;  4U95 D;  2GRR B;  4U8H A;  5AAR A;  4EZL A;  2ETC A;  3JQ0 A;  4ACK A;  5JJ7 A;  2C2L A;  2A5U A;  1QYM A;  4YDE A;  3HVE A;  3Q49 B;  3SY2 A;  3B7T A;  2RG8 A;  1NZN A;  3R7Q A;  3WG7 E;  3B7R L;  1N0R A;  4DX1 A;  2FO1 E;  3RO3 A;  1E8W A;  2RKK A;  2WXL A;  2QZA A;  1IQR A;  2GRQ B;  4GTM A;  3GW4 A;  3APF A;  2Y1L E;  3ZEF A;  4ACL A;  4ANV A;  4LNG A;  1BI8 B;  3HYM B;  1H19 A;  3ZIM A;  2DZO A;  5AYW D;  1H2T C;  5ARG A;  3ISM C;  2R5S A;  5B1A E;  2H6F A;  5CEC B;  4XI9 A;  3Q5M A;  4C9B B;  2KAT A;  1SVX A;  2KZT B;  4ABN A;  3QDN A;  4DI3 A;  3HXB A;  4HI9 A;  3KD7 A;  4GTO A;  2BF0 X;  4JW1 A;  4P29 A;  4FC8 A;  5KJK A;  3C3Q A;  1N4R A;  1BPO A;  1H2U A;  3URZ A;  3B7B A;  4U04 A;  2WPV A;  2V4L A;  3Q4A B;  4FU3 A;  1KZP A;  2LXM A;  3CHO A;  1JCQ A;  4A63 B;  3ULY A;  2X6J A;  1TR4 A;  4W9R A;  3PUK A;  2WXO A;  3T8M A;  2FBN A;  3PVL A;  3UI2 A;  4URK A;  3CQG B;  2HR2 A;  2QFC A;  4XZ4 A;  5G2N A;  4N3C A;  4JA9 A;  3UUX A;  4YDW A;  1OY3 D;  3Q7A A;  5C1D A;  2VTB B;  4LUN U;  2L0T B;  1Q2Z A;  3FFL A;  2LAH A;  1HX8 A;  4N3A A;  3QAR A;  1O1R A;  3UX4 A;  2IJG X;  4UQX A;  1E8Z A;  2J09 A;  3FTY A;  4XIF A;  3TL5 A;  4GZ5 A;  3L82 A;  4EEC A;  3QJZ A;  1E90 A;  4I2W A;  3LY7 A;  1ZU2 A;  4AY6 A;  4OVV A;  3LKU A;  4A55 A;  2WXJ A;  3SQV A;  2MOW A;  2FI7 A;  2XQ0 A;  3TWV A;  4ATG A;  3HXD A;  2P9U G;  3UKR G;  3DRA A;  3LVQ E;  3HG0 D;  3LYA A;  3CVP A;  5FIN A;  3PRZ A;  4X8Q A;  5CHE E;  4AXH A;  5FQ4 A;  5JMN D;  1LTX A;  4LCT A;  3ESL A;  3CHP A;  5IY5 E;  4JVS A;  3CVY A;  4CZ2 D;  4MKT A;  3FHE A;  2WXH A;  3FUI A;  4DI4 A;  3RJV A;  4KT6 B;  5G55 A;  4GYY A;  3BUA A;  2P9N G;  4JEU A;  3CKC A;  5ANR A;  1DNP A;  2KCL A;  4KMO A;  3ABL E;  3EUV A;  5G05 J;  1H6P A;  3JYS A;  3AS8 A;  2X3M A;  3UIO C;  5DBK A;  4AOF A;  4NIK A;  1TNU A;  2PM6 A;  5CMY A;  2VGX B;  3UTM A;  2XRZ A;  4O1O A;  4HVB A;  3AG1 E;  2I1J A;  4EHM A;  2YHE A;  2XGO A;  4J8S A;  1EYH A;  2Y4U A;  4UI9 C;  4HQD A;  1PY1 A;  3RRN B;  3W9F A;  4B0Z A;  3FUH A;  5CRV A;  3TJP A;  3ONL A;  4LEU A;  4UWH A;  4F3V A;  2FUL A;  4G25 A;  2EIL E;  3MKR A;  3CEQ A;  2ZGG A;  2EIK E;  4JXT A;  1NL4 A;  3KEA A;  3Q78 A;  5LP0 A;  3GZ2 A;  3GYZ A;  1KPS B;  4G2V A;  5FZQ A;  1A5E A;  2OV8 A;  2OCC E;  1S64 A;  2GRM A;  3QOU A;  3E33 A;  2RFM A;  1DCE A;  1UJJ A;  2ETB A;  4BY6 A;  2OOE A;  1JPL A;  3FTU A;  3ZGQ A;  1SQM A;  4FLB A;  1HS6 A;  4HOR A;  4XKC A;  4WNE A;  1UN9 A;  2AXU A;  1NA3 A;  5AQ7 A;  5KJM A;  2YNQ A;  2KXP C;  4RLY A;  3EHQ A;  2DWZ A;  2P58 C;  3VLF A;  1BU9 A;  1MX6 A;  4G26 A;  3TAX A;  3JXI A;  2LSV A;  3Q7F A;  1E8Y A;  1K3Z D;  2EIN E;  2HE0 A;  1GW6 A;  2I1K A;  3V79 K;  1HG5 A;  3MV2 B;  2KM4 A;  2L0I A;  1PAQ A;  2DZN A;  3RAU A;  2F8X K;  2OVB A;  2QY7 A;  1W3B A;  4Z68 A;  4MLP A;  4CRW A;  4FAD A;  3U4T A;  4GAA A;  4LER A;  1FVF A;  4ME2 A;  3CQC B;  2BED A;  2ZXW E;  5KJL A;  4F6R D;  4UWF A;  2Y0B G;  3NOG D;  4JPS A;  3IEG A;  4G11 A;  1P5Q A;  4K0R A;  3AG2 E;  1LF8 A;  4UWL A;  2MHK A;  3SBS A;  3MKQ A;  3LVR E;  3CHR A;  2BKG A;  2V5Q C;  1MX4 A;  4BER A;  3UT8 A;  1NP7 A;  2VTB A;  3P2B A;  5BXO A;  2F8Y A;  4U63 A;  2MRI A;  2J49 A;  3NAW A;  3J5Q B;  2XEH A;  3HDX A;  4JHJ A;  3ASO E;  4F1P A;  1IQU A;  1Y6I A;  3JUI A;  3CHM A;  4EZJ A;  1YYH A;  5JHA A;  1OWN A;  1HF8 A;  3R7R A;  3SFZ A;  2GRO B;  1NI1 A;  3S7J A;  1N4Q A;  2V5F A;  3FUE A;  2KZT A;  4WWO A;  5HKP A;  5C2Y A;  1MJ0 A;  4CT0 A;  4QQI A;  3SD5 A;  5BW8 C;  4FA6 A;  2V4H C;  3ZXP A;  1D9S A;  2WXP A;  5AEN A;  3L6A A;  3C3O A;  5FIO A;  1E8X A;  2WB2 A;  4C0E A;  1FCH A;  3CVL A;  3D3M A;  4HBD A;  1UG3 A;  1TJF A;  5ENP D;  1TEZ A;  2DYR E;  3EDT B;  5AQA A;  2YIN A;  4GZ3 A;  3E4B A;  4HRL A;  3E32 A;  1U2V G;  3D9I A;  3UIN C;  4EBA A;  1ELW A;  3S7B A;  3OTN A;  4AEZ C;  4WWP A;  2AVP A;  5LCW J;  2IU1 A;  3UM0 A;  3ABK E;  4HRM B;  1ELR A;  4GPM A;  2WVI A;  3ENE A;  4LRZ A;  5ENO D;  5G04 C;  4OAV B;  3LY9 A;  2YHC A;  4AP2 A;  3I3N A;  4I2Z A;  3ULE G;  4J8F A;  3SNX A;  4HOS A;  3ZPJ A;  1OWP A;  3FUL A;  1NA0 A;  5ENQ D;  4EBA G;  1E7U A;  3MJW A;  2R59 A;  3L13 A;  3SBT B;  4C48 B;  3TG4 A;  2ION A;  2MYO A;  4ANW A;  1N4S A;  4GZC A;  4HOT A;  4DX7 D;  4N3B A;  4ZFH A;  4YDY A;  4JB8 P;  3TWT A;  1OWM A;  3B7U X;  3ASH A;  3FU3 A;  4GZD A;  3BG0 B;  2L6J A;  2IEJ A;  4RSY A;  1N94 A;  4KZ0 A;  3FTW A;  4AIF A;  4DK5 A;  3FP3 A;  3RKV A;  4B93 B;  2OEV A;  4YVO A;  1H2V C;  3FU6 A;  2NC9 A;  4CGV A;  4HNA D;  4Q96 A;  2J4D A;  2UWJ G;  5EIB E;  4TUU A;  4GTT A;  1WDY A;  5HRY A;  4U8V D;  1B89 A;  4UWK A;  5HQ8 A;  5JHB A;  4DX6 D;  1SA5 A;  4J8E A;  3PNL B;  2CFU A;  4BTA A;  1SA4 A;  3IHV A;  4Y6C A;  4LG6 A;  3ZHE B;  5LX8 A;  4ANX A;  2R03 A;  2H6I A;  3CIA A;  1IYG A;  2OEW A;  2X6K A;  3UT7 A;  5CED B;  4ILI A;  4J7W A;  4V3I A;  3MX3 A;  1EDU A;  2PQN A;  3V2X A;  3APD A;  5BUZ A;  3FEX A;  2OVF A;  3CLJ A;  2DIW A;  4HLE A;  3PNT B;  3D9P A;  2VJ8 A;  3DST A;  1KZO A;  2IQC A;  2J08 A;  3QNK A;  2XEN A;  4GTR A;  3I4R B;  5J08 A;  4I6G A;  3LJ3 A;  2X6H A;  4FLH A;  2E0I A;  3EIJ A;  3PH0 C;  4FHK A;  4UWG A;  4M3O A;  1OWL A;  2L6B A;  3ZKJ A;  4EZK A;  1K1B A;  4YND A;  5T4Y A;  4L2L A;  3UPV A;  2HM8 A;  2DYS E;  4BTB A;  4XE0 A;  2I9C A;  4IN3 B;  5EYP F;  3UQ3 A;  4BSX A;  2J9Q A;  4A3T A;  1V55 E;  5AIJ A;  3T8K A;  3CSF A;  5A23 A;  3NB2 A;  4XX5 A;  4MBG A;  4U0U A;  3J5P A;  4JC8 A;  1OCC E;  1G3N B;  1ELK A;  3CVV A;  3VTY A;  4YVQ C;  4KBQ A;  4AM9 A;  4AY5 A;  1S70 B;  1K1A A;  4L23 A;  5EKQ D;  4CEM A;  4PDX A;  4I6E A;  1DCQ A;  3L16 A;  1N9A A;  3G2S A;  4K5A B;  3DSU A;  3RIB A;  4WWN A;  4LNU D;  1AP7 A;  3NZU A;  4UI9 K;  3KEZ A;  3C98 A;  4B89 A;  2IY0 C;  3VLD A;  4BX8 A;  3BU8 A;  3RU0 A;  5BXU A;  2V0P A;  3FWV A;  2WXM A;  3JXJ A;  3MV3 B;  2LAI A;  3DXM G;  3F6Q A;  4GPK A;  5ARF A;  2R02 A;  3OXF A;  5BT1 A;  4ILH B;  4IRU A;  3KAE A;  2M63 A;  3ZVV A;  1INZ A;  1BLX B;  3L54 A;  4O60 A;  4I9C A;  3ONK A;  1X81 A;  3DPD A;  3V30 A;  3RRU A;  3T5V A;  3UIP C;  4XEI G;  5KJN A;  2ZU6 B;  5KCM A;  2XGM A;  3G2V A;  2VGE A;  4GTV A;  1O5M A;  1X5B A;  3D9H A;  4WNF A;  3FUJ A;  2NSZ A;  4J6I A;  3C5R A;  3V2O A;  1D8E A;  2WQH A;  4B8A A;  2QYU A;  4K5C A;  5BV1 A;  2KC7 A;  1BD8 A;  1UJK A;  3OXL A;  4AVX A;  3L17 A;  4WND A;  4I17 A;  4JD2 G;  2DCP A;  3S7D A;  4NQ0 A;  5D0O D;  5EDS A;  4H7Y A;  4GTS A;  3KSL A;  4CDR A;  2YQ8 A;  3PE3 A;  4J0U A;  4KYO B;  4JL0 A;  3MCX A;  5EN5 D;  3FH5 A;  5G04 J;  5B3S E;  2KCK A;  4BEP A;  4KVO A;  4N5Q A;  3HVE B;  2VSO E;  3CK8 A;  2FF4 A;  3V31 A;  5T8I A;  1S63 A;  4U07 A;  4EPZ A;  1WAO 1;  3QAQ A;  3TG5 A;  4AV7 A;  3G2W A;  5M72 A;  1KT0 A;  4FP7 A;  2WMN A;  1OT8 A;  2EIM E;  4J8Y A;  3UMV A;  2P9L G;  1Z3Y A;  1V54 E;  2R05 A;  3P1U A;  3G2U A;  3EU9 A;  3TWS A;  3VTX A;  4G24 A;  3HRA A;  1N4P A;  5LOZ A;  1MHQ A;  2RD0 A;  3AJI A;  3PEV B;  2QYJ A;  3O4Z A;  4U0Z A;  3TXM A;  2IFU A;  1KT1 A;  5JA4 D;  3ML9 A;  3NOC D;  1TNO A;  3LCA A;  4A3V A;  1ZBP A;  3PS6 A;  3IXE A;  2IF4 A;  1SZ9 A;  1YMP A;  4DX2 A;  3S7F A;  3AG3 E;  4XI0 A;  1RW2 A;  2AJA A;  1OCO E;  3U3W A;  4FHJ A;  4PS8 A;  1UOH A;  3APC A;  4LNB A;  2CHZ A;  2AXZ A;  1D8D A;  2DVW A;  4NUR A;  3UM3 A;  5KNG A;  3DWL G;  4XKB A;  5E76 A;  5JJT A;  5LFA A;  3DBS A;  1H0A A;  1IXV A;  3ASF A;  4D10 C;  3JQ1 A;  3OAW A;  4G1T A;  3ZYL A;  3RSE G;  4IUL A;  3ZUV B;  4AJW A;  4E85 A;  3FUM A;  4JHK A;  2WQ7 A;  4HFG A;  3Q75 A;  2CHX A;  4HS2 A;  5FWQ A;  4N2Q A;  1N95 A;  2H6H A;  5BNW A;  2GRL A;  1JCS A;  4A1S A;  4GML A;  1MYO A;  5HI7 A;  4R7L A;  4C0M A;  2VYI A;  2CG2 A;  3UT4 A;  3DSV A;  1FVH A;  2B6C A;  3SGH A;  2XPI A;  3S2A A;  3Q73 A;  3FU0 A;  4HI8 A;  4HXI A;  3DPY A;  3QB2 A;  2X38 A;  3FUF A;  1S0P A;  3I4G A;  4GYW A;  2P9I G;  1IHG A;  2NXP A;  2PZI A;  4WNG A;  2GGF A;  1H6K A;  3LDZ A;  3CGH A;  1Y8M A;  2V8S E;  4UI9 J;  2X6I A;  3KSQ A;  3TWQ A;  1N54 A;  3TWX A;  4CGW A;  2XRY A;  5H7P A;  2UY1 B;  5D2M C;  5AQB A;  3L22 A;  2WXI A;  2C0L A;  4KZC A;  3FUN A;  4IYP A;  4GTP A;  2WQ6 A;  2WXK A;  2IO2 C;  1FPP A;  2HO1 A;  2DBA A;  5BPP A;  2XEE A;  5CEA A;  2C0M A;  5LCW C;  3ZNG A;  3PZ1 A;  2P9K G;  2WXQ A;  4BX9 A;  3BQO A;  4MS6 A;  5EID A;  3PEU B;  4FJY A;  4DUI A;  3FUK A;  3ASG A;  3JCK C;  3ULQ A;  3ZXS A;  4QFV A;  5FQ7 A;  4GZ6 A;  2VSY A;  2E2E A;  3FDH A;  3WXX A;  1TNY A;  2JEK A;  3AS5 A;  3EHR A;  3MGB A;  1EPU A;  3LS8 A;  4PS7 A;  4WUY A;  4HB5 A;  2P9P G;  4MRU A;  3EU5 A;  1FT1 A;  3DXK G;  2WM9 A;  3PZD A;  4GB9 A;  5AQ9 A;  1U3C A;  2L9B A;  1TJC A;  3SHF A;  2CFZ A;  5AN8 A;  1Z6T A;  2XZT G;  4BSZ B;  4N5C A;  4BET A;  1OCR E;  3ABM E;  4B94 A;  3HXF A;  4I1M A;  4GA1 A;  3FEY A;  1FT2 A;  4DPR A;  1DC2 A;  2UY1 A;  4GCN A;  3GZ1 A;  3PUJ A;  1O1T A;  3ESK A;  4UQZ A;  1JWF A;  3CVW A;  1JUQ A;  4TV3 A;  4GMJ A;  4JEH A;  2CHW A;  4U96 D;  3R9A B;  4O1P A;  4G8L A; 
#chains in the Genus database with same CATH homology
 2H6I A;  4LNB A;  1D8D A;  3Q7A A;  4GTM A;  4GTP A;  1N9A A;  1TNZ A;  3Q79 A;  3DSU A;  2ZIR A;  1FPP A;  1TNU A;  1N4S A;  1O1R A;  2F0Y A;  4GTS A;  3KSL A;  4LNG A;  3PZ1 A;  3PZ3 A;  4L9P A;  3Q75 A;  3Q7F A;  4EHM A;  2H6G A;  1N95 A;  2H6H A;  3PZ4 A;  1JCS A;  1QBQ A;  1NI1 A;  1O1S A;  3DST A;  1KZO A;  1N4Q A;  3HXD A;  1S63 A;  2H6F A;  3DRA A;  2IEJ A;  3DSX A;  4GTR A;  3E37 A;  3HXC A;  1N94 A;  1TNY A;  1TNB A;  1MZC A;  3E30 A;  2R2L A;  3DSV A;  3PZ2 A;  3HXB A;  3Q73 A;  1TN8 A;  3EU5 A;  1FT1 A;  1LTX A;  1TN6 A;  4GTO A;  1TN7 A;  1NL4 A;  3DPY A;  1N4P A;  1X81 A;  3Q78 A;  1N4R A;  3DSS A;  1LD7 A;  3E34 A;  2BED A;  4YDO A;  1TNO A;  3C72 A;  4GTT A;  1S64 A;  1KZP A;  3SFX A;  3E33 A;  1LD8 A;  1DCE A;  3HXF A;  4GTV A;  1JCQ A;  3HXE A;  3E32 A;  1JCR A;  1O5M A;  3KSQ A;  1SA5 A;  1FT2 A;  3SFY A;  2ZIS A;  4GTQ A;  1O1T A;  4YDE A;  4MBG A;  1SA4 A;  1D8E A;  3DSW A;  3EUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...